3JWGA

Crystal structure analysis of the methyltransferase domain of bacterial-cthen1-c
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
200
structure length
195
Chain Sequence
NLNQQRLGTVVAVLKSVNAKKVIDLGCGEGNLLSLLLKDKSFEQITGVDVSYSVLERAKDRLKIDRLPEMQRKRISLFQSSLVYRDKRFSGYDAATVIEVIEHLDENRLQAFEKVLFEFTRPQTVIVSTPNKEYNFHYGNLRHRDHRFEWTRKEFQTWAVKVAEKYGYSVRFLQIGEIDDEFGSPTQMGVFTLGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyltransferase type 12
publication title Structural and biochemical insights into 2'-O-methylation at the 3'-terminal nucleotide of RNA by Hen1.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Transferase
total genus 63
structure length 195
sequence length 200
ec nomenclature
pdb deposition date 2009-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08242 Methyltransf_12 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3jwgA00
2ZBRA 4Y2HA 3OU7A 3E7PA 2Y1WA 4M38A 2O07A 5CVEA 3EVZA 2P35A 1JTFA 1RI1A 3KQWA 3M4XA 4BLVA 1NE2A 3G88A 5BP7A 3RODA 2FYTA 2P8JA 3O31A 3G2MA 1U2ZA 2IDJA 2JHAA 4RX1A 4KRGA 3I9FA 4PGHA 2HNKA 3FUVA 3JWGA 1TW2A 2YXLA 3OZSA 3KQYA 5HOQA 1VP9A 4RWZA 1O54A 2H00A 5FADA 4RTJA 2IBTA 2BR3A 3NMUF 3DXXA 2NXNA 3SVZA 2OB2A 3KQVA 2OB1A 2UYCA 3KR1A 2ZIEA 1QAQA 3LDFA 4QDKA 5BXYA 4OA5A 3GRRA 3QOXA 5EZQA 1KXZA 1VBFA 4O29A 3I53A 4FP9A 1IY9A 2HR1A 1ZG3A 4KIFA 1L3CA 2AVNA 2EFJA 2VZ9A 5GOZA 3QOWA 4YUWA 5CIYA 4PIPA 3HM2A 2ZVJA 2P40A 2I9KA 5C1IA 4RTRA 2GLUA 2OY0A 1JQEA 1UFKA 3UFBA 3E8SA 3P9KA 5CVDA 2PSSA 4LWPA 4PYIA 5EGSA 5CVUA 3IYLW 5CVVA 1YB2A 2WA1A 5HZMA 2BM9A 2XYRA 3BGDA 5K0CA 5LQNA 3A7EA 5DT2A 5E9WA 2Q41A 4FR0A 4PYQA 1RJEA 2GPYA 3B5IA 3JWIA 2ZZNA 5KQSA 3PT9A 1PRYA 3D2LA 3R24A 4HRAA 3V8VA 3GRYA 3SXJA 5DTQA 5BW4A 5DX8A 1D2HA 1XJ5A 3RW9A 1G8SA 1G8AA 3GRZA 4RVDA 3LHDA 3V97A 4XUCA 5FUBA 5ICFA 4DMGA 1X19A 10MHA 4FS8A 3SSNA 3TM5A 3ME5A 3HCFA 3R3HA 5EEHA 1PJZA 4B17A 5EEGA 2C7RA 2N47A 2Y1XA 1R00A 2ZIFA 3DULA 5E9QA 1DL5A 3DOUA 4ER3A 4E2WA 1NT2A 4EK9A 5ICCA 3KPVA 1I4WA 4CXMA 5LQJA 1Q0TA 3GNLA 2OPBA 5EKUA 4R8SA 2ZBPA 2BR5A 1VQ1A 2GS9A 4HSGA 4YUVA 5T67A 2JHPA 4AZVA 3DLCA 2ZSUA 4A6EA 2JH8A 5M5BA 3JWHA 2NXCA 5FA8A 3LKZA 2QE6A 1N7JA 4E32A 3B7PA 5MHTA 4V0QA 1O9GA 4G56A 1KYZA 2QRVB 3JWJA 4CTJA 2G72A 2BH2A 4Y30A 3CVOA 3UJ6A 4IWNA 4DZRA 4DQ0A 3QV2A 2UYHA 2PGXA 2V7EA 5ICEA 3MCZA 3NDIA 1ZGAA 5DSXA 3R9XB 5FULA 4C03A 1ZHFA 4E2XA 1L1EA 5GINE 1JTEA 3PX3A 5DSTA 4HGYA 3MQ2A 2B3TA 3LDUA 2IP2A 1YUBA 3NVMB 3LGAA 1NW7A 4KIGA 3BGVA 4MQ4A 4P7FA 3EGVA 1X1DA 1WXWA 2YXDA 5H02A 1NBIA 1DCTA 1Z3CA 4RVGA 3FTCA 5DLYA 4AX8A 2R6ZA 4E30A 3HCBA 3GWZA 1XDUA 2NNWB 3CCFA 8MHTA 3KR2A 3Q7EA 1JG3A 1XVAA 4AUKA 2AS0A 2AOWA 2PT9A 4PYNA 2PKWA 2IGTA 2P7IA 1SQGA 4RTQA 4K6MA 1I9GA 2P3QA 3TRKA 3BXOA 3EVEA 2YTZA 5HFJA 3S68A 4ER7A 3ELWA 1WS6A 4OA8A 3C0KA 2YUIA 4FSXA 3M6VA 1F38A 4MHTA 1QAMA 3NJRA 3TFWA 4F85A 2CL5A 4X1OA 4RYLA 4QVGA 1RJGA 4BLUA 3ERCA 5FHQA 4LG1A 1RJDA 3A27A 2OO3A 4KWCA 3UJ9A 4DF3A 2ZWAA 2GAFA 4IV0A 2FRXA 2PVCA 2ONYA 4OQEA 5E2AA 1N7IA 3TQSA 2IFTA 3DP7A 4CKEA 1SQFA 2P3LA 3C6MA 2P41A 4HC4A 4GUAA 2PT6A 3M70A 3VC1A 4BP1A 2NP6A 2I7CA 2H1RA 5K0LA 3UJCA 3KQQA 3OPNA 1VP3A 2ZZMA 2GH1A 3B89A 1T43A 4MIKA 5FWAA 3ANXA 4C08A 1G6Q1 3SMQA 5K0NA 2I62A 3T7RA 3THRA 5HIKA 5FQNA 4WXHA 4RV9A 4MWZA 4PCLA 3UJ7A 1JG1A 3HVJA 4QPPA 1M6YA 3G5LA 5CM2Z 3UJDA 2P3OA 1XXLA 4RVHA 3I64A 2OXTA 1SUIA 2DPMA 5IH3A 4MTLA 5DWQA 3TOSA 3EVAA 3C6KA 4DCMA 2QM3A 2ORED 2YXEA 2DULA 3G8BA 3EVBA 4AZSA 4E31A 5K0JA 1SUSA 3NWEA 4KDRA 4PYOA 2VDUE 5DXAA 5GIOE 1M0EA 2O57A 3DTNA 3FUTA 1O9HA 3EMDA 3VC2A 2IH4A 3LCUA 4HG2A 4P7JA 5GWXA 2VDVE 4GOND 2BZGA 3HCAA 3FTEA 2ERCA 2ZBQA 3B3JA 3L8DA 1FBNA 1EJ6A 3IHTA 4YV2A 5K01A 5LQCA 3KQTA 3MGGA 2B78A 3G2PA 3DXYA 3OE5A 2IBSA 1NV9A 2FPOA 2FHPA 1YZHA 3OFKA 3F4KA 4DCGA 3GCZA 3KPYA 3HA5A 3KU1A 5DTMA 3IV6A 3TMAA 5E1MA 1VL5A 3NWBA 4QQKA 2JG3A 1H1DA 1P1BA 4YUZA 4R6XA 2JJQA 1MHTA 2KW5A 2NXJA 3H2BA 3P8ZA 4PGGA 4GEKA 3MTEA 1JG2A 4X41A 5EVJA 4PINA 3DMGA 5FA5A 4EVIA 4RTMA 1YFLA 3SGLA 4ATNA 2VDWA 3TPZA 4EMSA 4PNEA 5E1BA 4F84A 4KDCA 5JUWA 5EMMA 5LQUA 3AXSA 1ORIA 4UOEA 3M6XA 2PWYA 2CKDA 4JXJA 1BC5A 4M37A 4PYKA 3CC8A 4AZTA 4F86A 5CUQA 3GO4A 1WXXA 2NYUA 3DMHA 3FPGA 3CJRA 3HCDA 5EMKA 5B1SA 2V74B 4ISCA 5K8VA 4DM3A 5DPMA 2G71A 5EG5A 3SR4A 3HCEA 1G60A 3PFGA 4C07A 1AF7A 1EQAA 3ELYA 3DUWA 3P9IA 1R6AA 3OU6A 4IV8A 4FSDA 4RTOA 2VP3A 3BKXA 3LL7A 3M33A 5D1NA 1NW6A 4OBXA 3K6RA 1FP1D 1VIDA 5GM1A 3PTAA 4YMHA 3KKZA 5E8JA 4RVFA 5K0EA 4POOA 3HTXA 3TLJA 3GIWA 2IPXA 3P9CA 1KPHA 1R18A 5P8WA 4FGZA 3LX6A 4CWAA 2K4MA 3KPJA 3KR9A 3VSEA 1KHHA 3BT7A 1AQIA 2R3SA 4XUEA 3T0IA 3KQSA 9MHTA 5HIMA 3A25A 3ELUA 3LBYA 4P7KA 3EEYA 1NV8A 4OBWA 2C7OA 2CMHA 1NW5A 3FPEA 3G7UA 3PVCA 1EG2A 5BW5A 2ADMA 3TR6A 3GGDA 3G2QA 1Y8CA 3AWIA 1WZNA 5EPEA 5T64A 1SVUA 2B9EA 4RTPA 4RTKA 2UYQA 3KHKA 5C9ZA 3FTFA 2ZFUA 1IXKA 2AOVA 3EVFA 4LECA 1M6EX 5E9JA 5CCXA 3FPHA 2YR0A 5KYGA 2AOUA 3I5UA 4E33A 5F2KA 5LQRA 4GC9A 5HIIA 5FQOA 1XDZA 5EKXA 5CD1A 3B3GA 2BR4A 1VLMA 2WA2A 4GF5A 1NBHA 1MJFA 2OKCA 4H0NA 2YX1A 1YFJA 2E5WA 5DRTA 3P9NA 2QY6A 3VYWA 5K0BA 1XCLA 3A4TA 4V0RA 2B2CA 4YUXA 3P2IA 4CKBA 2A14A 1NW3A 4CKCA 4HH4A 1TW3A 5K0GA 3LKDA 1HNNA 5E1DA 3GXOA 4EQZA 3HVKA 4YV1A 1YZ3A 5EZSA 3AXTA 4RTSA 1JR4A 2CMGA 2EJTA 2PV0A 2ZWVA 4GOLD 5EOVA 5HILA 2Z6QA 5KS2A 4YMGA 5EHGA 1EIZA 1X1CA 2AN3A 2I6GA 1QANA 1JQDA 3FZGA 4PYMA 1F3LA 1EAMA 1KYWA 3HA7A 3LPMA 3UZUA 5LQKA 4P7GA 5KVAA 2PXAA 1WY7A 3M6WA 4XUDA 2IH2A 2NP7A 3PS9A 1B42A 2Z6UA 4FT4A 2XBMA 3NTVA 3GDHA 2FK7A 5FCDA 2EX4A 2ZLBA 1ORHA 4NECA 4EKGA 2HWKA 3GJYA 3BWCA 4OQDA 2ZTHA 3BKWA 3E05A 5DXJA 3REOA 4C05A 2AOTA 5EIWA 4LWOA 3UBTA 1SKMA 3PLAE 2PX4A 1ZKDA 3FUXA 5ERGB 3CKKA 5T6BA 1D2GA 4FZVA 1I1NA 1R74A 3X0DA 2QYOA 3BZBA 3UJBA 1KR5A 2PJDA 2CWWA 3DR5A 3OCJA 4IKPA 2UYOA 2WK1A 4C04A 3LECA 2AZTA 3NVKI 3DLIA 3G8AA 3FUUA 5E8RA 4E2ZA 3O7WA 3O4FA 1AV6A 2AR0A 3FUWA 3ORHA 4QTUB 3K0BA 2Z6AA 3U81A 5CCBA 4EKIA 3ER9A 3Q87B 4HTFA 3FRIA 3FPFA 1KPIA 2YVLA 1X1BA 3CJTA 1INLA 3IEIA 3BGIA 4GOMD 5F2NA 4M36A 3THSA 4FT2A 3LCVB 3P71T 1G55A 1NKVA 2HMYB 3GRVA 3M6UA 3OZTA 3R0QA 2ZIGA 4PCAA 1KP9A 1R8XA 2G8NA 2JH9A 1TPYA 2AOUB 3T7TA 2HV9A 3EGEA 4X61A 4PYJA 5EHIA 4BY9E 2YQZA 1WG8A 2PY6A 1D2CA 3EMBA 5DTRA 1FPQA 3OE4A 3AJDA 4U7PB 4HGZA 2OBFA 1R8YA 5ICGA 3ID6C 2P1DA 3I58A 4QPNA 5DRYA 2AN5A 4Z2YA 1RI3A 3TM4A 5LQAA 4RTNA 3LSTA 1P91A 4ER5A 3EGIA 3MTIA 2UZ4A 2O06A 1NW8A 3UA4A 3A7DA 5EMJA 1JG4A 4PYLA 4P58A 2ESRA 5FTWA 3EVCA 5DM2A 3LBFA 4CTKA 1V39A 4E2YA 1RI5A 5DX0A 4ER0A 2ZULA 5CVJA 1BHJA 3LDGA 5FWDA 1N2XA 2XYQA 5DM1A 3BWMA 5K09A 1L3BA 3EVDA 2FK8A 1YF3A 3MB5A 2ZW9A 3DH0A 3BWBA 5E1OA 4C06A 3T7SA 3EEOA 2ZZKA 3SX0A 3AY0A 1RI4A 3DXZA 3HA3A 1SG9A 4ZTBA 3HEMA 1IM8A 2G1PA 3CJQA 4AZWA 1XTPA 5HEKA 1G38A 3FYCA 3KPWA 3KR0A 3PB3A 4WVLA 1UWVA 3OZRA 5KQRA 5EQJB 5EIFA 1KIAA 4KW7A 3UA3A 5K0FA 1JSZA 3A26A 2O05A 2AOTB 3B3FA 4GQBA 2O0LA 4M7RA 3OU2A 3WSTA 1JQ3A 4PIMA 3TKYA 1BKYA 3OFJA 2EJUA 1L3IA 5EC8A 3UWPA 1HMYA 3NW9A 3FYDA 1RI2A 4R6WA 4A6DA 1OR8A 2FCAA 4RSRA 3NDJA 1UIRA 2F8LA 5JR3A 5GIPE 4YUYA 2PX2A 3MHTA 5FHRA 1BOOA 5G02A 5LSAA 3BWYA 3CBGA 4QDJA 3HVIA 1ZQ9A 1L9KA 3P2KA 5LR6A 2C7PA 5K05A 2ONZA 1EJ0A 2AOXA 4HTFB 1P1CA 1AQJA 4GC5A 7MHTA 3TKAA 2GA9A 1JSXA 3HVHA 4C4AA 4PWYA 1FP2A 2C7QA 2AVDA 2NXEA 3ELDA 4DA4A 5DM4A 2PBFA 3SSMA 2PX8A 5DX1A 4RTLA 3G89A 4OX9Y 4PONA 3UJ8A 3R6TA 2IIPA 3KQPA 2LD4A 2XVAA 1XDSA 3P2EA 3RIEA 3C3YA 3CGGA 4GBED 2H11A 4DKJA 5F2OA 2EG5A 4QQNA 4QTTB 2AN4A 5EMLA 3UJAA 1FJXA 5U4XA 1RJFA 2ZCJA 3PFHA 3MERA 1Q0SA 1QZZA 5DM0A 1XCJA 3BUSA 3P97A 5K03A 2XYVA 4GOOD 5C0OE 2IH5A 4X63A 4E70A 5E2BA 2GB4A 2PWPA 3LCCA 3KPUA 5GM2A 4YV0A 3MCTA 4KVZA 3ER8A 2PX5A 2XVMA 1KPGA 2PXXA 3FRHA 3DMFA 3HP7A 2G70A 4BP3A 2BM8A 2OZVA 3EPPA 3GU3A 1QYRA 1QAOA 4XCXA 4BLWA 2VS1A 3GRUA 1ZGJA 3G2OA 5GP1A 2IDKA 1VPTA 4L7VA 4QVKA 2OYRA 3PX2A 3E23A 3KQOA 5IKMA 3SSOA 2P7HA 3MAGA 4X60A 3FTDA 3KQMA 3HCCA 1P39A 1X1AA 2PXCA 5D1HA 2HTEA 2PLWA 2QRVA 3G5TA 4R8RA 4ER6A 4U7TB 1DUSA 1VE3A 2B25A 2JHCA 3SM3A 3FPJA 5HIJA 3C3PA 4R05A 3EVGA 3HNRA
chains in the Genus database with same CATH superfamily
4KH1A 3UT5B 3VYUB 4GPZA 2CXUA 3IR7A 4JDPA 4A15A 4IIGA 1VG0B 2PGNA 3STWA 4NS1A 5BP7A 1JHPA 2ZSFA 3K0AB 4BX9A 3GDFA 1MGPA 1FNBA 1DINA 1Z2PX 2F17A 3GY0A 1Z62A 3JZDA 4GZ6A 2ZI6A 3JWGA 4TLMB 3UQZA 4BTVA 3PUWA 4BO6A 2I3DA 1Z45A 2HN9A 3L84A 121PA 1W8IA 4L85A 1RS0A 3EB9A 4HQRA 1NXTA 2NXNA 1ULHA 2IOHA 2PMWB 3C4VA 3KQVA 4NWIA 3TRHA 3HU3A 3BGOS 4TLEA 4EY3A 1ACMA 3C5EA 5BXYA 1LRJA 2CDCA 2QM8A 5KSOA 2OORC 3CEMA 1MEJA 3D4PA 3DQPA 3TKLA 4AQYB 2TMDA 3KB1A 5D00A 4M6WA 1OTYA 4S1PA 4MKGA 4BX2A 3WK6A 5IYZA 2VZ9A 5CIYA 1KGSA 4NMXB 1EFAA 5FUQA 1RXSA 1JZTA 2X9GA 2WUVA 4EG0A 2IT1A 2NUPA 3E3AA 5AHXA 4DSNA 3KJIA 1SOAA 3WL7A 4PCVA 3C3MA 2WA1A 5BN4A 4KOAA 4RGBA 4BX3A 2Q41A 3KOZA 4G1VA 3AIIA 3HV0A 4B79A 2WDPA 4RD6A 4Q18A 3T9BA 4B6RA 3VHRA 1ZCFA 1GVNB 3E9DA 3RH0A 1JEJA 1THTA 1D2HA 3ZG6A 3QF4A 5F7JA 4BC1A 5EIAA 1X19A 2D8MA 3PHBE 4MWBA 3TM5A 4D0SA 2B37A 1KYQA 3JQEA 1HV8A 1WL8A 3BMNA 2C7RA 3DDHA 4AUMA 1UPCA 3PFBA 1X1EA 2F6RA 1LK7A 4R31A 2QTMA 4EHIA 3OOSA 3QGMA 4BMSA 4E1VA 1KR2A 2YJ5A 4C4TA 5BUSA 4X3OA 5KYWB 1RKQA 5CLHA 4QJ5A 1Q0QA 1X42A 3FX2A 1KEPA 3DLCA 4A6EA 4DMHA 5IMSA 1W1IA 2J59A 4P22A 5FA8A 3G02A 3RVLA 3QEMB 4FLFA 5BMVF 3FXAA 5B4TA 5HK9A 2NO7A 2DJ5A 4EB6A 1ICEA 4BFWA 4KHPB 4EW6A 1PT7A 2PX6A 3P0IA 4CEJA 2X9VA 1OZHA 2GPJA 3HVUA 3UHFA 1NF2A 2YXBA 4KIGA 2IP2A 2D5LA 3QKRA 3GCXA 4GPD1 3BGVA 3DLPX 5LP6F 2OUKA 2XZPA 4FFNA 4MW6A 5FLKA 4YRSA 1NBIA 1K75A 2NO1A 5DLYA 3ILSA 1W30A 4K9PA 4KR0A 4QOGA 1PBNA 2H54A 3DBVO 1MVNA 3SLGA 1JA0A 3I23A 4WBNF 3S81A 2XUKA 3K05A 2BHLA 2JGNA 1H5NA 3E9QA 1FMJA 3HXLA 4BNNA 4CMBA 4FOLA 1SWWA 2ZVPX 4UMEA 5BV8A 3I4LA 3BRCA 3ZLTA 5IWAB 4S2UA 3S1AA 2FWJA 3F98A 3RTEA 5IT0A 2WILA 3AR3A 2A5LA 2NO9A 4NCIA 4H27A 4P35A 1NLYA 3W1EA 5C34B 1AG9A 5H4HA 3L0SA 5A9SB 3T0FA 5AW7A 4H7IA 1ZD5A 2EZTA 2BMAA 2R6GA 3A1EA 4J1QA 5IX8A 1DRUA 1VJRA 2FEMA 2Q50A 4PZZA 5KHAA 3W5HA 3TWOA 4GXTA 2F9MA 3IELA 3TVTA 1TZKA 2WSYB 1EUYA 2H1CA 1E2BA 3DHNA 3M89A 3WQBA 1AB6A 2QN3A 3IB3A 3VYSB 4JGBA 3M70A 1M0TA 2RBEA 1V7QA 3U44A 3L1KA 4J75A 3B6ZA 3BEDA 4MDHA 4UU1A 3HFSA 3OPNA 4HVLA 4P08A 2HCFA 3DGFC 4QQFA 1DZIA 3TE6A 2WFLB 5I7UA 4C08A 3RJ9A 1ZJZA 4IUYA 4Q3KA 1YZUA 1N8KA 5HPYB 1XLVA 1Z0DA 1RRCA 2GOYA 3UOAB 2E4UA 2EBWA 2LCIA 1C0EA 1XAHA 2VNJA 3D02A 3K6JA 4MUMA 1YCGA 4R1LA 4RFVA 3AVVA 2QSUA 1XXLA 4RKQA 4UEWA 3V4SA 2ISQA 5KSYA 3PR1A 3ZI7A 3LUFA 4FZ3A 2WU1A 2WYWA 4C5CA 2WTBA 3KTFA 1KKUA 1P0IA 3QFFA 4IWXA 4U7FA 1ENYA 2XI4A 4LQCA 5J1TB 1NXSA 5U4QA 3OZAA 5T8KC 1KP2A 1Y7PA 1CZUA 2IXGA 2B94A 4R69A 3RT1A 2VPPA 1UC4B 1KAQA 3EMDA 3FIUA 1HBJA 3DDSA 1JEDA 3AVYA 2F1JA 2ZS7A 5HF6A 3SEAA 1NUAA 4ZI7A 1L4FA 1SZPA 4JLSA 1PZMA 2DFVA 1KK1A 1WUJS 4DCPA 1BKSB 1XROA 1EE9A 2A78A 4B47A 3UGJA 2GAIA 1GKUB 4KRYA 3WI7A 4CDRA 4LYEA 1S8AA 4HB4A 1P5HA 3N2IA 1E66A 1YBHA 1WCIB 3F2IA 1YXMA 2I8AA 3DYVA 4M9XA 4BC0A 4JITA 1JG2A 4Z4HA 3DMGA 3SGLA 4PNEA 4J4BA 2C03A 1NBEA 2AZXA 2CYAA 3Q3VA 5F9MA 1RAEA 3I2JA 2UU9B 1ZSVA 3FYSA 3PNLA 3KZKA 4LRQA 5BYKA 5E6RA 2OCXA 2Z5FA 5JD6A 4MI3A 4FQ5A 4QUIA 3N6VA 4FFDA 3WLOA 2WQ6A 1U8UA 1XA0A 2V6IA 4C3OB 1YZYA 1CIVA 3DVLA 5DJ5A 2WJZB 1KMCA 1OZAA 2XDQB 4LHVA 1DBPA 1THMA 1L2TA 1X7YA 5LIPA 5ECYA 5IULC 4JNKA 3DUWA 1DOAA 4RLFA 1JMVA 2EQAA 3NU1A 1N9ZA 5DB4A 5E7JA 4CF5A 1JLSA 3K5HA 5KYVA 1K8ZB 2HPAA 3K6RA 3DPSA 5CT8A 3IOCA 1GU1A 5DGDA 3CN7A 1GITA 3UK2A 1IY1A 4YMHA 3H2IA 1KI6B 3FNHA 2HMWA 4N82A 1E92A 2FRDC 1M1XB 3MWLA 5ESWA 5IAGA 3LX6A 4TXNA 1EBBA 2D1QA 2ZANA 1V2HE 3IIKA 1Y82A 1Q11A 2CLSA 3BA1A 3DE4X 4UUOA 3QI7A 2K7ZA 3G1UA 3HR7A 3NHBA 3MAAC 4N5IX 1DVRA 4AWBA 1BFDA 1AKVA 2IX9A 1GQSA 1L7QA 1Y98A 3KJGA 3V2UA 4ENTA 4Y9UA 1BCSB 2RARA 5AM1A 4DIMA 3G2QA 4YIHA 2M2IA 2O8BB 1RQ7A 3GUZA 5EPEA 4KR9A 3S2IA 1QORA 2B9EA 4UNPA 1O94C 2JDIA 2GFHA 2G77B 3AF2A 2PUEA 1L4YA 2OK7A 2VPTA 2ZFUA 4LNAA 3RVBA 2WQZA 1SZDA 3LT0A 2XAAA 1A9XA 5IEBA 1G4AE 1RT9A 4P92A 1K4MA 4GC9A 2JFZA 1WXHA 3DCIA 4LSZA 5I7FA 3FOFC 5HIIA 4RH3A 1ODJA 4FEEA 4BWYA 3INRA 1VLMA 3T0GA 5B5SA 1NBHA 1GXSB 1SQ6A 3U1BA 3D64A 5AXBA 5CJJA 1YQTA 4RKWA 1CDEA 1LFDB 4CTNA 3I37X 3BICA 2NV2B 1C41A 3MK31 4V0RA 5C8XA 3T06B 1NBOA 2AXEA 2RKOA 1S0UA 1N2CA 4UDYX 1LJ8A 4Z1MA 4UEQA 1W2HA 2DUWA 3WGTA 3H2KA 1T8TA 3QKWA 1MIOA 1LDNA 3F6PA 1BAPA 3JZIA 3W9SA 5J43A 2Z6QA 2JGAA 3DEHA 5HRUA 2GMWA 3D54D 1NZJA 5DBHX 3A4LA 3C8HA 3Q6IA 3N0XA 1V3TA 2Q6IA 3RTCA 3ZWKA 3Q3HA 4NBNA 1XPOA 3L0ZA 4RY2A 1NJ5A 1EH5A 2HJSA 3JQAB 4L5JA 3WMWA 4AKHA 4DABA 3HI4A 1EZZA 2X8JB 3DHVA 4GH5A 4IHJA 5C4MA 4MK4A 4BVBA 5FPKA 3GDHA 2XUOA 4AZ3B 5IF9A 1USVA 5IJZA 2EX4A 2HLDD 3PZBA 4ZTZB 1ZJWA 4YMWA 3U7RA 4EKGA 1MZPA 1ZM9A 4TTPA 3PHLA 3BKWA 5EAIA 1N33B 1DIHA 1F2UA 4HLDA 1E6WA 2Q1XA 4WJZA 1UPUA 3U4GA 4PRKA 4LV5B 1DOZA 5T4HA 2QSYA 2B92A 4WOKA 1NLZA 1SVWA 2JAWA 1BDMA 2CL7X 3IA2A 1N5MA 3UH1A 1P73A 1SC1A 4XFJA 4DY4A 4OB8A 3ZWMA 5BY2A 3DDWA 2V1XA 5C8VA 1PJQA 1JQJC 4WSOA 3U6BA 4EKIA 4MAFA 2OAQ1 2OO5A 1FYFA 2LE0A 4EG3A 4IS2A 1E1QA 5AJYA 2H1IA 1SAYA 1NTRA 3WSVA 1HDGO 3RD5A 2BEUB 4FT2A 2PH3A 4XGNA 2QR3A 4G1EB 4ABYA 1NT4A 2ODPA 4IUBS 1O5OA 1CUAA 1FMLA 5LYJF 5EP1A 3WJ7A 2C2XA 2FWMX 2O8NA 2GBFA 4HPXB 1CW2B 2WNHA 4EPVA 3MMSA 1WG8A 1C4XA 4R2IA 2HD4A 1D1PA 1RBQA 3S2UA 4N8SA 4ZYXA 1WDTA 5ENZA 4AZ0B 2EF1A 4TT3D 4E94A 1MC1A 2PGAA 4UNNA 4WY5A 1N6PA 4R83A 3I58A 5BOSB 2AN5A 1M72A 2MINB 2BZ1A 3GZTB 2C8JA 2HSDA 3BRQA 3FSGD 2AL7A 3C1AA 4KYUA 5L3ZA 4BE9A 4CKCB 2FUKA 4B48A 3LMKA 4LF4B 3STVA 2E2WA 5TT1A 3AEZA 4O0LA 4RY8A 4UE2A 3QNWA 3NHWA 3BZUA 3LGXA 4EHNA 3BE6A 1B1CA 1BHJA 1Y1SA 2C5EA 3LP5A 2WPDA 2HLNA 3JARA 4BRWA 3BWMA 3HKEB 4HCJA 1OA1A 1X39A 5L40A 2REBA 4ZVQA 1X7GA 5JJ5A 2ILVA 2XB6A 2VDPB 3GZNB 4FVTA 2UDPA 1OKKA 1XQVA 2QAGC 3WYBA 5C18A 5L3QA 4DV3B 2I78A 3K9GA 2XH8A 4XAQA 3VTZA 2AR7A 5GPBA 3T15A 2O3RA 2J4FA 2NQTA 2VAVA 3A9RA 3CRVA 4YP5A 2Q5LA 4MV6A 5ELMA 2XOXA 4XGRA 1AQNA 2ZRHA 1CX9B 1SKAA 1P4JA 4RDHA 3T5MA 4PR0A 1DT3A 1R1DA 1O97D 3KAKA 2DECA 3TKYA 4URVR 2QT9A 1L3IA 5AW2A 3DVAB 4RKEA 4JEMA 3SJBA 1RI2A 1ONPA 4NZMA 1XZGA 3RADC 1B76A 4YMSA 4OLFA 4TMKA 1OBHA 2VAPA 2XW6A 4QDXA 3KRTA 4WN9A 3CW2A 1EDEA 1L4GA 1YI1A 4ECAA 2KLBA 3EXHC 3KEMA 3KKPA 4GMDA 4Y2TA 1CJUC 2B35A 3CZ5A 2I80A 3D4IA 5LJLA 1L5YA 1Z6QA 3UK0A 3O8OB 1O87A 5LBUA 4CL8A 1IL0A 3DTVD 2FPIA 1E9RA 4DQVA 2NXEA 2I29A 4FOTA 4U1RA 1J4AA 3DAPA 5JMPA 3SSMA 4FM9A 4Y9DA 3JYOA 4LPSA 4F2DA 1WV0A 4Z3KA 4YPVA 5H9WA 2CSXA 2J32A 1M10A 5AJWA 2ODEA 5BVHB 1L5HA 2B5OA 4F8YA 2DKFA 4K6FA 1A95A 3BSYA 1CY0A 4OHOA 3VM6A 2AN4A 1ORWA 4EG1A 5T41A 1JDNA 4MR8B 2Y2UA 3TQFA 1QX4A 1MO2A 2I33A 4UCXA 5EMNA 5U4XA 3E35A 3N8GA 1FJXA 2HF8A 1HG1A 3O38A 2Z04A 4AULA 2OFOA 4F12A 1PWXA 3LY9A 4V1CI 1IHXA 1NN1A 2NSDA 3W8RA 2ZYVX 1ZOLA 2DQ4A 2YBEA 3FLEA 3FNFA 3GJZA 5KDLA 1HQKA 2PWPA 3H4TA 1ZICA 4YV0A 5KJFA 2ZS9A 2W2KB 2B4RO 2WU4A 3D6UA 1KU0A 2PQMA 4MHSA 2XVMA 1U8CB 4IX9A 4OHUA 3ZI0A 5DFAA 1ZA1A 3VOAA 3JRXA 4AJIA 3DEYX 4O4JF 3NYRA 4FHDA 1K6EA 1KH1A 2G09A 2JA2A 3KKLA 4CNQA 2J41A 4BIIA 1R4MB 1G8GA 2XVXA 4FFOA 1EJBA 4H1VA 2W83A 2RHMA 4L02A 3OSZA 1OWOA 5EFZA 2FTKE 4K6CA 3ED5A 5IXSA 4FYKA 1QG4A 2FVXA 2Q21A 3X1YA 3GZJA 2AYXA 3T1VA 3JQ7A 4K46A 4E46A 4AMBA 2HTEA 5C4GB 2H2DA 4BVJA 4CF3A 1FX0A 2C2YA 3EN0A 2WHXA 3GEBA 3N76A 4J3NA 3G0OA 1IATA 1H2WA 1TM5E 2LR0A 3C3PA 3R6GA 1E4YA 2CHUA 4FFRA 5HNKA 4EI9A 3GRFA 2VHXA 4QTXA 2QNIA 1E77A 1P5FA 2N46A 4UE6A 2DKOA 4UM8B 3PXGA 3RKRA 1Z6XA 2B0CA 3WKEA 1V8OA 4BQFA 1QVZA 2TMGA 1JL3A 3I9FA 1LLQA 4IG9A 4QUBA 1T0PA 1VGVA 1BDBA 1KMMA 1SVSA 2HKIA 4D4KA 4KPGA 1K3UB 1PQPA 2XGSA 4K9OA 3N0WA 4KWIA 4NU5A 5K8JB 4YQZA 2R9VA 1OH7A 5HKBA 2EKZA 2Z9BA 4DT1A 1FVFA 3S2ZA 3ZZTA 4JVOA 4NYJR 1EVLA 1UK8A 1GY8A 3KB6A 4OA5A 4XPIA 4C4ZA 4UCFA 3BIXA 2ZB3A 3BTOA 4QJIA 4REQB 4TOIA 3WK5A 3AEUB 2IPNA 4AQ7A 5DV9A 4Z4IA 1JIJA 4P0TA 4LHEA 5FV7A 4ZOBA 3TOCA 1XZJA 4DGQA 4G0WA 4IM7A 1YB6A 2X2PA 4I1UA 4XE5A 4OHYA 4DUZB 4ZEMA 3AV0B 5HZHA 1CYEA 1D8AA 2G80A 1UWKA 1DKQA 1J0EA 1YB2A 3SLKA 5C7IO 1SKQA 4ZO6A 4ZWNA 2GDZA 2QPLA 5D8DA 2NM0A 2GPYA 5JZSA 2GUGA 2ZZNA 4ML3A 2V7UA 4NRDA 3H0KA 4D8TA 1RW4A 4HUJA 1LUAA 1Z88A 2FPXA 3UWSA 4DR1B 2O8DB 3EGXA 1IPFA 2BM0A 2HC9A 2Q3MA 2RHCA 1DHTA 2A9OA 3OQIB 4KQKA 2X3FA 1Y48E 2XMQA 3MMXA 5CHEA 1U02A 3RW9A 1LZLA 4ZV4A 1OXTA 1PFYA 2ZRLA 1MABA 4PCUA 3QOYA 1XZIA 2Y77A 3C39A 5K4GA 2YHSA 1P3JA 3EAFA 4UHEA 5FUBA 2ZBFA 4D8XA 3TQOA 4KDEA 4BV2A 1PJ8A 5B7QA 3EVTA 2V9ZA 5ENVA 3MTDA 5B64A 3I04A 2ZAYA 1AN9A 1GARA 4NMMA 1IEXA 2AI1A 3EWNA 3LRPA 3EC7A 2YV5A 4FOSA 3VR3D 2D54A 1O57A 3UAOA 3K20A 4RLQA 2I2FA 1VQ1A 4YB8A 3TX6A 1NF9A 4ARZA 3JWHA 4HNGA 4LYHA 1AQUA 4WUVA 5AJZA 3PFCA 3ZV6A 1O9GA 4DLLA 1LNSA 4PS0A 3RJZA 3ZWBA 1QRDA 2G72A 3V4LA 2R79A 4RHUA 1V4NA 4DLNA 4JWTA 4TQ9A 3MYYA 3MCZA 3S4YA 1CEEA 4HDRA 3OX1A 4P3OA 3KVVA 3ROQA 4R9UC 3VZRA 2RC6A 3HBLA 4UEJA 2Z1DA 4BNYA 4WQMA 1MENA 4Q7EA 5DSTA 1JEYA 1M8JA 5KVCA 1PEYA 2PKYX 4P7FA 4RJIA 2NU8B 3P2YA 1T2DA 1NP6A 1P9NA 4IZOA 2BRUC 3KSAC 2ZS8A 3RIMA 1NX6A 3M1YA 2EWWA 5KINB 5K7SA 2J3IA 2AC2A 1XDUA 3BCHA 4IRUB 3UWMA 1IHUA 3W8FA 3GJ7A 4FQ7A 4QHSA 4IF6A 1V7PC 3FCXA 5KREA 4AUKA 2QIOA 3S2EA 1CF4A 1QCDA 2B83A 2PT9A 2WT8A 4EYKA 1P2UA 3HB5X 5LBTA 3AR6A 5E3HA 2ZSDA 4ZCMA 4N01A 4WCDA 1VE1A 1PJRA 3VMFA 2PPLA 4MPJA 5DIZA 1OSNA 4DLZA 5CD9A 2OAGA 5AI4A 5BR7A 3MJTA 1FJHA 2YUIA 4BFYA 5TLSA 1JI0A 2CJFA 5E4FA 4HDOB 6AT1A 1GFZA 5EIEA 2IP4A 4BLUA 2UXBB 1T0BA 3N2KA 3NBXX 1XPJA 4G5YA 4PHHA 2GTIA 2ONYA 4EUKA 4HOYA 2XMZA 4YMTA 2VYND 4Y0AA 3RV3A 5DM60 3DP7A 1P7ZA 4AN4A 3BE8A 4CMIA 4GKKB 3LXUX 4B6OA 3AILA 1SVOA 4DR2B 1EFHA 3DBHA 4BN5A 1XVTA 2GK6A 2ASEA 4YRBA 2EQBA 5CFLA 3UJCA 2FMFA 5IDQA 1XEAA 5KSWB 1ULZA 1FZQA 4X54A 5KOIA 1UDWA 1P7CA 4QBKA 1IN7A 1JE0A 1KYIA 2X76A 1O77A 4PHTA 5K0NA 4TS3A 1N2OA 3RFCA 5JNSA 3G0DA 1NDUA 3DAOA 3IOMA 5IRCD 5EZYA 3J81k 2FZ4A 4NJMB 1U98A 4C89A 1DKMA 1EEXB 3RHZA 5BURA 1C4OA 4H4CA 1VG1A 3MNFA 1H3EA 2BGUA 3TMYA 5EIXA 1QQ6A 3GF4A 1SBHA 2FW9A 3SU8A 3BCRA 4Q39A 5SYNA 2H2AA 2YXEA 1KI2A 1Q92A 3EVBA 5PNTA 3IPCA 2X22A 4LEIA 1E2GA 1Y1LA 1YHYA 3TTYA 5KWSA 5L4NA 3X1DA 1ZBQA 3AHFA 4EECA 4D2IA 1V95A 4W4TA 4HWGA 4ZGGA 4P7JA 5BQXA 4HWKA 1EK1A 5LC1A 5CT9A 2J4DA 3REQB 1R9NA 1YMQA 1OY1A 1JHVA 1A88A 1NVXQ 2GPBA 3EXEB 3FMOB 3KVNA 1RFLA 4ZT6A 2V8OA 1L8QA 4D9BA 1X87A 4YT5A 4OAQA 3SLRA 3KYBA 4JCCA 3TECE 3ZD7A 3IP9A 4BWFB 2GCOA 4IHKA 4QQKA 1C3XA 1X7DA 1JR3E 2JG3A 4YUZA 1PW5A 4BFSA 4KWHA 3DYBA 1TQDA 5JTTA 1I4EB 1U6KA 3J7AC 3I2YX 5DZSA 3B52X 4GEKA 3MTEA 1NRWA 4CPDA 4BVLA 5JBQA 3F6EX 4JBYA 5LQCA 3IAUA 4B75A 3FNRA 1JT9A 3UAWA 1NU6A 4GX1A 5TPWA 3UMCA 1C9JA 5BSGA 2GD0A 4KX3A 1V37A 1AMNA 1E32A 2WVAA 3EUEA 2I99A 2HLDA 4KWTA 1JDVA 4H0CA 1SHZA 5J3JA 2OEPA 3W3AH 1F4LA 3N2GB 1WUTA 2C3YA 1LBEA 1ECFA 2HLHA 2CHGA 2X7HA 4JZKA 3WNCA 4YPOA 1LLUA 1P2DA 2MYUA 4FYJA 4R1OA 3U1VA 5LOVA 2XAUA 2X2EA 1T1IA 3HL0A 1G60A 1T2EA 2AJTA 2GCNA 2D2XA 2OD7A 1SCDA 3G2JA 3LT2A 1F60A 3L6EA 4U5XA 4Z7NB 2BYTA 3H2HA 1Y63A 2WJ4A 3MMNA 4RTOA 2ABWA 3Q85A 4TSFD 3NFYA 3PPYA 2V9CA 2EFYA 2ETVA 2C1XA 4MKFA 4I14A 4RCYA 2YVQA 4PPGA 4BYMA 1AURA 1OBFO 2XT0A 2QVZX 2QLJA 2RG1A 2UXCB 1U3VA 3KHSA 2FSVC 4X1IA 1E94E 3DHEA 4FGZA 4J1SA 2OESA 4EF5A 1AUOA 5MN5A 3GGSA 3T0IA 4AJEA 1XD2B 2C5BA 2Q6KA 5A3QA 1JSLA 4EG4A 1Z47A 2NLOA 1I2CA 5ER6A 2Q3LA 3O8BA 3BERA 1NOJA 3TEMA 3DBOB 4E2FA 3GGDA 3IILA 5CK4A 2QV0A 5EY5B 3SYRA 1KERA 5ERYA 1KZ1A 1NMSA 3TCXB 3RFXA 1Q3KA 2CXXA 4HJRA 5AK5A 2AFVA 2FEAA 5FWXB 3NFRA 1T3SA 5JXWA 3AY7A 2ECOA 4WZZA 4J3JA 1MX3A 4BKQA 4L9AA 4TT3A 4BTLA 1PQ4A 1E7WA 2ZJYA 3T7DA 1C4KA 4JI5B 1UXOA 2JFXA 1N3YA 4HDNB 3G2HA 4JKIA 4QFDA 2YMMA 5IAEA 1KJZA 1QH1B 3NTRA 1BU8A 1LC0A 2ZUVA 4YRQA 1Z5NA 3GLGE 3FSGA 1XZ8A 3B3GA 2CNLA 3AZOA 3L43A 1A5BB 1U31A 3FY4A 3DXFA 3Q41A 4JL8A 3B53X 4KXYA 4NMHA 4V38A 2HRBA 4XD2A 2ZETA 5KCMA 2JCGA 4GR5A 3SNKA 4CQMB 4PLCA 1H66A 3R6DA 5ALKA 2NSHA 2WF7A 2HBQA 4C3UA 3C3CA 4CG2A 4CF7A 1OV6A 3OTWA 1XRSB 4Y0VA 4Z9FA 3GYGA 3UAVA 4L76A 4MV7A 4P8RA 3ZNQA 4IG4A 3IAXA 1YIOA 3HPRA 4EBBA 3G9TA 3IDAA 3DE2X 3MWEB 3ZHSA 4NICA 3N7TA 4TL7A 5FFNA 3ZCRA 1UXKA 2YNMD 5A1JA 5G0SA 1POWA 4M55A 5HILA 2GYUA 1VECA 1JQDA 3LQ1A 5BOVA 3ENKA 5I7VA 2ANBA 2CYBA 4L50A 4ZAXA 5J9FA 4CV3A 3HZOA 5HE9A 2H08A 2NWQA 3I09A 2IK8A 5LMCA 5DH9A 3EAQA 3PS9A 5CCEA 5EJ6A 1XHEA 3DGEC 4ZREA 5BQ5A 3ECSA 3V1MA 4P98A 4CN8A 4PFJA 4JGIA 1K0UA 2PTHA 2VWGA 3AUXA 5FL7D 3E7FA 3GJYA 3RLFA 3BWCA 4ON9A 2ZREA 2ICAA 2QL5A 2R62A 2XGMA 3JQAD 5DXJA 1UOQA 8AT1A 2UV8A 1PTJA 4AK9A 3FRJA 1D5CA 3UBTA 3HK2A 1ZHHA 3UK1A 4CCYB 5IJWA 3DLAA 2Z3ZA 3OSUA 3RVPA 3R9WA 3IUQA 1ODIA 4Q9LA 1W4BA 1E6CA 1LNZA 1FFYA 2CWWA 4BMPB 4IKPA 3TW8B 1JE1A 2AZTA 2PMEA 2M1XA 5K3OA 3DTVA 3FUUA 3I30X 1W73A 3O4FA 3P94A 4C6SA 3IQZA 4URHA 1LB1B 5AVXA 2ZB7A 2PRKA 1MC5A 1Z08A 2GAOA 3AZQA 3CXUA 4R0MA 3VR1A 4QLOA 4EDHA 5B36A 2EAUA 5L7TA 1ZNYA 3A37A 5G40A 1HX7A 3UGQA 4YGXB 1DQPA 1S2DA 3IQXA 3W2HA 3R5SA 3QHQA 1MO6A 3CRQA 1JBKA 4D6XA 3PKJA 4PHCA 1KP9A 3FG9A 3LRXA 5DWDA 1UF9A 1F06A 1PDOA 4XGIA 4PYJA 1QZXA 2VDMB 3E18A 1NMZA 1QS0B 1BSVA 2B6NA 4IH1A 1G63A 4I4TB 4D9GA 2AG0A 2E89A 1PV4A 2PUFA 5ECWA 4U7PB 4NE2A 5ES4B 4D0LB 1J2EA 4QDUA 3FCSB 2UUAB 3FBWA 1R8YA 5ICGA 5DRYA 5ALZA 4QOEA 1UDAA 2IHTA 5LM3A 4HAZA 3RHTA 2FN8A 4Q3OA 1F4PA 1AZWA 1Y1TA 1ZRNA 2EBUA 2Z4RA 2P8SA 3TAHA 3U3DA 4CKBB 2OFPA 2E4YA 2WD8A 3C7AA 1QNLA 3A7DA 4LZNA 4ZVSA 1Z28A 2G4LA 3LE8A 2REQB 1M1NB 4BLOA 4ZEWA 3PWKA 4KBFA 2RG7A 4N65A 1QGDA 2WYUA 5BT9A 5GJCA 3P5BA 2LIVA 3A6HA 1QGUA 4L27A 5IK2D 4J94A 3VNSA 3T7AA 2BUAA 5JXGA 1RVV1 4G8BA 1EXMA 4ZKDA 1R0KA 1E2LA 2YZMA 3BWBA 4ZO7A 2NZXA 3RGGA 3P7MA 2P2ZA 2WWGA 5FOTA 2V7WA 1VJCA 2WF5A 4WAUA 1HZZC 1Z0AA 3L7MA 4I1PA 1BH2A 3INNA 5C37A 4Q7JB 1I2ZA 1M8FA 2VNHA 2UYGA 2DWOA 4XJXA 2NADA 3CNOA 3R5JA 4LS3A 5HCIA 1T29A 3ZCUA 4HYTA 4EFLA 2O8FB 2YVAA 2OO7A 2H85A 1FDRA 1FLNA 1T2VA 1E79D 2FZWA 5CX1B 4MKXA 4PIMA 3TUZC 3K0AA 3B1KA 4EVQA 2EJUA 5BUZA 5EC8A 4LJ5A 4ALKA 1V11B 3H84A 4G0XA 4R7GA 3AHCA 4GKBA 4RSRA 1V3QE 4DY6A 2BMFA 1BXRB 3MS4A 1BRTA 2H52A 3P2JA 1GTL1 3P2KA 4RPKA 2V0NA 1K92A 5EP2A 1TT5B 1HETA 3PHJA 1ZINA 3EVNA 3WMGA 1XSEA 2O8VA 4QELA 4G85A 1L7BA 1MOQA 4D4HA 5DDIP 4D3SA 1CQJB 1MAAA 5KAMA 1HL3A 4JVLA 1SHJA 3RU3A 1YK1A 2CV0A 4MW1A 4DA4A 2WFZA 2YDXA 3WFZA 1DHRA 2JGDA 3I1YA 1M67A 3QPWA 1Q19A 3Q1LA 3WQQA 1MAUA 4HT3B 4KUHA 5JZ9A 3IEMA 3FHTA 1RJ9B 1TQ4A 3R0IA 2CY0A 1ZJYA 2J4CA 5TVGA 5KTKA 3TN7A 2ZPUA 4FFBB 1K3TA 3FWNA 1OXMA 1O95D 2QWXA 3FROA 3NI2A 3C3YA 5D51S 4MOWA 2BF7A 2NU9A 2Q5JA 2R84A 4L5AA 4MI1A 3UJAA 4Z8YA 5B1IA 3VZPA 1BDHA 1FDIA 1ZMRA 3GMDA 1YT5A 2H4HA 3BWXA 1U7PA 1U0HC 3Q1KA 1XTBA 5DYWA 1QIKA 2BSXA 4HTAA 4IHAA 1T4CA 1GM5A 1YULA 4JLBA 4DIKA 5C0OE 5CIQA 16PKA 3X44A 2IJGX 3WGUA 1RWBA 3ROFA 4YAUA 2GB4A 4UXJA 1EYZA 1CDOA 3L18A 4KQWA 1OX6A 3B1VA 3COPA 2PQ6A 2CXNA 4KVZA 3RUIA 3OZBA 3U26A 3VR3A 1HOTA 4QYTA 3RUAA 2JS7A 2HRZA 3DMFA 3FE2A 2YS6A 3ABZA 5FXMA 3G13A 5JNVA 3BWVA 2WKWA 4UULA 1E3IA 1DX6A 1DI0A 4BLWA 4TL9A 4NDZA 2YY6A 3R7BA 1RLMA 3HBFA 3CUUA 5AK6A 2W43A 3LP8A 4RA6B 5ALMA 4E0BA 1H2EA 3OIWA 4EYQA 1A2QA 5KYWA 4X60A 1OU0A 4GR9A 4GZ5A 4K6HA 3ZBTA 1E0AA 1M2VB 3HCCA 4TXJA 1BMFD 2COUA 4YJFB 1SHUX 3PFIA 5JO9A 2BKVA 5CA1B 4XM0A 3QEMA 4X8OA 2ZAOA 2QQEA 3R7DA 3TS1A 1NZDA 1FQJA 2H65A 3E48A 2C9MA 4WZBE 2P9BA 2VATA 1DJNA 3HNRA 4R51A 1FQWA 1NU8A 2C96A 2PAFA 1B8OA 3E7PA 3L0IB 4J4HA 4NNOA 1K3FA 2WIJA 3L0BA 3KOWA 5CVEA 1Q57A 3E8MA 4E5KA 3ABIA 4OGWA 2QMYA 1JQKA 2HT6A 3CZ9A 2FYTA 1BVYF 2J87A 5G0UA 5K8TA 4F38A 1XGKA 4JVNA 2XEXA 4LW8A 2YV1A 3S1SA 4BNZA 2RGXA 5FL3A 4CCSA 5K4HA 2C92A 1RYZA 3AIMA 3Q8XB 1PL6A 2IOYA 2ZVDA 3MBKA 2HU7A 5JSQA 2Y2VA 4PSAA 4RTJA 2ON6A 2QG4A 4FEAA 2UYCA 3GD7A 3HWRA 1C9EA 3FGOA 4TYMA 1GPMA 4Q0MA 2X1VA 3UMSA 4E4RA 2WSBA 2D8AA 3LBAA 2BAGA 3PEEA 4YRLA 3WB1A 3AF0A 4D6YA 5DHSA 1NNLA 2IC5A 4M0KA 1YIDA 1JAZA 1FUUA 2NAPA 3KFLA 4Y6LA 2OHXA 1EBUA 3VISA 5IS2A 3DEJA 3EQ7A 2VYNA 1OWPA 2PT5A 1U1IA 4ND2A 2E87A 2PUAA 5C1IA 2OY0A 4EUEA 2JFGA 4G41A 1JR6A 2GO1A 2MSEB 5FTKA 1MOPA 5EGSA 3RRBA 2Q8PA 3H1FA 1OCEA 2HPZA 2CE7A 5BSTA 4EL0A 5CDGA 2V45A 2HSZA 1IY8A 1S1MA 3FH0A 2Y0BA 3LX5A 3V9AA 3PI6A 2XZTA 3VAZA 2Y3IA 1P4HA 1RYEA 1VLLA 3IVMA 3PT9A 4BNTA 1PRYA 1ABBA 3ICCA 3RFUA 2D2IA 4CMCA 2IS6A 2EGHA 4OFXA 1U2RA 4QOIA 3ZWYA 2WFLA 2Z56A 3L06A 4MWTA 2N42A 3P20A 3O92A 1L7PA 3RS0A 4DDWA 1IONA 3JU3A 3HYLA 4KMMA 4WJLA 1UCFA 4KG7A 2OXRA 4MWEA 1PJZA 3H8JA 1VJTA 5DISB 1BXKA 1IZ9A 5HR5A 2P9HA 4RHTA 1COWD 5I9IA 5KQPA 3PE6A 1ZVVA 1M8PA 1IXYA 1T4DA 3PP8A 1PHPA 1PX0A 2AJLI 3PXXA 5HM8A 2GHIA 3GFTA 1I7PA 3F97A 2O9JA 4PG4A 4RPGA 2BHTA 3D0RA 4FMCB 1N5OX 5ALYA 1B74A 1HDRA 2X7JA 2XE7A 1Z0FA 2M6LA 3GR6A 4PC7A 2YXNA 4QAQA 1N7JA 4F9GA 2VYCA 1E3LA 2QRVB 3CLUD 4KBYA 3ZZ1A 4J1TA 3RT7A 3KQUA 4IWNA 2IYLD 1GRNA 5AUPB 1N25A 2I4LA 1CP3A 1TAGA 4OFZA 3K2IA 5AXCA 1JZQA 2BI8A 1EX9A 2NUTA 3VO2A 3WNBA 1L1EA 3DO5A 3HZZA 3NASA 3O6VA 1EFCA 4CG3A 3MQ2A 3NVMB 2V97A 3ND8A 1MA3A 1M74A 5CT5A 1KMHB 2J6BA 4MV5A 5KNBD 2AXPA 1WCIA 5K2MA 2AFHE 5KIAA 2BD0A 4E30A 5FBRB 3UM9A 2O2DA 4CZ2A 2A35A 3V4FA 1DDOA 1C1YA 4BJ3A 3BDVA 2QB5A 3UUWA 1NNI1 4KLCA 2H18A 2H29A 4K9DA 3T3MB 2IGTA 1Y5RA 4RTQA 2HHAA 1U0SY 4K6MA 5A3RA 4Z3OA 3AR2A 1ZW1A 2BFFB 3D0KA 4S0ZA 4XYMA 3WV5A 1OU4A 4FDVA 1YR6A 4G9BA 3N3AC 3HYCA 3NRBA 2XDQA 1BG6A 5J4HA 4QJ4A 4BGIA 3M6VA 4Q9KA 4MHTA 2SKCA 5LP1A 3ZWVA 2VRCD 1J9ZA 3PT5A 4RYLA 1RJGA 1GPUA 1RYNA 5FDFA 2ZB4A 5AKXA 4ZQFA 3OQPA 1B6GA 1PL8A 1X3LA 3UJ9A 2PD6A 4AKEA 2HPVA 3H87A 1ZMBA 2IFTA 4DWVA 1TD1A 1VPVA 4HH3C 1KI6A 4BLQA 3L4BA 2AXQA 4LJRA 5JC8A 1GUYA 2PT6A 3COYA 3A1UA 2Y1CA 5K0LA 1O8CA 3NAGA 2P4EA 3ZGNA 3IALA 2VPIA 1JDBC 2EIXA 4MIKA 1MAHA 3FTPA 3QFRA 3UMVA 1H05A 1EXWA 5JSZB 4BWGA 1S9HA 1RC0A 3Q6MA 5BQFA 5HIKA 5HOEA 2YL2A 1U28C 1W87A 4RS4A 2I71A 1B2LA 1BCSA 1C0PA 1QR6A 5EL0A 1T0HB 4LMBA 1M6YA 4BVFA 4FHFA 2E85A 3DL4A 2FX5A 2OC4A 4I66A 2Z2JA 5E7QA 1KDVA 3TZ6A 1ZMOA 2J3KA 2QN2A 3EVAA 5A9RA 1T8RA 3AJEA 2V4UA 1XP8A 1XTZA 5CFRA 3G0IA 2Z0MA 5AIAA 4YRKA 4ZCIA 5C81A 4PYOA 3VBCA 1SRRA 3CLTD 5H3CA 1MP0A 2VN8A 4PNPA 1B2RA 1N77A 1GXSA 3HNOA 3RAJA 3T4XA 2FW1A 3DBLB 4YJHB 3S27A 4O33A 2NVBA 2PR2A 3DXYA 1RCTE 3KZXA 3WB2A 3B9QA 3WK4A 3ESQA 4QTYA 4QRIA 1QC5B 3I0NA 2VJMB 4GKJB 4IH9A 4MGIR 1K2VN 2YNMA 2QTRA 2R60A 3FIJA 5KNCA 3LD9A 1P0PA 2HW8A 2QRNA 2R7AA 4JQZA 3U7GA 1HLGA 2F1IA 2RGEA 4KE6A 3OOHA 5NLLA 1MFZA 3PR3A 4PAWA 2C54A 2I76A 3FWKA 3H8WA 2PTGA 2BEWB 2XQGA 3IFSA 1U2GA 4FZJA 4G24A 4L8GA 1H3NA 4LE2A 1LY1A 3M6XA 3UG6A 5BN3B 3QVLA 4JXJA 3F5MA 5FL7A 4ITRC 2JLYA 4X1KB 5ES3A 4NBTA 2PVSA 5HKAA 1PP4A 1OH8A 2A5FA 2Y99A 4CTMA 3JQAA 1PJAA 4MRPA 1Y3BE 4EBFA 1YZKA 2REXB 2X8JA 3GO4A 3OPMA 1WW2A 3CJRA 4JT2A 1N1MA 4A0FA 4D9KA 4P4SB 4AZ3A 1V71A 3DFMA 3EA0A 2OHOA 4XGKA 2OSBA 2ORIA 2J0UB 3S8EA 2XXJA 4HZUB 1K2WA 3FZYA 4B3MB 1O9BA 4C2BA 3AUFA 4A0QA 2QX7A 3ABRB 5B30A 1GAWA 4QDZA 1XMVA 3HCOA 2QD4A 2HEGA 4OMDA 2PJRA 5GM1A 2YWRA 1A7UA 2DVMA 1DFHA 4BJ5A 1CZRA 5K0EA 4YN3A 1LGYA 2EJWA 3O83A 1XPUA 3NX4A 4BLTA 4FXOA 5M04A 1CR4A 4ZXPA 1LPMA 2DQKA 3ZHQA 4KL8S 2OLEA 1ANKA 1KHHA 3R6WA 4Q3BA 4OFBA 4YRDA 3RSLA 4WFKA 2QU8A 4WK2B 1XXHE 1YZFA 2HMUA 4FFSA 4FHEA 4MW7A 2RHLA 3LBYA 4P7KA 1OIWA 2RH5A 3WBKA 1QMPA 4MB6A 1GR1A 4LOKA 4OP3A 3A3PA 5DTEA 3HBJA 4ZVVA 1ADGA 1W44A 4M0PA 3OHSX 4I1VA 2FOLA 4WZBB 2BEUA 3NYIA 4RTPA 3Q7QA 1KO1A 2UYQA 1S8FA 2XB4A 3KHKA 3QUSA 4WOJA 4DLYA 4EGSA 5C9ZA 4LF6B 1HLFA 1IXKA 2AOVA 3EVFA 4IDAA 1E3DA 4OXYA 2OV8A 3T54A 2W2OA 3ZLVA 1KJYA 4BO3A 4EWLA 5C3MA 3QI2A 1Q1AA 1MIHA 5C46F 1PT6A 3ANNA 4AZ0A 3LQ4A 2WOJA 2ZB2A 1ULAA 5DRTA 1YJ5A 4DJTA 4PGAA 1IBMB 3VNRA 4FYHA 5BOSA 3MJ4A 4CEJB 1E3SA 1ABFA 2RB4A 3KTAB 1QUFA 3EH1A 5IK2A 3GV0A 9GPBA 1WLSA 4CKCA 3TZKA 4CQMD 4YALA 3N2ZB 4XCQA 4ENUA 1NVAA 3PJFA 1A9ZA 4BX0A 1W5AA 1RADA 3AY3A 4HFJA 4DW8A 1SCIA 1G3UA 2VDWB 4L4UA 2X19A 4X71A 2VZLA 2NZVG 1YZGA 4O8CA 3SFZA 4D92A 3WGIA 1Y3IA 3HKEA 1FSZA 4UZFA 2CLLB 2PO7A 3GJ0A 4PYMA 4O8ZA 1NIJA 1OMOA 1XQ9A 1CE8B 1J0CA 4LF8B 1OTHA 1EDZA 3GZNA 3KOUA 3G5UA 2IH2A 4YCBA 1J70A 3DV0B 1T1SA 3W79A 4BFLA 2A7QA 4L4ZA 4CIWA 3ZQ4A 4J0QA 4AW9A 3A31A 4JUIA 2H3EA 3IL2A 1OOEA 1ODSA 3B9BA 5E4TA 3ECAA 3THXB 2WWVD 4C6TB 2DETA 4E5UA 2A67A 2O4CA 2FOXA 2YWDA 3EUWA 3VSDA 2CV1A 3CKKA 1HDIA 3QENA 4R41A 2J31A 1IZYA 4B3GA 1RBYA 4KQHA 1U81A 1AKUA 1I36A 3A6GA 1GJRA 3VVCA 5JS1A 2WK1A 2GEVA 2XF2A 3FJYA 5FR2A 3LXMA 3G8AA 1DIBA 1GLNA 2OGSA 1Z0UA 1B0PA 2SKDA 2GBLC 3M34A 1LVGA 4UDOA 4MCJA 5LBIA 2Q5FA 4KYVA 6GPBA 5CCBA 1L5QA 2IP1A 3LF2A 1G5FA 1BHQ1 2ZYDA 1CS0B 2O6LA 3TGPA 4GM4A 3LKBA 3N0RA 3O8OA 1RYFA 2QE7D 5I4BA 3P0RA 2B4KA 2XMBA 2ZUCA 1O95A 3GAZA 5UKDA 2GD2A 3SXUA 4BKMA 4IJUA 3NT4A 1E9CA 4QEZA 4ZMBA 4U4AA 4ZMSA 1DFIA 1DBWA 4KGZA 3SF8B 5ED4A 1G1AA 4DJEC 1F51E 4MVJP 3OD1A 4TXHA 1OILA 5D3KA 5BVHA 4KIWA 1LVHA 1GCOA 1B15A 1PVOA 1M2WA 1G98A 3OPYB 4U9IS 2AFHB 2DHEA 3SEQA 1OBCA 5CH8A 4DA6A 5GJWC 4GP6A 4LSGA 2R6DA 3EGWA 1GGMA 4DG8A 4PFSA 5IXJA 3MVEA 4R3UC 5D3MB 1Y6QA 3PSHA 4L72A 3L6DA 2DTXA 2VJNA 1RWKA 5JRJA 2X0RA 3WSWA 4IMIB 1JVNA 4DJ5X 4QUEA 4JEHA 1Q74A 2UZ4A 2HWUA 1Y3HA 5HRCA 2Q8QA 2W2KA 1Q6YA 2XBUA 3OM1A 2C61A 2QG9A 3HUUA 4HLUC 4ZD6A 2QJTA 1BE8A 3JY6A 3NBZC 7ABPA 3E82A 1SGWA 5L3RA 4WESB 3WYFA 4D57A 4KREA 4U2GA 1NX9A 3IS3A 3JD1A 4WV3A 3SZLA 5IFKA 2JCBA 3QF7A 1N2XA 1BMFA 5F51A 1R4MA 2BGNA 2XX3A 4INPA 4P86A 4AG5A 2Q4BA 1QJCA 2XCSB 4PPFA 3UANA 3ZWXA 3CWZA 3DH0A 1J2JA 1OTXA 1TCCA 9LDTA 5F4ZA 1YB7A 3AY0A 4D82A 3OESA 4G63A 3U9TA 2VO1A 4R71A 3TNDA 2QTCA 4Q82A 1I4DD 1VI5A 1A04A 4G5OA 2AMYA 4DB4A 1UWVA 3HGTA 1QPGA 2V59A 4B82A 1P2SA 2A5DA 5EXSA 5CK5A 3RVJA 3PNKA 3ZVLA 4AJOA 3ZVMA 3OLYA 3TLAA 3EWIA 2WAXA 4IILA 2DHRA 3C3WA 3GELA 1XYYA 1TO6A 3KYCB 4JUAA 1FFWA 4C0XA 4EJ2A 1ZAKA 2B9VA 1QOQB 2GM5A 3A04A 1DJQA 4YDHB 1HXHA 3F1KA 3AFMA 3LO5A 4LCBA 3UJNA 1C1XB 4HNSA 1PEAA 4UAJA 5LUAA 3NEYA 3MFYA 1U7UA 3UN1A 4BE4A 1UMDB 4Y1FA 2P2DA 5AW8A 1DUVG 2J0QA 3FMFA 1RAIA 3PUHA 2IVZA 5J2UB 3N0TA 1E69A 3WKBA 3OQHA 3W5BA 2VBGA 1ATIA 3GQBB 1XKXA 3D43A 4WOBA 1KA9H 3B38A 1JSXA 4PWYA 4REQA 4PZCA 1QVWA 3K15A 3AEUA 4B8WA 3QWAA 3ROEA 4TM7A 3EDYA 1CY2A 4V0KA 2W0MA 5DOVA 1T1EA 3NIGB 2R86A 2WV9A 1IXZA 4L74A 2FR8C 2GZSA 2WFAA 4PONA 3C2QA 3QQPA 4A8PA 3DVQX 3N8IA 3H3XA 4HEA1 2I7DA 2BUBA 4UMFA 4X1YB 2IYVA 5LQDA 4QSMA 4NYJQ 4L0QA 3ZY5A 2B8EA 4HPJB 3KUDA 5I7OA 3PDCA 2GK3A 4YCCA 4GBGA 5A06A 3L40A 5C80A 3MMZA 3TO5A 5GVRA 1EUCB 2O8DA 1M8GA 2XEDA 1ISPA 1WCYA 4LJ6A 4ZVRA 1S9DA 1XOIA 3T3DA 2FFHA 3OQIA 2X7XA 3JRWA 1GEGA 1E2EA 1COWA 4X6LA 3VZCA 1XCMA 3GEPA 2B1JA 4DLKA 2CMDA 2V5UA 3K4PA 3QBTA 4E03A 4P3PA 3FOCA 1ZK0A 3O1IC 1NURA 1KPGA 1Z07A 3DE6X 3DZDA 1WUYA 3KEOA 3HP7A 4FGKA 4J9VA 2BM8A 1RTTA 3WYDA 1X9GA 4RHCA 2XKBA 4RF2A 1AA9A 5P21A 3WY9A 2XUQA 4JAVC 1QYRA 1LJUA 3IE0A 3WLLA 1AUVA 1Y0BA 2QXUA 2KS6A 3LVFO 5K3CA 1J2YA 3OLWA 5AM2A 1K9VF 5JXJA 2CD9A 4MUAA 3TZEA 4TRJA 1UBUS 4N9WA 5CLQA 1UBEA 3P9YA 3T7EA 4EI2A 1DIOB 2OHFA 2HFKA 3FETA 3QVOA 1ZK3A 4R8RA 4H4DA 4HEA6 5FTMA 4GI3A 3USCS 5KNBA 3ND9A 3DZBA 1XXHB 1XZCA 5CHYA 1R5BA 2HT1A 4EUHA 1ZNZA 1EWKA 4FE7A 3T95A 1UC5B 3HMQA 2LKDA 1M83A 3SQNA 4C87A 2O3SA 3IBYA 2JD1A 2F1KA 2WRZA 2Y1GA 2GK4A 3CSDA 3PTLA 1SHKA 4YP1A 1JTFA 3UENA 4B6QA 1MN6A 4NLLA 4NCXA 4NE7A 2BGLA 1AC5A 2NU8A 8ADHA 4CGZA 4RX1A 4KRGA 1KDOA 1MXHA 3M5PA 4LV8B 1EXNA 3CY6A 4ACAA 1IQ0A 1UZMA 2JIMA 3GJRA 4LOLA 4M1QA 3T9FA 1TJ3A 1FXUA 5I4IA 4I50F 5J2TB 2IHNA 3T4EA 5DNEA 2B82A 2L18A 2PSFA 4WW0A 5HJEA 1VYHA 1Q77A 4WACA 5SYMA 2OB2A 4MROA 2XYGA 3ADCA 1P7PA 4F1KA 2DKNA 3CLSD 2VRCA 5HRAA 4MPTA 2V58A 5KTTA 4U5QA 4II2A 3BF8A 4AY5A 1JEQB 1V5WA 4JP2A 3BJIC 3R5HA 4UUBA 5CTJA 3RIXA 4K28A 1UEXC 3WKDA 2WWTA 4IAOA 4UD6A 4NI5A 3ZQKA 4A2WA 3KP1A 1H4SA 3ZXIA 1DTSA 2JK1A 4M1OA 3V8RA 5D3ZA 5JEEA 4RTRA 2ZYAA 1N5RA 3E53A 3F5DA 1UFKA 3FM9A 3H1EA 4GECA 4TSKA 1DRKA 1SU6A 4TV9F 1CCWA 1WMAA 1XEXA 3L0PA 5IABA 2QL7A 4J49A 4LZZA 2QAIA 1A97A 3JYLA 3A9UA 4C30A 2OHHA 3L0OA 2MSWA 2YFKA 2JGLA 3HDVA 1Q3TA 3K4QA 4JBWA 3SXJA 2B4AA 1KAMA 2OWEA 4IRXA 1RE0A 4FMBB 1PFGA 2PMDA 1YVDA 2NNLD 3H5LA 3JQRA 4HQ0A 4LDQA 4PLHA 1WKVA 2IIQA 2L17A 3I92A 3N2LA 3CNHA 10MHA 4NJMA 3HP1A 3DLTA 2UUCB 3IIJA 5AVJA 5EEHA 3TINA 1NHGA 3QLVA 4K2HA 4TN1A 2ZCUA 2ZIFA 2CFCA 3LIIA 3NM4A 3MGKA 4FR5A 1UKVY 1Z13A 2Q9BA 4H1HA 4E7OA 1UKEA 1KDPA 2R6R1 2YJ3A 1LDMA 4IZ6A 5JE8A 1UJ4A 2RGGA 3GUVA 3OF2A 4NKRA 2FXIA 4NH0A 1NVGA 4CTJA 4DQUA 5A5FA 9LDBA 1DJLA 2WF8A 4XRGA 3REQA 1OT5A 3QV2A 2OP1A 5I5EA 2E48A 2ZJAA 3EXEA 4MZDA 1USIA 3IBTA 2OCPA 2G76A 2WJGA 4NEQA 1YRBA 1E9FA 4BQNA 4S1TA 4E88A 1XI2A 3CUYA 3HH8A 2WUFA 1W2GA 1KNQA 3N70A 3QM1A 3GGCA 1N6OA 2Y0CA 1XQ1A 3CEPB 4KLRA 4R1MA 2ZIXB 3I5MA 1NVEA 4URFA 3ZZ0A 4IY1A 5ALIA 4PVDA 1EGAA 1HQDA 3HY4A 2VNSA 2P3SA 3QWIA 2ZUBA 2JHFA 4H3VA 4KZPA 1JLHA 1KMNA 2FPRA 1NHWA 3ISVA 4CM9D 2HCTA 3Q10A 5AW3A 5JWRA 5IVHA 3ZDFA 3L5OA 1FJ2A 2IU0A 1WDWB 4OYLA 3A6EA 2AOWA 1I2AA 1QH9A 3V8MA 2GGSA 3VH2A 4AJ2A 1ECCA 1XQYA 3N2GA 2F1OA 1GGKA 1U7WA 2X1HA 1TXGA 3AFHA 2WNIA 3FVTA 3OFSA 2W6MA 3HXPA 4RYDA 2NT4A 8OHMA 2QD3A 2R2GA 4W9MC 1QIDA 3TQRA 2ZM6B 4ZCPA 4IVPA 1TJ4A 1AGXA 2QG6A 3L7JA 3RRJA 1PZFA 1W59A 4UARA 1U3TA 1VMIA 1RYDA 3S0JA 4I8IA 4QUHA 2P2NA 4GNRA 1RYHA 4RV4A 4Y1EA 1VDMA 1BTOA 2C84A 1TRHA 1Z2CA 3MUFA 1XCBA 4A5OA 3C6MA 4BRSA 4B09A 2P41A 1SOVA 2FW8A 3TSWA 3LC2O 3PGJA 1U7HA 5BT8A 4C01A 4ZDJA 4DBVO 2W2XA 1EINA 2W2NA 4IYRA 1XD2A 3KUCA 1ESEA 5HYVA 1T43A 1G1MA 3BGSA 1U7XA 4RQUA 5E3IA 4L51A 4B4KA 4WA7A 3SJ7A 1GN9A 1EK6A 2HQBA 2P5SA 4R7ZA 1ACLA 4IIJF 3N05A 1JXMA 2YW9A 3R76A 3KSBC 1PL0A 4G5FA 2FLWA 4RVHA 4NDAA 2FWAA 2FVYA 1TCBA 4O63O 5FWXA 2P6OA 2F8SA 4LHZA 2CXHA 3PPWA 4N39A 1ZJJA 4R1QA 1ZAYA 4ALIA 4HDNA 5C31A 1ZMTA 4E31A 1QP8A 2VDUE 3R44A 1QH1A 3DTNA 3PXDA 1K5DA 3KU4A 4AWAA 1QPBA 5D5PA 1D04A 3CZMA 3LCUA 3VC7A 2EP7A 1E3QA 4EEXA 3UFBA 2EJCA 2ERCA 4F6RB 1ZIYA 3M2TA 4HVCA 1W1WA 2ZKIA 1YASA 1Q7GA 4JUDX 4CQMA 5EIOA 5IAAA 1U1DA 3OO1A 3EY4A 1JDTA 3KYJB 2CJPA 3Q5EA 4IX1A 1TM3E 4JJKA 5DCYA 5FJIA 3SQLA 8LDHA 1HKUA 4OXQA 3V1NA 2VG8A 3O1HB 4MW4A 1YDFA 2R00C 4I1SA 4JB0A 3CMCO 1XRLA 1K66A 1TAQA 1QP4A 1P1BA 3E7WA 3C15C 2OFFA 1RM5A 3UCFA 2R5WA 1M73E 2R2AA 3KAPA 2D59A 4DC1A 3MWEA 4ATNA 3O4IA 1T3ZA 1SCUB 3SBEA 1W49A 2LXNA 2VT2A 3OIDA 4MGEA 3JAMA 4F4IA 4UOEA 3IAM1 2PFGA 2CFSA 1RLJA 1U7TA 3MJSA 1BMQA 3LKVA 4OUDB 4XRRA 3ZU3A 3OLXA 3WNZA 2C9YA 1T34A 3DDCA 2YMQA 1XF1A 4RLSA 2W6OA 1Z0KA 1ITZA 4RLHA 1T9GR 1ZEMA 2Q0SA 4OHZA 4P2BA 3SR4A 1KO7A 2AUTA 3IR5A 4ARSA 4XYLA 5LNK6 5KNDH 4W1RA 3LLSA 2DPYA 4ZRNA 4W8GA 1G17A 1NM5A 3UKDA 3WAGA 1G59A 1X80B 4MITA 3EA5A 4YK7A 4BUZA 4CCYA 1FP1D 1KZ7B 2AYYA 4KPUB 4NHEA 4AYTA 1RRMA 5JIBA 1TKAA 4P93A 2PANA 1CU1A 2PU5A 2GEDA 4EKEA 1WPRA 4EPWA 2WU0A 1VLQA 1ID8A 3TW8A 4NENB 2VJLA 1NR1A 2QE7A 4LE0A 9MHTA 5T57A 1VSBA 3S55A 4CMAA 5EJMA 2LP4Y 4Y7CA 1VE6A 2VKQA 2HUPA 4QDOA 3V7FA 5KYUB 5LXTB 4R2HA 2AHOA 3PCRB 3BJMA 2KX7A 2ID7A 2VHYA 4FN4A 4K03A 4RMNA 2VPYA 2C5SA 3TIXB 2J9YB 3T5AA 5B12A 4AX4A 4Q01A 4EW1A 1RXYA 4RFLA 2FUEA 4US1R 4Z8XA 3LRTA 3C4QA 4UFPA 4D81A 1CZOA 4E33A 2QQGA 4I08A 1FS6A 1KI7A 3IVRA 5F2KA 3RBXA 4AJJA 5A03A 2MJLA 3VUEA 1GZ7A 1OYWA 5JPDA 1XDZA 3N8HA 4I4TA 4L4RA 4DBLC 2MTBA 2WA2A 3OF3A 1Q7TA 2XXBA 1B4DA 1XAIA 2POQX 3VYWA 5FD8A 2I2DA 4YO8A 1VLJA 3LVQE 1WMEA 3PXBA 2XODA 4MNTA 3QX7A 4Z2AA 3ADPA 2XWQA 3OKPA 1KP3A 3IMFA 2KQUA 1SXJC 3TB6A 1NW3A 4CKBA 4DR4B 3MJEA 1VRWA 5JSYA 5BR1A 1NP7A 3H1BA 2REQA 1M1NA 1ZOPA 4QT0A 1ECGA 3WFIA 3E0XA 5JH7B 3H05A 4Q4CA 1OPRA 3H9JA 2JLBA 3AK4A 3GLRA 4M54A 2J5QA 3GLHB 1LPBB 6Q21A 2HQRA 2IPAB 4ITVA 4G0UA 4ILKA 4HUQB 4JX9A 1A8QA 2P77A 3CG0A 1A7KA 2HWYA 1P6QA 1ZI9A 2WYVA 2DC1A 4G37A 4AVYA 4JXXA 2OV4A 1EAMA 4ZZ0A 1Z63A 1JHDA 3UZUA 3L6RA 2F55A 3W4KA 4EG5A 3EA4A 1FXWA 1YRLA 3OTGA 4I6EA 2G0NA 3O8QB 2IUTA 4HVTA 4PEVA 4R5MA 5DNVA 5EYPB 3JCZA 4IIBA 3QE4A 3AOEC 4TM8A 4DDUA 3CTMA 3R4VA 2NX2A 3ZXXA 4DSAA 5CG1A 4C7KA 4NG4A 3G8DA 4PRZA 2OGZA 4Y6QA 1L4UA 1T3TA 4C05A 4DV4B 1VKNA 3ZY4A 2XT9A 4GRAA 2O8FA 1I3KA 4OAOA 4LC0A 5IXYA 2HCRA 1OGIA 3OX4A 1VMAA 4FZVA 3C8UA 2ZUDA 3RJMA 2JBAB 1V11A 2XT6A 4X84A 5I7RA 1XJCA 4C04A 3ZXSA 3H9QA 2VUHB 3HP4A 3L1UA 5EPUA 2WWHA 2XRMA 1VCHA 3O8NA 3N5KA 4F8JA 4NFLA 2LUOA 3G9QA 2H4WA 3O9ZA 2Z6AA 3P9XA 3U81A 3CX4A 4BNLA 1Z5OA 2VHZA 4KFUA 3TLEA 3UGTA 4BMZA 3CCCA 2IITA 3IT2A 3GAAA 3I01M 3IEIA 4QM6A 3BGIA 1CQJA 2JZOA 3NXKA 1J2UA 3OUUA 5F2NA 1BFKA 4KN8A 1SXPA 4KXVA 2X0IA 2R1UA 5J4VA 2PMFA 4QPJC 4MICA 2H1OA 1W4RA 3GRVA 3HUTA 3K0CC 1RJ9A 2C42A 3WLJA 2NUAB 5BNTA 1XZBA 4FFBA 3WRWA 2OMEA 4NR0A 2QX6A 3ZY6A 1E2NA 1MBZA 3MILA 3SYNA 1MQAA 2QTBA 3HJNA 5AOAA 1UH5A 2CD7A 4JU9A 3WDMA 3PNYA 4AI6A 3O3CA 2CNWD 3KSDO 3TD6A 4YT8A 3ESCA 1PFUA 5AD1A 4M88A 3I6QA 3SZOA 2XITA 3QA3E 4DADA 3EC1A 3D2BA 4RIIA 3ACCA 1ONBA 5D85A 4J90A 1XL1A 3VR5H 2P27A 3JVVA 4QGFA 1CY8A 4NNJA 2P78A 3P9ZA 2VSYA 3DMDA 5DEIA 2DGDA 3CLRC 2IOFA 2H1HA 4JB2A 2QGNA 1E98A 2X6TA 4XDZA 5DM1A 2EZUA 2QDKA 5K20A 3U7FB 2E49A 2DBQA 5AUOB 1E1NA 3AFGA 3QU5A 1T1RA 5A02A 4RA6A 1YE5A 2ZZKA 4KQCA 3KNZA 3AR4A 3LK7A 4RDXA 3KJFA 2P90A 1W5SA 1QCZA 1C1HA 2IGBA 1G21E 2PV7A 4DPKA 3T1HB 4F4FA 4YJFA 4BNKA 5CA1A 4MDEA 1HFEL 2XMCA 1SCAA 2PL5A 2WIBA 3E1SA 4N40A 3KQHA 1XDWA 5ITWA 3HRIA 5EQJB 1KY5A 4UEOA 5IARA 4DLAA 4EJMA 3U44B 3O2QB 4FBGA 4F3NA 2I6SA 5IDWA 4YAKA 4M9CA 4BASA 1TGYA 1G5TA 1R15A 4EY5A 1F2TB 2VUUA 3NANA 3EIEA 3RFFA 5C1BA 3Q3GE 4POAA 4CMEC 2IYYA 1HDXA 1Q12A 2KBFA 1JFTA 2JI7A 5JVDB 3UHAA 2M1ZA 1HMYA 4DEVA 3T61A 2FCAA 4MVJH 2PUHA 4FZRA 2WABA 3HJTA 5FHRA 1BOOA 3W77A 1EGMB 1I5RA 2Q4TA 3BWYA 4G0MA 4OKNA 1AMOA 1SKUA 1ZQ9A 3A3NA 3K8OE 1KVRA 4QXAA 5FRDA 1T9GS 3JYPA 1X1QA 4XX0B 2XMPA 1PGPA 1X2BA 3E5MA 4N18A 5FBHA 1I7DA 2DUUA 5EE5B 5FEMA 3C3EA 1VGRA 3VJLA 3ZGVA 2IYTA 2C20A 2V7BA 1V8BA 4U2CA 5DT9A 4CFZA 3H5RA 3I01A 2J5XA 4RK7A 4LXIA 1COZA 3T5PA 4W9NA 1KJNA 1QIGA 3C1UA 1WW8A 1XLUA 2YJ6A 3GA7A 5AT1A 1BXGB 3DEIA 2VSNA 1ZLXA 3R6TA 1R6VA 3CE6A 4IXMA 3GPBA 3OJEA 3P2EA 3FHCB 3PHGA 4PTYA 3U80A 3X2EA 5CB4F 5JJBA 2VDLB 2H11A 4I9HA 2DZDA 4M0EA 5F2OA 1Z7GA 3NHLA 4EGJA 4KXFB 4YP6A 4YCSA 3KBOA 4BJHB 2HMAA 3CB4A 4JLWA 2PMCA 2XVZA 5BXQC 3BHIA 4G8DA 5JNTA 3C6XA 2VPWA 2W8ZA 3C98A 4A16A 1ZVQA 1TMOA 2H9AA 3IUJA 3L6UA 3QTTA 4PPQA 5K3DA 4A8JB 3VZSA 4MS4B 1IPEA 1T9BA 1IMJA 1JLKA 1LF0A 3T1QA 4D6PA 4HNHA 1KQFA 1Y6RA 1Z2DA 2XGOA 4HRXA 3O8LA 5A5GA 4HADA 4DC0A 2O0JA 3CSUA 3RF7A 3VXKA 5JZBA 1ZUWA 1DJPA 3NVDA 3BWEA 3IAHA 4H3HB 4PIVA 1MORA 4FHGA 2Q2QA 3Q6NA 1GPDG 1T5DX 4AJHA 2R6HA 3N86A 2VS1A 2TYSB 3R6LA 3T3EA 2Q7XA 3LPDA 2OYRA 4PSDA 1S4MA 4YJDA 3VR6D 5FUXA 1RSZA 3ZWDA 4ZT3A 1M7BA 1ZW6A 1Z4IA 2Y1LA 4OXKA 2HK8A 3KQMA 4FFLA 1K7SN 4PYRA 4R1NA 3NUQA 3T3NA 2VF2A 3EXG1 2QRVA 2PLWA 3G5TA 5T6MA 1VE3A 1DUSA 4JP1A 1A9YA 1GGNA 2OXEA 3B48A 4XDYA 5B57C 2F90A 2IYSA 4MAMA 3WBJA 3JQDA 5B2ZA 4WK0B 4BNWA 1ORDA 3KQWA 1UJNA 3QP9A 4JLPA 2XNJA 4CM9A 2NOAA 1KMHA 2VDJA 3RYTC 3DMPA 3GJ4A 2VRBA 4J8PA 2DR2A 4EAQA 4BUJA 2YXLA 4EZIA 1VJ1A 3PBKA 3W5DA 1GYQA 3OZXA 4RWZA 4XARA 3GGPA 3IDFA 1F8XA 1U80A 4J1NA 1AY0A 3OTHA 4DCVA 2BFDB 4FHCA 4S1VA 1QRAA 3WC4A 3UYLA 2BFFA 1KO8A 2B0JA 4LQLA 1EWYA 1KXZA 2ZOSA 1UZLA 2JJ2D 1T5TA 3PJDA 1GKLA 4O29A 5ALOA 4JXZA 1EVZA 4B6PA 3IGFA 2J9RA 1F9AA 1VXOA 3AP2A 4EYSA 5JC1A 3CVVA 1YD7A 1LLFA 2B7CA 1HE2A 2HM7A 2CLCX 2I9KA 1B41A 4DLVA 2J5KA 4I0WB 1J99A 1XK7A 3E8SA 1GNTA 1BVUA 2I1QA 4OHXA 3FLMA 5FTLA 1Z6YA 3UATA 3CVWA 4F7DA 3EIFA 4MGZR 3TNFA 4C0KA 2C9DA 1UXGA 3GGOA 1IHPA 3BE4A 3CPHA 3A9WA 3G2KA 4PRLA 3WL3A 1LA2A 1PYOA 2OBYA 1B1AA 4G5SA 5J4LA 2QF7A 3B85A 4V0ME 3PQ7A 2QX4A 5JSZA 4UXHA 3GZ4A 1U9YA 1YA6A 1DAKA 2PL1A 3AY6A 3JD2A 2D1RA 2RGNC 3UG7A 2MU1A 1QFZA 5ICFA 3IPAA 3M81A 3STTA 2I4MA 2AG6A 3GLKA 1X3SA 3TTWA 1I3NA 3ADDA 2BI4A 2WC1A 4ZQGA 2WR8A 3EDCA 2O3QA 1XD9A 4FMDB 4F4CA 2WIKA 3NEAA 5I7AA 2YS7A 3HMKA 1RM4A 3PF9A 4IGAA 1DBIA 4N0EA 1W5TA 1PTKA 1VHJA 2FW0A 2F48A 2OPBA 1EI9A 1KJQA 4HX2A 5EKUA 4B32A 1MX5A 4RACA 4WLFA 2FMUA 2P4HX 1MB3A 5M5BA 2ACVA 2G25A 3FMPB 3PGVA 3R0VA 4WOPA 4R2KA 3DOEA 3LKZA 3NAMA 4RW0A 5DLPA 3ROGA 4F3YA 3AO0B 4G56A 1U2QA 1EDBA 1KSGA 1GZSA 5C8YB 5KVVA 3UJ6A 3IVCA 2VJPA 3DBLA 3VPFA 5B55A 4ZV7A 2I1LA 2F8TA 2P67A 2WYHA 4UAVA 2EERA 4JJAA 4HNAB 1QC5A 2ZBDA 4NF2A 5FULA 3C7KA 1ZHFA 2VJMA 1JB9A 3A32A 2AZDA 3R0XA 3EF1A 3PJEA 4B6GA 1WPGA 5GINE 2NU7B 1F0NA 3FPLA 1YUBA 1ZI8A 1GTRA 1E1LA 3PQ5A 4MVXA 4C20A 3R3UA 3NG1A 2Z8YM 5H02A 1DCTA 4WCFC 4CMHA 3URKA 1NQ5A 3JS5A 3QXHA 1Z12A 4MYSA 1YC2A 2W6NA 3TH5A 4YP9A 1JX6A 2EU8A 2VYQA 5AJXA 2BEWA 2FR0A 5COBA 4BNXA 1EUQA 5BN3A 4DCCA 1H0RA 2VJQA 1FPMA 4PYNA 3WVNA 2BFWA 1UBGA 4TYYA 2VF4X 4LTDA 4X1KA 4OJYA 4P7BA 5F78A 2C2ZA 3UCXA 5JDCA 1NVTA 1QO9A 521PA 3TLCA 4D1YA 1XC7A 3HYNA 3NWJA 3I52A 2G7ZA 1L7AA 2JI6A 4P4SA 5H80A 3K9QO 3B8HA 2J0UA 3TFWA 4HZUA 3NT2A 4ZVTA 5IKPA 1XL0A 4D8VA 5FHQA 2D1FA 2PA0A 2QAJA 2BDTA 221PA 3A27A 3IKLA 2R1TB 2C9OA 4QWMA 4ENRA 2XLBA 2P5TB 2Q6VA 3KUUA 2ORYA 1F5SA 3KWMA 1LDYA 3MAJA 4J7XA 4NQRA 5D5HA 2O4UX 2I4IA 3U3RA 3LHIA 4FWBA 1WBDA 3HR8A 3K30A 2BSAA 1J1IA 1LEHA 2O7RA 1LBQA 3JQBA 3RK1A 4EHDA 3EODA 4W1QA 3EISA 5DTJA 1V5IA 1Y4AE 1SXIA 3T3PB 1G6OA 2B4YA 2FHSA 4FINA 3R40A 3CRRA 3CF6R 4U2EA 3DJYA 4A8HA 3PTZA 1JWAB 4U6SA 3JQFA 2I3GA 1SJ9A 1VSQA 2I6FA 4O4HF 5JQGF 4YV7A 3HRKA 5ANRB 2QS9A 3KEQA 3QXCA 2CBGA 4PCLA 3GFPA 2P4QA 2B2NA 2GTHA 2FFRA 2VUIB 2V0GA 2PN1A 2G28A 2EXXA 4WZBA 4TZKA 4CLDA 4GZLA 3E9ZA 4WGGA 4DCMA 4QO8A 3G8BA 3DMYA 3FD8A 3NHRA 3O1JC 1G19A 4Y2JA 1SIUA 2IF0A 2UZ1B 4UKDA 2BSQA 1FMTA 4OQ4A 2A88A 1G64A 2WZBA 1Z8HA 1VZ2A 4HG2A