3JWGA

Crystal structure analysis of the methyltransferase domain of bacterial-cthen1-c
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
200
structure length
195
Chain Sequence
b'NLNQQRLGTVVAVLKSVNAKKVIDLGCGEGNLLSLLLKDKSFEQITGVDVSYSVLERAKDRLKIDRLPEMQRKRISLFQSSLVYRDKRFSGYDAATVIEVIEHLDENRLQAFEKVLFEFTRPQTVIVSTPNKEYNFHYGNLRHRDHRFEWTRKEFQTWAVKVAEKYGYSVRFLQIGEIDDEFGSPTQMGVFTLGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyltransferase type 12
publication title Structural and biochemical insights into 2'-O-methylation at the 3'-terminal nucleotide of RNA by Hen1.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Transferase
total genus 63
structure length 195
sequence length 200
ec nomenclature
pdb deposition date 2009-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08242 Methyltransf_12 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3jwgA00
3ID6C 1UIRA 3CC8A 4EKGA 1NW5A 2Q41A 3R0QA 2NXNA 3KQTA 3UA4A 3M4XA 4EK9A 2PLWA 2AOWA 4MHTA 2PT9A 3B7PA 1L1EA 2AS0A 1ZHFA 3LGAA 3UZUA 3PTAA 1IXKA 1N2XA 3KQSA 5CCBA 3SGLA 4PCLA 4QQKA 2K4MA 4DM3A 5DTRA 3DULA 3HNRA 3ORHA 1I9GA 4GEKA 5DTQA 3SSMA 2EJTA 3TKAA 2PKWA 4PINA 3E05A 1YFJA 2GPYA 4RSRA 3M6UA 4YV1A 3M6WA 5EHGA 1RI1A 4MTLA 3HVIA 4R05A 1BHJA 3KQQA 1R00A 3AWIA 5KQRA 3EGVA 4XUDA 1YZHA 3HCDA 3MTIA 2PGXA 3B5IA 5E2AA 1SQFA 4PYMA 4KIGA 3HCAA 4YUWA 1DCTA 3TR6A 5FTWA 5DSXA 2F8LA 5FWDA 4PIPA 4E32A 1VL5A 3OCJA 5GM2A 5HZMA 3LHDA 2IDKA 3DXZA 5E2BA 4QVGA 2XVAA 3EVDA 4FGZA 5EPEA 5EZQA 4KDCA 3V8VA 4PONA 3P9CA 1QAMA 2OY0A 2R6ZA 5DPMA 5EMMA 4MIKA 4P7FA 5E8JA 3UJ7A 7MHTA 2HMYB 4RVFA 8MHTA 5K0EA 4P7KA 2AR0A 3KHKA 2G1PA 1OR8A 3KQPA 4GOLD 1NW7A 3LBFA 4HH4A 3GJYA 5EIWA 1V39A 2NP7A 5HIIA 1JQDA 4OBXA 5K0CA 2LD4A 2UYHA 2GLUA 5DX1A 2YQZA 9MHTA 5E8RA 1YB2A 4IV8A 4C07A 3E7PA 1VE3A 3LX6A 3FPFA 4Y2HA 3TM4A 3SSNA 1YFLA 2VS1A 2IBSA 3SMQA 3ELUA 3EMDA 3FUWA 4ISCA 5E1MA 2VZ9A 2ZWAA 3FTEA 1O9HA 2HV9A 5FHQA 5C0OE 2PX5A 4GC5A 2Y1XA 3GWZA 3R24A 3MERA 3G89A 2BR5A 2OPBA 3FRHA 5ICCA 3NTVA 3A7DA 3V97A 1JTFA 1Z3CA 4DZRA 1KYWA 4UOEA 2XYVA 4AZTA 4C4AA 4FT2A 3O4FA 3OU7A 4E2YA 5KS2A 1WS6A 5LSAA 5GP1A 3GNLA 3R3HA 3DOUA 3KPVA 2VDVE 1ZKDA 1RI4A 2FCAA 5G02A 5BXYA 1Q0TA 5IH3A 3DTNA 1X1DA 4BLUA 2BR4A 3KQOA 3LCUA 3G8BA 3EVCA 5DT2A 1TPYA 4KIFA 4FZVA 2QRVA 3I58A 5M5BA 3G88A 4PGHA 3KR0A 3ELYA 4RTNA 2ZIFA 1AQIA 2AOTB 2O07A 1X19A 1MHTA 2HR1A 3LPMA 3BGVA 1M6EX 3P8ZA 4QPNA 3L8DA 3B3GA 2YUIA 4ZTBA 3A4TA 3LSTA 5JUWA 3KPYA 2QM3A 2PVCA 3FTFA 3AY0A 3OE4A 1QZZA 5GOZA 3HA5A 2ZZNA 3FYDA 3ERCA 2O57A 5F2OA 3NMUF 4AX8A 2XYRA 5GM1A 5DX8A 2BR3A 1JSZA 1QAOA 2XYQA 3HEMA 2PXAA 1L3CA 1NT2A 3LDFA 3OE5A 4IKPA 1X1AA 4A6DA 1RJGA 2EX4A 3A7EA 1G6Q1 1NBHA 2ZWVA 3LBYA 2NXEA 4IV0A 4AUKA 4MQ4A 5T64A 2A14A 1XTPA 4HGZA 3GRUA 4OX9Y 3THRA 2UYQA 3KU1A 4PYLA 3G7UA 5EG5A 3S68A 3BGDA 3SM3A 4CTKA 3M6XA 3PS9A 4YV2A 5CCXA 3LDGA 1I1NA 3UJ8A 3EVFA 3DXYA 3OZSA 1EG2A 5K01A 1U2ZA 2I7CA 3E8SA 5FULA 2ZFUA 3GRYA 1DL5A 2OKCA 1XCJA 1FP2A 1PRYA 2QYOA 4GOND 1EJ0A 3IYLW 5LQRA 3R6TA 1NE2A 2AVDA 2ADMA 3G2PA 2PY6A 3C6KA 3I53A 3MB5A 2ZSUA 5FWAA 3TOSA 2Z6QA 3NDJA 2DULA 5D1HA 4LWOA 3BGIA 3EVZA 3P71T 3G8AA 2B9EA 2G70A 3MTEA 2HTEA 2B25A 2XBMA 3G5LA 2O0LA 4MWZA 4BY9E 3DP7A 3LKZA 3PX3A 1VIDA 2BZGA 2IH5A 2DPMA 3KQWA 3EMBA 1XCLA 2ZTHA 3IHTA 3KPWA 4KRGA 4ATNA 4R6WA 3FZGA 3EGEA 3BZBA 3F4KA 4M37A 3A25A 5DTMA 3REOA 4PYQA 4XUCA 1ORIA 2G8NA 2C7RA 1JSXA 1P39A 2AN3A 1KIAA 5P8WA 5BW4A 1NBIA 4E2XA 1VP3A 1NKVA 2ORED 1EJ6A 1L3BA 2Z6UA 5EGSA 3VSEA 2AOUB 5FUBA 4F84A 4C08A 1XXLA 2PXXA 3B3JA 3HM2A 4KW7A 4L7VA 4HTFB 4OQDA 3UJBA 3OZTA 5LQUA 1XJ5A 3HA3A 2HWKA 2IP2A 2OBFA 4R8RA 3I5UA 3LKDA 3UJAA 4RTOA 3DMGA 1G60A 5CVJA 2OZVA 4EVIA 3C3PA 3GRZA 2G71A 2JJQA 3QOWA 5DRTA 3TM5A 4OA8A 3LL7A 5K09A 4PYNA 5T67A 2NXCA 4ER5A 5KVAA 1D2HA 3GDHA 3T7SA 4RVHA 2UYOA 1VLMA 4OBWA 2O06A 2JHAA 2XVMA 1KPHA 3B3FA 1MJFA 3E23A 3KR9A 3P9NA 2P7IA 1R6AA 3QV2A 5HFJA 5HIMA 3SR4A 1P1CA 3UJDA 1BOOA 2YVLA 3UBTA 3FYCA 3AJDA 3HCFA 5F2NA 1ZGJA 3KQYA 4OQEA 2YXEA 2PX8A 5EEGA 5ICGA 2PX2A 4KVZA 4X41A 2ZZMA 5DX0A 1EAMA 1FP1D 2FK8A 2JH8A 3EVGA 3AXSA 4OA5A 2P35A 2I6GA 3BUSA 3EVAA 2BM8A 3DXXA 4LWPA 3VC1A 1VQ1A 1L9KA 2NXJA 5CVEA 5DM0A 3KR2A 4HGYA 3LCCA 1VPTA 4CTJA 2BM9A 3GU3A 4FT4A 1TW3A 3MGGA 4GQBA 4EKIA 5HIJA 1VP9A 2YXDA 4E70A 1VBFA 1X1BA 5ICFA 1KHHA 2B2CA 2PXCA 3DMFA 5CD1A 3NVMB 5GIPE 5BW5A 2C7OA 3PT9A 1UWVA 3ME5A 3FPHA 5FQNA 2QY6A 3GIWA 5U4XA 3GGDA 1WXXA 3ER9A 1ZG3A 2ERCA 2GB4A 2EG5A 2AOUA 1WY7A 3FPGA 3KR1A 4A6EA 2I9KA 4PYIA 4CXMA 4RTJA 1JG1A 2YX1A 4HTFA 5CVUA 1QANA 4PIMA 4C05A 3VYWA 4CKEA 2P8JA 3RODA 4PYJA 5HOQA 2IH4A 2Z6AA 2ZZKA 4P7JA 1HMYA 4XCXA 1AV6A 1EQAA 1DUSA 1Q0SA 1P91A 3KQMA 2P3LA 5E1DA 4P7GA 4BP3A 1KP9A 2AVNA 5H02A 1QAQA 4U7PB 2P3OA 2CWWA 3H2BA 3LCVB 4CWAA 4YUZA 3CGGA 5GINE 1SKMA 2P7HA 4DCGA 4YMGA 2ZW9A 2QE6A 4RV9A 5JR3A 3OFKA 3T0IA 2AOVA 5DLYA 2PWPA 3GCZA 1KR5A 3CJTA 3OFJA 1JG2A 5CUQA 2OXTA 3JWHA 3NWEA 2H00A 4GOOD 2N47A 3K0BA 5KQSA 3TMAA 3MQ2A 1M0EA 4GOMD 3SSOA 5B1SA 5CVDA 1ORHA 2YR0A 5K0LA 5EEHA 3P2KA 3G5TA 3JWJA 2ZCJA 3T7TA 5K0FA 2ONZA 1D2GA 5DWQA 3UA3A 3EGIA 3OU6A 1AF7A 2VP3A 3EVEA 3P97A 4QDKA 4AZVA 3X0DA 2OB2A 4RWZA 5K0BA 3TQSA 2UZ4A 3C3YA 3FUXA 4X60A 3NW9A 4ER0A 1RJFA 1RJDA 4WXHA 5DM2A 4M7RA 5IKMA 3R9XB 4F85A 2PJDA 5DRYA 4GBED 4R6XA 10MHA 2GH1A 3ELDA 5CVVA 4JXJA 2VDUE 3D2LA 1D2CA 4DMGA 3FUTA 4FSDA 3P9KA 3O31A 1RI3A 1R18A 4QDJA 4CKCA 4YMHA 2ESRA 2HNKA 3DLCA 5EMKA 4RTMA 4YUXA 4HRAA 1XDUA 3HVJA 1R74A 2P41A 3FUUA 3MCTA 4PYKA 4H0NA 5E9JA 1NW3A 4RTKA 5T6BA 2I62A 3A26A 1BKYA 2IPXA 2KW5A 3G2MA 3PFHA 5EKXA 3HCCA 5K0NA 1G55A 2ZBRA 4NECA 1FPQA 4CKBA 5K03A 5CIYA 5HIKA 2AOTA 4QVKA 2FRXA 5EHIA 4F86A 2VDWA 3P2EA 5DM1A 2OB1A 2ZIEA 3FTCA 5KYGA 1AQJA 3GXOA 3FPJA 3UJ6A 3CVOA 5EKUA 4QTTB 4YV0A 4AZWA 4RTQA 2BH2A 3G2OA 3NVKI 3GRVA 4E30A 4RYLA 3A27A 1PJZA 3BKWA 3BWBA 1M6YA 2WA2A 1G38A 5LQAA 1NW8A 4GF5A 1I4WA 5EOVA 4POOA 2AN5A 2JH9A 1JG3A 3M6VA 4ER3A 2YTZA 3MHTA 2B3TA 1F3LA 1YUBA 3HVHA 4FSXA 4RX1A 1KPIA 3FRIA 5FHRA 1YF3A 4LECA 5DSTA 4BLVA 2FHPA 3K6RA 1RI5A 2CL5A 2CMGA 3EPPA 5E1OA 3P9IA 2GA9A 3CJRA 2OYRA 2H11A 1TW2A 4DQ0A 5LQJA 3DR5A 3KPUA 1EIZA 4PGGA 3P2IA 1RJEA 2FYTA 2GS9A 3Q87B 1HNNA 3OU2A 5EMJA 1XDZA 2R3SA 1N7JA 1X1CA 2ZVJA 4FR0A 1IY9A 2IGTA 2CKDA 3QOXA 4QPPA 5LQKA 3PFGA 4GC9A 4QTUB 4DCMA 5LQNA 3DUWA 4M36A 4ER7A 4LG1A 1WXWA 3UWPA 4YUYA 5EIFA 3SX0A 4C04A 3LECA 3PB3A 3GRRA 1JQ3A 1NV9A 3RW9A 4PWYA 4E2WA 2PWYA 5FQOA 2NP6A 2QRVB 3FTDA 5MHTA 2B78A 4V0QA 4KDRA 5EVJA 4BLWA 3M33A 1JR4A 1KPGA 4ER6A 2C7QA 3WSTA 1SQGA 1O54A 5DXJA 5ERGB 3TRKA 3DLIA 3CKKA 1JTEA 1NV8A 4E33A 1SVUA 4X63A 5FA8A 1YZ3A 3G2QA 3HA7A 4FP9A 5C1IA 1H1DA 4C06A 2IDJA 3SXJA 4E31A 2YXLA 4RVDA 4EMSA 3PX2A 2IH2A 3THSA 2ZLBA 1WZNA 5FCDA 2FK7A 2CMHA 5GIOE 3C0KA 1L3IA 3CCFA 5LR6A 1G8SA 5F2KA 3KKZA 3I64A 4EQZA 2PX4A 1FJXA 4G56A 3EEYA 2C7PA 3FUVA 2PBFA 2G72A 3PVCA 4XUEA 4DKJA 4DA4A 3EEOA 4P58A 2EFJA 2PV0A 2NNWB 3UJ9A 3NDIA 2ZBQA 3MAGA 3AXTA 3TPZA 4X1OA 5ICEA 2UYCA 4PCAA 3BWYA 2IIPA 3OPNA 5EQJB 5LQCA 3VC2A 2ZULA 4O29A 4YUVA 5C9ZA 2EJUA 2NYUA 4KWCA 5DXAA 4Y30A 4RTSA 4WVLA 1QYRA 4IWNA 4K6MA 4U7TB 2AOXA 5E1BA 4QQNA 3JWIA 1FBNA 4AZSA 5FADA 3M70A 2V7EA 1B42A 1ZQ9A 4R8SA 5EMLA 3PLAE 5CM2Z 5HEKA 3ELWA 3I9FA 4RTLA 1P1BA 3BT7A 3LDUA 1SG9A 3B89A 3ER8A 1SUIA 4E2ZA 2JG3A 3BXOA 5DM4A 1N7IA 1RI2A 3T7RA 1JG4A 1T43A 1IM8A 3DH0A 3Q7EA 2GAFA 2IFTA 3NJRA 3HVKA 3IV6A 3ANXA 5EC8A 3C6MA 5D1NA 3DMHA 2IBTA 4HSGA 4M38A 3HTXA 1SUSA 4BP1A 4V0RA 4HG2A 3EVBA 1KXZA 2Y1WA 2AZTA 3IEIA 3TKYA 1R8XA 5K0GA 4B17A 3KPJA 4C03A 3GO4A 3O7WA 3UJCA 5BP7A 2P1DA 3MCZA 3TFWA 1O9GA 1F38A 1R8YA 2JHPA 2PT6A 2H1RA 1JQEA 1Y8CA 1XVAA 4GUAA 2JHCA 2ONYA 1UFKA 2OO3A 3BWMA 1WG8A 5E9WA 3HCEA 2ZBPA 3U81A 2ZIGA 1G8AA 1INLA 1ZGAA 4PYOA 2WA1A 2E5WA 1BC5A 2P3QA 5FA5A 3UFBA 3NWBA 3BKXA 4RTRA 4Z2YA 3TLJA 5K8VA 3CBGA 3HCBA 4PNEA 3HP7A 3FPEA 1NW6A 2FPOA 5EZSA 1KYZA 2PSSA 3JWGA 5HILA 5K0JA 1XDSA 4HC4A 4FS8A 4RVGA 2AN4A 3KQVA 3OZRA 3CJQA 2WK1A 2O05A 2P40A 3BWCA 4X61A 5E9QA 2V74B 3RIEA 5GWXA 4DF3A 5K05A 3SVZA 4RTPA
chains in the Genus database with same CATH superfamily
1PJ2A 5ARCA 4Q1FA 3A6JA 4QNNA 4CG3A 4DXHA 4DJAA 4YAFA 3KVRA 2PT9A 2HREA 2WE8A 3E3MA 3LGAA 3AUTA 4I1UA 4ZAFA 1TD1A 1Q1BA 4JYBA 4JX8A 1JNXX 5D6OA 1H5NA 1T3GA 2O6HA 2IEGA 2WSIA 2K4MA 3IUQA 4LRTB 3VV3A 1PWZA 1PDVA 2D3WA 3IH5A 4HFRA 3HJFA 1V7CA 5ES3A 5H1YA 1E79D 3MINB 3KJXA 1TUBA 4MI1A 1NC1A 3CTMA 4PINA 4L72A 4CF4A 4YP7A 2FEMA 4I6EA 1ZLYA 3OIVA 5B1YA 1WKVA 3BSYA 3RS0A 1ADYA 1G5HA 4HJXA 4JL5A 5F9FA 2W42A 4WJKB 2OQIA 4XR4A 3NR2A 3GOHA 3SF0A 1NJFA 1TAHA 3D6AA 1VBKA 1XZEA 2Z2YA 1CU1A 1XWFA 2Z0MA 2ID7A 4HXGA 3ANMA 5C31A 4BWYA 1VL5A 2QZZA 4WNAB 1SHZA 3CF4G 3F6EX 3ZHRA 4ZCSA 4FYJA 4DJ5X 3ZX5A 3VAYA 3QY0A 4DIMA 1GQQA 2H2GA 3V8VA 1TTTA 4BZXA 4C1NA 5REQB 2NV0A 2JIZD 2O2XA 3RBXA 1U2DC 1H1TA 3GRCA 3ZHCA 2BONA 3NVAA 3PFNA 5LBUA 2AR0A 2FPXA 3GMSA 3KHKA 2YKGA 2MINA 4NCKA 4OGFA 3ORFA 2MYNA 4JUAA 2FGKA 2J46A 2OBXA 3ACCA 3AEKA 1Y6JA 2JCYA 3PKIA 4PG6A 4C0HA 2WICA 2XB8A 2B1QA 5L45A 3EY9A 2NP7A 3EEIA 1I0IA 5K0CA 1K6XA 4W5RA 2OAEA 1HF3A 1TA4A 3ZGYA 2SBTA 4IV8A 5IBCA 1PNVA 3LX6A 1MAAA 2ZUFA 3KEOA 1FMCA 4M0CA 5CA1A 2DPXA 2FG5A 2H63A 2WF5A 2NO7A 3QK7A 3V7YA 4WLFA 3OIYA 4XD2A 3ROEA 2POQX 1PJ3A 1VL2A 3QWIA 2ZIWB 3D3WB 1ECCA 1YZKA 3Q85A 4G37A 4MARA 1SVNA 1MJ5A 1YBFA 4UW9A 4Y2QA 3ZCTA 5FA6A 3WGLA 1U8AA 3R76A 1TZMA 2QG9A 4NMXB 2BE9A 1QVWA 5AVSA 1JFVA 5CDYA 2XZDA 1LK5A 2ZYIA 5HCNA 1N6LA 1GLVA 4E2YA 3OE1A 1UBRS 3V32A 3HQ4O 1U8YA 4BECA 4I5FA 5LSAA 3QX3A 2QYSA 2YJ3A 3DOUA 2HCJB 3MF4A 5G02A 3DO8A 4EGAA 1U0FA 2D5LA 1MF7A 2EBFX 1L5MA 4F2HA 3BD8A 4OBEA 4LNUA 2J0QA 3E1SA 2O3TA 4MW1A 3RUIA 5E7MA 3K0CC 1UMCA 4E3ZA 4RTNA 3DVQX 4BUZA 3L4EA 4WZZA 2DHRA 1JQJC 4EHBA 4FI3F 1M6EX 4NJEB 4L50A 2VDWB 3L8DA 4LSGA 4QPNA 3U2QA 5FBVB 5KNDD 3T99A 3A4TA 3D8BA 3STWA 2NO5A 3K2QA 5ECWA 5F78A 2I4NA 1YBAA 2PWZA 5G1NA 1QZZA 4Y2JA 1JLRA 4P3NA 4LQCA 3KETA 2ZZNA 1MQAA 1MZVA 2O5EA 3VZBA 3WYCA 3NMUF 4JOQA 4ANFA 5E7JA 1DG1G 4XDYA 4WOCA 4CQMB 5K6AC 3DLAA 2FOLA 1YIDA 4GMHA 4PSVA 2Z9CA 4WXPA 2ZQ5A 4L9SA 3RYCA 3JVVA 3ITEA 4BNDB 3LO5A 2VBFA 5K7SA 4JJGA 2I03A 3TLEA 1JKJB 4HQNA 1UXKA 4G4GA 4LXXA 1G9SA 2QTLA 2FWMX 3VOAA 3S2IA 3VU1A 4BX0A 1Z25A 1BMDA 3OM1A 4DCPA 4G84A 2AF3C 2GEFA 2UZ0A 3RHZA 4RCYA 4UU1A 5FULA 4E51A 4G4IA 2QYOA 4YCNA 4RENA 5JAOA 4O2RA 2G83A 4TXNA 1NVFA 3MHPA 2EQAA 5DVZA 2JIZA 3OWXA 2JKYA 4K9LA 4HQOA 3IOBA 2IYPA 4CGYA 5ES4B 2ZIAA 3DMYA 4LA4A 5D1HA 5HK8A 1WDTA 2OCYC 3AEQA 3VC3A 4DVJA 4CCSA 4DGSA 4ZFNA 4DANA 1H9CA 2ZB8A 2EIHA 2ZJ1A 1J0AA 3A9WA 3N7UA 5LCXA 3KP1A 4G4JA 5JSKA 1TIBA 4AD8A 4XYMA 1W4LA 4HYQA 4N6GA 4U2GA 3K20A 4D92A 2JI7A 1QCCA 1OYOA 1R6VA 4KO4S 4X93A 3SHFA 4YJFB 3BULA 2OL4A 4OXXA 3GD5A 4WOJA 1PKEA 2BFDA 3W8RA 3WIOA 5AI8A 4U0KA 3SHWA 3T3EA 4BGUA 5C7YA 1PS8A 3WQBA 3M9WA 1QQBA 3WQQA 4IVPA 1HURA 4YJ2F 3T95A 3K9GA 2IXGA 1UQRA 4G1MB 3TQRA 1W4CA 3ADOA 5J9FA 2CB9A 5B55A 4JI3B 2F4NA 3JVIA 2JAHA 4MCHA 3VSEA 2A94A 2G06A 3ZHTA 4CIVA 1N0UA 4D9JA 1IY2A 2XYPA 4H0CA 1BWRA 1H4QA 2GCIA 3A3OA 3GVPA 1NN0A 3D3NA 5JH7A 2BZ1A 4YJKA 5J4HA 2PN1A 3L84A 3HN6A 1RIIA 2R66A 3SICE 2HQ1A 2P8SA 4HDRA 5JD4A 5K6TA 1OH5A 2VXOA 1Z6AA 1S2MA 2HMWA 1MDBA 3HKDA 3RT7A 5DRTA 3AVYA 2VJMB 1HUQA 2CVQA 3SQWA 3LQFA 4S3MA 2F48A 1U90A 5SZIA 3B82A 3G3EA 1T6XA 2GPJA 2UYOA 3OJOA 1AS0A 3S7TA 2OUIA 4F5ZA 2JK1A 3BSSA 4EO7A 4QZVA 3AVTA 3QV2A 4U1RA 5J2UB 3ZCQA 3L7MA 1LFDB 1VGVA 3OG9A 2KQUA 3UJDA 5IN5A 1MDFA 1P29A 2PWAA 3AJDA 4MVJM 2WJVA 4N03A 1PJRA 2Q0SA 4UD2A 5KNDA 2YXEA 1FQJA 5KWJA 3PEWA 2EKDA 2YZGA 1M6VA 2Z58A 3ABIA 1L4HA 3GLQA 4OG2A 1JQAA 3T3GA 4BO9A 1X9GA 1FP1D 1GR1A 3M9XA 3VA7A 4EDFA 1P5ZB 2IY9A 2R85A 1NU8A 2RI1A 3AR7A 4CM5A 3GOQA 1R15A 4HQFA 1U7OA 4Q82A 5D00A 3GYGA 2W8BB 3B6ZA 1LBHA 4BMVA 2INGX 3FCEA 3UAOA 3BAZA 3B60A 3N59A 3GMDA 2LKCA 1SBTA 1AN0A 1LPSA 4ZDWA 4XM2A 1NDHA 2XNJA 1Z2EA 1O1YA 3N0VA 1T4DA 3ONNA 2XQFA 2TECE 4ZVOA 3K70C 1L4BA 1KDPA 3G9XA 3ZV5A 4DR3B 3X3HA 3D8SA 3KWFA 3NUZA 1DCMA 4B8YA 2BFCA 3N86A 3OTIA 4G09A 4PIMA 3HB0A 3ONDA 3TQQA 3S99A 3QG1A 2G0TA 1UXIA 4DSOA 1OH6A 1S1CA 1D4OA 1QHXA 2PH7A 2VG8A 1FYEA 3DZCA 1I4EB 4ZGBA 5IF3A 4IHAA 2PUDA 1Z7YA 5CGZA 3UYLA 3WMFA 4AKEA 5E1DA 1DUVG 1PV1A 4TRJA 2Q5JA 1KP9A 3CB4A 3IBGA 1GZ3A 4U7PB 4CWAA 3FTEA 1NLMA 1NXPA 2XNSA 5GINE 5HQTA 2AQ8A 5EKTA 1DBPA 1DIRA 1PSDA 2HIGA 3E22B 4MR9B 3TZBA 2ZG6A 3L05A 3ZXYA 3GZJA 4CMEA 3F97A 5B3KA 4WECA 1OU4A 3K4PA 4YAIA 3PHIA 2IYYA 3K0BA 1DARA 3IE2A 3LVQE 1LQTA 4J1NA 3ZTTA 5C3MA 5HP4A 3M49A 5I9MA 3ZBUA 2YIMA 4P2GA 3WLSA 4L76A 4E07A 2X2FA 4B83A 4CKXA 3L7KA 2XUOA 2NU8B 1XTVA 1YQDA 2E4WA 5EEHA 3P2KA 3L5KA 3EXG1 1EDEA 1V8ZA 3WFIA 2Z08A 2EDAA 5CG2A 4QJ5A 2OZLA 2ECPA 1JVBA 3OLZA 2ONZA 3SJBA 5FDFA 3W8FA 4AZVA 5K0BA 3ORQA 2DGDA 2HU7A 3OMWA 3T9AA 4FN5A 2J6HA 1GGFA 4H3KB 2CYBA 5IKMA 3GJ8A 4TTRA 3EIQA 1JG6A 5DXFA 2RGGA 1VLLA 4JELA 3FNFA 4EGSA 1W9HA 2HNKA 1CJBA 3A1UA 3NM6B 3A3KA 3GFVA 3HY3A 5CT6A 5I7WA 5BQOA 4RTMA 2QW1A 3WQRA 4TUYA 4GM1A 3R40A 3M4NA 4DRXB 3WG9A 3ESZA 5HK9A 3CVXA 2Y93A 3IQWA 4ALKA 1KVUA 2H2FA 1FOEB 3NHSA 3LPAA 3P4YA 3U13A 3VMMA 1N5DA 2XVYA 2LZ0A 4I5EA 4UBOA 4MI9A 1EFVA 4MDHA 1VKHA 4EMBA 1O96A 2A9FA 2Q0QA 3HFGA 3OM9A 2DX7A 3DM5A 2PA0A 2EWMA 4IJVA 5EHIA 5CAEB 4CRWB 5D86A 4CIAA 3B5JA 3ZCSA 3P2EA 3JAWA 3SZ3A 3KJEA 1Z4OA 4RQUA 1PTKA 5B3JC 3QXGA 4X9XA 4BMDA 1HLDA 4TZTA 1LD3A 4BNLA 2OO5C 2QZSA 2G5CA 4UAJA 1SUBA 4RYLA 3INGA 5DKFA 2MSNA 1XLWA 2QYTA 2WIBA 1IN4A 2XGOA 1B7GO 2IF0A 1YR8A 4O3MA 2BI7A 3WBFA 3O2JA 1I4WA 1VLVA 3I01M 2V7UA 5FEMA 5C52B 1V48A 3WK6A 3EZXA 4C7JA 5BSGA 4K2HA 3HVHA 5DBIA 3ZGLA 4ZN6A 1L5ZA 2AFHE 2LTAA 3GQVA 1HTBA 3WNZA 3K6RA 1XDWA 5A06A 1C9YA 4YBRA 3BBLA 5IHXA 3WWCA 1EXDA 1WLSA 4RCZA 1YGYA 3IT3A 3LWNA 1O6FA 4MO9A 3VMFA 3N2ZB 1N25A 3VJMA 1VA4A 4Z4IA 4ZOEA 3BOSA 4NV3A 3SIRA 1X1CA 3OFSA 2XGSA 1G63A 4ND4A 4MKFA 1B16A 3LCJA 3EG5A 3FGNA 1ORTA 4M0UA 1ISIA 1H4TA 3V4PB 3H5VA 4YC7A 3VHXB 4MDEA 2H29A 3NM4A 3M5DA 1TT5A 2PD6A 3UWPA 3M1YA 3RANA 1U5CA 4D2IA 4PZDA 4EP1A 3OJEA 5FNVF 4PQRA 3LGXA 3UJNA 1EWVA 3L4JA 2MT9A 3D3KA 1OAKA 1SC3A 2B78A 3HP1A 3JQ9A 3FE2A 1D2MA 3UHJA 3CQ9A 1N2SA 4TMZA 3A4LA 4PQEA 2RGUA 1GLNA 5H70A 3VHLB 4CNBA 1EGQA 1JB1A 1TZKA 4QOJA 4YP5A 5IJZA 5J47A 1HG1A 4KXYA 4RABA 3KDSE 3EA5A 5GPBA 2WUFA 5EKDA 4ZCPA 5EIXA 2HMVA 4E08A 4A8TA 4F4CA 3DBIA 4AJ2A 5BT8A 3L0OA 5HBRA 3VO8A 2W6CX 5FPKA 1I51A 3VTKA 1B3BA 4B3FX 4NE2A 2XMGA 3IQXA 3DHNA 2W43A 3K8ZA 5DI9A 4AMVA 4ZOLB 5AJZA 5JSYA 5AVRA 1ZNWA 3C8UA 1CJTC 1U2RA 4FKBA 4QFDA 3ASVA 2JA1A 4NHOA 1CVIA 4PO9A 2H1OA 4Z4FA 1SOWA 3JX9A 3ICEA 2VR1A 2PVSA 5J4VA 4WZBE 2UUAB 4JZKA 1YOVA 2X4LA 1X39A 2UVDA 2B21A 3Q9SA 4NYIR 4GWGA 2WLSA 4F45A 5LP6A 2QUZA 5KSWB 1EQ2A 1GN8A 2NW6A 1JHRA 4IDAA 2QTVB 4PLZA 5L7YA 4M1QA 3IOYA 3FJ1A 3QYAA 3VNBA 2XUJA 5LQCA 5BW6B 2OORC 5BNIA 3BSWA 3IELA 1XTQA 2YNMC 1KQ3A 2WJPA 1HFWA 3BJRA 5CNMA 4A0SA 2AOXA 3HBNA 1K7YA 2O7RA 1XK6A 1B74A 2R6GA 3IAUA 4PLFA 2WM8A 1WMFA 1X1QA 3DFIA 4ZOCA 1EEHA 1C7EA 2GXSA 2W2OA 3SQOA 2I1VB 2DFKB 4JOSA 2R1VB 2XOKA 1Z5PA 5KUTA 1X7YA 3ZE9A 4WFKA 5EA2A 2A58A 4FU0A 5AHWA 5AKYA 3ZCXA 5LJIA 5A6SA 1PW5A 5AM1A 3ER8A 3JYOA 2NQTA 1TFUA 3L79A 1YCGA 2XUHA 1EXNA 2ZYVX 4QT4A 3Q6MA 3QKRB 4NDAA 4B6PA 2JD2A 3NJRA 1F4LA 1KK0A 1U8UA 4R0NA 4N0EA 3FSRA 3HJUA 3IE1A 1Y3HA 3F74A 3IJEB 3F78A 1C3XA 3B9PA 3CNQS 2GK7A 1H3FA 2QGNA 2QKYA 1Y9ZA 1JR3E 3IEIA 4Q7MB 5T8KC 1PGOA 2QVCA 4DC0A 5AW7A 5MFZA 4KR2A 1ZRSA 4NAUA 1E9EA 4F7WA 3TFWA 1O9GA 4Y2TA 1XTJA 4R8MA 3EX7C 4BIIA 3GUYA 4B47A 4MV6A 1U7TA 2HO5A 1CUVA 2HBZA 4A0FA 3JU3A 5H9VA 2QMQA 3B3AA 3G1WA 4W7IA 5JO0A 5DOVA 4E5NA 5LVAA 1XLVA 1TCUA 4M1YA 4L6CA 4EJ2A 4KRFA 3CSSA 4EJSC 4RTRA 3KZOA 3CG4A 2JGEA 2QQGA 4Z2YA 1YQEA 4DB4A 1OC4A 2PUVA 4FFOA 3HP7A 1FYVA 1GZ7A 1H2YA 4BBZA 3CXRA 3PA8A 1BHQ1 1MC1A 1Q84A 4IUCS 2G5PA 4JT8A 1V1JA 1XDSA 4QLOA 4XIFA 3HJHA 2QSUA 4B7XA 1S2GA 3F7NA 3KQVA 4FJ2A 4D74A 5GVSA 4KVGA 1KK1A 1YASA 4WINA 1NQWA 2V74B 2RK3A 4JVNA 5ICSA 2QTAA 4NQRA 3VR6D 3ZHQA 3R0QA 3HFJA 3UOAB 5CBPB 4R83A 4XJTA 3CNHA 4YBZA 4U6SA 3GV0A 2WG1A 3S2UA 3K9WA 2X8JA 1BX1A 2BTQA 2H9IA 3FXAA 4PCLA 2IQIA 1D0IA 1TYDE 2A8YA 1SIOA 2BUAA 3KLMX 1L7MA 3W0LB 1V16A 4F4JA 2WHPA 4J7XA 4D9IA 3CT6A 3WLPA 4U63A 3LS2A 5DTQA 2HT1A 3L7NA 4W99A 3A9VA 4B9EA 3QTLA 5CH3A 4LRXA 1VSQA 1YFJA 2HQBA 1TCCA 3E3AA 2DH6A 4JI7B 1FBTA 4KXXA 4PM4A 4X6YA 4UUPA 3U48A 3T35A 3B12A 4NCHA 4R05A 4U7JA 4ZANA 4CUJA 3KQQA 3K6SA 1MJNA 1PT9A 2JFNA 1JEYA 4QTZA 1VIYA 3ABSB 2GJ4A 1I3LA 4YJ3B 5FPYA 2OG2A 5KVCA 1OJ7A 3ETNA 1GAXA 3B5IA 2D0DA 1D4ZA 3PF8A 3GVIA 4HVTA 5BSTA 1EKXA 1V5FA 3DCIA 3IVXA 3PK0A 3JD0A 1SBIA 3LRXA 4TRRA 2FWRA 1ILEA 2SCUB 3AFMA 3T12A 4D9GA 4ZHQF 3LHKA 1YQQA 5JRZA 1HYEA 3FWHA 3WXMA 3TI7A 1FNSA 1AN9A 3IKMB 1PI3A 1AMUA 1P33A 1K98A 4GW3A 4H1VA 3IAS1 4H31A 1EJ2A 2Q8PA 1FXWF 1IHPA 2WMYA 2ZVQX 1L4NA 2ZYUX 4J0HA 4LJRA 2JLRA 2WD8A 2TMKA 4QO7A 1H2AS 1VCNA 4AO6A 4CDNA 1NKSA 3O3OB 2JC3A 3FOFC 2KJQA 2WT8A 1QWSA 3RVBA 1NX9A 5B7NA 4BKOA 4RHFA 3ZWCA 1YNOA 4ND8A 2W6JD 2H16A 2QNIA 4PG5A 2YQZA 2VP0A 4Z7NB 2HM7A 3L0SA 4Q4JB 1R64A 4X1YB 4J0GA 2E18A 3IIJA 3E7XA 2AJDA 3EMDA 1BXZA 1RLJA 1CZKA 4OQYA 4ZMBA 3OOWA 2ZQZA 3EOAI 4LJ9A 3IC5A 3OEED 3R24A 3IJPA 2H1WA 2HSZA 2WSYB 4OUDB 1ZJ5A 1JTFA 1UP7A 2ODNA 3QFFA 4R1NA 3O3MB 1YB6A 4I50F 3QUBA 4FFBA 1ZHHA 4GVXA 1DTWA 1XZMA 2D7CA 2FDRA 1JF8A 1WBBA 1Q0TA 2QNBA 2QRPA 1RI4A 3PHLA 5BXYA 3WZLA 1PR1A 1NI4B 2KHZA 3LWDA 1X7ZB 4HFMA 4OHRA 3UB4A 3ZGOA 3WVNA 5EZ6B 4L8GA 3DKVA 4R81A 1L4LA 1S3GA 1VB5A 2XD4A 4P84A 1RJ9A 1V43A 1J8YF 1WXFA 2HHJA 2GUWA 2XAAA 1VYHA 3C14C 3C5HA 3DBRA 3DP9A 2FUCA 2O3UA 3LPMA 4IXTA 4LRQA 4UEWA 5IJWA 2WWIA 2O1SA 3L02A 1PS0A 4DJDC 3D43A 5C46F 5L3QA 1DELA 4I4TA 4KQWA 3RTEA 3SDSA 5FFFA 1C50A 4NYMQ 1YJQA 3KTAB 3D1VA 4PBSA 5G4KB 2LWIA 3S6JA 1G20B 4BXOB 1QP8A 2ACKA 3EQ9A 3A1EA 3QMWA 3G79A 3WGZA 2RAVA 5BWLA 2QMEA 1I1QB 2TRSB 4GR4A 3RHTA 4BMZA 3TR0A 2CBGA 2N0SA 2ZREA 3HXKA 3UGQA 5FV4A 1ML4A 2X5XA 3O3NB 4ESOA 1IWPB 3F96A 3KSUA 2C3MA 1SD1A 1STOA 1G7CA 3L8MA 3O1IC 2VH5R 1VSBA 4KN9S 5D51S 3WLNA 4AUKA 4ZGWA 3RFTA 2PRZA 1T2DA 2Q4OA 4CN8A 4TQUS 3SM3A 5LDHA 3H7IA 1NP6A 3AY3A 1U0NA 1Z33A 1CF9A 1XAHA 2R6JA 2XT6A 3EMVA 3BJZA 3LDGA 1UWKA 1Q6YA 3ORSA 4I1RA 3R7BA 1JILA 1EG2A 1R4MB 1PFYA 1TUGA 2P9EA 1C0PA 1KJWA 4JC5A 4OK3A 4LNHA 2OKCA 1XN4A 3DDOA 4GOND 2WOOA 3LE8A 4UM7A 4IGKA 1JDZA 5BW8A 4Z8XA 3PNKA 3A10A 1WB6A 4IVNA 3ZDBA 1HBJA 2D59A 2OVBA 3BXFA 4ALJA 3NDJA 1T9GS 3Q2IA 3SHOA 3U09A 4NBLA 4G9BA 4K6OA 4W1PA 1W5BA 1Z5VA 1N5RA 2JZCA 5I5EA 5IVPA 2ZRAA 1G2QA 2O0LA 5ALIA 3GK3A 4Y1RA 4ZJYA 5TIIA 2FDXA 3NASA 1NXXA 5F73A 4FMDF 4CETA 4XTCS 1L7QA 1I3MA 2O0JA 5T4HA 2W6JA 4R98A 1Z4LA 5DLDA 3K72B 4M37A 5LQMA 3A25A 4OB8A 5AKIA 4ZJPA 4EW3A 1ORIA 5FPSA 2XMRA 4CM4B 4EQ6A 3HBJA 4Q9KA 1KRWA 4IWXA 2V4MA 4QYXA 1DZ3A 4CMBA 5ALXA 4FYPA 2ILTA 1HYBA 2CEAA 3OEEA 3GMIA 5EGSA 4JKIA 5CT5A 1BVRA 1V47A 1XVIA 5FTMA 4S24A 4F84A 1UPAA 2BEUB 2XNHA 3VTFA 3GLFA 2W2MA 3PPYA 1NT4A 2HWKA 2ZI4A 3UG7A 1VMDA 1BGXT 1R0XA 4DV7B 1B6GA 2VDRB 2PQ6A 5HZHA 4P32A 1TECE 2HA5A 3AUKA 2BZ0A 4C0AC 4UMEA 1GNLA 5HS6A 1FVOA 4DLYA 5KVAA 3IEMA 3HBFA 2CGEA 1BDIA 4OBWA 3SR3A 1KPHA 1LTKA 4M9UA 2QX4A 3NATA 1DJMA 1E9SA 3CINA 4L4YA 2QUAA 4MWOA 3LI2A 2ZM6B 4R5MA 3FRJA 4NE7A 5C5EA 1G98A 4DE5A 2NV6A 3SQDA 3WWDA 5KSOA 1T1JA 3NHPA 2RH5A 3WB2A 3OIUA 3GWGA 4B7UA 3FF1A 3JARB 4QOSA 5IK2A 3EQ2A 2FWBA 4KGVA 1M1YA 1NMSA 2ORVA 1OLOA 3AIMA 4LWPA 4G1UC 4MV9A 1L9KA 1ORVA 1B0PA 1O97D 1U6KA 2WQZA 4BB5A 4E5UA 1JWLA 1PLJA 3F0TA 1B2RA 1BRMA 5T57A 3ENZA 4E70A 2VTVA 4Z4HA 2HU8A 4TPKA 3D5TA 4MK4A 2J9FB 4MW6A 1X1BA 4Z9AA 5JROA 3KYCA 2B2CA 5FUMA 2RGNA 3VJLA 4B46A 2DYKA 5BW5A 4HZUB 1ID8A 5LU8A 2FETA 4LBYA 2UXBB 3DFUA 1RP1A 1TB4A 1XWIA 2Y1CA 3CF2A 2OTCA 5HDBB 2H7CA 5ENZA 5B6PA 2QI9C 2BFOA 4IINA 4IIEA 3NOXA 3G8CA 4UC0A 2ETVA 4RTJA 2FWPA 3AEUA 3QJYA 4WFQA 3DSRA 3VYWA 2QLJA 2JFUA 3STUA 5ITZB 4BQEA 3F71A 1ACJA 1DBIA 2JVKA 2KWIA 1MO3A 2C4HA 2WNHA 2X9GA 2ZOSA 3C7CB 4P7JA 2WUWE 3THWB 1HM5A 1QRTA 1JR6A 3MWDA 3G7SA 3PQFA 1SUAA 2CNKA 3GJZA 2BEWB 4F11A 4LTMA 2X5NA 5TY0A 4DR4B 2GPAA 3EC2A 1KI6B 3NCHA 4NCAA 1OBVA 1UAAA 1D6NA 2O3JA 3L7YA 4ZOAA 2I3BA 3ICWA 5SZKB 4RULA 1Q21A 4ND2A 4ZT4A 5DBGA 4CUZA 4A03A 5B1DA 2W2KB 4D9BA 1JSLA 3HUFA 3QEBZ 2EFGA 3IDSA 1QDEA 5K0LA 2JAQA 4KWHA 4RZHA 3G5TA 2HRZA 5FFMA 2OD2A 3PQ4A 5GV8A 4CMEC 1JSCA 2B7LA 5KINB 3D4BA 4HDNA 4K05A 3B20A 5E95A 5J1SB 3FPBA 3CEJA 3QLEA 4CBVA 4FCCA 3PUIA 4RWZA 1M73E 1Z15A 2MOKA 3FUXA 3LOUA 4BATA 4CFSA 4DTIA 1Y6FA 1BS2A 1HDYA 1BDJA 4UU7A 1THTA 4GBED 4ALNA 1KZ1A 2QP3A 3BGSA 1QF9A 2EKPA 4LQLA 2W48A 2ZB7A 1S02A 4DMGA 4BX8A 4EA8A 2I34A 1H2BA 1WOMA 2A9KA 2X4IA 2R8OA 3IEXA 4QVIA 3OZIA 3QVUA 1UBSB 1W29A 1NQAO 4Y2SA 4DNQA 4QBHA 4RKYA 4W8OA 5J2TF 3ZJ5A 2ZJ0A 5ILQA 2GM3A 4KE6A 3T5AA 1IVNA 3MUFA 2KW5A 3DE1X 2AKEA 3DVAA 4HOYA 2OYCA 1QKKA 1UOEA 2A86A 3R5JA 4B3CA 4DC1A 2DLDA 5BRNA 5BV1A 2LNDA 5AIAA 3AILA 1GYPA 3GFFA 3OPVA 5LKAA 1MO5A 5CCDA 4YJGA 5HPYB 1AQJA 2WB4A 4Q9JA 1CYDA 3HGQA 3UJ6A 5JVDF 1Z3IX 3WFJA 5KX5A 2XKJE 4E30A 4M1KA 1Y1PA 2RH8A 4WKPA 1PJZA 2WP0A 5F4ZA 2W58A 1M6YA 1QPBA 1DC4A 4XX1A 4WBNA 5KNBH 1YQXA 6REQB 1EBBA 3ZQ4A 1NOIA 5ECGC 4KR9A 1US8B 5J23A 1DFGA 3ILHA 3M6VA 4Q3BA 1D0VA 1G5IA 1E1YA 4KDFA 4Z4CA 1BDHA 4F5YA 4UQLA 2RK6A 2AD5A 3BS4A 5TQ0B 2ISQA 3N3AC 4NJMA 2WWVD 3ZNQA 3F8SA 2FDCA 4OLBA 4UQPA 2SKDA 2VAPA 4GDMA 1RRMA 1MB0A 3DR5A 3KPUA 4JSYA 4MV7A 1RKXA 4WZAB 1U7WA 4IIVA 4PCUA 3BH6A 4ACBA 4BVJA 3W5BA 1GR0A 4C2UA 1I3CA 4C3UA 5EMJA 4QBTA 1XDZA 1QFSA 3ON5A 1RQRA 2RARA 1VJRA 2QM7A 4FR0A 4HWTA 1C5KA 4JXXA 3IUSA 1IUOA 1QORA 2I7VA 5JY1A 2BFBA 3DUFA 1GSAA 4IZ6A 3WYEA 4K0KB 1Z29A 4LYJA 1K86A 4IAOA 3L0CA 3EZ7A 2PD3A 3R77A 5CLGA 2I67A 2ZYGA 1PSWA 2JARA 3V5NA 5AUOB 5H8WA 4V0QA 1J99A 5FBLB 1J8QA 4D7AA 2C5LA 1C9NA 1OLSB 2CHFA 3T4PA 1DKOA 3TW8A 1MUUA 3G2QA 3PGKA 1OIVA 4FKZA 1FF9A 4ZI5A 1BKSB 1D6MA 3NIFB 3SS7X 2DWUA 1WVMA 5E7IA 1R8QA 4QJ4A 1PR0A 1YJ5A 2A9VA 2QNRA 4PTZA 3ZLVA 5KSPA 5BY2A 3JQ9C 4AMYA 4BLQA 3TUIC 1FU4A 2YW9A 2HJWA 1G291 4U5XA 5AUQA 4MS3B 1JFFB 1CF4A 5SICE 5K4GA 4Z0HO 4MYHA 4BKMA 3CLTD 2Q1XA 4ZKEA 3K2BA 1P2VA 2PZBA 3U7QA 4EEXA 1OIWA 2JLWA 1GCAA 5ADVA 3GGPA 1LTQA 2AZ4A 3ASYA 2AC2A 2E5LB 1CRZA 3CV3A 4OY3A 4BN0A 2IYAA 3PCTA 4IG4A 1WMSA 2AJCA 2ZULA 3EG9B 4J0EA 3OLQA 3SBDA 4BMPB 5CH5A 4S04A 4L8LA 3W2FA 1TM3E 3HU3A 3WMGA 1HZZA 1V37A 4PFSA 2QAJA 3JWIA 5E6SB 3X2FA 1JPNA 5BRAA 2BTEA 2WP8J 5LP6C 2HBQA 1C9MA 4QC2A 2O8FB 2V7EA 3VO9A 4L5JA 3D7SA 3GAMA 4ETNA 4N40A 1H0RA 2QAGB 3UH1A 3WL3A 5EMLA 4EHDA 2ZCUA 2H4FA 1UKYA 3B89A 2UUOA 3CZ5A 3EFBA 4IMIB 1DKLA 1IG0A 1GA1A 1YRLA 4JBYA 1CQIB 5BN1A 1Z4JA 4DR6B 4URFA 3E48A 4I81A 3MQ4A 4XJSA 5TGZA 3RRZA 3WL8A 3OQPA 4JVOA 2PQMA 4Z3DA 3WLAA 1RXWA 4WNCA 5FO0A 1VIMA 3O2NA 3H3FA 4BP1A 1T0HB 1CE8A 1KDTA 1KXZA 2FUEA 3QEKA 1JJ7A 4OYYA 3H6GA 3GO4A 2F8MA 4MVCA 4L5CA 4BFYA 1EFHA 2Y1KA 3QUSA 5HG0A 4ZVKA 2JHPA 4DSAA 4JYAB 1QX3A 1JQEA 2HO4A 2QI9F 3OBIA 4AZ3A 4KXNA 3VVLA 3BDAA 4NFSA 4RGYA 2BGIA 4OQFA 4REMA 4RS4A 1P4SA 5E9WA 1MG0A 1PGPA 3L7JA 2DMRA 1Z63A 3QELA 3TSOA 1YI8A 2CUTA 4ZT3A 4AQ7A 2R60A 1EGAA 4LHYA 1SXPA 3ZDRA 4L6IA 4YAGA 1JPVA 1UM9B 1Y9JA 3FUCA 5A02A 5FA5A 4KIWA 3WJ7A 1QP4A 1K63A 1ESZA 5JSHA 3DDUA 3SZUA 4CM7A 2P30A 4LFCB 5TVGA 5I7UA 2J87A 4MJXA 4TV9B 1AKRA 1JFSA 4ZVMA 4XARA 1R0SA 2BGKA 2QR3A 2ZYAA 3GARA 3DJYA 4FS8A 4HWOA 5UKDA 1WVIA 3OCZA 1Y6QA 2WK1A 4X61A 5YASA 4FYVA 4A5OA 2X0EA 2GO1A 2PRKA 1PR3A 2NXNA 1F12A 4LJ8A 2F2TA 3NHFA 4CU2A 3E3LA 2NU9B 1ANKA 2FPMA 3B7PA 3ZNOA 4BVKA 4D1YA 4RVNA 2OOSA 1KYTA 3E5NA 1E3WA 2F3SA 4DM3A 3DW3X 2WSSD 4QXAA 4RY0A 4US1R 4QL3A 4DEXA 4C3OB 4ZIRB 3MGAA 2ZJAA 3G8YA 5ALKA 3OFND 4GHWA 3D7MA 1XJCA 5TMPA 3LT1A 2HPZA 2Z9BA 1S8NA 2WSBA 3NV7A 4KCGA 5JQGB 1J1UA 1ZVKA 4P1ZA 4MQ5A 1FE8A 3C8HA 1SEVA 3TPFA 1ZONA 3H17A 4EVRA 1D6SA 4V0KA 4D4IA 1BU5A 4AI6A 1UMDA 1C9EA 3A6HA 5BWNA 2PFKA 5KQMA 2BGLA 3KL2A 4JHXA 1YH3A 2EQBA 2NO4A 4MUMA 2PQ2A 3R6WA 4LV5B 5JSZA 1J56A 3UOWA 3RSLA 5KYXA 4XLTA 3CVUA 2X4GA 3UY4A 4DN6A 3Q0EA 1AHNA 1C1XB 5CW1A 3DV9A 4HZIA 2WFLA 4BEVA 4B44A 2R6ZA 4CE6A 2FPRA 4R68A 3LBHA 4YREA 2E89A 3N5KA 4N41A 2HHLA 1SELA 1T10A 1JJBA 3BJIC 1WETA 4V3BA 1N1GA 1UZAA 7MHTA 1EWRA 4P7KA 5C1BA 2ZRMA 2GN0A 3FFBA 3B13B 4GOLD 4URZR 3BFXA 3I9LA 1NW7A 1I0LA 1VLZA 3KSBC 4RDCA 2IIBA 4Z8YA 2BI4A 3FDZA 3B8EA 1JQDA 3QXJA 4QATA 4FFMA 3KD3A 4OF4A 3H42B 2BFWA 2FPLA 1BEEA 4C5AA 1Z5WA 3EXHA 4P9NA 5LIPA 4V0LA 2NSJA 3FWYA 1QZXA 3JASB 3OZFA 2WOJA 3VX4A 1M8PA 2EX1A 2J3JA 1AK1A 1SUCA 2XECA 3EIOA 4MV4A 3JZMA 3SMQA 4E15A 2EIXA 4JB2A 4FM9A 2UU9B 2HV9A 2QM0A 2RGAA 2HI0A 2YFKA 4GC5A 4JSRA 4N18A 2KPOA 4OHUA 1URPA 2BR5A 1ZM4A 3DL0A 3I28A 1G2IA 1PNRA 1VGQA 4HXFB 3N2LA 1BX3A 2O8DA 1KYWA 5A9SB 1E7YA 2QT0A 1DAHA 3BX1A 2EZ8A 5FX2A 1D2AA 2Q8QA 3HJNA 1BH6A 4E94A 2ZVDA 3GNLA 2B37A 2FQ1A 4O4LA 1G6HA 4H6XA 4M1TA 2AF4C 2AMJA 4PO8A 5EHXA 3QBEA 1Z7GA 1CJUC 1YGPA 4NEHB 4MZDA 5IH3A 5A4KA 1A4RA 3LCUA 5A9TA 1IY0A 1V35A 3LC7O 2OZKA 4KKXB 4FZVA 4BBJA 4DV3B 1QRSA 1K0FA 1CEEA 3K0AB 4M46A 4RM2A 3GEBA 4WA8A 3RUPA 2CHQA 4WT7A 3GBSA 2HR1A 3OZBA 4RDHA 4LRUA 5BNTA 4PIVA 5EUMA 1YS6A 2HFKA 4NFHA 5BNZA 1YZNA 1OU0A 1BVYF 3KO8A 2WB2A 3SNHA 3BFVA 2G1UA 3ZE8A 5HUHA 4WOKA 3NCTA 3U3XA 1DJNA 1N6KA 2FP4B 2WSSA 3B6MA 1CULC 4KZKA 3BB4A 1E4OA 1U0LA 1ULHA 1Z2PX 3CSDA 3IQGX 4M8LA 3CLKA 1KH2A 1F8YA 5DOZA 3H0CA 4IKPA 5K9ZA 1X7GA 3OFNA 1YZFA 1X7HA 1QYDA 5DNWA 1OTHA 2Y05A 3DTTA 3TGPA 1TVEA 4ENQA 1P1JA 4J3NA 5C1OA 4AP9A 4KVFA 2GF0A 2O2CA 3LXXA 3DZIA 5L3RA 4BASA 3GLFE 1U7UA 1R6TA 4C7OA 4FGWA 4L08A 1HZJA 3S68A 1ZD4A 4HDOB 5EG5A 4MRMB 4IO1A 2QXTA 1ZOPA 4W1SA 4CV3A 3FNQA 3HE3A 4ICIA 2V97A 3KL4A 4DG9A 5SZJA 1RWBA 4J90A 1KDYA 4CIXA 2FW6A 1H23A 4CEHB 3KHSA 1ZLXA 7YASA 2ZFUA 2ZI3A 1AMNA 4JDPA 2I54A 1HDCA 3EZ6A 4MTCA 1JR2A 1LJUA 3QQPA 3ZBTA 3CH4B 3NXSA 3Q40A 3TI9A 3MELA 2GPSA 2H2AA 3PCXA 4ARIA 2IYZA 1JN0A 4DT1A 5H59A 4EY7A 2Q45A 3GVHA 3QH4A 3EVZA 3SHQA 4M0MA 5AQ1A 1ISHA 1N8KA 3QMVA 5CIQA 4AS2A 2B25A 3TTYA 4CM9D 3P2MA 1U31A 5C3UA 4X65B 3VJRA 1NJGA 1R7RA 2F1HA 4O4IB 4WLUA 4FDTA 1EGMB 1M1YE 3ZU4A 1FFBA 2Q1SA 3GLHB 4R01A 4PPGA 5DSZA 4C01A 3DWGA 3KPWA 5JPCA 5A0FA 2D00A 2RCYA 3E9CA 4YCJA 2PTHA 3RIYA 5IYZB 3EZ2A 1IN6A 5IM4F 2VKTA 4PYQA 1DQNA 1OPRA 2ZIXA 2CLIB 4OXNA 2Y66A 4UHFA 5FLYA 5LA6A 5IC4A 1EUQA 1P39A 4G25A 1ZCBA 3A9RA 1P1KA 1JS1X 1FS4A 4JEHA 5CM8B 2ORED 4I2VA 3W6PA 1EI9A 1MFZA 3EIFA 4XDHA 1K6EA 3WDLA 4W9NA 4LJSA 4LZWA 3D8RA 2J3IA 1MO2A 3PXUA 3QKIA 5JAHA 3FWNA 1MHPA 1NOJA 4ETMA 2RKWA 1JTVA 1U1DA 3L0IB 2J0VA 2QMYA 2RONA 3DMGA 3I0NA 4ZAXA 4BNUA 3GBVA 4MRPA 4ZXPA 4C22A 4BQIA 2HW8A 1XUOA 1X87A 2HDWA 4AMBA 4PYNA 1EX9A 1DINA 2GFHA 3T7SA 3PD0A 3RYIA 2J3MA 2XVMA 1CIPA 2W4MA 2VAXA 3HWSA 3P9NA 4P31A 1NHWA 3UGTA 3EBLA 1R12A 2DTDA 4EX7A 2FPKA 3FYCA 2W83A 3P0JA 4HWRA 4I4LA 4PLWA 4DV1B 5C8VA 1N78A 3SC2B 1THZA 1JHYA 4ZCQA 3L0DA 7AT1A 3CRRA 2PX2A 1E64A 1V95A 1B93A 2B9VA 4G5FA 5MF6A 1PAUA 3D7KA 2RHBA 3FPLA 1GRCA 1M5UA 1VQ1A 2OZPA 4M22A 2BH9A 4TXMA 3LO8A 2NO9A 3U7JA 3JD4A 3FBWA 3H8VA 4KMOA 5G0UA 2QN1A 2H54A 4RUKA 4LHXA 4P2BA 1YC2A 5DASA 4DMMA 3FOZA 4J0DA 3MINA 1V25A 4A1OA 1SB8A 4X7PA 3CKYA 1W0JA 3F5SA 1GPH1 4B71A 4DV6B 1SU7A 4JLVA 3AUFA 4KLRA 1GPLA 4F9GA 3FPHA 4JLPA 4EB3A 3IEPA 5AHOA 1JGTA 5AK3A 1LV7A 3OIFA 4WW0A 1DO0A 2EVWX 1D3AA 3TO5A 3OKFA 5GMOA 3IXMA 2BM0A 3LWZA 4WBXC 3SHTA 4LHWA 1SG0A 2ZZKA 2FPPB 2RGNC 1WP9A 3AUAA 3QE4A 4HBGA 4PSDA 4X6UA 3H7AA 5JMPA 4DLNA 4P7GA 3WMRA 1XMVA 3M3HA 2W2NA 5REQA 2W6NA 1SKMA 5AK0A 1GGNA 3CE6A 4CM9A 4DCGA 2W37A 3QNWA 1W30A 3BWVA 1P3DA 2OD7A 3DZFA 1MJGA 2O1WA 3U9TA 4D43A 5ALUA 1H3NA 4AM8A 3UWSA 5JEDA 4GVPA 2ASEA 3MQ2A 3NDPA 3GNTA 3IRUA 4IVQA 3SEAA 4WE3A 3RS9A 1Y3FE 1HC7A 2O8BB 3W3ZB 4F8YA 1GL7A 4TVOA 1SHLA 4NBKA 1MN6A 1WU7A 3SR0A 4LBVA 7REQB 3W04A 3P97A 1AF7A 4H17A 3CO5A 5FOQA 2GCEA 1L6RA 4MOWA 3OHPA 3ZGZA 2I8LA 3ANNA 4RHXA 1M5TA 2JGDB 3D3WA 4KFSA 3QHAA 1GNVA 4K03A 4W5NA 4H35A 4JXJA 3KUXA 4XOUA 2AR9A 4IOMA 4MVJG 4RADA 4FGUA 1LPPA 2ZUCA 2W9XA 2XF2A 2ZT5A 4IDPA 4BO4A 6GPBA 1TK3A 3DLCA 1TLLA 1JKXA 4LJ7A 5G2OA 1UKVY 1U7PA 2F9MA 1WA5A 1DEKA 4CHTA 5C32A 2IV2X 4RTKA 1KQPA 3IAS6 2P2NA 2ZBFA 3QY9A 4HEA1 3EGOA 4OQQA 1Q91A 2QX7A 3A3PA 4YT2A 2JAXA 2GZDA 4FSHA 2CV1A 1Y8QB 3BG5A 3A6EA 4ZZ0A 2PMFA 5EKXA 3KS9A 1X1TA 2FF5A 4MXDA 4KV9A 5K0NA 2CLMB 2FRXA 2NYVA 4AQYB 3I2HA 3S1LA 4C3VA 2VPXA 5ITWA 3DWFA 2VDWA 5BYJA 2R6DA 1ZI9A 1E4YA 1OT5A 3UXMA 3L1UA 1IY1A 1PYOA 2O20A 2OB1A 2Y2VA 5GGYA 3KQUA 5AM2A 1IXSB 1QU2A 2R1UA 2K6GA 4Q3OA 3CVOA 1U04A 4OHWA 1L4YA 4QU0A 2PSFA 1AGYA 5IBQA 4NEGA 1QCZA 3VPSA 5BR8B 3L77A 5DMHA 2WA2A 1ZN2A 1IHOA 2OCIA 4IVRA 4LMPA 3FNIA 1E8DA 2QQ0A 3N0RA 5JYBA 5FUQA 1V41E 4P0QB 2HA7A 2L18A 3FBGA 4M8KA 4QQ8A 1ZHOA 2IYRA 2P2CA 1O97C 2Y9MB 4EITA 2L17A 2X7JA 1NFQA 4I9FA 2IP1A 1QP0A 2R2GA 1G6KA 5JNSA 3OTGA 4O5OA 1KE2A 3R74A 4CCYB 4DQ0A 1XD2B 3PI7A 1XRSB 2X0IA 4TSRA 1EIZA 4PRZA 3RIHA 2KBFA 4GGMX 5DCLA 5JMOA 4DUZB 1PG0A 4RNCA 3PFWO 4K3UA 3W5UA 1U2GA 3DGFC 2HT6A 3RWBA 5TX7A 3U56A 2P2ZA 5ED0A 4Y6PA 2GHTA 4BC1A 4BP9A 2HIAA 1H66A 1Z0IA 1E60A 1FK8A 4XOIA 3QKSB 4UU0A 1MH9A 1OWOA 1SG6A 2XA1A 3D8HA 4P7BA 5KOYA 4RH1A 2A0KA 3NKLA 2PZJA 3OLVA 4AK9A 3G5AA 2B0JA 2D2IA 2HNAA 3N0TA 3HXMA 1I3KA 2RHGB 4YJFA 5DXJA 1NV8A 3WJ2A 1A7KA 4Z54A 3HKEB 4OLJA 1TEVA 3SC6A 3O4HA 3A36A 4FP9A 1DPGA 5KOHB 4E31A 4JLAA 4AL4A 1N3IA 4B6EA 1ZFNA 4QUEA 1OYVA 1XCBA 4OI1A 3WV5A 1IMJA 4PPNA 2ZTMA 2C5BA 3Q2OA 4JI5B 2B6HA 1GZHB 1NSFA 4YS6A 3NBMA 3OP1A 1L3IA 2NT3A 3CNOA 4MPPA 1TX4B 1RCTE 2PS9A 2YZ2A 4Q4LA 3LY8A 2EL9A 3MWJA 2QHXA 1CKEA 1WCYA 3M5WA 1RBZA 4JKYA 4HH3C 1MB4A 1RMQA 2ZS9A 3GG2A 4ZAGA 4MX8A 4R1QA 4N65A 1M2KA 4I6JA 2NVUB 1CG6A 1X77A 1IN7A 1ZZGA 4LHEA 2PRIA 3IBFA 5EQJB 4CVNA 1B3RA 2Z6AA 3O94A 5IKOA 3SU8A 4C7VA 2ZJ4A 3X1XA 4OPMA 5LQSA 5BUCA 5J2UA 3TAHA 1QYRA 1A2QA 4IWNA 4YXFA 1OLUB 5LWHA 3RH0A 1N9GB 5E4TA 3FPAA 4MA5A 3B3QA 2PBRA 4M60A 4JLDA 5AICA 1F48A 2C2YA 1V11B 1YXMA 3M83A 2VC2B 1GFIA 3FCXA 2AV6A 2CXRA 4QXQA 4ERNA 5C5DA 5C7IO 1CEYA 1C8BA 3OLYA 3F5QA 3VNSA 4JAVC 3RFXA 2JLYA 3Q9UA 4UMFA 1B8NA 3BXHA 2Q4RA 4YDQA 2EW2A 1D1TA 1RXSA 4P54A 3MGCA 3GEGA 4OKSA 2Q21A 2VEDA 3FROA 3E8XA 2W8BA 4BGVA 4G5YA 1I2MA 1EK6A 1U3FA 2V7VA 2R48A 2VAMA 3NHKA 4F91B 1PCXA 3B1YA 4REQB 2F17A 2FN4A 3IHKA 3WL5A 5IFLA 3VAZA 3TXAA 4B17A 1GFWA 1TVMA 2EFYA 1J90A 1NW4A 3KPJA 4AP6A 3HJAA 2ZE8A 2NTVA 4X1KB 1E99A 2AFVA 4B40A 4DWVA 4EBFA 2ZRCA 2VT3A 4KBYA 4RHUA 1T0IA 3I4CA 4X6LA 1JA0A 4FMPA 4L07A 1F1BA 2IV7A 3RU2A 3KU4A 3KTDA 3OHMA 2ZR9A 3AI1A 4L85A 4QXMA 1TA9A 2PH5A 3RIGA 3QU5A 2FN3A 2RC5A 4XVQA 2ZTVA 5FF9A 3RTBA 3VPFA 1JHAA 4E5KA 4EH1A 4F5DA 5LZ9A 4FFNA 3OEHA 2C99A 2VPTA 4I36A 4L9RA 1C7IA 4PXAA 1CNEA 2ZI5A 3E22A 2I7TA 4QXPA 4XZ3A 4GRAA 2ZROA 4BKUA 1WDLA 4DA6A 2FPOA 4YMWA 5DNVA 4PHTA 5K5EA 1Z08A 3S55A 2IOHA 4RVGA 5GONA 1Q77A 2Q3CA 2JFPA 3H5NA 1T2FA 3D6VA 1LCIA 1L5QA 3PRYA 4ZVLA 4N8DA 2ZB2A 4ENRA 1VCIA 3TGWA 2J5QA 4DF3A 1NJ8A 4F1WA 2H5IA 1CUJA 4O2AA 4BQSA 1KIMA 3RVLA 3KJHA 2NU8A 2DLNA 1NVMB 2JB9A 4F3TA 4F21A 3UA4A 2D4AA 4R9NA 2PO5A 1AV7A 5H68A 2AS0A 2F4VB 3NP7A 3B2QA 2BMJA 4L3VA 4TQAA 4BU0A 3Q11A 4Q4AA 5CCBA 3KVVA 4G1FA 2I4MA 2Z5LA 4B74A 3ZOZA 5BMVF 3MS2A 3PWKA 3CNNA 1ZX1A 4TQ9A 3AM5A 4S1VA 5ECYA 2OPHA 4D4LA 1TQDA 3EIUA 4F4FA 1FSPA 1E4EB 2GWRA 2H06A 1CHNA 1ZM7A 3EDRA 4LI0A 3ZVMA 1NQOA 3W5CA 1ZAYA 4Z0TA 1K1EA 4CEJB 3IILA 4C30A 4FFPA 1E0AA 2UZIR 1U6IA 2OCAA 4HTAA 4AUNA 4DRXA 2X8BA 1RPAA 3M4YA 3NWOA 3KYIB 3JQCA 2D1YA 3GFBA 1NQVA 1JHXA 2ECQA 3C3XA 3MTIA 3R7WA 4PXSA 1U8EA 3CLTC 1E9BA 1DCTA 1VBNA 1Y4ZA 1WOYA 2WJYA 1D7AA 3A4NA 4WEQA 3H97A 4C7MA 3TINA 3A1WA 1XQVA 1QRDA 1N2GA 1MGPA 2P9ZA 4QVGA 5E2BA 3SZRA 4QWMA 2MR5A 1UBJS 1KEEB 4KDCA 4Y9DA 5CAEA 2BUBA 1TK9A 3ITKA 4NZOA 4BYMA 2ZDHA 4DA8A 4S35A 2VBGA 1WPXA 3NUQA 2Q07A 4PAOA 4QELA 5BSUA 2HSJA 5IAKA 3KFLA 3Q3VA 3R5XA 3JSXA 3GJYA 1ZN7A 4GBJA 4N7BA 2O2DA 5FI5A 2Q5LA 2RI6A 1RJWA 1K6IA 1WULS 1IZ9A 3NT4A 4RFSB 3WDMA 4WKGA 1HDEA 2PGOA 1HYGA 4TKZA 3W5AA 1XYYA 2BFAA 3URMA 3FPFA 2MSLA 4YJ2B 4EZIA 1BVHA 4W7SA 4MITA 3LKVA 5CYPA 4G8DA 3SLGA 2H17A 1IQ0A 3PYLA 4ISCA 2PUFA 3AF1A 3N75A 4AYWA 5FOTA 2ENWA 4E3WA 2DPLA 3OHSX 3B38A 3AZPA 2PX5A 3PGXA 1C4KA 3RSHA 1UP6A 1XF9A 2JLQA 2OPBA 3E7FA 4TKMA 1CNMA 3FZEA 1CD5A 3EXHC 2C2BA 3NIGB 3DFMA 4ZODA 1Z75A 1HWYA 2NZYA 4WHMA 1HT0A 3I5YA 3G17A 4HB2A 2WC1A 2O6LA 1MC5A 3VKGA 1KNXA 1X7WB 5FUWA 3WWPA 4QGBA 2DWCA 4XDZA 5EUBA 2DCUA 3DTNA 1IK4A 4PSAA 1CUGA 1OQAA 3HXLA 3ABZA 4BLRA 3AM4A 4XM0A 5J5CA 4HX5A 4E4RA 4C29A 4YRGA 5HF9A 4PGHA 1EBFA 3TXXA 4L9AA 2B5VA 1E2HA 1MVOA 2QMUA 4WKCA 3HRIA 4UTPA 2CVPA 1K7SN 1RLMA 2VA8A 2XOXA 5B6IA 3ML1A 1A8IA 4RWEA 1SHTX 4OYLA 3S4YA 4Q21A 3HKBB 3V46A 3EDOA 4DUGD 4CMGA 3AQ4A 4XAQA 3H8JA 5EL0A 3I76A 1XZNA 2Z4SA 3S1SA 2FJ0A 1JJFA 1CP2A 4RXUA 2DLCX 2J3DA 3N7TA 5JJ5A 2YV1A 1U5BB 4ZOLA 3GP8A 3AL2A 2BR3A 1NT2A 3IAHA 3WA6A 4N9QA 3JZAA 3ZGVA 1RWKA 3WBBA 4EPWA 4RA9B 5BORA 1G6Q1 5TF0A 1JDBC 3DOCA 3GVXA 1A9OA 3OTWA 4P5DA 4R2WA 4XWYA 4CL0A 1XKXA 1C8LA 2HHAA 3BCRA 4CIYA 3CX3A 2DBRA 3BGDA 3DJFA 5CCXA 1GDHA 2QTVA 3K1TA 1JU9A 3MCUA 3ZEIA 1GNRA 3ORRA 3LRPA 2XBUA 3DL4A 3N87A 2I7CA 2XQIA 1Z8NA 2H4XA 4BNNA 2REQB 5F7XA 1T8RA 1CZOA 2Q0XA 3NHJA 4YROA 3ZJTA 3FH0A 1NRJB 3I53A 2BI8A 3O9VA 2QENA 1MX9A 2R1VA 3ADCA 1UBHS 2XUIA 4Y98A 3R6DA 1GGJA 2O7NA 4RMIA 3BAFA 3ZK7A 5F98A 3FFXA 1N6PA 2G5TA 4X7RA 2YW2A 5I4IA 1WTAA 1SU8A 2YWEA 1GGVA 1I80A 1L5VA 1DX4A 2G4LA 3EC1A 1DRUA 3IXLA 1QV9A 1UBUS 3PFIA 4FCTA 4I4IA 4TMVA 2DSTA 3UNXA 2AJ8A 2Q0HA 3QKRA 3SQMA 3T3IA 5CHEA 4JUCA 4RK1A 1RRKA 2NO6A 1XCLA 5EAIA 1YIAA 1U2SA 3FB4A 2C1XA 3G8DA 3FZGA 2B8TA 3KAJA 4TLEA 4MRAA 1OASA 2C88A 5E6UB 5FKJA 3T34A 1OROA 1TVCA 5DO9A 3DR3A 1PEAA 2G8NA 3AC0A 2GK3A 1JSXA 2CVHA 2ZSIA 3LLCA 1MBZA 2PAFA 1KIAA 2FFRA 2W6QA 2ZJ8A 4OH7A 4TOIA 4YWHA 3ND7A 2ZRPA 1GARA 5JCPA 2WF6A 2E4VA 4F7DA 3GELA 5SY6A 2IYNA 4OO3A 1XXLA 2AUTA 1WEHA 4OQDA 4ZQHA 4EKEA 1XJ5A 1V7QA 4JYCA 3GX1A 2VRWA 4ARSA 2Z6VA 2P78A 1K4KA 3GZ4A 1TJNA 3ISJA 5AKJA 3GRZA 1BXGA 2GILA 2G71A 2ZWMA 4NBRA 3OA2A 4MWBA 2VUTA 2XXBA 5T67A 4W9NC 3R7AA 5I45A 4JB0A 4AF6A 2XT0A 4DY6A 3KR9A 1KJYA 2JHAA 2ONJA 2ZWPA 4LPSA 2GEUA 2YVLA 3PNVA 4MIYA 4LCJA 3A0RB 3T5DA 5KKCA 4QBIA 3RK1A 4G6ZA 3TTUA 2ET6A 1DMRA 3ILSA 4EY8A 1V8PA 2PX8A 5CBPA 2VKQA 4XD7D 4DUGA 2I4RA 4B84A 2B8NA 4K9MA 5ALYA 2ZRJA 1XL1A 4LYHA 3A6LA 1QNFA 3O75A 1WHTB 1SM4A 2Q4DA 2C83A 4Q7KA 5TV2A 2NAPA 3T7EA 5AI5A 1KQNA 3U60B 1AKNA 2ZXUA 3RVQA 1QR6A 2L82A 2GLXA 5LLTA 1CS0A 1D03A 3CONA 1G16A 2KX7A 3L07A 3AFGA 2PZMA 3LQYA 3F3KA 4RSMA 3SC3A 2Q3DA 2A1UA 5FI3A 1E32A 1EVLA 2Y1OA 3RHFA 4ZDKA 5AJUA 1H6CA 3BREA 4W5TA 4YJ3A 2FEPA 4Y9RA 1PHRA 3N05A 3D6UA 2I1LA 4MIOA 3THOA 1B2LA 1C0KA 2GKGA 4TMYA 2C5FA 5JTTA 4F4IA 2GHRA 1ZD8A 1XZQA 3FM9A 4P34A 2FAXA 3B1XA 1HMYA 3ZXXA 3CLRD 2G1AA 2J30A 1MRNA 1Q0SA 3ER6A 4LDAA 5FBQB 1A9SA 4DEYA 3BRWD 4KJXA 2ODAA 3LCVB 2C3UA 3AV0B 2IGBA 2BM1A 2LIPA 1DQPA 5BN4B 4YMGA 3MAJA 1Q1AA 3GR6A 3OFKA 4RF2A 5KSZA 4WN9B 5AW1A 3GJXC 4Y18A 4DZTA 2FWNA 2VDLB 1NAIA 2VRCD 3O8NA 1LLCA 2I6XA 3QNUA 3NDBB 4ISBA 2A33A 1CNFA 2OCBA 2V98A 4XPIB 4GOMD 4YMSA 5K20A 1KI7A 2QRMA 2VI5A 2PEYA 3THYB 1YZQA 1KFJB 1USUA 4C0SA 1H2XA 1UQUA 2E3JA 5B1HA 1JJAA 4B4KA 2OENG 5JYEA 1QWOA 3PHHA 4H7PA 2WHEA 2CZQA 2VP3A 2Z09A 3KTFA 1QIEA 3KXLA 2AB0A 2W2XA 1LNSA 5DF1A 3UHFA 1KO5A 5KQGA 2RHRA 1YB5A 4HLQB 4IXWA 3RR2A 4YRNA 2JL1A 2IHBA 3VH1A 2PKQP 1NLUA 1TYBE 3NYWA 1FUEA 4LYEA 4KGZA 1ATZA 3RI3A 2ARKA 3QENA 2VDUE 2HA6A 2WU8A 4RL6A 4YJDA 1A04A 5BWCA 4PSUA 3SY8A 2ODQA 1I6KA 2UYGA 1RI3A 1QP7A 2VT7A 3HCRA 4D97A 2Q9BA 3AJAA 1Z37A 3EHDA 5EMKA 1FP7A 2JZNA 4A27A 4BAZA 3GDFA 5LJLA 2DUMA 5COQA 4EF5A 2QTWB 4BB0A 1NI4A 2RGCA 3PGJA 4JR0A 1K0UA 1K3FA 3A6DA 1BWPA 4XQEA 1NYRA 4X7BA 2OQ2A 3H0EA 3HR4A 3PPVA 2GNPA 2WHQA 5EWLA 6ABPA 1JJVA 2CXNA 2GETA 1Z8DA 3HLYA 5ALDA 5DMXA 3RV3A 4XD7A 3DXFA 5IUKC 3ZE0B 2LW7A 4HY3A 1GKKA 3OJFA 3CEAA 4MB6A 4J43A 4NH4A 4YUAA 1Q0UA 5CA0F 1RM4A 1ZL0A 2GZAA 4NQZA 5FUVA 3RBAA 4CF7A 2EKQA 5G4KA 4BXOA 3TTVA 1G20A 1DIHA 2VN8A 4LQ4A 4QPJC 4XWOA 2JA2A 5DHFA 5JCOA 1L5RA 4H6VA 1XWWA 1KJ9A 1NR7A 3FHJA 4YH1A 5EOVA 1SPXA 4KQ2A 5I9SA 4ACAA 3ZJ4A 3O83A 2AMYA 4RX1A 3TNFA 4GH5A 1S01A 3DD5A 4DPMA 3HNPA 5CX1B 5HMMA 1XZHA 3V8EA 4X85A 1FS5A 1KH3A 2OLKA 2ZSAA 4I1VA 4NWIA 4RD3A 1U9YA 3HUUA 3OQIB 4YALA 1DQZA 4XSGA 2NYAA 4JQSA 1G3UA 3P0IA 2X42A 2CXHA 5SZHB 1JECA 2FZLA 3NHAA 2YOGA 4LXHA 4NZPA 1LX7A 5C4IA 4HAVA 5EXDA 3IO3A 3WLMA 2CKDA 4CLOB 3L7AA 2CYAA 1WBDA 4ZZ2A 1GEGA 3W5SA 1QX4A 1LPBB 4V1CI 4RHYA 3SX0A 1CUHA 1M3SA 2HK9A 2VRCA 2ZU0C 3LECA 2C77A 3LHSA 3PQ5A 1Y3AA 3SYRA 1JE1A 3ESDA 1WVGA 4HNAB 3ZVRA 1U2GC 1KOLA 1AKVA 4CDGA 5M34A 2XITA 4OREX 5IZ4A 3HYSA 4FYWA 5AKHA 2O50A 5HKLA 1VYVA 4GGPA 2QUBA 2R62A 1NM5A 1MB2A 1NBMD 2ACEA 2P9HA 4TTAA 1D2RA 2OM6A 5T41A 1R10A 5KYNA 4Y0NA 3FCOA 3I34X 3KB2A 1XL0A 3ONWA 2PYZA 1U0EA 4DYVA 4UHKA 2XYHA 1QK4A 4S2UA 3VISA 2GO7A 3NHRA 3OP4A 4NDZA 2C4TA 4X1IA 2BEUA 1ULTA 5FBKA 3U37A 4RH0A 2JW5A 3ZC3A 3ZV4A 4BDTA 3GEMA 2WYVA 2J67A 4IX1A 4YFVA 2PV0A 3DDSA 2VHYA 1NBWB 3ZG6A 5DH9A 4B3GA 1J23A 2RH4A 3UMMA 5TE9A 2C8KA 3GT3A 5CT8A 1YDGA 1UINA 1VB3A 1P1IA 3PHBE 1PQUA 1R9GA 1EFRD 4LY3A 4F6CA 4S05A 4ZHQB 4LDRA 3CVWA 3LY9A 2A5JA 4JUDX 5EWMA 1XIVA 4Z0PA 3SN6A 1A0OA 3HYCA 3UT5A 1MA3A 3BCHA 4MR7B 1OSNA 2O0HA 4QQFA 5KIAA 3NHZA 3MTDA 4NG4A 3OD5A 1B42A 3T9FA 4R2KA 1MH1A 2VNSA 1KSHA 5BV7A 4KWIA 2FX5A 1IUNA 2PT5A 2ZXFA 4Y6SA 5KVVA 1YCDA 2R5FA 2XRYA 3EZYA 3FKJA 1DXHA 4QFCA 1TLFA 2LCQA 3L04A 2Z3ZA 1G66A 1JG4A 1UADA 3FR7A 3U39A 3ZDEA 3JATB 5DJ5A 4JEIA 6Q21A 3HVKA 5AVXA 1VBMA 5EQDA 2BPOA 2IYSA 1VSVA 3NBZC 5BV2P 3VPCA 3DMHA 4JT4A 3QMPA 1EK1A 3ADKA 3K0HA 2J9FA 1T6ZA 1M83A 4U3JB 1KZYC 5TS2A 3ZH9B 3MNFA 4N12A 2OV1A 5AWFC 3HDGA 5KDOA 2ECFA 3B85A 3O7WA 4LJ6A 2ZRNA 1SY7A 5I9TA 3K9QO 3K92A 3AKCA 1HKHA 4GI2A 2J9XB 3T4EA 4F06A 3O1LA 1S9HA 1KOGA 1B8VA 1TEZA 1Q1ZA 2VDJA 4OP1A 3GLSA 1JEEA 5HMLA 2P11A 4H7EA 4QDOA 4I50B 4Z6KA 4M0LA 4DR5B 2WJHA 1N3YA 3C5VA 1INLA 3C1OA 1ZAKA 4CL3A 2CNNA 1T3ZA 5AM5A 3COSA 4EOGA 3THWA 4FBGA 2VBIA 1WPQA 3WQSB 3NI2A 4HEHA 1W0KD 4M1EA 1U94A 1QSGA 1HYHA 2XDQA 3IX7A 4F93B 1YQGA 5F3DA 1RQ2A 1E1NA 3G0BA 5TDHA 1AUPA 1RAGA 2X4DA 2IQ5A 4CT0A 3QXSA 5CB6A 3HXQA 1U65A 2BFPA 1WTCA 3R4CA 4RZ2A 3T61A 1JA9A 2W2KA 1HSZA 3BXZA 1W8DA 2DFDA 3BH7A 1QB8A 4ZAWA 1UJNA 4LE1A 2IUUA 2C4NA 3TF5A 1QZUA 5CLJA 1NBMA 4LDZA 4AIRA 2A4MA 2GYYA 3M4XA 2P27A 1ZD9A 4TM8A 3IAXA 5AD1A 1O0CA 4EENA 3UZUA 2P0YA 1GTG1 4UHDA 5IT0A 3G0IA 1DADA 1G1AA 4Q4HA 2ONCA 4ZZ1A 3O2SB 3DAHA 4TTJA 4TTSA 3B1KA 4FMCB 2DFNA 1FS6A 4DEVA 3TECE 1QHEA 3GGJA 2XMBA 4HNRA 1JT2A 4ID3A 3LDHA 4FILA 2VFAA 2QROA 4PLVA 1IB6A 2ZJFA 4FLEA 1B14A 4KN5A 4EFMA 4BLTA 4YMTA 3BFJA 4CYMA 1BIFA 4Q1VA 2WWTA 4EABA 4RD4A 4W8HA 1TO2E 2BY4A 3I9NA 4D57A 4RHCA 5AVKA 4B35A 3HCDA 4RJ2A 1UKCA 3TZHA 2IXFA 2JCVA 1E9DA 1PX2A 2GR9A 3MTAA 3BL8A 1EFRA 1Q0PA 3JZDA 2JGNA 5B37A 4YUWA 4B82A 1W48A 3DZGA 1AS3A 3R20A 1QIFA 2IHZA 1PE0A 2ZRGA 3N8IA 1NN5A 4UZFA 3GRPA 3SE7A 5BN3B 4AFNA 4D3DA 2ISCA 2YYZA 3L6UA 4C5CA 5DDIP 4ESVA 3RUFA 4I8IA 4US0R 5JRDS 3OPQA 4PF1A 2W70A 3G0CA 2G9NA 4AW9A 4UM8B 4FYKA 4P7FA 1U0JA 3F8TA 1TGYA 4DCSA 3KYBA 4RVFA 4DG8A 3HWRA 1JZSA 1UMBA 4U02A 5HZKA 4DLRA 2KLBA 4S1WA 4P3YA 2HYIC 1GDDA 2ZP1A 2BMEA 2VF4X 4FMDB 4JJAA 4X71A 3OSUA 4B33A 2VZ0A 1HTWA 1KBQA 1I2CA 2ZBVA 3D5EA 1CS4C 6REQA 1SKYB 1J5EB 1YB2A 3QU4A 4ZAVA 3ZKAA 1LBIA 1VE3A 2VP6A 3F7TA 2DPYA 2YXPX 1GTRA 2C58A 3QZUA 1GZUA 5EQTA 2ZRFA 4GL2A 2CXXA 3HYTA 4H6WA 2P9JA 2ZXEA 1DAIA 2HXSA 4OIMA 4MQLA 1RVDA 4PO1A 1JH9A 2CXTA 4AKHA 1SWWA 1ZK0A 4HEA6 1E59A 1JE0A 1Y6RA 3N6VA 3DHEA 3U4CA 2CUZA 1U0GA 2C98A 4AURA 1Z3CA 1CRQA 3K9HA 1IUPA 1Y6GA 5F77A 1D0SA 2ZKIA 3T3PB 4TWAA 1W0KA 1C7JA 2EZ9A 2EOAA 4KQJA 3G0HA 3HJTA 2FRDA 1YWGO 3AM1A 2VDVE 3BFKA 1NLFA 1RQNA 3G7NA 4MW7A 3S3TA 1QXSA 3MMNA 1SCDA 4KPUB 4P83A 4PR0A 3IVRA 4RETA 3ZBPA 3AHDA 1Z56C 4NPHA 3NAZA 5KX5F 4Y2YA 2I0FA 1LVGA 3GT7A 4PAGA 1JXQA 4GZ3A 2XTZA 1GGMA 4HDAA 3H8SA 1UBEA 1WMEA 3TMKA 4B0PA 3RQSA 4B4OA 3STHA 4CUKA 3VR5H 4Z2AA 1B4DA 4PGAA 1USWA 3PDIA 1SAYA 4FKMA 4RIFA 3QEAZ 3FTFA 4LJ5A 5K8LA 1CTQA 2F64A 3TE7A 1KARA 1OZFA 1WQ3A 4RW0A 1A82A 1XRRA 2QE7D 4MGEA 1G4AE 2WIAA 3E2PA 3ZBQA 3B6JA 2QK4A 3EW9A 2V7WA 2VWQA 3NH6A 2ZJ5A 4DSZA 4KK3A 4D79A 5EJ9A 2WU0A 4OQPA 4B3HA 5IXYA 2GNAA 4OAOA 4K88A 3TDMA 4D9CA 3IALA 2W2TA 1Z6GA 2JI9A 2YDXA 4D0SA 4KL8S 3BRCA 3WAGA 3AOEC 3AFNA 4GD3Q 3MAAC 3UUWA 3A6ZA 4PYLA 3PDJA 1P74A 3EUAA 4JCOA 2AC4A 3WGGA 3I6MA 2XWPA 3PD7A 2OV8A 3B36A 4UMDA 3GCXA 3EG9A 1BFDA 4WUVA 2CKMA 4F9EA 3E8SA 3T1YB 1NFRA 2JJ2D 3GRYA 1YNSA 3HHPA 4ND3A 1FFGA 1QK5A 3IYLW 1W5FA 2ZJ3A 5E6SA 4KHZA 5AUPB 2NU6A 1K5GA 3A37A 3T7KA 4JR2A 4YECA 3VU9B 2Z8ZA 3IPYA 4JJKA 4KPEC 1L7RA 3H99A 3MRXA 3VR6H 2ICAA 3R6LA 4D4HA 4L1KA 4MGYR 2AUNA 2VNHA 2Q1UA 5CFLA 1CQIA 4Y6RA 1E9AA 3SBEA 1C29B 4PAMA 2JFZA 3HXTA 4AJ4A 1DAMA 1WKCA 3AF3A 1Y6ZA 4I4NA 4FGJA 2DG2A 4JLOA 2CF5A 2QQFA 3RK0A 4MQUA 5H3LA 2QDKA 1YDHA 2PHZA 9ATCA 2Z3VA 1Y1RA 4HB4A 1G7SA 3OJ0A 4HAZA 5MDHA 3ETLA 3LT0A 3CE9A 3HWX1 1RXYA 2XKKA 1QLHA 4H6PA 4UJ5A 3U4QB 2CEKA 4HLNA 1EINA 4DQLA 5FB3A 1Y7HA 2AOUB 3LPNA 2C4KA 3NAQA 2PXXA 2VQFB 3ZHXA 2HLPA 2XDYA 3UJBA 3ZI0A 4CKEB 2A5DA 2QX9A 2PKQO 3UJAA 5A71A 3X1ZA 1Y4UA 3WIUA 4AYXA 2P4SA 3AK4A 5AQEA 1UM9A 4ZEXA 2W22A 1CDDA 5DGTA 3RT9A 4D0RA 1Z39A 1CLEA 5J2TB 3AWDA 4U6NA 3M6FA 2CL0X 1DX6A 3MSXA 4GX0A 4BJ3A 4D81A 3I9V1 3RVRA 1BMFD 1VLMA 1L4GA 2ORYA 4G1CA 4TV9A