3HSSA

A higher resolution structure of rv0554 from mycobacterium tuberculosis complexed with malonic acid
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
274
structure length
274
Chain Sequence
NLYFQGAMDPEFRVINLAYDDNGTGDPVVFIAGRGGAGRTWHPHQVPAFLAAGYRCITFDNRGIGATENAEGFTTQTMVADTAALIETLDIAPARVVGVSMGAFIAQELMVVAPELVSSAVLMATRGRLDRARQFFNKAEAELYDSGVQLPPTYDARARLLENFSRKTLNDDVAVGDWIAMFSMWPIKSTPGLRCQLDCAPQTNRLPAYRNIAAPVLVIGFADDVVTPPYLGREVADALPNGRYLQIPDAGHLGFFERPEAVNTAMLKFFASVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords putative Bromoperoxidase
publication title Structural and functional analysis of Rv0554 from Mycobacterium tuberculosis: testing a putative role in menaquinone biosynthesis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 96
structure length 274
sequence length 274
chains with identical sequence B
ec nomenclature ec 1.11.1.18: Bromide peroxidase.
pdb deposition date 2009-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hssA00
4CG3A 5D6OA 3G0GA 2B4KA 4FLFA 3FNBA 5JAPA 4B7ZA 2BUCA 2VJBA 3FSGA 5AI9A 1LPOA 3WWPA 4B6GA 1UK9A 5HK9A 1WB4A 3OPMA 4ZREA 4KE8A 2CKMA 1LBTA 2WSLA 5KWIA 4B85A 1G4HA 5ALNA 4KRYA 1HBJA 5K3FB 1YA8A 5AO9A 4A16A 5AK4A 2HRQA 5D7BA 5DNUA 1A8SA 1O6FA 5AK5A 5C8VA 2J3DA 3CXUA 4BP8A 2ES4A 5AKLA 2WU4A 2FUKA 3HJUA 4L72A 1ORVA 4AO7A 3VJLA 2W6CX 5JZSA 1K63A 1SCQA 5DNWA 2BAGA 2RIPA 2WLSA 4D9JA 5T4HA 3OOSA 1JT2A 1VZ3A 2WIGA 2H9YA 4X90A 5BWCA 4QDOA 1E66A 5LZ5A 1JI3A 3L1IA 4HAIA 5BWBA 2DQYA 1LNSA 1BS9A 2BKLA 2WHPB 4FMPA 1YAHA 3D5EA 1A88A 3DD5A 5ALEA 2CUTA 2ONCA 4W1PA 3HEAA 4Y2PA 3FAKA 3BIXA 3FVTA 1FFBA 5DLPA 2B61A 1HPLA 4DNOA 5FPQA 2I3ZA 3WZMA 2OCLA 1DWPA 1MX5A 1XFDA 4FWBA 1IUOA 5CT8A 4BCCA 2Z3WA 3O4JA 4Y2SA 1UWCA 4N8EA 2WUEA 1W76A 4U2DA 3N0TA 5AIBA 2JGFA 1AMNA 4FDMA 3OG9A 3A2MA 3BIWA 1NU6A 3I6ZA 4Y2RA 4J3JA 3DQZA 5K3FA 4YX9A 3DS8A 4BE9A 2CJPA 1AQLA 3KWJA 2XUHA 1XZLA 1P0MA 4PSCA 4OPMA 3H18A 1IZ8A 3LIIA 4DM7A 4Q1VA 5A62A 5AOBA 3BXPA 2AJCA 3NWOA 1U2EA 1BROA 1THGA 5HKBA 2XUFA 3A2NA 4G5XA 3F97A 1EINA 4F5ZA 2ROQA 5ALVA 5IKXA 2DQZA 5LZ7A 4I19A 3WQHA 4IH1A 5HFAA 3EQ7A 4FBLA 5ALHA 5A7HA 3VVMA 2WHPA 5AM0A 3V48A 3KSRA 4UFPA 4Y2VA 2VAXA 4EZIA 2WIJA 5DWDA 1XQVA 1H23A 4B81A 4YASA 4N5HX 4KAFA 3DL4A 4RGYA 4MYDA 3RKSA 1CUJA 3WK8A 4BYMA 2X76A 3PE6A 5SYMA 1CUWA 2J3QA 3QPCA 4EY6A 5EHNA 1GPKA 4ZI5A 1SC9A 3AIMA 1BRTA 3AUKA 4MYSA 4BCDA 3IVMA 4X94A 4KE9A 1CUEA 3GA7A 4E46A 4OD0A 1JKMA 1QO9A 1R50A 3PUHA 2JF0A 5JD5A 2RGUA 5A6VA 2GZSA 3V9AA 2HU7A 1CQZA 3O0DA 1MNQA 4JYMA 2QS9A 4B80A 1XLUA 3R3ZA 1MNAA 4GDMA 4J7AA 1QTIA 3R41A 3D3NA 3ZLUA 1HL7A 1EHYA 2HHAA 4WCVA 4BC0A 2JGKA 2PSJA 4AZ0A 2WFMA 3T4UA 1TCBA 3LS2A 5KREA 2EDAA 3RK4A 3G0CA 1MT3A 3I2HA 5DYTA 5CH3A 4Y2YA 2Y6UA 2XUJA 4LKOA 1LLFA 4X6XA 3M81A 2JGEA 3HZOA 5C7YA 3E1GA 2H7XA 3D7RA 2HRRA 2XMRA 2Y2VA 4C4ZA 3AZPA 4O08A 3I6YA 1R4ZA 3ESCA 4P08A 4KE7A 5HKAA 4NMWA 5T4FA 1NX9A 4V2IA 4QNNA 4DGQA 2Z3ZA 3RLIA 1K5PA 4KRXA 4HRYA 4Q34A 4H7FA 3G0DA 2QUAA 5JZBA 2C5FA 3G02A 3WK4A 5A71A 1BEEA 4UFNA 5DYWA 2QVBA 4XX1A 1EK1A 1BEZA 1XZGA 2XLCA 5FPPA 3X3HA 2I03A 5FKJA 1SCIA 4G4JA 4FFVA 3DOHA 3STWA 1EDEA 1WB5A 3N2ZB 4RPCA 2O7VA 3OURA 4X7BA 2PM8A 2C5GA 1ODSA 2WG2A 1YB7A 2XLBA 2XDWA 5CMLA 4C01A 1EB9A 1GKKA 3STUA 2XUAA 1IUPA 5AM5A 3NUZA 3I2JA 4H77A 4Y2JA 4BRZA 3WKCA 4WDQA 5AJHA 4N8SA 3V1MA 1TCCA 4QA9A 3WL6A 2HA4A 4AB1A 4G9GA 3DYVA 1YS1X 2WILA 4B83A 2IITA 5AICA 3D4LA 4UHHA 3RM3A 5CH8A 2JGJA 3HACA 3EQ8A 1BCRA 3ANSA 1J07A 2RHTA 1CUGA 5J3JA 3PI6A 1VXOA 5ALWA 2VATA 2HA7A 4Y2XA 1THTA 4KE6A 1JJBA 1Y37A 4CG1A 4BB0A 2WQZA 5ALKA 4OCZA 4AMYA 3ESDA 3SC2A 2PKYX 5E4JA 2WIFA 4PW0A 1WOMA 1C4XA 4ZV9A 5BV7A 2ECFA 5KWJA 3G7NA 4E11A 3FWHA 5C81A 4QDXA 2HA3A 5FDFA 1MU0A 4S0XA 4K6KA 2P8SA 4AXBA 4ROTA 3I6MA 1SCKA 4I4CA 2PPLA 2O2IA 2PVSA 4CCYB 2OGTA 1QIKA 2WG1A 3ZI7A 2V9ZA 4IHAA 3EIOA 5K3AA 4WY8A 3O4HA 3WKEA 1X2BA 4IH4A 3IDAA 4J0JA 5ESRA 4X97A 1EXWA 2XMCA 1OXMA 1CEXA 4CG2A 1MO2A 3W9UA 4KYVA 4CCWA 2FJPA 1MX1A 3RARA 2WFZA 1MPXA 5AP9A 1VA5A 1L7RA 3IBTA 1T4MA 2G4LA 4BTVA 1QTRA 4JUIA 1P0QA 1EA5A 5ALDA 3WWOA 4KACA 3ESBA 1F0NA 1XZMA 5EHXA 5FRDA 2HU5A 4BVKA 2D5LA 2C0PA 5CT5A 5AKXA 2BFNA 1EI9A 3W06A 2QUBA 4P9NA 1CUFA 1VA4A 4OB8A 4DSZA 4GI1A 2C4HA 5ALFA 4A5SA 4DLNA 2GBFA 1BE0A 4J0KA 3WKAA 3H2IA 3FYUB 1C7JA 1B41A 3HLKA 3I2GA 5C8ZA 1DWOA 3DLTA 3ESAA 1U8EA 3H0CA 4PV7A 1J06A 1E8MA 5HFNA 4CCYA 3OM8A 1GKLA 4M0EA 3VISA 1SFRA 4X00A 3B3QA 5CXUA 1TCAA 2FX5A 2YH2A 3PUIA 2O2HA 2WUDA 1KU6A 1W6RA 2V98A 2HU8A 2G63A 3O9MA 4B82A 1ZD2P 4OYLA 4UBKA 4G1FA 2I3DA 4K6HA 2VTVA 2GYUA 4DIUA 1KU0A 1P0PA 3HYSA 2O2GA 2QJWA 2Z8XA 2PU7A 3WYDA 2Y6VA 3R3VA 4FNGA 1R88A 3FYTA 3MUNA 3FCYA 2RHWA 2WKWA 4LYDA 1DWQA 4X85A 3C6XA 5CURA 1WPRA 5ALMA 3TRDA 2HA6A 4H7KA 1FSSA 3QH4A 2R8BA 4OB7A 1XRRA 2Y1KA 1XZDA 1CUBA 2JGIA 4HXEB 3L1HA 1VZ2A 5LZ9A 5CXXA 3DYIA 2ZYSA 3S2ZA 2AXEA 4ZRDA 3R3WA 4K6GA 4W1QA 1JMYA 3FYUA 1VE7A 5AI8A 4TGLA 1O6GA 3IIIA 5A7FA 4TVKA 5K3CA 3QVMA 1XZKA 1EDBA 4AN1A 4U2CA 4G4IA 4HZGA 2FJ0A 1RYYA 2V97A 3STXA 2XUDA 3FLEA 3DOIA 4FKBA 1CLEA 3G9ZA 2XT0A 3GFFA 5AHXA 3H1AA 1A8QA 2ZJFA 4HTAA 3STTA 2OAEA 3KDAA 4MEAA 3I1IA 4EY7A 1I6WA 3KWFA 4H35A 2QTBA 4HRXA 1T2NA 1ETHA 4Y7DA 3PF9A 2HL6A 3AIOA 1F8UA 2DFPA 1QIEA 1Y7IA 1E3QA 2XI4A 4UBOA 3QITA 4PSUA 3DKKA 3S8YA 1OILA 2OQVA 4X92A 1QO7A 1QIFA 3HSSA 2OGSA 2XUIA 5JARA 5AKHA 4ITVA 1YAJA 4G9EA 1KEZA 1BCSA 3EQ9A 2WJ4A 5AK3A 1UK6A 3MVEA 1DQYA 1FFDA 5LZ8A 3VJMA 4OUKX 1QFSA 5CBKA 1EVQA 4FLEA 3I1YA 2XMGA 2XMQA 1UK8A 3VJKA 1XRQA 2Z5GA 1HLGA 2OPHA 5T4BA 5JZ9A 4Q3KA 4QDZA 5HF6A 1ORWA 5IVHA 3AILA 2HM7A 1CUHA 4EHBA 3SWWA 2XUGA 3O4IA 3OTQA 5A7GA 3W2TA 4OU5A 3KXPA 1ODCA 5ALPA 3F96A 1WHTA 3D2CA 5KBYA 2WUFA 2IX9A 3H2KA 3A70A 5A2GA 4UHBA 3PF8A 1M33A 1DT3A 1MAHA 5AK6A 3ZLTA 1LPAB 4FFWA 2XUKA 4M0MA 2VF2A 4LXGA 1CUDA 3H2GA 3IUJA 2XMSA 1W1IA 5JALA 4DNPA 1QIHA 3WZLA 1LPPA 1QIDA 1VJ5A 1G42A 1MX9A 3E4DA 1CUCA 2YASA 3F67A 4UBIA 2DCMA 3NOXA 5ALGA 1LGYA 3DNMA 3WIBA 5JADA 1XZAA 5EFZA 1A8UA 5AKYA 3WJ1A 1BN6A 1DX4A 1LZKA 4HS9A 4RE6A 4XJVA 2RAUA 1IUNA 5CRIA 4NVRA 5C8XA 1UK7A 3WWCA 5ISMA 1WPXA 4X91A 2DHEA 1ZIYA 5EHQA 1CRLA 4IO0A 3C6ZA 5DJ5A 4CI9A 1SOMA 4QDTA 1XKTA 3LIPA 2JGMA 1XQXA 4GECA 3D0KA 2WM2A 3DL7A 1WB6A 2QKYA 1K8QA 4B9AA 1AKNA 4F21A 5EI5A 1FJ2A 4BAUA 3TGLA 3WKBA 3GBSA 4ARAA 4AN0A 3R3UA 4UFOA 1XROA 5FUMA 5ALIA 2AJ8A 3WK9A 2WG0A 4PF1A 5AM1A 2OLEA 1ZD4A 4P92A 2H1IA 3C5WP 3LCRA 4XIIA 3CN7A 2QOEA 2BUBA 2XB6A 3QPAA 4GXNA 1UT6A 3BF7A 1JJFA 1QONA 4IQ4A 4Y2QA 4UBNA 1LPMA 1GQRA 1X70A 1AC5A 1ZI6A 3AZQA 4AQDA 1WM1A 1EB8A 4QLOA 5CW2A 5JYCA 4ETWA 3BDIA 1EVEA 1R1DA 4IH9A 4GW3A 4A23A 1GPLA 4EA6A 2JEYA 1EX9A 2XMBA 4CIBA 3ANTA 2VJCA 4NZZA 1J1IA 1IZ7A 1VXRA 3C8DA 5HF5A 1R9NA 3AINA 3Q8WA 1L7AA 4H7DA 4PO3X 3H17A 4BE4A 4G8DA 5ALRA 4BZZA 2VQ6A 3E0XA 3ICWA 3TEJA 1F6WA 4WJLA 2PUJA 1MTZA 5SYNA 4M0FA 1CR6A 3BJRA 1XLVA 2JEZA 2QMQA 2XMZA 3FLBA 2ZJ6A 1N5MA 2EEPA 4E15A 4JEIA 1XKLA 5LKAA 1CFJA 1GZ7A 3FOBA 2WJ6A 2PU5A 4EY5A 3M3DA 1PFQA 3FBWA 2WHRA 4WY5A 3WLAA 4BVJA 1AUOA 4J0IA 4BBZA 4XVCA 2WIDA 1CUZA 3O9VA 3QYJA 4QWWA 3V1KA 1J2EA 3UMJA 5H3HA 2WIKA 3O95A 2CBGA 1HKHA 5DTJA 4N8DA 2B20A 1XZCA 4CFSA 4H7EA 3SK0A 5FLKA 2C58A 3UUFA 1YR2A 5YASA 1N8SA 5EGNA 1QIJA 1JJIA 3JYHA 2AJLI 4OB6A 1CUVA 3A2LA 1CPYA 1UOQA 2VJAA 2GYWA 4F0JA 2ZYIA 5K3DA 5AKIA 1AGYA 4BDTA 2IIVA 4DNFA 2WHQA 4W1SA 5ALTA 1CV2A 4DNQA 3H2JA 4Q05A 3W05A 3O4GA 2V96A 5EIEA 1QJ4A 4DMFA 2C7BA 3YASA 1NU8A 1QIMA 3U0VA 2HDWA 2PSEA 1QGED 3H04A 1TK3A 2BCEA 3G9XA 2YXPX 2ACKA 4ZXFA 1Q83A 1N1MA 4XWGA 5HQ3B 1N5RA 1C7IA 5K5EA 2JGLA 2K2QB 3SX4A 2OG1A 1B6GA 1VE6A 2OXEA 5AI4A 1G5FA 2JIDA 1VLQA 1DINA 4RE5A 1TQHA 3IURA 1GXSA 2XQGA 3WMRA 1CIJA 1WHSA 1YASA 4LHEA 2ZSHA 1ZD3A 2QZPA 4J0HA 3HI4A 3I2IA 3ED1A 1XRMA 1ZOIA 3VXKA 1X2EA 2WTNA 3LLCA 3C43A 2HA0A 3BL8A 4H7JA 4Y9SA 4QDUA 1TIBA 1W75A 1ACLA 1G66A 4Q3LA 3H1BA 3QBJA 2C0QA 1XRNA 1MN6A 3F9CA 3C6YA 3WK7A 5JAOA 3C8HA 1LPSA 2I78A 3T52A 4H18A 1CUUA 1ZI9A 2CMFA 1H2XA 5EIHA 1LZLA 5ALQA 2VEOA 4JYPA 4Y2TA 3WA6A 4J0DA 5ALJA 5EIAA 5HF8A 1H22A 3WL7A 2Q0XA 1R9MA 1VKHA 5JAUA 3BF8A 3EBLA 5CT4A 4MEBA 1CUIA 1AX9A 2OQIA 5LYYA 3IUQA 3D59A 1UZAA 1Y7HA 4L3WA 3ZLVA 2XUPA 4G4GA 2H7YA 1K6EA 1OCEA 3MGAA 4WDRA 4W63A 1D07A 5HK8A 5HQ3A 2XQIA 4PQEA 1YCDA 2VJDA 1CUAA 3C6BA 4HXFB 2ZJ7A 4GBGA 1TRHA 4J03A 1XZBA 1ACJA 1UFOA 3KOOA 2GZRA 3DDUA 4HXGA 4MQLA 3WKDA 3QM1A 3FYUC 2PX6A 3GUUA 3DEAA 1XZHA 5JIBA 1EK2A 1LBSA 4EY8A 3VVLA 2LIPA 4Q3OA 2HADA 3TJMA 3IA2A 1ZJ5A 5CT6A 4W9RA 2E3JA 2XMDA 2RI6A 4KAAA 4LXIA 5DYYA 1DT5A 4MWSA 2VAVA 3STYA 2BGNA 2QT9A 2XUOA 2H7CA 4UBJA 1JMKC 4DTCA 1AZWA 3Q0TA 3AFIA 1W4LA 4KEAA 1UXOA 1ISPA 1UKAA 3QMMA 2OCIA 3R0VA 3WI7A 5AKEA 1YB6A 2QM0A 2PSDA 3KD2A 4B0OA 2OAGA 4F60A 2OGZA 4DMKA 5AOCA 3BJMA 3BE8A 1ZGBA 3BDVA 5I8PA 4X3CA 4FBMA 3W9BA 2ZSIA 3ZV7A 4AO6A 3L1JA 4QEKA 1JFRA 1CUYA 4DMHA 5LZ2A 3JWEA 4MXDA 4AX4A 2NW6A 4K5QA 3STVA 2QRUA 1FFAA 2RONA 3HXKA 4UUQA 4AZ3A 3G0IA 5LLSA 3FVRA 2HFJA 3A6ZA 1E5TA 4DMCA 1DQZA 2X5XA 3E3AA 3W04A 5FXMA 1YS2X 4G8CA 5D3KA 3DCNA 4LXHA 1EH5A 1HDEA 5AI6A 5CH5A 1Q0RA 3K9BA 4H0CA 5HF9A 2GBGA 4BAGA 1DTEA 2GYVA 4PSDA 5AI5A 4X6UA 5BOVA 2ORYA 3CCCA 4HVTA 5AM2A 2OCKA 1DU4A 2BJHA 2VSQA 3B5EA 2WFLB 1MJ5A 4N5IX 2D0DA 5JAHA 2X8BA 3MUOA 3IUNA 2WU3A 1RWQA 5CTAA 4OU4A 4AO8A 5E4TA 4MWTA 3IUMA 4W1RA 3B12A 3PFBA 5JATA 4GLBA 1YA4A 1FFCA 2CB9A 3CN9A 3G9UA 2EDCA 4ZWNA 5AOAA 3CCBA 4KJXA 5LIPA 4BATA 1H2YA 3D2AA 3G8YA 4GWLA 3WL8A 1CUXA 4MJ3A 2ACEA 3M83A 4X95A 5JD6A 3ZPXA 5AM4A 2B9VA 3AZOA 3EF3A 4BZWA 2Z8ZA 3BWXA 4ARBA 1GQSA 5DTIA 5FP0A 4X93A 1BN7A 4GHWA 1XRPA 5I7UA 3UUEA 2G5TA 1PJAA 4Y2UA 3H19A 4OSEA 4BAZA 1TKRA 2W22A 2VT6A 4X71A 2OCGA 3HC7A 4BCBA 4J0CA 4YPVA 1QE3A 1E8NA 1CQWA 1H2WA 4C4YA 3FLAA 1U65A 1ZD5A 2WFLA 5ALSA 1VOTA 3WIOA 1Q84A 4ZGBA 3NGMA 4WFKA 5AI0A 4P93A 5ALOA 3VDXA 4L0CA 2XQKA 5AKKA 2HFKA 1E8DA 3I2FA 4KR0A 4QZVA 6YASA 4WFIA 2Y2UA 4WFJA 5IH7A 1HQDA 4BTLA 4H7HA 2UZ0A 4C89A 5E2IA 4UBMA 5I9IA 4C88A 4CIAA 1EDDA 2XQJA 3G0BA 4LYEA 2XUQA 1IMJA 4B0PA 1UOOA 4UPDA 1GT6A 2DSNA 7YASA 4BP9A 5JANA 2ZYHA 4B9EA 2AJBA 3FSGD 4EY4A 5JD4A 2HA5A 2BGRA 1XZJA 2CEKA 4AMZA 5FOQA 2PSFA 3HRHA 3OC0A 4FOLA 3ICVA 2WJ3A 4QE3A 3K6KA 4FTWA 1QZ3A 2JBWA 3GROA 2CZQA 4BVLA 4KAJA 5F4ZA 5T4EA 2DHCA 3PDCA 5DNVA 2GBIA 2VA9A 2WUGA 5LZ4A 1USWA 4YK7A 4FHZA 3GELA 3QMVA 4U2FA 5CT9A 3K2IA 4U2GA 1F0PA 4EUSA 3V1NA 4TPKA 4LIPD 5IVDA 2QJRA 4DYHA 3ILSA 1UKCA 3QPDA 3WL5A 4BC1A 2VT7A 5K3EA 3LP5A 3IB3A 3D2BA 3PFCA 4BDSA 2BUAA 3FCXA 4QWMA 4JH0A 3PICA 2PL5A 3AJAA 4EB0A 1ZGCA 4GEGA 4C4XA 4EBBA 4UHEA 4MQMA 3WA7A 1WCYA 1P0IA 1XQYA 1GPNA 4U2BA 5HZGA 3QZUA 1CVLA 2ZYRA 1LPNA 4FLMA 4OYYA 1YSCA 2DR0A 2DHDA 3M82A 5LKRA 4J0GA 4B84A 3VKFA 4UHDA 2O7RA 3WWEA 3WK5A 5E4YA 2J4FA 1XRLA 1ZJ4A 1PV1A 1Z68A 5ALZA 2R11A 1XZEA 1BU8A 3DKRA 5JASA 5HCUA 3C87A 5LP1A 5AM3A 1QFMA 5AH0A 4NS4A 3C45A 3H2HA 3F8SA 1U4NA 1L7QA 5D3ZA 5ALXA 4E14A 1QOZA 4C6HA 4DSAA 2GBCA 2HA2A 5AIAA 3R3XA 1QLWA 1Q0ZA 1K4YA 2XQFA 5IVIA 1E89A 4C87A 2QXTA 3WK6A 4QLAA 1S8OA 2AJDA 4ZV7A 1XZIA 1IVYA 1JU4A 3V1LA 3GZJA 5IVKA 3C70A 4X6YA 5ALYA 1H2ZA 1R3DA 4UHFA 5AKGA 1CUSA 4U2EA 3DJYA 2PSHA 2J4CA 4INZA 1XQWA 3HABA 2PUHA 1UOPA 3C5VA 5AKJA 4I3FA 1XLWA 3R3YA 4Z49A 4L9AA 2PBLA 4UBLA 3U1TA 1DX6A 4H7IA 3P2MA 5EHZA 4JNCA 1TAHA 1A7UA 1LPBB 2QXUA 3WJ2A 1RP1A 1MAAA 3JW8A 3IULA 1QIGA 4BRSA 1UKBA 4RNCA 1JU3A 1ZICA 4FNMA 2YYSA 4Q82A 1XZFA 2G5PA 3WYNA 1FFEA 3I28A 5FV4A 2ZVDA 1AURA 3WWDA 1GGVA 2WTMA 4PNZA 1ZIXA 1ZI8A 5AKZA 5ALUA 3I2KA 3AIKA 4G8BA 3G9TA 3F98A 2XE4A 3QMWA 2HIHA 4K2AA 3R40A 5K3BA 1ODTC 2QR5A 1QIIA 5ALLA 3ZWQA 4UHCA 1W52X
chains in the Genus database with same CATH superfamily
1D6JA 1UXHA 3HKDA 3JVEA 3M33A 1GQQA 2N42A 3LCUA 4CG3A 1WDTA 4FLFA 5BW8A 4FSDA 3GUCA 4XTRA 1PZEA 2NZ2A 2BUCA 2R8YA 2CL0X 2Q1WA 1SXJB 3SGLA 1ONPA 3BGOS 2YMQA 1EBUA 3L18A 5FR1A 1T5HX 2VF7A 3WWPA 5C37A 3AF1A 4CM4A 4YT4A 4B6GA 1P44A 2O3UA 3ND9A 5F3DA 2H59A 5HBGA 5HK9A 5C9ZA 3B89A 5KWVA 3W3ZB 3NM5A 4AAYA 3OPMA 1WCXA 5BP7A 3CW2A 3DXFA 3K73O 3VR1A 4CQMA 1Z35A 1F14A 3OZSA 4KWEA 4MGHA 1DTWA 2O3SA 4ZVNA 5KNBA 3UHPA 1LBTA 2BEWA 4ZTBA 3L6DA 4YECA 4O2AB 5IM5A 3HMKA 4WZBB 4X1KB 4LJ8A 1VJCA 5HCNA 3U2QA 2D4HA 2Y05A 2DR2A 2YXBA 1YZ3A 2FXIA 2D1FA 2J9FB 1CWUA 4OV6B 5EXXA 3MS7A 5JNLA 1XU7A 3MPOA 5L6MB 4XZ3A 2PYDA 3L6OO 4JA0A 5BO5A 4OHPA 4XGRA 4LQ4A 3K53A 4JR1A 3GGOA 1HDYA 4MQFA 5K3FB 4BQEA 1HL3A 2C2XA 3PYXA 2EFDB 2SECE 4B35A 1CY7A 1L5YA 4II2A 4C9BA 3NTRA 4FS8A 4GMHA 3DT8A 1KS2A 1NJGA 3F8WA 3L7LA 1COZA 3KPWA 1OMOA 2V7PA 4C0XA 1U9CA 4O3MA 2C42A 2XIJA 2EV9A 4LDRA 1EDZA 4JYBA 5AK5A 5HZHA 5C8VA 3SSAA 5JH7A 5ICSA 4DBZA 4TYNA 2H2AA 4R40A 4CG0A 1MF7A 3PJDA 2FB9A 1V16B 1VYUA 4HEQA 3ZXIA 5U1PA 2I2CA 2FRDA 3T5DA 3QBDA 2DJIA 3VV2A 5EMLA 2DUWA 4LK2A 3TTXA 4ALKA 3U4QA 2JFOA 4FW8A 3RKUA 1ZJ6A 3TLMA 1LDMA 2NV6A 3QVUA 1JSLA 5AQ1A 4QQRA 4A6DA 1HR0B 5CB4F 4LE0A 2MCFA 4CT0A 4Z4HA 4CCAA 3KT3A 4D46A 1VQ1A 2XJ4A 4XLLA 4I7EA 1PQYA 4ZVSA 2QMEA 1DMSA 1SEPA 2CLFB 3R74A 1DFHA 5T4HA 1RU3A 1HYBA 1VZ3A 2ZI4A 1SBNE 2DAPA 3W05A 5KO2A 2NP7A 1AZLA 4DUGA 3ZZNA 1KFKB 2ZROA 4JWKA 1JI3A 3SYTA 1LNSA 3UCEA 2FU5C 2WHPB 4D8XA 3S1AB 3IHTA 2IHUA 3RJ5A 2HU2A 1OFHA 1B00A 2M6RA 3UMFA 2ZI5A 5ALEA 4XDZA 1Y7LA 3LI2A 4L5AA 2MINB 1J4AA 1GFSA 4W1PA 4B3IA 4KR2A 2P78A 4R71A 1ZSNA 3AP1A 3LHDA 4OF4A 3BIXA 1UC8A 4HZUA 5IX8A 1FFBA 3PQCA 3BKWA 3ZW7A 5AVUA 2D74A 1R15A 4BNYA 1PWYE 3W6OA 1HPLA 1ZK0A 3J7TA 4DARA 1JLRA 1S7CA 4IDCA 1FU8A 1PUJA 4RFLA 4BNTA 1X1RA 3WZMA 2FOXA 3TI9A 1MX5A 4GPZA 3KR0A 3BFJA 4BFXA 4FWBA 4CR6A 5K51A 3CNOA 5CT8A 3BXGA 1C80A 1M34A 2Q21A 1Z5GA 5EINA 2ATVA 3G2QA 4JMLA 5LA6A 1UWCA 5BSRA 1Z4KA 3HJCA 3HJFA 1EWYA 8LDHA 3ZY2A 1QR6A 1W76A 1SCAA 1E79A 1XAGA 4U2DA 1JE1A 2VNJA 3SYKA 5JEDA 1KETA 5G41A 5I4KA 2GN4A 2JGFA 3A6JA 2H5JA 1EQAA 1T1EA 4M1MA 5IWAB 3K0AB 4Y1GA 3KSZO 3BXZA 3AUFA 5C51B 4QHYA 1B6TA 4V24A 4ENTA 5ABPA 2XKAA 4AMVA 4PVDA 1NU6A 4M46A 4RYLA 4XUGB 5LSAA 2H0AA 4DV3B 3G82C 1G6Q1 2O4UX 4B6FA 1ZY2A 5HFJA 3Q87B 2RGWA 3DGFC 4FT4A 4DILA 4IGIA 4CW7A 4DADA 4YX9A 2WAMA 3LVQE 3FTFA 3R0QA 2C9DA 1AQLA 4QQ8A 1ECPA 2XNHA 1E7MA 1GG5A 1HI9A 4O2RA 4UCQA 2I99A 3KWMA 1B0PA 3OJOA 1U11A 3IV9A 1RBZA 1GFIA 3PKIA 2GCPA 2PIDA 2WB2A 3EF0A 1FP7A 1N2CA 2B94A 4CBVA 2RARA 1WSBA 3EG9B 3U37A 4DCMA 3GPLA 3BPSA 4D3SA 3S1LA 1F3LA 1SUCA 4RTJA 3I9OA 2D3WA 1ZLXA 1U2ZA 4XGNA 4Z0NA 3SQWA 4P0PB 1U2EA 1LNQA 3P0JA 1VI2A 4DDMA 2W5UA 1P7ZA 2BH9A 4IMPA 1W5SA 5HMLA 2XUFA 5HKBA 3CM0A 3A2NA 1EZZA 4G5XA 2ROQA 2H2GA 2ZAYA 4QXPA 3B1VA 3Q6IA 1ISGA 5IKXA 2EZ4A 2HT6A 2IS6A 1KDOA 3MT8A 3IEPA 4MV6A 5IYZB 2IU3A 3PBKA 2G9VA 2WWGA 1FDSA 4IH1A 4YB8A 2RHLA 3AEKB 4R6WA 3EPLA 4PG4A 3VH2A 3SBDA 5EKTA 3HDHA 1XJCA 5LDGA 1GPUA 4H16A 3SYLA 3SZUA 3V48A 1XDSA 4XPZA 3ZE1B 1LI4A 3NYQA 3P0RA 3A14A 4W82A 1RLIA 1TM2A 3D1LA 4MVJM 5LFAA 5DWDA 4MS4B 5AW9A 1Z26A 4NX2A 4X24A 3V8RA 1KPIA 1SCUA 4F3NA 4YP7A 4XYGA 1N3YA 4GPTA 4MUJA 3SHVA 4NPCA 1W9HA 2G36A 1U04A 4ZYZA 3MJ4A 1JZQA 1DBVO 1CUJA 5KU1A 5A6SA 2REBA 3FGZA 1TVEA 2LWIA 1BSVA 1X0XA 1S7GA 1AGPA 2FQWA 5SYMA 4MS1A 1F2TB 3SJZA 2M1XA 1R8JA 5DE3A 1E2UA 4DIUA 2YZGA 1D6NA 5EHNA 4AJ9A 4EGCB 3V2IA 4N65A 4EJ2A 3QX7A 3T06B 2HF9A 5H4GA 1MH9A 4NONA 4MYSA 3K31A 4BCDA 4ASUA 3K0CA 2FF5A 4IMRA 3IA7A 5TLSA 3J80A 2GGSA 4BLTA 1D8TA 4CM9D 2PUBA 3C41J 3DYBA 3GNQA 1QDEA 1TD9A 2Q1SA 1PNTA 3SVZA 3BXOA 4H3KB 4DBLE 4E46A 2M6KA 4RK1A 1E59A 2VDWB 4JJ6A 1RWWA 4MROA 3SJBA 1CIPA 1RI3A 2Y66A 4TTRA 4YQYA 2EKZA 4R54A 4EQ6B 1JKMA 4JLJA 1AZTA 1QO9A 4K9OA 2N1MA 3CRRA 5ILQA 4ZU6X 3OA0A 1D0SA 2CL6X 4KZPA 2JF0A 4GVPA 5KYYA 2JFVA 2YHAA 3A1CA 3G2NA 4HDCA 3VU9A 4BMOB 4GYYA 2Y0PA 1Z29A 4ZP1A 5A6VA 3V9AA 2IZ7A 5B1IA 5DBIA 5L7WA 1YT5A 5I5GA 3I52A 1G9XA 4XB6B 4Y6SA 4FP9A 4KQXA 1RAGA 1O5TA 2IYZA 1MNAA 3R3ZA 5BSGA 2Q45A 1QTIA 2Z09A 3D3NA 3PLRA 3DO5A 3R41A 1JBKA 2EP8A 3KTAB 1EHYA 1WLYA 3UH1A 1KHTA 4BKPA 4US1R 4MUXA 2FPPB 4V02A 3LS2A 5JEEA 4D9HA 3AF6A 4K0KB 3B3JA 2IOFK 1EJBA 4OAQA 4PHCA 4RK4A 1HNXB 1MT3A 1P4GA 2QTZA 1KYYA 3ICPA 1WKVA 3TM4A 3UXYA 1OI4A 2POQX 3U9TA 1X8LA 1WMEA 2H4YA 4MWZA 1XJ0A 2ECKA 1ZGZA 4LDQA 4R84A 3GLGA 1Z47A 3O2JA 2MU1A 1M54A 1LLFA 3BBPA 2CLKB 2VHVA 4HH3C 2GN6A 2G70A 4UXIA 3FFWA 3DTNA 1XTSA 2B1IA 1YHZA 3IPLA 4G56A 1Q3TA 5COQA 1Z2OX 2RAPA 3KR9A 4NY1A 3VKGA 3FXAA 3GCXA 3WLTA 1OXTA 3DQQA 3MIIA 5K0EA 2B92A 2G71A 1UH5A 2XMRA 3CZRA 3DMTC 3MLEA 2JCGA 3HEMA 4MVYA 4EPYA 1A5AB 3JVUA 3PR2B 3PQ6A 4IR7A 3O47A 4C06A 5TEVA 1V7PC 2Q27A 3EXEA 5PGMA 3I6YA 3DWFA 3BVPA 1XCBA 4QU5A 1W19A 3H83A 5KBYA 5M34A 3F5MA 3AR2A 1H4QA 5K3OA 5HKAA 4C6SA 3K20A 3TS1A 4BEBA 1X39A 3PC3A 4K87A 1FNCA 1MP0A 3X1YA 2IX3A 2BHSA 4PC7A 3QOWA 3RS4A 3R44A 2Z3ZA 3RFTA 5TPZD 4TKVA 1UJ5A 1O1YA 4KRXA 5J2UA 4I3HA 2D7DA 1VLZA 3U81A 2JFYA 1P2SA 2Q5CA 5ESXA 3ZK8A 4AKSA 4CIVA 4Q34A 5TGDA 3T3EA 1NFRA 4G97A 4R8VA 5DI3A 3G0DA 3OPQA 4WXEA 3SC2B 4R1QA 3WIVA 5CA1A 5JZBA 5KYYB 3L2OB 4JUCA 4M9XA 2ZT8A 4KKXB 5A71A 1PR1A 3KFVA 5BPFA 4EY3A 1UFKA 1Z9BA 2H4JA 3CF0A 3QIVA 1BKDR 3E2IA 4Q9DA 1BEZA 1XZGA 3EZ2A 1B14A 2XLCA 2ZAOA 3KEOA 4HAYA 2IYEA 4YWJA 3ZHCA 2X23A 3Q3CA 3L7JA 5INTA 2J5QA 5DHAA 4RHXA 3LTEA 2I03A 3FVVA 4RHTA 2C7VA 2D2FA 2MMGA 4BFUA 4O4JA 3AF0A 4ZVPA 3G6WA 1RYNA 1KJWA 1QQ6A 3AJ8A 2GCOB 3IQHX 4G4JA 4RLQA 3RASA 3T1NA 3DOHA 3WTCA 3ZZMA 5BRAA 4QGGA 4BNIA 4D45A 1VRVA 1Z5WA 3AOEC 1ISSA 1R0CA 1OX4A 1VKZA 1JXQA 3GLHB 3FPEA 3AFOA 2PM8A 4JGBA 2B1QA 2YIVX 3LUDA 2RBEA 2XGMA 1N9GA 4CHGA 2XDWA 3CX3A 5EEHA 1AUQA 4L4YA 4JK3A 4Z9BA 2QSJA 1JP7A 2JD0A 4LXQA 4RIGA 1GKKA 1I01A 1FP4B 1C7EA 2XUAA 2HHLA 6Q21A 2IXEA 3DHYA 3BJZA 3D64A 5CD9A 1IUPA 1JHZA 1KE2A 2R97A 5G1NA 5FNZA 2WU8A 5ITSA 2HC9A 2XE7A 3H84A 4KQ6A 1TA4A 1FMTA 1VMIA 3D6AA 1ZR4A 5ESDA 3N87A 2ATEA 2WD8A 3D3JA 2POCA 3BQ9A 5IH3A 1PWXA 1KKUA 3T7TA 3A1UA 4C0HA 1XFAA 4QJ4A 3L8MA 3NHJA 1I2MA 3I2YX 1NQUA 4KU4A 1A8HA 5FWDA 4BLRA 3THYA 3W2GA 4HLUC 1RJFA 2ZB3A 4RK5A 1MA3A 2FETA 1S02A 2V58A 3P94A 3ABSB 4PCUA 1QUFA 6GPBA 4IRMA 3ZBQA 5GJVC 2QAGA 3NDBB 2YZKA 4LQLA 5JHGB 4GRIA 4JP3A 4YUVA 1Z6TA 3RM3A 1L4UA 2GB4A 1NVEA 5CPBA 2V7EA 4XCVA 3HADA 4OSPA 1ZK2A 1SXGA 2FWNA 1SCNE 4NKRA 4A8PA 1RQ7A 2J46A 3ST7A 5FEUA 1ZN7A 1CJMA 2O8DB 3JAKA 4J7XA 1IM2A 1I5OA 4NJMA 1OKKA 2H5LA 5J3JA 4X20B 2O59A 1FTSA 3OAAA 3MCZA 3KIPA 1XTQA 5BQOA 1VDZA 4PO9A 4YMLA 5FUVA 2O9JA 1OFGA 1J6UA 1DUVG 1X9HA 2AF3C 1NLMA 1YUBA 3WRVA 4EQ6A 1XJQA 1WZ2A 3K0BA 5F5NA 1KDTA 1THTA 1FDWA 5AXDA 1ZUIA 2PT7A 2ZP1A 1RWNA 5B1HA 2VF4X 2DY1A 1JJBA 4BMSA 1Y37A 4CG1A 4U7JA 5G4KA 4BLQA 1ZK3A 1JQJC 2C1ZA 3T95A 2B5OA 2CF6A 2NSYA 4AMYA 1ZQ1A 2JIPA 2VDUE 1R6AA 3ESDA 4M99A 2V1XA 3VZDA 1TT7A 5MN6A 2WF6A 2ZWMA 4G8JA 3ZDXB 1TLLA 2R79A 1HSOA 1QZUA 1T8SA 4F4DA 2ATIA 1OBVA 4P98A 1OIWA 2BEUA 2VP2A 2ZYDA 4EPVA 2D1SA 2V7TA 4P53A 3OM9A 4JU8A 1PR9A 3MWYW 1YL7A 2Y27A 3KYIB 4TSKA 5KMGB 2C3MA 5ADWA 4E11A 5DT9A 3J7AC 2GSDA 1AB5A 3HWWA 3AVOA 3FWHA 4EFDA 1QPZA 4E03A 1WXHA 3THXA 4QQFA 1JQ3A 5HILA 3GVHA 3L41A 4TZ0A 1Q16A 2O07A 4NJEA 4HDMA 4JLKA 3CPSA 4O6VA 3U31A 3I6MA 2XX3A 4I4CA 2PPLA 2O2IA 2PVSA 1YZTA 2JJ1D 1E20A 1UANA 2C8LA 4FZ5A 3V7UA 2M1ZA 2E87A 3NV7A 3RIGA 4PTLA 4NF2A 1IB0A 1EWVA 4IHAA 4R2LA 5EP1A 3GT0A 1DAHA 1UQUA 4G41A 4HR7A 5T5QA 3D0OA 5BOSA 2XJ9A 1FX0B 5HVNA 4WY8A 3FETA 4NPHA 1USIA 4PZYA 1ZO8A 4XVUA 4J2OA 1Q0HA 2C2GA 3F71A 5CPFA 1GUAA 3ZI0A 3PHGA 1VIYA 3TE7A 5HWSA 4TTAA 4IF4A 5LBTA 2O2XA 3GRAA 2ZQ5A 4W7IA 2ODNA 1MORA 4HB0A 4DQLA 4ALJA 2EFGA 3ZGVA 5ESRA 2IVZA 3BAFA 4M87A 2FSIA 3EN0A 3ITDA 4F5YA 4I1SA 1FMJA 1NP6A 1PT6A 1CEXA 1L8XA 1U8AA 2NUPB 5I8ZA 4CG2A 1MO2A 1WQ4A 3FR8A 4LPSA 2OXRA 1NKTA 3FB4A 1SUBA 2WT9A 4KYVA 3IR6A 3KAPA 3TQQA 2IU0A 2FJPA 2W2VA 1OV6A 1MX1A 3GNTA 5GJCA 4BQSA 4CU5A 1ZOOA 3HXMA 4MH0R 4HCJA 5AP9A 1FP2A 2R6CA 3IALA 1N6RA 1YZUA 4AMUA 4K86A 2G4LA 4G5RA 3I04M 1R8XA 1QTRA 2ZUWA 4BGIA 2HJHA 2WPDD 1P0QA 4LOLA 4RPLA 1QO0A 3ETHA 4PPNA 5A03A 4BJ1A 2XWJI 4K9LA 5J1SB 2YJ6A 2QU7A 4XDGA 6REQA 1ZM2A 2NO7A 5AK0A 2IP1A 4ZYLA 4PC3A 1DAKA 3UXMA 1DG1G 5H0IA 3SF8A 1P4SA 1MX3A 4C0QC 2L0XA 1XZMA 1VCHA 3LE8A 1GSIA 3HCEA 4ONEA 5IAJA 2XNDA 4R9SA 3LOQA 4B4DA 5B1EA 4B3TB 3DVSX 3ODPA 4QQKA 4G1CA 4O4LA 5BVHA 2FHSA 4U3JB 3A9CA 5COAA 2AQIA 3WMGA 2XB4A 2P6OA 3EAGA 2DQSA 4CV3A 4W8OA 3IX7A 4F5DA 3AY0A 1XD8A 2Y1CA 1IATA 1NMSA 2HWXA 1CC1S 3JATB 3KOWA 1T34A 3JPYA 3LPMA 5IKMA 2C7RA 3V4OA 2HV9A 1NW5A 2CNKA 1JGTA 1CUFA 1UMCB 3VHQA 3V4RA 1K89A 4FJ0A 3OIDA 4LE2A 4HNUA 1SUEA 1SXJE 3LLMA 4PCLA 1OIVA 1WZCA 2C4HA 3P96A 4G2TA 4EHNA 2HQRA 2OWDA 5BQPA 2GBFA 1NBMA 1HGXA 2FEWB 3WKAA 5ITZA 1Z3IX 2JFZA 2VTDA 2QT0A 1I4LD 3QVLA 1VECA 2QGZA 1SC6A 2WAXA 3WO1A 1RXVA 3DB1A 1ZOSA 5EMJA 1RIIA 1X94A 3SKVA 1UEJA 4HADA 4EG6A 4QVKA 3C3AA 4HS4A 3SZ3A 2RGEA 2A30A 2IYRA 3HHEA 5C8ZA 1MLDA 2ACWA 2J31A 2WTAA 4C4RA 5I4IA 1NRWA 1R8SA 4ZGWA 3LO8A 4GD3Q 1BA3A 1PGPA 2NUAB 3CRVA 2JIMA 4M0EA 3FDJA 3FYHA 5A3SA 1NVVQ 4NDNE 1LSOA 4MQ4A 4BNXA 3TRJA 3MBKA 3B3QA 4QASA 4K46A 2YH2A 4NV1A 4EWLA 1ODIA 2WUDA 9GPBA 2SCUA 4X1IB 3ZIAD 3ENVA 4TT3D 5H9WA 4F6RB 4PNEA 2AGVA 1V25A 1ZD2P 4PEVA 4UBKA 3IPRA 4QTZA 4NZOA 3FR7A 1RAHA 2UXBB 4CKWA 2XZPA 2JJYA 4K6HA 1KFCB 4O5AA 5DRTA 3QXSA 4KFCA 2MSNA 3QV2A 3SQMA 2WWRA 5EKUA 3NFRA 1B8PA 2FRVA 1O89A 4KN9S 4YP9A 1KU0A 5J23A 1SOUA 3ZS9A 1XHLA 3MWDA 4MUYA 2V55B 3FTPA 2OC4A 3WHIA 4ECAA 4G07A 1VSUA 1XSEA 4ZEMA 5JJ5A 1ULUA 4MARA 2Z8XA 2OA0A 4N48A 1GZSA 4L9RA 1KP2A 1WXDA 1EVLA 5EJ2A 5HP4A 4QELA 4HQ6A 2P9CA 2WF5A 5DW0A 5K7SA 1I94B 4WOBA 3X1ZA 2JA1A 2AK2A 3K2EA 2Q9UA 2IHZA 2IV7A 3EQ2A 2KYRA 1N8KA 1X0VA 2AIRA 2PGDA 1YJ8A 5EIXA 5ARDA 4M7OA 4RH3A 4UOEA 2PV7A 3GMDA 3UW1A 3THOA 2AN3A 5F2NA 2O1SA 1EQ2A 5HR5A 2RHWA 1PGJA 4NBWA 4PLFA 5HA5A 3EGEA 2FPLA 3JQQA 3NXKA 1OHHD 2VA8A 3I58A 4ENRA 2QP4A 3NZEA 3AWDA 3F3SA 4OMUA 4UTOA 5CURA 5FAKA 2HSGA 4LRUA 4UTRA 2YHBA 1QGAA 3TRDA 1BCSB 3LPDA 1LRLA 1FSSA 3HYRA 4B7AA 3N2IA 2XWBF 3PUXA 1LUAA 4BV9A 1A5TA 1F20A 2BJWA 2JHPA 2PUVA 3GGDA 4IUBS 3CU5A 3DZBA 1BMFA 2R85A 5JMWA 3IEKA 2ZXUA 3UT5A 1XMIA 1Z2AA 3BBLA 2W6MA 3LWNA 4FOTA 4NMLA 1T8RA 1XNHA 1JH9A 1VKRA 2CMKA 4Q4DA 1H8HA 1AXRA 4RMNA 4BQOA 5JNTA 1VL5A 3SDSA 4DHEA 4KX3A 4NYIR 2BFBB 3SCZA 3CR7A 2ZYSA 3DYIA 2WSYB 2C94A 5HQTA 5FPSA 2FW8A 3AH8A 4HLQB 4NYMR 3A6FA 1SD1A 3JR7A 2IPAB 4UDNA 4ZRDA 4RIFA 3ZHZA 4DWWA 4UQLA 3U44A 2FQYA 4W1QA 1Z5ZA 4LCEA 1UBCA 3FYUA 5DTQA 3W78A 1RRGA 1B15A 5AI8A 3R8XA 4Q4JA 5J2UF 4TGLA 1GA1A 1RRCA 2PZMA 4QEDA 3PRHA 4URZR 3GLIE 4J2HA 3QVMA 2QYOA 1Y3DE 3N74A 4D41A 1EDBA 1WF6A 5HUQA 3C15C 2BFEB 1WMFA 2REQA 3HE3A 1TLTA 3TQRA 4ECEA 1H1DA 4JQCA 2ZB7A 4TL8A 1KMHB 2IA5A 1ZVJA 1N2CB 2WFAA 3GGPA 3Q40A 3HU5A 4G4IA 3GLFE 2AFHA 1V9CA 1WHTB 4R0VA 4WTOA 1PZNA 3BFPA 4F2GA 1IWOA 3I05A 3STXA 3WFJA 4UVDA 1WBDA 5DRYA 3DOIA 1FLNA 3NWEA 3WDMA 1CLEA 3G9ZA 1PU2A 4JLDA 3KKNA 3H1AA 4P3XA 3UUWA 4AMBA 4Z5XA 5H4HA 4M8SA 3JQEA 4LS3A 4BQNA 4W9NC 5KNLA 1WVGA 3MAGA 4WZAB 2OAEA 3STTA 4E22A 1ZJWA 4B71A 3NVMB 1G5HA 5GMOA 2Q9BA 1H6DA 1PVVA 2RC5A 4JR0A 1Y8RB 1XDWA 4JI8B 5JCOA 4CT4B 1RDFA 2XUZA 3QLVC 3IKVA 1NYRA 1GSAA 2DWQA 2QTHA 1F9EA 5DNEA 2WVGA 2XTAA 3V46A 3NKVA 5CDTA 4DQKA 3UV7A 1JEYB 1QFZA 1T2NA 1HQCA 3ROTA 3NFYA 1L7PA 1Y5MA 3IV6A 3O1JC 4XIFA 3ZS8A 5JXIA 4MUMA 8GPBA 1WXGA 1E4YA 2PNFA 3HJRA 3VHLB 4BOYA 1JR3A 1ULAA 1UDCA 3X1XA 5DBOA 3E53A 4M37A 1SNYA 3H4MA 1CF9A 1XEFA 4N49A 2JLBA 4MR7B 2V3VA 4GPAA 1V9LA 1E3QA 3L7OA 1K3TA 1U8YA 5C52B 4QNRA 3QITA 4PSUA 1GTMA 1P5RA 3DKKA 1ZIDA 2IP2A 1OILA 4C3VA 5LYJF 2D1QA 3C1UA 1KF0A 3K94A 4HDKB 2CJYA 2CK3D 3IUPA 4NK5A 3U4MA 5DBHX 4MS1B 3H8VA 1HYEA 2AEFA 2VYFA 4RTNA 1M8FA 5F12A 2UYHA 3E5HA 2XUIA 4RLFA 1L1QA 5EIFA 1CYDA 5H59A 1IZZA 4ITVA 5BN3B 2QRMA 3N28A 4G9EA 1VCOA 3VYUB 4OTZA 2X1LA 3EQ9A 2WJ4A 5NULA 1SVKA 3HKEA 2QD4A 1N9ZA 1H5NA 3MVEA 1TUBA 4KDRA 1C7RA 3QVTA 1THMA 5E1BA 4MDFA 2QD5A 3P2YA 2H1LA 3GG2A 2QENA 2I6QA 3GA5A 1W5TA 2WKSA 3BXEA 2R3SA 5AHOA 2VTBA 3K6SA 5KEIA 1BDHA 1WJGA 4FQ5A 4QFBA 3SFTA 3WOHA 5K09A 1OTHA 1XU4A 2QLNA 1EVQA 1Y6QA 1ZH2A 1ZYUA 3UN1A 1XEXA 1PNQA 5EP2A 2WYOA 1GRCA 1UK8A 5C1DA 3VJKA 1E2PA 1Q77A 4D9EA 3CHYA 2DH6A 2OPHA 2GI4A 2V59A 3DZJA 4Q3KA 4U9HS 5T4BA 1R2QA 2H5EA 1ORWA 5HF6A 3ZG6A 4BV2A 5LLDA 2HM7A 4YNBA 5EJFA 1IBSA 3DPSA 1OGJA 5C53B 5HG0A 5AYVA 2ID4A 2FPGA 1IN5A 5CNMA 3OTQA 3B1FA 3EWSA 4I4TA 3EVNA 3I42A 3IIJA 1ZHOA 1DG9A 3RIMA 5BV0A 3OLCX 1R0KA 1GGEA 3K8OE 3KXPA 4D92A 1I1HA 2BI7A 2VC2B 1U1CA 2QIPA 2YWDA 2I6UA 3AEXA 3PSAA 3PUKA 4Z3DA 5E1MA 1V1RA 1Z0JA 4D9MA 3GFSA 3RR2A 4IQFA 1MB0A 2R1VA 4F92B 3C98A 5EUBA 4HF7A 4FSHA 4K6FA 4OP1A 1KTVA 5I4BA 3OY7A 1P6XA 3G2PA 4UHBA 2VDOB 4MWDA 1JG2A 3PUWA 4A0HA 1DC4A 4K9MA 2RG1A 4DLZA 4IV8A 3ZVLA 3WAJA 1HZZA 4KQEA 4DA9A 3WBBA 5F73A 3EOZA 4J7CA 3FUCA 2O7SA 3CSDA 4LHVA 3QTBA 1ITZA 3PDHA 4V0LA 1GPDG 1DFGA 1MHTA 3GD7A 3BRSA 3EDMA 3B48A 3FFTA 4BL5A 4F96A 4B3RB 1IXRC 2XUKA 1P2UA 3U7QA 4BB5A 4BO1A 2EJTA 3SIXA 1QVZA 4LXGA 2ZDQA 2EYQA 1WV1A 4QUIA 4L4SA 2YV2A 3H2GA 3ABQB 3Q2KA 2IQ5A 4WNCA 1I5EA 3AXTA 1O03A 3B3AA 4TKUA 3F73A 3D2LA 4ER6A 4YUXA 1W1IA 1D6MA 2ZB2A 4PYMA 1N6IA 3OZEA 1M2OB 3BHJA 3ZWOA 1KVUA 4DNPA 2JLUA 1QIHA 1PTJC 1LPPA 2DULA 4IAOA 2PXHA 4RH0A 1MJGA 3BICA 1U28A 2OHGA 1G42A 2JVIA 1TM4E 1Z5OA 4CF7A 1VLMA 3Q1LA 3FI9A 2EGUA 1DAGA 5C32A 2W2KB 4UVHA 3LZ6A 4BRWA 4P84A 3M49A 1CUCA 2YASA 1VCNA 2FZWA 2MTBA 1OWLA 4JC0A 3MYYA 1V3VA 1GNSA 2GTHA 3GB9A 4UBIA 2ZIXA 4QU8A 2CXRA 4HN9A 5HSGA 5E0KB 3D8SA 4RF5A 1QTQA 3L1VA 4JZYA 4NG5A 3RI3A 1JQ5A 2DCMA 4OQQA 2DKNA 1E6WA 3RSHA 2ZWIA 2Q8NA 9LDBA 3ZV6A 4E5UA 3DNMA 3N2LA 4CDNA 4B48A 1CNMA 1A72A 2P0AA 3HSKA 1YRAA 4K6MA 3RQIA 2JGDB 3DFIA 3LPAA 3AHHA 2GF9A 3O92A 1E3LA 4ZRMA 2NU8B 3GLIA 4YFYA 2WQ6A 4TT8A 4Y2GA 2GFQA 1L5WA 5C5EA 3WFIA 4QX6A 1BE6A 3PFGA 1JVSA 1KYIA 1MEEA 2VBFA 1C3VA 3DTVD 4H60A 3UAWA 5FT9A 4I5IA 4YCAA 1DX4A 4O25A 2HOQA 5FUWA 5FWXA 4RA9B 4GBJA 3KFLA 3KSBC 4ID3A 3E22B 5CIWA 4EDHA 3CINA 3SHWA 5DHQA 4ESEA 5LP6B 5C7IO 2JKYA 1RHUA 1VBNA 1DVRA 4ZC8A 3M4NA 2FDCA 1MO3A 4QARA 2CW5A 4ZO4A 2J6BA 5AJVB 2H54A 3WWCA 1DLIA 2QLLA 3DEKA 2ZM6B 4G5SA 5IBQA 4DLXA 1N2BA 4ZALA 4X91A 3CR8A 2DHEA 4XD2A 3IQGX 2HRCA 1ZXXA 3CZAA 3RYIB 4BNJA 3VSEA 4DDHA 3SZOA 2Q0QA 1I2AA 1W5FA 3GLHE 1CEEA 1J2JA 4IRUB 4WA8A 1VLLA 5DJ5A 4UVGA 4V39A 3EOAI 4A2WA 5EJ9A 2V54A 3PGJA 4QJIA 3G8AA 4V3BA 1SQSA 5CK4A 2JGMA 3THYB 2AZXA 4HFJA 1ICIA 2ZPAA 3HB7A 2HMWA 4EX6A 2E89A 1QH8B 3D0KA 4TUYA 1G6HA 3ZHUA 5KJ6A 4Q9AA 3GXOA 2FUG1 3PX7A 4CEHA 1JB9A 1RWMA 1E5DA 3CWZA 5EI5A 4YWHA 3ZHVA 4IGAA 4TSFA 5AWFC 1SU7A 3KZCA 2OHJA 4Y67A 2PT6A 1N4AA 2ZSFA 4JOSA 2Q6TA 2ONYA 4RKEA 1RRKA 3EZFA 2JFHA 4XR4A 4P80A 3TZQA 4Y9UA 1UBGA 5FFMA 5FQNA 4HGOA 3ZKAA 4TTVA 1RVDA 4Z7QB 3QJYA 2X4GA 4UFOA 3RUHA 1DFIA 1OC2A 4QT0A 2BMJA 2KBFA 4PFKA 1G3QA 1YV9A 4Z9FA 4DM3A 1ZP6A 3MXOA 2PTHA 2H0QA 2MSLA 4FC7A 1SBIA 4TS4A 2AJ8A 4DRYA 3UK2A 3UBTA 1XRJA 3AJRA 1Y8QB 4QICA 3Q5GA 4IVQA 2OQ2A 1TU0A 2P77A 2PGNA 4GKBA 1LVHA 3CEAA 1RQRA 1Z7BA 1ZD4A 1T9GR 4NV0A 5SY4A 3O7WA 2EEZA 4HYEA 4M0PA 2OL4A 1XZPA 3C5WP 3CO0S 4XFKA 3LCRA 3ZD8A 4EH1A 2QOEA 4KO4S 5TPWB 2BUBA 3ECSA 4W8HA 5J5VA 4GXNA 5KYUB 2EIXA 4AECA 2ZUDA 2HHHB 1OYOA 2BTEA 1UT6A 3NIFB 4CDRA 4D81A 2QG4A 3TXAA 4LFAB 1JJFA 1P8AA 4Y2QA 3KALA 3RJMA 1LPMA 2FVYA 2QN9A 3AF5A 1YZLA 3MTGA 4JBWA 1R0WA 4WNYA 1JIVA 5JCJA 1R37A 1XMSA 4TM7A 2B3TA 6LDHA 3IAS1 2WD7A 3PU6A 4AQDA 1S9DA 2D0OB 4G24A 4PLHA 4PR3A 3HDJA 2AC4A 5ICGA 2SKDA 2YICA 2ZCJA 3QFRA 3TZLA 1ZA1A 2P3QA 1L4FA 2X58A 1P18A 1IOVA 2DFVA 4E13A 1PL8A 3ETCA 5DH9A 4ETWA 2A9KA 2C3OA 3SDBA 4GW3A 1P0FA 1VIAA 2X1VA 2F9FA 3B9RA 1BH6A 1DAPA 1T8TA 2DM6A 4RS4A 4HC4A 4IW3B 3PPIA 1MXHA 1RFGE 5FR2A 2OD7A 3TLGB 4BMCA 1HE3A 1UZNA 4J76A 4YJGB 3PEYA 4TS9A 4TQ9A 3HCNA 4OA8A 4YEDA 1NM5A 3HA2A 3HJAA 4NOLA 3IQEA 4CIBA 2QLTA 4U7PB 1B73A 2VJCA 5K4AA 5BYJA 4UCFA 3HHPA 1O08A 4BAGA 4L28A 9ATCA 3ZD7A 4UDXX 1IZ7A 1ZZEA 4Q18A 1VXRA 4GM4A 4G65A 3MHTA 3RS0A 1UAAA 1U3WA 3FM9A 1R9GA 4P4LA 1U9YA 1UEIA 1GTRA 4HWOA 3QI2A 2D2XA 3AVYA 2R0QC 2FMUA 3L4BC 1WUTA 4RSMA 2BD0A 1EP3B 1K1EA 1L1EA 3PHBE 1S2DA 1M74A 1V43A 1IOZA 2N9UA 3KAQA 2JJMA 2VDLB 4HNAB 1VKNA 1Z08A 4RZSA 3OQHA 5GVSA 2ZI6A 5H1YA 1CNEA 2XMZA 3C3EA 4M8LA 4MHTA 3QVJA 2ZJ6A 2IOFA 2QYTA 4E15A 3IIMA 5TGZA 3OZWA 1F8FA 2F59A 3M7IA 5L45A 3RU2A 5KHLB 1SUDA 1V5IA 2PWYA 4WEQA 1JXOA 5EJ7A 3M3DA 1HYHA 2ZUUA 4IIYA 1PEDA 3NS7A 2FW6A 3VNQA 3ZD9A 5A04A 5FLXA 3DE5X 4WY5A 2UZIR 3Q6NA 1AUOA 4J0IA 2QRHA 4MWEA 3R5TA 5AOVA 1RC1A 2UXCB 1PW5A 1LQ2A 5A3JA 3VZBA 4CKBA 1TLFA 3M9LA 4JCCA 1YONA 2J7PD 2Z57A 1X7YB 3O9VA 4ZFNA 3QYJA 3QVSA 1XXHA 1X7WA 5KJCA 1G3UA 1Y6JA 3K16A 2WYWA 2CDAA 4HATA 4F4FA 5JJIA 4PGMA 3AETB 4HAOA 4JBHA 5TQJA 1EK0A 3V1KA 1V6SA 3EEBA 1XLTA 5J63A 1PLKA 4DYVA 2X3UA 4GZLA 3DTVB 4LF6B 3RH0A 3A3YA 5EXDA 5FPYA 4FGUA 3D0RA 1GV1A 3UJ7A 2CLHB 4MOWA 1S8FA 3MQFA 5H3HA 2WIKA 4PC6A 2F48A 1J2UA 3P9XA 5MDHA 1WHSB 2BEVB 4X61A 5IJXA 4W5WA 2VXYA 3I0MA 2HBQA 4JB0A 4F2WA 1HDCA 3LLUA 4ZIRB 1N8TA 5DTJA 1C1XA 4MRAA 4I8DA 1QBGA 2UUPA 1RLJA 3VPSA 2PZ8A 3AHJA 1RCUA 2ZAGA 1TJ5A 2ADFA 2C88A 2XBUA 3QVGB 1QFYA 4H7EA 3UUFA 1C5KA 2RGCA 1EK6A 2W93A 1QGZA 3L1KA 5YASA 3LU1A 1Q57A 3IJ5A 3OJ0A 1GTJ1 1ONBA 1BWQA 1N1GA 1P8JA 1RM3A 2FSGA 2VP0A 1PV2A 4TN1A 3WLQA 4DJJA 3JYHA 2Q7OE 2HBRA 3KKMA 3NYIA 4YRFA 4GKKB 1W8DA 2E5FA 3A2LA 3OFSA 4FDUA 4F1JA 3OTOB 4G0UA 3DZGA 4OPMA 5HS6A 1RXYA 4ZCSA 1PQUA 1UOQA 4ZU3A 1WRBA 4S04A 4CLRA 5ILOA 1TZMA 3H86A 2CBZA 5EEGA 1PG5A 3HCRA 2I7VA 2WHQA 4PBRA 1Y5IA 2FW0A 4B6JA 3AEUA 3MWDB 1TUIA 2A67A 3TRIA 3HRKA 4AKTA 2MSDB 4JBGA 3KLBA 3N2GA 3DWEX 3AESB 3NHMA 1VB5A 4KXNA 4JT8A 3DZFA 2C7BA 3GVIA 3K32A 1W35A 1M2VA 1RFLA 3AI3A 3UXHA 1SKYE 1QIMA 3R6DA 3DOCA 4S1PA 1DBIA 3BGSA 5DHTA 5TNXA 2OAQ1 1AHHA 1JR4A 1P39A 4CETA 5H5JA 5C46F 3N2KA 2FPUA 4ZO9A 3MCWA 4M49A 1WDMA 4XM1A 3G9XA 4NU8X 3K9NA 1Q83A 3HQ4O 4QSMA 5CVVA 1KBQA 1IQRA 1Q91A 3L6UA 1P2TA 2CDNA 4Q1DA 5P8WA 2XDYA 4D9KA 5HQ3B 3ZD6A 4XW2A 1QGUA 2G06A 2P5UA 3DHVA 1QC5A 3RQSA 1XYYA 2C2MA 4AUKA 1C7IA 5BR7A 2C98A 1XDUA 5I51A 4RDXA 4UUAA 4IVRA 4R3UC 1ECCA 3EIXA 4GPEA 1GGNA 1TVKA 2K2QB 2QSZA 4Y18A 4CM9A 4EL5A 4TXLA 5A4FS 4BPBA 4UE2A 1J0XO 4A92A 4C2TA 4H6XA 4M1ZA 1MFZA 2Q1XA 1ML4A 3NTOA 2R1TB 3COVA 4ZAGA 3T9BA 1OV4A 4A0SA 1J7KA 4D25A 1L5ZA 2WSIA 2XHZA 4LOHA 2F64A 4CMKA 3BTUA 3UJHA 3U44B 3H5LA 5ITVA 1KEVA 3IURA 2A5JA 2D1TA 2O48X 2H2IA 2OZEA 3AR9A 5LBUA 2G7MC 2P75A 1CIJA 4IWYA 1IEWA 1OPRA 1R4MA 5E7MA 3AF4A 1RP7A 4F3TA 2ZSHA 3Q8XB 2DMRA 1ZD3A 4J0HA 1RPNA 3EUWA 5KI6A 3I2IA 2EJCA 4EJ0A 1YQTA 1Q1ZA 3F6BX 1GT91 1O95C 5KVQA 2FQ1A 5HE8A 3VXKA 2C1EA 1VB3A 2WJAA 3IPXA 2R87A 1UPBA 2VDRB 1ECBA 1XNRB 1FSGA 5EQTA 5JBQA 1P9WA 2WE7A 1JLHA 5FI5A 5IAGA 1YRWA 5AW6A 1SUPA 4E7OA 3DUFA 2IUEA 1ZMOA 1SO8A 2DXIA 1ACLA 1QKJA 1J2YA 3QBJA 1ORDA 2N1BA 1MO5A 4J07A 1UMBA 2HUNA 3OO0A 3TBHA 3WGZA 1A71A 4AKEA 1MN6A 2IYXA 4J16A 2AFIB 3EVAA 4BZXA 2HO4A 4ENQA 3WK7A 3C8HA 1XNJA 1NXWA 1XF1A 3IVGA 4IFEA 4LVCA 3B9QA 4FFOA 1RAEA 4DSOA 2Q7XA 4QFMA 1DEHA 3PXUA 3MELA 4ZODA 2XE6A 1HYQA 2DPLA 3VX3A 2R6R1 4ZKDA 1UJCA 3GCZA 4JYPA 3OOWA 3WA6A 3LGAA 2P2LA 2CY0A 4DDUA 5HIIA 3GZNB 4Y0VA 4PBSA 1JJAA 4WZAE 2J30A 3OP1A 4X1YB 2Q0XA 5IMSA 1VPDA 5A4JA 4R5MA 5TARA 4YDSA 5JAUA 5DMHA 1C1HA 4QQNA 3C2QA 3D3WB 5I3ZA 4R7ZA 1BIFA 4DT1B 2RKOA 1M0SA 1EE9A 1USGA 2JAXA 4FFRA 5CLHA 1F8XA 4UEOA 1L1RA 2O2SA 3IUQA 2FUNB 4FNOA 3C48A 3ZWNA 2ZDGA 3LY7A 1NBOA 3KUCA 2X9NA 1H1LB 2I62A 4L3WA 3TZKA 4YJFB 5TPZA 3PJFA 5DGCA 4PQFA 3EVDA 2XECA 3KYCB 1K6EA 1JAYA 1QKIA 2VJMA 5F7XA 3H9EO 4RELA 3EARA 4XWOA 4W63A 1QSGA 2DUUA 5M5BA 1P0CA 1E99A 4Z99A 2OHIA 3J81k 3FOEC 1EFDN 1G3IA 4PQEA 4DOMA 2VJDA 2R6DA 4B4OA 3VTAA 2C5HA 5BURA 4LSMA 1K88A 2CSXA 2QRKA 2ZJ7A 2AKEA 2O6LA 3R9XB 4GBGA 3GBPA 5IJWA 2SKCA 3WGUA 1QFJA 2BKAA 1UDBA 3IPCA 3NGLA 4Q5IA 3RIHA 1HUQA 1X8KA 3A4VA 1PG2A 2GZRA 3Q72A 3DDUA 4HXGA 5LNK6 4TXMA 1RYEA 2YHSA 3K5PA 4HX9A 1NOJA 1KZ7B 3FUWA 4XUCA 3FTNA 3PD7A 2OM2A 1P5ZB 3RRFA 2PX6A 3HBNA 5IMBA 3CUYA 3GUUA 1OFUX 1RJDA 4K9NA 3IP3A 4V0RA 3K05A 4TXHA 2JBAB 2G7ZA 1LBSA 3RHTA 4J6FA 4EY8A 3QBEA 3DBHA 1R0LA 5B2FA 5G0TA 2R25B 4UASA 3RHFA 3TJMA 3E5NA 4F84A 1ZJ5A 4Q1CA 1A9PA 1SC4A 2FZ5A 5CT6A 4QJ5A 4I1YA 4UM9D 3MTBA 2NTNA 1G2IA 3NJ8A 2E3JA 3HS3A 5BWMA 4KAAA 5CCEA 3LQRA 2ZIGA 5B2ZA 4MWSA 1GYRA 2ZT5A 1YKSA 3REFA 1X15A 1G21A 2YQZA 1V39A 2GVNA 4LNHA 3CZPA 1T3LA 1G8PA 1KEWA 2XAUA 4FSXA 3IEMA 4ZAXA 3ZVKA 3E6AA 3RGWS 1BS2A 3L05A 4DTCA 4ZVRA 4A0RA 4HNGA 1HEUA 1H3NA 1QQ7A 1LVGA 2I2FA 4IFBA 1TAQA 2GJAA 4OQYA 3VZCA 4W5RA 4MYTA 3AFIA 1T2AA 2GTIA 4ZCQA 1CG6A 4YT5A 2YFYA 4N0DA 3PRYA 4BVBA 4CMCA 2IEIA 1UKAA 1G5PA 3KP1A 4GE3A 1WABA 4QHTA 1I0IA 2DF8A 3WIUA 5LYJA 3OVMA 1Y1SA 2WZBA 1BGWA 5E6RB 3SS8A 1T0IA 2IP4A 2QM0A 3DZCA 3KD2A 4XWKA 3KJXA 2HD4A 1EUZA 1E92A 3WG9A 2OAGA 3C3WA 1Y9EA 4MGEA 4PYNA 5TV2A 3UFXB 4DJFC 1L5HB 3ZCVA 2VCEA 3CVJA 3GVXA 4G85A 4JSRA 4DMKA 2WNHA 1GITA 1T91A 1VKJA 3S40A 3GPDG 3TLYA 3AY3A 5AOCA 4XQ0A 4F8EA 4DE5A 1F8YA 1ZGBA 1T6XA 3EIQA 3OLWA 3GXBA 4A27A 2F1HA 1FB5A 1KEPA 3QPBA 3DLHA 1XNQB 3KUUA 2JC3A 4DZTA 3X1KA 2CMHA 4CF3A 1TQ6A 4OX9B 8OHMA 4JNKA 3U3ZA 4UDYX 2V6FA 1RLOA 4Q93A 3PXCX 3SIWA 3QK7A 4XWAA 3WLMA 5LZ2A 2FLKA 1CJUC 4ZPXA 4D9FA 5DF1A 1TF7A 4BFSA 1EX6A 4AX4A 5MFPA 1I24A 4EI2A 5JWOA 2PLFA 3QNMA 2FG6C 5I9TA 2RD2A 3AJEA 2PZKA 4AD8A 3EXHC 4K5QA 3VYVA 1MIOB 3TGWA 4BRUA 1UM9B 3KV3O 1W8IA 1CZNA 1C9MA 4HQKA 1JN0A 2J3EA 4UU0A 4MTCA 3EXFA 3FNEA 3VC7A 2OP1A 4BO0A 1XT6A 4RPJA 2GUWA 1CHDA 1I4DD 1UT8A 2P5TB 4FGKA 2B5WA 4MUFA 2YYAA 3EULA 3PGVA 4WJZA 3IXLA 4JLVA 4AZ3A 5JC1A 3A7EA 2X2FA 1W4ZA 3LHKA 1L8OA 3B6MA 5FWXB 4EZBA 5F7JA 3AT1A 1JTEA 3LXRA 4LSZA 2YV4A 3KTFA 2B99A 4TTQA 2VOJA 3MMSA 1E5TA 5GZ6A 4B40A 3EEIA 3MAJA 1G19A 2OECA 4MA0A 4RTOA 4QOGA 3IH5A 3CEPB 4TV8A 4EHAA 2X5XA 5TMDA 5K8UA 2CV0A 1YC5A 3DMGA 5IBCA 3I9V6 3VMMA 4F71A 2PXAA 3TUJC 3A36A 1G9SA 5AJYA 1O94C 5B7QA 3LFUA 2OB2A 4ESHA 1U3CA 1JEAA 4B43A 5AI6A 1EBBA 1DJOA 1Q0RA 2PMEA 3TAHA 4C7JA 1NN1A 4EW2A 1RZVA 3VNRA 4EI8A 2PUDA 4B6OA 1LY1A 2HTEA 3FMFA 1A0OA 2GYVA 1E6EA 4PSDA 1PS8A 2W6OA 3C3MA 2AN5A 4JIGA 4Q03A 3W5JA 3ADOA 1OPXA 4PLZA 3MG9A 1AO0A 4LXXA 3IDQA 1E9FA 4GNKA 3I4CA 1RWBA 1SUWA 1L5OA 1ZW6A 3HDYA 4MR9A 5B1SA 4RSGA 4AW9A 1X13A 5B3AA 2R8EA 3QKIA 4H2DA 2C2OA 1C8KA 4FZJA 4FYYA 1EX1A 4O4HF 4P81A 4BUZA 2VDNB 1A7JA 2BJHA 3EGDA 4FFSA 2YR0A 3IE0A 4I5EA 3W34A 2D2IA 1T1RA 2VT3A 5F5XA 3MFYA 2D13A 2GXUA 5DP2A 3MUOA 4I5FA 2J6HA 3VSCA 1N5LA 2EFCB 2WPDA 2WU3A 4JBXA 2FSPA 4TVSA 2Q9CA 2BEJA 1RWQA 4D97A 4WK4B 5CTAA 5HKOA 3ZQUA 4YIKA 2DBRA 2Z1NA 3HA7A 4UUBA 5LQUA 3DWGA 3WYCA 1Q20A 1YE3A 5E4TA 3WMXA 4JN6B 3EVFA 3GA0A 4UUOA 3V80A 3WRYC 3H9UA 3OM0A 4NCIA 4B79A 3V4VB 4QATA 1LK0A 4DKXA 3U5ZB 1YFZA 3TG8A 1I6LA 1RQPA 5KDDA 4O4IA 4NFSA 1VJ1A 4FVTA 5CFOA 1UBEA 3DCJA 2O8EA 3IUEA 1P4HA 4ZWNA 4R41A 3EDCA 1C41A 3HB9A 5AOAA 2DKOA 2WPNA 2QRQA 3DCIA 4LBVA 4QXOA 2Y1FA 5FO0A 3MEQA 3PFNA 4R9UC 4DPKA 4H3HB 3PJGA 5ER9A 4KIWA 5EJAA 1UAYA 1RMQA 2OY0A 5BSKA 5L3VA 1H2YA 1KBZA 1V6AA 2A9OA 3B1ZA 3RVNA 4B2IA 4F93B 4WD3A 1P1FA 5JDCC 2AG6A 1IXKA 1UBNA 2ACEA 4OFBA 4OQMA 4CMIB 1ZDMA 4MPPA 3K1ZA 4QEZA 1ZCZA 3KZNA 3FLMA 4X95A 2GM9A 2AT1A 1DCTA 3D6VA 1P5JA 5KKCA 2Y71A 4AJ4A 2IKSA 1O96A 2DWCA 2EBWA 2EVWX 3SOZA 3HR4A 2REOA 1U8TA 2B8JA 4K9SA 4RDIA 3TQHA 3EF3A 2P6RA 3DLPX 5IN4A 4QDUA 1F8GA 2QQ5A 2Z8ZA 4D3ZA 4F9FA 3LC1O 4L73A 4AVYA 5TQ0A 1DWUA 1PFUA 1S2IA 2C5EA 2ZBUA 3N7AA 1U9JA 1ZN9A 3T7JA 1T43A 4IEFB 2CVQA 3WYFA 2VWHA 2C61A 3N6XA 4ZKEA 3UIEA 4AJPA 2O8VA 1SPXA 4L7QA 4A8JC 1WDLA 1MZPA 5I7UA 4ZVUA 1RYDA 2G5TA 3RU3A 1YDGA 2VJNA 3EGCA 1LLQA 1U98A 2F90A 3KE9A 3OQVA 3P45A 3EGXA 5E6SB 3RSCA 2VQSA 3VSDA 4E5MA 1Y8CA 1B7GO 1EA7A 1U4SA 4CFYA 2VT6A 1ZRHA 1IFXA 3K6RA 1RI5A 1TKBA 3VR5D 3OX4A 1O4VA 4YAGA 1WZUA 1YIAA 2E4UA 1DV1A 3GL9A 3SYNA 2YVLA 3F7TA 4B74A 4DVJA 3DP9A 3DBLA 3UICA 4RK7A 2EG9A 1NX6A 3OLQA 3OOEA 1E8NA 2YJNA 3ISVA 1EUDB 1GARA 3AYXB 4E12A 4TL7A 3ZW8A 3PEFA 3EJ6A 3HCWA 3WLKX 1DQSA 3EH2A 3AG6A 5AW4A 2BI4A 3DGEC 4AX8A 1WS6A 1U65A 4DMRA 1REQA 3NM6B 1BE8A 1LJ8A 3KVOA 4KOEC 2IPMA 2OZLB 4ON9A 3KK0A 4RZIA 3VR4H 4IJWA 1VOTA 2XCLA 4L6IA 3F9RA 3U48A 1ZFNA 3WYGA 2OFOA 2QA5A 1ZD9A 4WFKA 2XADA 3DH0A 4KNVA 1WCIA 5FLYA 3IAHA 1OFTA 3IYLW 4KO8A 4QM6A 3TAXA 4FQ7A 4KQ9A 2E5LB 3IDFA 1E6KA 1NHWA 2HFKA 4V0QA 1LLUA 5AKKA 1G7TA 1NVAA 4F91B 4WK0B 2W2PA 4D8YA 4QZVA 3LK6A 2GKSA 1BDMA 1CD5A 1RKUA 4JLSA 4MUHA 4N7BA 4C7KA 2A5DA 3JARB 4RLSA 4JQOA 4OXXA 4TXJA 1FPMA 1GL3A 4ND3A 2DOKA 2Y2UA 4WHMA 4NICA 3IILA 3ZBUA 1P7CA 4EF5A 4BTLA 1W85B 4HQNA 4L95C 4KQGA 4HAVA 4ZQEA 3M6AA 4DJDC 3E70C 4H7HA 1QYRA 4CM1A 4DKJA 3V4FA 4O8ZA 4F4UA 5DFAA 5BW4A 4FYJA 2ZYTX 4D99A 1AN9A 4AQ7A 3JQ7A 1YFKA 5JJCA 2W70A 4CXMA 4GI3A 2N75A 5C1PA 4W6QA 1QH1B 3GG9A 3KXLA 2X0FA 2XUQA 4S1OA 4EVRA 4ZO7A 1IMJA 2QSYA 4B0PA 521PA 3WADA 3FPAA 5LUAA 5FEMA 1QS0A 4EEKA 3AGPA 1WPQA 5L6LB 1ESDA 2DWUA 1VJRA 4C1BA 4ZA2A 5I7VA 5IYZA 4UTXA 2HPAA 2H18A 3X0DA 4AUNA 1ILEA 1FNDA 5FBRB 3RUEA 2AJBA 2ODPA 1E1YA 3FSGD 3GJ0A 3TNJA 3TKLA 3TTYA 1WD7A 4LJSA 4KMRA 1DEXA 1VJTA 3H5NA 4E51A 5JD4A 2H6EA 4NECA 2R48A 3HJTA 2EZTA 2Z4TA 2P6NA 3S2SA 2VHWA 1V45E 4J6EA 4JS0A 3RC3A 5FOQA 1KZ4A 2IYPA 3SC4A 4YHBA 2XF8A 4EG8A 4FOLA 5F9MA 5K0GA 3KQSA 1V11B 3D81A 4HMOA 3I4FA 3K6KA 3TVYA 5JNSA 1OA0A 3AOEA 3QKRA 3CZMA 1TOAA 4I3GA 3GRFA 2R6AA 4CLRB 1QPBA 3F7NA 2IW1A 5D87A 1U8CB 1AXGA 3Q9UA 2CZQA 2HCRA 3HO8A 3HKBB 5A4KA 2XZDA 3K30A 3DMNA 3QY0A 3AHIA 2ZI3A 5F7OA 1KHHA 1WZEA 3HYLA 4BHTA 2XOKA 3PTLA 1VE9A 1I8TA 3HXLA 3INTA 3MLAA 4M0CA 3A6GA 3EZ7A 4ME6A 4YK7A 1KSHA 1NW6A 3K5HA 3QMVA 4FIZA 5DCYA 1YQGA 2NUBA 3FWKA 1LBHA 1E1MA 1DO8A 3JYQA 2BTQB 2WWTA 5FADA 3JVIA 2AZTA 5CT9A 2ZR8A 3K2IA 4HOYA 4KFUA 3ZX4A 5JSZB 2BN4A 2O0HA 2GBLC 4XEUA 4X84A 1FW8A 4HUTA 4U0KA 1A95A 3A6LA 1QAQA 3ORHA 3PQ8A 3O8BA 4TPKA 3L8GA 3WWZA 4LRYA 1IHPA 3KKQA 4WXMA 2HEIA 2LV8A 4ZQHA 1GAXA 3D6JA 2EZ8A 1J20A 3AYZB 3DBRA 4D1YA 1YTUA 1GZVA 3O82A 1MHPA 3OE7D 1JI0A 2CK3A 1UKCA 2H2HA 4D74A 1N0HA 2OP0A 2BFAA 4PY2A 5FA5A 1PR6A 1OIXA 1Z4NA 1FJHA 3OMXA 5K01A 5MHTA 2XKBA 3P2JA 3URKA 1EUYA 3G0HA 3QI7A 2V4UA 3IB3A 4CMGA 3TFWA 5LVAA 3D2BA 1GHTA 3DVQX 3R0JA 3PFCA 1K8RA 2AOUB 3BRWD 1J9GA 1DIHA 3BWMA 2X2EA 2Y93A 4R2MA 4CKEA 5TY0A 3FCXA 4QWMA 5IKEA 2PL5A 3PT9A 1U0TA 5EA2A 1LQUA 3OQIA 3EVEA 4JP2A 4R83A 3MINA 4UHEA 3GRKA 1OU0A 2IBSA 1QJCA 1RCFA 2Q4EA 2VJPA 3EDOA 3QX8A 2AW5A 2QQGA 3ZCQA 1WCYA 1IONA 4WOJA 3RRZA 4C14A 1CEYA 3OX3A 3DMPA 4NYJR 1OAKA 2FZGA 3KJQA 2WDPA 5TSDA 3SMQA 1C3EA 1US8A 4P4GA 4CHTA 3OJWA 5CAEA 3ZW9A 4RKYA 5K8CA 5LMZA 1PJ3A 5E1DA 1BRMA 2V0NA 2W4QA 2FW9A 4Z1MA 1ZM3A 4LHWA 3MUFA 5HZGA 2BCGY 4NBVA 1PSWA 4BUJA 1GYPA 4CRWB 3OE1A 3QZUA 1R6DA 4INAA 3OQ1A 3DXXA 4CN8A 3ZHYA 1P1HA 1II9A 4OYYA 2QT1A 1CT9A 1I7DA 1U1GA 2ODEA 4YDRA 1MENA 1BWPA 5FNVA 4ESOA 3FCAA 2DR0A 2FJUA 2H00A 2HYIC 2FGKA 5IM4F 2DHDA 1IG0A 1J70A 3MSCA 5TMEA 4CLXA 4G5YA 4P22A 1KNQA 5LKRA 5JDIA 4B84A 3IHKA 4BNNA 3HBAA 1YFLA 4UHDA 3ZQKA 1KXJA 2VQEB 1AGNA 1D8AA 4XR9A 1H3EA 3G1WA 4N76A 3L7MA 2WJZB 1LU9A 1OASA 1XRLA 1BWSA 1FYDA 2J4FA 4LBYA 5E4YA 8ATCA 1EFVA 1Z6GA 4ZOAA 3F90A 3UMSA 3UA3A 3AHEA 5ALZA 5DHSA 1V4VA 2BGTA 2NTEA 2R11A 1SXHA 3ETEA 1KSFX 4YCBA 4JVMA 4B8YA 3NTVA 4UW9A 4ENPA 2YVAA 2IYSA 3DKRA 3KLOA 2I66A 3HYTA 1YR9A 1O94D 3N7TA 4R8KA 5DX1A 5I7RA 5JASA 3IE1A 3AKYA 1FXWF 5HCUA 1WBBA 3RU9A 4OBXA 2J3LA 1ZM9A 2CWWA 4EG1A 2W0SA 5LP1A 2X1HA 2G0NA 3CBGA 5CJPA 2AFIE 1C1DA 4U6NA 3WHKA 3ANXA 3G1UA 5AH0A 4A03A 4P3NA 1TW3A 1XVAA 3OZBA 9MHTA 2J87A 3I0NA 3NC0C 2W2TA 2NOAA 5MGNA 2C4MA 2HB6A 3SHOA 3GFQA 5FTJA 2OORC 4RM2A 3OU7A 4W5OA 3HJNA 1NDHA 1U4NA 2DPYA 4OQDA 2HXYA 5D3ZA 4K03A 1XTVA 3K09C 3OJFA 2UYCA 3PUZA 3UJ3X 3T7SA 3LP8A 4N5DA 4QBHA 5KAMA 1HE1C 2IJGX 2G07A 1EFRD 2JCVA 4DV4B 4P6VF 2P4EA 3C3DA 3OIFA 3R3XA 5ED0A 4IHJB 6NULA 2ZBPA 3ERCA 1PBNA 1JKJB 2SNIE 4GZ5A 2M9MA 4KRGA 1JNYA 2FGJA 2JVKA 2VSXA 1K4YA 3HXTA 3NBYC 4RV9A 4CL0A 1DHRA 3RUFA 3LDHA 1VPLA 1FOEB 4D0GA 1ADBA 2Q5IA 5D3QA 2PH7A 1ZU5A 5D5HA 1BAPA 4L5YA 3DSRA 2D8MA 4OHMA 2IXGA 5L4LA 1IHOA 1QK5A 1U0BB 3EE6A 3GJ3A 2RIRA 3K9WA 4N40A 4N4AA 1XZIA 2PG3A 3RNOA 2VH2A 4NCNA 3W4IA 3EPJA 1F7VA 2CVZA 3KR1A 2RGXA 1IVYA 5FUXA 3V1LA 1DKMA 5I8WA 4LF4B 1QVAA 1X1SA 2AMLA 3MOSA 2QK4A 1H2ZA 1R3DA 3JZDA 1TD1A 5AKGA 1QG4A 3LDUA 1Z73A 1IJBA 4RHFA 2Z2JA 5IDYA 1LTKA 2MJLA 1T9HA 3A05A 3DJYA 2PSHA 3HCFA 2NU9B 4QYXA 5F2EA 1A9OA 3KAKA 1U2DC 5I01A 4N5LA 3D4PA 1T24A 3U4QB 4AYXA 1RQLA 3C4QA 1VC2A 3C5VA 4MPDA 4XYMA 4BO3A 5F98A 4EMSA 2QMUA 3GT4A 4IYRA 5JQWA 1CRZA 1VCMA 2B0JA 3AY7A 4RNDB 3JQPA 4M0DA 3HNRA 3OLXA 4NDZA 3TTTA 4KPEC 4Z4IA 2EFHB 4FX5A 4XLZA 3VNSA 1GKUB 2AFRA 4URXR 2COUA 1TU3A 4L9AA 3M6IA 2BP7A 5DLDA 1SD2A 3LF2A 1BFKA 3JX9A 5DU2A 3U1TA 3GOQA 3P2MA 3RTAA 4JNCA 4R0NA 5IKOA 1SWVA 1TAHA 2XY4A 4Y9RA 2D5CA 2VRCD 3G5UA 4WXYB 5K2MA 1M7GA 1EXVA 4DSNA 1M2HA 3KYJB 4BWFB 1JDTA 2VP6A 1KOGA 2GAAA 1UC4B 2V7VA 4LYYA 1QIGA 3JQ8A 2YXLA 1UKBA 4H3VA 2VP5A 4HDAA 4MWGA 1ZICA 5KZMB 3L8FA 1I10A 4D3YA 4EMBA 1JEOA 2WZDA 1JLLB 2P90A 2YYSA 1QH9A 1X3SA 2CFRA 2FLVA 2RBGA 1NXOA 2G5PA 5SY6A 5BNTA 4Y98A 4GYWA 5JQGB 4BIMA 4Z1OA 5H9VA 3A1DA 2A5YB 8AT1A 1Z4OA 1AKWA 1TF2A 2GPTA 3E9ZA 3WYNA 3O91A 4D9GA 3HY3A 2PZJA 3ZGNA 4EJSC 2OHVA 3D5QA 4DPLA 1FFEA 3AK4A 2QD3A 1Z6YA 3L79A 4QVIA 3I28A 4RTSA 4HD8A 5FV4A 1YQWA 3IUBA 5LQSA 4CEJA 1EXMA 3PUJA 4JUDX 1B2RA 3O8QB 4PS0A 4O5OA 1DC8A 1KEEB 2EWVA 5FTLA 3AEQB 2GZ3A 1WD5A 1CXZA 1NW8A 2H65A 1U8XX 3MCUA 3SLGA 3E9EA 2L17A 3LXMA 3ETJA 3N8IA 4OK5A 1RABA 5KAPA 3KEMA 1ODFA 3AIKA 3G9TA 1MOSA 3LSTA 4C0KA 3IEIA 1U8UA 1KO5A 2ACVA 3UG6A 1YL6A 1CZHA 2PZBA 3RROA 2ZRDA 3B2NA 2HCJB 5AHKA 5JS6A 2GMWA 2QZ9A 2PYIA 1KO1A 4FEGA 3R40A 1BQEA