3JWGA

Crystal structure analysis of the methyltransferase domain of bacterial-cthen1-c
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
200
structure length
195
Chain Sequence
NLNQQRLGTVVAVLKSVNAKKVIDLGCGEGNLLSLLLKDKSFEQITGVDVSYSVLERAKDRLKIDRLPEMQRKRISLFQSSLVYRDKRFSGYDAATVIEVIEHLDENRLQAFEKVLFEFTRPQTVIVSTPNKEYNFHYGNLRHRDHRFEWTRKEFQTWAVKVAEKYGYSVRFLQIGEIDDEFGSPTQMGVFTLGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical insights into 2'-O-methylation at the 3'-terminal nucleotide of RNA by Hen1.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Transferase
molecule keywords Methyltransferase type 12
total genus 63
structure length 195
sequence length 200
ec nomenclature
pdb deposition date 2009-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08242 Methyltransf_12 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3jwgA00
4KIFA 4R6XA 2G1PA 4P7FA 2AOUB 2CMGA 3K6RA 3IYLW 3MCTA 4QDJA 4E2ZA 5DRTA 1TPYA 3LL7A 4PIPA 5K0JA 1YB2A 4KW7A 4FZVA 2UYQA 5DT2A 5T64A 4PGHA 2AOTB 4OX9Y 3R9XB 2NP7A 3BWBA 3C6MA 3EGVA 2EG5A 4YUYA 4HTFA 3GJYA 2P40A 2PY6A 1EJ0A 1BHJA 5DX1A 1MJFA 2Z6UA 1OR8A 3A25A 1RI2A 4YUVA 1XXLA 5U4XA 4E30A 4YV2A 3V8VA 3MTIA 2C7OA 4PYJA 2G72A 5HILA 4YV0A 3WSTA 2P1DA 3NW9A 1I4WA 3P9KA 1AQJA 5M5BA 3CBGA 4Z2YA 3UJAA 3HA3A 5MHTA 3G2QA 3ANXA 4ER3A 2ONYA 1Q0SA 5DXAA 1NT2A 3PLAE 3G7UA 5C1IA 3M4XA 3HCDA 4XUEA 10MHA 3O7WA 3PFGA 1BC5A 2WK1A 3KR2A 1SUIA 2AOXA 3Q7EA 1M0EA 1JQ3A 1KXZA 4YMGA 5E9WA 2VS1A 3KQQA 5KYGA 4MIKA 1P1CA 2NXJA 2VP3A 1YZ3A 3KHKA 2GAFA 3LDGA 3QV2A 3ME5A 1JR4A 3TM5A 3GXOA 3CJRA 3I53A 5ICEA 4GEKA 3LBYA 3FPJA 1JTFA 1KR5A 2ZCJA 5F2NA 1KPIA 3L8DA 4PONA 3M33A 4BY9E 3OFJA 2AN3A 2ZBQA 3R6TA 5FWDA 2HR1A 1NW8A 3CC8A 3P2EA 3CJTA 4C04A 3KPUA 2QE6A 3GRYA 2NXEA 2AN5A 2OXTA 1JG1A 5LQJA 2PSSA 4OQEA 3SGLA 4MHTA 5FA8A 4JXJA 2ZTHA 4EQZA 3LECA 1NBHA 2P3OA 3LX6A 3QOXA 2P7IA 1RI4A 3LDFA 1INLA 1XTPA 2PX5A 2QM3A 5E9QA 3EEYA 4CWAA 4YUWA 5CVUA 3EMBA 4PGGA 4PWYA 2FHPA 3KQWA 2YXDA 4CKBA 2YTZA 3HP7A 2ERCA 2PWYA 3HCCA 5K01A 5LSAA 2ZZKA 5G02A 2I6GA 2P35A 2ZULA 4E2YA 3EMDA 5FA5A 2NP6A 2PXXA 2ZZMA 2P3LA 4AZTA 4AZVA 5FULA 4RTOA 3ELYA 3HVIA 4M7RA 1RJDA 1KHHA 2H1RA 2EJUA 3NDJA 3HNRA 5EMMA 2Q41A 5CCXA 2AVNA 2XYRA 3THSA 1Q0TA 5HIKA 5FQNA 3LKZA 2OB1A 2PT9A 2PBFA 1SUSA 3P8ZA 5BP7A 2K4MA 2AZTA 3HEMA 3MCZA 3O4FA 3M6XA 2ZIFA 2NNWB 4YUXA 2R3SA 2WA1A 1D2HA 5HZMA 3EEOA 3FRHA 2OYRA 2G71A 3G5TA 4OA8A 4FS8A 4O29A 4R8RA 2CMHA 4RYLA 5P8WA 3HCFA 3V97A 4C05A 3MB5A 2XYVA 3T7TA 4BLWA 4GOMD 2V74B 1L9KA 5T6BA 3FTCA 3SSNA 2A14A 4EK9A 5ICGA 8MHTA 4CKCA 2PX2A 5DXJA 2PWPA 5CCBA 5CVEA 2I9KA 1BKYA 3C6KA 5FQOA 2UYCA 4ATNA 4DCMA 4RTMA 4F84A 1VBFA 3KPYA 2IDJA 2VDUE 3OE5A 1MHTA 3BWYA 4RTLA 1WS6A 3OCJA 3EVAA 3I58A 1WXXA 2GLUA 2IGTA 1FPQA 2PKWA 4KDRA 2JHPA 2ORED 3SR4A 3NTVA 3QOWA 3HA5A 4GQBA 4V0QA 3KQYA 2QY6A 5DRYA 3NMUF 3ELUA 2PXCA 2B9EA 2UYHA 1G6Q1 3HM2A 3DXZA 4HG2A 1ZHFA 3I9FA 4FT4A 2PX4A 3P9CA 3HTXA 3LSTA 5EVJA 1XDSA 4P58A 2F8LA 3G89A 4YMHA 2AOUA 4R8SA 2O07A 3CGGA 4EVIA 3P71T 4RTKA 3BT7A 1QANA 4Y2HA 4DM3A 5LQRA 5K0FA 4QVKA 4F86A 5K0CA 1FP2A 2OY0A 3KR9A 2JG3A 2AOTA 3U81A 3A7EA 4PNEA 2FK7A 3NWEA 1NKVA 3DH0A 3VSEA 1RJGA 3T0IA 1O9HA 3B3JA 4P7JA 3KKZA 4C06A 1ZQ9A 3KQTA 1JSZA 3GWZA 2YR0A 3KR1A 2YQZA 3OZSA 1NV9A 4RX1A 1T43A 2GA9A 3UA4A 4QPNA 3NVKI 2NYUA 2XVMA 1JQEA 3EVZA 3HCAA 5ICFA 2GS9A 1QAQA 2ESRA 4E32A 3JWHA 5LQNA 4FT2A 3CJQA 4BLUA 3MQ2A 3D2LA 2YX1A 3EVCA 2ZSUA 1M6EX 1ZKDA 4FSXA 3HCBA 3P9NA 1JQDA 3THRA 1QAOA 3BUSA 3P9IA 5F2KA 5E8JA 4PYMA 2C7RA 5DTRA 5LQUA 4X60A 4HRAA 4GBED 4RTQA 1VPTA 2H11A 2BR4A 2OO3A 4GC5A 4RVDA 2HMYB 5E1DA 3TKYA 3UJ7A 5K09A 3FUVA 3OU2A 1D2CA 5CIYA 1HNNA 2YUIA 5CM2Z 3UWPA 5C9ZA 4KDCA 4ER0A 1NW3A 3S68A 3C3PA 4RTPA 5GM2A 1R8XA 2QYOA 3K0BA 4IKPA 3ELDA 5EKUA 1NV8A 2UYOA 1B42A 1M6YA 1XVAA 1RI3A 3TKAA 3GIWA 3GO4A 1SQGA 1R6AA 5D1NA 5EQJB 3TPZA 2UZ4A 1SG9A 1X1DA 4FSDA 3OE4A 3DMHA 4KRGA 1G8SA 3VC1A 1G38A 4ER5A 4CXMA 1AF7A 1L1EA 3T7SA 2JHCA 3UJ8A 3KR0A 3ER9A 5HIMA 3ID6C 2ZIEA 4E2XA 1KPGA 4POOA 4LG1A 3TR6A 3DLCA 4RTJA 1YUBA 3LCCA 4HH4A 5F2OA 1D2GA 3GU3A 4OA5A 5GM1A 1P39A 3E7PA 3MHTA 1R00A 2C7PA 3I5UA 2IH2A 4ISCA 4EKGA 1RJEA 5K8VA 1U2ZA 2HWKA 5T67A 5E1OA 2Y1WA 1Y8CA 3C0KA 1VQ1A 3NVMB 3P97A 1H1DA 1JG2A 2IPXA 1NW7A 2ZWVA 2ZW9A 3ER8A 1IY9A 1Z3CA 2E5WA 5HIJA 3C3YA 4AZSA 4CKEA 3ERCA 2OKCA 4PYQA 2ZZNA 5KQSA 3FRIA 2PLWA 1HMYA 1JSXA 2QRVA 4M37A 4YV1A 1X1CA 2PV0A 1WXWA 4H0NA 5EOVA 1YF3A 4NECA 1KYWA 3GRRA 3KU1A 3MAGA 3R3HA 4PYIA 1DCTA 3HA7A 2BM8A 4QDKA 5KS2A 5DM4A 4IV8A 4DCGA 1YFLA 2P3QA 4BLVA 3GRVA 2GH1A 3UJ6A 4OBXA 4LECA 4RTRA 2H00A 3M6WA 2G8NA 3GDHA 5GOZA 3RW9A 2VZ9A 4X63A 3UJBA 2YXLA 3BZBA 3GRZA 3LHDA 3FPEA 3OZTA 2ZIGA 5E1BA 2FRXA 5FUBA 4E2WA 5EEGA 4UOEA 1O54A 1TW3A 1SKMA 5DTMA 2YVLA 5K0GA 4PYKA 3Q87B 4M38A 4U7TB 5DM1A 2ONZA 1EG2A 1X19A 4MQ4A 2G70A 4RSRA 2IIPA 1L3CA 1NE2A 3KPJA 2C7QA 4GOLD 4DA4A 4IWNA 3B89A 4IV0A 3LGAA 5E2AA 4FP9A 1UFKA 4OBWA 3VC2A 3BGDA 4ZTBA 4AZWA 5EMJA 1UIRA 2FCAA 5FHRA 5GINE 2B78A 2ZVJA 3HVJA 1KP9A 3HVKA 4RVHA 2FK8A 3FTEA 3JWJA 4OQDA 5CVVA 3FUTA 3FUWA 3E05A 2EX4A 3PB3A 4FGZA 3X0DA 1VLMA 3LBFA 3OU7A 5DWQA 5FWAA 5K0LA 3I64A 1YZHA 5E8RA 3R0QA 2PJDA 2KW5A 3PVCA 4Y30A 3GCZA 3P2IA 3TRKA 3B7PA 1F3LA 3FTDA 5K0BA 2PT6A 3EGEA 3KPVA 2IBSA 1EJ6A 1NW5A 2IP2A 2Z6AA 3GGDA 1G55A 3LCVB 1QAMA 3LCUA 3PS9A 5CVJA 2ZFUA 4BP1A 3PTAA 1PJZA 3BGIA 5FTWA 3E23A 3NWBA 5LR6A 4DKJA 1I1NA 2XYQA 1X1BA 4PINA 2JHAA 5EGSA 3TOSA 1VE3A 3GRUA 3DXYA 4DF3A 2YXEA 3FPFA 4B17A 5EPEA 2B3TA 5EHIA 3TMAA 5CD1A 5JUWA 1XCJA 2PVCA 5EMKA 4AX8A 1VP9A 2IH4A 1FJXA 3OFKA 2ZBPA 4E70A 1WZNA 2ZBRA 3G8AA 2AN4A 5EIFA 5LQKA 5KVAA 1KYZA 3ELWA 4AUKA 2O06A 1XCLA 3RIEA 1QYRA 4R05A 1JG3A 2AOVA 4HC4A 2JH8A 1FBNA 2OBFA 3KPWA 5GWXA 1JTEA 1UWVA 3SM3A 4BP3A 3FYDA 4C03A 3OU6A 3BWCA 3DMFA 4R6WA 4RVFA 5DM2A 2AOWA 4ER7A 3FPGA 2NXNA 1AV6A 3KQPA 5FADA 4YUZA 4MTLA 5FHQA 5DSXA 4C08A 4EMSA 3SXJA 3EGIA 4GOND 3AXSA 4X41A 3M70A 4PCAA 4RTNA 2I62A 4QTTB 3FUXA 4M36A 3DUWA 5EHGA 5EZQA 2Z6QA 3TFWA 4FR0A 3F4KA 1VIDA 1ZGJA 2FPOA 2HTEA 2ZWAA 3CKKA 3HVHA 4KVZA 4K6MA 3EVDA 2HNKA 2JJQA 3IEIA 1G60A 1ZG3A 2FYTA 3G88A 2JH9A 5E1MA 3T7RA 3TM4A 1IM8A 1XDUA 2DPMA 1DUSA 5DX0A 2N47A 2VDWA 5ERGB 4CTJA 3SSOA 5DM0A 2IBTA 5EC8A 5EEHA 4LWPA 5BW5A 3OPNA 1NBIA 3IHTA 1KPHA 4F85A 1R8YA 5JR3A 1F38A 3MGGA 3AWIA 3PX3A 4GF5A 5FCDA 3A26A 4QVGA 1X1AA 1L3IA 3EVBA 4DQ0A 2CL5A 3R24A 4E31A 5K05A 4RTSA 2PGXA 4XCXA 3G2MA 1RJFA 9MHTA 3B5IA 4QPPA 3DP7A 5EKXA 5DLYA 5HIIA 3FYCA 1ORIA 3BKXA 2P7HA 3GNLA 3M6VA 3AJDA 3PX2A 4XUDA 4C07A 3UFBA 2EFJA 3LPMA 3KQMA 3REOA 3EVEA 3UBTA 1N7JA 2Y1XA 1EQAA 1SVUA 1V39A 5EZSA 1PRYA 3DTNA 3SVZA 1L3BA 4L7VA 2ZLBA 4PYOA 3VYWA 3DR5A 2I7CA 1VP3A 2GB4A 5LQAA 5KQRA 3MTEA 3CVOA 5CVDA 5GP1A 3EVGA 3BWMA 4PCLA 4PIMA 2O0LA 3EPPA 4PYLA 5HFJA 1TW2A 3G5LA 1R18A 4DMGA 2P8JA 3UZUA 2OB2A 4U7PB 5EIWA 3B3FA 5K0EA 1I9GA 2DULA 1YFJA 5LQCA 4KIGA 5EG5A 1AQIA 5IKMA 2B25A 5E9JA 2R6ZA 2PXAA 2AS0A 3EVFA 3SSMA 4E33A 4LWOA 3P2KA 2CWWA 1XDZA 4XUCA 1KIAA 2EJTA 1RI1A 4DZRA 1IXKA 2AVDA 3BKWA 3A4TA 5C0OE 1R74A 3FPHA 1ZGAA 4C4AA 4GUAA 3O31A 3DLIA 2BM9A 2PX8A 2VDVE 5DTQA 1EAMA 2ADMA 3DMGA 1WG8A 3HCEA 4HSGA 4HTFB 2LD4A 5IH3A 3AY0A 4WVLA 4X1OA 4WXHA 2P41A 2B2CA 3BXOA 3DULA 5DSTA 5GIPE 2QRVB 2BH2A 1P1BA 3CCFA 5DX8A 2O57A 5DPMA 2BR3A 2BR5A 2V7EA 4A6EA 3FUUA 3PFHA 4GC9A 3MERA 4GOOD 2BZGA 4X61A 5HEKA 2IFTA 4KWCA 3NJRA 3DOUA 5E2BA 5HOQA 2XBMA 4HGZA 1P91A 3TLJA 3SMQA 1FP1D 1XJ5A 3KQVA 3PT9A 4RV9A 1N7IA 2GPYA 4G56A 5BXYA 4P7KA 3OZRA 5GIOE 2O05A 3G2PA 1O9GA 3ORHA 4MWZA 3A27A 3JWIA 1WY7A 3KQOA 3LDUA 3AXTA 5EMLA 3UJDA 4CTKA 4QTUB 5K03A 2WA2A 2NXCA 3G2OA 4V0RA 5CUQA 3SX0A 1G8AA 7MHTA 2OZVA 1BOOA 2AR0A 3DXXA 3TQSA 1JG4A 4A6DA 3A7DA 2IDKA 3NDIA 4HGYA 2XVAA 5B1SA 3G8BA 3B3GA 3IV6A 4RVGA 2HV9A 3UJCA 4EKIA 3JWGA 4QQNA 1N2XA 3RODA 1SQFA 4PYNA 4RWZA 1NW6A 1RI5A 5H02A 3BGVA 3UJ9A 5ICCA 3FZGA 2CKDA 3E8SA 1VL5A 1QZZA 5BW4A 2IH5A 3M6UA 3UA3A 4ER6A 1DL5A 1ORHA 2OPBA 1EIZA 3KQSA 5K0NA 3H2BA 5D1HA 3LKDA 3FTFA 4P7GA 4QQKA
chains in the Genus database with same CATH superfamily
1VCHA 3ZHVA 5BYAA 3L7IA 5G0SA 3OT1B 3LWBA 3KOMA 1TPYA 2HQSA 3UEOA 1UPAA 3FWPA 3KZXA 2G9VA 1RHJA 2C00A 1QC5A 3JD3A 3L93A 4MRMB 5FNVF 1DNPA 3TXYA 4OLBA 2OQIA 1W0JA 1F17A 1PL0A 3BSWA 4M0EA 3RVRA 1L7BA 1T29A 1POWA 4X8LA 1JHYA 3C6MA 3EGVA 4GU5A 4BAGA 2V6GA 4DBLC 1ESCA 1NPDA 1WLSA 3FCCA 4HP8A 3UVEA 3H83A 5A9SB 5BV0A 3MXTA 4HH3C 2QD4A 5I4IA 3L1KA 1G9TA 1CP2A 4ND5A 3MAJA 2C7OA 1X42A 3AHDA 1CF2O 1Q0ZA 2YJZA 3WSTA 3II6X 4YALA 1J39A 1HRDA 2MINB 2P1DA 4FUTA 4RZSA 1I4WA 2AG6A 2OG1A 3IELA 4CR6A 4Z2YA 4LNHA 3UJAA 2PUWA 3F2VA 1NI4B 5JCOA 4CDNA 4ZJZA 5DWVA 1YR1A 4JBIA 2VHWA 2CXTA 3CVJA 4TKVA 3O7WA 3WBBA 1J6UA 3PFGA 2FCRA 1II0A 3VHXA 2EWMA 4E46A 4O4JF 2J07A 3QELA 4LSZA 1E3WB 1LPBB 1U3UA 3GEHA 2M1XA 2YY6A 2VP3A 1XQ1A 1QVVA 2A9JA 3KHKA 1XXHE 2JATA 1JEJA 1NNLA 1PQPA 3RSCA 1JR4A 2CJPA 3MTGA 3TM5A 2FUG6 3GFQA 4TKMA 3T3DA 3W04A 3G9UA 1PP4A 2BGJA 4UOQA 2J5RA 3FPJA 1SCNE 2G08A 2BTQB 4BPBA 5F2NA 1Z83A 3K0EA 2RGDA 1A9XA 1QHSA 2PO7A 5FWDA 1JNXX 2YMQA 2P67A 4L76A 3S7TA 4EOGA 3G7NA 5AHRA 2ODBA 4Z3OA 4C04A 1X13A 3KV1A 1V9CA 2B4TO 3NAQA 5K3CA 1EKXA 3QVGA 2VF5X 5A9RA 1JV2B 2GBFA 1E0DA 1R0CA 1Y48E 2QIPA 3T99A 5JAMA 3U7JA 1K06A 3NM4A 2VP9A 2H29A 3AINA 3M5CA 3QKIA 4HY3A 3PC2A 4IDCA 3U3DA 3ZR4B 4LWQA 3T4PA 1RI4A 2NW6A 4ZOAA 1N7GA 1NYLA 2IPAB 5IBPA 3EQ7A 3N2NA 4KI0A 4CWAA 2Q5CA 3RJ5A 3RS5A 4FGSA 1TIBA 2V03A 1YRAA 1NQUA 3DYVA 4UBJA 4ZD6A 2VXOA 4PGGA 4LCEA 3PHLA 4FILA 1E4EA 1A97A 2RKBA 4JZKA 4QOSA 5DM70 3V32A 1RM5A 5BT9A 1FVXA 3MW8A 4BATA 4Y7DA 3WB0A 2GHRA 4FIDA 2O4CA 3L7DA 4FW9A 3ENNA 4M7RA 4W6QA 3O8CA 3ZXSA 3IJRA 1H1LB 3CV3A 2GEDA 3K9LA 5CCXA 1A98A 4BB6A 4FCVA 5EI5A 5FOSA 3RHTA 5HIKA 4Q7KA 2CLDX 2OB1A 2WWTA 3LUJA 2GN6A 2J32A 4HEJA 4JL6A 4JNKA 2PBFA 5K6TA 2O1SA 2ZGVA 4HNHA 3VR5D 4DDUA 1A77A 3ESQA 3UWDA 5CRIA 3MS2A 1GRNA 4L27A 3I5YA 1TCVA 1SZJG 1RT9A 3TK1A 4ZQEA 3CLKA 2HXGA 1HWYA 1H0HA 5FV7A 4F2GA 1G5TA 3RHSA 1ANKA 2AG1A 2G9UA 1EFRD 3AM4A 1UBNA 3H17A 3G6WA 3R7WA 3U3XA 7REQB 1KAQA 4BKPA 5DWDA 2CUKA 4RETA 1XD2A 4G89A 4ZGBA 4F3TA 3VH3A 1FX0B 5T3UA 3OM1A 1I5RA 2CNOA 4CVNA 4LJ8A 3QPCA 2HM7A 3RJMA 4Z1OA 3HYCA 2OCBA 4DIDA 1NF3A 2AFIB 1XNGA 1ZA2A 4WFJA 2FMIA 3I58A 1SXPA 2IWRA 4LRSB 1FPQA 3A8TA 2Y0CA 5FWXA 1ZVVA 3NTVA 2GUWA 1YS9A 2OCGA 1UWLA 2C5BA 3QOWA 1FJGB 3AL0C 1H23A 2NO9A 1G63A 1NJGA 1F1BA 1HA3A 1CF9A 4TSFA 1EUDB 2QLMA 3PR1A 4TLAA 1P7WA 2C4WA 3PUXA 5ELMA 3SY8A 3VPFA 4X91A 2ZRMA 4FT4A 4ZYTA 2G25A 4K9SA 4ZIRB 3K5WA 1OYWA 3GRCA 1C29B 1RBMA 4Y2SA 1LDMA 4YMHA 3CNLA 1PBNA 2O07A 1CZUA 3P71T 4OSPA 2C8KA 2HBRA 3C6QA 4X9XA 4BU1A 4DM3A 3GLFB 4NJOA 4QVKA 2BFFB 4IOLA 1R3DA 3EAFA 4ND7A 1A0OA 1NG9A 3LT5A 2CBGA 3EXEA 3NWEA 3GMTA 1KO7A 3CU5A 3HI6A 4CLRB 1FLNA 4G23A 3I05A 1HKUA 3QU9A 3KQTA 1SOWA 1TT5B 4CU2A 1BGWA 3WQSB 2FTKE 2ZRAA 4KXQA 2GBLA 3ET5A 3C6XA 1C0KA 2GA9A 3D3WB 4RK1A 4Z86A 2XVMA 2XKKA 5F7JA 3SU8A 1G8GA 3WB1A 4FLEA 4WK2B 4D2IA 3I04M 3P9QA 3HUEA 2Q2VA 1JA0A 4HXYA 2FFJA 1G7TA 1P4SA 4N6NA 4RQAA 4YQZA 4AK9A 1DKLA 1OILA 4JELA 3PQ2A 5AYVA 3A3YA 3CZQA 2F4NA 2GEFA 2R25B 2ZJ0A 4HDRA 5E8JA 4DREA 3H04A 5DTRA 1KAEA 3O91A 5JANA 4YT8A 5DGDA 1CY7A 2K2WA 4TMKA 1OC4A 3ZW8A 5EIEA 1SU4A 4DV2B 2EKLA 1FLVA 2KSQA 3D7SA 2E6KA 4JDPA 4C3UA 4Y1RB 5KC9A 2OP1A 5KNCD 1QV7A 2ZVPX 3OU2A 1VCMA 3SCZA 3N7UA 4F91B 1EQ2A 1CB7A 2IXEA 2P9CA 5L4SA 1Z08A 3OTWA 3A6DA 1TMKA 1WTCA 4UBMA 1N0WA 3K0BA 2FEOA 4IKPA 3KTAB 4GDFA 4JJEA 3ELDA 4JY7A 2X8JA 1B42A 2P9JA 2QVLA 3SDSA 1PJ3A 4C6TB 2RMKA 5CXUA 2D00A 2OXFA 2FPUA 1I7LA 3GO4A 6REQA 3CBQA 3R6LA 3GJXC 1X1DA 3CRNA 1WXQA 3L6DA 4G4IA 4GM0A 1AF7A 1LLDA 2JHCA 3U60B 4YY3B 3T1HB 4D96A 1U3WA 1KSGA 1KZYC 4JIGA 3DMDA 4L8FA 5C1OA 4UHCA 3WWDA 4WCFB 4IFTA 2Y0EA 1M8PA 1XVUA 3E1GA 1PEYA 3FNFA 4O08A 2G28A 5J59A 2M6RA 4GM4A 5F3RA 4OH7A 1U2ZA 4BFTA 2GAIA 2XMBA 1WE2A 4J1TC 4CCYA 2CNWD 5DGHA 1Q20A 4P5DA 4PC6A 5E0KB 5EE5B 1JEYA 4WV3A 1HTBA 1LBSA 1IZ9A 2H16A 1O95C 2E5WA 3K35A 4R16A 1ZUD1 1L5RA 3T7EA 2QTVA 4BXOB 4UE2A 5L3RA 2YJ6A 1YNOA 1E60A 4WADA 5D6NA 3RQIA 4CQMA 1WXWA 4MRAA 3E22A 4YDQA 2DGDA 2XRYA 5EOVA 1Z7GA 2OG2A 1C41A 1N3LA 2WTNA 3DEYX 1KMIY 3ESRA 3F5DA 5DYIA 5F1PA 4WZAB 5E4FA 4D3ZA 2OBXA 1KMCA 2XMZA 1W25A 1CUYA 1FMTA 1GZ7A 4IOKA 3U7QB 4E6EA 1D7AA 1K9VF 2R6GA 4L5YA 2A9KA 5T3YA 1YR9A 3MNFA 4OM8A 1IQPA 1XR3A 3S44A 2WWHA 5JJ5A 3OY7A 4HAOA 1YK0A 1G8HA 5JHGB 3IX7A 3RYCA 1WMEA 2H52A 2GZ3A 3AGPA 2I54A 1E4VA 3IDFA 3VTAA 4BWVA 2JKZA 4UOEA 3AVYA 1DRVA 2I66A 4CBVA 4D8UA 1N2CE 4IH1A 4FHGA 4U7TB 4KFSA 4DMMA 1LZKA 3Q1KA 2BFDA 4EKNB 3KSAC 1GPWB 1C9YA 1PG2A 2YJGA 1XTVA 2RKWA 1UJ5A 3EASA 1CVIA 4IWNA 2OD7A 4MVWA 3JQCA 4FP9A 4JI2B 4IEIA 4IGIA 3COPA 1Q6ZA 1WVMA 1PO7A 5GINE 2B7CA 3EIXA 5JXIA 3BULA 3CKYA 5DHQA 3TGPA 3MQFA 3JWJA 3RVDA 2Z9BA 4FEYA 4OHCA 3D3KA 2J3KA 3VPCA 3BTVA 4KHZA 2AGVA 3ER6A 3NC1C 2PS1A 5E8RA 4B5LA 3DWGA 2F62A 3G0IA 4HGNA 5TS3A 1A8SA 3EZ6A 1PT7A 3EB9A 4MJ3A 3AVXA 1C0IA 3GH1A 3C97A 1MH1A 1YFKA 4LY6A 3T52A 3U6BA 3KT8A 3I5MA 3CR8A 4KL8S 3EMKA 1K7FB 4BEJA 1M0WA 2TSYB 4N7BA 1NN5A 3V8BA 4W99A 2QD5A 2WTBA 4XR4A 9GPBA 3AR7A 2V1XA 3AEZA 2MWMA 3CRRA 3D7LA 3HBNA 2CLLB 1SD2A 4DEYA 4BGEA 2GTIA 2OOKA 3ZD9A 4D3XA 1N5JA 3ROQA 4HRVA 4CLOA 3W6OA 4LHEA 1PR4A 2JAWA 4F04A 5JCPA 4FWTA 1P8AA 2QUAA 2WJ4A 1GZ3A 2GRUA 1G3UA 2O6HA 1PFGA 3FD8A 4AUKA 4EGSA 1SB9A 1ZH8A 3RIEA 1NJ1A 1KY5A 5KYUA 3DFKA 1JG3A 5AXCA 3F97A 2BI7A 2QTWB 1SVLA 3RPEA 3UO8B 1JTEA 4CM1A 4F5YA 2CNDA 3FYDA 3GN1A 3SHOA 1Z6ZA 5BWLA 2CZQA 3VA7A 4LX8A 3KOUA 3BMXA 1THZA 4FCWA 2DT8A 5IJ9A 1T0BA 5K99A 5JJIA 4KLAA 2AQKA 3WRYA 4C0KA 2CV0A 1BMFA 2VL7A 1E1YA 2G8LA 3GFVA 2QN8A 3OJ0A 3T1YB 1O3YA 3MJ4A 4BBJA 1JXAA 5U1PA 2J6IA 1VYVA 1F0PA 2EU8A 3AEYA 3L7JA 4QTTB 2BBOA 4TL7A 2AKYA 1ICEA 3C7DB 4HLCA 3UAWA 5K9ZA 1PD0A 4XLTA 2R5FA 1K8ZB 2XKBA 1SXJB 3NRJA 1K7SN 1H4TA 1II8B 1KSHA 3SZ3A 2H17A 2VR1A 2O2GA 3R5XA 5KU7A 1GITA 4EYSA 1IIBA 2H4WA 2WJJA 3ZQUA 4UNRA 4GPIB 3VJRA 1TEZA 1WP4A 1QQAA 2C4HA 1CFZA 1ZZEA 3JAMA 2I6QA 3AOGA 3OZDA 3VM6A 4PWZA 4BVBA 3GBPA 4D3YA 3OPNA 1ABFA 1IZZA 4K86A 4N54A 1IZ8A 1YB6A 1W581 2SKCA 4I5DA 4HLUC 4QYIB 2ZS9A 3PX3A 1ZL2A 1M2KA 4R0VA 1OHHD 1V37A 1OBOA 2WDZA 3F1LA 4UVDA 3WGMA 3AFOA 1TUGA 4AG6A 3UMCA 3L02A 3HCOA 3WK7A 5CT4A 4YAIA 3PEYA 2VCHA 3DP7A 1RQLA 4UM5A 2JGLA 3ON5A 1X1TA 2P7HA 4KFTA 4M0KA 2A9QA 3WO1A 3EW7A 5IKPA 1N57A 3REOA 3TZKA 4JBHA 4AP5A 1IMOA 1WZUA 5G1OA 1S2GA 3AEKA 1EQAA 2O0JA 1E7WA 1SCKA 3N70A 3OLCX 3SVZA 1R5BA 2ODTX 1W30A 2YVQA 2CL7X 3ASYA 2GB4A 3L4BC 4DLPA 4C7JA 3TSZA 2C4NA 2P1ZA 3SVLA 1N6OA 2WWVD 1NVTA 1XAIA 4N3BA 5E2IA 3IPRA 1F06A 1D6MA 3IUJA 3HB4X 3L6CA 1FY2A 5KTRA 1Z38A 4X45A 1WBJB 2OZLA 2YFHA 1IMJA 3JQFA 3NBAA 2PEYA 3UNXA 5TRTA 4MS4A 3ZWOA 2C7VA 1EEHA 3JARB 4KIGA 2R6ZA 5TXGA 4DNFA 2AS0A 3M1YA 4Q6WA 3L6RA 3QZUA 4HI0E 1OQAA 2V7GA 3GL9A 2Y77A 4HJXA 3P4UA 4KI7A 4PZLA 4TT3D 4WZAE 5AIBA 1YDFA 1U4OA 3D0QA 4ITVA 1FTWA 2AI2A 2W11A 4KODA 3GP5A 3VR4H 2SECE 2WHRA 4QBFA 4MLCA 1SU7A 5MGBA 4PG4A 2KPOA 1H2EA 4UCXA 1T4CA 4QHYA 2G0TA 4CG1A 4GVLA 5LXTA 3IP9A 4N5HX 3EG5A 4JEUA 5HFNA 4WVLA 3U26A 1AQLA 2H6EA 3NHPA 1UBGA 3QEMB 1IUNA 3L7CA 7MDHA 5ITZA 4Y1GA 3FY4A 4AX4A 2VZEA 3E53A 3ABQB 2QP9X 3ZD7A 1C1HA 1ABBA 3DOIA 5CA1B 2BR5A 1OLSA 1GNSA 3QQ5A 2A86A 2Y3IA 1S6YA 4IILA 3URMA 2R86A 1NJ8A 2Q2WA 2Q9CA 3EEBA 3IB6A 3QXGA 5DXFA 3GFSA 4PLCA 4XJXA 3Q9LA 3SBDA 5BQFA 3M82A 2J5XA 4GZMA 2DQ4A 4MAMA 4EY8A 4DEVA 1TLTA 3M81A 3PU6A 3NHFA 2H2HA 2R8OA 1B6GA 2EFHB 1J2EA 1U6JA 4ZALA 5LZ5A 1P45A 1MP0A 3TZEA 3JQ6A 1F8YA 4TLBA 1KZ7B 5E6UB 3WK4A 3A27A 4IZ6A 1WY7A 4TTPA 3AUXA 5IW8A 4P53A 5TGZA 1XZ8A 5K03A 3WYEA 4TXLA 2A3NA 1I4DD 2WA2A 4C1NA 3WAJA 3LHIA 2BV3A 3M5DA 3WMFA 4BKMA 3C5VA 1B6TA 1KBQA 1QG6A 4ZZ0A 2YOGA 4UREA 5AVSA 4A91A 2BUBA 2XXJA 4QLOA 4M0LA 4QT0A 1YZTA 2HV8A 2FUCA 4TOIA 1SCQA 3JVDA 4KXUA 4O8ZA 3JWGA 5GQSA 4PNHA 4MLZA 2FKAA 1TYEB 3W3AA 1GA1A 2QV0A 3W9BA 3LPLA 3P32A 5T6MA 2GTPA 3ZGNA 3DHYA 1N0UA 5AM2A 4BB9A 2IYEA 3T7AA 1NQOA 2B7BA 4JOSA 4NFHA 3PFNA 4RIHA 2AFHE 4LK3A 3DBLA 5BN5A 1DX9A 4D79A 5KTYA 4KNYA 4LC9A 4K6CA 1DIRA 2QN7A 4K5QA 4EB6B 4PG8A 1W9HA 4GS5A 1YBFA 4J76A 5HRAA 3IP6A 3GFPA 4BMNA 1S7CA 2KX7A 3MTAA 1LPNA 2XMCA 4O4IA 3OCVA 4FZVA 4M0MA 3VO8A 4DY6A 3TNYA 3BWBA 1V1JA 1ZIDA 2CJWB 2NYAA 2IZOA 2WG0A 3QYFA 1WUHS 2C92A 4DGQA 5C46F 1T6NA 2ATEA 2EWVA 1P4JA 4U4AA 4WI1A 1CR1A 1OPXA 1P4GA 1R88A 3DO5A 3A6LA 3V8VA 4MVJP 2WW8A 1J8FA 2WU1A 3AB7A 3MINB 5HILA 1SVOA 5C4MA 4KN6A 4YV0A 5DNCA 3IAS1 3IA2A 1E3LA 1Q14A 2W6JA 5JVDF 2VCYA 1C4KA 3KUUA 1GZVA 3FZNA 2O8CA 1OFVA 1DV1A 1GGVA 1REQB 3L6EA 4PAQA 3RG8A 3BXFA 5D7BA 2WIBA 3G7UA 2ZUCA 2EW2A 4NCKA 3V00A 5JDIA 10MHA 3L5OA 3DEIA 3EVNA 4JYZA 3MJCA 5IAKA 1QQ5A 2HQRA 4IVNA 3GGGA 5AOVA 2EARA 4JFAA 4R7TA 5AVJA 3KCQA 4BLQA 1MR3F 2O2YA 4PLWA 1IOZA 2CJWA 2YHIB 4EPWA 2A8YA 4X3CA 1WW2A 4NV3A 1FB5A 3C8ZA 2WLTA 4ILKA 4QUJA 2ZRDA 3NYQA 3R6GA 1UODA 3EA4A 4RM3A 4MV9A 2ZRBA 3HYTA 2IU3A 1VHDA 1D3AA 4FMDB 4KK3A 1WHSB 3ORFA 5E3HA 3OJLA 3M4YA 4ZVPA 4J0CA 5AKJA 4KXVA 1VJ5A 4URUR 2LIPA 3MVEA 4TUYB 3PXGA 1BCSA 1FFSA 4KSBA 3IEKA 2ZRNA 3LUGA 1O94D 1B3BA 3WIOA 1GUBA 4ZK6A 3UT6A 1VE5A 3BE5A 4Q3NA 3WRVA 3VVCA 1AD2A 3JARA 4B6PA 2NOAA 1ECCA 3AFIA 2NXEA 4IJWA 3KSZO 2EX1A 4UNIA 2DBVO 4BNFA 3M6FA 2ZTHA 3ZW9A 3R3VA 1V4VA 5TGTA 4G8CA 4BBPA 4CM3A 1YKSA 2ZUEA 2REQB 5L3SA 1J9ZA 4KX5A 1IRXA 3CZ9A 3TTWA 4KN8A 4LXTA 4MITA 4P33A 4X97A 2H9YA 3CRQA 3EDOA 1J8VA 4A2QA 2HSGA 4CUJA 5KHOC 4OHWA 3FYUA 1JP7A 2ASVA 3OHMA 4NV1A 4PWYA 4RVUA 3Q3IA 3DHWC 2C83A 2NTNA 1OX4A 1SPXA 1Z6GA 4WBXC 4W63A 3ED1A 3FM9A 2C5FA 3R76A 3RVNA 3VMFA 4PPFA 4HUTA 5FUYA 4V02A 3L40A 4AZVA 1M6WA 1PEAA 3ICVA 3CVYA 1PFYA 1RJDA 2XHZA 2RHHA 3B9BA 1PW5A 2OO7A 2V55B 3AVQA 1RYFA 2ZYWX 4IVQA 2F6RA 5FLEX 3JQGA 1YK1A 2HRCA 4X85A 3WTBA 3NXSA 1NXOA 2OBLA 3ZK8A 3H1TA 4D0RA 2GASA 1QIGA 2SKEA 4ZV4A 1SBQA 1XZAA 4LQCA 5D01A 4RZHA 2DFVA 4GPD1 4AF6A 1FNBA 2Y66A 4ZHQF 4TV9F 4BWGA 4JLJA 5FNZA 1OWOA 3R7DA 1VI2A 4F4JA 5EJMA 5EJ4A 5DU2A 1K5DA 3IT2A 3RRNA 2VNKA 4C05A 3H7IA 2I71A 5LB2A 2I2BA 2EIHA 5T6BA 1GGNA 3KLBA 4LE1A 1B8UA 2BTEA 2V7BA 4U7GA 3WISA 1HC7A 3C85A 3DZGA 2QVXX 3H4IA 5FQOA 2BI4A 4CI0B 3IVAA 1MOQA 3A4LA 3TLZA 4LYYA 2QU8A 1TIPA 4IH4A 2VPQA 1PS8A 2IUSA 2VDUE 4H3KB 2M6SA 4TT8A 5JNRA 2P4UA 1DC4A 1Z25A 3G8CA 1UKZA 3R9WA 5JE8A 3MBKA 4UDYX 4P1ZA 4EENA 3DL2A 1Z29A 3ZWMA 1X0VA 1FUUA 2F9MA 3KQYA 1NVAA 5DRYA 5IN5A 3VO9A 3LT4A 2RJ3A 2XD4A 2N75A 1JDPA 4W9RA 4FJ2A 4YLEA 5JBIA 3D8TA 4B44A 4N47A 2E1RA 2D4AA 4BKRA 4PX3A 4UM8B 4CHTA 2ZBGA 3KKNA 4RSHA 3EDMA 4CTMA 1B8PA 4WY5A 3BT7A 3PQDA 4ZT5A 5BV2P 4YR9A 3MJVA 4F86A 2D13A 4JB8A 4ND6A 2A35A 3UPDA 4OX9B 3OZ7A 4FGWA 4B3IA 3DLPX 1RJGA 3S2EA 2IXTA 1W85A 2UKDA 4RQTA 3I23A 2NLOA 4PX5A 4IZIA 4DLVA 3D6VA 3ICOA 1PR3A 4HEQA 1K0FA 5FTJA 1Q1EA 1QIFA 2VJNA 2C57A 1MV5A 2RH9B 2VHYA 1JA1A 1OYVA 2VNJA 3G68A 1W0KA 1Y89A 2BEVA 2COEA 2J85A 4OPMA 4ZREA 5SZHB 3HXQA 1WQ1R 2WY2D 1FIUA 5EHQA 3PDJA 3H1BA 4TYYA 1MGPA 3IKVA 1HFJA 2X76A 2DR3A 3ONDA 1F2TB 4QFBA 4EY4A 2BFOA 4M0DA 5K8VA 1AQNA 1RDFA 3DLBA 4LVUA 4I4TF 4PLVA 4JLWA 4KQ6A 4XWTA 1XEXA 2IYSA 3G79A 4B2IA 3DFUA 3C98A 3UWPA 2C1ZA 2ZXUA 3RUPA 1CRZA 4XLZA 4MW7A 3BJIC 3GLVA 4GVPA 4XE5A 5G0TA 2FFHA 2SKDA 5ALMA 2W9XA 3I61A 1O87A 4F4HA 1OZAA 3VNRA 2NXWA 1QYWA 2OVBA 3B2EA 4M9ZA 3M9WA 4GO1A 3ZY2A 5E6SA 3W2EA 2NTJA 2B35A 1BDJA 1ULBA 1XKXA 4Q1BA 1A71A 3PG5A 1IM2A 4TL6A 1BCSB 4FWBA 3AP2A 4UD2A 4ZT6A 1O58A 3G1TA 3HJTA 1ILWA 4V0LA 1GGJA 3WRXA 1M54A 2H31A 4L15A 1PKEA 5KMGB 3AVPA 1SKQA 3GLRA 3GR6A 3RBVA 4ZGGA 4MVJG 1AVTA 4LMPA 2QD1A 4P81A 1D2GA 1NT4A 1U3CA 2Q3HA 4HDSB 2FB9A 4KH0A 4RS4A 3QHAA 2NO7A 2P91A 2WHPB 4BCBA 4JOCA 1RJEA 1U9JA 5IBQA 4XYMA 1JR3A 2C5GA 1KK2A 3JCZA 4XDHA 4E94A 2H3EA 3L8HA 3NUQA 4FZ3A 4BLRA 3R2JA 5C7OO 1N3IA 2EJCA 3NU1A 2ZB8A 4QTZA 4WT7A 4YXFA 5KBYA 4JFRA 3HS3A 4OCZA 4D81A 1Q2UA 4KPUA 1NBAA 4F7DA 5KYTA 2YWEA 2QZSA 3I4CA 3FBGA 3RT9A 3VSDA 2PEZA 4XTRA 2P9YA 3A9TA 5FO1A 5CEFA 4I6GA 1GUDA 2XZTA 3EYAA 1ECPA 1QK4A 3CMCO 1U0RA 4DSUA 1YFLA 1J42A 2FA9A 2XUQA 4NNJA 1D4FA 5JYBA 2AEEA 3GMIA 1Z06A 1J5XA 3S8YA 2APJA 1X7XB 3E27A 2GVZC 3AG6A 3SQWA 2QRZA 1U2QA 5IC4A 3N53A 1W49A 3KJHA 3SEQA 1E69A 3GPDG 1Z4LA 3H87A 5JH7B 2HRDA 5TJHA 5IKXA 5TX7A 1B1CA 1GUYA 5L3ZA 3GCWA 5IJ0A 1MRSA 1V9LA 1YRBA 3QUQA 5AUNB 3QKSA 4JVOA 3TVTA 3VTZA 5GJBA 2H1SA 1P8JA 3FRJA 3KTDA 4KFCA 3CR3C 4OY3A 4HCJA 4LDZA 4ND8B 4EBFA 1NGSA 2G5PA 3WP0A 3QU4A 4XD7D 1GFZA 3REGA 4LZOA 3OIFA 2M1ZA 2OE2A 1I5EA 5AJHA 4D9IA 1Z5UA 4QJ4A 4H6XA 2AYZA 2Y4NA 2GD6A 4OMFG 2JLSA 4P36A 4L5CA 4V38A 3HVJA 5FHRA 3T9DA 4AJHA 5FAKA 5JJBA 4YPOA 3HDGA 3ENWA 3CG0A 4F5WA 2UVPA 3WAGA 4OKNA 3O95A 4PO1A 5EJIA 1HZJA 3FUWA 4YJFA 2J3MA 3LBFA 4BNXA 1Y82A 4YCAA 2AV6A 2PJDA 3RS9A 3GJ6A 3EODA 4BO2A 2IDZA 3JVVA 3DVAB 4E08A 1V7PC 4M9XA 1Z5PA 4UNQA 2HOQA 3ZS9A 2PT6A 5HUQA 4ZVNA 1YZLA 3B2NA 4YLYA 3U5ZB 1KMMA 1NXXA 3LCVB 3CZ5A 1EA5A 1QAMA 2YV5A 2FDCA 4FNAA 4A6PA 5IAJA 1Z0FA 2XNKA 5H4GA 2O59A 1HTTA 1ZI6A 2XNHA 1N92A 1S2DA 4EHAA 4PINA 1WULS 1H3NA 4MPRA 4D4IA 1COWA 2F3SA 1ZOPA 2OESA 2PVCA 2WKRA 1NUPA 4PQRA 3WIEA 4B87A 5JBNA 1G291 2GZDA 3DDSA 4E70A 5A02A 1GZSA 2OXIA 4LFCB 1ENYA 1H5QA 4REQA 3PCRB 1SIWA 2PX6A 1BVRA 3CF4G 3LYHA 5KTNA 4M76B 4JMLA 3EPRA 5HBRA 1SZDA 2C31A 4FMCF 3A9VA 3G5UA 3T4XA 3ILHA 3UAOA 1WV1A 1HLPA 3ZJVA 3MRSA 1LX6A 1UWVA 3K20A 2O0MA 2GHIA 2IZ6A 3KJGA 1NAIA 4RD6A 3RYIB 1D1PA 4ADSG 1ZISA 2UUPA 1F5NA 4A0HA 1AV6A 1GGMA 2BEUA 5EIBC 2I65A 3SK0A 2WKWA 1G2OA 1J2RA 2VBGA 2XVXA 1D1TA 1HE8B 3L0ZA 4QKQA 3E1SA 3H42B 2VDJA 3VGPA 4JGBA 2BELA 1KEEA 1LC3A 5F35A 1S89A 3AVOA 3F46A 5GADl 5CD1A 4LBZA 4Y2XA 4KBYA 4TPKA 3EVDA 3PQ3A 1E3JA 1NWCA 2JJQA 4IDBA 3O2JA 5C8YA 2JH9A 3TM4A 3TUJC 4OVKA 3ROKA 4Q9HA 3DZCA 3WQRA 1JQLB 2N47A 2WZCA 2BP7B 3BD6A 4LDJA 4DJJA 1L6RA 5CA1A 3STYA 1LRLA 1TZ2A 4U2CA 4V0NA 2OXRA 4X24A 3RC3A 3DBRA 4R1SA 1D2RA 4TTRA 3SOZA 4MO9A 4C3OB 4DQ0A 3MCWA 3IAM6 3R3ZA 3NS7A 4HQOA 2B1QA 2EKQA 3LAWA 4OFBA 3TW6A 4E03A 5JY1A 3P9ZA 1EBBA 1KY4A 1Y6JA 3MGBA 1T0JB 5FB3A 1J1ZA 4NVRA 2GHTA 4YCNA 4NXNB 3ZLBA 1NG1A 1E2DA 9MHTA 3FYCA 4X54A 2YXBA 3A1CA 1USKA 1IHXA 2ZYGA 3C1OA 1RRGA 2C9ZA 2DAPA 4EYOA 3INGA 1XWFA 3JYPA 1E2UA 1R7RA 1CW2B 4WXYB 3FIJA 4Q15A 3DEJA 2BHNA 1JGTA 2BFWA 2LKCA 4KO1S 16PKA 3DTNA 2IQ5A 9ABPA 1U8EA 2ZLBA 4MH0R 3BMCB 5F52A 1QU3A 1CVLA 1BHO1 4IIGA 2OBYA 1P5HA 2FGJA 3MTEA 5HJ7A 3EXFB 5KTMA 1S96A 4XPZA 2Q6IA 1V8OA 4OXYA 3JYNA 2PFSA 3PI6A 2JGFA 3U7FB 3L7NA 3K2IA 5AXDA 3TTUA 4BEWA 3HYLA 2P8JA 5C34B 4IY1A 2ERXA 3JZFA 4YRQA 4FFLA 3UZUA 3V1KA 2RI6A 5KSOA 4ZT2A 2BONA 5IX8A 1CY1A 3UJHA 3VKUA 1N5DA 4O4LB 1FVFA 1ZJZA 3GGPA 1KBOA 4I4TB 5TNXA 3RD5A 4NMWA 5CB4A 3B1FA 3T4EA 1ZW1A 4Q3CA 4UVEA 3P0IA 1ZONA 1K6EA 4D9GA 4P2BA 1SGWA 2IU6A 4HQFA 4UMVA 3PQCA 3GA5A 3UIEA 2PZGA 1S2NA 1ETUA 2O20A 3CGWA 5FJJA 4GUAA 3WDLA 3BJRA 4DR3B 3BIXA 3QTTA 2WHQA 1IK6A 1LZLA 2BM9A 1BMTA 2PX8A 2VDVE 3L7YA 4NBLA 1EPUA 4W7SA 2OV4A 2XCUA 4HFMA 2DR0A 3OMLA 2CLFB 2P65A 3KCNA 4D92A 1BA3A 1U7UA 4RVCA 5KYYA 2X1LA 2W2VA 2B2CA 4LNUA 1IC6A 4KQJA 1BO6A 1P1BA 4BCCA 3CLHA 4TWAA 5EWJB 3HVUA 3HJFA 5NULA 2Z8ZA 3FUUA 3PL1A 4OHFA 1JQ5A 2B34A 2EJVA 2ZVQX 3GT3A 5FOUA 3V48A 1FA9A 2CDNA 4QGBA 4V03A 1NUHA 2HN9A 2ZI3A 4B8ZA 3Q2OA 3ANNA 2W6ID 4IXWA 1CG6A 2FOLA 4NF2A 3SC6A 2VF8A 4HDNA 1TYDE 2VLBA 5CDTA 4Y6QA 1V71A 4RV9A 4Q7JB 3R3WA 4HAIA 3OO1A 3RNLA 3WLEA 1JQKA 4TZ6A 3WFJA 2AH5A 3SHQA 2I4OA 3OWHA 5G0WA 2BFFA 2L42A 2VRBA 2C2GA 3PFBA 4H6VA 3T34A 5LU9A 1Q7BA 2PUVA 3JYLA 3PPXA 3V1TC 4EW2A 1X1RA 4F0JA 1SZPA 3SLRA 3USES 1PQUA 2OZVA 1FSFA 1NLUA 1WB4A 5JOQA 6Q21A 4FTWA 2YRXA 4MUKA 4AL4A 4DOMA 3N0VA 3E58A 3QFRA 2FXIA 2KB0A 3QU5A 2X6QA 1FS4A 2H2WA 1QB8A 2XVAA 1G8FA 3IV6A 3IAS6 4OQLA 5ITZB 3H11B 2Q7OE 4MGIR 2FW9A 4HWGA 3AP1A 5DBOA 1LTKA 1NATA 4K05A 1QRTA 3HLTA 1YZFA 4NPAA 5C7LO 4K9DA 4ZRNA 4WX2B 1WUJS 5I8WA 3AF4A 3LFHA 1XZEA 2AG0A 4GZ5A 2CHGA 1ZUNB 3M6UA 3NBXX 1UOEA 2OZEA 2VJBA 3TRIA 4TS3A 1U65A 2LE0A 3N7AA 4GX0A 3FTFA 1UP7A 3VPGA 5A06A 3ADPA 4PHTA 1GSHA 2IOQA 4ZVKA 4WDRA 1YZVA 2JFXA 5M3BA 5BWCA 3IQZA 4XB6B 2HPVA 1K8XB 2FJ0A 2Q3CA 3NIDB 3O21A 1PR2A 3L8EA 2AX3A 2UYQA 4LEIA 3TVDA 4AYWA 2YQ4A 4D4HA 3R9XB 4JOBA 4FQ5A 3GP8A 1JI0A 2NSHA 3OG9A 1A9TA 1CC1S 5AI0A 1KI2A 1VOTA 1TMOA 3HQ4O 4KGXA 5D51S 1DBQA 1NVWQ 1Z8HA 5H4HA 1V26A 2HYDA 1O6FA 2VPYA 3LT1A 4WNAA 4DPMA 4QGSA 1VI5A 4ZANA 1V1MB 1E5DA 2IGBA 1TUBA 3K0CA 3PPWA 2A92A 4M86A 3JAWB 1IN1A 2ODNA 2JFPA 4PEVA 3MWEA 2JB9A 4XUEA 5ESRA 5C7YA 2R6JA 5CX1B 2VBFA 4N6GA 4OYHA 3H8JA 3HACA 1D0IA 1CUUA 4MRRA 3NFYA 1QGAA 3PF8A 3VC7A 1IJBA 2I8AA 4I3HA 4ESVA 1QIKA 1VCNA 3CPHA 1OFUX 2OCXA 3RFFA 4QXAA 5HF8A 2J3IA 4MQUA 5EUCA 1U3TA 2AUTA 5K3DA 4LKOA 5JWOA 4P92A 1RRVA 1VHLA 3GGSA 3H99A 3GXOA 5J2TF 5GVSA 3WGJA 5K0TA 3AESB 3DOHA 4R9SA 2EP5A 4LPSA 4CIXA 1KOFA 3F2IA 2VF7A 1N9ZA 5EE9A 4Q9KA 1QNLA 3EMVA 3OFJA 4Z1MD 3CKMA 3MWDA 3PEEA 2GJKA 3GRKA 3N3AC 4A7PA 1CUHA 1TF5A 1O97C 4QQFA 3SJCA 1WKVA 3W4JA 1YIAA 4MUEA 1VTKA 3OJEA 3HMKA 1BX1A 3IQFA 3LKVA 4GMDA 4HB4A 2MCFA 2M9MA 5TS2A 5LP6A 2VOJA 2G9ZA 1D6SA 3WAKA 3OI7A 3ORSA 2P3OA 3D4LA 1ZXXA 1IVYA 1Y3HA 4MA0A 4MQMA 4UHBA 3VBEA 1D04A 2QPAA 3HBAA 4J8PA 4XDGA 4AB1A 2EF1A 1EFAA 2PMDA 1T4MA 3FDZA 3N0XA 2GLTA 1SCDA 4XVHA 1NX6A 3OE7D 1H6CA 4UC0A 4YUWA 1JWLA 3ZLUA 3QV1A 5HKKD 2D3TA 1Q5PA 3KLPX 4GMXA 4KQEA 1PJLA 2BMFA 2F8SA 2FP4B 5F9HA 3IUNA 4EVSA 1E62A 1OA1A 2MDTA 4GLFA 3G82C 4IIJA 4M1WA 4UPVA 5FA5A 4CRWB 4CLOB 5IK2D 3KKPA 4B3XA 1M1YB 4F8JA 3I32A 3B1YA 5JSUA 2AK3A 2DTXA 2IYZA 3NDJA 3T5GA 4XIJA 2B61A 4RGVA 1GP2A 3IKLA 1EX6A 1Q21A 1QOZA 1JWBB 3W5HA 1T0HB 4ERNA 3P8ZA 1EI9A 5HP4A 2K4MA 1JFSA 4W1SA 2HQOA 2H0AA 4B71A 4LYHA 1IHDA 1TUEA 1WQ4A 3ITKA 4LXGA 4TX1A 3SFVA 1QQBA 1DAFA 3ICEA 1IRIA 4LOLA 3TVYA 2WMOB 3KP1A 4R0MA 2CMHA 4MUNA 1MDBA 2NT4A 4A5SA 2H1VA 1DQZA 2AG5A 2ONCA 1NF8A 2PGAA 4BLWA 4IRMA 4K0RA 1E6WA 4UBLA 5JROA 3DDHA 3R41A 3U3JA 3QE3A 5FWYA 2RH8A 5THXA 1C9NA 2C4MA 3A1UA 4Z3DA 2ZSHA 1F4PA 3NXKA 3CO5A 4R2MA 5FD8A 3X1KA 1QPZA 2BDTA 3LWDA 4NOLA 3HGTA 1EFPB 1HG1A 2H8GA 4JC4A 1ZSVA 4QO7A 1ZBDA 4IV5A 4BKOA 2VJAA 4KE9A 4YP6A 1XROA 3H5AA 1V11A 2OMEA 3GFBA 3JD0A 1MX1A 4U9HS 1ZK1A 3HV0A 3ZHXA 3DDWA 4JLNA 3U56A 1EVZA 3A1NA 2YHUA 2JBAA 1Z7YA 5KWEA 2BKXA 4YA6A 2WPDD 4L75A 4KPYA 1JPJA 5H9VA 3T7CA 3TB6A 3PPIA 4NE2A 2O5RA 3FZEA 2IVFA 2OGTA 3OZBA 4IX9A 4W82A 3HTXA 2HMSA 2A88A 3NONA 4G0OA 1JDVA 1DEKA 2X0NA 2JIOA 5J2UF 5AVOA 2H4ZA 1UPBA 2R7LA 1EK0A 3IO5A 5LQRA 3ZJTA 2JFHA 1E8NA 3DZ8A 3F1KA 2I4LA 2NO4A 5BSWA 4PNEA 1SUCA 1WXGA 2JFOA 2QN2A 1MB3A 3HBFA 2D2IA 4X6XA 1ODKA 1QOQB 3AQ4A 1PFWA 2EZTA 4UHKA 1M6HA 1SVWA 2UZ0A 4JKIA 3WGZA 1C8LA 1Z4PX 4RX1A 5FWXB 3LW7A 1L0BA 1W4RA 1OAOA 2ZQ5A 3AH8A 3P1JA 1ZMBA 2VZLA 3DAFA 4GWGA 4JI0B 2E0IA 2ZJ5A 3WKDA 1O0CA 2WFLB 1YDHA 2VHVA 3CUTA 1NMYA 1U1GA 3PA8A 4MMXB 4HEA1 4RVOA 5HGJA 3NHLA 3LT2A 2WZQA 5AW7A 2VXCA 4QAJA 1AKQA 3UK0A 3SX2A 4FHEA 3CX7A 3EF0A 2W22A 4WIAA 4DMKA 2J48A 4CIWA 3TKYA 4ERXA 4MW9A 4NENB 5K09A 1QCZA 1MD9A 5FFNA 1XJCA 3AYZB 3AVUA 1QC5B 3KHTA 4MRMA 2WYVA 4Q93A 3E7WA 3ORQA 4RHXA 5DNDA 2Q6KA 2P68A 3B5JA 1T1IA 5H7XA 3UKOA 1VSVA 4OK5A 4R68A 3RABA 3T41A 4C4ZA 3AF3A 5ALWA 5J1SB 2UUCB 1G2IA 2VPIA 4I3GA 5H83A 4X3PA 1KMHA 5DLPA 2DZDA 4F5DA 1IDOA 4YYEA 1P2GA 1KQOA 1QPGA 1HT1E 1RI3A 1ZM3A 3TPCA 4ENUA 4B3GA 4LHVA 4DRXA 2ZDGA 2DHQA 2W8BB 1A9XB 1O5OA 3EDCA 5K20A 3NLLA 4ZHQB 2DH6A 4Y2RA 4ER5A 4HH0A 4EY7A 4JXZA 1XEAA 1NVMB 3PL5A 4C30A 4XSGA 4DVGA 3VR6D 1YDMA 4RXTA 2GAOA 2JEOA 1U8YA 1JR3E 2Q27A 3WMRA 1UBHS 4BRUA 2SHKA 3ZZTA 1DQNA 4DR7B 2V58A 1B74A 5AKZA 5KI6A 3JZMA 4YP0A 2FZGA 3RIYA 1JHZA 4EFKA 2IPXA 3F9RA 4LCBA 1IY9A 1XZFA 2LTAA 3KBOA 3GPLA 1OPRA 4Q18A 5LKAA 3QG1A 1KKUA 1XJQA 2WAOA 4J3JA 4NMXB 3LF2A 3JQ7B 1UPUA 3UWSA 2GCPA 1RWMA 1DCTA 4YFYA 4YRJA 2BKVA 3PGVA 5LM3A 5B37A 5LKRA 3OQPA 5DM4A 4DCGA 4KK4A 2P3QA 1PT5A 1Y6QA 4A27A 1Y98A 1YRQA 2DOKA 5IJZA 3ZDXB 5A5FA 1FXWA 4CN9A 5B3LA 1ZLYA 1V8FA 4QYMA 1FSGA 5GOZA 2G1UA 1RIFA 4FHCA 4DS3A 1QRDA 5IAEA 1MRZA 3BMQA 3JQQA 4MQ6A 4KPEC 1TTPB 3R7NA 3E5NA 4DJAA 4XQ0A 1E64A 4JEMA 2WUVA 5DM1A 4OOEA 3LUDA 5G0VA 2AD1A 3WGIA 4MYCA 3C5CA 1O97D 1JHUA 3KPJA 4JI8B 5HS4A 4B8WA 2HC9A 1P44A 1GZDA 4FNGA 5TF4A 3B89A 4CKEB 5DIZA 1E3MA 1M83A 5ELXA 4RD3A 3TWOA 2AN9A 3DAGA 4AZWA 4I81A 2AFIA 4XCQA 1RC0A 4B84A 2FCAA 2H0RA 3GOQA 2I4IA 3RSLA 2JFZA 3AIOA 3UW1A 4YCMA 4MLDA 3HEBA 2IX3A 5FOWA 4IJUA 4PCVA 3K9NA 2IYUA 3U19A 5D3MA 2NU7B 1WNFA 2QT9A 2CDBA 4GWKA 2JBAB 5ALQA 1ONSA 3PVCA 5THQA 3GCZA 3IUYA 4QU0A 1YS6A 1UBFA 4U8HA 5CDFA 4Q1EA 1E9RA 3IAAA 4MO2A 2MU1A 5EQTA 4FEEA 3OT1A 4CT5A 3VSAA 2XMDA 1L5LA 3OEED 4E07A 1T1GA 5CA0F 4G2NA 1XDGA 3N0WA 3GRUA 4UARA 2VH2A 3S5UA 4PQYA 4LDQA 5IUNC 1CIPA 4CMAA 4IHQA 4ZQGA 3QHPA 4QNMA 1FJXA 3L1HA 4NZNA 5CH5A 1VPWA 2YW9A 4M6WB 4LC0A 5A4FS 2QR3A 1XNJA 1J06A 2XYHA 7ADHA 1ZK0A 1AGYA 1M7GA 5LP6C 3BD8A 1JR3D 1J0XO 2J3LA 4LY3A 4DG8A 2QJWA 3AMVA 1N2JA 4JGIA 4RVFA 3L07A 1AK1A 2Z8YM 3ZBPA 2HF7A 4QEDA 4E5PA 2M32A 1W8DA 2JGIA 2V97A 1ZKMA 2VG8A 1TPZA 2E5LB 4YQYA 1OW3B 4HNUA 3PJRA 4HNGA 3VYUB 1BAPA 2XNSA 4FFMA 4JCOA 4FZ5A 4Z4EA 4IDNA 3ZZUA 4B6EA 3R20A 1FP4B 3OAAD 2UZ1B 4M36A 1KETA 3RYFB 4H35A 3BORA 3BMNA 5EZQA 3ECSA 5ERYA 1C2TA 5GV7A 5F7XA 3HVHA 4EHIA 4MX8A 2NV6A 4QFMA 1Z15A 2C9DA 4WLEA 5KYYB 4JT8A 1KZ9A 3EARA 1D6JA 1G60A 1LLUA 2CY0A 2LCQA 1TMYA 4HVLA 2HH9A 4ZVVA 3BX1A 5KVVA 1MO5A 1RFLA 1TA0A 1Y4SA 3SSOA 1D2NA 5DM0A 4B3JA 1Z2OX 3ELBA 2ZWOA 5CD9A 4KLZA 5BW5A 1CB0A 2CSXA 3LNTA 5EP4A 2BJVA 5A5VA 5JYCA 3MGGA 3F90A 4ZVOA 5BN3B 2NWQA 2GJ9A 1W87A 1L3IA 2CLEB 2X40A 3A26A 5FKJA 1QM5A 4X93A 4HDNB 3E3OA 4WGFA 4QXPA 5CYGA 3KO8A 3IR7A 5CB4B 5D2CA 3OLWA 4KO8A 1SBYA 2H2DA 2GPBA 2VWGA 1MORA 2EFJA 2UUOA 4NPHA 3BF7A 3T0FA 2VJMB 1B2LA 1ENZA 4HFJA 3CSSA 3U3ZA 4UPDA 1KTVA 3FBWA 3T3OA 2XAAA 1W73A 1EM8A 4WFKA 1GRCA 2FZCA 4LNUB 3ILYA 1MNAA 3UMGA 2JI6A 2WNIA 4RFSB 4PIMA 2XHEA 3FOWA 1U6IA 3S8MA 4M1TA 1ZI8A 4RH0A 1USWA 1RQ2A 2MSLA 4NC9A 1TZJA 4H7DA 4ZXFA 3P20A 1WCIB 4PNZA 1D0VA 4IGFA 2R0QC 3AFNA 3IUBA 3EFBA 3UQZA 4RGQA 3GVHA 3HUTA 3S55A 2GMWA 3D0OA 2DSTA 4DPLA 4LV8B 2VRNA 5BY2A 4GM1A 1RPJA 4KJZA 1WEHA 1OUMA 3I0NA 5JSFA 1VHWA 3AK4A 4I5FA 2HB6A 4IH9A 4AMUA 1Z17A 2PH5A 3PQFA 2E55A 4UDNA 1CRPA 3KJZA 1E92A 1KS2A 1HPLA 5KJEA 4B33A 1E2JA 1VIMA 1RXWA 3ONVA 3AY0A 3LP6A 3PX7A 5FI1B 4GL2A 1Z5VA 2R00C 4M99A 5D3QA 5DSTA 3AR5A 1IJEA 3FFAA 1ZN7A 3BFJA 4KWHA 4E1VA 4ZO4A 1F7UA 3QKTA 5H70A 1GLGA 3WNBA 3ESYA 1AM4D 2H06A 4PQGA 1GSAA 4MP8A 4GOOD 1QJ4A 2LXNA 4XWOA 3ZHYA 1T4BA 3H4TA 1SCUA 1Z26A 3E1KA 3PYMA 1G9XA 4IZOA 1F8FA 2Z5LA 4TZTA 4I4TA 4P38A 2C1EA 2OL4A 1ODJA 3K1AA 2Q45A 3L41A 5JS7A 3KQVA 4J2TA 1NI3A 2ZI7A 3J7TA 1MO6A 3DWIA 1W0KD 5BXYA 4Q39A 1SKYB 1T3TA 1JSRA 3JWIA 3OUUA 3QMMA 5FLYA 3L6OO 4BRZA 1EWTA 5DNEA 3RS8A 1QXSA 4BV9A 4W9NC 4RZQA 1UL1X 3TSYA 3TL3A 5KX5B 2NZUG 1Z4QA 1H2WA 2AR0A 1W76A 2WG2A 1OTHA 2D1QA 4QRDA 5J47A 1DAHA 4PZ0A 2DPLA 2WSLA 1WF6A 4P4UA 3ZLTA 5LC1A 1QO0D 1S3SA 4RKRA 5B1SA 4RVGA 1U81A 5CFRA 4F3YA 1I7DA 2BFAA 2O8EB 2RARA 3KFVA 4FFVA 2DPYA 4NMLA 3EDQA 1AGRA 1C2YA 2FPSA 3JQAA 4MVJA 3IDQA 5AOAA 5EIOA 5A4JA 4G0YA 3PNPA 1R16A 4OQPA 1H2ZA 2W70A 6ADHA 3GQVA 4FM9A 3FZGA 3K7EA 4Q21A 4BMXA 5AHWA 3HFGA 1KL7A 3B52X 5LYYA 1OWMA 2W43A 3BFKA 4ER6A 3JZDA 2OYCA 4RHFA 2JFBA 4C7XA 3N5KA 3EZLA 3M5WA 5TPWA 1WMSA 4H1HA 4KTVE 4DQXA 3OTGA 2XT6A 1WCYA 1SBNE 2G67A 5GJVC 3KYCA 2H48A 3SZUA 3BGWA 3CEAA 4OXNA 1GDDA 1CVRA 1PYGA 4EFMA 4MJ7A 5AVVA 3GUVA 2PUFA 4A23A 1QCCA 4LJ7A 1L7DA 2EG5A 3NAMA 3HO1A 5H0IA 4XIGS 2GK6A 4WECA 1B8OA 2VA8A 3OSZA 1PV4A 4IFBA 4YRAA 4IIHA 5EUMA 2AWNA 4HDKB 1QSGA 2IEDA 1I1QB 4I66A 5CBKA 2Q2NA 1Q1GA 4IMRA 2ZXEA 3KEFA 1A7UA 3UUEA 3W7VA 3H9EO 3F8WA 2P5SA 1FRNA 3E82A 3Q6MA 5AKLA 3KT0A 5JMPA 4YP5A 4C88A 1J99A 2FEWB 2J6BA 3K4HA 1NQAO 1OZFA 4KRXA 2ZKIA 2WF8A 3FBTA 5BT8A 1T5BA 1BC5A 4KXMA 3ESXA 3U4QB 5HZKA 2GAJA 2LW7A 1YD7A 2AWOA 5D00A 3EXG2 3UWMA 2G4VA 3IOYA 5E9WA 4CU5A 3E9DA 1P9OA 2V7TA 3O4HA 4JBLA 3RC7A 4BQNA 2AEJA 3OIUA 4GYYA 4OXXA 1HLGA 3OKFA 2V9PA 4DMRA 1ZM7A 1XZDA 2H4YA 3QKUA 2BKEA 3ACCA 3H4VA 5DLEA 2ZYSA 3QH4A 4LYFA 2WTUA 2FVYA 4I8IA 2P6PA 4ZCSA 3U1TA 4U9UA 4ZVQA 1SURA 2ZJAA 3AY6A 3DWEX 2FW0A 3BMOB 3RSQA 5IABA 1R5OA 2AN3A 2PR7A 4ZT7A 1G20A 4CLDA 1E98A 3UG6A 4Q3EA 3VU1A 2G7ZA 4B2YA 2NAFA 3U62A 5IWAB 3Q7PA 2Q3FA 5LMZA 2VAVA 4ZVMA 1U2DA 2AN5A 2G40A 5LQJA 2J6CA 2W4MA 5K2MA 2WINI 3GLIA 4PYNA 4UBOA 2V0GA 4RE5A 4B6FA 4CL0A 1YR8A 3PFFA 4K46A 5I45A 3COJA 3ZGVA 4R1NA 3S5JA 3WA7A 4A8TA 2VYNA 3FVVA 4XOUA 3EEIA 2ZSAA 3NCTA 3IBCA 1ML3A 3ITNA 5CURA 4Y18A 3ZK9A 3P2OA 4WZBB 1O95A 5CA0A 4C0XA 2FHPA 2PGNA 4KXLA 2R8EA 3LP5A 3BMCA 1YKGA 5IFLA 3IQIX 2NP6A 3KXKA 2XF2A 3EIUA 3VPDA 3ZV7A 1JR2A 4X7MA 3R9IA 4Z9YA 2NTYC 3TH5A 3EULA 1TA4A 1DQPA 5C4GB 3UUWA 3CX3A 5KOYA 2VK1A 3GN2A 3SQDA 4B1FA 1FNMA 3WJAA 4C21A 1QYIA 1R4MB 2PL3A 5EXSA 1FQKA 2OD9A 2AEMA 4A92A 3W6ZA 1PSWA 3UMJA 1A8PA 2JJMA 1TL7C 1XRRA 4BN5A 2RGXA 1GO2A 2I5PO 4ZVTA 2Q9AA 4C4RA 4MKHA 4DMFA 1XZGA 1T1JA 2EIXA 2QRKA 4I8XA 4DLTA 4N3AA 5C3MA 5CGZA 3N2GA 2BGIA 1QF7A 3HCFA 1TF2A 2ZTMA 1XLVA 1I51A 1P7CA 4DNOA 1ID1A 1JPNA 1N5IA 1D2MA 1ESDA 4P08A 2XXAA 2CEKA 4TTIA 3GLGE 3C16C 4J1QA 3L0SA 3HBJA 4DQVA 4EG6A 1SQ0A 3CEMA 4BNDB 1H2HA 1JQJC 2PL9A 5CT6A 1UUFA 5FYDA 1WS6A 2ECOA 1DAGA 1L7QA 1PJSA 1FU4A 3FCYA 4RUKA 6AT1A 2H63A 2B36A 2ORED 5T8KC 3JQAB 4BQOA 1MAWA 2R97A 2YFYA 4EJMA 1UBOS 2ZAOA 3OCCA 5BOSB 4EB3A 4EUFA 3VJKA 2ANBA 4RDXA 2UYHA 3OO0A 4Z9BA 3GLHB 4I4NA 4KSYA 4RA6B 1R27A 3OJCA 4HG2A 3V4FA 4OGLA 3HP1A 4Z7JA 2XECA 1NXWA 2O7VA 4YRLA 2GI4A 3HR8A 3R40A 5EYPA 4BMOB 1FFCA 2JZOA 3R4CA 1G4AE 3SHTA 3AGQA 5I7OA 1IQUA 1KEEB 5JAHA 1V5GA 2GARA 3R6DA 1IY2A 5EHZA 2O5CA 1CLUA 4KAFA 2FK7A 2FFRA 4RLHA 5FPQA 5TT0A 1V3UA 5L6LB 3JYHA 2XKJE 2Q29A 2F55A 2QU7A 2YVAA 3N28A 4HAVA 2FSVC 3KTAA 4YASA 1ADYA 2EBWA 3GA7A 3H05A 2HU2A 1DBWA 1QZXA 2O5VA 3L49A 4DV0B 3ND9A 3R3JA 4AT1A 3K30A 4J3FA 4QG7A 3EVZA 4UM7A 1ELOA 1NU8A 2IUFA 2IZ1A 4NZOA 5ECDA 3D2LA 2YX1A 4JBYA 2I3GA 3GOHA 5I7WA 4FGJA 4INJA 4YJ2A 1NVXQ 1YA8A 1OB2A 4YR7A 4DLYA 3N2LA 4FSXA 5INTA 5KU1A 1NPYA 2YIMA 1I6MA 3OT5A 4RDCA 3DT9A 2GNOA 2W2KA 2X0FA 2ZATA 3K9FC 3KOYA 2HGZA 3IBGA 3T3GA 3ZZ1A 2MSKA 3VHXB 3WMGA 3KC2A 3IDOA 2QN6A 3Q6IA 4H1UA 2D59A 3I1IA 4HWRA 4KMRA 2O2HA 4V2UA 1KXJA 3NVDA 1LTHR 5IBRA 3ETJA 1QYCA 1FW8A 1XTRA 7AT1A 5AK6A 2FZ5A 4KJXA 4AZ0B 1JAHA 8OHMA 2G6TA 4TWRA 3AY3A 1FUEA 1PIWA 1VZ2A 3H3FA 3IVCA 1SXJA 1C7JA 3WMXA 4LZNA 1EE1A 1HRKA 2HDOA 3WV5A 3S1AA 1SKAA 1XVAA 4IL5A 2QZJA 2X8WA 3PXDA 4FI3F 2VAPA 2G5GX 4BEVA 3QG5A 2ZR9A 2GRAA 3R7SA 4F60A 4W5RA 3OE4A 2W0MA 3CZCA 3F6SA 3P5BA 3ENQA 1E0JA 2CLSA 3I6ZA 4BTEA 1G5FA 1L1EA 3HY6A 2YOHA 4R69A 3ID6C 1ZC3A 3QEJA 4BV8A 4QVIA 3U6KA 3MN1A 3PQEA 4GNRA 2PNFA 4I5EA 3TLMA 2E21A 2IHZA 1WF3A 1FFEA 4EATA 1YUBA 2HJHA 2J45A 2PKCA 3A6HA 2WRZA 4R9RA 2P9QA 5F12A 4C2UA 2AKAB 4LRYA 1R00A 1IE3A 1RYZA 2WMYA 1U5BB 1MIOB 2DCUA 4BZZA 4O5OA 2EFYA 3H9QA 3LV8A 2GXQA 4IHJA 5L40A 3DHVA 3HKBA 4MW2A 5AOCA 4Z0HO 4CMIB 1HDYA 3IEUA 1HXHA 1Z3IX 3L18A 3HB7A 1UC8A 1H8HA 2NVUA 1T91A 1EVKA 2Y1CA 4AIIA 4CM8A 1BTOA 1KH3A 4R2KA 3ZWYA 2X5KO 3OFND 4JJAA 5G4KA 3SYRA 1B0AA 1KEVA 2Y05A 4ND2A 4TV8B 1V2HE 2GBCA 2QM7A 1O0SA 3MAGA 1PGJA 1UJ6A 1R0WA 3B9PA 2GXSA 2O1WA 1MZVA 3G85A 3NHKA 4ZAXA 4ZV7A 3PHHA 5IZ4A 2WDPA 4GP9A 5KS2A 1UBKS 3WDMA 2FLWA 1MMFB 3GRVA 1L4NA 3THWA 1Z18A 3N39C 2VDLB 3VNSA 2A4KA 1QIMA 1TUBB 2Z2XA 2C4UA 2ZB2A 4F3RA 2OWDA 2DUJA 1JAIA 4ZEXA 4JQZA 2N1BA 3CNBA 2VAXA 4NCNA 3BZBA 3LHDA 3OZTA 3FPEA 1LVUA 3QF4B 4ABTA 2X86A 4WA7A 4KQ1A 4PM4A 3FHTA 3CEJA 1I8TA 5DTMA 4QLAA 4PYKA 1I13A 4EG1A 2NO0A 5A2GA 4A0QA 3MOGA 3UKJA 3FLBA 4CMJA 4TS1A 2QLJA 4J43A 5C5IA 3NBZC 2XGGA 3FGOA 2RAFA 5HQ3B 4KHPB 1EG7A 2CLOB 2PRIA 3OJXA 4YCDA 1U0FA 1MG5A 3AW9A 3BGDA 3GK3A 4FOLA 4PZAA 1PSDA 1XLWA 5AVKA 3SQNA 5BW8A 1I10A 4H7IA 5I9SA 3PUZA 4YTEA 4I9UA 4Q48A 4KGVA 3O94A 2FK8A 2RHJA 1HKHA 4YC7A 5CT9A 1RACA 1DOHA 5CK4A 1ZVJA 3E05A 3A31A 1G8YA 4OMUA 5FBQB 4DNQA 4JNCA 5EKTA 4CG3A 3N1UA 4LTNA 2CL0X 4GRIA 5ICSA 2W6ZA 3HU2A 3M9LA 5BYKA 2JGMA 3QF4A 3RUDA 1U99A 2GZAA 3KPVA 3WTCA 4RIEA 1KGDA 1NW5A 3PNBA 4H3SA 2PMBA 2QGZA 5DTEA 3LCUA 2B8JA 2FN9A 5CH3A 2DBZA 4F97A 2C3OA 3KXIA 1OGIA 1PV1A 1KC1A 1YV9A 3FCSB 2XYQA 3AVTA 3SIPA 4S35A 2NAPA 4DF3A 5EFOA 3JQFC 4LCJA 3BTUA 3LHSA 4R2JA 5EVCA 2WB2A 1Z2EA 3E70C 2QVBA 2QN1A 4BJ3A 4E4RA 1T4DA 3DLAA 4I6JA 4U7FA 4YT4A 4OJNA 4CL8A 3V4OA 1N5LA 1EVIA 1JAXA 3BH6A 2CNWA 1A4IA 1MQ9A 2XWSA 1AB5A 4MSUA 1XCLA 5ICCA 2AOVA 3D2AA 4HC4A 4XA8A 4BUJA 5JNLA 3P4YA 2R79A 3QBDA 1LVGA 4I19A 1F2DA 2WWIA 1KYIA 1J5PA 4UD6A 4BWFB 2OR3A 4UNPA 5J5VA 4PVDA 1I33A 1WVGA 2ZCUA 4GSLA 2BWJA 2VUIB 3M70A 3CUKA 2ECQA 3UM9A 2B7LA 2JK1A 3P52A 2UZAA 2HSEA 1O08A 3DUWA 3HCWA 2XE4A 4FGLA 4MPDA 3ZDYB 1B15A 3AF1A 4BNWA 3GUYA 4TWBA 5JSHA 2G06A 2FPOA 3SJAA 1FRQA 3N3BC 2QG6A 5DCYA 2HNKA 5LQDA 1TGVA 3NYIA 5K4GA 2QWXA 4JI6B 4JYPA 3C8HA 1U2RA 5YASA 2P6NA 5DYNA 2HU8A 3IUQA 3THYB 3X2EA 1KU0A 4QQRA 2OILA 1UBRS 1QP0A 2P9HA 3HDJA 2ZOSA 4CLEA 2B5OA 5TQJA 3LKBA 5CNKA 4BV2A 5FCDA 4EHLA 4F4CA 5ENVA 4RTSA 4C0SA 1XJWA 1YACA 2AMLA 3VDMA 5F51A 2ADOA 2R8PA 5IC6A 1ZAYA 1RJFA 2Q4OA 1M1NA 3F9CA 1QUEA 2VZ8A 3UJNA 4QOHA 4YO8A 5ALGA 4A5OA 4Q82A 4JJIA 5TB5A 4A03A 4ZOQI 3GMDA 3CLTD 4F45A 1LX7A 1WPGA 1VJ1A 1XZPA 2ZG6A 4JIMA 3BK7A 2IKQA 4PSCA 3W6PA 1WD5A 4CKXA 3L6UA 2J0EA 4DA0A 5JJKA 5JO0A 1V39A 1XSEA 1NW9B 2C98A 4UE3S 3TOVA 4MRNA 4DHWA 5KOHB 4D26A 4CQMD 3GLKA 4YT5A 3GQBB 4KLCA 1N5MA 5J4VA 3GUCA 1YVEI 4QA9A 3PLNA 5DCUA 1UPCA 5HFJA 2BSXA 3H5RA 3ABOB 1GPKA 2QDKA 5U9CA 1YC2A 2CBZA 1QH8A 4RVNA 1A8IA 3QSGA 3F7TA 5DYWA 5CLHA 5AJVB 2JARA 3C6ZA 4FYXA 4AY5A 4K9OA 3EAGA 1DT5A 3K2EA 2AK2A 4FYIA 5K7SA 2ZREA 4XUCA 3IILA 3ZZ0A 4QELA 4BNUA 2EG9A 3I6MA 1RSZA 5ARDA 3TNJA 4WK6A 3VOTA 2WYWA 5KYXA 2D4HA 3SS7X 1R74A 1EAYA 2I34A 4C4AA 4RK4A 2IEYA 1SU8A 2O1XA 4JLVA 4ZVUA 1OH6A 5KDLA 4QC2A 1EAMA 2HK6A 4G2TA 3ZNNA 1OXVA 2GAAA 3H84A 5E7JA 5LIPA 4IWXA 2Y1FA 3NQ41 5A9SA 3D8NA 4MV0A 5I9TA 1T2AA 5GIPE 1Z75A 2R8ZA 3VAYA 5DLDA 5DX8A 2QRUA 1JS1X 1O89A 4OIMA 4WOCA 2B0CA 1B0PA 4GXRA 1FFHA 5DBIA 1DFIA 5CAEA 4O33A 1EFRA 2FQWA 1AOXA 2Q1XA 2V0NA 1D4ZA 3B5EA 1KQNA 2ECPA 3VH1A 2Q7DA 4ECEA 1U1CA 1E3TA 5HRUA 1DQRA 3ZWPA 1BVUA 3CE9A 3D6HA 4B4UA 3TDMA 4FLFA 1GM5A 3L9WA 3AERB 4C01A 1EFLA 1SKUA 2WV9A 4MYDA 1YSCA 1GLNA 1T9HA 2CE2X 1Q0UA 3E3NA 3UJDA 1NY5A 1Y9JA 4QTUB 1ZM4A 2X0RA 4WN9B 4ZO9A 2NXCA 1GNQA 3LW8A 3NZEA 4UHHA 4Z4HA 3IEVA 2Q5IA 1S01A 4ENPA 2RGNA 1CLEA 4FIZA 4R1QA 5A0TA 3QEAZ 3F4BA 4MDHA 4GSYA 4BUZA 1YC5A 3ETEA 2QJRA 3KFXA 2WWYA 3NDIA 4U5QA 1DTWB 3O8QA 1KO5A 3D4OA 4RIGA 1EXNA 3RQSA 2O7RA 2LUOA 3O38A 4FUQA 4FX5A 3UJCA 4AVYA 4D02A 5I4KA 4EB0A 2IXBA 5C5EA 1EWRA 3Q10A 4RWZA 4MV7A 1S3GA 2HD4A 4NL4H 4RESA 2OV1A 3VNAA 1KDVA 4NARA 3WZ2A 1GTSA 3E8SA 4F4DA 1WZCA 2JJ2A 2FFAA 2IU4A 1GRRA 2W71A 3A6JA 2LBPA 1QHXA 1MAAA 3KUDA 4FFRA 5BR1A 2VDOB 3TLAA 5K0NA 2YFQA 4JQSA 1S4MA 2L17A 4KIFA 4R6XA 4LYGA 5BSVA 2W37A 2CMGA 3RAPR 3C3WA 4E2ZA 1A5SB 3I28A 3LL7A 1MPTA 3E84A 5DP2A 1OLUB 4AF7A 4RLSA 1FNNA 4WZZA 3K0AB 4JZYA 3H75A 3VUFA 1N34B 3CUWA 1HYBA 4FFNA 1NBEA 4UM9B 4XFKA 2JIDA 1E6KA 1JG6A 3PYXA 2Q1TA 3RFCA 4W9MC 3OEWA 1E6LA 3A25A 3E9EA 4N5LA 1E9FA 4I9FA 5TPZA 3SF8A 2W8BA 3MTIA 4EUHA 5LMCA 1SBZA 1ZGZA 2NQ2C 5F5XA 2ZE7A 5DI3A 1Y3BE 2HCFA 4L1KA 2C0QA 1C1XA 3P7MA 5BQOA 4R1MA 3P9KA 3A4IA 4GX5A 1JMKC 1HEIA 2PRZA 4MW6A 4QPZA 4JITA 3VZQA 5B1DA 4INZA 2JDIA 4K6GA 3PLAE 1XRPA 2ZSIA 3ZPXA 2OO5A 1BD3A 3V4VB 2IYNA 1JH9A 3FHCB 4NS1A 2AOXA 2HHLA 1ONPA 1JJFA 1JQ3A 1M2GA 2G1JA 5C8YF 3K70B 1J2TA 3B36A 3BFPA 3QE4A 1SU6A 3EW9A 3HV2A 3KQQA 5KSWB 2JCYA 3IQEA 3ORRA 1FJ2A 1CY8A 2EATA 3WHIA 3WZMA 4BVJA 1LS6A 3TDKA 1KMQA 3D6JA 2ZRQA 2H7YA 3BVPA 5JNTA 2ORWA 4G4SP 3CJRA 1SUFA 4XQGA 2OECA 4GEKA 4W1RA 5ICEA 1E7MA 4BNDA 1BH2A 2Z1NA 3F5QA 1GGEA 2GBLC 3M49A 3ZJ5A 2FMFA 2DKOA 2PS3A 1BGXT 1K6XA 3HPRA 1M1YE 4KZKA 1YVPA 3WADA 2LNDA 4TV8F 4CHGA 2HSJA 4C2AA 1HT3A 4BAZA 2HR1A 3CC8A 2E4AA 2OHFA 2COKA 3CJTA 4PAOA 1F6BA 1XTBA 2OCIA 1L5GB 5DHRA 5C53B 3PCTA 1GIAA 1WUTA 2SICE 3IAHA 3MMZA 1BFKA 5KMGA 1JFTA 3GV0A 5A4KA 3GRPA 4GT1A 1CYDA 3VR6A 4B83A 2JAQA 1JI3A 3LECA 4IF4A 1F4VA 4PC3A 3ROXA 1SKYE 3I4LA 1PI3A 3FNHA 4UZSA 2KBFA 4M2LA 1YOBA 1QNFA 1EFHA 4WXMA 1KI1A 4CKWB 4OB7A 4YAWA 1CULC 1DRJA 1FP4A 5CEEA 3NHYA 1RPAA 3VZRA 2D54A 4EM6A 3KXLA 3O8DA 5JMOA 4G5XA 3OD5A 4HAZA 2YTZA 4H27A 1E2BA 3TRJA 5K01A 5G02A 2P35A 1YGPA 3STWA 2RAUA 2YV1A 5DGIA 1CR4A 4KMMA 2ZZMA 3JRWA 1P81A 3QEOA 4RTOA 3D8UA 2VQDA 5C80A 1BA2A 2GYWA 4X84A 3PD1A 4YT2A 1L7VC 1H05A 2WUEA 3NC4A 4UNNA 521PA 4L8LA 3OOSA 4LTDA 1MKYA 2DQKA 1XTTA 2VJLA 4H4EA 2LIVA 1ZJJA 2VSNA 1G5PA 3MCZA 2D2XA 2OENG 4II7A 3TSCA 1VPDA 4H60A 3S70A 5B1YA 3EGXA 4GMGA 5JZBA 2WA1A 2HK7A 3EEOA 1PZGA 3L84A 4XFDA 2C2KA 4B31A 4CKYA 3AG5A 4OA8A 1NNUA 1QF9A 4FS8A 4JU9A 4L0MA 2OLJA 2ZIAA 2D2FA 2X6TA 3GEEA 3V4LA 1P6UA 3ZV6A 3EK2A 2TMKA 1JBKA 4JP3A 2I1VB 5FR1A 5EP3A 4L08A 1CDEA 1FK8A 3H1EA 4Z0NA 4UDXX 4J4HA 2IV2X 3D5EA 1Y1PA 3GNQA 4LGMA 2ETVA 3O92A 2DKNA 1SWVA 2B2XA 4O8CA 3VOAA 5KNDA 3V6LA 1W2WB 1GQRA 1ULHA 2RG7A 3FZYA 3QMPA 3ZBQA 2HADA 3EPLA 1MHTA 4RTLA 5JTUA 4C20A 3OBBA 4CGZA 3EVAA 5CT8A 5CXXA 4F9GA 4WOJA 3CW9A 1RJ9A 1H4QA 3EA0A 4MV8A 4GQBA 5I4BA 4L4RA 1QGZA 4BNTA 5TSDA 3ANTA 4E7PA 1P9LA 2POQX 4AG3A 1IBKB 3SJBA 4GYWA 1PZHA 2DYKA 3DXFA 4JWTA 2LP4Y 2XSZA 1FRVA 1YZNA 3NPAA 1KKMA 3NTOA 4N3GA 3LTNC 1XDSA 4ZAVA 1VRVA 2QQ5A