3JWGA

Crystal structure analysis of the methyltransferase domain of bacterial-cthen1-c
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
200
structure length
195
Chain Sequence
NLNQQRLGTVVAVLKSVNAKKVIDLGCGEGNLLSLLLKDKSFEQITGVDVSYSVLERAKDRLKIDRLPEMQRKRISLFQSSLVYRDKRFSGYDAATVIEVIEHLDENRLQAFEKVLFEFTRPQTVIVSTPNKEYNFHYGNLRHRDHRFEWTRKEFQTWAVKVAEKYGYSVRFLQIGEIDDEFGSPTQMGVFTLGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Methyltransferase type 12
publication title Structural and biochemical insights into 2'-O-methylation at the 3'-terminal nucleotide of RNA by Hen1.
pubmed doi rcsb
source organism Clostridium thermocellum
total genus 63
structure length 195
sequence length 200
ec nomenclature
pdb deposition date 2009-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08242 Methyltransf_12 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3jwgA00
3V8VA 5T6BA 4YV0A 2BM8A 4HGZA 1JG4A 4LWPA 5FA5A 2N47A 3EGEA 1EG2A 4CTKA 2IBSA 2ZWAA 1ZHFA 2ADMA 1EJ6A 1YFJA 5CVEA 2I9KA 2H1RA 3NWEA 2ZCJA 2PVCA 3GWZA 3CJQA 3EVAA 2PBFA 3M6WA 4QVKA 3PVCA 3SR4A 3ORHA 3M6UA 4GQBA 5K0GA 3ANXA 3EVBA 3FUXA 3THSA 2YXDA 3TOSA 3PTAA 2ZZMA 3GIWA 5F2OA 3GRVA 3LCUA 4E70A 1RJGA 2JHAA 2JJQA 5DTMA 5K05A 2PX4A 1SKMA 4RTOA 3GU3A 1R00A 3G5TA 5E2AA 3JWGA 3ER8A 2O07A 1O9GA 2CL5A 3HA7A 4ATNA 3X0DA 4AZSA 3G2PA 3Q87B 4QTTB 2ZSUA 4IKPA 4BLVA 3NDIA 2IBTA 5EKUA 4UOEA 3GRZA 5DRYA 2V74B 5LQUA 3TR6A 1G8AA 3HCBA 4PYLA 4CTJA 3P9KA 3SVZA 2PWYA 3LECA 5JR3A 1JTEA 2H00A 1X1BA 2OB1A 3UWPA 3KQOA 3BGVA 3CVOA 3GCZA 3SGLA 4DF3A 2AOTB 3HCAA 1PRYA 4PWYA 3TFWA 4WVLA 1M0EA 1ORIA 2H11A 2XVMA 5GINE 2AOTA 4KIGA 1R74A 2Z6AA 2Y1WA 3B3GA 4A6EA 4RX1A 5HIMA 4LECA 3P97A 1D2CA 2ZBQA 3OFKA 3U81A 2CKDA 3B7PA 3BKWA 1IY9A 3OPNA 4KW7A 1INLA 2KW5A 3LDFA 4PYQA 5E9JA 3KPUA 5LQCA 1JSXA 1G6Q1 5E2BA 4ER0A 4GF5A 2CMGA 2YXEA 5EC8A 3THRA 4P7FA 4U7PB 1JR4A 2WA1A 5K0NA 3S68A 3G89A 1RI2A 4DM3A 3G2MA 3KQPA 2OPBA 1EIZA 1G8SA 3MCZA 4IWNA 4PINA 1HNNA 4MIKA 2VZ9A 5U4XA 3UJDA 4LG1A 2C7RA 2QE6A 3H2BA 3T7SA 3UJ9A 3K6RA 4HRAA 5LQRA 5BXYA 1Y8CA 3LDUA 3EMDA 1JG2A 2JHCA 3M4XA 2ZBRA 2PWPA 3KQYA 1KP9A 3FYDA 3JWIA 2NP7A 4C04A 2VDUE 2NXEA 3REOA 4GOLD 5EIFA 3OU7A 5ICGA 5E9WA 3EEOA 5LR6A 5EQJB 1AQJA 2EFJA 4GOND 3EVCA 2AR0A 1G60A 4NECA 5FULA 2ONYA 3EMBA 3KR1A 2F8LA 3G88A 5EMKA 5K0BA 3LGAA 5DXJA 1UFKA 5EHIA 1VP9A 4CWAA 5LQNA 2OBFA 2OKCA 3NW9A 4BLWA 1WZNA 2WA2A 2VDVE 1AQIA 1OR8A 1XDZA 1G55A 3C6KA 3GRYA 3E8SA 3BWBA 5K0CA 2AOWA 3HEMA 5H02A 3PX2A 4P7JA 2NYUA 1D2GA 2AOXA 5GWXA 3HP7A 3TPZA 1KPIA 4RV9A 2YR0A 1RJFA 4L7VA 3UZUA 3P9IA 5D1NA 1FP1D 5DXAA 1P39A 1NE2A 3BZBA 2WK1A 4FS8A 5EEHA 5JUWA 5K8VA 2P40A 1FBNA 3P71T 3FPEA 4C08A 2FHPA 3I9FA 2DULA 5K01A 2NP6A 3FUTA 1H1DA 4AZTA 4MWZA 3HCEA 4OA8A 4X41A 2BR4A 1L9KA 4Z2YA 1NKVA 3GRRA 3OU2A 1QAQA 5DSXA 2BM9A 5E1MA 3TM5A 5GIPE 2B2CA 2AVNA 4X61A 5B1SA 5FA8A 2IH2A 2Y1XA 3NDJA 1NW6A 3I53A 1JQ3A 3G8AA 4QDKA 3FRHA 2NXJA 2XYVA 4RTMA 2IDJA 3E23A 3MQ2A 3UBTA 5M5BA 5C9ZA 1JQEA 4HTFB 5CVVA 5DM2A 4B17A 3MB5A 4X63A 3SM3A 3BWMA 2ZULA 4HTFA 3A26A 1RI1A 3TM4A 5EHGA 5DT2A 5FUBA 3CGGA 5HILA 1V39A 3FUWA 3HNRA 4GOOD 3VC1A 5LQJA 1SUIA 5IH3A 3EVGA 5DSTA 4OX9Y 5DM0A 3FYCA 3OZSA 4GOMD 2HMYB 4CKEA 4RTPA 3A7DA 3UJ6A 2O06A 2IIPA 5CCXA 5FQOA 3KU1A 3OFJA 1Q0TA 5HFJA 5GM1A 2ZVJA 4RSRA 3MGGA 4ISCA 1SQGA 5P8WA 1EJ0A 1VLMA 1X19A 3A7EA 3C0KA 5E1OA 3RW9A 5LSAA 1XCJA 1VPTA 3GRUA 3NVMB 5EMJA 1JG3A 1KYZA 3M6VA 3VYWA 4E2XA 3KQMA 2FYTA 3KR2A 5FWAA 1MJFA 1VBFA 1Z3CA 2O57A 5ERGB 2UZ4A 5EEGA 3DTNA 4PYKA 4RTSA 5F2NA 4PYNA 3KPJA 4YUZA 2ERCA 3BT7A 5T67A 4LWOA 4GC5A 1KPGA 1P1BA 2HTEA 2ZW9A 1NW7A 5EPEA 3VSEA 4E2WA 1SG9A 3B3JA 3SSOA 2GA9A 3R0QA 2UYQA 1I1NA 1O9HA 2P7HA 4OQDA 5E1DA 2ZLBA 2PXAA 1RI3A 3OE4A 5CM2Z 3QOXA 3B89A 3C6MA 4AX8A 5K0EA 1MHTA 1ZKDA 1X1AA 1UIRA 1X1DA 5EVJA 5EZSA 1R6AA 2PT6A 3AY0A 3FUVA 3DLCA 3QOWA 4FT2A 4ER6A 3P8ZA 3DUWA 4DZRA 5CVDA 1T43A 3JWHA 4QDJA 3B5IA 3FUUA 3IHTA 2IH4A 2FPOA 2R3SA 2IGTA 1L1EA 1AV6A 5GOZA 3M33A 2I6GA 3PS9A 2O0LA 4O29A 3OZRA 5ICFA 1EQAA 3GO4A 2CMHA 2B9EA 3GNLA 4M38A 5GIOE 3EVZA 2ZTHA 3LSTA 3P9CA 3K0BA 5FWDA 2GB4A 5DRTA 1R18A 3WSTA 3A25A 1PJZA 3BKXA 3KR0A 4C05A 1TW2A 1BHJA 5KS2A 3D2LA 3E7PA 3ELUA 2NXCA 4F84A 4OQEA 3T7TA 5K03A 3P9NA 4HG2A 2ZBPA 3CKKA 5DLYA 3LX6A 2P3OA 3OZTA 1XJ5A 2OYRA 2I7CA 1VL5A 4C07A 3ER9A 1D2HA 2ESRA 4YMGA 2PT9A 3FTDA 3BUSA 5CVUA 3G5LA 5FHQA 3SMQA 3FZGA 4RVDA 2YX1A 2B25A 3FTFA 1NW8A 4JXJA 3JWJA 3ME5A 4P7KA 4YUYA 3QV2A 3LKDA 5KQRA 3HCDA 3AXTA 3HA3A 1QAOA 4ZTBA 4H0NA 5F2KA 4HC4A 1P1CA 3HVJA 2VP3A 4RVGA 3SSNA 2OZVA 1ZG3A 4PONA 1QZZA 3T7RA 3PLAE 1KPHA 5HZMA 1N7JA 3P2IA 4X1OA 1R8XA 3C3PA 3UA3A 4EK9A 2YUIA 2GLUA 4DMGA 3UFBA 2PGXA 2PX5A 3DMFA 3FPGA 4QQKA 1XCLA 5K0JA 3KR9A 2I62A 2ZZKA 4DKJA 3OU6A 1NBHA 4DA4A 4QVGA 3RODA 3UJAA 3L8DA 5G02A 1KR5A 2XYRA 3HTXA 1JQDA 4P7GA 3NJRA 2ONZA 4E2YA 2AZTA 2JH9A 2QRVB 1U2ZA 2G72A 2XYQA 1FPQA 4X60A 4QQNA 3SXJA 2O05A 3PT9A 4KIFA 4PIPA 4EKIA 2IH5A 4FP9A 1RI4A 3V97A 3KPVA 1NV9A 2QRVA 3B3FA 4GEKA 5HIIA 3UA4A 2P41A 5EMLA 3LBFA 2E5WA 4GC9A 2DPMA 5E1BA 5IKMA 4IV0A 1B42A 3DXXA 5HIJA 4DCGA 2FK7A 2PSSA 1XTPA 3DXZA 2YXLA 2OB2A 4HGYA 4KVZA 3GDHA 1DCTA 3TKAA 4E33A 2G71A 4KWCA 3T0IA 1QANA 4EVIA 4FR0A 1WXWA 1N7IA 2Q41A 1F38A 2EJUA 2GS9A 5FHRA 5LQKA 1YZ3A 1IM8A 1SQFA 3P2KA 4PCLA 1ZGJA 3AWIA 1VIDA 2IDKA 2B3TA 4KDRA 1EAMA 2BH2A 3TQSA 3DR5A 2GH1A 3A27A 1TW3A 3BGDA 3I5UA 4YUWA 3R3HA 4DQ0A 5K0LA 5E8RA 3IV6A 4R8SA 5E8JA 3AJDA 1JTFA 1G38A 4EQZA 2EG5A 3KKZA 4PYJA 3LCCA 5CIYA 3R9XB 3PFHA 3KQTA 1XDSA 3M70A 5FTWA 1P91A 2P7IA 4FGZA 5LQAA 3KPWA 1DL5A 1L3BA 2NNWB 1N2XA 3EGVA 2B78A 3NWBA 3PB3A 4GBED 4PCAA 4AZWA 3EGIA 4C03A 3LHDA 1QAMA 3OE5A 5BW5A 5FADA 2OO3A 5FCDA 5D1HA 5DTRA 4MTLA 3IEIA 3LCVB 2GPYA 2CWWA 3C3YA 4DCMA 2P3LA 2HR1A 4BP1A 3ELYA 1XXLA 2ZWVA 1X1CA 3CBGA 3EVEA 4RTRA 5GM2A 1I4WA 1BC5A 3A4TA 1YF3A 5KQSA 4MHTA 2FK8A 3DXYA 1XDUA 4HH4A 1QYRA 2HNKA 4Y2HA 2OXTA 3MTIA 4XUEA 3HCCA 3FRIA 4U7TB 2Z6UA 3UJ8A 4FZVA 3KQVA 1ORHA 2ZFUA 1VQ1A 3BWYA 2UYCA 5ICEA 4PNEA 2K4MA 5MHTA 8MHTA 3FPJA 3KHKA 2AOVA 4GUAA 5DX0A 3CCFA 5T64A 3TMAA 4ER5A 2ZIFA 2FCAA 4IV8A 3VC2A 3ID6C 4FT4A 4PYIA 4RTLA 2JH8A 2QY6A 3LL7A 4RYLA 3UJCA 4M36A 4RWZA 1I9GA 5DWQA 1YZHA 1Q0SA 4WXHA 4RTJA 2IP2A 2C7PA 1R8YA 5FQNA 9MHTA 1RI5A 1NV8A 10MHA 4BY9E 4AZVA 3AXSA 2P35A 3G7UA 3PFGA 2C7OA 2AN3A 3BGIA 5DTQA 5EKXA 3RIEA 3TRKA 3DMGA 5ICCA 4YV2A 2ZZNA 3FTCA 2BZGA 2VS1A 4R8RA 4E30A 5CD1A 1TPYA 4V0RA 3SSMA 3I58A 3O31A 4R6XA 1WXXA 1AF7A 5K0FA 1BOOA 1RJDA 3O4FA 2XBMA 3Q7EA 3HVKA 2VDWA 2IPXA 3G2QA 2P3QA 2C7QA 2G1PA 3EEYA 2PJDA 4C06A 5DM4A 3P2EA 1KHHA 2G70A 4V0QA 4RTQA 4C4AA 2AN5A 2PXXA 4M7RA 2Z6QA 3KQWA 2JG3A 5HEKA 1IXKA 1VE3A 4KDCA 1F3LA 3DP7A 3EPPA 4PGHA 1WS6A 1SUSA 2HV9A 1WG8A 4YMHA 1M6EX 2UYHA 4CKBA 5BW4A 1WY7A 4RVHA 4Y30A 1JG1A 4OBXA 3I64A 4RVFA 4EKGA 4CXMA 5CCBA 4RTNA 3F4KA 4A6DA 1RJEA 3R24A 1KXZA 5DX8A 3UJ7A 1UWVA 5DPMA 5EIWA 3LBYA 3GXOA 2BR5A 5HIKA 3NTVA 3BWCA 1BKYA 2YQZA 4R6WA 2ORED 4PYMA 3CJTA 4CKCA 4YUVA 4E32A 5CVJA 2G8NA 2ZIGA 4XCXA 5CUQA 2IFTA 3HVHA 3TKYA 5KYGA 3MHTA 4EMSA 2PV0A 4P58A 5BP7A 5K09A 4G56A 4R05A 3ERCA 2BR3A 4RTKA 1DUSA 2LD4A 2PX8A 3FPFA 4MQ4A 4FSDA 3KPYA 1NW5A 2AS0A 1NBIA 2PXCA 3HVIA 4PIMA 4E31A 4F86A 3NMUF 1YFLA 4FSXA 3E05A 3DOUA 2R6ZA 3DLIA 1YB2A 3HCFA 1L3CA 2AN4A 3EVDA 5E9QA 5HOQA 3OCJA 3GGDA 3GJYA 1ZGAA 3UJBA 4BLUA 2P8JA 2AOUB 2GAFA 5EZQA 2PLWA 3G8BA 3MERA 3LPMA 3SX0A 3ELWA 5KVAA 1NT2A 3CJRA 2AOUA 2P1DA 3HA5A 3DMHA 3ELDA 4OBWA 1KYWA 3CC8A 1HMYA 4POOA 3EVFA 1SVUA 4ER3A 5EGSA 2UYOA 4PYOA 5DM1A 1O54A 3DH0A 1VP3A 2QM3A 5EOVA 2YVLA 7MHTA 2PY6A 2OY0A 3MAGA 1JSZA 1KIAA 1YUBA 3R6TA 5C0OE 1XVAA 4AUKA 2A14A 2V7EA 4ER7A 4YV1A 3LKZA 3NVKI 2YTZA 2ZIEA 1ZQ9A 4PGGA 2EX4A 3MCTA 2NXNA 3M6XA 4E2ZA 4QTUB 3DULA 4BP3A 3PX3A 3O7WA 3FPHA 2HWKA 2PKWA 3BXOA 1L3IA 2FRXA 3TLJA 5GP1A 4K6MA 2PX2A 4KRGA 1FJXA 4XUCA 3FTEA 1FP2A 3IYLW 3KQSA 4F85A 5DX1A 4HSGA 3KQQA 2EJTA 5EMMA 4QPPA 2AVDA 5C1IA 5EG5A 4OA5A 4YUXA 1M6YA 4XUDA 3LDGA 1NW3A 3G2OA 3MTEA 4QPNA 4M37A 2QYOA 2XVAA 3HM2A 2JHPA
chains in the Genus database with same CATH superfamily
4J94A 1UXKA 5LYJB 4AN1A 4IWYA 1GUFA 4PGMA 3GJ4A 1JI0A 4OHKA 2VDNB 2HH9A 3RIGA 4GM1A 4A82A 3QSYA 2I2WA 4IIHA 2R7MA 4WA8A 1I3MA 4WT7A 2WYHA 3GT4A 3SR4A 1YONA 4LXIA 3PVCA 3U4QB 2NM0A 3CRW1 5J5AA 3T7IA 5CNIA 1SUCA 4CMBA 1U0SY 3H3JA 1Q0PA 2ZUCA 3C5CA 1E99A 4F8JA 2YWCA 1HDXA 5G4KB 4TM7A 4GNRA 4YX9A 1NI4A 2AI2A 4PICA 1IUPA 3AT1A 3KEMA 3NM5A 5AI0A 4DCUA 1AMUA 2BGUA 3LLSA 3KBOA 3O74A 2XA9A 1I4OA 2D7JA 1CDDA 1LJLA 4FFDA 5J1SB 2VHYA 1SB9A 4IDOA 1RJWA 1S4MA 1TOAA 1TMGE 3DVAB 1VC2A 5CA1A 2YN0A 4HVTA 2H4XA 4Q1AA 3FNHA 2JBWA 4ETMA 3Q98A 4B81A 4PGFA 1OROA 3EIXA 2Z2ZA 5CFOA 5JVDB 2XCTB 2A9PA 2XHZA 3PGKA 4KKVA 1LEHA 1CJSA 1SULA 2AOTA 2XVMA 4U9IS 4ZZ1A 5JFGA 4MNTA 5CP8A 2XYHA 2FMFA 1AQUA 5FO0A 4L50A 5MGNA 3QF4A 4LWZA 1VJCA 2QL5A 4QG3A 4I1YA 1AUPA 3OOJA 2ZBQA 1BJRE 3DBHB 4L2IA 1AMNA 5BPFA 2YOFA 3BA6A 2FUNB 1A50B 1IOLA 1C8BA 1Z75A 2O7RA 3EJ6A 4FGLA 4Y6QA 2C9BA 3EGXB 3ZDQA 4LCBA 1ADGA 3OEHD 2I4LA 3AR7A 5E4TA 4BWGA 2JGKA 4R1MA 5DM70 4MV1A 2PBZA 1JBQA 2BEVB 3VR5D 2JIPA 2GCOA 3CLTC 3OKAA 3C4JA 4IHJA 1J2UA 4QPCA 5DEIA 3ROQA 2JFPA 4H6VA 4D9BA 4C0WA 4ACBA 1VKHA 4R0MA 2R79A 3W5CA 1RI2A 4LF9B 1JHYA 4BX2A 2JKZA 2FETA 2N0SA 1T34A 3K8QA 1VRVA 3OPXA 1WKVA 3LIPA 3N58A 4HWRA 5U4XA 3RRBA 3ZGYA 5EWMB 3Q8XB 1OWLA 3KE9A 4NJEA 1LW7A 1XGKA 3PCXA 3JQ9C 5AM1A 4DQDA 4CKXA 5LQRA 1N7HA 4TROA 3ZY6A 2PWPA 4XWAA 4FOPA 5AUQA 2DFNA 1FDIA 1XCMA 3ANYB 5E7IA 4KFRA 5SY6A 5A4MS 1U9IA 3EISA 3FGOA 2FN3A 2VJNA 3CURA 1P33A 5BV0A 4CIAA 4MIEA 4JGIA 5IDWA 2R2AA 4TYYA 1G60A 4U9HS 2D00A 3EG9A 3S7TA 1YVUA 2PSEA 1EFRD 3IVCA 4CVNA 4LQLA 3RANA 1GPMA 1XZPA 3ZWVA 4WSOA 2QW0X 5HP4A 2YV2A 2UZ0A 3PD1A 5KTOA 5ECGC 3R5FA 3RSCA 1L9XA 3WMXA 5HRUA 1IBRA 1R9GA 1S4QA 3HP7A 4YWHA 5JZVA 3RUHA 4CJXA 1P39A 4L08A 4B40A 2ODPA 3QLVC 5HE9A 3I5AA 3LVFO 2FMKA 1XV5A 1ZK2A 2CNWD 4AN4A 2RBEA 4LCEA 3UK6A 2UUCB 4B4UA 1THGA 2E1RA 5K01A 4TUYB 1FYFA 5KX5B 2VJKA 4IH1A 3PFBA 5IZCC 4ZZIA 1EQUA 3DEKA 1P5ZB 2EKZA 3WWEA 3R7NA 4RO0A 1BCRA 1AD2A 3FA2A 3LLUA 5LUBA 1ONBA 3I9V6 1S96A 2VSNA 1X1TA 3A4NA 2KJQA 3D0RA 2JD1A 3S44A 4DHWA 4REQB 4YCCA 4RAQA 2Y1XA 2XNDD 2NMVA 3LGSA 3QEOA 2RKOA 5F76A 1A9OA 2IDJA 3CPHA 4W82A 2WSIA 3IT0A 3JQPA 4X3PA 4DLBA 1KRXA 1T13A 4J6FA 4KMSA 3H7IA 4MAFA 4MJLA 3ZZNA 1MOQA 2VK1A 3BWDD 4LF7B 5H1YA 4O4LB 2OD2A 1G6HA 1DKPA 1VG1A 2CCGA 2J3IA 5ILGA 4YT4A 2E4UA 4CPDA 1OC4A 2QRZA 4XYEA 1EIWA 3ODPA 1RTTA 4KMRA 3AK4A 4Z4QA 3CGGA 3KTOA 1SHZA 1LLCA 2E7ZA 2IYZA 2WJPA 2XMPA 3FN4A 3QITA 4R98A 4TSRA 4KR2A 5ELXA 4HQKA 4TS3A 5DSTA 2HSWA 5AHKA 4J4HA 2QTVA 4XQCA 2GZMA 2I3AA 4ZDWA 4YRAA 1YA6A 3FGPA 1JA0A 3BMQB 3EULA 4B80A 2EQ5A 3V2GA 3WICA 4EUKA 3R1IA 2AFHE 1TT5A 3CQ9A 3QWBA 2WMNB 4XQGA 5P8WA 4ES6A 5LL6P 2VHVA 2VJAA 3REQA 4AMZA 2OZEA 3T15A 1WUYA 3I32A 3LX5A 2G80A 2VT3A 4LTDA 1HORA 2WZBA 1A5BB 1EFPA 1NLMA 2A58A 3KD3A 2O57A 5JCOA 2F8SA 2I7DA 2J9YB 3ZKAA 2Q3LA 5D86A 3BXGA 3GJRA 3KPJA 4J7XA 4E1AA 2ZUUA 3C7AA 3TSAA 3VU3A 4LWOA 4X1IB 4E2WA 2WTNA 3AY6A 1AXRA 2QKYA 3P9RA 2MT9A 3G2HA 3DEHA 4QGHA 1O3YA 2ZLBA 2HA5A 5DZSA 1A5AB 3C3BA 4RMIA 2C4KA 2XB8A 3PEFA 3DQZA 4RPCA 4TLLB 1RU3A 1VYUA 5FIUA 5EZYB 3U40A 2Q8NA 5ALFA 3CEHA 4GHWA 3OLXA 1CS0B 3JVIA 5L3QB 3R7SA 2UDPA 1QIEA 1U0BB 4TVSA 5JEEA 1P74A 2WWYA 4FLMA 4Z7NB 1CIVA 2R9VA 3W5VA 4TVOA 4BMYA 3CNNA 3OZRA 4L85A 4HH1A 4N5DA 1I6MA 3LXRA 5IRCD 1HRDA 3N2EA 3RVOA 5KTMA 1SKUA 4PHCA 5ITWA 2ZJFA 2QXTA 3CR7A 1G8KA 4NYMR 1LNQA 4DJDC 4DV6B 1L4MA 1C9DB 1DRKA 3JXEA 4TVKA 4OK6A 4FBLA 1RXCA 1TUBA 1U2QA 4DMGA 5KS2A 1WSWA 2CL0X 5IG2A 2W6MA 3V1UA 3JZFA 4P86A 1QS0B 2ZBPA 3L1UA 4BO9A 2EF0A 1JR6A 3LX6A 4WAUA 5JCPA 3N87A 2JK1A 1KI9A 1SXJA 1WBBA 5FD8A 4C0KA 4IDBA 3CR3C 3MHPA 3ESXA 4I5FA 4RFVA 3BYZA 1BS1A 4RMHA 3K6SA 1GIAA 3FTFA 5FV7A 3JWJA 3K8ZA 3TDMA 1WEKA 5EN4A 1UBRS 3HFJA 4BGEA 4TV8B 3T8YA 1QAOA 3TNDA 3B48A 3ZDFA 3PJEA 1ZG3A 2BV3A 2HREA 3F7NA 3PHJA 4X44A 1KZGB 3DKKA 3S70A 3PC7A 1GPKA 1PS8A 3P2IA 4IZ6A 3IIEA 2Q6OA 1DB3A 4X5OA 2V7QA 5JD3A 1MTZA 2GPJA 3UUEA 1BO6A 4J16A 4DA4A 3HWX1 3DDCA 1A1VA 5DK4A 1S9HA 2QOEA 5DO9A 5CXQA 2J07A 1XLTC 1ZSYA 1D4FA 2EEZA 1NJFA 4FOLA 1IXYA 4BRSA 2WSSA 3ZN2A 1Q3KA 3NJRA 4NAUA 4AXXA 1ZC3A 2JFHA 2QLLA 2R8EA 2Z4SA 4YCBA 5LIPA 4ARVA 2YZNA 1RI4A 3SE0A 2QZ4A 3ES9A 3UG6A 4A7PA 2V7TA 3E9QA 4E13A 4YDHB 2GZ1A 1O0SA 2PUBA 1UAYA 2DPMA 1FVFA 2I8AA 3TQIA 4HX2A 1E8MA 3DL4A 1M67A 5K4AA 5HIJA 5KAMA 4DMUB 2FK7A 4D0SA 1OYWA 3DXZA 2UZ3A 1N6RA 2YXLA 2DFKB 3H9BA 4W8HA 4DOMA 4N39A 4B3TB 3GDHA 3TKAA 4AMYA 2OKGA 2ZT8A 4GU5A 2IITA 2Z3VA 2BN4A 2CFOA 3A04A 4WKCA 1OH5A 3EGCA 2G07A 1NY5A 4ZOCA 3BCUA 2CFRA 1NUSA 2R87A 1V8BA 3BMCB 3M5WA 3PUIA 1SQFA 2Y6VA 3B9BA 2ZI6A 2OGSA 3EGDB 3HUEA 1FLDA 4L78A 1PFQA 3AWIA 3KJGA 4V1CI 2BH2A 3LX4A 4YS6A 4M7OA 2C9YA 1M2FA 1C7QA 1VHTA 2WZQA 1H6DA 2VDPB 4H4EA 3QEAZ 3KE8A 4G8BA 3DXFA 4YJ3F 5HMMA 1Z5GA 2DT8A 1CRZA 4Z0TA 1QPZA 3HO1A 2H7CA 2RH5A 1L5HB 3EXIA 2EF1A 4Q3KA 3W3AD 4DLWA 1I7DA 2XCQA 1XDSA 3OTWA 2YICA 1QFSA 2YC2C 3UMRA 3W3ZB 1K9SA 2AYYA 2BF7A 2XGOA 3ETJA 4RYDA 3KFXA 4Y1GA 2ZAMA 2HJ9A 4P53A 2QX7A 4C03A 3LHDA 4C89A 2G17A 4CV0A 2VBGA 3L8CA 3X1ZA 4BDTA 2MYUA 3CVYA 4BP9A 3TB4A 2XDQA 3ZV5A 1D2RA 2F7SA 1GRVA 3COYA 2C4VA 3P5SA 2BEWB 5F5XA 1MV5A 3IVMA 1F6WA 3LC1O 4JLJA 4N8EA 1M73E 4Q1BA 3S2EA 4BC0A 4HT3B 5FT9A 1DCMA 2ZWVA 3WHLA 5KSYA 2HMUA 3CA8A 5KQSA 2HFKA 4BASA 3DXYA 4PM4A 4Z1MD 2G9QA 1ZGZA 3HYCA 1MB4A 3K05A 3X1MA 4NENB 5HIAA 1CQJB 3H97A 3VFDA 3FY4A 3VR4H 4DCNA 1J8VA 1ORHA 2ZFUA 1IHYA 3T9FA 1VQ1A 4G9GA 4TV9B 4KVFA 1KEUA 3UK7A 4RS4A 1T5OA 5CPBA 4CMHA 1U4OA 1OBFO 3B7WA 4F96A 5GADl 5DX0A 3TMAA 3HNPA 2H1VA 1QLJA 1RKQA 2DPHA 5EWJA 3DE2X 3OSZA 4IV8A 4WZBB 3RK0A 4YR9A 1KZ9A 3SJCA 3ACBA 2JH8A 3F6RA 2HV8A 2QMYA 3LQFA 1G8GA 3PHIA 2V3VA 4RTJA 4WXHA 5ALKA 3PQ7A 4LJ9A 3RC3A 3STYA 1NV8A 5JZBA 2I6QA 2QEQA 5BV1A 3EZ9A 2GSWA 2EJCA 2VPXA 5IAGA 2V96A 2ZUBA 2ZITA 1HYEA 4R5MA 1U2PA 2VA8A 4PTZA 4RK0A 2YVKA 3LSYA 4EGJA 1UAGA 4LHVA 1W5BA 2GPBA 2VS1A 3HVUA 2KLHA 3RVJA 3VI3B 1PZFA 2W8ZA 2J09A 3EIHA 2DB3A 2OHFA 2HMTA 3O9ZA 5ETJA 1YR3A 5F1YA 1QTIA 4UNPA 1SCUB 1SCIA 3UT5B 2IWHA 1N7GA 2GKOA 6CHYA 1M34B 1HDOA 3ZZ1A 4IJ5A 4LI3X 4X6LA 2GMWA 3DZKA 4TSKA 5F7OA 4BFXA 1NM5C 4MUFA 1M2JA 1E2UA 1D7OA 1TCUA 3AO0B 3R0ZA 4HXFB 5IDVA 2Z98A 1VJRA 4M0UA 1KZHA 3OM9A 4YAOA 3LUBA 1KDZA 5HQTA 1OBHA 1V7CA 4U0KA 4F9GA 3FE2A 4PGHA 3ZXIA 3ETCA 3UMCA 5BUCA 4LXYA 4CKBA 1YRYE 3JQEA 3QJGA 1XHLA 3GT3A 3U62A 4CT0A 5K3EA 3AHEA 1RYNA 2WQZA 5EIXA 5EIWA 2VRCD 5ADVA 4ZVOA 3HBNA 4AAYA 1O94C 2Y27A 1UZAA 1LSSA 3FETA 4MKIA 4N3NA 4Q24A 1E3WA 2WNIA 2PNFA 2XXBA 3JSXA 3KKNA 5E4YA 4YUVA 3X2FA 3NOOA 4WFQA 4GSLA 4DE5A 2PV0A 2ZBGA 4UE6A 4E5NA 1TMYA 5BP7A 2WJHA 2R62A 5EJ2A 3FPFA 1IRXA 4FSDA 1B6SA 2BZSA 2SICE 4JKOA 4F86A 5AM2A 1Q1BA 2HA6A 3RLFA 3X1WA 5BQXA 4TL8A 1FRQA 4AJ2A 3D7LA 5BWOA 1KQNA 1MUUA 4TSFA 4R01A 2BEUA 1L4HA 1YB2A 2IXAA 4F5ZA 1G2IA 1T5LA 1ZU5A 1L3CA 4EIWA 1MRNA 2FE1A 3ZW7A 3OCJA 4UCWA 4L6CA 3CF6R 3UJBA 1SZPA 3OJCA 1JRLA 4MVJI 4MVJH 2HA4A 1Z6PA 2HDNB 3SX0A 1YL5A 2EZTA 1Z5OA 1BMFD 2B99A 1TTPB 2XGMA 3TRDA 3D31A 3NV9A 1GWNA 3CNBA 3L0SA 2Y1FA 4ZYVA 4V0KA 1KJNA 3OPYA 3ZYZA 1U81A 2LWIA 3I73A 5BMVA 3U3OA 4DUGA 3EX7C 1T3HA 4E5YA 3N74A 4L8YA 5K6RA 1I5OA 3HJBA 1UPFA 1W0JD 1MQAA 3O3OB 2WT4A 5IVIA 3T5CA 2WHYA 1NBWB 3IPRA 1SD1A 4ZOLF 3ZY4A 2AN1A 2FVXA 1JU9A 3VPGA 4WCFA 2PK3A 4LRSB 2I2FA 1WXIA 3GNTA 2HWKA 2MSDB 1FMJA 2EKQA 3Q41A 5JH7F 4RABA 4MW9A 4LJAA 4N3BA 1P81A 4J76A 4UQPA 1CFZA 4OA5A 1LBIA 4Y0NA 3IKLA 3OQIB 1DKNA 1XTQA 3SZLA 2P6OA 1IJKA 4GI7A 1Z4LA 2ZI9A 1ZIDA 2V03A 3MC1A 4J1TC 4L6AA 1R12A 2X77A 5M2QA 3DHYA 2JANA 2D1SA 3R2JA 2XV1A 4ZYZA 5KC9A 1J2TA 5EXTA 3LUAA 2HF7A 1R50A 3EXEB 2G77B 1OOEA 3I2GA 3PWKA 4QBGB 4QDZA 3RTAA 3FPLA 5K0GA 4HB3A 3NAMA 1UZMA 4NU6A 4KR0A 1T9GS 1I4LD 3RK1A 5J2UA 1JDTA 1I7LA 3PX7A 3LNTA 1TEZA 2VP2A 1J56A 1UDXA 2ZYWX 1GTJ1 4WI1A 5DYGA 5JMTA 4RTOA 3VHXB 1VIVA 2ZWMA 5A6VA 1N2SA 1Q92A 2CL5A 2R6R1 2OV4A 3BCRA 3X0DA 4CR7A 3GVXA 4XDGA 1YACA 3LG2A 4YCAA 2ZVQX 4N3GA 4XYLA 5TGTA 2XOEA 3KVVA 4V2IA 3WZLA 3PFNA 1J1ZA 4QYIB 5G0WA 1TTTA 1BHO1 1G8AA 1IMOA 1QHHA 3GGJA 1OB5A 3QXCA 4PYLA 5KNBD 4AJHA 2PWYA 1MMFB 1T3TA 1S01A 1KMIY 1QHYA 3SF8A 1GTRA 3LY9A 3JASA 2HLDD 5LQDA 3E0XA 5HDBB 3VC3A 4EHBA 3OF3A 3EFOB 5KTYA 3H4MA 4OFXA 4B47A 5JCZA 1FYWA 3JD2A 4CU5A 2FEKA 1IAVA 4I08A 3WNZA 3ZVMA 1MF7A 2IGBA 5CFLA 1N6PA 1W4CA 3F3SA 4II3A 3QUAA 4R9SA 1Z15A 3MRTA 2Q4EA 1IU9A 1ENZA 1J2JA 1CHDA 2IY7A 3U81A 4LJSA 2V8BA 2QX9A 3BRCA 3VNAA 4BPRA 1Z4QA 2JVJA 2QT1A 2AIRA 2JK0A 3C3EA 3I0ZA 1RAEA 4PYQA 2HOQA 3PYXA 4D42A 3EB9A 5H8WA 1LDMA 3SR3A 4GSYA 1NVAA 1E8NA 3PP8A 2GN0A 4IM7A 2NTNA 3DCNA 1KOJA 1JR4A 2FJ0A 2PS0A 2WA1A 3FBWA 3G89A 4FCWA 4MAAA 5H3HA 4RSHA 5KVSA 2J67A 1JAXA 2IUFA 4CW7A 3LT1A 4IWNA 5J58A 3B2NA 5LD2C 3V80A 1QGAA 1GNSA 2FA9A 2GJSA 1JA9A 3VTFA 4LG1A 4DT1A 1E0SA 1PCXA 4EB6B 4INZA 4RGBA 4X90A 4OI4A 3IEVA 4YYEA 1QBKC 2ZBRA 2VQDA 3SKYA 3WGYA 4DIDA 2YWRA 4C7OA 3I2YX 4FYHA 3M4ZA 1GAXA 2B2NA 2NXEA 2A4KA 3A1DA 3WOHA 2R8PA 4G0UA 1FUIA 1T4CA 2DKOA 2PAFA 3OBIA 1RAGA 4ZZ2A 3HSSA 4Z1OA 5BV2P 5E9WA 5IFLA 5KVCA 1Q3HA 3JRNA 3HPRA 1G20E 1TGVA 1XFDA 3UQYS 3EVNA 1O7JA 4JH0A 2QV0A 2VJBA 3E22B 3KR1A 1A8PA 2Z8ZA 2F8LA 4EUNA 1NWHA 3EQ9A 3K5WA 3L0OA 3PVSA 5K1ZA 5M34A 3OQ1A 3PBKA 1T4DA 1T8UA 1OR8A 1T9DA 1I14A 1KU0A 1OI2A 1EK2A 1W5FA 3HE3A 3PITA 1UP7A 4GKBA 3WAKA 5TARA 2I2DA 1YR2A 5CW2A 4O25A 5A0TA 1WP9A 4TWBA 3AI2A 5HW0A 2NTYC 2B21A 2QUBA 3PEVA 1NMXA 3JVVA 4EZBA 2GK4A 4EFLA 1L7RA 2HJVA 3GDOA 3ZE6A 1DOHA 4KXWA 4RVSA 4KK4A 5BO5A 2ZJ2A 1J90A 1VG0B 1ZUNB 2XQGA 3JYNA 3KT8A 1DS6A 3PUZA 4FJ1A 4IZHA 4C29A 1FYXA 2Z1MA 2F00A 2AWNA 2XQKA 1IZ8A 3B6MA 3CX7A 4HNRA 4X41A 4EJSB 1AZLA 4D25A 3CWQA 1KO4A 1XLVA 1CJVC 1EQ2A 5AOCA 3OUUA 1Z07A 2JAUA 1GILA 2AC2A 5JFTA 3LOQA 3G2NA 3MVEA 5AKZA 2FPRA 3SHQA 3JTEA 3WK4A 1U1GA 2B4QA 4FIDA 1LWNA 4MWTA 3W2IA 1WB4A 1PT5A 2RC5A 5I9IA 1L5ZA 4QDKA 1D0SA 1U0NA 4JLAA 3JRXA 3SYTA 3CN7A 3TPCA 5C9ZA 2R2GA 1QZ3A 1WKCA 2KWIA 3A4LA 3CLSD 2ICAA 1IN5A 3NM4A 3W5IA 5HS4A 4GW3A 2PPVA 1Y7PA 1U1EA 4D4JA 4ZJYA 1DFGA 4B1FA 3U4AA 3VYSB 3FJYA 2J5KA 2XNHA 5D3QA 5FBZA 4Q05A 3UOGA 3VC1A 3ZWBA 4DXDA 1SUIA 1BHSA 3K2EA 2W22A 1GPYA 4GICA 1JKJB 5G0VA 3AKDA 3BXZA 5EUQB 4QM7A 3NZEA 2XMCA 1V8FA 3T9DA 2J0SA 2XXAB 3HP4A 1M2KA 2C2KA 5CTAA 2I91A 3K20A 5DHFA 2JFYA 2XDYA 5FQOA 3D64A 3OFJA 4DR6B 2AQKA 4RD6A 3PF9A 4BB5A 3WL6A 1KYZA 1DAIA 3KLBA 3BFXA 5EE9A 4QLBA 2VHXA 4DA6A 4WN9A 5KJ1A 1JQ5A 4FMDB 4GVLA 3PUYA 1G3UA 1YZVA 4KQIA 5EPEA 4CM1A 3EVFA 1PU2A 3IGFA 3OCWA 1FNMA 5BN3A 1E4OA 1USKA 2AX4A 2VH5R 1XU9A 4FLFA 2P7HA 1BMDA 4Z8YA 3H9EO 1LBQA 4FINA 4JVLA 5BNTA 1YQXA 5CM2Z 3DT6A 2X1LA 7GPBA 1SBQA 4XGIA 5A4FS 5C52B 4HRYA 2PTHA 1ZKDA 3QA9A 4GGPA 4F46A 1V5WA 3R77A 2Z58A 4MKFA 3DEZA 3GPDG 1SELA 3H13A 5JRZA 2BFMA 4HADA 5HVNA 4KHZA 1FYEA 4F93B 3W4IA 1DPFA 5A04A 1TFUA 2AF3C 3C8MA 4YMVA 3BDAA 4IRMA 3RTBA 4C4XA 4L3VA 2DRIA 2CHUA 1RAAA 4RTQA 2O3RA 3BIFA 4UBJA 2B1JA 4B85A 4EW6A 2NSJA 1JQKA 4IVQA 1OBOA 5E4FA 2FSVC 2JFXA 3FVQA 4GX2A 3UGTA 4B5LA 2JLVA 1OLSB 2O8EB 4JQZA 1FUEA 4PAMA 1AOXA 1WW2A 2UXBB 4C05A 4PO3X 2HY7A 1UM9B 4YRBA 4MEBA 3AEYA 4QECA 2DFPA 2NXCA 1Z4IA 4F84A 2KMLA 1PJ2A 3T7TA 3FDFA 1R8SA 3BMNA 4HVLA 5ARBA 4NPAA 2IXGA 4RPIA 3RVNA 2J9FB 1XJ5A 1MBZA 5EXXA 1G18A 4YHHB 2PKYX 3Q3JB 3TLBA 5AUPB 3FTDA 3ZU2A 4MMYB 1Y81A 4S0XA 2CXRA 3UCEA 4M21A 3VR2D 1OA0A 1ZCAA 3WDMA 4KJXA 2PH3A 3F3YA 1YDHA 4D9KA 2IEAA 1O77A 5HTKA 3I9JA 5CYGA 2EDCA 4H18A 1FEZA 3RC1A 4N5HX 4HC4A 1ZKMA 4DBLE 1UKVY 1HOTA 4XFDA 4OMCA 5ITZA 1LSUA 4TMWA 2BGIA 1L5FA 3BXXA 3CPEA 5G4LA 3UO8B 3ZHUA 1F8GA 1K92A 5KDLA 5ER9A 3HRHA 3UA3A 3V1MA 3ZZMA 6ADHA 1IC6A 3COJA 2XDAA 3QE0A 2FMHA 2Q4OA 2RGNA 2E4WA 3DMFA 3FPGA 5DHPA 4F06A 5LLDA 4BMCA 4C4OA 1NRXA 5FNVB 3L8YA 4R2MA 4V1CB 2C2ZA 1ONPA 2C8JA 3KWJA 4L8WB 4FMPA 4RK7A 1LS6A 3KLNA 4X24A 4W5OA 2W5UA 3DTVA 2VDQB 1HY3A 2F8MA 1ENOA 1FPQA 1ZBQA 2O6HA 3KS9A 1V3QE 2DWOA 5TGZA 5CB8A 3TLZA 1XDGA 2KQUA 4FP9A 1FVOA 1EUZA 1ARZA 2REBA 1XZIA 3CZ9A 3CB4A 3HDTA 2JGNA 3IOCA 4GEKA 2HQ1A 4K8RB 4NTZA 4OYYA 4FVTA 1VZ2A 1WCXA 4J0CA 4EVRA 2YNMC 4F1KA 2XF2A 1TA9A 1X1QA 1E9RA 1DC6A 5EJ8A 1HYGA 1CZHA 3PYLA 4IKEA 4MUYA 5FTNA 3K5PA 1B0UA 3LQ2A 1PR1A 5LCXA 3V34A 4HGYA 1BE6A 4TYMA 3C7CB 2R5WA 3ILSA 3KU4A 3HBFA 2W6QA 2C2GA 1XEWY 3C8ZA 3M6FA 2C84A 1E6LA 4RH3A 1M2HA 2IZ1A 4INJA 4QAQA 2HAEA 3IAM1 4E5MA 1YK0A 3FR8A 2I2AA 1YI0A 5AESA 4G41A 2WF5A 1GTZA 4D43A 1RXWA 1SEPA 3ZH9B 5MN4A 1RDFA 2DQ4A 1T1RA 1JYEA 3PNSA 4OB8A 1PV2A 1M2OA 3MWDB 2O1SA 1MQ9A 2CJPA 4LZZA 3UFXA 1RZUA 1FLAA 4PR3A 3AJDA 3PEWA 2B4TO 4YRJA 3OAAA 3KOOA 3LCCA 1V41E 3LPNA 4JZKA 4LRYA 3KQTA 3QTLA 2OHXA 3GAZA 3RR2A 4CLDA 3TIXB 3COVA 2E5FA 3NG1A 1N6HA 2HDWA 2HA7A 3KT0A 3KPWA 5F9FA 1FTYA 3W2FA 4AZWA 2ERYA 3GQBA 4KI0A 4PCAA 1N78A 4WHMA 2IE0A 3DB1A 1X39A 1NUTA 1E2QA 4FW8A 4LYAA 3JYOA 1UJ4A 1J7KA 1NF9A 2VO1A 1WV1A 4YWJA 1WCV1 2JFFA 4HGPA 1VL6A 3EJWA 1P62B 3EZXA 2P3LA 1CR4A 1NT4A 3ECAA 1XKXA 1ADCA 2D5CA 1HE1C 2WI8A 2X2PA 3M5PA 3NTLA 1M2VA 1R88A 1REQA 1SVIA 2X9LA 3ZE8A 3B1ZA 1RP1A 1OKKD 1CYEA 3BIJA 3DD1A 2D62A 1XZFA 4QYXA 3RVBA 3ZGLA 2GD0A 4BCDA 3L92A 4CM7A 4ETNA 1EMDA 1E9AA 5FORA 3NIWA 2Z3WA 1G21A 2FG5A 3P52A 3ND5A 2ZREA 3GBSA 2W2KA 3LUDA 3PNLA 4LNUB 1NFRA 3G0OA 4U00A 4B6QA 3E1KA 1JPNA 4KR3A 1WU7A 2PKXA 2RGBA 4NK5A 3A10A 3D5EA 1C9MA 2CXTA 3IAHA 4MHOA 3WO0A 4Q4JA 3ZE1B 4DMKA 5BSEA 4GZMA 3F1LA 3W34A 4A6PA 3GUCA 2ZBVA 3NOXA 5FQNA 1N75A 1I0IA 3WXMA 1UFRA 2B6HA 2CL6X 4UBNA 5SICE 1A2QA 3QVUA 1H2ZA 2QIOA 1X7HA 2PX0A 4M3NA 2ZZNA 3DD5A 4D1YA 3SIWA 2BZGA 4NY1A 4E30A 1GGKA 1ZITA 2WG2A 1YDGA 4FI3F 4QDOA 1P17A 4R6XA 3N9IA 3ZI0A 2PRSA 5FWNA 3RRYA 5A05A 2WJZB 1LV7A 3AFIA 4CG2A 4GR5A 5M7EA 5AW0A 3GPBA 4PC1A 3ICEA 1ZONA 3L1IA 2AD5A 2C9CA 2XQJA 4R9RA 4ERXA 3OOYA 4XGNA 3D3QA 1J7JA 3EUWA 1UH5A 4I1OA 2VNHA 2O2IA 1AKQA 1F12A 4CIXA 3A06A 2P9HA 5DM4A 4LF5B 4EDFA 3FHLA 4IQGA 5EPUA 3W04A 5B53A 4QVIA 4FLEA 3WGTA 3VU8A 2JAPA 3DFFA 1WABA 2R60A 2ZKIA 3F90A 1JPUA 1IXRC 3UV7A 3QUCA 2Y92A 3C5EA 3ZWPA 5L7TA 3KKPA 2MSNA 1JE1A 3MYYA 4Y9DA 5F33A 3D8SA 1HDYA 3EPPA 4HZUA 4LRXA 3OJ0A 4CCYA 4Q12A 1GZVA 1DBWA 1PG2A 1LRKA 1EA5A 1JG1A 4BQQA 3BH7A 4GMHA 3F4KA 3RJ5A 2UUAB 4KLRA 2ODQA 1P4GA 3WIBA 1CR2A 2HKIA 1WWKA 1ZUD1 2C96A 2HZBA 4BNMA 3SIRA 1Q7RA 1UF9A 1TJYA 4R6WA 3ZDAA 5HIIA 2WMOB 2W6CX 1C29B 5FOUA 2C1ZA 1KKMA 1RQPA 1J2EA 4G5HA 2ADFA 3SPXA 2AWOA 1NX6A 2CLDX 3AHGA 2PUDA 1VE5A 2P91A 4G56A 4ZXFA 2R7KA 2IF2A 2JDIA 1G9TA 1AKUA 1HDZA 1NW5A 3QMMA 4UEQA 4E31A 3GFPA 3FNFA 5L4SA 3O8CA 1UJNA 5KQGA 4QX6A 1EDDA 4AJ9A 4HOYA 2J6CA 3P2OA 1GQ2A 4K9NA 5GJBA 1ZPDA 3RYCA 3RSSA 1XNHA 1Z26A 2HTFA 4GPAA 3K09C 5J23A 3AJ9A 5DCWA 4INOA 2GAFA 2PLWA 4V0ME 1E1MA 2I6TA 3HN6A 5AKLA 1HZZA 4J7UA 1G5QA 1NBMD 1UQTA 3KOYA 5U1PA 4EDHA 1I10A 5EFOA 3MCUA 5D3MB 1X15A 2VSXA 1FP6A 1DUVG 2OK8A 2XUZA 2ZEJA 3E1SA 3PICA 4NC9A 3MTDA 4GYYA 1LK5A 3UENA 4A5SA 1E1RA 1GU0A 3GJ8A 3GZNA 4ZFNA 4C3OB 3EPJA 1M7GA 3R8FA 2VPYA 2JIZD 1ML4A 2XECA 4WL0A 5C0OE 3RFUA 4DYHA 1QKKA 1SCAA 2RAVA 4QT0A 3WMFA 2I34A 2HHCA 2WIBA 3OO0A 1I2MA 3CSUA 4GR9A 2P4EA 3OP4A 3U48A 2RI0A 4E2ZA 4EL5A 4QTUB 1XRRA 3OJLA 4HLCA 1LKZA 1JVSA 3FM9A 4PLGA 4N48A 2ZYAA 3PQEA 2PLNA 3F3MA 4KGDA 2ZAOA 2ATXA 3G0CA 2XMGA 2QR3A 4G0QA 2ZBFA 3WTBA 2DUJA 3ROGA 1QM5A 4J29A 5I8WA 1YE8A 3PNQA 2Q3JA 4KGVA 5G0UA 5KHAA 1QVZA 3RAPR 3LO5A 4I55A 1WX1A 5I9BA 3E84A 1DV1A 2F17A 3FKQA 4C6HA 4QU8A 2BT4A 2V7PA 2YFKA 1GSAA 2YN2A 3HM2A 3UMJA 2PIDA 2WRZA 1JIQA 4PW0A 1ZGBA 5ESDA 4UKDA 1SVNA 1P8JA 4CTKA 1RCTE 1AUVA 2ZU6A 1EZ1A 2ZWAA 4LPSA 4LVOA 4RHXA 4NATA 5LYJA 3P9SA 3K0SA 2PYDA 5EYPB 3GRPA 1JDJA 2C5HA 3NBUA 4AUNA 3L02A 3WLQA 5F4ZA 2XUFA 1GPH1 4FFNA 5A0FA 3U4QA 2VK8A 5KTNA 1OI3A 2ARKA 5AR1A 5HRAA 3ER8A 3W5BA 4P9NA 5B3JA 3UWKA 2JLZA 4I19A 4LOAA 3OEED 5E2IA 1D8TA 3W7AA 1SVSA 5G4KA 1E3TA 2OBBA 4AX4A 1D1PA 2C2XA 2ZETA 3B82A 3NDIA 1DCKA 4R8MA 1GPAA 2CYCA 3E7WA 4J49A 1L5WA 1XAIA 4HEA1 3UM9A 5JR3A 2FMTA 2OB1A 3LDAA 4AWAA 1PYGA 6PFKA 1F7UA 1WM1A 3CVOA 4JJEA 3DVAA 1XWWA 3ZCPA 3MT8A 2XAAA 4TTQA 1CUUA 1O5IA 4PWYA 5FPPA 2XBLA 4EHJA 4DCVA 1G63A 4MLDA 4BKPA 3IAM6 3CXRA 2HJHA 3FWYA 4M9RA 1BU8A 2AG1A 4A03A 1BGVA 3PNKA 2YRFA 2YWGA 4KGZA 5AVUA 5JVDA 1YR1A 3UG7A 1KDPA 3JZDA 1S2IA 4LECA 3BJIC 2CC2A 3GJZA 3OLVA 1LQ2A 1QCCA 1INLA 2MMCA 1ULZA 5DNUA 1I2ZA 3GLGE 3FCYA 3DBHA 4HK4A 3WHKA 2IYRA 5IX8A 3H2HA 3TINA 3D2BA 1T15A 1DBIA 4YLEA 4X7MA 5DXFA 2C3PA 4OIFA 5SYMA 3SKVA 4C21A 4AY6A 1GPUA 1GZSA 1A9TA 3RNLA 2QPOA 1NXXA 3EGXA 4OL0A 2CMGA 2AG5A 1SQSA 4B0PA 2P6PA 4P7FA 4Z4FA 3FNIA 3MJTA 2VTBB 2BEVA 3NKVA 2IHUA 4Q4AB 1R8QA 2PD6A 1J0DA 1NJ8A 2H1LA 3FWNA 5KEIA 1ZCFA 1RYYA 3R20A 3RGWS 4Z7QB 5IVHA 2XPCA 4BFYA 1AS0A 1KMMA 3KTDA 2PGNA 1M6NA 4HRAA 3SYMA 3A2KA 1K7YA 5EWMA 4C2TA 1KP9A 1QIJA 3AF0A 4JWTA 2CB0A 4UM8B 2YDXA 3I37X 1Y9EA 3JQDA 1Z7GA 4Q02A 1DFHA 3SQWA 1G0NA 4ZCQA 2CHFA 2PUVA 3KKKA 3S4YA 4IP0A 1JFFB 3SQOA 2AMVA 1X1RA 3QXXA 2WDZA 3AL2A 4L9RA 3HC7A 3EVCA 4XAQA 3RS9A 2EW2A 3MILA 3OD5A 2F67A 1GZ4A 2CE2X 2CGEA 3PUXA 3EIUA 1RHKA 3R4VA 4B7ZA 3RS2A 4CR6A 1UFKA 4Y2TA 5CBPB 4MV8A 4BLWA 2XRFA 3KQNA 1TU0A 2JBAB 5JD5A 2VXYA 5LVAA 1CJUC 3H84A 4HLNA 4ZO8A 3WMWA 4IBOA 2Z0MA 4A8JC 4QGGA 5IK2A 2IYUA 4FR5A 5D1NA 1LSJA 4R8KA 3FDJA 1SQ6A 1ZD3A 4MRSA 3N07A 2FMXA 3RIMA 4ZIRB 2Z8XA 4HNSA 2ZQ5A 2NPFA 2H3HA 3L6EA 4CG1A 5JFOA 1GZHB 1GKKA 3ZLVA 3UB3A 4L5JA 4TTVA 4DQVA 5AM3A 5HOEA 5HWSA 2HIGA 1NJSA 2I7XA 1JA1A 3LI2A 1H0KA 1N0WA 1FU8A 2G6BA 5LBTA 4AZTA 4CR8A 4CLRB 1IHXA 4EA6A 4HY3A 2XZDA 5KX5A 2PO5A 4MGKR 4TUYA 4YMIA 1JEEA 5GGYA 3NUQA 1BDHA 3GUYA 4OHCA 3VR6D 4R0VA 2B2CA 3JWPA 5E38A 2F3UA 2XDWA 1YS6A 2OFWA 3EGWA 1NVBA 1TMOA 1Y7LA 3KDSE 3PEUA 5FTKA 3VTAA 4WTOA 2PUAA 3PEYA 1UC4B 1ISPA 2H1CA 1OT5A 2QVBA 3PZBA 3JU3A 2JI6A 4RXUA 4F3NA 1W93A 2WUEA 5FDFA 3LHFA 2L2QA 3OZEA 4HD8A 1M83A 3LT0A 4REQA 4BNJA 1WUKS 1JYFA 1UOQA 1Q44A 4B7AA 4BBAA 1T6XA 2H7XA 3WKEA 4WINA 5CA1F 1Z37A 2ZUVA 1Q0LA 4GXNA 4XX1A 5ADWA 1KI4A 3GBPA 4P32A 2DERA 1IN1A 3QWIA 3TM4A 4O4LA 3W05A 3WBJA 1BS9A 1PJCA 2Q4RA 5DCYA 5DT2A 1PV4A 1J99A 1OTXA 4DG8A 2Z04A 4E12A 1V39A 4GOOD 1MORA 3EZ6A 4WNYA 1FY2A 2NZWA 1AXEA 4P22A 4Z51A 1Z4NA 3OZSA 4AG6A 3PI6A 4E7OA 4I81A 5REQA 4JY7A 3C5WP 3V6MA 4AP9A 1XKTA 2IEIA 4LDPA 2FSIA 4LFCB 2QYTA 1J24A 4LV8B 4RTMA 3SQXA 1A72A 2GAOA 3BMQA 3HCWA 2CNNA 3OCXA 4LMPA 2HSGA 3MG9A 4O59O 3G8CA 3HV2A 3QF7A 5F9MA 3IPCA 4OHRA 1DWPA 1X9IA 3OE1A 4OG2A 4HBZA 4IHJF 1CUWA 4ZK2A 3C45A 3HI4A 1NJ1A 1QLHA 2YJZA 1GEGA 1M8JA 4QXRA 5IAJA 5BSTA 4DPLA 2YIJA 2ZW9A 3AUAA 4ZCPA 4CRWB 1KS2A 3B6EA 5JS6A 2P9TA 4MMZB 1RI3A 2Y93A 3E18A 3IEUA 3Q3CA 4LW8A 4R1UA 4DMCA 4F4DA 1CY8A 4RAOA 4NJMB 4OPMA 1TC2A 2V54A 2BKLA 3AUSA 3V1KA 5JZOA 1B6TA 1YH3A 2F1HA 4FT2A 4B6EA 4DQXA 4B4VA 4KR7A 1JDUA 2Y05A 3HBMA 1XTZA 4QWWA 1VKJA 1UBCA 3UMSA 1SXGA 5EZYA 2FPOA 1BZYA 3GRKA 1CS0A 1E94E 2YCBA 3HJGA 5L3QA 3R75A 1AV6A 2OCXA 2N42A 2ZI5A 3MUNA 4KSBA 4O29A 2E18A 2FN4A 3COSA 3EDRA 4BMPB 1ILEA 2XMZA 3I4FA 2B9EA 3AF6A 5JWHA 1P3Y1 1OXBB 1W44A 3O75A 5GIOE 2D4AA 3BB1A 5AXBA 4BAGA 3IPAA 3TZHA 5C3MA 3BZWA 3RS4A 3WSTA 3GPIA 3BKXA 1ESNA 4GI1A 1CG6A 4UVDA 1BHJA 1Q84A 3B2EA 3RJTA 3TIGA 4AW9A 1UM8A 4OQEA 2V7VA 1UKYA 2NO9A 4FCCA 3GEHA 3F6EX 4IMJB 5LD2B 3O7MA 1CRLA 1T10A 3RRZA 2Y0EA 5ALEA 1Z7WA 4PR0A 1QS0A 1ZK1A 2ZRDA 4I4IA 1FSFA 1OZAA 1X8XA 4L5YA 4G23A 2EIXA 2OA0A 3FZGA 3JQBC 3SMQA 7ABPA 2SBTA 2O2GA 1NW8A 5CEEA 2XJ4A 3MWLA 4TRRA 1UR5A 1IHPA 3WB2A 5KQRA 3NHBA 3OLYA 3KUUA 3ESAA 4JOSA 1RYBA 4BGVA 5ICSA 2C98A 4DEYA 4TV8A 4BO7A 5C8VA 1QTQA 1SHKA 2JH3A 1TXGA 4BFLA 3OMXA 2BSXA 1MU0A 4F4UA 1MIOB 3G9QA 4IDQA 1RSZA 2CLHB 3BTVA 4L4ZA 2I62A 2ZZKA 3LCMA 3O8OB 4BKQA 4DKJA 1XF1A 3URKA 4EGAA 4XGKA 3VR5H 2R25B 1P9RA 3SHWA 3UB4A 4E11A 2NAPA 1TT7A 2XYRA 3OMLA 1YOVB 4X3CA 1YR7A 5GONB 2REQB 5HG0A 2DJIA 2UZIR 1S2NA 2ONZA 5JBNA 2AZTA 4HEA6 2RCYA 3OETA 4Q1VA 4QQNA 4DC0A 1PT6A 3GLUA 2D6FA 2IH5A 1E5QA 4TYPA 3OZVA 1L1RA 3U7JA 3B3FA 3KZXA 5CNJA 4DJJA 4ZDIA 3IV7A 3ZVRA 1FDVA 1ODFA 1EVKA 2GNPA 4O4JB 4R1QA 4TTJA 3A6KA 4M7PA 2AZDA 1E7SA 1KY2A 5KJFA 3F8TA 1L8XA 2PL5A 4QODA 5KWSA 3K7EA 2DHCA 5JOQA 1IK4A 1HSOA 2HWUA 1WQ3A 2FWPA 3L8ZA 4FHEA 4F8EA 4RNCA 1TRKA 3UK2A 4OLFA 2XWQA 3FRJA 2R00C 4NV0A 5KWIA 4XYBA 2H2HA 1EE1A 3U9SA 5KOHB 2O8CB 4D3FA 1EBBA 3OWHA 1IJEA 4HJXA 3AM1A 3P2KA 4YC7A 1AC5A 3BB4A 4JI2B 3TW0A 1YU9A 5B7GA 2PT7A 3BMCA 1JJ7A 4P3YA 4K03A 2Z08A 4DDMA 3V1YA 4A91A 1QG2A 5K3BA 1XA3A 5CT8A 4L9SA 5CW1A 2O14A 1ISHA 2QA5A 2YV4A 3IV6A 5B2ZA 4EKDA 3PR2B 2G5CA 1PWXA 1RLTA 4KN9S 4C7XA 2V55B 5CIYA 3PFHA 2H16A 1KSFX 3AB7A 4UHCA 5JATA 1L5HA 3RWMB 4OKIA 3WYCA 2ZVPX 5LQAA 1IWOA 1U9YA 3FWZA 4ZOAA 2AEEA 4CMGA 4B8YA 1M1ZA 5TQ2B 1ZH4A 3DE0X 4F2HA 2DUMA 2GRUA 5JAPA 1R6TA 5B5SA 4GECA 1YQEA 3IIJA 5CURA 4ADSG 3GYBA 2GWRA 2QAGA 2HR1A 1CUIA 2V5UA 4UDNA 1GG2A 5ALZA 2FQQA 4HAWA 3DHWC 3ET5A 4P35A 1XEFA 3EVEA 4J0KA 2BEWA 4DTIA 1BC5A 2X41A 2FK8A 3SF0A 2C4HA 2WFZA 2X7JA 4DR4B 4FTWA 2FEMA 2W6JD 5DP2A 3W5AA 4UEJA 4M55A 2QJOA 5AXCA 4J0IA 4BNYA 2XCSB 4I2VA 2GEBA 3HYTA 3ACDA 4NENA 5B1HA 3RJZA 3HPQA 5BR4A 4V2UA 1CQJA 1KBZA 3FPJA 3NIFB 2I6UA 4D4LA 2BELA 2IXTA 3IPYA 3JARB 1RQXA 1MEJA 2H1IA 3MRVA 4NYJQ 1FP7A 2EYUA 4QASA 2GYYA 4TV9A 2UYGA 2R6GA 3LL7A 2COEA 3CUVA 3VZQA 1B2RA 1IG3A 5K6AA 2O19A 3V4PB 1G5HA 3VDRA 4EF5A 2WWXA 2Q5OA 4JXZA 1C0KA 3BXPA 4F72A 1X8JA 2HGZA 3NRBA 3Q0TA 1IN4A 1QIIA 1BQ4A 2H92A 4IXNA 2I6XA 4FHZA 5IJXA 2BY4A 5EJ5A 4ARIA 1KO7A 1CD5A 1LZKA 4E09A 2JJ1D 1L5NA 1TO1E 1ZI6A 3PFGA 2C7OA 3EZLA 2FN8A 2CT8A 2OT3B 1C9EA 1ULAA 2R6FA 3BGIA 3JD0A 5EKXA 4B45A 3LUJA 2MSKA 1CIPA 2A1UB 4D8TA 4EP1A 2VP0A 4DSUA 4R8RA 1R5OA 1X13A 5E3JA 1E2JA 4J0HA 2R6AA 2QRLA 4S0ZA 1T0PA 5K0FA 1QB7A 3EH1A 2YYYA 3M5DA 1JB1A 1ECPA 3KLMX 2XBMA 1TIPA 5D6NA 3GPCA 5F3DA 5KNCD 4DR7B 3BQ9A 3QVKA 4PEVA 1SCUA 3BDIA 1OJ7A 1R1DA 2J6IA 3RSHA 1BX0A 3UAZA 3CGWA 3UT5A 2ECPA 2PA0A 2HCBA 3DQPA 1M34A 1YO6A 3GQVA 4DDVA 5DI3B 1NVVR 2JG3A 5HEKA 1A9RA 4GZLA 4YNBA 2A59A 2ANBA 3W5HA 1TF2A 3KEGA 1HQKA 2WHEA 2W98A 5IN5A 4W5HA 2QVGA 5JQGF 2BKUA 5TE9A 4JBLA 1PNTA 2QORA 3K0KA 1L6IA 4EG3A 4MVJG 5JHHB 1LUAA 5HYVA 2GO1A 3EGOA 3VKWA 3TE6A 2PWZA 3GUUA 2ZATA 4JT8A 4MYTA 1R4ZA 5F1OA 5HIKA 1SZCA 1NW9B 3NTVA 4N5MA 1QORA 2FUKA 2F55A 3SN6A 1F2TB 2IFTA 2JIQA 3UHOA 3ILVA 3D6AA 5K09A 3F3KA 2NOAA 1H2RS 3P9PA 1HX7A 4FGSA 1XMOB 2PXCA 5EP2A 1DXQA 1NBIA 1O9BA 3PA6A 3I2JA 2CHEA 3D8NA 2NGRA 3O92A 4MQBA 2MJLA 4GI2A 1JHAA 1V26A 4BVHA 1NBOA 1VE7A 1YMQA 3A1SA 4N4AA 3SEFA 2F8TA 3U09A 1AMOA 1Q19A 2O7NA 4HTAA 4MP3A 2BE7A 3V32A 4BLUA 2WAAA 3MPUA 4P1ZA 2OYSA 4NBNA 1LBHA 2PDAA 3E9CA 3SJAA 4C4TA 4DQKA 2JCVA 1CVLA 2X3UA 2YC4C 3CJRA 2I29A 1C1YA 1PLLA 3LTEA 3LX8A 3C3DA 3IR6A 4RY2A 5EAIA 1P2FA 1UBGA 4OBWA 3R7DA 2GTPA 3CC8A 2EJBA 3R6GA 4HUJA 1C7ZA 1KZ1A 1CDOA 1N0UA 1NDQA 4EYGA 4F5DA 2XKKA 4E4RA 1T9HA 2NO5A 2JB9A 2LIPA 2ZKLA 2BKXA 5E0OA 3IVRA 1AKTA 2X23A 1L5VA 3TUIC 4D4HA 4DWOA 1T9KA 2ZR8A 3MUOA 3IUQA 1GRCA 1OX4B 2VUIB 5ESWA 1T0UA 5AKGA 3WJ2A 4AN0A 3BXHA 4UU7A 4W1QA 2YBEA 1IEXA 4LXGA 2SHKA 1ECCA 3G3EA 5J59A 4M0MA 4D0NA 5A3QA 1QU3A 1DAGA 3LA6A 4BP3A 4E5PA 4LVUA 2PKWA 3P27A 4NL4H 1TJPB 3L6CA 3OFSA 2FFHA 4H3SA 4O6VA 5EZ6B 4EGSA 3T7CA 1UOPA 4HPWA 4NE7A 5DX1A 2DY1A 4Q3OA 3UHJA 1NZFA 3OFVA 1D5CA 1EFTA 4S1PA 3HYRA 3UK1A 3IB3A 2C5AA 2BI7A 3O91A 5C46F 4KC0A 1G2OA 3NNSA 1M33A 4IXMA 2XE6A 3BJEA 2A9FA 4MS4B 3WRYC 4RK5A 3OQIA 3DWGA 2JRLA 1RMQA 4RADA 2YS7A 2CLCX 4FHFA 1JLLA 5P21A 2OUKA 1C3XA 3RSLA 2ZJYA 1EJ6A 3MFQA 4G5SA 1LLQA 5LDHA 5LYYA 5EXEA 1F48A 1U7PA 3M6WA 4WBSA 4MQEA 3VU0A 1XMQB 2Y1DA 4DCCA 2VNJA 4IDCA 5IPFA 3ANXA 3PL5A 3SD7A 1F4LA 3HHPA 1E7WA 3FXAA 4QM6A 1SCDA 2ZSFA 1Z0DA 2ZUEA 3IOMA 1TFRA 1GR0A 1XB2A 3PGXA 4KBFA 4QSMA 2V7XA 1HWYA 3HA7A 4NEQA 1FX1A 4HQRA 4O8CA 2A0WA 4PQFA 3NWPA 5HF5A 2CY0A 3COWA 3VHXA 1NATA 2C61A 4IIGA 4UOEA 1JLSA 3VM6A 4JL8A 4X97A 3LPCA 3RV4A 2VLIA 1J5XA 2GJ9A 4Q5IA 4QG7A 2DLDA 5ES3A 2C8VA 3RT7A 4BMSA 4ERNA 4GKKB 4QYIA 3C48A 3PKZA 3MMNA 1RWKA 1X1BA 2FEAA 5JY1A 1P2UA 3R3ZA 1U02A 3WMRA 4URXR 3JZMA 3TLKA 3CUUA 2ZIUB 2E49A 2H2WA 2QQEA 4I1SA 3L4EA 1XLWA 3EXHC 1FP4B 4O4HB 4IUBS 2ZRKA 5DNWA 4YPVA 2F4NA 4QXAA 3MWJA 5J5VA 4X7BA 3IQDB 2H9AA 3ORQA 3UAXA 3W0LB 3EFOA 1K89A 4CLEA 4NZNA 1RFLA 1Q1GA 3VJMA 1EXMA 4RJKA 4E46A 1XWFA 5C4GB 1G8PA 2OCYC 3CLUD 3KL4A 1Z0JA 3LDFA 3II6X 5DULA 3N8GA 5IMSA 4R2HA 2TECE 1O97C 1WUTA 1SXPA 2DM6A 2IYSA 2VVTA 3H1GA 1FFDA 2R1ZA 3LWZA 1C30B 1HT2E 5E2BA 5JPIA 5LA6B 1DBPA 1AB6A 1X74A 4AWXA 2JJYA 1P29A 1T5BA 3KNZA 1PDVA 1D6NA 3QVXA 4Q34A 2QMUA 3NBZC 2DP4E 4GT1A 1VKZA 4COOA 3LV8A 4P3OA 2QLFA 1C3EA 4FZRA 1VE9A 4CN8A 4RH0A 5BMVF 2JFZA 5B7QA 2C7RA 3S3TA 1GGJA 3GRFA 5HCIA 5BXYA 3Q7QA 1GNQA 3QZUA 4HL6A 4F04A 4YT5A 1Q22A 2IZ6A 3PPIA 4EB6A 3QELB 5L8VA 4Y7CA 4TTIA 3HM9A 5A71A 5CD9A 1NQUA 3OOHA 2WJ4A 1U0EA 1QQ6A 5CLIA 2L82A 3CIFA 4RZ2A 5T4HA 3TO5A 3GJQA 4AIIA 2H8KA 4KPGA 1PEDA 3CNHA 4J0FA 3FWHA 1XNGA 2BVNA 1KK1A 4CTOA 1LY1A 1SIUA 1FNNA 1NNLA 1TAHA 4PLWA 3REGA 5LQNA 3ZBPA 5A2GA 5LNK1 1RM4A 2VH1A 3BB3A 3WLOA 3AEXA 2ZT7A 3N8DA 2DHQA 1D9XA 3E22A 2GSDA 3E81A 2HRBA 3EZ2A 2IRWA 3ORFA 3GRYA 4J43A 5H4GA 1YB4A 1NNI1 2V7WA 5AJVB 2FH5B 4K81B 2NYUA 4D4IA 1WIWA 1RRMA 1JR3D 5IT9A 3WYNA 3CLRD 3UZUA 3CCBA 4QRHA 1ZXLA 4LZAA 4MRPA 1U7WA 2XUOA 1ULSA 1EJ2A 3EF0A 5I7UA 5BURA 3WAGA 4Z53A 3FPEA 2EXXA 2P9QA 3Q12A 3T34A 3HY3A 3ZK7A 3I9FA 3VVLA 1KWKA 1RWPA 3C3AA 1H1DA 1D4AA 1L0BA 2L0XA 2FOIA 3Q9SA 5EP3A 4B4WA 3VNRA 3HH8A 4BJ5A 1KHTA 1ZUNA 4FE4A 4DV4B 2B8JA 3BC1A 2AUMA 4GG1A 2PZ8A 2AMYA 4EJSA 3GFGA 5CPFA 3RVLA 4QLAA 1WMSA 2B94A 3C6BA 3MIZA 2FEOA 3NXSA 4MO2A 3KSZO 5B1SA 4Q39A 3ZVNA 3EDYA 1Q2XA 1D1SA 2OV2A 2QJTA 3G8AA 2ON6A 2JGLA 3WGNA 4PANA 3G02A 1PFKA 4NCBA 3N0VA 4CV1A 2X0JA 1PG5A 2W8BA 3ZZUA 2F90A 2JL1A 3D4LA 5TQVA 2J5BA 5LMZA 1F2VA 3INYA 1IDN1 3I09A 3LUCA 3MB5A 4JOQA 3OO1A 3QSGA 4R83A 4F3CA 4G0PA 4B6RA 1SK9A 1YT5A 5J4HA 5BW6B 4YRLA 3OX3A 4KVGA 1F60A 1MO2A 2CCJA 3E53A 4PC3A 3L43A 4UMFA 5LB2A 4QUGA 2WUDA 1U3GA 1G4UR 1NG1A 1F4VA 1U94A 2ZRCA 3EOBI 3FOBA 5FOQA 1EGHA 1CR0A 1FSSA 1V8ZA 3QW2A 1ZD1A 3SNKA 2EFGA 4GOMD 3AM5A 2DKNA 4IUYA 4XDZA 4DIMA 1JKJA 1KK0A 2UVPB 3KU1A 3U7GA 2E89A 1J97A 1UXIA 4MR9B 2X13A 1NP3A 4D9HA 1BSVA 4EY7A 5ES4B 3CZQA 1Q0TA 3A7EA 4CTNA 2V6IA 1OTHA 2IHNA 1HLGA 4N03A 4JB8A 4BLQA 3FFBA 2VJOA 3VUEA 3FCUB 5ERGB 4Y2UA 3G1UA 2VCEA 4ZEWA 3M6MD 4C0QC 2IYQA 2AJLI 2ETVA 3PNMA 4P0QB 1MJGA 4D0RA 3H75A 5T67A 4YCLA 5TXGA 2HTEA 4CM9A 5JQGB 2FE4A 4U6SA 1RXEA 5FI0B 4OLHA 3W5SA 2PBRA 4EPVA 2PXAA 3SJZA 3OE4A 2O9JA 3N6XA 4D45A 3FFTA 2IPLA 1HL7A 3REFA 1BNCA 1HT3A 1Z5NA 5K0EA 5C8YB 1EHIA 3RUCA 3ST7A 1L4UA 2ZI7A 4BB0A 1FDRA 2G88A 1XU4A 2Z56A 1RBQA 3OZXA 3DL0A 4X62B 1FYVA 2QP9X 4GKVA 3MGBA 4ZTZB 1QIGA 2ZRNA 3QOWA 5FPQA 1A95A 3N8HA 3PDIB 1XLUA 1ZQ1A 2AUNA 2I22A 3C6QA 4HB4A 3GCXA 4MJ3A 2RH4A 4AG5A 1N8KA 3NC0C 3JWHA 5BRNA 4DGSA 3B5IA 1SC9A 1X70A 4UPDA 2WIJA 1N36B 1PVOA 2AV6A 1XEWX 1IZYA 4LOLA 1EEXB 3RQSA 5DWDA 4J9UE 2WG1A 1GGEA 4N0QA 3V4VB 4HWGA 4KV9A 1YDMA 1CE8B 4M38A 5E4JA 1UJMA 4ENVA 2ID4A 4ZOQI 3BE6A 4DLKA 1YRBA 4NBUA 1GFZA 1Z8DA 5K7SA 3WK7A 4NICA 1BVYF 3KR0A 2IHBA 2X1MA 4NPCA 5AW3A 3HXOA 1OLSA 2O8EA 2IHKA 2ZR0A 3I6QA 2EP8A 3DEAA 2PZGA 4UJ5A 5DIFA 2FB9A 4DFDA 1C1XB 3CKKA 3KO8A 1JWLA 4NX2A 1P18A 2BBSA 2I7CA 2R85A 5H82A 2HWWA 2BZ1A 4PLCA 3Q5GA 3QV1A 3QXSA 2HBYA 2J9FA 2OHGA 4BECA 2B5VA 3FHJA 5COAA 3HGMA 1J0XO 2ASVA 1ND6A 3JQ9A 2FKAA 3KXPA 2PM8A 4P7KA 3WQRA 5C34B 2Q8QA 3HA3A 1WMAA 4KBGA 1E63A 2IPAB 4YJKA 3VNVA 4GKJB 1HDGO 3DE5X 3QPDA 2IU4A 3NHUA 2ZT6A 2DLNA 1QZZA 3H2IA 4RDIA 2QTFA 3RUPA 5KOIA 2RAPA 4HYEA 1I6WA 7REQB 1X38A 2EGGA 4YHBA 3UUWA 3ADKA 3L05A 4Q3BA 3L0CA 2J6BA 1NBHA 3OU6A 4UHFA 3TRIA 1ZVKA 4XPZA 4HEQA 4JT2A 4YXWA 1Q83A 2BFDB 2XGSA 3SAJA 1XZMA 2D13A 3A3YA 3TUJC 3UPTA 3NANA 4Q1CA 3DF7A 4A8JB 4NNJA 2CLIB 4V1CA 3EUFA 4BEBA 2QVXX 3ZHBA 3DO6A 5YASA 1OF1A 1KARA 1LNZA 2EFDB 2I65A 1E2GA 2A7XA 1F8FA 3DA8A 2Z8YA 4MKGA 5EMLA 1JPJA 1DXHA 3QLVA 2V7BA 1XKQA 3KKEA 5IKMA 5LFAA 5C8DA 4PF1A 3WFJA 3T3IA 4LHYA 3KEFA 2WSMA 4I9HA 1ENYA 1QTRA 1WDLA 3SS7X 4QGSA 3ZU6A 5IZCA 1ZDMA 3KJEA 5JJIA 4MWGA 4TRMA 1H22A 2E4YA 1EX6A 1GGFA 1Y4DE 3HUUA 1Q6YA 4JJZA 4CHTA 4N9WA 3RVRA 1JDNA 1E9EA 3FR7A 3VR3D 2P69A 3CUWA 4PY2A 5JROA 4XR9A 1ZCZA 2HLPA 2VA9A 4WK6A 5BQ3A 4JOCA 2NQ8A 4XXHA 5ENZA 3UPDA 2GF2A 2OCBA 1DAPA 1ZMOA 1QHXA 3L6OO 1NN0A 2DMRA 4DA7A 4FOOA 1ZICA 4DLUA 4Q7LA 3N05A 4OK5A 5FI5A 3EODA 3M3PA 1QXSA 1TQ4A 3CWCA 3MWDA 3NHKA 1P75A 1H4VB 3JZIA 2XMRA 5CMLA 8ATCA 4NCAA 3TTWA 2P7IA 1M7HA 4J0DA 5CEJA 5KC8A 4MVWA 2HMWA 1N2XA 2ZWOA 2B78A 4G8DA 4B7UA 1FMTA 3AILA 1RAFA 3DOJA 4GBMA 2XT6A 3OE5A 3HJRA 3VOSA 1MAUA 3TTTA 4D6PA 4EPXA 1H4SA 1Y80A 5JNVA 2WE8A 4MTLA 3MOGA 4QELA 2RDMA 5JNSA 2W37A 2Q9BA 3K9FC 3O93A 3CH5A 2NT3A 2X9NA 3MGAA 3LWBA 5C4IA 1JKMA 3A31A 4ZC1A 4FWBA 3W8NA 3FHCB 1T36B 2C88A 3L9XA 4X3OA 3Q3HA 1ORWA 4G4JA 1K9VF 2B0CA 4YJHA 2OXTA 3RHTA 2MCFA 4UPEA 4QARA 1PR9A 4ZT4A 1R6XA 3WFIA 3JV7A 1ZRHA 16PKA 4HF7A 4E15A 3DT8A 3NYWA 1R5BA 1V43A 2EZ4A 4ER5A 4M8NE 3GD5A 1CJCA 1T5DX 3AV3A 4LNUA 4ZI7A 3VC2A 3L8MA 4G97A 4GZ6A 4NAHA 1EM6A 4RYLA 4QWMA 1X9GA 4R9NA 2C2OA 4BJ1A 1BWQA 4IXTA 1TCVA 3K9QO 4YMTA 4A4DA 3EW9A 4XASA 2JW5A 3HP1A 1T6NA 3LUFA 4DR2B 5HF6A 3M6LA 4ZAGA 1L7MA 3FSEA 2AN3A 2WWVD 4OQ4A 2KHZA 2XCIA 2J9XB 4DS3A 1RQLA 4H1WA 1KH3A 3O90A 4C7BA 4LDNA 1DZ3A 2HIHA 1KTVA 4PWZA 4B3CA 2ZRLA 4UTPA 2OPHA 2WTUA 3N5KA 2OM6A 3EWNA 1ULBA 3PENA 2F4VB 4ALMA 3KZ1E 3BWVA 3E1GA 5A6SB 4AS1A 1N1EA 4OFBA 4M0FA 1W0KD 3VU9B 1Z5ZA 3BX1A 1R66A 1TVMA 2Y0PA 5KCZA 2MMGA 2AJBA 5FPKA 4R54A 3DP9A 4X94A 1KHHA 1AQ6A 2D59A 4U8GA 4V0QA 4EELA 1N5RA 3GB9A 5JS8A 3H7AA 2XJ9A 1A9XA 3HXMA 3PTZA 4ZEXA 1U99A 4HDSB 4BPBA 4DIBA 4B9EA 1EVJA 2VAXA 3CNQS 4IVPA 2OV1A 1F3LA 3EMVA 3AR4A 1XZQA 1OE0A 3BD8A 2GN4A 1EPUA 2VI5A 3K6KA 1M6EX 3T1HB 3Q11A 1CPYA 3RV3A 3WYFA 3WG9A 2Q2NA 3TNFA 5IVDA 4LXTA 1JQAA 1QZUA 2BFOA 1TD9A 2X5NA 1N6LA 3CBQA 3NTXA 4ILEA 4PLHA 4MVJA 4U5QA 2HCFA 4Z86A 5DX8A 5BSMA 4DY4A 3K70C 2J7PA 3GVIA 1NQVA 2RHCA 3B85A 3DZHA 3HLYA 3NEYA 3RSFA 2VF2A 1OHHD 3IFSA 1PUXA 3VKHA 5KTPA 3BWCA 4K5QA 2YQZA 4E32A 1NW4A 1QE0A 2ZIGA 3DOFA 3E9RA 3HSKA 4JLUA 4H4DA 4BFTA 1TJNA 1ZZEA 3CH4B 2BCGY 3Q2OA 3TVDA 4GOJA 3KUDA 3T1VA 1D7AA 4XDYA 5CDFA 3ZQUA 1EDZA 1XLTA 2FZEA 2HF9A 3I4CA 4L16A 4YUYA 8GPBA 2ZK7A 3NMUF 2KM1A 4MWCA 1C5KA 3U0BA 1SXHA 5LQCA 1OFUA 1AG9A 3N0WA 4AKEA 3B9RA 4AJKA 4DLVA 1RJ9B 4DLRA 4FD3A 4MWEA 1RPAA 1ZH0A 2C29D 1WMDA 1O2DA 2JGDA 1PR4A 1YBVA 3Q3GE 3IDOA 5KQLA 1PQYA 3LPMA 3ELWA 4G3XA 4KO3S 5FBLB 3RU9A 3VOBA 3L7IA 4AYTA 1JMKC 2CEKA 2H0QA 3WYBA 4FK8A 3NALA 1U1FA 2PA3A 1ST3A 2EOAA 2IYVA 1K66A 2CJFA 1KFBB 3F8WA 1I30A 3WRWA 4JJGA 2QTCA 5TIIA 1GCOA 4PYOA 4LA4A 3OY2A 4EY4A 5D3MA 2GERA 1V6AA 3CVVA 4DV7B 3UPUA 1KIAA 1TDJA 4XSGA 5AXDA 2XUHA 3TL6A 2O2ZA 1NVMB 4D44A 4BAUA 4JS0A 3B1YA 1QRAA 2RHDA 3Q8LA 1Q11A 2Q5QA 2R65A 4EFDA 2QRHA 4EO4A 5ALVA 4UTRA 1N8NA 4FNGA 4I9UA 1HFEL 1BVHA 3LAWA 4BFZA 1FXUA 3MTAA 2C5GA 1UBEA 2HIMA 3PNYA 4ALJA 5JS1A 2OXEA 2OE2A 4UAJA 4Z3KA 5DKFA 1OA1A 2VZ8A 1S89A 4RACA 2NQ2C 5L95A 3A14A 1XAHA 2NAFA 3BIWA 1H9BA 4TYNA 1PFGA 4YMWA 5I48A 1FUUA 1D07A 2EP7A 3VZDA 1JHUA 5IXJA 4IDHA 4B2IA 2RGGA 1EM8B 1I1QB 4E07A 3Q88A 1WHSA 1O4VA 1H2XA 3F9IA 1FIUA 2PD3A 2FF7A 2WHXA 2N47A 4FOTA 5TJ9A 3LBIA 2DWQA 1E1YA 1NN1A 4O3MA 4YDRA 4K9KA 5F7JA 2GGSA 1ZNZA 3E58A 3GEMA 3NGMA 4H16A 4DILA 1WSDA 1PZNA 3WZMA 5KTTA 2C0PA 4XIGS 1ZP6A 2X22A 3PRHA 4ZYLA 1XZGA 2G7ZA 1XL1A 1KYIA 5EYPA 2NU8B 2P4SA 1XZDA 4INAA 5I47A 4KCGA 1U11A 1OLXB 2O07A 4DCSA 4OQPA 1QPGA 2PL1A 2RAFA 3AEZA 3L7JA 4CM4B 1WOMA 4UUNA 4B79A 3GRZA 2GCIA 1T2DA 3ILYA 1KJJA 2O0KA 4H6PA 1KJ9A 3EN0A 3S81A 2Q9UA 3GEGA 5LQSA 3VAYA 3PE3A 4Z9BA 4IUCS 4E03A 1ZSNA 2H00A 2E0IA 1JWBB 2WU4A 3OSUA 4I2NA 4MTCA 1WUJS 3BGVA 4NDNE 4NK4A 4CGZA 3TTVA 4OQQA 2FX5A 2GZRA 1UDBA 3EY4A 1F20A 1ORIA 2PZMA 2XF8A 5EMNA 3CR8A 1PWEA 5LWHA 2Z6AA 4S1TA 1DNPA 2FJUA 5KQPA 1D2CA 4C4SA 3AHCA 4O5OA 5D5PA 1ADFA 4AY3A 3QLUC 4KDFA 4I50B 2F1KA 4G6ZA 1CCWA 4IZOA 2A3NA 3IP3A 1RLUA 1QIDA 4QULA 1FFAA 1ZMXA 2CYAA 2QW1A 1T8WA 5B1DA 1L1FA 3Q8MA 2G5GX 1UK9A 1NM5A 3WGUA 5ALDA 1V8PA 4UZSA 1S3IA 3WSVA 5EQFA 1YZNA 2ZTMA 1ZM9A 1DT5A 2XTNA 2NG1A 3MCZA 4A9AA 4BNVA 1HNNA 2VTBA 4UVEA 1H1LA 3H2BA 4Q4AA 3L0BA 2I0FA 2XMDA 3C4VA 4MI6A 4DREA 1Y8CA 1XRQA 1PJLA 2ZYDA 1GDHA 3FH0A 4JLPA 3N2YA 4MUJA 1MAAA 4F6RB 2PZLA 4ZO6A 1ISRA 3MUEA 3BTSA 4ICIA 1JKIA 5TLSA 3P19A 4FWTA 5LPNA 1O94A 2KLBA 1M1NB 3WA6A 4FW9A 4HFRA 4MAMA 2GNAA 5DHTA 5FBWB 1JFFA 2NYRA 3LBNA 2ZAIA 5U4QA 4QD3A 3D7MA 4D7AA 1FSGA 2Q27A 3WGOA 3BWXA 4HB0A 1UJBA 1W0CA 4RLFA 1E0KA 1K4YA 1PQ4A 5KMGB 1BVUA 1YS9A 4I55F 1MOZA 4DEVA 1YASA 1SURA 5CBPA 5G3ZA 1QSGA 3GVHA 5D3ZA 3RSQA 2ACWA 2Q7XA 4K9DA 1ZN9A 2J6HA 1CUDA 3UYKA 2JBAA 5B55A 1KJ8A 4D9NA 3O3NB 2ZQZA 1NE2A 1QHSA 3I92A 5JG7A 3D54D 5K5EA 2QUJA 3FZYA 1WBDA 1UXOA 2DWUA 2BC9A 3KSBC 5LYJF 3S2YA 1JQBA 1W1UA 5HKKA 3ZJUA 2VQ6A 4ZIRA 4PO8A 4Q3CA 4MYUA 1VM6A 3IDQA 5JSZB 4DA9A 2BM9A 3IOYA 1LWOA 2P9JA 5E1MA 5GIPE 4CLRA 3Q5EA 1BAPA 5ARDA 4OAQA 4M88A 2BFFB 4J0JA 1KO5A 3RHFA 5I9SA 3NDJA 1ZGCA 2EX0A 2LE0A 3STWA 1YU6A 1T2NA 3G59A 1XR3A 1AK9A 2R1VB 5TJHA 1E7MA 2OCGA 4OB6A 1DX9A 2GF0A 1PD0A 3QUQA 2WWFA 1SVWA 1NVKA 4S1NA 4HMOA 1FDOA 1QIMA 1P60A 1UP4A 3HWWA 4QTZA 1KAEA 4GRAA 4TQGA 4Y1RB 5DBGA 5I6DA 4ZEOA 3L7LA 5LU9A 4PX3A 1RI1A 3ZHVA 1GTVA 1SBIA 3GGPA 4HJRA 4RMJA