3HSSA

A higher resolution structure of rv0554 from mycobacterium tuberculosis complexed with malonic acid
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
274
structure length
274
Chain Sequence
NLYFQGAMDPEFRVINLAYDDNGTGDPVVFIAGRGGAGRTWHPHQVPAFLAAGYRCITFDNRGIGATENAEGFTTQTMVADTAALIETLDIAPARVVGVSMGAFIAQELMVVAPELVSSAVLMATRGRLDRARQFFNKAEAELYDSGVQLPPTYDARARLLENFSRKTLNDDVAVGDWIAMFSMWPIKSTPGLRCQLDCAPQTNRLPAYRNIAAPVLVIGFADDVVTPPYLGREVADALPNGRYLQIPDAGHLGFFERPEAVNTAMLKFFASVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative Bromoperoxidase
publication title Structural and functional analysis of Rv0554 from Mycobacterium tuberculosis: testing a putative role in menaquinone biosynthesis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 96
structure length 274
sequence length 274
chains with identical sequence B
ec nomenclature ec 1.11.1.18: Bromide peroxidase.
pdb deposition date 2009-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hssA00
1H2WA 4Y2XA 1O6GA 1UK8A 4BATA 4YPVA 2V9ZA 2WJ6A 3MUNA 5EIHA 1Y7HA 3M82A 1X2BA 1TCBA 1XZLA 3I1YA 2WUGA 4KRXA 1YCDA 4QDOA 2Y6UA 1S8OA 1TCAA 1R88A 1T4MA 3K2IA 4HXEB 1BROA 1JMKC 3DQZA 1VXRA 2XMCA 4CCYA 3F96A 4XWGA 4Y2SA 1E5TA 2XUAA 1QO9A 2QVBA 3VVLA 4W63A 4C87A 4UHHA 2WHQA 1GKLA 1Q83A 3WIOA 4GECA 5CH5A 4FDMA 3C5VA 3QITA 3G9XA 5FUMA 1ISPA 5AJHA 2W22A 2CEKA 1IZ7A 3O0DA 3FCYA 3FOBA 3FYUB 2PM8A 2CKMA 1I6WA 3LP5A 2O2GA 5ALZA 4QNNA 4XIIA 1CUEA 2WILA 4LXHA 3DNMA 3PFBA 1XQVA 4RE5A 4AMYA 4K2AA 2HRRA 4BAZA 2DR0A 2EEPA 2XQIA 4P92A 2Z3ZA 5ALLA 5AOAA 5AI6A 3WIBA 2BAGA 3V1LA 4MYDA 3BE8A 2P8SA 1VOTA 2X76A 5ALRA 4F21A 1YA8A 1WHSA 3HZOA 5T4HA 3EBLA 1AX9A 2IX9A 3B12A 1BE0A 1U65A 1XZJA 3A2NA 4KAAA 1VE7A 2G63A 4JEIA 3ED1A 2J3QA 1IUNA 3G0DA 5HFAA 5KREA 4PSCA 1HPLA 3CXUA 3AINA 1EK1A 3DKRA 2H7YA 3K6KA 3OM8A 3STXA 1UT6A 4GWLA 4I4CA 5I8PA 2B61A 4DMFA 5HKBA 4L3WA 4J03A 1THTA 3R3ZA 1LPOA 4JUIA 1MJ5A 3DLTA 4XJVA 3WYNA 4Q1VA 1CFJA 2CB9A 2OQVA 4QWWA 3E1GA 2XUFA 4Y2RA 5K3BA 1MN6A 4GDMA 3ICVA 5D6OA 4WFIA 4GBGA 3WL7A 1A88A 2JBWA 2VJAA 3JW8A 5HCUA 3DKKA 4A5SA 3GA7A 1ZICA 1CUXA 4EZIA 2LIPA 2QXUA 4IH1A 4BP8A 3DYVA 2GYWA 5EIAA 3FYUC 5AKLA 3PF8A 4CG2A 5CT8A 4UFOA 2HM7A 4KJXA 4QDTA 3WJ2A 1QIDA 3OG9A 2PSDA 2YASA 5EHXA 1Y37A 5JALA 1CUAA 1KU6A 2C0QA 4KEAA 2XUPA 2GZSA 4ROTA 1HL7A 3V9AA 3KDAA 5CH3A 3WL6A 5C8VA 1OCEA 2BJHA 2ZVDA 3G0GA 5HK8A 1YASA 5DTJA 1LPBB 1XQXA 3QMWA 5KWJA 3C8HA 3BF7A 4ZREA 4KE7A 2WU3A 4UFNA 1UFOA 1P0PA 4PW0A 5AM3A 1DINA 5IKXA 4EY4A 1RWQA 4LYDA 3IURA 3WL5A 2OG1A 3KSRA 1UK6A 3WWOA 2WFLB 4WFKA 3H1AA 3N2ZB 3GELA 3ESCA 2OGSA 3IUQA 1QIGA 2QR5A 1AZWA 1VZ3A 1H23A 1XZFA 1EB9A 2RHTA 4M0MA 2OPHA 4BC0A 4IH4A 2HA4A 1XLWA 3FVRA 1C7JA 1FSSA 4Q05A 1WB6A 5AP9A 1QTRA 3BXPA 2GBIA 2ZJ6A 2OXEA 4FNMA 4B83A 3AJAA 4KAJA 3AUKA 2HIHA 3FNBA 3O4GA 4J7AA 3RM3A 2FX5A 4X90A 1MU0A 5AKJA 4WJLA 1UK9A 4AMZA 4HXFB 2AJLI 3W9BA 3HYSA 2ACKA 2OCKA 2ZSIA 3IBTA 2JGEA 4X7BA 2PSHA 2B9VA 1FFAA 3S2ZA 1ZD3A 1TQHA 1GPNA 1IZ8A 4KR0A 2VAVA 5HF5A 1MTZA 1LZLA 4G4GA 4BCCA 4W9RA 2H7CA 3K9BA 4CIAA 2EDAA 2QUAA 3R41A 4WDQA 2WSLA 3BL8A 2YXPX 2CUTA 2VATA 1MT3A 4U2EA 3WYDA 1E8DA 4U2GA 5IVDA 4G5XA 4DYHA 1EA5A 1U8EA 4Q3LA 2Y1KA 4FFWA 5AKYA 5K3CA 3ZV7A 5BOVA 4HVTA 4KE9A 4RE6A 4UHEA 1ORWA 2QRUA 3DOHA 2JGIA 3UUFA 4G4IA 4Y2QA 3TRDA 1QIIA 3BJMA 4X91A 2R8BA 2H7XA 4UBJA 1CUJA 1ZD5A 4X71A 1GZ7A 1A8QA 1ZIXA 5J3JA 3C45A 3NWOA 1M33A 3BDVA 3IULA 5E2IA 3AZOA 5F4ZA 5K5EA 1RYYA 4KRYA 5JD6A 3DD5A 4OYLA 4ZV9A 2WFLA 5ALUA 1WPXA 2OCGA 1A8SA 1B6GA 3O4JA 1NU6A 4MEBA 4AN1A 4B9AA 3C6XA 3ICWA 3RKSA 2PU7A 4H7HA 2BUAA 4ZWNA 1QIFA 4ZRDA 3PUHA 4J0HA 2O2HA 4BDTA 5ALOA 2RAUA 3SK0A 3D59A 3E0XA 2WFZA 1ODTC 3BF8A 1VLQA 3W06A 2HL6A 4HRYA 5ALPA 5LKAA 3O4IA 5CXXA 2K2QB 2AJ8A 2WKWA 1LPSA 4LIPD 4W1QA 4J0IA 1N1MA 3I28A 1Q0ZA 3HACA 3E3AA 1PV1A 4CIBA 1CUGA 4PSDA 4LXIA 1DT3A 3I2JA 2J3DA 4DNFA 2CJPA 3H1BA 2OCIA 1U2EA 4JYMA 5BWCA 1VE6A 1BN6A 5AKEA 5K3AA 3MVEA 5FXMA 2O7VA 4HRXA 1DWQA 2PL5A 4QWMA 2QOEA 5BV7A 3WK7A 3PICA 3FVTA 4OB7A 1BN7A 2JGLA 2ZYHA 3HJUA 4S0XA 3STVA 2B4KA 1A8UA 2XMQA 3QMVA 5AK4A 4WY8A 4PNZA 1JJIA 4DSZA 2WUFA 3JWEA 4Y2TA 3QPAA 1QOZA 1Q0RA 4C4XA 5I9IA 2OCLA 1VA4A 5SYMA 4FHZA 2H1IA 2WUEA 3EQ8A 3WWPA 1YAJA 4D9JA 4GHWA 5AM1A 4BP9A 3PI6A 5AI4A 2XQJA 4E15A 6YASA 3WK8A 4YX9A 5ALIA 4MWTA 2XUHA 5A6VA 4HZGA 1E8MA 4DM7A 4FLMA 1KEZA 4PV7A 1XROA 3R40A 5AO9A 5AIBA 1AKNA 3GUUA 5E4TA 4MQMA 3WZMA 2JGJA 2GBGA 4BE9A 3AIMA 4BRZA 2I3ZA 1GPLA 2VJDA 4MEAA 1FFDA 1ACLA 4OD0A 4BE4A 5IVIA 1DU4A 2XLCA 3O9MA 4B80A 1H2XA 2WQZA 2QMQA 2XMDA 3R3XA 3PFCA 5IH7A 5AI8A 1USWA 4BDSA 1XLVA 4BZWA 4ARAA 3WQHA 2AJCA 2PVSA 4Y9SA 4JH0A 3FSGD 3O4HA 3KXPA 1W52X 1XQWA 2WG1A 3KOOA 5JAUA 1J1IA 1LPPA 4QA9A 5ESRA 4Q3KA 1VJ5A 4J0CA 3DL7A 2VAXA 1CUFA 5A71A 1XZEA 4X00A 1EDDA 4PF1A 2WJ4A 1IUPA 2PPLA 3ZI7A 5AKHA 2W6CX 4DSAA 2JGKA 4B7ZA 1W75A 4UBOA 3GROA 4B81A 4YASA 1CR6A 2O2IA 5AKXA 3QVMA 3O95A 3H2IA 3WLAA 4L0CA 3HABA 4EB0A 2NW6A 4NMWA 1EX9A 4KE8A 4DGQA 2QZPA 3PUIA 3VJMA 3G8YA 4QLOA 1H2YA 5AICA 4KE6A 2Q0XA 3HLKA 1DWPA 4C88A 3AIOA 4H18A 4U2DA 2VEOA 3WWDA 2JEZA 2WHPA 3ANTA 1DX6A 3DEAA 2FJ0A 2VA9A 4HXGA 4BVKA 4J0DA 1NU8A 1HDEA 3L1JA 2PX6A 2OAEA 2QT9A 1K63A 4N5HX 2DHDA 5LZ7A 1ODSA 1ZJ5A 4Y2UA 4BAUA 1U4NA 3G9ZA 3CN7A 3WA7A 3BWXA 1CPYA 1CUVA 4FKBA 1C4XA 3ZWQA 2HA6A 2HU8A 4WCVA 3BIWA 3FWHA 4C89A 5CRIA 3SC2A 1MNAA 2WJ3A 5LZ4A 4AO6A 3AFIA 3N0TA 5AM0A 1XRRA 3R3UA 1EXWA 4QEKA 1XRLA 2Z8ZA 4HTAA 1LBTA 4DNOA 4IH9A 4Q82A 1SCQA 2HADA 5FKJA 4X85A 3D3NA 4J0GA 4UHFA 4G4JA 5D3ZA 5HFNA 1A7UA 1TIBA 4U2BA 2XB6A 3HRHA 1OXMA 1GQSA 1DTEA 3H18A 4QDXA 2HA3A 1W4LA 4G1FA 1QIKA 3FBWA 5LZ9A 1UOPA 4BB0A 4LKOA 1J06A 3DS8A 5ALXA 1TCCA 1YB6A 2AJDA 2XUIA 2VT6A 4A23A 1MX9A 4G8BA 5K3FB 1L7AA 4JNCA 1JI3A 4UHCA 2B20A 2QJRA 5BWBA 2D0DA 1WOMA 4BTVA 2WIFA 4UBNA 5FLKA 2HA0A 4CCWA 2C58A 1JFRA 2XE4A 5HF9A 3NOXA 1HBJA 4O08A 1CRLA 3U0VA 3A70A 5CT4A 1QFSA 4Z49A 4EUSA 2OGZA 4IHAA 3C43A 4MXDA 2XQGA 2GZRA 3E4DA 5C8ZA 2PSFA 5ALKA 5IVKA 5HK9A 1UXOA 1BCRA 1E66A 2XUJA 4C6HA 2BGRA 4Q3OA 4AX4A 5E4JA 3T52A 1MAHA 1E3QA 3ILSA 5EHNA 5LLSA 4BCDA 1Z68A 2G5PA 3H04A 2RIPA 2HA7A 2PUJA 4EA6A 5CBKA 4Y2YA 4EBBA 4BAGA 4H35A 1BRTA 1YS1X 2IIVA 1J2EA 3D5EA 4DMHA 5DNVA 2ONCA 4DLNA 3W2TA 5LIPA 5LKRA 2HA2A 3QZUA 1AC5A 2ZYRA 2WIDA 2BGNA 1XZKA 4UBLA 1CUHA 3AIKA 3I2IA 4RGYA 4B0PA 1EB8A 3G0BA 1BEZA 2FUKA 3ESAA 3WK9A 4A16A 4FWBA 3WMRA 4C4ZA 3AILA 4FLEA 3IDAA 1QE3A 2XUGA 3TGLA 4IQ4A 4C4YA 1XZIA 1JKMA 2ROQA 4OUKX 1MX5A 4LXGA 3AZQA 2HU5A 4FNGA 2QM0A 5ALVA 1R50A 4BC1A 2QXTA 1J07A 1HKHA 3H17A 3C87A 4J0JA 5EFZA 3ZLTA 1B41A 2AJBA 3T4UA 2OQIA 2PSEA 3G7NA 5K3FA 3H2GA 5C7YA 4ZI5A 4KAFA 1UK7A 3ESDA 3IUJA 1QO7A 3QMMA 5DWDA 4F60A 5DNUA 3CN9A 2IITA 4BVLA 4K6GA 2XUDA 4KACA 3GZJA 3QPDA 5D7BA 1MX1A 1XZBA 2WHRA 1H22A 3PF9A 4J0KA 3H2KA 4PQEA 3C6ZA 3STTA 1D07A 1QIHA 1C7IA 4YK7A 4DMCA 4FFVA 4H7DA 1JU3A 4WDRA 3EQ9A 3OOSA 2HHAA 2JEYA 1Q84A 3ZLUA 2RI6A 1R3DA 1TKRA 4GEGA 2GYVA 1N8SA 2DCMA 1QFMA 3IB3A 1XQYA 3A6ZA 1TAHA 3WJ1A 1R9MA 4AZ3A 4OU4A 2WM2A 5K3EA 4TVKA 3I1IA 4P93A 4Y2JA 4P08A 5HQ3A 5CT9A 1EH5A 1BEEA 3HC7A 3WKBA 1LGYA 5I7UA 2XLBA 4JYPA 4BBZA 1CVLA 2UZ0A 3TJMA 1QLWA 3W9UA 5ALHA 1ZGCA 4E11A 2ZJ7A 4X6XA 3VJLA 4U2FA 3DOIA 4N5IX 2VTVA 1GKKA 1IUOA 2JGMA 1YSCA 4ZV7A 1O6FA 1WB4A 5FRDA 4B82A 1TK3A 5JATA 1H2ZA 5CW2A 2RONA 2VQ6A 1CUIA 5AK3A 3LIPA 2PUHA 2GBFA 4P9NA 5CMLA 1PFQA 2G4LA 4PO3X 1GT6A 3X3HA 2EDCA 1P0IA 4UPDA 2CMFA 4E14A 4AB1A 3WKDA 4UBMA 1LPMA 5HZGA 4K5QA 3F67A 3WA6A 1FFCA 4H7JA 2BUBA 4ITVA 4GLBA 5E4YA 5AKGA 2XMSA 3DCNA 1VKHA 2HRQA 3STUA 5A7GA 3M83A 3Q8WA 1JU4A 1VA5A 1BCSA 5C81A 3WKCA 1XRQA 3NUZA 2JGFA 1VZ2A 4X6UA 3I2KA 1XZGA 1HQDA 4AO8A 4H7FA 2WHPB 1EK2A 1QTIA 3STYA 1W6RA 1SCIA 2X5XA 5HF8A 3IVMA 3I2HA 4CG1A 3VKFA 1G66A 2I03A 1EI9A 2C7BA 1AQLA 4H77A 4OB6A 2HFJA 5ALEA 4MWSA 5ALJA 3WWEA 1G42A 1GGVA 3AZPA 1WPRA 3WK5A 3WKEA 1T2NA 4NS4A 1LPAB 1K6EA 1K8QA 1DQZA 2XMBA 3V1MA 4N8DA 3STWA 1UOQA 1CUCA 3DL4A 1QONA 2WIKA 3R3YA 4FTWA 4EY6A 4X95A 2XT0A 3FCXA 3UMJA 4L72A 2PU5A 5LZ5A 4L9AA 3HSSA 5A62A 4W1SA 3D7RA 2PBLA 2DSNA 2WUDA 5AOCA 4ETWA 4PSUA 2VF2A 3RARA 3RK4A 5IVHA 2WTMA 4Y7DA 1LBSA 4RNCA 5ALMA 2C5GA 2BUCA 5DTIA 2C4HA 2GYUA 1ZIYA 5JADA 3B3QA 1N5RA 3PE6A 3V1NA 5JZBA 2WG0A 1RP1A 1UKAA 4OB8A 1XRPA 1OILA 4MQLA 4X92A 1QIJA 3U1TA 2V97A 5EGNA 4W1RA 1ZJ4A 2CZQA 1QJ4A 1CUBA 1LLFA 5EHQA 1XFDA 1YS2X 1CUZA 3WWCA 1YAHA 2GBCA 5DNWA 3H0CA 4MYSA 3I6YA 3FLEA 4AQDA 2XQFA 3WI7A 1XZCA 1CLEA 4DNPA 3G02A 4N8EA 2DFPA 1QGED 4KYVA 2WTNA 5LZ2A 3M81A 4AXBA 3G0CA 5T4EA 5CURA 4BYMA 3IUNA 1MO2A 1XLUA 3D2CA 3EIOA 4QLAA 5KWIA 4N8SA 5JD5A 1Y7IA 4HS9A 2X8BA 3DJYA 2WFMA 2WU4A 3ESBA 2J4CA 3Q0TA 4FLFA 4BCBA 2XMRA 2ZYIA 3RLIA 2VJBA 3IA2A 5FP0A 1CUSA 3MGAA 5AI9A 1EVQA 5CT5A 4QE3A 5JAHA 2Y2VA 1CQWA 5AI5A 1XKTA 4X94A 2PKYX 5K3DA 2QJWA 1EDBA 1THGA 5A2GA 1FJ2A 2ES4A 2Y2UA 1UZAA 3UUEA 3P2MA 5ALYA 1R9NA 4ZGBA 3LLCA 3V1KA 2BKLA 3B5EA 5JAPA 3I6MA 1KU0A 3VVMA 5FOQA 2ZSHA 4X97A 5ALSA 3W04A 5AKIA 4B0OA 3R0VA 1FFBA 2O7RA 1XZDA 2E3JA 5LYYA 2OGTA 4IO0A 1XZHA 4F0JA 2DQYA 3F8SA 3OPMA 1CV2A 1F0PA 2C0PA 3LCRA 3QYJA 4OCZA 5ALFA 3MUOA 1JT2A 5ALGA 3GBSA 5ISMA 3A2MA 3QM1A 3YASA 1G4HA 2ECFA 2OAGA 3FLAA 3ZLVA 1EVEA 3FAKA 1SC9A 4RPCA 3W05A 1MNQA 4H0CA 5DYWA 4LYEA 3F98A 1XZAA 3VXKA 4I19A 4Y2PA 4LHEA 4AO7A 3F97A 3OTQA 3CCCA 5AOBA 1NX9A 3IIIA 4X93A 1XKLA 4B84A 5CTAA 1E89A 5AK6A 4H7EA 1P0MA 1CUWA 2XDWA 2JF0A 5T4BA 3BDIA 5SYNA 1FFEA 4H7IA 4OPMA 3QH4A 4UHDA 3VJKA 3PDCA 1ZI9A 3C5WP 3D4LA 4ZXFA 3I2FA 1DX4A 4OU5A 1WCYA 2QUBA 3OURA 1QZ3A 3FYUA 1BS9A 4G8CA 2D5LA 2I78A 1R1DA 5AH0A 1LZKA 2WIGA 4B9EA 1ZI6A 1ZGBA 1QIEA 1EINA 2XUKA 4UFPA 2YYSA 1F0NA 1GPKA 2DHEA 3GFFA 1W76A 4DNQA 1N5MA 5EI5A 5DYYA 5JIBA 4F5ZA 3FSGA 1P0QA 2CBGA 3C6BA 3HEAA 3R3WA 1QIMA 1WM1A 3G9UA 4FBLA 1E8NA 3ZPXA 2C5FA 1UKBA 3H2HA 2HU7A 2Z5GA 4UUQA 5HQ3B 2WLSA 3C8DA 1CUDA 1UKCA 4Q34A 2Y6VA 4BTLA 3DYIA 4HAIA 2QS9A 3TEJA 1AMNA 4EHBA 1ZI8A 4UHBA 1F8UA 4WY5A 4M0FA 5A7HA 3WL8A 4V2IA 1F6WA 5EHZA 5A7FA 3A2LA 5LP1A 4INZA 5AIAA 5AKKA 2I3DA 1IMJA 3KD2A 4BZZA 3WK6A 4DTCA 1SFRA 3WZLA 3BJRA 1YA4A 4OSEA 3VISA 2XMGA 2ZJFA 1UOOA 4CFSA 1CUYA 1K5PA 2Z8XA 1ACJA 4CI9A 5D3KA 4OYYA 3WK4A 1XRNA 2WIJA 3O9VA 1AUOA 1R4ZA 5AHXA 1YB7A 2RHWA 3KWJA 3KWFA 4M0EA 5AM5A 4XX1A 3CCBA 3I6ZA 4E46A 1ORVA 5HKAA 2H9YA 5ALQA 3DDUA 1CEXA 4K6HA 1X2EA 1LNSA 4QDZA 5DJ5A 3L1IA 4K6KA 5ALTA 4UBIA 2AXEA 4U2CA 4W1PA 4BVJA 4Y2VA 1XRMA 2R11A 1SCKA 5AK5A 3D0KA 3I2GA 5LZ8A 4QZVA 1XZMA 4G9GA 3R3VA 4X3CA 2XUOA 1ETHA 4FBMA 4AN0A 5JAOA 3FLBA 5H3HA 2HFKA 5DYTA 4WFJA 5FDFA 4XVCA 1ZD4A 2XQKA 1IVYA 3HXKA 1GXSA 4EY8A 4DMKA 5JYCA 3G9TA 3V48A 5JD4A 3M3DA 4C01A 3QPCA 2DQZA 2XUQA 5AI0A 1L7RA 1W1IA 2DHCA 3SWWA 2ZYSA 3S8YA 3D2BA 3SX4A 2BFNA 3JYHA 2XI4A 4DIUA 3VDXA 2Z3WA 5FPQA 1AGYA 5YASA 1YR2A 1DT5A 3QBJA 4G8DA 2HA5A 3IUMA 1LPNA 5JANA 1BU8A 2VJCA 1ODCA 1WHTA 5DLPA 5C8XA 4FOLA 4NVRA 4GXNA 1X70A 3G0IA 5ALDA 1JMYA 4BRSA 1TRHA 4CCYB 4UBKA 4AZ0A 4NZZA 4B85A 1EHYA 4ARBA 1VXOA 1MPXA 4G9EA 5AKZA 1DQYA 2QKYA 4I3FA 1EDEA 4EY7A 3L1HA 2ACEA 1CUUA 4TPKA 2JIDA 3H2JA 2G5TA 3HI4A 3C70A 4H7KA 3H19A 3NGMA 4MJ3A 1JJFA 3EQ7A 2VSQA 3LS2A 5JZSA 3D2AA 1UWCA 1DWOA 5FPPA 1PJAA 4J3JA 4GI1A 1MAAA 1K4YA 2WG2A 1HLGA 1GQRA 5AM2A 3F9CA 2PSJA 5JARA 4QDUA 5CT6A 1SOMA 3FYTA 5FV4A 1L7QA 3LIIA 5ALWA 2BCEA 4FMPA 2ORYA 2VT7A 1JJBA 2FJPA 1G5FA 1CIJA 5ALNA 5KBYA 2RGUA 2QTBA 3C6YA 4GW3A 2HDWA 2XMZA 5JZ9A 1AURA 1ZOIA 3OC0A 1WB5A 5T4FA 5HF6A 2J4FA 3ANSA 4TGLA 4X6YA 4CG3A 5AM4A 5JASA 4B6GA 5CXUA 3WKAA 2V96A 3EF3A 5CH8A 4EY5A 3BIXA 7YASA 2V98A 1ZD2P 1CQZA 5EIEA 2OLEA 2YH2A
chains in the Genus database with same CATH superfamily
3EWSA 1ILWA 4WBXC 1LH0A 3C1TA 3B1YA 2G8NA 1UK8A 4BATA 3IL2A 1P9WA 1SCBA 3C3PA 4A6PA 6PFKA 2PEZA 5T7BA 3S3TA 2VHEA 3X1JA 3KKZA 5DEOA 2XITA 1KFEB 4GOMD 3R5KA 1Q1QA 2CDCA 2FUCA 1KGDA 4HGPA 1T9GR 4FCVA 1CZLA 3EDMA 4RJKA 1ADYA 2P2LA 2GUWA 1WXQA 2DPHA 3WADA 1WVIA 3BSWA 3QXJA 5ICCA 2AVDA 3PUWA 4JLJA 4TMYA 2F3PA 3OZSA 4KMSA 3OEEA 2JRLA 1KERA 1NN5A 2X9QA 3H5NA 3W5JA 3ZCPA 4MICA 4DKJA 2WP0A 3AIIA 3OZGA 3GJ4A 2YMMA 1TCAA 1EFPA 1Z45A 2JGNA 3A6GA 5IZCA 1T4MA 13PKA 2FF5A 1IPFA 3AF1A 3AHIA 3QFHA 1RLJA 4DM3A 5IBPA 1JMKC 2RH8A 1MJHA 3DV2A 4CQMB 4AMBA 4BVBA 4LC1A 3LU1A 1E6EA 1OA0A 4QNMA 1NAHA 2XMCA 4CCYA 1E62A 1XU9A 1JHDA 3BK7A 3IERA 4WVFA 3W34A 5L4NA 2C7QA 1GL3A 4WI1A 4C7BA 2ZPAA 3RYCB 3SDBA 3DM9B 3QG5A 2JPDA 1KMNA 1RKQA 1V9CA 1YGPA 2L82A 3TNYA 4EI2A 1TFRA 1QO9A 2B30A 4JB2A 2QVBA 4GPAA 3CPJB 3QWAA 1TZ2A 3HU1A 3L7KA 4C76A 1FMJA 1FSGA 2O20A 2TYSB 2Z43A 3DE0X 4LFAB 2AN1A 5TQ2B 4O4LA 4OLJA 5TPWB 4C87A 3AJRA 3U56A 1K4MA 1PT5A 2V7TA 4UM8B 3ENQA 1O03A 3DMPA 3I39X 2B2CA 1ISRA 1GTL1 4HB4A 4N18A 4QT4A 4UOEA 2GD1O 2P4QA 1PDWA 1KEPA 2WJVA 5C37A 3I8SA 4XDZA 1K7FB 3VBEA 3A32A 1Q2UA 4KLCA 5EUQB 5CDTA 1FUUA 5CH5A 3G2HA 2FWAA 4FDMA 3QITA 4JDUA 4S3MA 5IN5A 2OXTA 2I4IA 5E9JA 3B7GA 3DEYX 4MS4A 4JIMA 1ISPA 4M6WB 1RPNA 1KOGA 2JLQA 5AJHA 4FFPA 4QEZA 2GT1A 2VTDA 2W22A 4DTIA 1OBVA 1RVDA 4ZDJA 1RI1A 5G0SA 1IZ7A 3T7JA 2DBQA 2PZBA 4MVYA 3QU4A 4KPUA 1ZBDA 1IZZA 3FCYA 3RAJA 1R74A 4BFTA 4MWDA 1J49A 1HMYA 2XADA 3NWJA 1D7AA 1E2IA 2OESA 3QKSB 5EJGA 2VF7A 5DW3A 1W96A 1YTLA 3AG6A 3HY6A 1LV7A 1MABB 3MNFA 5TVGA 4BV2A 2O2SA 2QLBA 2PFGA 5KSZA 4BQSA 1U7OA 2CE2X 3C3CA 1RZRD 3DZKA 1CR4A 1VMIA 2NZJA 4IFEA 2ZWVA 4OQMA 3PFBA 2GPTA 3ESYA 1I1NA 1UDRA 1S2IA 2GERA 4BAZA 4EH1A 1K88A 3E7DA 2AKYA 1DO8A 1DAKA 1VCMA 3DFZA 4WMLA 4AS2A 1L7NA 4JI5B 3O6VA 4JNKA 5AOAA 1BH6A 5CDGA 4GDFA 4MJLA 5J63A 2C94A 1SCUA 1D0IA 3H11B 1I3OA 4X7MA 2BGJA 4TTSA 4TS1A 4MYDA 3T3IA 4QODA 1DZIA 4RVUA 3TTXA 4DLKA 1C4OA 3EY4A 1V9SA 4F21A 1WMEA 3PCRB 2I6FA 1WX1A 1BSVA 2H31A 2XWPA 2QIOA 3NTUA 4NNPA 1WHSA 3G2LA 3HZOA 1WNTA 4OQYA 3EEBA 1MCZA 3I73A 4RSMA 2Z09A 4ZP1A 4KPEC 1U90A 2HHHB 3RTBA 3OZAA 4KK3A 1UBEA 4GUAA 3D8HA 3CPHA 3EXG2 1JTFA 1M6YA 3FNEA 1UC5B 3E4CA 3OD5A 3SQDA 1NI4B 4O3MA 1SZDA 1EUYA 1NN3A 5HX7A 4Y6PA 1B0ZA 3COZA 1WZCA 5KTTA 2IX9A 3B12A 3TINA 4CKZA 2F3TA 3WLJA 1NYLA 1NJSA 1XZJA 4XGRA 3RE1A 4H4EA 4EPVA 3DF9A 4JIGA 4IDAA 1H8EA 4DMUB 4JEIA 2I4LA 4WKPA 3ED1A 3EEIA 4RK1A 2CFSA 1IUNA 3QFRA 4LDPA 5ES3A 4JT4A 5HFAA 1DJOA 2WJJA 4PSCA 3LLUA 1TUEA 4HYQA 3EY9A 2PCLA 3V42A 1PGOA 4D57A 2AUNA 4AI6A 4M55A 3HRKA 5C1IA 4G37A 5IF9A 3MTJA 1EK1A 2ZZNA 3MN1A 3DKRA 4A8TA 4RDXA 1J25A 3QELB 4OQNA 1VLMA 1JLLA 2W37A 2HEGA 1HDIA 2C1XA 4KXMA 4NICA 3SHWA 5DFAA 3IQGX 4OQ4A 4MO2A 3WOHA 4DB4A 1XEXB 1DS6A 2FUG1 2YVLA 1YBHA 2AG8A 3OUTA 4Z2AA 2BBTA 4M1KA 1SK8A 1GNQA 1BDHA 4MVJH 3T99A 5HKBA 1MV5A 4NENB 4DABA 4R3NA 2PJRA 3PWTA 4MDFA 5I9BA 4CKWB 5KJFA 3PFKA 2J0QA 4XJVA 3DLAA 2VJMA 3P2OA 4Q1VA 4R8RA 1NNUA 4UVDA 5T3YA 1MEEA 5DHAA 1S8NA 3VR1A 4JFRA 4NBNA 2O5EA 3KUDA 3ZXUB 3HJAA 3LY8A 4MLDA 1T2CA 3E1GA 3V4LA 1U28C 4CEJA 5LXTF 3VTKA 1SULA 3LWBA 5ECWA 4YRFA 4EVIA 3E23A 3THRA 3L84A 3LT1A 1OASA 3PLNA 3JZDA 4MRAA 3TH5A 5CB4B 3CO0S 4JEUA 4L4YA 4N12A 1Q0PA 1WPGA 2JBWA 3UMYA 4F5YA 1XAIA 4TVSA 4YUWA 2C4NA 3L8CA 3IJPA 4QUGA 3DKKA 1T8SA 4LY9A 3DM5A 2WVAA 2RJOA 1JR4A 3SBOA 1AQIA 2OV6A 3TQHA 3WBFA 1PRYA 4LYGA 3VH2A 1TZJA 4IH1A 4OQEA 4KXXA 3R0ZA 4QBKA 5EWLB 3ZHZA 4G1CA 2I87A 2J6CA 4EAQA 2PKRA 4JLNA 3FYUC 1XMSA 5EWMA 4F11A 4Q93A 2IUEA 4M0PA 4OIMA 1TKCA 4UFOA 1DEOA 1ZRHA 1B1AA 4TKVB 1EXNA 1P9RA 3KAQA 4UQOA 4K7JA 3PYXA 1Y8CA 1QIDA 1Y1SA 4JX8A 2V1XA 3M8KA 3TD2A 1K6XA 5LOVF 2EHJA 5HBRA 4Y6RA 1XNRB 1D2GA 1CB0A 3D6MA 2PSDA 4NK5A 2VOEA 2VXOA 5EHXA 3AFNA 1T9CA 2X0JA 4KNVA 3F5MA 4Z4HA 3K53A 3OPQA 4IXNA 1CHNA 2KS6A 2RK3A 3RUFA 1E2HA 2LDBA 5TARA 1NVBA 3V1YA 5JMTA 1OIXA 2F4NA 3REQB 3VHLB 3NIFB 3GNSA 5AMXA 4WCDA 1MFZA 3MCWA 4D98A 1HSOA 3KDAA 4ZCMA 3GCXA 3X1ZA 3IIEA 3NOQA 3NIWA 2GM4A 1WZNA 2HHCA 1PFWA 4JT9A 4LJAA 5C8VA 4X61A 3MTIA 3TM4A 4F6CA 3ZZ0A 4JB0A 3RW9A 1JVBA 1OJLA 3KLMX 3TW4A 1RLTA 2QVLA 2BM0A 3G0GA 3IUEA 4O2AB 1YASA 3RS5A 1WSAA 4DWOA 1KI8A 4GOND 3KJEA 3FFWA 5JPIA 5CNMA 2QBYB 1XQXA 4RJLA 4TWJA 2J6HA 1F7VA 1EEHA 4J16A 4LHWA 1E7RA 1HKUA 1Y48E 3MMZA 3L0OA 4KFUA 2NV2B 4B75A 5CDHA 1DEXA 3VJRA 1LI4A 2QL9A 3RAEC 4TN5A 4EDFA 2QI9C 2XYVA 4KP7A 5TPZA 2B36A 5DGDA 4DVGA 4E1BA 3BOSA 1QJCA 1HQKA 3QLUC 1U1GA 4J9UE 2C84A 4JLMA 4PZLA 1MXHA 1CX9B 2INGX 3NM4A 1DINA 3CVYA 5IKXA 2FN8A 4OSOA 1RWQA 1OU4A 1QCDA 3H9QA 3N05A 4ENTA 3LCVB 2FQWA 3CF6R 4LYDA 1RKXA 3CINA 4LYJA 1Y1QA 5JY6A 1HY3A 2OG1A 3UMBA 1U2RA 5A6SA 3I58A 4UXJA 1XO1A 4C7JA 1XKXA 2AOXA 4LNUB 2BMWA 2VBCA 5JFTA 1I80A 3MMNA 3TR0A 2EXXA 4BMVA 3CSUA 5GPBA 3RRBA 1QIGA 3DMYA 3FPKA 1JJ7A 4EI8A 1K7SN 1VZ3A 5FPSA 4ZD6A 2WDZA 4IJQA 1T1SA 2GXQA 2OPHA 4RTLA 2BSQA 4BC0A 2HEIA 5E1DA 2HA4A 2F1OA 1FSFA 2FPPA 2TMYA 3GO4A 3LDGA 2B8TA 3BD6A 3MZ0A 4MWCA 1DJLA 2ODWA 2ZQZA 4IJ6A 2BHRA 3AY6A 1J7JA 3OMWA 3FVRA 4EFDA 4FW8A 4CFZA 4UNPA 3D6AA 1Y6GA 4Q05A 1QPZA 3M2PA 2ZJYA 1ZSYA 3DE6X 3ZHQA 4BUCA 1RPZA 1YV9A 3GDOA 3H5OA 3OEHD 2H1WA 3KUKA 2D3TA 4MV9A 1ND6A 1SA0B 3VR3D 3BKXA 1ID8A 4JBXA 1J24A 1K0UA 2OXEA 3D3QA 1Y5MA 3K0AA 4FNMA 4IAOA 2NU8B 4B83A 4C6TA 4KZPA 1PCXA 1PJTA 4K9SA 5T6MA 4P4GA 4O2BB 4F71A 2R6FA 2B0CA 1N0IA 5CK5A 4W9NC 3PPVA 3ABRB 1HOTA 2GRJA 3NC1C 3OFND 3AUKA 2HIHA 5FTNA 3O4GA 4O4JF 1AV6A 5F1KA 2XJ4A 1FL9A 2KB0A 2OLKA 5KNCH 1UPFA 1UK9A 3IESA 4OKIA 3W9BA 4ZIRB 2J85A 3I8XA 5ETJA 2EF0A 4R9SA 4LF7B 1OYWA 4DYDA 2LUOA 4IDPA 2OENG 1W4ZA 2I66A 3UQZA 3IBTA 1RXWA 4X7BA 1C9NA 5GZ1A 3VPDA 2PSHA 2CL6X 2JDIA 2C82A 3CY6A 1FFAA 1YFLA 4JJEA 1RRVA 2C04A 4MW0A 2VAVA 1E3EA 4M0DA 1LZLA 2JFWA 4OGWA 1QAQA 1HO3A 3VGPA 4Y3UA 3RS7A 4WESB 1N2OA 2DCUA 5H8WA 1IAQA 1R9JA 1CDDA 3DL2A 2QUAA 1FCJA 2HSDA 1U2GC 1UPCA 1O2DA 2FK8A 4HBGA 3CWQA 3TE7A 5EZYA 4F1JA 5HJEA 2XNSA 2BMJA 5CFQA 2TSYB 5DLYA 1TM4E 2J30A 3ZWCA 3OT1A 1Y7LA 5KOYA 1M8JA 2Y4NA 3LDUA 4L9RA 4R9UC 5KYUA 1FW8A 4G5XA 3O7MA 1ENYA 2P65A 5BNFA 2R7KA 5J4KA 1CF9A 4DYHA 4AKEA 4K88A 1ZD9A 3EYWA 3PBKA 4O29A 1U2ZA 4NJEB 3L0CA 4R2KA 4FFWA 4I3HA 3SOZA 1CJTC 5AKYA 4TV8A 1PL6A 1LWOA 1KPHA 3FW1A 1P9LA 4BNUA 3WSTA 5B57C 4KE9A 2CSXA 4AKHA 4CV2A 3BRCA 4Q18A 1GEGA 2Z1DA 3A9WA 2IYUA 3GHYA 5A5EA 5LOVA 5FB3A 5JO9A 1M6HA 4L0DA 1VPLA 4YRLA 2OP1A 2G72A 5T6BA 2HXYA 3PV0A 3INNA 1KAEA 4AZWA 4OP1A 4X1KB 2R7LA 3SAJA 2B1QA 3FJYA 1GZHB 4BO7A 4MR9A 3TRDA 4Y0AA 3H8VA 1M54A 1JSZA 2OGWA 3UFXA 2Y9MB 2M9MA 4KTTE 3B36A 3NFYA 4GL2A 4OHCA 3T3EA 4X20B 1L4LA 3K92A 5HEKA 1EG7A 1WU7A 3P0EA 1NVVQ 3CZAA 1U7WA 3KJZA 3M5PA 5FI0B 2LDXA 1Y1PA 2LRHA 3GT4A 4XW2A 4D2IA 3E1KA 3RNOA 3U7JA 3SFTA 4U1RA 1RJDA 2ZCUA 1ZIXA 2AOUA 3BWVA 3EUAA 4GE0A 4LYYA 4N7JA 4PWYA 3EOBI 3C45A 4I99A 2GPNA 1Z35A 3NWOA 2HSJA 4WBSA 4GMKA 4U0JA 4M46A 2VHXA 1ZH8A 5E2IA 3WIVA 5F4ZA 1RYYA 2PO5A 4FSXA 1W6UA 3QTLA 4OUDB 3CX6A 4A91A 3ZHVA 5BQXA 5JV5A 3ZE2B 4HNAA 1G20A 1SG9A 4I4IA 3PDWA 1DCFA 1Z16A 2B69A 3OF3A 4PHGA 2KPOA 2W4MA 4XSVA 3T9BA 4DIOA 1AT1A 1H2BA 4DY6A 5B7PA 3AGQA 4XARA 2PKWA 4R5MA 4TN1A 5K0NA 2X3UA 5BYBA 3BZWA 2ZOSA 4AP6A 4PQFA 5J5AA 1B6GA 2PX5A 2ZSEA 3JALB 1QH8B 4O5AA 1B76A 2H1VA 4HADA 1A9OA 4GMDA 5LL6P 3ICWA 3PR3A 2X6QA 4HP8A 1YUBA 2PWZA 2QAJA 1STOA 3ML1A 1A4XA 1Z8FA 4PM4A 2CY0A 4IMJB 1NPDA 1P80A 3KJNA 1WCWA 4PPFA 2K7ZA 3IOCA 2HMTA 1EP1B 4NU5A 5LFAA 3QXXA 4OQPA 3FCUB 2O2HA 4BDTA 3ZZUA 5A9TA 1KL7A 1I5OA 1XN1A 1YIDA 3FGOA 4LCEA 5IKOA 3T1VA 4DC9A 1GAWA 3JSXA 3M4JA 4CIVA 5AVTA 3DW1X 5AVQA 3IKVA 2Z1NA 3WNCA 1TEXA 3G5TA 1DHTA 2WV9A 3I37X 1VSVA 2VDRB 3H9CA 4TMZA 2AX3A 3BF8A 4UTXA 3TSWA 2HCTA 5IYZA 1EFAA 3W06A 4BU1A 2C5LA 1JDBB 4L4UA 1RM4A 3ON5A 4V0LA 2Y0CA 3N2EA 2AJ8A 1AF4A 3MS2A 2MSLA 5CNJA 2I6XA 1B43A 3A1WA 4CM5A 2PX4A 5I47A 1U9YA 4ALJA 2JAXA 1K92A 3GRKA 1LBHA 3L6RA 3MBKA 1YRHA 2J5XA 1YMVA 2VCYA 4WL0A 2UZ1B 1KAGA 5E0KB 1A69A 2WWWA 3CX7A 1JAIA 4KDRA 4I1SA 5EP1A 4H3VA 4XJXA 5H3CA 2AK3A 2TECE 5HMLA 5IMBA 4X3OA 2DULA 5J2TB 1W2HA 2IP4A 3BD8A 3E3AA 3ZKWB 4XWYA 1CUGA 5JVDB 4AJPA 4D5GA 4KO3S 4PSDA 4CLOA 4FDVA 5ABPA 2IWHA 1DBRA 2PS0A 2CYCA 4DNFA 4YRKA 4QBHA 5JWOA 4DGSA 2OCIA 3C3DA 4DL9A 1QHIA 5BWCA 1PUJA 2VZ8A 3SNHA 5A4KA 1RZ3A 1J8FA 4L4SA 3ZE8A 2JK0A 5B4TA 1GPMA 1U6KA 1BHQ1 3CVVA 1IJKA 4DCMA 5A4JA 5EZ6B 5FXMA 5KWEA 3ROKA 3M6VA 4F9TA 3OLWA 3HMQA 3PGVA 1W4AA 4HRXA 3CKLA 2OO5C 1RXSA 4I4TF 4RGQA 3ZWDA 1MVNA 3BIOA 5FH9A 5A3SA 3M4ZA 2FFQA 3MUFA 5FUBA 4DIKA 1VB5A 5DHSA 2DFTA 4B43A 2EFHB 3RVSA 3ZBQA 4CM4B 4G1MB 3C5CA 2OK8A 4NHEA 3P32A 2V8BA 3JQCA 1DTSA 1T29A 1ZMBA 5CM8B 3DDWA 2XH8A 1ZUHA 3S28A 4S0XA 4JBHA 3STVA 4HNSA 4IOLA 1YC5A 4TLDA 1W1WA 3I72A 4KDEA 3BCSA 2YHAA 3QMVA 3WYGA 4YJ2A 1TYCA 4G5HA 4R1UA 1T9HA 3VPAA 4BMCA 2XE7A 3I76A 1E3SA 1ZRMA 2CDNA 2OO7A 4QU5A 3P4YA 4FK8A 3GVIA 2HDOA 4MQUA 3BILA 4NMMA 3H0KA 1Q91A 3OQJA 4Q9DA 4Y2TA 4LCJA 2YJ6A 3BEOA 3VOSA 2VVTA 4PXSA 4BMDA 5BO5A 3ANYB 2R25B 4TV9A 4QT0A 1Q0RA 1WY5A 4M98A 3S2SA 1KFJB 5L53A 4CYMA 2XECA 3GFTA 2G77B 2J7PA 3QF7A 2H51A 2X8AA 5EJ6A 3UOGA 2HJWA 2W0SA 2JH9A 9ABPA 1X87A 3F6SA 4FHZA 1WV1A 1ZL0A 2GJAA 3PHGA 4KAXA 3DG9A 2V6FA 4NCJA 2GXSA 4D9JA 2FPXA 4KN9S 1FF9A 4B76A 2NVOA 1SOUA 3CUUA 4QYSA 3HVJA 4EZBA 4R4JA 3H3FA 1KMQA 1KVSA 2VG8A 2BFEB 4DR3B 1WBJB 3NEYA 3OTWA 3IBYA 3BMNB 1TJ5A 3BMXA 3IILA 2XUHA 4LHXA 4D9MA 3C98A 4NMLA 4CPDA 1QU2A 4NC9A 1EG2A 4YT8A 2G3YA 1CQJB 3EZGA 4FLMA 4PV7A 3HCAA 3W6PA 1HDZA 4MHOA 4C7XA 4N49A 4WCFC 2FOIA 2A33A 1IZ9A 1ZUD1 4RXMA 5D01A 4FBGA 3GUUA 1UR5A 1A7AA 1FLDA 3MD0A 5E4TA 2P1ZA 4LOIA 4MYRA 3WZMA 4M2LA 3ZJVA 1Z4QA 2MCFA 1Z0SA 2NO0A 5JRZA 1OWPA 2I3ZA 2YWRA 3MS7A 4TKMA 1P4SA 3N07A 3TTWA 3GUHA 1NVTA 1V2HE 4OD0A 3TBHA 3USES 4BFSA 2CNWA 3T3GA 4ER6A 2CDRA 3EIQA 3JQ8B 5IVIA 3TZCA 1DU4A 1QDUA 3L8GA 3VR6H 3VU3A 2C4WA 4U3JB 2ZJZA 3O9MA 5AW6A 3FPBA 1USUA 1G4AE 3AWIA 3QGMA 4HQLA 4WK4B 1BVUA 1I24A 1DCTA 2QMQA 1PIWA 3AF3A 1E1DA 1OSNA 1E9EA 2WMYA 1RHKA 2AI1A 3HCFA 4OL9A 5BWNA 1TKBA 5AVYA 1I5RA 4JI3B 1VSUA 4X62B 2GH1A 1HG0A 3O3OB 1XCBA 1Z7EA 2EBWA 3JCZA 3S2UA 4L57A 4F2DA 3DO8A 3GA5A 4JP2A 5DXAA 4AQYB 4BNMA 1KXZA 3GXOA 4J07A 1BC5A 1MO6A 3EGXA 3TAXA 2AJCA 1T5IA 3VZRA 5D00A 4H0NA 2X9VA 1ZNWA 2VWHA 4RF4A 5LQNA 2XCTB 4UTRA 3FTQA 1LPPA 5DHRA 3VHXA 5IDXA 1DAPA 2FZ4A 4QA9A 1OWLA 3KV3O 3NI2A 3CIFA 4IGIA 4A36A 1MAVA 4RQUA 1L8QA 4LVCA 4P0PB 2YICA 2MSKA 1SBQA 2ON6A 5ESRA 4HYEA 1DAGA 1TK2A 2F9MA 3BGWA 4WVLA 1SUDA 2H2IA 2O05A 3C4VA 3JXEA 1CUFA 2A7XA 4ZQBA 1A2QA 3CRNA 3I5XA 1F8FA 2WIAA 1EDDA 3CJQA 4JA0A 3ESXA 3HWSA 3P19A 4D9HA 2KYRA 3LCCA 1OROA 5EXTA 4PF1A 2WJ4A 1UPTA 5TT0A 3L8FA 1YZNA 1QUEA 2UUPA 3LWZA 3ZDAA 1KYTA 3UPTA 4R1PA 1JXQA 2CJWB 3IR7A 4TTTS 2G17A 4X41A 3SICE 3NHLA 1A96A 4FYIA 4OV6B 1QMPA 2W6CX 4RIIA 4DSAA 4BZPA 1DFGA 3FWYA 5B6JA 3DMRA 1X7XA 3S2IA 3F7TA 1I2DA 1PGQA 4GM4A 4FSDA 1N5DA 2ZRAA 3F9RA 3R5TA 4R9VA 4UBOA 2ZJAA 5AVKA 4BWYA 2G4CA 4E88A 5JDCA 5KKAA 2ORED 1KEWA 1CR6A 1P1RA 2O2IA 3LNTA 4NU0A 4YASA 5AQ1A 3FOZA 2J5BA 1FNCA 1ORIA 3GFVA 1QX3A 1Z8HA 2W6MA 3JYQA 4GSKA 3TOCA 3AVPA 3OWXA 4WXPA 2J3HA 1LK7A 3VV2A 3WLIA 3H5RA 5JFGA 1UMCA 4TL6A 3HABA 1S8AA 3I2YX 4EB0A 4NMWA 1NONA 2HHLA 2I29A 2W2MA 1EBUA 4DGQA 1T0BA 1YRWA 2NUTB 4LCBA 4F2HA 1XJWA 3S2YA 3VPFA 5A4AA 4DUYB 2C9MA 2WU0A 3AVWA 1NM5C 3QPBA 2VLIA 4QD3A 3VJMA 3UJHA 3PNPA 2I6SA 3WGTA 4M7PA 2XBLA 1SOWA 1QYVA 4D26A 4Y6QA 4H6XA 4CF7A 3I4LA 4KE6A 3AXTA 3RHTA 2WAXA 4CDMA 1EP9A 3SX2A 2IDMA 1BCRB 3HLKA 1DWPA 3LY5A 2AD1A 4C88A 3H42B 4KXFB 3OT4A 4QFCA 3SN6A 3IRVA 4JLAA 3RB8A 4ES6A 1Y8QB 2VEOA 2W00A 2ZRCA 3W7AA 2OQ2A 1AG9A 2WHPA 3FZQA 3CUSA 4PLPA 4RHCA 2CD9A 5ES4B 3DEAA 4RPJA 2HD4A 5EAIA 2FPRA 2VA9A 2WKSA 4G1UC 3LFUA 2ADMA 3F5FA 1JDNA 3Q3JB 4J0DA 3T7AA 2JS7A 1E5DA 3DCIA 4DC0A 1KPIA 3L1JA 3M1AA 2JGRA 4BQNA 2IC5A 1SMKA 5FR2A 1GPWB 5I4BA 4N5HX 2DHDA 3UHFA 1V95A 2M6RA 5LZ7A 1ODSA 1EP3B 2UYOA 3HP7A 2JIMA 3OCUA 1U4NA 4H4DA 4HDQB 3CN7A 2YVAA 3O1LA 4LKRA 3V1TC 1DC8A 4A10A 3WA7A 2A58A 2IYLD 2ANBA 2HSWA 1PJBA 2FZGA 3DTVB 3HB1A 3LYHA 4OA8A 1NZFA 4U7HA 3ZX4A 1C4XA 2QYOA 3EPHA 3ZWQA 4B7AA 2HU8A 4WCVA 2IPLA 1TT5B 1MP0A 3TQSA 4YAUA 1AB6A 4LJ9A 2VPZA 3M3PA 4MW6A 2D5IA 3TLCA 3TQCA 1OH7A 3R9WA 4XM1A 4WXHA 3EXFB 4CMKA 5BP7A 3U31A 2QTVB 3QEMA 3SLGA 3ICEA 1U9IC 1XP8A 3GRYA 3AFIA 3PG5A 4QELA 1AKRA 2XCLA 1R0ZA 3O7WA 5AM0A 4KYIB 1FTSA 2GZAA 4YV7A 2IS2A 3EOZA 1XRLA 2I4NA 4OK6A 4K1LA 4U9HS 2I4MA 1HEIA 1T9BA 1CETA 1SHTX 5JCJA 1C1YA 2WZBA 5KSWB 3H1FA 1R5NA 1VRCA 2DKOA 5IUNC 5JS1A 4HQOA 1SXHA 1ISIA 1R5OA 1WQ1R 2WNSA 3IVAA 1ICIA 2DFVA 1SKYB 1JILA 3KZOA 4N0QA 4R3UC 3D3NA 3C48A 3KPUA 3RTAA 1E6KA 2CF5A 2ZYUX 2AI3A 1M2VB 2BJVA 4UHFA 5DBEX 4PGGA 4PAMA 2Q28A 4EKIA 2Z3VA 3RJ9A 3NT4A 3PHCA 1KFBB 3BUSA 2FR8C 2C92A 4WQMA 4WW0A 1DG3A 2FFBA 4EX6A 5B7QA 2Y76A 3K1AA 5HFNA 4MR7A 4YAOA 4Z9FA 4DQ0A 1TIBA 3HEMA 4JB3A 1QBKC 4QX6A 4QRDA 2D5CA 2DBZA 3NW9A 4ZOLA 4ZEXA 1OWNA 3GB9A 4LX8A 1P9OA 3ANMA 5HKLA 3VKVA 4CIYA 1LS6A 3RSCA 1OXMA 3JQBC 1W94A 3R76A 3ZQ4A 4MTLA 5JSHA 3GX1A 1JIVA 4Q9HA 1U04A 2YNMD 2QGZA 1E9RA 3H18A 3KKEA 1NBOA 2E2WA 2HA3A 4DLBA 2VPYA 1U7TA 2M6LA 3W5VA 3O8QB 2VRNA 4CQJA 4N3BA 3COPA 4R2LA 1DMSA 3SF8B 3D43A 3LF1A 4I5IA 4KXWA 4C6RA 4LJYA 1FS5A 1N2GA 1W5FA 2R00A 3PWZA 4GD3Q 2XB2A 5IAGA 1YJBA 2DJIA 3MYRA 3U7QA 5HHTA 1QXSA 3C74A 1ZMXA 2H3HA 2RGEA 4CKBA 1NVAA 1ZYUA 1J0XO 2Z30A 4KH0A 4NHOA 3RAPR 4B4WA 5TS3A 4A23A 3INTA 3RJMA 2H5JA 4R71A 3V8NA 5J43A 3DWGA 4MVJE 4DV7B 5H3LA 2C7OA 2VSFA 2BE7A 1GAJA 3E48A 2HJRA 3MMXA 2JIQA 3P52A 3I05A 4OJMX 2D0DA 1WOMA 3VH3A 2GZ3A 3RRMA 2HDNB 3BDAA 4BTVA 3WAGA 5I5GA 2JVKA 4P7FA 5CPBA 2ZRJA 1MBZA 5A03A 2J9FA 1TL7C 1XIVA 2HSEA 4DDTA 4A1OA 3MJEA 5HGJA 1JFRA 2F62A 2ALJA 5KCZA 4KTVE 2BTOA 1T36B 3S55A 5JY1A 3PE3A 1YVRA 4G5FA 2H1FA 4KGZA 4OJNA 4L8VA 3MAAC 3T9FA 1G41A 3UB4A 1OIVA 1D6MA 2BI8A 2QAIA 2W8BB 1FFHA 4RKEA 4Z49A 3PHHA 2WWHA 4FQ7A 4TMWA 2P69A 1E4OA 1Z4IA 3LQ1A 4ANFA 4D9NA 1CQXA 3C43A 2O8EA 2P9HA 3ISJA 5I5EA 1Z17A 4UUAA 4XVQA 2BMEA 3GXBA 2Q3LA 1R10A 5LLTA 3GLIB 3V4VB 2Z4RA 2XEDA 4URFA 5C8ZA 5D5HA 2PSFA 3VOAA 1DJPA 4DPMA 3O03A 3VO9A 3IBSA 5CXQA 4G0NA 2Q3BA 3QX3A 5FR1A 2BT4A 3KKLA 1ZUNA 2ZRLA 4NL4H 1OT3A 3T1HB 2A30A 3BCHA 2H1SA 2PZKA 1E66A 3QU7A 1FX0B 4TMFA 3VR2A 1DNPA 4AWAA 5C9ZA 2BGRA 5M3BA 1FVFA 1ORTA 2PGXA 3V3TA 4Q3OA 4OO3A 4RPKA 3AETA 4Z0HO 5KUTA 3D02A 1H2AS 3H1EA 1Y42X 2B21A 4G5YA 1HXHA 1EXVA 2GKSA 4BCDA 4GYWA 4FFMA 4RNDB 4NONA 3TZQA 2OP0A 4K6CA 1JA0A 4U7JA 2QV7A 1SGWA 2BBWA 3BULA 5BN5A 1UJCA 3WAJA 2XW6A 1CWUA 3O2JA 4LV5B 2HA7A 3FFXA 1DXOA 1YJ8A 4G5OA 1JVNA 3L9WA 5D3MA 5A0FA 3A6KA 5SYAA 2QRZA 4DLUA 1SWWA 3FOCA 4O4IB 4RKYA 3WIEA 2EZ4A 1IFXA 1QP8A 1YRYE 1YS1X 3CGGA 2BR4A 1U6IA 5KNDD 3RIMA 1NI3A 4DMHA 3I64A 4WGFA 3FG9A 3PQ5A 2ONCA 4KQCA 2QQ5A 3HL0A 4QUKA 1BW9B 1W93A 1ZINA 1L1QA 3BH7A 3OX4A 4TTPA 3WFIA 1LBQA 4S2UA 4PANA 3FKSA 1ONPA 1Q92A 1J2TA 3UWSA 5JNVA 4WOKA 3COSA 2BGNA 5K0SA 2QN9A 2QRMA 3MBIA 5ITWA 2ZI3A 1VHTA 3BBLA 3GR6A 2Z2XA 4M36A 3FR8A 1L4HA 4Z7JA 3E70C 4BS9A 3IP9A 4HG2A 4GE3A 4OI2A 2VUUA 5JC1A 3FM9A 3VQTA 4YALA 5BW8A 1H9AA 2FPOA 1RPJA 4II3A 2EFDB 4QJ4A 2FUKA 2GNAA 4E6PA 5KQPA 4ARVA 2O7NA 4RY9A 4FWBA 4R8LA 3KZCA 4WBNF 5FTWA 4X1YB 2I9KA 1SUFA 1A1SA 4INAA 5A02A 3N74A 2W4IA 3G8AA 1ANKA 3KXLA 1T2UA 4RPHA 2REQA 4F9EA 1LI7A 1V8BA 2OL4A 2VP3A 2PXAA 1P5JA 1RMYA 1YR1A 1QNFA 1G3MA 2Q46A 1WW2A 3FSRA 3PHIA 1C3VA 2A5DA 2PFSA 3MWJA 3NBAA 2IYZA 1ZITA 4EIWA 4MRSA 4AS1A 1RYHA 2MYTA 3LUBA 4YCDA 5A0TA 4NOJA 3NBZC 1SKYE 1ZXBA 3S68A 4HVAA 3K5IA 4BX3A 5A3RA 3R9IA 2FUNB 1I6MA 1TEZA 2BFMA 4C07A 5TGZA 4BMYA 3LTNC 5JNTA 1PEKE 2OQRA 1QV6A 5B6IA 2CHUA 4K8RB 1H5NA 2BN4A 4Y6SA 4Y9UA 4C08A 4A6DA 1PW5A 7ADHA 4KQ1A 5B2ZA 1XQ1A 5GONF 1VKJA 2W6JA 4NAUA 3L4JA 1HF3A 4YYEA 2EJUA 821PA 3E5MA 2X22A 3MJCA 3PC7A 2EG9A 3I9FA 4I4LA 2JJ8A 1YZTA 1HKHA 2QXTA 3VZPA 4EVSA 3IE2A 2W2TA 1HDGO 1V47A 5HGXA 1R8XA 1N7GA 5JLAA 3QEOA 2AJBA 2HQ1A 4Z9BA 4RK0A 3MJFA 1CS0B 1Z0DA 2R6R1 4Y9DA 2PSEA 3KEOA 3RIGA 1G59A 1CRZA 4YAGA 4IRUB 4F8YA 3FUXA 4OFWA 2OVFA 1I6KA 2VBFA 3ABZA 5L7TA 2XOKA 3HA2A 4RC9A 2HXGA 2RD2A 3CG0A 3KT0A 4HLQB 3T4PA 1CULC 2WUWE 3HPRA 4UMVA 4OXKA 5FFNA 3VC3A 2R1ZA 3BK2A 4RANA 10MHA 3G2KA 1PQPA 1X3SA 1WF3A 3I6QA 1P9NA 5D1NA 1IONA 2QYTA 3PRKE 1M6VB 2ID9A 4MPDA 4ZOQI 3GZJA 2WSIA 5A5VA 1KQPA 3EEYA 5D7BA 3VFDA 3P26A 4OHYA 4EMBA 2IP1A 4FYVA 2WHRA 2Q3MA 3BH6A 3KX2A 2Z2IA 4WKOA 2IXEA 1MT0A 3IBFA 4HDMA 4J0KA 5HCNA 4J1TC 2Y1GA 5TLSA 3CNQS 4WKNA 5C2JB 1LD3A 2BWJA 4K9NA 3H2KA 2AHRA 1BG6A 1FDUA 1H4TA 2PRIA 3AKYA 3GNTA 3N8GA 3RLFA 1R6AA 4WLNA 4LZZA 2HK9A 2OCDA 4RZ2A 4URZR 5AD1A 4F4UA 1BJTA 3OU7A 4OH7A 3KSBC 2IV7A 1Q16A 1PTKA 2YX1A 4NZOA 3EQ9A 3EUWA 3L1KA 2EFEB 4A8JA 5L6MB 5HW0A 1NSFA 2NV6A 2JHFA 1W59A 1E79A 1PBTA 1TD9A 2PL9A 1Q84A 4EG3A 3CUVA 3NJRA 4A0FA 2O3UA 1V5FA 2JA2A 3ICPA 2R86A 2W2VA 2JCXA 3ZDZB 3P27A 2GYVA 4QFBA 3HGTA 2DCMA 2DAPA 3BG5A 4GT1A 3A27A 3FGNA 1U0JA 1E63A 2PD3A 3OA2A 5KX5A 3G89A 4F85A 1QFMA 1G18A 1UAAA 1AK9A 1B14A 3TTSA 1ECBA 1NHGA 4GPBA 4PYOA 3U2QA 2FSVA 2VBGA 1NLMA 4CMJA 1XMVA 5K3EA 3QKRB 2G76A 3NBKA 5LM3A 4Z1MD 2NZWA 2V6IA 3UA3A 1QGOA 1TYDE 1F7UA 2XTMA 4P93A 2EKBA 4AJEA 2VJQA 5K6TA 2XOEA 3T7TA 5F73A 5KHAA 2UXDB 2V5AA 4JLUA 3NDJA 5JNLA 4IHQA 3SGLA 1IZ0A 3HJBA 5BNWA 1EH5A 3HC7A 1XRSB 3FPLA 3IO3A 5KTOA 4KWTA 5F2OA 5FI5A 3T3PB 2HQSA 4RKQA 2PZEA 4FQ8A 2HTFA 5B1SA 1KO4A 1VFPA 4PEVA 2UZ0A 3X43A 1QLWA 5IEBA 1U31A 4JLDA 4RPIA 1CEQA 5ALHA 1ZGCA 2QUIA 4ZCRA 2FZKA 1PFYA 3KEMA 3DZGA 1VHDA 3B6ZA 4OLAA 1UBSB 3QVJA 3DCJA 4KBGA 4U2FA 2BKXA 4LE1A 1M6EX 3GNQA 1ZJWA 3PUZA 3DMFA 2R6HA 4PFKA 5CFMA 1RFLA 4PRKA 1YGYA 4OGKA 3GZNA 5TV2A 3NM5A 1BVRA 2A5YB 4TXLA 1AKWA 1IYZA 5DLEA 3DBOB 5EMLA 3DF7A 3WMWA 4ZHQF 3BL5A 1EQAA 3DOOA 3HDYA 2F8LA 4RENA 4RTRA 1OB2A 5IDWA 4ZVSA 2BFDB 2OBXA 3CCFA 3TN7A 3PXDA 1WB4A 2DHQA 2QE7A 3K2EA 4OK3A 4YDHB 3UA4A 4A1FA 3PUKA 1W5TA 2ZUVA 3C3KA 1H2ZA 4BO1A 4AVYA 4Z9XA 1QOQB 2CFOA 3M0EA 2XXAA 1ZPDA 1V16A 4XPIA 1GPH1 1TMOA 4PYQA 3NXKA 1ULZA 4IVNA 2XTZA 4HATA 2E4UA 5FBHA 1VJ1A 2WF6A 1LDYA 5TDHA 3QYFA 4WBNA 3IHLA 4GZ3A 1KI9A 3MSXA 5CMLA 2X8LA 3BTOA 2RK4A 2ZK7A 1GTVA 2QLFA 3A3PA 2D7DA 2IF0A 1GT6A 3FA2A 4TQ9A 1GTMA 1D6SA 1KIAA 2EDCA 2XAUA 4MRMA 4XA8A 4JZYA 4UTVA 2CNDA 1I2CA 2GPBA 3FTEA 1V8DA 1ISFA 3BFKA 4AB1A 1GWNA 1XLTA 3B2EA 1FP4B 3WKDA 1P7CA 5HZGA 3UKJA 3QWFA 3VH1A 4BO6A 2BFCB 2A94A 2XE6A 1B8UA 3WA6A 4DIFA 5EMJA 4NP6A 1K1EA 3MJRA 1FFCA 1K7EB 1LBIA 2ZIEA 2NQ2C 3PLRA 2HYDA 4GLBA 4O63O 4PGHA 3WB2A 1KJQA 2PZGA 1QZXA 4HXYA 1GSIA 2QVYX 2XMSA 5GONA 2ODAA 4NDAA 1JE1A 3UAZA 1GPYA 1G5RA 1DLIA 1VKHA 2PVPA 5G53C 3TVYA 3T5GA 3O91A 5B64A 3FZYA 1D9XA 1UDBA 5EE9A 1Y4SA 1JFFA 2AFHE 5A04A 1QQAA 1M76A 1GNPA 3I42A 3ZE7A 3M1YA 2PRKA 4FEEA 3ZNOA 1N6IA 5FOWA 2GD6A 1N6LA 3C7KA 3RJTA 1S2GA 5LP6C 3WKCA 2P7HA 2DF8A 3RSQA 2PYZA 3TNFA 2AZTA 6AT1A 2QTMA 5PNTA 1ZAYA 3OEWA 3G1TA 4LRUA 2G06A 2IDZA 3EXHC 3EWAA 1RCUA 1M72A 4RU1A 4WZAA 4AO8A 3H86A 2F2TA 4RM2A 2IQIA 4G97A 3CTPA 1LDEA 1C8KA 1UMDA 4MINA 3CO5A 2QQEA 1EK2A 1XFAA 3STYA 1CYDA 1E5XA 5FUYA 4JGGA 2Z2KA 2RGNC 1W6RA 2GSDA 2WVJA 4QOEA 4ZN6A 2PZAA 4IJWA 1IBKB 2QRQA 2X5XA 3M6LA 3DE7X 5HF8A 3VC7A 2D8MA 1N6HA 1IY0A 3IVMA 2FPMA 4CG1A 3ZHOA 3ZGOA 5AVXA 2A84A 1FXWF 2AIRA 1NE7A 4P7GA 4YRBA 3AHJA 2QL5A 4NDZA 2A1TS 2QX8A 7ABPA 1AZTA 3DHEA 3KYDA 4MWSA 3WWEA 3GQBB 4FUTA 3DB2A 3DTYA 1R12A 5C7LO 4Z5XA 2HIAA 2P9ZA 1P2BA 1WPRA 5ILQA 3CRW1 4UAGA 2SKDA 3WK5A 4CODB 3Q9LA 1JZTA 1MH9A 4KMRA 5L3RA 1NQVA 1T13A 3AHFA 3FTPA 4O1MA 3MELA 1PFGA 4M87A 4LJRA 4Y2GA 3C16C 3CEMA 4BVGA 3CLTC 1NP6A 4TWAA 3EZ7A 2CNNA 5K6AA 1NVGA 3S0JA 3UMSA 2JAOA 3D6JA 3AHCA 3N8DA 1I7PA 4S1WA 2LW7A 3OEYA 3DV0A 1X9HA 4I36A 1XPOA 3OOHA 4OP2A 4QYMA 3DL4A 1KSJA 2WIKA 4FFRA 5KJ6A 1K5GA 2NT4A 4UZEA 1DFHA 5JAQA 4AWBA 2VK1A 2WWXA 3UN1A 4WZBB 3HA3A 3GRRA 4KKXB 3P9XA 4EHFA 1M6WA 1KI2A 1EX7A 5AVJA 1L8OA 1PU2A 4TTVA 1MB2A 5CCEA 1JXMA 2RHJA 2NYRA 2PWPA 3QIAA 1Q7CA 4MIKA 5DWQA 4Z6KA 5A9SB 1FSPA 1V8ZA 4L72A 4UD2A 2XRZA 2A0XA 3BC1A 3S1AA 3ZUGA 3NYWA 3TFWA 1U3WA 1LTKA 4LMAA 1M8PA 1YRAA 2Z98A 1KJIA 3EDQA 4XQGA 1C8BA 1Z7GA 2X40A 4RY8A 3WRYA 5A62A 3TSZA 1KI7A 3K05A 4DRXB 4C2TA 2IHYA 3N7UA 1KVTA 1PNRA 2I4TA 4YA6A 4DNXA 3W3AA 2ADOA 1D3AA 2X9LA 1BKSB 3RARA 4F3TA 2GPAA 4LWOA 1UADA 3LBHA 3IELA 4Y7DA 1P0FA 2PY6A 1WV0A 1QK3A 1R0LA 2C5GA 2MR6A 2VRCA 3IBGA 4FX5A 4KGVA 3DGEC 5ALMA 1I4EB 3TL3A 4ZMBA 2BUCA 2RDMA 3KPWA 5DTIA 2C4HA 4HBZA 1EX1A 4KGDA 4N0MA 3L8HA 5TE9A 4XJSA 3FHOA 1ZIYA 4NULA 4OI1A 1R2QA 4LJLA 3WLNA 4B3FX 3AVUA 5JZBA 2I2XB 4M4SA 1I10A 1RP1A 4DHEA 4B44A 1GZUA 4JOSA 4OYRA 4UUBA 4B3CA 3D3JA 1HNNA 2XTAA 3MWDA 2AF3C 4RVNA 4COKA 2J9RA 2GJKA 3ZVKA 4CQNA 4JJ6A 1QIJA 2ZJ3A 3U1TA 2EBUA 1V71A 3H99A 5JI2E 2RIRA 2I2DA 2CZQA 4K26A 4UQPA 3P9SA 3TE6A 2IFTA 5CYGA 5LD2B 3FRJA 2PKQP 4WWHA 1VJGA 4F5DA 5AVUA 2FWRA 1F06A 2GCOA 3LHFA 2NVUB 1XFDA 1TPYA 1CUZA 1SXQA 1Y63A 4E12A 1JWLA 1C0LA 1ZK2A 2YFHA 3ZGVA 1AM4D 4Q4JB 4KOEC 3TUJC 3E35A 4AULA 4EI7A 1X7HA 1U3TA 4LZPA 3HYNA 1CEEA 2NTYC 5FWXA 4L2IB 4MYSA 2DETA 2JHAA 1QBGA 4UW9A 4AQDA 2SBTA 3UHPA 2A5LA 5HRUA 5CFPA 1NP3A 2NACA 3CH4B 2QROA 4DNPA 4ZZIA 2FNAA 2ACWA 2V7QA 2DFPA 3DFMA 2BEJA 2WTNA 1RJ9B 3G59A 4OQZA 4RVFA 4F91B 5HVNA 4AM8A 4AXBA 1UJ6A 3LY9A 4ZQFA 1QRTA 5DRYA 4V38A 2Q0QA 5CURA 4E3ZA 4YJ3A 2ZTVA 3FD8A 1MHTA 3KBOA 2OXCA 3GMSA 1M2JA 2Y0DA 4JBIA 3VX3A 1N25A 3KNZA 2ZAYA 1TZBA 3NHAA 4CDNA 4E07A 1Y7IA 2P9YA 4FZRA 4G0PA 2X8BA 4IDDA 5KSOA 3R7SA 3ZTWA 4ECAA 3JQ7B 2EERA 3HHEA 3K1TA 4C3VA 3JQGB 4UAVA 2WU4A 3FMVA 3MJSA 6Q21A 4RJJA 3Q0TA 3FMGA 1RWKA 5EQJB 2HQBA 5KYYA 5FO0A 2GO7A 4BCBA 1UJ2A 4I6GA 5KVVA 3BXXA 1U5CA 3THSA 3DTNA 4H1UA 3ZE9A 2XMRA 2QRGA 2O5RA 3BD9A 4MQEB 2NPOA 1IWOA 5FP0A 2FSPA 3IA2A 3LT2A 3OZIA 5TRTA 1JHYA 1J56A 1E1QD 1X1BA 2BEUA 2IYWA 3AUSA 1EVQA 1KH2A 1Q7RA 5CHYA 4UKDA 3B1JA 1YR8A 4QE3A 5CIWA 1FRNA 1HMPA 2CMHA 4S35A 3SZLA 3UHOA 2XXBA 5IU6A 2REOA 3PZRA 2QL6A 4JVMA 4BKQA 3N75A 2IEDA 1KHHA 1CVIA 2Z9BA 2QJWA 4RMJA 4Q9IA 4DADA 4DWVA 1THGA 2FI1A 2H16A 4M1ZA 1H2RS 2P0AA 2O54A 4MCHA 2JA1A 1NNSA 3FDJA 3N87A 3DOFA 4UC0A 4WGGA 4D4JA 2BE9A 2QY9A 1F51E 2Y2UA 3KU1A 1ID1A 4HFMA 1DUIA 3UUEA 4HPJB 1ZVKA 2J3JA 3QLEA 2ZE5A 3IAFA 2IHZA 4MKRA 2QPAA 3X2FA 1AKUA 3I12A 4V0NA 3UHJA 1KU0A 4QDKA 3V7WA 3ZGYA 3EPRA 4I14A 1TZKA 4C4OA 1Q7BA 4B6PA 3CRVA 4I5DA 2ZEJA 3V5NA 1ZC4A 2HLHA 2AE2A 3A25A 3K9CA 2PD4A 3Q9NA 3VZSA 1LC3A 1U0FA 1P6XA 5ALSA 1E9AA 1QQBA 3JZAA 2FPKA 1P5ZB 5DT2A 4BO5A 5CA0F 3GRZA 1VI2A 3FIUA 1U7ZA 4PX3A 5LYYA 4BRUA 4WZBE 4IO0A 4Q3AA 3QLTA 3JU3A 3MRXA 1UP6A 1VBNA 3AR5A 1VP3A 3F8SA 4LDJA 2VYVA 3OPMA 2AOVA 5CB4F 3KT3A 1CV2A 4QC2A 3DBRA 5FEUA 3AEUB 3AR7A 3OPVA 4KITB 1XZNA 1RYZA 2C0PA 4LRQA 4CM3A 4OCZA 5ALFA 1IBSA 2ZXUA 4M0LA 1Z39A 2IIPA 3D4IA 3F5SA 5HM6A 2JFOA 5IT9A 1XPUA 1YB5A 3C41J 5ISMA 3V1UA 3A2MA 3QM1A 3RRNA 1UXHA 2UVPB 1E3WB 1G4HA 2B82A 3FLAA 2YXEA 1QVZA 1EVEA 4NOKA 3V34A 1KIFA 3TMYA 4CQMA 2Z9DA 4C7OB 5LBUA 1RYMA 4OHXA 4FEAA 2PAAA 3PPYA 4XWAA 2K5UA 3OA0A 3NHMA 2DUMA 4YAIA 3K70B 1ISHA 4QVGA 3JR3A 3EWIA 5MF6A 3ELWA 4QPJC 3ETLA 3KHKA 4Y2PA 1YNSA 1DAFA 2H2WA 5TQ2A 4ZAXA 5TPWA 1DJQA 3HJTA 5AOBA 1PVOA 4YAWA 3T9DA 1UDAA 5TT1A 4IKOA 3IIIA 2EIHA 3KZMA 5EKUA 5DIFA 2FRDC 4Z2YA 1PNVA 1E89A 5CTAA 1CY8A 2X7JA 5H70A 4H7EA 5HM8A 3O73A 4M53A 1CUWA 3C6MA 3UJ3X 3E15A 3E9CA 3U3KA 3BDIA 2FEWB 4EABA 3QU5A 5FI1B 1OKKA 2LBPA 2AYYA 2V03A 4EJ0A 4H7IA 2APJA 5HIIA 3MPUA 2Y67A 1VSQA 2ZAIA 4M6WA 2YXNA 3VJKA 5JTTA 4YAFA 1GYRA 4TWBA 2BM9A 3D4LA 4RHYA 2ZSFA 5THQA 2UDPA 2JVIA 3EGWA 1B0AA 3FUCA 4O2AF 2P30A 3LX6A 3OURA 1DFIA 1QZ3A 3U7EB 2Y1FA 1BS9A 3LBFA 3QKSA 5EJEA 2D5LA 3KT6A 4RULA 2I78A 4IQ0A 2A0FA 1R1DA 1G17A 4KQ9A 2P91A 1W4BA 2WIGA 2POCA 4HUQB 3LY7A 3R6LA 3WYCA 2G71A 4B9EA 2W42A 3PK0A 4ZU3A 4PFQA 2H1RA 5FNVA 2DECA 1T4CB 1T5TA 2ZXEA 4BGDA 4DG5A 3LBNA 1D1TA 4W7HA 3P0RA 1F0NA 2ZROA 5LNK1 1DKOA 1TQ6A 4DPKA 2G0TA 2IHUA 2X3YA 1ZR2A 3KVYA 3DEZA 1PJQA 1HETA 4OG2A 4Q7KA 2CBZA 4RACA 4V24A 5KJEA 3SM3A 4UVIA 1KI1A 1JEQB 1UEXC 2O1SA 4IP0A 2CBGA 1YUMA 3HEAA 3SJ7A 3K6SB 1OXBB 2BGIA 1QIMA 4YBZA 4M83A 3DAOA 3G9UA 4H7PA 1RRFA 3UJ9A 3KDPA 2DRIA 3ZE6A 1CQPA 2B3DA 4B2IA 1J09A 1J0AA 2D74A 2PGNA 5E8JA 4JL5A 3PFWO 2WW8A 4OI0A 1NI4A 4MRVA 1LV8A 2O59A 3DNFA 4WNAB 1M1YA 3S99A 1D2CA 1UFKA 4RDHA 2WLSA 2ZT8A 1ML4A 5FA8A 1L5KA 1CUDA 2G5CA 1FOEB 1XA3A 3DYIA 4CEIB 4OKSA 4QU9A 1LF5A 1S0UA 2YV5A 5DDIP 4A8HA 2BGMA 4G0YA 5CNIA 4CZ2A 2C59A 3R6DA 4MVCA 4RHXA 2ZI7A 2B4TO 4U02A 6ADHA 3WV5A 4DCOA 4YRQA 1Z2NX 1NF8A 3Q7SA 4YMHA 5JTUA 3MRTA 2XZTA 1DRKA 1S2NA 2G0AA 1TVCA 1J20A 3ANXA 3F9IA 1B93A 2O7SA 3C3BA 2QTRA 2YINC 3E6AA 2ZTSA 3QELA 4O2BF 4MA4A 2F1KA 2WM9B 3TF5A 4NH0A 5HP4A 3RASA 5A7HA 3ETHA 3WL8A 2O3QA 1N5IA 2E5WA 3AONB 3G68A 4LK3A 2GVZC 1E6UA 5EZ5A 1GG8A 4RD0A 3WLHA 5EHZA 2QRJA 4GX1A 1FQJA 1G6OA 1XTIA 1UBKS 2TMDA 4GLJA 4MI3A 4RY2A 1YL6A 2ZB2A 1RHRA 3F2IA 4D9CA 1WVMA 3HCCA 4W8GA 4YWHA 3RC9A 4D8VA 4NENA 3C8ZA 3I9V1 3I61A 3GLHB 1U0LA 4CQLA 1LRLA 5B1YA 4CEHA 3NYRA 5MHTA 2EQ5A 6GPBA 3Q88A 1QANA 1SU8A 4PTLA 3ROMA 3RTGA 1OZFA 3W8EA 3BJRA 5EWJA 2FFJA 5CG2A 5JZMA 1AD2A 5AJZA 3CLUC 5TJHA 1KKLA 3M9LA 3V7UA 5IFKA 1XCOA 2ZJFA 5KSYA 1BGWA 1FNDA 4KKVA 3ZW8A 4WN9B 2FKNA 1E9DA 3DXFA 5TEWA 4TS4A 3CUWA 3WLOA 2PUGA 4WA7A 3ADDA 2IU6A 2WWTA 2O8BB 3KUUA 5CB4A 1QF6A 1WULS 1EJ0A 5AJYA 1XRNA 2QSZA 3D4PA 2JLZA 5BN4B 1X92A 3MTEA 2W0MA 1R4ZA 1G7TA 1OBCA 1KH3A 1RM5A 1X8LA 2XD9A 5BXQC 5MN5A 1JR3E 2FPGB 4P4NA 4MW9A 4Q7MB 1E1CB 2XWSA 3NHSA 1N8NA 1GV0A 1AIPA 1RI4A 2VH1A 2W6ID 5AM5A 4X9XA 1OGIA 1QFZA 1A9YA 1W0KD 1U5AA 2RHHA 4CM1A 3PL5A 4E46A 1W9HA 1JYSA 1QO0A 3DXXA 3LPLA 2VTBB 2I8AA 3SJBA 1KEUA 3A4YA 4TKVA 1KF0A 2A59A 4NBKA 4Q9AA 3RUPA 1JKXA 3F5QA 1FUYB 4I5GA 2R65A 3WYDA 3IKJA 2ZI6A 3MINB 4HAWA 4HH3C 4FFLA 3CLTD 4D02A 4C0JA 4K6HA 3ROEA 4PCAA 1X2EA 2C31A 4TKZA 2VDNB 5CJPA 4YJKA 1G3RA 3EMKA 3QTBA 2NO7A 4LBWA 4CMIB 3W2EA 1KY2A 1BCSB 1LLUA 2XV1A 5DHUA 3OQNA 1FQOA 1Q0UA 3AUTA 1U7DA 4K6KA 1OBHA 5H7XA 4JODA 1EGMB 2A9QA 4BVJA 4Y2VA 1T9GS 5JOQA 1E6MA 4BLSA 1EUDB 4KI0A 3TOZA 1G8AA 1ZLXA 3I9JA 2FZVA 4DVJA 1DAEA 2Q1YA 1RKVA 2G9RA 5DV9A 2Q2QA 1HLDA 3K9QO 4XDYA 1LSJA 4B33A 4BNKA 3PHJA 3U4QB 4YCMA 4TSFA 5AK5A 3D0KA 9LDBA 4J3FA 1E2NA 1R5JA 1Z83A 2R2GA 4K40A 4LNAA 1XZMA 2FVYA 2GDJA 4G9GA 1QQ7A 4HAXA 5ILOA 3LV8A 3R3VA 2C7VA 1TUGA 3HCOA 2XUOA 4BEBA 2GHQA 3IUSA 4MQFA 5KI6A 2QBYA 4FYWA 4DILA 1Z15A 4PFSA 4O2LA 3SHTA 1KEVA 1C29B 1DCKA 1V45E 1N7JA 2XR1A 3U4QA 4OHMA 1CJKC 1E3DA 1R0YA 1R64A 1II8A 2D59A 2HWKA 2J1LA 3AY0A 3PDJA 2OMKA 5JEDA 1ECFA 5FAXA 3BH0A 2HFKA 1IOWA 1G3UA 3KZKA 1BMFD 3U4DA 4GR9A 3D3KA 3OWOA 3N5KA 2AF4C 3P9QA 4L28A 4XVCA 1ZD4A 5BPHA 5HJ5A 1EPUA 3I1FA 5CYOA 1J5EB 1IVYA 2BFBB 2C54A 4JXKA 1QAMA 4R05A 1NMEA 3ZQKA 4FQ5A 1GXSA 4CTJA 3HE3A 1JHZA 3TW6A 3MXTA 2J9XB 4I2VA 4G2NA 1CBUA 1BQ4A 4IDOA 4ZKEA 1PEDA 2QTFA 5F4BA 5P8WA 2W48A 5EJ2A 4RXUA 3EFOB 3TO5A 4LNUA 4LF6B 3D8NA 5SICE 3QBTA 4C01A 3F1LA 3ZU6A 4LGYA 2AUTA 3U3MA 1ZZEA 3HU5A 4URWR 2DZDA 2QGNA 4ZJZA 3PNSA 2EOAA 3CPEA 3EWNA 4FI3F 2WYWA 1XJQA 1ST3A 4FOOA 4K46A 2R68A 5AJTA 4FN4A 1FMLA 2FDRA 2VDWB 1NQAO 1Z6PA 1T6BY 5F3WB 2AG0A 2D2VA 2X14A 1RLIA 2JAHA 2OE2A 2VWQA 3M1LA 4GI2A 2XNDA 1T3HA 4B6JA 1U8AA 4PHCA 4WADA 2FGJA 1QHHA 5FPQA 4PXYA 2HO5A 1SZJG 3ILYA 4LISA 4AT1A 1Q7GA 3F3SA 3NCHA 3QLVC 5GQSA 3RS9A 2QMYA 3WXMA 3ZHRA 1EFPB 2O8FA 3N2NA 1URPA 4MUYA 1PYOA 1TJYA 4RIGA 2FH5B 1PTJC 1SA0A 2LZ0A 3I4FA 3T3MB 3TLEA 1MXFA 3WLEA 1O4VA 2NU8A 2WF9A 1Z0JA 5DLPA 3SQLA 1J39A 5EIBC 3KIPA 4GPD1 1GUAA 2ZUTA 1RDFA 4CKCB 3M6AA 3CZQA 3WQSB 2VAMA 3TQIA 2YOGA 3K73O 1HE4A 3PRHA 1TRHA 4CCYB 3TLZA 4AZ0A 1X15A 3C3WA 3SLKA 5F33A 4NZZA 5HBGA 3GLHE 4JI6B 4E08A 1NVMB 1O57A 4LTDA 4P7KA 2GF2A 1DELA 1V25A 4ZVPA 1Z5UA 3B3AA 4PAQA 1EHYA 4PQRA 1SBCA 4ARBA 4C14A 3HKCB 2Q2WA 3ZY6A 1J5XA 3F3MA 5ED0A 4O4LB 3HA5A 3JRNA 2NTJA 1SBNE 3VUFA 4ZIRA 1PAUA 3TBKA 4OFXA 1J70A 3L1HA 4MVJI 1YB2A 3ADBA 4LPKA 2I76A 2OEPA 2QL7A 1OTXA 1HZZA 4X84A 2RI1A 3LT5A 3H2JA 4IDCA 4NV1A 3BHIA 3HI4A 4ZU6X 4F56A 3G2NA 4IBOA 4MJ3A 3HDHA 4N5NA 3A1VA 2CK3D 3NH9A 2P77A 1BO6A 4U8GA 1JJFA 1NLYA 4KVZA 3ZG6A 3SEFA 3T5CA 5K6RA 3QVKA 4JGIA 4LV8B 3LS2A 4MEJA 5JCPA 5JZSA 2HYIC 4XR9A 4OAOA 3RSSA 4CLHA 4WESA 4RTPA 2CNBA 1YZQA 3OBIA 2R8YA 2VCEA 3FNQA 4TS3A 1DWOA 1VHWA 5FPPA 4CIWA 1PJAA 2GPJA 4KPUB 2O0JA 3D8RA 4RK4A 3LW8A 2QVXX 3PFNA 3TOVA 4BFWA 2OSBA 4HVLA 2P67A 3LWNA 1L5WA 1K4YA 1LW6E 2CXPA 2GBPA 1WA5A 4UDOA 3BIJA 4ZANA 1ZSVA 2C20A 1HLGA 1TT7A 2R7MA 2X19A 5LSAA 2JFFA 4EHKA 1RWMA 1H1DA 3W2HA 1H2HA 2CHQA 2IA5A 2KSQA 3LA8A 4D44A 4ZO8A 2VCHA 4L8GA 4F3RA 3GEMA 1E2UA 2Y1WA 3FYTA 3DT9A 4TMXA 5IN4A 1L7QA 2GK4A 2Q5CA 3J7TA 1QRAA 3SBDA 2BCEA 4GX2A 4BFUA 4ETNA 3E61A 4PPYA 1B8NA 4LAFA 4RJIA 4Y30A 3GH3A 4MW4A 4PRLA 2FJPA 5C80A 2E4ZA 4ENWA 2OCAA 1JA9A 4EX7A 3A6PC 2XGJA 5ALNA 2QPTA 1US8A 3SXJA 1YBVA 2IPMA 3TPFA 4NBSA 2OFWA 1P8JA 1Y5LA 3UKDA 1PLKA 2DSTA 3OIDA 4LWQA 4DCTA 4GP6A 2BDUA 3U4GA 1CP3A 1WB5A 3GRUA 3OCWA 5K45A 2O2ZA 1Y3FE 2E89A 1TGVA 5HF6A 3BMCB 1N5JA 3CRMA 3RSZA 1TVEA 1VL0A 4B09A 4YAJA 1WHSB 4PFJA 3R7FA 3U81A 2G67A 2Q9CA 1EGVB 4BYGA 2C2KA 1I9CA 3WLSA 4E2FA 5IM4F 3CIOA 1XF9A 2XNKA 3GCWA 3ICOA 3HA7A 1I94B 5U1PA 5DB4A 5TC4A 3H84A 4RYLA 1RKBA 2V96A 5G4KA 5LWHA 4IIFA 4KFCA 1T43A 3G3EA 2OECA 4PE5B 3ASUA 4ISCA 1L8LA 4G84A 2PQMA 2X2EA 1XMJA 1HNWB 4OA5A 1M2WA 4OUDA 1D5CA 2PT5A 4BFCA 4XOIA 3O8CA 1M34E 3DVQX 4FGKA 4DUPA 3AUYA 1IG3A 4CV0A 2OLEA 1YC2A 2J31A 3R0XA 1UC8A 2ANCA 1O08A 3LQKA 4IMRA 4B8WA 4FM9A 4B87A 1IRIA 3LUFA 1IH8A 1Z28A 4C4SA 3JARB 2QPOA 1RRPA 3PS9A 3DE4X 5ICSA 1QH8A 2H1OA 4JROA 1R3UA 5TX7A 5KNCD 2RB4A 3I32A 4GPZA 3RVOA 2PBFA 3F6CA 3GJTA 3K8ZA 2H4YA 2WUGA 3I1YA 1FUEA 2H1CA 2PT7A 1WJGA 4AKTA 1NXQA 3WQBA 1REQA 1BGXT 2RJ3A 4J29A 5ESXA 3ZWAA 3BHJA 3A4IA 4YMLA 1PZNA 1L4EA 4QDOA 4D4HA 4HQ6A 3E81A 5FL7A 3WAKA