3JWGA

Crystal structure analysis of the methyltransferase domain of bacterial-cthen1-c
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
200
structure length
195
Chain Sequence
NLNQQRLGTVVAVLKSVNAKKVIDLGCGEGNLLSLLLKDKSFEQITGVDVSYSVLERAKDRLKIDRLPEMQRKRISLFQSSLVYRDKRFSGYDAATVIEVIEHLDENRLQAFEKVLFEFTRPQTVIVSTPNKEYNFHYGNLRHRDHRFEWTRKEFQTWAVKVAEKYGYSVRFLQIGEIDDEFGSPTQMGVFTLGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyltransferase type 12
publication title Structural and biochemical insights into 2'-O-methylation at the 3'-terminal nucleotide of RNA by Hen1.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Transferase
total genus 63
structure length 195
sequence length 200
ec nomenclature
pdb deposition date 2009-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08242 Methyltransf_12 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3jwgA00
3M70A 4KRGA 1XDZA 4R8RA 3M6VA 3Q7EA 3EVFA 1DUSA 2HNKA 2OZVA 3E7PA 4HGZA 1P1CA 5E1MA 4P7GA 5FA8A 2ZIGA 3GU3A 4IWNA 5D1HA 5HIIA 5IKMA 4U7TB 1L3CA 2ZVJA 3LDUA 2BM8A 3ELWA 5EMJA 3NDJA 5CUQA 5FCDA 2IBSA 1N7JA 5DM1A 1JSXA 1NBIA 5CD1A 2DULA 1JQDA 2O0LA 4PGHA 2AN5A 3CVOA 2AVNA 3OZRA 5CVVA 1T43A 4X60A 3OPNA 3ID6C 2PGXA 1IXKA 3F4KA 3G5LA 4IV8A 1DL5A 1RI3A 1XJ5A 3AWIA 3UJ6A 4FGZA 3UJAA 4U7PB 3EVZA 4E30A 1I1NA 5CVJA 5EIFA 3BGIA 1FJXA 5EC8A 2P3OA 3C6MA 5E2BA 1MJFA 3KKZA 5GP1A 3LGAA 5HFJA 1KPGA 3AY0A 4KIFA 5LQJA 4RTPA 1R6AA 5FHRA 3SVZA 4QVGA 1BKYA 1RI1A 4EKGA 2PWYA 2ONZA 5DXAA 3FYCA 1AQIA 5EPEA 4E70A 3DOUA 4FR0A 1NV8A 1YZ3A 2QYOA 3M6XA 5DRTA 3LBFA 2ZIFA 5K0NA 2EG5A 1TPYA 2JHCA 5CM2Z 2EJTA 3T7TA 2UYQA 1XDSA 3NJRA 3TR6A 3CJTA 3M6WA 1AQJA 1YFJA 3LECA 3CGGA 4V0RA 1ZGJA 4YMGA 4GOOD 4RV9A 5T67A 3R9XB 2I9KA 1YFLA 1KPHA 3PX3A 2YTZA 2O06A 1VE3A 2PSSA 4PONA 4XUEA 1SVUA 3NTVA 4E2YA 4PWYA 1NW5A 3RW9A 4Y30A 3JWIA 5C1IA 1NE2A 2GPYA 3UJ9A 1QAOA 2ADMA 5CVUA 3VC1A 3MCZA 1XCJA 3KQQA 4BLWA 3EMBA 2UYHA 2VS1A 5E8RA 3G2OA 3P2KA 3KU1A 3M6UA 2P8JA 3FYDA 3BUSA 1QYRA 3PB3A 4FSDA 5DSXA 3P8ZA 1D2HA 1JSZA 3LSTA 3UJDA 3B3GA 4CTKA 3UA4A 3EGEA 1VP9A 2O07A 4DCGA 2PBFA 5BP7A 2HR1A 3HVKA 1JR4A 4ER6A 1EG2A 3NDIA 3HCBA 3Q87B 4XUCA 2YXEA 1WY7A 5EMMA 3EGIA 5DRYA 2PT9A 1NBHA 3DLCA 2G1PA 2OXTA 3BXOA 1EIZA 2IDKA 2ZBQA 3HCAA 3VSEA 3X0DA 3HNRA 4B17A 1BHJA 3GNLA 1KP9A 2OB2A 3KR2A 4R05A 4QTTB 2G72A 5K8VA 5CIYA 5FQOA 4X1OA 1WG8A 1VIDA 2NXEA 3MAGA 2EFJA 2F8LA 3HCEA 3MERA 4PYOA 5K0CA 5ICEA 5LQRA 2I6GA 1XCLA 5DTQA 2NYUA 2P1DA 3LHDA 3P71T 2O57A 3GDHA 2XBMA 5HILA 3A25A 3BWYA 4RYLA 5FWDA 2FRXA 3G88A 3PFGA 4P58A 3PX2A 5EVJA 3LKDA 2A14A 3I5UA 1F3LA 2Y1XA 2AOXA 2KW5A 4FS8A 4GUAA 5C0OE 5EIWA 3RODA 4E31A 5LQUA 5EKUA 2AOUA 4PIPA 5DM0A 4HGYA 4M37A 1XTPA 3UWPA 5EMLA 2IH4A 2JG3A 4PYKA 2YUIA 3DMFA 2G8NA 2ESRA 4PNEA 3HP7A 4O29A 5DM2A 5FHQA 3QOWA 2PT6A 2ZBRA 2OPBA 3KR9A 2AOWA 4AZTA 1X1DA 3P9CA 1KPIA 3A4TA 4K6MA 4PYNA 2R6ZA 3G7UA 3VC2A 4RTKA 1VP3A 2FK7A 3TM4A 4EVIA 4MWZA 4KIGA 4C03A 1ZQ9A 2Q41A 2P7HA 1NV9A 1KYWA 1PJZA 2V74B 1QAMA 2NXJA 3HM2A 3HEMA 2P35A 1ZHFA 1RI5A 2JJQA 4X63A 1F38A 1AF7A 3B7PA 1NW6A 1ORHA 2XYQA 4DA4A 5E2AA 3T7RA 2G71A 1NKVA 1OR8A 2VDUE 1JQEA 1L9KA 3CCFA 5FADA 2HTEA 3FPEA 3T0IA 3KQSA 4BY9E 2VDVE 1H1DA 4QDJA 5GIOE 2AOTA 5FQNA 5K0JA 4GC5A 5BW4A 4L7VA 3SX0A 3E05A 5DM4A 2OBFA 4PINA 3GJYA 4MQ4A 5EG5A 4AZWA 3KQWA 2Z6AA 3GGDA 3HVHA 1D2CA 1JG2A 3I9FA 4PCAA 2AVDA 2FHPA 4RWZA 5ICFA 4WVLA 5DWQA 4ER5A 2DPMA 2N47A 3FPJA 3HA5A 3KPYA 3ANXA 3LCUA 1BC5A 1SG9A 3EVBA 5EMKA 3TMAA 5EKXA 3ELDA 5LQKA 4GC9A 2PX2A 3BGDA 3UJ7A 2AR0A 5DTMA 2NXNA 3EVCA 2ZZMA 1FPQA 4CTJA 1DCTA 5EEGA 3REOA 2VZ9A 4EK9A 2IFTA 4ATNA 4FSXA 1KYZA 1HNNA 1WXXA 1YB2A 3DULA 3CKKA 3R3HA 1SQGA 5DPMA 1R8YA 5E1BA 3IV6A 3SSOA 5JUWA 2IDJA 4KW7A 1JTEA 4G56A 2BZGA 3UJCA 1QAQA 3I64A 3M4XA 1JG1A 2H1RA 3CBGA 2QRVA 1L3BA 2YX1A 4DMGA 1X1BA 5M5BA 1EJ0A 1G6Q1 3RIEA 4P7JA 1M6EX 2IPXA 2NXCA 3KR1A 2H11A 5CVEA 2PY6A 5F2KA 1RJFA 4PCLA 3TKAA 4RTSA 2HWKA 5K01A 4AUKA 1VBFA 3ERCA 2H00A 3HA3A 5KVAA 3LDGA 3EEYA 5FUBA 4HH4A 4IV0A 4LWPA 3FUXA 4OA5A 2AOTB 2B2CA 3GRYA 3H2BA 3PFHA 1TW2A 5CVDA 5E9QA 5DSTA 4DF3A 3GO4A 2P3LA 5FWAA 2O05A 3V97A 3GRZA 5BW5A 4EMSA 3A7EA 1Y8CA 3C3PA 1XDUA 3B3FA 3TQSA 2WA1A 2P3QA 1RI2A 3C3YA 4OBXA 4M36A 5EGSA 4A6EA 5CCXA 2IBTA 3FTDA 1G8AA 4HTFA 1O9HA 3C0KA 3O31A 3P97A 3M33A 3HCFA 4GF5A 4ER3A 1Q0SA 3FPHA 3L8DA 2PVCA 4QPPA 3OCJA 4RVFA 5FTWA 4EKIA 5LQNA 1ZGAA 3E23A 2LD4A 3GRRA 3OZTA 4P7KA 1FP1D 1BOOA 3CJRA 2FYTA 2JHPA 1UIRA 3NVMB 4GOMD 1NW3A 1X1CA 1EQAA 2GB4A 4IKPA 4PYLA 1KIAA 2YQZA 3CJQA 3IYLW 4PYQA 5EHIA 2VP3A 5P8WA 1P91A 3FUUA 3THSA 2ZTHA 3HVIA 5HIMA 4QPNA 3AJDA 4M38A 2Z6UA 1O54A 3OU2A 1X19A 3R0QA 4X61A 4RSRA 1WXWA 3P2EA 2B78A 5EQJB 5HIJA 1U2ZA 4DQ0A 3FUTA 4PYMA 3SSNA 1SUIA 4RTQA 3ORHA 1L3IA 3WSTA 3A7DA 4ER0A 1R8XA 2C7RA 3IHTA 2HV9A 3FZGA 5EHGA 2XVMA 4P7FA 3BKWA 4F86A 5U4XA 2C7PA 3LBYA 2IH5A 5GIPE 3MB5A 3ME5A 5DX0A 5G02A 4PYJA 2QY6A 1N7IA 2VDWA 3UFBA 3O4FA 3DXZA 3KQTA 5KQSA 4EQZA 1KHHA 1R74A 5HOQA 2E5WA 4FZVA 4C08A 3PLAE 1WZNA 1P1BA 1QZZA 2QM3A 5FA5A 4RTRA 4ER7A 2AS0A 5F2OA 2JH8A 3HCCA 2IH2A 4PGGA 4GOLD 2AOVA 3GRUA 3KPWA 4PYIA 3BGVA 1VLMA 3P9IA 4C4AA 1I4WA 4MTLA 5IH3A 2ERCA 1M6YA 2HMYB 3QOXA 2NP6A 3THRA 3D2LA 4V0QA 3R6TA 3FUWA 3V8VA 2PKWA 4DCMA 3FTEA 2XVAA 3P9KA 3NMUF 3FRHA 4C07A 9MHTA 1RJEA 5E1OA 1YF3A 1R18A 2V7EA 2I62A 4FT4A 4KDCA 4QQKA 5H02A 3FTFA 3EVDA 3GIWA 3HA7A 4BLVA 4RTLA 2PXXA 1XVAA 4QTUB 2UZ4A 2YXDA 3AXTA 3UJBA 3DXXA 4R8SA 3TFWA 2OKCA 5EZQA 5JR3A 2GS9A 1FP2A 3IEIA 3KQMA 5FULA 4AZVA 5CCBA 1IM8A 4CXMA 3DH0A 5DX8A 3A26A 3ELYA 5E1DA 5MHTA 5KQRA 1O9GA 1PRYA 1SUSA 2CMGA 2ZSUA 3G2PA 3PS9A 4C04A 4E2ZA 1MHTA 2XYRA 2ZCJA 5EOVA 3SMQA 1INLA 1Q0TA 4R6WA 1VPTA 3NVKI 5DLYA 2P41A 1NT2A 4LWOA 3BWBA 3DTNA 3QV2A 1RI4A 2AOUB 5HIKA 1ZKDA 2BR5A 5LR6A 2PX4A 2WA2A 1ORIA 3TPZA 3JWHA 4YUZA 4DKJA 4YUXA 2ZZKA 5E9WA 2R3SA 5K0BA 4YUVA 2NP7A 3LL7A 1N2XA 5K05A 1ZG3A 3BWCA 5GWXA 4CKBA 3NW9A 3K6RA 2FK8A 4RTOA 3DMHA 1SQFA 3MTIA 4E2WA 2P7IA 5D1NA 4FT2A 1UFKA 2ZWAA 4YV1A 2YVLA 3G2MA 3MCTA 4KWCA 4Z2YA 5T64A 4CWAA 3DXYA 1HMYA 1G8SA 2ZLBA 2ZWVA 5K09A 3FPFA 2JHAA 3UJ8A 3GCZA 3UBTA 10MHA 3DMGA 4H0NA 4C05A 3R24A 4F85A 3EMDA 3CC8A 3I53A 3P2IA 1Z3CA 2CKDA 4MHTA 3I58A 2IIPA 3K0BA 2Y1WA 4GQBA 3OFJA 2OYRA 4BP3A 4CKCA 4E33A 3GXOA 3A27A 2G70A 5BXYA 2QE6A 1YZHA 1I9GA 2NNWB 3LKZA 1P39A 3AXSA 4GOND 3LCCA 3MQ2A 4RTMA 4HG2A 5K0GA 4LECA 4LG1A 4RVHA 1RJGA 3B89A 3TOSA 2IP2A 3E8SA 3FPGA 5K0FA 3G2QA 2K4MA 1L1EA 3HVJA 1JQ3A 4QQNA 3TLJA 3ER8A 3DP7A 4QVKA 2B3TA 4DZRA 1AV6A 3PVCA 1RJDA 4NECA 4OBWA 4R6XA 2GLUA 5KS2A 3GRVA 5B1SA 5K03A 5F2NA 3S68A 5LSAA 3KQOA 3SR4A 5DT2A 4ZTBA 1EAMA 4E2XA 2JH9A 4PIMA 2UYOA 3ELUA 3KQYA 3GWZA 4M7RA 4CKEA 1G55A 4XUDA 5GOZA 2ZFUA 5LQCA 2UYCA 1WS6A 4RX1A 1SKMA 5E9JA 3SM3A 3KPJA 2Z6QA 3FRIA 3B5IA 5HZMA 2OB1A 4DM3A 4C06A 8MHTA 2FPOA 4HRAA 1G38A 2PV0A 3G5TA 4AX8A 3OE4A 2QRVB 1V39A 2ZULA 7MHTA 2PLWA 4ISCA 1EJ6A 5HEKA 5LQAA 2YR0A 2OO3A 3BKXA 2CMHA 4X41A 3BT7A 2ORED 4Y2HA 4HC4A 3T7SA 1JG4A 4GBED 2YXLA 1B42A 3BZBA 3KQPA 4POOA 3BWMA 1IY9A 2EJUA 2ZBPA 3DR5A 3DUWA 4RVDA 3KPUA 5K0LA 1JTFA 4A6DA 4YUYA 3TKYA 3B3JA 2PX5A 2AN4A 3UA3A 5ICCA 5DXJA 2OY0A 3FTCA 2P40A 3JWGA 3LPMA 1JG3A 1R00A 3DLIA 3EVGA 3OU7A 2PXAA 5E8JA 3SXJA 3C6KA 3HCDA 4JXJA 3SSMA 4AZSA 5K0EA 4KVZA 4YUWA 3G8AA 4GEKA 5C9ZA 4OA8A 3MHTA 5DX1A 3KQVA 2ZZNA 4RTNA 2BH2A 3UZUA 4HTFB 4XCXA 4QDKA 3EVAA 3EVEA 3P9NA 5EZSA 1KXZA 3G89A 3OFKA 5GM1A 4WXHA 2FCAA 1QANA 1FBNA 1VQ1A 3FUVA 3KHKA 1G60A 5GINE 3LDFA 2GAFA 2C7QA 2WK1A 4BP1A 3U81A 1D2GA 4OX9Y 3JWJA 2BR3A 3NWEA 3O7WA 4E32A 2BR4A 4YMHA 2C7OA 4KDRA 2CWWA 3OE5A 3TRKA 5KYGA 4HSGA 2EX4A 4OQDA 2PJDA 2GA9A 4MIKA 4F84A 4RTJA 1M0EA 3PTAA 1NW7A 1X1AA 3EPPA 2ONYA 2PX8A 3TM5A 2BM9A 5GM2A 2IGTA 3ER9A 3OU6A 2ZW9A 1VL5A 2CL5A 3MGGA 5EEHA 4BLUA 1TW3A 5ICGA 1XXLA 3LCVB 2XYVA 3PT9A 2B25A 2PXCA 2PWPA 5T6BA 4UOEA 4YV0A 4OQEA 3OZSA 2ZIEA 2AN3A 2GH1A 2AZTA 5DTRA 3MTEA 1NW8A 4FP9A 1KR5A 3LX6A 3VYWA 2B9EA 3EEOA 3KPVA 4YV2A 1YUBA 1UWVA 3EGVA 3SGLA 2I7CA 3NWBA 5ERGB 3KR0A 3G8BA 3HTXA 4RVGA
chains in the Genus database with same CATH superfamily
4DV0B 1N6NA 3CO5A 4CUKA 1XDZA 4WE3A 3R7NA 4DVGA 2J9GA 1C9JA 4OUDB 4PY2A 2GZ3A 4GPTA 4XQ0A 2ZIGA 4IWNA 4HZUA 2W6IA 1N9GB 4L8GA 4ZYVA 4QL3A 3AL2A 4NIMA 3IQEA 2BM8A 5FPPA 3ZJ5A 5TVGA 1SBTA 1HDYA 1N2HA 4C2UA 1MJNA 3GFSA 2X6RA 1G63A 2H06A 1T43A 1XNQB 3P9RA 2GZDA 3ETLA 1UJ2A 3OD5A 1RI3A 1Z28A 4ERNA 1NSYA 4ID9A 1P19A 4LCBA 1Q1GA 3CVXA 3TIVA 2YJNA 2YCBA 4A0HA 2IHNA 5DYTA 3KT8A 5EA2A 2HJWA 4OYLA 1N8NA 1VOTA 2J31A 4IH1A 3RYFA 3SVZA 5AVYA 1UC9A 1ZHHA 2V9CA 2WHYA 3D6MA 4K6HA 5HUHA 4RHTA 1HO3A 4O8CA 3GYBA 4KQ1A 1QH1B 2R1VA 3MOGA 4R2LA 4M6WB 5JQWA 4JZKA 1QIGA 3LBFA 4UXHA 4DBZA 5LIRA 1HA3A 4DXAA 2W6PA 3L1JA 5H59A 1JKFA 5AVTA 3RI3A 1MV8A 3I9OA 3IURA 1CFZA 4V3BA 1Z08A 1Y9ZA 3HO8A 4GR9A 3SFVA 5LLDA 3L0SA 4HGQA 2GXAA 1TM1E 4JDPA 5DTJA 2EU8A 4MI1A 1RC0A 5EFOA 4FWIB 1MEJA 3RBZA 3B52X 4OV6B 2MOKA 1FSPA 2F8TA 2Y92A 4HZUB 1UDWA 4C6HA 1E9VA 5ALNA 5I7HA 2RH9B 1VJGA 2WD7A 3N0TA 4MDEA 2J30A 3I28A 3AIKA 4EHBA 2H9YA 2NLOA 1ZR4A 1JPNA 2J0EA 4O4JF 3N07A 5F51A 2E4YA 4KIUA 4YRMA 4KTTE 1IPFA 4NDZA 4XDHA 4BNFA 3C1TA 5HKBA 5A2GA 2I99A 4QQFA 4F7WA 2XH8A 5LA6F 2XNJA 3FYDA 1EINA 1CJMA 1JPUA 2GCNA 2G63A 2GPJA 2Q1TA 3P8ZA 2ZYSA 1CUXA 1JSZA 2R9VA 1Y34E 2Y6VA 4JBIA 2HA3A 2O07A 4LRSB 4F45A 4MV4A 3N59A 5EIBC 3OWXA 1H0RA 3NHZA 1CUEA 3HCBA 1ZNZA 3QWBA 4H18A 4WN9A 3RYFB 5HWSA 1QZUA 4FYYA 2QVZX 4PC3A 5JIBA 4WCFA 3V1LA 4F4HA 3FOFC 2J3KA 421PA 2R1VB 3GUUA 4P98A 2G0NA 4F4DA 2O9JA 3WRYC 2P2GA 3GMDA 4JVMA 1EFHA 2JF0A 3HNRA 5DLPA 2XQFA 3K30A 1TTHA 4C7MA 1FUYB 2RG7A 3BICA 2NXEA 5HZGA 1GTG1 4L9AA 5HA5A 1ZCBA 1AQUA 5AOVA 2IYFA 1NVWQ 1JZSA 2W42A 4ZCSA 2Q21A 1YI1A 3GDHA 5EXEA 3A25A 4QU0A 3L7AA 2QG9A 3RSQA 1P4JA 4EKEA 3PFGA 3G88A 1WCIA 1HG0A 2XODA 3HN6A 3GXBA 4X24A 3BIXA 4B3BA 1FDOA 3FKSD 1C14A 1Z0DA 3KOUA 2WD7B 5JCJD 4UZSA 1H8ED 4A7PA 5JJ5A 5P21A 5JI3E 3OTQA 1HFEL 3D5TA 3AI1A 2TMYA 4HPXB 2VG8A 5EJFA 2HRZA 3HBAA 2ZYDA 4Z0PA 1CHDA 3EX7C 3MB8A 3HFGA 4J2HA 5EMHA 2X0EA 1SHUX 3BMNA 1J8VA 1E9FA 1F0PA 1L4LA 1VKZA 2ZSFA 3FCEA 4ZAWA 4OHVA 3IHWA 2A78A 3FY4A 4G9GA 3K71B 4P3PA 4Q1DA 4Z1MA 1NRXA 2ZBRA 3CR7A 1A5SB 1V95A 2ALJA 5DNCA 2GYVA 5K6AC 4TKVB 3P2MA 3WB2A 2JFOA 3L04A 2H2HA 3MSXA 1DCKA 2YY5A 2QTRA 3H2IA 3BQNB 1M5UA 3B1XA 2WFMA 4WCFB 4BO6A 5BWCA 4H1WA 4MWZA 2XX3A 1WMSA 4C03A 1XRNA 2XQVA 3DC7A 4HDKA 2IHBA 3PDIA 2Q41A 3DE1X 4L75A 4TTPA 1T9BA 1KYWA 4XGKA 1UUFA 2R2AA 2XMCA 3A11A 5TQ2A 2WTUA 3RVRA 4BNDB 3O8CA 1JHAA 4Q4HB 2RIRA 1DU4A 5JHGB 1MC4A 1AF7A 3DV2A 4HZGA 1SU7A 4HWGA 1YQGA 4DM4A 3GRAA 3JWPA 5B6PA 4LN1A 3G0HA 1W1UA 2HTEA 1XELA 1IK6A 1NXTA 4FTWA 3UAWA 5A6VA 3B6IA 1WCIB 1K6EA 4N8DA 3RAEC 5C8YA 2IHVA 3SJCA 4D41A 4DNFA 5C5CA 3MWFA 1ECJA 1ZM7A 2L17A 5ANRB 4KQ2A 1NTOA 2I7XA 4MQLA 4UCFA 3TSCA 3CFYA 3LHKA 3OZIA 2AEJA 2FRDC 4XD2A 1I4TD 3KPYA 5LQKA 1VE1A 2QP4A 3ELDA 4I9NA 4GC9A 2NPOA 3BGDA 1RQ2A 2OHFA 3V7NA 1PNVA 2DGDA 1R0LA 3G0GA 4R83A 3SQOA 1SUBA 4GMXA 2FWIA 5K8IA 3GBPA 3R3HA 4PVDA 1LNSA 2CNKA 4D3FA 4Z4GA 1W52X 3ZVKA 1BFDA 2C8LA 1KJZA 5ABPA 3QXJA 1G9XA 1T6BY 2DMRA 2X4LA 4JT2A 4ZCPA 1D09A 1G20E 3OCCA 3IIEA 3PDIB 3WK4A 4JBLA 5BMOA 1G6Q1 1R0RE 2HIMA 3NXKA 4Q9AA 4RNCA 5BRAA 1RQ7A 1KJNA 1WKVA 2V6JA 2BRUA 3G68A 4NZZA 1RJFA 4BKPA 3O4GA 1W73A 4QM6A 1PCXA 1ZXLA 4V38A 4IVPA 3ERCA 2IY8A 3FPAA 3VKVA 2JCXA 2XUOA 4FN5A 3WISA 3NT2A 3ZS8A 5ICSA 1GUDA 1GQYA 3BQMB 3EYWA 2IVZA 2XUAA 2VDNB 3KYBA 3GNSA 2O6HA 4L3WA 3WY9A 4YXWA 3A3YA 2PBLA 2V65A 3TNJA 2CSXA 1CVLA 4J4TA 3L43A 5C8YB 3BXGA 4ZEWA 1JVSA 3HCNA 3IP5A 1DAEA 1TA4A 1XL1A 2GAOA 3EXEA 4TV9A 4KXUA 2ISCA 4WN3A 4Y18A 4CW7A 1EX6A 3M6AA 3EIXA 2WA1A 3FCOA 1OROA 4ZO6A 3BK2A 3DOHA 3FOWA 4M36A 5C53B 3LTEA 3KELA 4E1VA 3ADBA 3ZGZA 3PEEA 4TL7A 3U4DA 5LLSA 3KZCA 2RI6A 3REFA 2C2MA 3CKYA 2R6DA 1NPYA 4MCAA 4RZXA 4U7GA 5LDGA 4IIXA 2QTWB 4Y2TA 5CFOA 4CKZA 2O8FB 1ZGAA 2KBEA 3QA3E 4UNQA 5U1PA 2ZJOA 1TA0A 2FN3A 3ZW7A 3V55A 3WA6A 1KFCB 1TZJA 3W2TA 2Z56A 3ZWPA 1ZNXA 2A84A 1JP7A 3OLVA 5A7GA 4CM8B 3CIFA 3QPVA 2QE7A 1MOQA 1VL6A 4IKPA 4IDAA 3TB6A 1A5TA 1C8VB 1S02A 1Y4SA 3ANMA 1QYIA 5TF0A 2JASA 1Z2AA 2XF8A 4JYPA 2JLSA 4W5OA 5CLIA 2FWAA 3P27A 3EW7A 3HVIA 3Q11A 1NJ1A 4U0KA 3G0IA 1CQXA 2E9SA 2FR0A 2ZCUA 1UOEA 5HIJA 3P2EA 3T0GA 2MCFA 4Z7OB 1ZP6A 2QUZA 2E7ZA 4YCAA 4CG0A 4E88A 3QEAZ 5THXA 3STTA 4QU5A 1H2EA 3QFRA 1F8GA 3RVPA 2PNFA 2C7RA 3WWDA 2C4WA 1B2RA 1ZH4A 1XPJA 3I9KA 3T41A 3SX4A 1EHYA 4YCNA 3RSSA 4Z6KA 1B74A 2V8BA 2J3JA 3EXEB 3Q9UA 4NV1A 4TV9B 3TLCA 3U2QA 4PYJA 3BB1A 3ET4A 4UAUA 3R0IA 2AW3A 1ZM4A 2DBZA 2B37A 4V2IA 1Z17A 1ZJWA 3EZ9A 1M2EA 2CLEB 1OBFO 3KBBA 3KAPA 1BS9A 3N74A 3IO5A 4LJAA 4M7WA 3WYAA 4Q7LA 3WG9A 4ER7A 1J0BA 4URZR 3UMMA 1AKEA 4R3WA 1JU9A 1SWVA 2I9PA 2XQGA 4LVCA 4HNQA 4YJ3A 3ADDA 2A3NA 2ERCA 1SVSA 1QG6A 4K6OA 1WBJB 4GXQA 2VNIA 4DT1A 1IPHA 1E9RA 2IZOA 2WZBA 3NHYA 2AGVA 4P8RA 5C46F 3HSKA 2ZS7A 4NAUA 5E1OA 4F8JA 1YAHA 1PL8A 2V7EA 3AZPA 1ZNQO 3I6IA 3NBFA 3QU7A 5DYYA 5EKSA 1SM4A 3RH0A 1ADBA 1ML3A 4XB1A 1B76A 1QORA 3S27A 2RHLA 5A1TA 3ACBA 3C3MA 4AZVA 3QE9Y 1IM8A 3GDOA 2D1FA 1QMGA 4NOJA 4FFRA 1U65A 5E1DA 2DFTA 2QJRA 2H0QA 3AP2A 5G53C 1L5NA 1NYLA 1N4DA 2QYSA 2PPLA 3T7DA 3VDXA 3BN3A 4KRYA 1NHWA 1GUZA 3MGCA 2FUNB 3ZDEA 1TUIA 3MJFA 3EBPA 3UW3A 2P41A 1MAAA 4EB0A 1R10A 3UWSA 1Z2DA 2HA2A 1ZKDA 1ISHA 2HQOA 4YASA 3WK6A 5FEUA 4KLAA 1MV5A 1CEYA 5F5XA 3D9QX 4YUXA 4QAQA 3VR1A 2C5SA 3VPHA 4MP6A 3J7AC 2GYUA 1JECA 3U3RA 1ZUIA 3QRWA 5FH9A 4C5CA 2OFOA 3FNEA 3ZV3A 5HPYB 1CUJA 3NHWA 3ORRA 1NURA 4YJ3B 4YACA 4ZV9A 5IZCC 4KE9A 2PLFA 2YVLA 4ZCTA 3LNTA 4XQGA 4DT1B 3WLFA 2WMOB 3DXYA 2UAGA 4LFCB 1XLUA 2CXXA 5HRCA 3UJ8A 10MHA 2O1SA 3VR4H 1I33A 4LDZA 3PHJA 1J1UA 2QMZA 3ROMA 1N78A 4UVGA 4PWZA 2FEKA 3NJ4A 1N5IA 1JHMA 5DWVA 4FJ0A 2OYRA 4CLHA 1H4TA 4P4SA 1W2WB 1WPQA 4WESA 1UP6A 1Z47A 1CF2O 4M9CA 5IDYA 4JOQA 3GNTA 1YACA 1Z5GA 3FDIA 3OI7A 1BCSA 1RAEA 2ATCA 2FN7A 2H5JA 3JTEA 1XRMA 4JR1A 1S9HA 1LV8A 2D06A 2NUAA 4BB0A 5I7OA 4H1HA 4O0LA 3R5JA 3WRVA 2WB2A 2CLHB 4RA9A 4XEUA 3W2HA 5JQGF 3ER8A 4QVKA 3FKSA 2B3TA 3TQCA 1O5OA 1FX0A 5JCJA 1A95A 1H8EA 1T36A 3PVCA 4ETNA 5JNLA 3JZAA 2Q45A 1HORA 4R6XA 4BB6A 2VSOA 4D4HA 4LKOA 1LUAA 2C3PA 3I3SR 3C70A 1FMTA 2TS1A 2X9GA 1Z0JA 1ZN2A 3QG5A 4X20A 1XJ0A 5I7AA 4BMYA 5CT8A 4JXZA 1IN1A 1JJ7A 3RS9A 1LPSA 3IVXA 2GWRA 3GY0A 4YDQA 1OIXA 3PR3A 3RU7A 1ULUA 2FR8A 1U80A 2H48A 2PL5A 2CFCA 2UYOA 3ZTYA 1TM4E 4BLRA 5C7YA 4DEVA 5KHOC 4M7RA 1ADCA 3AOEA 2YWGA 5DHUA 1LK7A 2ZFUA 3KAJA 4BX2A 5E9JA 1HY3A 1J0XO 4I19A 4RS4A 2Z6QA 2ZWPA 2OVFA 1F1JA 2UXBB 4U7HA 1RMTA 4XM0A 1Q5PA 2DFLA 2VK4A 3EEQA 4HX2A 3EWAA 4BIMA 3KYJB 3OFVA 4Y1EA 2EKLA 2WFAA 3PFNA 3I34X 1FW6A 1CZOA 3R5FA 3LHFA 2VQFB 4BN5A 4WESB 4KXMA 3DUWA 4DLUA 4PZLA 4CEJB 3SKVA 2JGAA 4GM0A 2JJ2D 1YTLA 3ZXIA 3TTSA 4K03A 1I2MA 2PLAA 1N5KA 3ZIAD 5DXJA 1ILEA 3MS4A 4RA9B 1JXOA 1HLFA 3EVGA 4P7BA 3AKZA 4KVZA 1P0MA 3PHGA 2QJOA 3UJHA 2WAOA 3FW1A 1W59A 3MHTA 3F8SA 3NTLA 3K96A 5DCYA 3W90A 3NHBA 1C3JA 2C5BA 1E1MA 3WB0A 3A9RA 1I6KA 1KYQA 3G89A 3KTAA 4JJ4A 4EPVA 4BBAA 4BTVA 1QX4A 2QD5A 2ZTLA 3ISVA 4J1NA 3CNEA 5KO2A 4LJ9A 4OQFA 3IKTA 1I1HA 3UWKA 1NVDA 1OJ7A 5J2TA 2BEJA 3CNHA 2FW9A 3DFMA 1JB9A 5L6MB 1D2EA 3GLIB 3ULKA 3CG4A 3LVBA 1XAHA 2YZ7A 3LUGA 2QXTA 4UARA 4B35A 2IWHA 4GPZA 4E22A 1XDWA 4LSGA 2HDOA 3O1IC 1OA0A 1P31A 3L0CA 3O9ZA 4TX1A 4ZYUA 1EE2A 3BWDD 3BULA 3LYLA 2XSZD 3G9QA 3VR6D 5B7PA 1KWGA 2AUMA 1UBGA 1KOFA 2A0UA 2CXQA 2D5LA 4M0LA 4PG7A 1KU6A 1WY5A 4V0SA 2X5NA 2FUG6 3RFTA 3SK0A 1ZGGA 5BSFA 4GI1A 1FRQA 5HCNA 4F8YA 3ER9A 1M2WA 4JP8A 4ZANA 3UUGA 3A1VA 4C3OB 1BU8A 2QR5A 1TI7A 3T9AA 4N01A 5H70A 5AQEA 2RAFA 3PT9A 4A8HA 3QX8A 3CH4B 3W6NA 4U2CA 3L79A 2RGAA 2OCXA 2QN9A 2W4IA 5DTRA 2XB9A 2EYQA 1BDBA 4EF6A 1OH5A 1WP4A 2BGTA 4HDOB 2XR1A 3VYWA 1SWWA 4CR7A 1TC1A 4TGLA 1XLTA 1YA6A 3SYTA 3EXAA 1QIDA 3ZH2A 3SGLA 2IS6A 4G5RA 2H9AA 2O0HA 4JR2A 3WL3A 4C2AA 5ERGB 3U9SA 2GYWA 4I08A 4BASA 2HHAA 4DSOA 1VGVA 3V32A 3O9MA 4KL8S 4R8RA 2H0AA 1Z4IA 2HNKA 3C85A 1U0RA 2J9YB 1QE3A 4CMEC 1YS6A 1JZTA 2RGBA 1FNMA 4RGBA 3NDJA 3PKIA 1WVIA 2QN3A 3T3PB 1XCPA 4KH1A 1DIHA 1HNZB 2C3YA 5CVVA 1QYXA 2OO5C 4KFSA 4IFIA 2WTEA 3A31A 1GDDA 1V43A 2WM3A 1VTKA 1XJQA 3A4IA 1HNWB 3UJ6A 1JSLA 1HE5A 4M22A 2J6CA 2VTDA 3BTVA 4U7PB 4IDDA 4MPRA 2HX1A 5KWIA 1MO3A 1E7YA 3S4YA 3R7FA 4D3DA 4RGYA 2HBQA 2VDQB 3DDCA 4KPGA 5AM1A 1SCUB 1E62A 2CFRA 5LOVA 2Y1EA 1BYIA 4Y2QA 1E5XA 2ODQA 1DI0A 1BKYA 4F38A 4ZDKA 1F2TB 2JFQA 3TSYA 3GZJA 3V9AA 1OI7A 3W2EA 1ZNWA 1D07A 4DLNA 1WSWA 5AK0A 5L4LA 1J2TA 7ABPA 1NJ5A 5JATA 1XKXA 5D5QA 2I71A 4JYCA 1PHPA 1EK0A 2ZE5A 1UEJA 4JLMA 4CT0A 1HLPA 3UFXA 1JRLA 3ITDA 4H7FA 3ETNA 2A1TS 1P44A 1EA7A 4KH0A 3C5WP 1ECBA 1M1UA 3A9SA 3M6WA 3KALA 4R2XA 3QFCA 1W4ZA 3ABQB 3VKGA 1WHSA 1RC1A 1UJBA 2WJ3A 1P74A 4Q3DA 1KPHA 4EF5A 1R15A 2WT4A 4N5MA 1DRKA 1TYBE 4RM3A 4NRDA 4C6TA 5F2NA 5JZ9A 2WVHA 1KORA 1QUEA 4FE3A 2FZ4A 3ZNNA 2CNLA 4BGIA 4MQUA 2V55B 4CLEA 4WA7A 5C1IA 1WMBA 3RROA 4D0RA 5L4SA 4B3MB 1E92A 1K8YB 1KEWA 3B70A 5DLDA 1BW9A 2Q6VA 4LJ4A 2ZYIA 4ZU3A 5I8WA 5KOHA 2NZ2A 1ODLA 1ZK4A 1IBSA 4Z0NA 3TGPA 2OC4A 4RZSA 5CIWA 2Z9BA 3B3GA 1Z5ZA 3RRMA 3FZYA 2KS6A 5EUCA 2DHDA 3P26A 3C7DB 1UJ5A 4MYHA 4ER6A 3U44B 3KM0A 4LOJA 3WDKA 2W4QA 2YHUA 1T10A 1QQBA 2YXEA 3GLFE 2N46A 4REOA 3SFZA 3DWIA 3IVGA 1DBSA 3O2SB 1C30A 3CONA 5J47A 4NX2A 3UFXB 3R4CA 2NX2A 4ZCMA 5CIYA 1L5LA 3RQIA 2P91A 5JNUA 3HJBA 3QVTA 3QXGA 2O3TA 2VZEA 2J9XB 1Z74A 1SCDA 3E5RA 4UEKA 4JD5A 1FS5A 3D2BA 1YS4A 3KJQA 5KTSA 3PNSA 5HILA 1WHSB 1LVHA 1OX6A 1TECE 2QUJA 5AI6A 1VXOA 4P58A 2C4KA 1PYGA 3PX2A 4QHTA 5KAMA 3WMGA 2A14A 1N3BA 2DYKA 5BV0A 5FFFA 4ZPJA 4PPQA 1F5SA 4OYRA 3VFDA 4ZOLF 2OD9A 4B2LA 4D0NA 2BFAA 3E18A 3HACA 1ACLA 2AOUA 2ZSBA 3NYIA 4MQEB 3RU9A 1JJIA 1EX7A 3EC2A 1UBNA 4N5HX 4HB3A 4RF4A 1DLJA 1J9EA 3WL4A 2BDEA 4D9IA 4Z7JA 4Q18A 2JG3A 5A5DA 2O8CA 2ZTMA 2X8AA 2NVOA 4GZLA 4I5GA 1JJFA 4FZJA 3STVA 1L2TA 1N3IA 1V8BA 1YJQA 4EABA 1VMEA 3UG7A 1B73A 1I4LD 5TDHA 4AJ4A 4ZOQI 3TE7A 1X1DA 5K4GA 2ZTUA 3VRHA 4KGXA 4MPDA 4EEKA 3KQNA 1V7QA 1N5OX 3V3KA 5DNVA 2XLBA 1E9EA 1SHTX 4CTNA 3KEMA 4EVIA 4CMAA 1RMYA 1NONA 4MI3A 2ZXUA 4YRCA 1NI3A 4UCQA 2F62A 3CRVA 1PYOA 2GSWA 1DC7A 5KJCA 3GPBA 4Y6PA 4WUVA 1ZHFA 4FOPA 4B9EA 1JVBA 2DKOA 3CBQA 3NV9A 3ESDA 3M4YA 1QPBA 1JN0A 4HADA 3PU6A 4YJGA 3DZ8A 3DEHA 5KYVA 3RC2A 3GLTA 3HKDB 1EM8B 5BVGB 4B4DA 5FADA 1X3LA 4TQUS 5HQJA 4XR9A 2P9YA 3O2QB 4HUQA 4D6PA 3D02A 1WULS 3T5AA 2PE5A 3MWGA 3IAFA 3C3KA 3KQWA 4Q4JA 3E9CA 1E8NA 1U2DC 1YMVA 4WVLA 2AR9A 4DR4B 1VCIA 1KVSA 1QLHA 4K9OA 2HYDA 4TTIA 1G5HA 3T4UA 1D4AA 4PAOA 2O8CB 3TPFA 2QVYX 3TQOA 2WIKA 2ECOA 1XDDA 4BQPA 2HNAA 1CUZA 4BFUA 3B51X 2JJ2A 4X44A 1QFZA 1MQ9A 1SELA 2VHJA 4DNOA 4A15A 2VZ0A 3LLCA 1I1OA 4MARA 2NWQA 3J80A 3ZIAA 1GNSA 1JTEA 3NM6B 4MINA 1PLLA 2C96A 4PAQA 3KZXA 1L6IA 3W05A 1QFXA 3V4ZA 3ZJVA 2QRVA 4LHZA 1YBHA 1E32A 1DQRA 2YFHA 3FFWA 1AQYA 3HG7A 3P94A 4G5OA 3UH0A 5JSUA 4HQFA 4CIBA 3IAUA 4US1R 3H87A 1AHNA 2NXCA 3WLQA 5I7FA 3VJKA 4HWRA 1LA2A 1UT6A 4PCLA 3WZLA 1YZVA 4U63A 4NBSA 3JQBA 3ZU5A 4RZHA 1E9CA 2HJGA 2J85A 1G1AA 3I8OA 3IPAA 3VU9B 4H7IA 4M0MA 3AESA 1C4XA 2GCPA 4EA7A 5JAZA 2CDBA 5C31A 3MCUA 1EZ4A 1WOYA 4FYWA 4EBBA 1TW2A 4FD3A 1ZVQA 3KO8A 4HUQB 4C0WA 3T5CA 5FWAA 3PZBA 2PZGA 1OD6A 4HDRA 4HWTA 4Q4JB 5IP5A 1BN6A 4C5BA 2F8MA 2CLCX 1MENA 3N6VA 3C3YA 3VR5D 2PRKA 1O87A 5DM60 1GYQA 1XZFA 2WFLA 4EI2A 2XSZA 3FTDA 2WU3A 2EZTA 3VR6A 3LFTA 4Q9IA 4JBHA 4MR8A 4GF5A 5A4IS 3RTBA 1UT8A 2XZPA 3OY2A 4I4LA 2DSNA 3QLTA 2CYBA 1W30A 2HCFA 4FFSA 4Z9AA 2VLIA 2HMAA 2DLCX 2UVDA 1POXA 1GZHB 2FZCA 1AXEA 3WYBA 3GPLA 2GN9A 5CHYA 2VTEA 4L9WA 2WSSD 4M9ZA 1F7UA 5DU2A 5KDLA 5CD9A 4TL9A 2JGRA 5EERA 3ZBPA 1JJBA 2LPMA 1K98A 2D62A 3EHEA 2ZWOA 1KAHA 1SBIA 2RK3A 4PLFA 1VECA 4TWAA 2HCRA 4AO7A 3PUWA 1P5HA 2DJIA 3KD2A 2I29A 1U31A 1Y3BE 2P9TA 3HUFA 5CA0A 3FI9A 1WF6A 5COAA 5AKHA 2VA9A 3VZQA 2QU7A 4U5QA 2GM9A 5FBHA 3IVMA 1MH1A 3A9WA 3AP1A 4MVJI 1U2ZA 3DZGA 3V7YA 4LY3A 1GPKA 3AESB 4AY2A 3COYA 3FFBA 4NC9A 2OQRA 5DI3A 1EFUA 3SSAA 1YNOA 3VTZA 1QB7A 1R8XA 3G79A 3I2JA 5FNVA 3U7IA 4B3GA 3RJ9A 1VB5A 2WKQA 2VJMA 2XVMA 2FMUA 3W3AD 1SHJA 3P4YA 3U26A 5KNCD 3KDSE 4B6FA 4JBNA 5AOBA 4XH9B 4S1WA 3WIOA 4TZ6A 1J39A 2QI9C 2VDWA 4OL9A 3TX2A 1PR5A 2XRZA 3UK1A 3D8RA 4Z3OA 2WFLB 4TMZA 3OTIA 1AU9A 4GPIB 5BNFA 1SHKA 3AHCA 4C08A 4HXYA 4MR8B 5F1OA 2FJUA 3VZDA 4CDNA 1IXYA 4Y9RA 1DKRA 1FLNA 3SVTA 5A2QA 3KKMA 4WEQA 5L6LB 1PZXA 2NTJA 2RSLA 1V5WA 3EJ6A 3V8MA 3GRUA 3ZY3A 4C4AA 3OZWA 4CNQA 3CT6A 1M33A 1S9DA 1LWNA 1IN4A 1KVQA 4MW5A 3WWCA 4Y2YA 5C4IA 3JAMA 1XMPA 4GI7A 1P5FA 3H5LA 1WWKA 1KZHA 2GM4A 2IZ6A 2RHOA 1YDHA 3I32A 2VH2A 3KC2A 5DNAA 1IYZA 1G291 2NAFA 5DLQC 1Q7EA 4KQGA 2RB5A 4MGEA 5G3YA 1E77A 1TO2E 5CA0B 4Z4EA 2FEOA 1FBTA 3NBUA 4LBWA 4BX9A 5A1JA 4DB4A 5CJJA 2OD7A 3RLFA 5CFZA 1E3QA 4IDOA 4R8SA 4D8UA 5A5FA 1NHGA 3HR8A 5CXUA 2UXDB 2ECKA 4OLBA 1N0IA 1V0JA 4CXMA 1UZUA 5ESDA 1WUHS 2AEFA 7AT1A 3C3EA 1PT6A 5DI3B 2IL1A 7GPBA 4W1RA 2PFGA 1PRYA 2QPOA 1ZAKA 2FLKA 1OLSB 1ECFA 1YU9A 2AFIE 2ASEA 2J1LA 2VJMB 2XYRA 3N28A 3OQPA 4LK3A 2W2NA 4DG8A 3SAJA 2ZS8A 2GD6A 3GW8A 1T4GA 1VPTA 4G2NA 4NENB 1CUBA 3CV3A 4QEKA 5AK4A 2WBLC 5LD2B 3KOXA 2DHEA 5TPWA 4B6JA 1SOVA 4YUZA 1ORIA 1EGHA 3DF9A 2SECE 2ZBDA 1ZG3A 1Y7LA 3MBIA 4L57A 5FORA 5GWXA 2IV7A 3WVNA 4XKJA 2X14A 1DBRA 4DR3B 1GHTA 1IMJA 2PX0A 2XW6A 4QYSA 4JLNA 1QQAA 3JQ6A 4YV1A 4XPIA 3IEMA 1BQEA 1U0BB 2DKNA 3A37A 5BSRA 1HMYA 4OQXA 3AKCA 2Y8EA 3ZIDA 4TTTS 4OHBA 2R00A 3C1AA 4YAIA 4PLYA 3HNPA 3CC8A 1T2AA 2QL7A 4AUMA 1SD5A 4F96A 2CKDA 5TXGA 1UODA 4YV7A 5JAHA 4ZCIA 1RKXA 3RM3A 1KK0A 5HG0A 5KWJA 1OQAA 3I0MA 3T1TA 4CMGA 1ZK2A 4CFZA 3PUHA 4ZREA 2G25A 2JATA 4ZK2A 1I6MA 3UCFA 3R4VA 3LCCA 2H1CA 3FZQA 1G2IA 4RTMA 2CJYA 3LVQE 3OJLA 1Z6QA 2ZUVA 2DHQA 2XMBA 3NKVA 3F0TA 3IRVA 4MIYA 4J76A 4OHPA 3SMVA 3T7KA 2ZSHA 5CA1A 1WV1A 3DP7A 1GQ2A 4C87A 4ENPA 3L7JA 2ANCA 3S29A 1KY4A 2I66A 3N2IA 3OCWA 1QNLA 4UUNA 3IDSA 3T38A 3RVDA 1YAJA 3MMNA 4XQ9A 3WGMA 4KIWA 4EFLA 4ZQGA 3ZWNA 1GV0A 1M2NA 2H3HA 1TKAA 4W5TA 3RVKA 1PG0A 2IHYA 2ZTSA 5DOZA 1EU1A 3V4PB 2Q7OE 2WY2D 1K0UA 1FDVA 4ND4A 4RH3A 1L5YA 3KEQA 2QNIA 3N58A 2D5AA 4Q3EA 5E6SB 5EP2A 3REGA 5GOZA 4RELA 4XPIB 2XCUA 2WP0A 1VDMA 2ZREA 1THZA 2YASA 3B5IA 2CDAA 3LAWA 4PNHA 1Q83A 3WBJA 4A5SA 3RSGA 3ANSA 1PJTA 4B80A 5EE1A 1BGVA 2GD1O 4MV3A 5CH8A 5EKTA 3TZHA 2C9CA 1M2JA 4WK4B 3DQQA 2HJRA 3JSAA 5HNKA 1JHYA 4KQ6A 3PQ2A 2H07A 1K5HA 4UASA 4POOA 2W6OA 1JA9A 1W5BA 3ZV5A 3A6JA 3TRDA 2VEOA 4QQRA 4UDXX 2PUHA 1B23P 4XGIA 3WZMA 2OHVA 2HD4A 3HKCA 2GN1A 3RG2A 4A91A 5ENZA 2VQSA 1FUIA 1QOZA 4GPD1 3L8HA 3DLIA 4GDFA 3EDCA 1NVBA 3I0NA 1X86B 3TSAA 1EXDA 4CYMA 2CXTA 3AR9A 4TV8B 1J0EA 3HCOA 3U1VA 1N6PA 2JLXA 4OI0A 1YDFA 3CWQA 3UT0A 2WU8A 3R9KA 1Z56C 2AJ8A 1VBKA 4JC5A 1Z7BA 5FL3A 2ZRGA 5J4LA 1KO7A 5JYEA 2VF8A 3E53A 4FFLA 2P77A 3DL2A 3IA7A 2P2LA 3T9DA 5AW0A 3DL4A 1SOWA 4OXXA 4RGVA 3BSFA 1RBYA 1SCQA 3UUFA 4HRXA 3EHDA 1E3IA 5BMVF 5KJ6A 4KQHA 1VHDA 5KOIA 4KJZA 4O33A 4Y0AA 4K2AA 1XSEA 1G6KA 3HXPA 1A77A 1XTVA 2XE4A 4IIDA 3ESAA 5H80A 821PA 1CZUA 1OW3B 3G85A 3OPYB 1VRCA 3EMVA 3QOYA 1ZCAA 3ZY2A 2XUFA 1RHRA 3KB6A 4IOJA 4MW4A 3L0YA 1HRKA 4ZVUA 2R6JA 1R9JA 5JJIA 1LPMA 2E4WA 2P0YA 2PRSA 2ZP1A 5HFNA 1QZ3A 1U2SA 2EFCB 3A6KA 1MR3F 1EFVB 1YZLA 3HADA 4J3NA 3LZ6A 3NCHA 5AKEA 3BJEA 4PQRA 3Q3GE 4RULA 2NU7A 4YRDA 221PA 1ZONA 1HOTA 2VSXA 3AQ4A 3C3XA 2G06A 4ZC8A 3T1VA 3I1IA 3I45A 5ALSA 4HAXA 1FDWA 5BWMA 3GDGA 4BO9A 3EPHA 1MGPA 3ONFA 1MA0A 1OBOA 1WQ3A 2A2ZA 2RCNA 5JDCA 2BGWA 3EXFA 3VR5A 1HT0A 4MH0R 4G85A 2E4AA 4Y0NA 2ONKA 3KR0A 3PZRA 3S2ZA 2YN4A 1UQRA 1TAUA 1VKHA 1K5DA 3D8SA 3FMIA 1SXJD 2WSLA 4YY3B 3ZJTA 4MDFA 1QO7A 1T2VA 1EUDA 2JFPA 3GGJA 2C2GA 4ZYYA 1TJYA 1GKYA 1VSQA 4KITB 2WAAA 2WSSA 3QXCA 4R1QA 2D7DA 1XTKA 2FX5A 3HHPA 3JPYA 3ITEA 4J0JA 2ERYA 3KXKA 3P9QA 5FI5A 4E6EA 3AJRA 5BN3B 4RANA 1JQDA 1KMIY 5ARCA 3JQ9A 1VMAA 4BXOA 2YZMA 3LXXA 3X1MA 5BUZA 3FB4A 2AT1A 4A16A 5KIAA 2QTNA 1OIVA 3NASA 4O4JA 1O9BA 5FBRB 4JIMA 2CNBA 3NGMA 3S99A 4YRGA 2ET6A 3BGIA 1L4NA 2CLKB 4EFDA 4NS1A 3KKZA 3ZWOA 2C97A 3SQWA 4KIFA 1N6RA 3VYTB 3EH1A 1R6AA 2NU7B 4BS9A 4L07A 4OXQA 1U28C 2JLVA 2UVPA 1D1TA 1KDPA 1NTRA 3W3AA 4R4JA 2QD1A 1NN3A 1AQIA 3SJZA 1Y8QB 1Z22A 1RCUA 1LRKA 1XA3A 4GECA 5KNCA 1NV8A 4RVSA 4EY5A 1X7ZA 2COEA 2H59A 3CF4A 4EI7A 5FWYA 4DIFA 4R5MA 3W5SA 1U1GA 3EXFB 3JQFA 3T8YA 5JS2A 1ZAYA 2CL7X 5JZOA 1FYEA 2J9ZB 2YQ5A 1ZUD1 2FUG1 3HGQA 5JHHB 4A8PA 1LBEA 5KKNB 4OATA 1EVKA 2MSEB 3D81A 1EFCA 2C58A 1D1SA 2CZGA 3R0JA 3Q7IA 1GG5A 3BMCA 4FDUA 4J1SA 1UPBA 1IU9A 4DJJA 1TIPA 1NNI1 3U4QA 1G6OA 3PX3A 1U8UA 2PSSA 3DE5X 3IH5A 5C3UA 3W4KA 3OICA 5BUCA 3SEZA 4RLSA 3WYEA 2WP8J 4XDGA 1TO1E 4Y9DA 5KYUA 1W85A 3QA9A 1HYHA 3JWIA 1GKKA 3LWZA 3GLUA 5EJ9A 3Q8WA 1RMQA 4DV5B 4KFCA 3ZKWA 3K9QO 1WU8A 4C3UA 4ESVA 3VNUA 1RR6A 3IIIA 3KT3A 1Y82A 5ALEA 4UREA 2VK8A 3LP5A 4XE5A 3Q5EA 3TEMA 1MXHA 4IO0A 4EG0A 3EGEA 1AB6A 1AUPA 3EVTA 4WCDA 1Z4NA 2BBTA 1Z8FA 3HEAA 3LE8A 1N6KA 1X1RA 4MKZA 4YNBA 5TC4A 1FRVA 1XTTA 2WVAA 2CE7A 2W6NA 3HCPA 2UVPB 3T7EA 1DADA 4B81A 2DF8A 4H16A 1JYSA 2WIDA 2IUTA 2Z04A 4IJMA 3RJTA 1KY5A 1QWSA 1LX6A 1REQA 4RPHA 4D9HA 4DIBA 1S8NA 3LOPA 1W5FA 1MJGM 1HEIA 1U9JA 3UC5A 2OWEA 1W36B 4BNYA 4C4ZA 4B17A 3EISA 1FFAA 1GSIA 2QRKA 2ZITA 4RVUA 5BSTA 2CT8A 2BKVA 4DC0A 4X1OA 4US2R 4X8OA 2QMOA 4J16C 4QHSA 5AP9A 1GUAA 2C4HA 4EPRA 1NN1A 3SC6A 3U4CA 2P6MA 1C0KA 5IK2A 1N2BA 2ZYTX 3A1FA 1SVOA 3QE4A 3OJEA 2R96A 1Z15A 4RC9A 3LKDA 2GN0A 4FBLA 5KYUB 4U3JB 1FQJA 2KW5A 1W85B 4R01A 1VMIA 5AO9A 3K2BA 4B75A 3DVRX 3IMFA 3OT1A 4ZI5A 3VR2D 4AP5A 4AWXA 2SKDA 4M37A 1DEKA 1OWOA 2J3QA 5J4VA 1ULBA 2WMYA 1GFSA 1ZRHA 2EW8A 4U6NA 1U81A 2CBXA 4CV3A 3RIHA 4KMSA 4Q1CA 2WRZA 5MGNA 3E4DA 1FDRA 3GBVA 1UBRS 5BOVA 2IU3A 3TD6A 1ZICA 6NULA 5JECA 3D4IA 4LPSA 4K6MA 4H7KA 3K4HA 2ADOA 3M1AA 3P9XA 3HR4A 1UXKA 3O8OA 4GPBA 2VCYA 3L7KA 4MCIA 5IF9A 3KDPA 3NLLA 4NXMB 1CQWA 3JRXA 1QHEA 3T06B 1MA3A 5AVUA 3TQQA 2WNHA 1WBDA 1RIIA 3QWFA 4BMPB 1CYEA 4LE0A 1WXGA 4ZVMA 1KY2A 1EVQA 2X8BA 2ON6A 1KP3A 1GZVA 1E1CA 1QXSA 2W2PA 5KREA 1QP8A 4JYBA 1X1TA 4UFOA 3ZWXA 3QJYA 3IVAA 3T7RA 1E1DA 2IYTA 2P30A 4GLLA 5GOTA 5JJKA 4ABTA 1XN1A 4R98A 3TK1A 3EK2A 5KOJA 4OXYA 3AUFA 3MWLA 1ZPDA 3HFSA 5IHXA 1JEQA 2O2XA 4FYPA 4PO1A 2E4UA 1UIMA 2JAOA 2W43A 4KQJA 4LYHA 4MS4B 4MR7A 3RE1A 5L7WA 1KO1A 4DMLA 2L19A 5PNTA 1JR3D 3DT9A 4M1QA 4UTNA 2RGNA 2AC7A 3W5JA 2DPMA 3WQRA 1XWIA 1RRVA 2ZJ6A 4QEZA 2RGDA 1O6CA 3MQFA 3FVTA 4Y6RA 3M82A 1TQHA 3EVCA 4BAGA 5J4HA 2EVWX 5E4YA 1BGWA 1SR8A 1L5GB 3T3MB 1U2QA 1S3GA 3I1FA 3LDAA 4FSXA 1KOLA 3RARA 1ODTC 4KMMA 4QYIA 4U9UA 4Y3UA 5EGSA 2GM3A 1FLDA 2GJSA 2O0MA 2WEKA 3KSUA 2FCRA 3Q5GA 4G0XA 4HUTA 2GPSA 5UKDA 1ATIA 3VO8A 4CJXA 3TQRA 3M4XA 1I3NA 1HYEA 1OXVA 2AWNA 1FYXA 4MYCA 1X3SA 1JLLA 2JI8A 2XY4A 2ZANA 4Y2RA 2BMAA 4B40A 1XA0A 1ZW1A 4PX9A 1H8HD 4TS4A 3IVRA 3HS3A 4MLPA 3KR1A 4IKEA 4YLEA 3ZLTA 4NY1A 4Q3LA 3ZHQA 4GZ5A 5AT1A 4MK4A 4BDSA 2H00A 4D92A 4CCAA 5I48A 3AM3A 3NAQA 1YVDA 2WPDD 4LEIA 2X0DA 4BE4A 3TOCA 4EA9A 5L8VA 1TZCA 1ZCJA 3A1TA 4L08A 3ZE0B 3HMKA 3PXCX 1F6BA 3MMPA 3PUZA 3QMWA 3TJZA 2ZRJA 4WW0A 4KBGA 3ZE8A 1F5NA 1ZN9A 2ZBFA 2OCLA 4MR7B 4YC7A 1Y8RA 1BWSA 3KJIA 4IJ5A 2XXAA 4UBOA 2N75A 4EKDA 4UM9D 3TQSA 4MS3A 3C14C 2C5AA 2R97A 3LCRA 4LIPD 4IILA 1J2RA 1OWLA 3GBSA 4R8MA 1NBEA 5TV2A 1YBMA 1OIWA 3U9TA 3GFOA 1CZLA 2ISSD 4OQZA 4DR1B 2GFHA 2PUCA 4XRRA 3LQKA 3FPHA 1KU0A 4LXQA 4H35A 3UHPA 3RR2A 1Y5RA 1FTWA 1YB6A 4HZIA 4P7KA 4D4IA 4I8IA 2JD0A 1OTXA 1CXZA 2A5FA 2KI5A 3KSMA 4YS6A 2FG5A 2NUPB 3V2UA 5ES3A 2VF2A 1F4LA 2BY4A 3D31A 3P2JA 1X1CA 5EE5B 4AB1A 4XYBA 4NL4H 5KYXA 4AAYA 4O0MA 1S1CA 4RMHA 2IS4A 4MO2A 1JLLB 3OZXA 4XW2A 4YRTA 2KJQA 1O96B 3CG0A 3FF4A 5TMDA 4EHLA 2EZ8A 3CEAA 4S35A 4URFA 1GU1A 4HBGA 5KYTA 3HXLA 4IZOA 2ZSDA 2BJHA 3SZUA 1I10A 5BR7A 2XCRB 1SEVA 2HIHA 3KZVA 3NOQA 3OQOA 1JWBB 4ZEXA 1QH9A 1L3IA 1CUDA 1LW7A 1SXJA 3MBKA 3VKFA 4L5IA 2D6FA 1ZM3A 4AJ2A 4C7OB 2E55A 3E7XA 2ZIXA 4LFBB 4CV0A 1M54A 1F2UA 3GI1A 1TT7A 4HNGA 1J09A 3CE9A 1H0HA 1Y3IA 2A1IA 2ZJ5A 1YKGA 3EIOA 5ECWA 2ZUFA 5G02A 3GVCA 2UU9B 2HJHA 2B1QA 2ZB3A 4MS3B 1F8YA 2ZJ3A 4HY3A 4Q16A 3TPCA 4I55B 4HAYA 5K1ZA 1R74A 2WQ6A 4HGNA 1XZKA 1P1BA 1CRLA 5LIPA 3B6EA 2OV6A 1OU0A 3EUWA 4QGAA 2GRUA 1B43A 4LXTA 1EVJA 1QH8A 2QXYA 2AOVA 3WGJA 1IBMB 4GWKA 2JJ8A 2OM6A 1N2CB 1C0PA 2CUTA 3UPTA 1EWQA 1DWOA 3ZHUA 2Z1NA 3THRA 2ZYHA 3FUWA 3QLVA 2B8JA 2NTVA 2R7MA 1IDN1 2JHFA 1UFVA 2JGMA 3E9QA 1XXHB 3QI2A 4P2BA 3C8ZA 1CEXA 3UEOA 3I05A 4DE5A 5IDWA 3GIWA 4Y98A 1E0KA 2ILTA 4LJSA 3IGFA 3SE7A 2E89A 3BGWA 5JC8A 2V58A 4FEGA 5TX7A 1DCFA 3JXEA 1BNCA 1QBKC 3NS7A 4Y6QA 5EZ5A 3SJBA 1SXJB 4DV6B 3DMDA 4W63A 1JMYA 2RI1A 3FNGA 3K16A 4P36A 4ZZIA 1U2RA 1F2UB 1NYRA 4QBHA 4QU9A 3QNMA 1RAFA 2ZI6A 1NRWA 2Z9DA 2Y68A 4GRAA 4QFDA 5DLYA 5JQGA 4AJIA 4ZIRA 2I67A 1UPTA 4DIOA 1VI6A 3UUWA 1D03A 1UMCB 2I4OA 4INJA 5G1OA 1XZDA 5K0BA 2QUKA 1P0QA 5G40A 3PRJA 1EFKA 2EIHA 5CM8B 3OWHA 4I50B 1IBCA 1V5IA 2B7LA 1Q2UA 2JCGA 4F72A 5JTUA 1JMVA 1DC4A 1B41A 1Q0UA 1SKQA 2NVUA 3GB9A 6CHYA 5GJVC 5IN4A 3SLKA 2O8BA 1QH8B 1LJ8A 4MWCA 1AS0A 2PSEA 4OK5A 4P32A 2W90A 5BO5A 4NCJA 2JFVA 3G2MA 5AUNB 1CB0A 2V9ZA 3IMCA 5CX1A 3TCKA 4YMWA 1FU7A 4Z4CA 4TUYF 2XCLA 3AHJA 3DONA 3FPFA 4R9RA 4AJ1A 3ZZ1A 1QHHB 4XFJA 2H1SA 4HHEA 4EELA 2R7LA 3AY6A 4JB2A 4AJNA 3AF5A 1YGPA 3DBHA 2CHUA 4HF7A 3LQ2A 4FYMA 5KVCA 4RAOA 4TTAA 5H5JA 4UPDA 3KKOA 2H7YA 2IIPA 3TR0A 3WB1A 1KS9A 1L4FA 3LO8A 5JS1A 4NBRA 2WWRA 3LKZA 1NN0A 1XMXA 4R1LA 5DH9A 2Q6IA 4MZDA 5BT8A 4DXHA 2NSDA 4RHCA 3ROKA 3CLVA 4GP6A 3HXTA 1YVRA 4HOYA 4WFQA 2MYNA 1USGA 1K06A 1MB3A 2DWUA 4M8LA 5F1KA 5JRZA 3PGMA 3PFKA 3MOIA 2K7ZA 4F2HA 2R8PA 5EY5B 1RJDA 3AX6A 5EXPA 3TDKA 4GH5A 4AF6A 5JSQA 5DEOA 3B2EA 5JQGB 4AF7A 2CHGA 3VR2A 4G4SO 4GX1A 1E79D 2FWRA 3V00A 3EGXB 3AUTA 3QUBA 4PBSA 3NHAA 3KQOA 1RYEA 3TZQA 5JEDA 2Q46A 1QK4A 4GU5A 5I9SA 3COZA 1J97A 3FSRA 3M1LA 3RPEA 5DK4A 3ELUA 5EHNA 2O3RA 1RXIA 1ZGCA 4RJLA 3V8QA 3WDSA 1I6WA 1JAYA 3ZQUA 1T1SA 2BFEA 1Y7HA 2I0FA 3FCCA 1ZK0A 2GILA 4WADA 5HZMA 8MHTA 4BJ1A 2CD7A 2D0OB 2RHJA 3OE4A 4B5KA 1V39A 1Y3HA 16PKA 4LF5B 2DUNA 5G1NA 4RZIA 2DSTA 1PTKA 4GT1A 2I76A 3DZBA 1CR0A 1O89A 4ICIA 3ABIA 1J2JA 4B6GA 4ACBA 3N2LA 3PC8C 3DBIA 4IS3A 5A04A 2WPNA 3I2FA 4AS2A 1VZ3A 3OMLA 3LXMA 4D0GA 2DFVA 3PWKA 3VC7A 5IVHA 4HLQB 1QV9A 1DT3A 3T3HA 1CUSA 3CPEA 3OLWA 5CT6A 5E8JA 3PE4A 4NBVA 4X92A 1FRNA 1S2MA 3A10A 2ZR7A 3EZ7A 3NHMA 4HMOA 3SF8A 5K0EA 1PZNA 1GCUA 1X7WA 1UMKA 2ENUA 1JR3A 4GEKA 3KQVA 1V1MB 3KKQA 5D5HA 2ZUTA 3OCXA 4BQSA 1R64A 2XB8A 4P33A 2WINI 3K1AA 4GL2A 1BD3A 1QLWA 1L8AA 1GZ5A 1WCYA 2GTIA 3U61B 1QIJA 5IEBA 3F7OA 4A2CA 4ENWA 2X1LA 4MLZA 3L6DA 1TB4A 1W4CA 5EQDA 1KNQA 1KRXA 2QMUA 3V4SA 3TN7A 2GAFA 1EBUA 2YJ5A 1OTHA 3KT0A 2XWPA 5A0VA 3D4BA 2FPRA 1C4KA 3LSYA 4CIVA 4RBNA 5LVAA 1CUFA 1D0SA 1OKKD 2ZYRA 4MV9A 4ZHSA 3K53A 1O94D 1X94A 4RDHA 1IFXA 1H8HA 1SZCA 2UDPA 3B8HA 3Q88A 3I83A 1QC5A 5HHTA 4MGKR 1B15A 3BB3A 3EPPA 4HAOA 1MO4A 5EIBD 2QT0A 1MRSA 4LNUB 3WNCA 5I45A 3L05A 1O97C 2WPDA 3QFSA 4IIVA 3C7CB 4ENUA 4O4IB 2RGUA 5KQLA 1PNOA 2FPUA 4TKZA 5DGDA 2QI9F 2XYVA 2B25A 3KB1A 2PWPA 3LX4A 4A2PA 1R5BA 4Y9SA 4ZXPA 2WJIA 3IAXA 1Q50A 2FN9A 4OJNA 3SU8A 5D6NA 3WIBA 3ZQKA 4EG4A 5I4KA 5KDDA 3F46A 4DCJA 1E3MA 2O5EA 4FXPA 4JQOA 1B8UA 2W6MA 2O1WA 3FYUA 1XO1A 2IK8A 5LU9A 3K3PA 4QGSA 3WMEA 1U3FA 2BGNA 3MUEA 1VL2A 3VKWA 1CEEA 2DWCA 2VQEB 5BSGA 1LZLA 2XD4A 2YH2A 1ILWA 3UB4A 3M9XA 4HAZA 3E7PA 4CHTA 4CLRA 3IPRA 3GU3A 1E9SA 4QJBA 3INTA 4P84A 5CAEA 2IHUA 3DHVA 3PDHA 5L3RA 5C5IA 1NATA 2RH4A 2PKQO 3B9PA 4PGHA 4TTVA 5IFKA 2R1TB 4QWMA 4TWBA 3LBIA 4JOCA 3R6DA 2BV3A 4OVKA 3UJAA 4NAHA 1Y9EA 4EL0A 1MGOA 2SHKA 3N8NA 1X13A 3OPQA 3R6WA 3U19A 4JYZA 4P0PB 3K0HA 1OXMA 2IP1A 4L0DA 1DAIA 4OY3A 1ZSYA 1B0PA 3DG9A 2ECPA 3PP8A 2FHSA 2O3SA 4J3FA 4KGVA 4IJVA 4S1VA 3ESBA 3W3ZB 3RANA 1Y4ZA 1VB3A 3CX8A 4NU0A 3VYVA 2R0QC 5HGJA 3U40A 3U4AA 3EUFA 5KYYB 1WD5A 1VKJA 1Z0AA 4L27A 3RBVA 3BL5A 4G3XA 2WSIA 3VOTA 1T6XA 4MP3A 3HO1A 4G5XA 4EA6A 1WSBA 2P75A 4YMSA 2VEDA 3T7TA 4L16A 2CEAA 3K0CC 2H18A 2IHZA 3G3EA 1G41A 1G9SA 5LMCA 4NZMA 2GRJA 1ODSA 2M6SA 3WLAA 3CJTA 5AM3A 3VZRA 4UU8A 5CYPA 3K6SA 4DY4A 3L7DA 2FWMX 1KYXA 1Z5PA 3EA0A 3EAFA 4E5UA 3GHHA 4BX8A 3VTKA 2EKZA 3KAKA 1WOMA 3TEJA 1YCFA 3DCYA 4J0QA 4W9MC 5KQPA 1H0KA 4E2YA 3HZHA 5THQA 3JX9A 5C1BA 1DFHA 3ZU6A 4IO1A 1A82A 2Y05A 3FHLA 1ZH8A 1JDTA 1PZGA 5CVUA 4FIZA 4ZOLA 1PV4A 3KQQA 3G0DA 1F1BA 1EFAA 1ECGA 1U0JA 2VS1A 4X5OA 4YR9A 4YH1A 1G3UA 3KFLA 3M6UA 2Q8NA 4KMRA 4MA0A 4XIYA 3RFUA 3UM9A 1Y4DE 3WWEA 4NR0A 4YAUA 2C98A 3LO5A 8ADHA 1R50A 4DCGA 3B2QA 3ZDBA 3DMTA 1O5TA 1UFQA 3DVAB 3PIIA 5ESWA 3WMXA 4BGEA 4LHYA 4Z4HA 2CW5A 3PNMA 2FWPA 1OZAA 4ZDWA 2IOHA 4PG5A 1JUDA 2PH1A 1DX9A 1CWUA 2VK1A 3R9IA 5A6SB 1YDMA 4MMXB 3HCAA 4DIDA 4DREA 3RADC 3U60B 3A2MA 3SM9A 2C54A 3GNLA 4EGQA 5CJPA 3EIEA 4LVNA 1YZUA 2JBWA 2VRNA 5FQOA 5AVRA 4RVCA 1Z82A 3MAGA 4HDSA 3WOHA 2C29D 2Q2QA 1T4DA 4UATA 1R5NA 4RIFA 4DTCA 1W96A 2YIMA 4MUBA 3STYA 1NFFA 3GDFA 2ZIUB 2O3UA 1OI3A 2P8SA 1CZNA 3D7NA 3KLMX 3W2IA 1X0VA 5LLTA 4ANFA 4KXLA 2H2AA 1P8AA 3BORA 1E3JA 2Y1XA 5G2OA 3K20A 1NMXA 2C7VA 3DS8A 5ALTA 3EDMA 2A5DA 1XK7A 2DRIA 3MBOA 3MJVA 4ZOLB 721PA 2O8EA 1BJRE 1EUCB 4M1ZA 4QOJA 1RWKA 3TLGB 2C94A 3ZDRA 5ELXA 5JO9A 1JU4A 2GFIA 1QGDA 2C0CA 2EEZA 2AJLI 3RDPA 5HJ5A 1K8QA 4PZPA 5IBRA 1I80A 4W82A 3QU4A 2JLBA 2VHZA 4L74A 1JR2A 3L8CA 4DQDA 1XX6A 2QPAA 3KV1A 2WAXA 2F3SA 4A8TA 1H94A 4EL5A 3NBZC 3X2SA 2XWBF 2YS6A 4KIGA 1JFFA 4I4TF 2E0IA 5DGCA 3MA0A 1YFZA 4PS1A 1NV9A 2BFCB 1E79A 2HQ1A 5BT9A 5GZ6A 3ANTA 4DSAA 1RHJA 5J2UF 1B3BA 2FZLA 1OASA 2WHPA 4YAEA 1TO6A 3GN1A 3INYA 3RKRA 2RB4A 2VDVE 2AOTA 2I4LA 1PL0A 2I8LA 1AGPA 2J9RA 3OVMA 4GPEA 4BO8A 2P79A 3G6WA 2Z3VA 2QSYA 5YASA 1WQ1R 1Y42X 1NIPA 2YZ2A 1T34A 1UJNA 3PGLA 1AXGA 2Y1CA 3BH7A 2O8EB 4FD2A 4LQCA 3DBLB 1L5KA 4GGPA 1CR2A 4CGYA 3BMQA 5KVQA 3JQGB 4WAUA 1WKBA 4NCAA 1RDFA 5HKLA 1Z37A 3REOA 4DZZA 4QOEA 3FKJA 9GPBA 3AB3A 2H5EA 3PGA1 1R8YA 2BCGY 1KQPA 3AR2A 3JZMA 4FKZA 3SN6A 2HF9A 1PFYA 3BE8A 3UJCA 5AM2A 2FW0A 3DO5A 1BWQA 2HMTA 3LWNA 3VJLA 5H1YA 1JFFB 3Q1LA 5E9AA 5K3SA 3ENQA 2V0GA 1N6LA 3BF7A 4P7JA 3JYOA 4D4KA 3AVUA 5C8DA 3DCIA 3A1UA 3H3FA 4X84A 2AXPA 5HM8A 2D2EA 1JDNA 2NUBA 1EWTA 2A9OA 1E2GA 2WHPB 1NWHA 4PFJA 3W5HA 2AK2A 1QHYA 1P7CA 3OMWA 4ZOCA 5EIAA 4EO9A 1DGQA 1K8XB 5GTDA 4C0BA 2AOTB 1IJFA 1H05A 3VOBA 3V8EA 3A1SA 3EQ7A 2GF2A 3GJ8A 5DBEX 1DTEA 5EQTA 3GUYA 2Z8YM 3R0ZA 4DRXB 3A7EA 1K5GA 2XBLA 3EWSA 1OKKA 3TMYA 1DEXA 3UCXA 1E89A 4IFBA 2HT6A 1G3IA 1Q7RA 4MVJG 2HV8A 1J99A 1XMQB 4DNQA 3TNYA 3G02A 4A0QA 2BIFA 4IJQA 4L95C 1VIAA 2AK3A 1IN5A 3P5SA 2PVCA 4MV8A 1EQUA 4RVFA 1OLXB 2H4WA 4F1KA 2IHJA 3KYCB 4MJ3A 4OLAA 2C2BA 4HVAA 1FTQA 4Q1FA 3COPA 3LW7A 3NCTA 2FPGA 3NVMB 3E03A 1ES9A 4RHYA 2ZSIA 1Z8NA 1PWHA 3JYPA 4N03A 1EQAA 3V7UA 4HI0E 4Q1EA 3WRYA 6REQB 3TG8A 1U8EA 4ZOAA 3WLTA 2Q9UA 1VIYA 3ICCA 4QJIA 4AJLA 3H2JA 4C5AA 4XX0A 4HYTA 4Q47A 4PHCA 1HG1A 2B94A 3DQPA 5BNWA 4CQLB 4M38A 2R4QA 3ED1A 4IIBA 4OFWA 4X6XA 1L4BA 3L0IB 3I6QA 5REQB 2ZATA 4M76B 4ZCRA 1H4SA 1NQTA 1OA1A 1JT9A 2JANA 4FKBA 4PYMA 2WJJA 2WVGA 4O1IA 1RCTE 2DP4E 3PVZA 3WIVA 4D82A 3TXXA 4EB6A 4RTQA 4GLFA 1TCBA 3E9DA 3BERA 4DMFA 1M1XB 1EIWA 3LW8A 1I94B 4G0WA 4BVFA 4YJ2F 1O5IA 3UJ3X 3QELB 1P73A 1O4WA 5F35A 4E5SA 3HYSA 3AH8A 2QY6A 3IHLA 4WXRA 5A3VA 1MTZA 2Q1XA 4WA8A 1X92A 1DZ3A 3PFWO 4CQJA 5HM6A 1KO4A 2HKIA 3AR6A 4BO4A 1LTQA 3BJIC 5LKRA 2FXVA 1KAMA 3P0HA 5K6AA 4RTRA 2RC6A 3QX3A 3RS7A 1JEJA 1J56A 1JHQA 1EK6A 4V03A 3VQTA 3MG9A 3IUEA 2OE2A 4JKIA 1VLMA 3P9IA 1ORTA 2BUCA 3I0ZA 4GGMX 4KAAA 4NEQA 2KSQA 4N18A 2PUBA 4AN4A 4MKIA 1ISIA 5DGXA 3FR8A 3TW8B 2QSJA 1Q17A 4IIEA 4YI5A 2JRLA 1XL0A 4XX0B 3HABA 4YA6A 1R18A 3UT5A 3NB0A 1YF3A 2AN1A 3KUCA 5FDFA 3WBKA 5A3JA 4QSMA 2JZNA 1XVAA 5M34A 4QTUB 1QKJA 2B35A 3AXTA 3UJBA 3ZY5A 4CG3A 4OHOA 1KEVA 2GS9A 5K9ZA 1TZKA 1OFUX 1LTHR 4BB5A 4GZ6A 1H2WA 2ZJFA 2UV8A 4GOJA 4EB6B 6AT1A 3SHOA 5JAUA 5MHTA 1M76A 3JQ8B 4QUKA 4J0EA 2QTVB 3MJDA 5DHTA 1NX6A 1ULHA 3B85A 1HDXA 1XVUA 1MQSA 3QLEA 3N3BC 5EOVA 3LQ1A 2OMKA 1GADO 3DE0X 3OTHA 4KXNA 4L1KA 4Q9DA 4RFVA 5K3EA 5LR6A 3UVEA 4J90A 4J1TC 3SIXA 4Y2GA 4ZVQA 3VZSA 2NZYA 1IWPB 2AZMA 4KK4A 5ECDA 1D5CA 1VLQA 3ZH9B 1DRUA 4NK5A 1Z68A 1KBQA 2R47A 4B3JA 1NDUA 1P2GA 1DC5A 3FNIA 3X1KA 1DKQA 3N2KB 3QVKA 1PFGA 2O2JA 2QLFA 3R5TA 1L8QA 4DNXA 4EUEA 1YQDA 4KWCA 2QG4A 4QT0A 3DPIA 4C7OA 2AMVA 2CVZA 1NNEA 1CRZA 4I66A 1V11A 2JHAA 5DHRA 5TEVA 4EX6A 2B4AA 5DCWA 4COOA 3NBXX 3UBTA 2FRVA 3R24A 3DFKA 3P2IA 4HNRA 3HL4A 3PQCA 3QY0A 4O4LF 5AKGA 1N34B 3GK3A 3K9HA 4MUJA 1AA6A 2V7GA 3O2NA 1IOWA 1TK9A 2F00A 2XZTA 4G4GA 3LFHA 4BOYA 1W25A 5IS2A 1L7RA 2VDKB 2YY6A 3VI4B 2PH5A 5AOCA 5CVTA 5K0GA 3DCNA 2CHEA 1KI1A 3B5JA 1V8OA 1SRQA 2MINA 1B4DA 1K7FB 1OGYA 2C5FA 2Y1GA 2Z2ZA 3E8SA 3HVJA 3KZ1E 4MWOA 5ILQA 5FR1A 2WHEA 1E1RD 4LWZA 1FVHA 1GGMA 2AX3A 1OZHA 3KB2A 2HZBA 1W88A 4G36A 5B2ZA 4RVOA 2QRMA 1RQPA 4QXMA 2Q5IA 1TL7C 3H5OA 1N5RA 4NYJQ 3UK6A 1TC2A 3SC2A 4MX8A 4GLOA 2BM0A 1X7DA 1SUWA 2HSWA 3D3NA 5AESA 3VZPA 3VX3A 1NKTA 1G6HA 1N5LA 3DSRA 5LB4A 3RT7A 4N8EA 1Z33A 1AK2A 3C1OA 4CQMB 3G5UA 5DI9A 2I5PO 3DEAA 1L5HB 1N9ZA 1GRCA 5A05A 2FSGA 2E3JA 4TWIA 5BMVA 1V11B 4DR2B 2L2QA 4G4SP 3CLRC 1UZMA 2H08A 2CCGA 3I9NA 2FEXA 2IU4A 5ALZA 2WUWE 1MTOA 2CMHA 2ORED 2UZ1A 4M54A 4TZKA 3KQPA 3PK0A 2A1UA 1TGVA 3L0BA 4GQAA 4YP5A 4AQDA 4CEIA 3KPUA 5KU7A 5AM5A 3LPNA 4RLQA 2QPLA 4BLTA 1Y6GA 1DT5A 5ICCA 1ZJJA 3LYAA 3N86A 4KRXA 1GNVA 2P40A 2XNKA 1P2VA 3E9YA 2DBYA 4FOLA 1LW6E 4LZPA 1C50A 1PVVA 3O4IA 1UDBA 1W1WA 3L6CA 4JH0A 3WJ1A 1TRHA 2J5QA 1GAEO 1BHSA 3Q7SA 1W88B 5C9ZA 4ZQEA 1T4CA 2XXBA 2HUNA 1FYVA 1AY0A 4XB2A 3GYGA 3NT4A 3RNOA 4X00A 3HXQA 4OKNA 3RRYA 4CEHA 1A4IA 4RJTA 3W5BA 4XSGA 3TD2A 1KXZA 5A9SB 4K40A 4WXHA 3F7MA 4Z51A 2FPLA 2H92A 3H1FA 4V0MA 5JBIA 4JJIA 3H9BA 2ADFA 2EP7A 3EMKA 1P1RA 5TE9A 2ONCA 5JNWA 2J0VA 4G0ZA 4Z1OA 1H6AA 3G2IA 4ML3A 5K3BA 5KKCA 1GTRA 5F7JA 1OREA 2P69A 1ENOA 1JHUA 2N0SA 1EDZA 4XI9A 3RUIA 3TRIA 3ZJUA 3T99A 3OE5A 3O8DA 3KXIA 2ZYUX 4ENRA 1XWWA 5A5VA 1UMDB 3A4MA 5CCDA 2FZGA 4MUGA 3UH1A 1M0EA 2HXGA 3S40A 4F6RA 4JLBA 1P2TA 2ONYA 1FFYA 1WKCA 5GM2A 2IYSA 1P2SA 2VHVA 5KWSA 3OU6A 3GCDA 3KAQA 5D85A 3W1WA 2V6IA 2GHTA 4BNUA 5CXQA 1BFUA 1M0TA 1UOPA 1ZUWA 3OAAD 3CQ9A 3QLJA 5FXMA 2DH6A 5BQ3A 2C9OA 1JFTA 4Z53A 2QOEA 2P9FA 1DJMA 5CYGA 3LRPA 3UW1A 1IZ8A 2VQ3A 2GM5A 3ZE6A 4YBRA 5A62A 2PV7A 1G19A 1GFIA 4YV2A 1T4CB 1UWVA 5IJ0A 1Z6AA 3D7SA 2I7CA 4AY5A 4JI8B 2V5UA 4EECA 5JZBA 2BGKA 3IHKA 2EXXA 4FHCA 4N7JA 4NOMA 4XLLA 3WIDA 3Q0TA 5BR4A 2NZVG 1GU0A 2JFNA 2NZXA 5IXYA 5IZCA 2WWIA 1U1IA 4G26A 1ESNA 1NPTO 5JEEA 5DEIA 2WM8A 4G5GA 4F3CA 2ZM5A 3V4RA 2NV2B 3DAOA 4P7GA 1B00A 4MAAA 1PFVA 1Y1SA 2PL3A 3GZ4A 2FI1A 2Z6VA 3HU1A 4FJ1A 3W1VA 1QF7A 1N7JA 1OX4B 1JSXA 1QLJA 5JW6A 2VNJA 4IYJA 4QGBA 3K9WA 5DM70 1RC8A 2XNCA 1I01A 1OAOC 1U1EA 2WOOA 5F5NA 3USZA 2AVNA 3G2NA 1P6QA 4UUAA 2JD1A 1ITZA 5AKXA 5NLLA 5B6IA 3F4KA 2IOFK 3E1GA 4IV8A 4AYXA 1DL5A 1XJ5A 5AW7A 4EO7A 1I1NA 1T0IA 3P9YA 2EJBA 1A27A 3WNDA 4F6RB 3EYAA 4GE0A 2PFKA 3PUIA 2NU8B 1JEYA 1XMVA 4IF4A 1KPGA 4KG7A 2LNDA 1E2NA 1UKBA 2O8NA 4EYGA 2YHBA 1RI1A 5HCUA 2WSBA 1NNLA 2IGBA 1L5WA 4DSNA 1T25A 2F9FA 3FYCA 3ILXA 3IMKA 3QZUA 7YASA 1OBVA 1FX1A 2PKQP 1XMJA 4GO1A 4H6WA 3WA7A 3F8TA 4HDMA 1QJCA 1YS7A 3TSWA 4C76A 4PICA 2BUBA 1EPUA 4U7FA 3NG1A 1P0PA 1SIOA 1TM7E 3KP1A 1WDWB 4HH3C 3WK9A 5IJ0B 1VJRA 3KSZO 2B1JA 1CV2A 2FZEA 1DPFA 1V3TA 2X0NA 2OT3B 3DNMA 1ANKA 2FE1A 3NJRA 4BFYA 3WGGA 3SPXA 1XTBA 4CM9A 1JWAB 3BWVA 1Y3DE 3D6VA 2XCTB 3A32A 1ZI8A 4HQ6A 1XRQA 2UVQA 4R7ZA 2GZSA 1O6BA 3S8MA 1FSZA 2PYDA 3LBHA 4UNRA 9LDBA 1J25A 2R85A 4PFQA 1BKSB 4LXUA 2BFFA 1A4UA 3QW2A 1X70A 2W0MA 2HIAA 3L8YA 4LZZA 4WZBA 4X7PA 1NULA 2JW5A 2OV1A 3DOEA 1U8AA 1H6BA 3GR6A 2QQFA 4G1BA 1TJ5A 3OY7A 4JJ6A 4LI3X 3RWOA 1JIXA 4B46A 4MB6A 3VC1A 5C7OO 3R7DA 1T6NA 1AS2A 3GAMA 1ZCZA 1C7ZA 2R8XA 4AKTA 3IL2A 4F3TA 2JLAA 3KU1A 4B6QA 4G0VA 4D9CA 1HFKA 4MNTA 1E2IA 2ZUSA 3AVQA 4GGOA 2A88A 2Q5OA 4AWBA 1F20A 1GA6A 1VBNA 4DSTA 5C8ZA 1AKRA 1RM3A 1SQ5A 1CQPA 2AF3C 2C78A 3K0EA 3CXUA 4LJ7A 4C0SA 2KLHA 2D5BA 2HSJA 3PBKA 3Q87B 5F4ZA 3RSLA 2Q27A 4BYMA 2AG5A 4Y8VA 2X23A 4NCXA 1AURA 3FM9A 1NF3A 1I0IA 1Y6JA 3D2CA 3AV3A 3A1EA 4BVBA 2HRBA 2JJMA 1V2HE 4HDMB 4IMIB 2JVIA 5TRTA 4BNXA 4JY7A 3RSZA 3SEFA 3VPDA 2P9CA 3KCNA 4MGZR 4RQBA 2LGJA 3V1TC 3M83A 4C20A 2UZIR 1FFWA 2CL6X 3HV2A 1QHIA 2EFJA 3IQDB 1ULTA 1XCLA 4KV9A 1NVFA 1MC8A 2Y0BA 2ZRIA 2Y27A 4ZYWA 5ETJA 2BUAA 4JJKA 4DR7B 2PKXA 1T2NA 1ZZGA 1W8IA 2J3LA 2QX7A 4RIGA 1T5SA 3ENNA 4J07A 1D9XA 5EN4A 3RRFA 5JCXA 5CH5A 2IXAA 1KEEB 3HUUA 3A2KA 1FSSA 2UXCB 3L41A 1SPXA 4CDMA 1O2DA 1JXQA 4GBMA 2JJYA 2OUIA 2Q4EA 1YE8A 2Z98A 3G2HA 2HDHA 4X94A 4FMDF 1QHNA 1CQIA 3DMFA 1X15A 3LIPA 4U00A 2O2EA 4JENA 2PPVA 4PNEA 3OE7D 1CK4A 4RXUA 4YP6A 3CY6A 1Z5VA 2OGSA 2QMEA 1TPZA 3BCSA 3E7FA 4HLDA 2HCBA 3OLCX 3BOSA 2EJWA 1AQNA 3F6RA 1T9ZA 5LQMA 4MVJH 5C52B 3NYWA 2R6ZA 1GUYA 2OGWA 2RK4A 3HJAA 3V46A 5CBPA 1SBYA 4I4CA 5KVVA 2R8BA 1P4HA 4WL0A 1CB7A 2P9GA 1XFDA 1CR4A 3KHTA 3RGWS 4FGJA 4M0FA 1E1RA 1VHJA 5EHZA 2QJFA 3O0DA 4YIHA 1A96A 2P35A 3DAYA 5BV8A 1RI5A 4IUCS 3JD2A 2BI4A 2ZGVA 4KQIA 1F38A 2J45A 1RYDA 3SC3A 1X7GA 3H8JA 3OX3A 4D42A 4RDCA 1UM9A 4MI9A 2RHWA 3P0FA 4RSGA 3RSHA 3VR3D 2G71A 2ZAGA 3WB9A 1HTWA 4CMEA 2KX7A 5KAPA 3I9MA 2AZXA 3NDBB 1C7IA 1C3OA 3V7WA 3RTEA 1UBOS 4B82A 3ZJ4A 4F4IA 4MW7A 3ZU4A 1I3CA 1QYCA 1BE1A