3HSSA

A higher resolution structure of rv0554 from mycobacterium tuberculosis complexed with malonic acid
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
274
structure length
274
Chain Sequence
NLYFQGAMDPEFRVINLAYDDNGTGDPVVFIAGRGGAGRTWHPHQVPAFLAAGYRCITFDNRGIGATENAEGFTTQTMVADTAALIETLDIAPARVVGVSMGAFIAQELMVVAPELVSSAVLMATRGRLDRARQFFNKAEAELYDSGVQLPPTYDARARLLENFSRKTLNDDVAVGDWIAMFSMWPIKSTPGLRCQLDCAPQTNRLPAYRNIAAPVLVIGFADDVVTPPYLGREVADALPNGRYLQIPDAGHLGFFERPEAVNTAMLKFFASVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative Bromoperoxidase
publication title Structural and functional analysis of Rv0554 from Mycobacterium tuberculosis: testing a putative role in menaquinone biosynthesis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 96
structure length 274
sequence length 274
chains with identical sequence B
ec nomenclature ec 1.11.1.18: Bromide peroxidase.
pdb deposition date 2009-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hssA00
4OB7A 5C7YA 1VA4A 1WCYA 4BYMA 1CLEA 1HQDA 1LLFA 4UHDA 2CBGA 2JGKA 4H77A 2IITA 4BE4A 3GBSA 5FP0A 4AMZA 1ACJA 4GDMA 1DWQA 3OTQA 4WY8A 2PSEA 4N8SA 3BWXA 2X8BA 3C6ZA 5T4EA 5K3DA 1C7JA 1JJIA 3E1GA 1XRNA 3QPCA 2GZRA 1ZD3A 1SCQA 1YS2X 2YASA 4K2AA 5CT9A 2XLCA 4D9JA 5JATA 2WQZA 1DU4A 2PSFA 3PUIA 5ALTA 2B61A 5JD4A 4LKOA 1JT2A 2XQFA 2P8SA 1K8QA 3FOBA 1MX1A 3WMRA 3WZLA 4BRZA 1E3QA 1I6WA 1A88A 4K6GA 5HF6A 2XI4A 1LGYA 3M83A 5EFZA 5CH8A 2FX5A 3ED1A 5HKBA 2WU4A 4G4IA 1CV2A 5CW2A 1GQRA 5CH3A 4P08A 3O0DA 2WUFA 4B7ZA 1JJFA 4IH1A 3WA7A 3KOOA 3BL8A 1CUZA 3G8YA 2R11A 4KRXA 1RYYA 3G0DA 3O4HA 4IH4A 1LNSA 2WIDA 3C6BA 2XUJA 2XMGA 3FLBA 2XLBA 4ZRDA 1QOZA 5A7FA 2NW6A 4BBZA 4DMHA 3G02A 4AO7A 2O2GA 3IDAA 4V2IA 5AKIA 1UOQA 2HDWA 2CZQA 4A5SA 1WPXA 4X7BA 5EHQA 1THGA 2HU5A 4IO0A 3H17A 3DLTA 1EDBA 5HF5A 4AXBA 2HA2A 1XRLA 3CN9A 5AK4A 5DYTA 4B0PA 4Y2UA 4BCBA 2PSJA 5CXXA 3I6YA 1UK7A 4B83A 4BRSA 3HSSA 4AO6A 3ICVA 4FBMA 1R50A 3G0BA 4PO3X 2O2IA 5ALEA 3B3QA 4X85A 4PSUA 4B80A 1DINA 1XQYA 3VVLA 4Q82A 3H19A 3R3YA 2GBCA 3EBLA 3RARA 4B9AA 2BUCA 4H7EA 2XMBA 4QLAA 5CT8A 1CEXA 4UBMA 4X92A 2CEKA 1CQZA 4C89A 4CCYB 2Q0XA 3I2KA 2WFLA 1IZ7A 1UWCA 5I8PA 4J03A 4MWTA 5EHXA 3SWWA 1P0IA 5ALIA 1TCAA 4G1FA 1B6GA 1K4YA 2HU7A 1UK8A 3FBWA 3G9TA 3D2CA 4GHWA 5ALXA 1XZFA 4M0MA 3IUJA 3IUQA 2ZYIA 4BATA 2D5LA 1QZ3A 1DWOA 2Y1KA 3HJUA 2R8BA 4ITVA 1OXMA 1SOMA 2QS9A 5E2IA 2HRQA 3E3AA 5K3BA 2JEZA 1XQWA 4UBNA 5HZGA 2AJLI 2DCMA 1QLWA 2CMFA 5LKAA 2JF0A 2OAGA 1P0MA 1E5TA 2K2QB 2G63A 1QGED 3BDVA 1YAHA 5HQ3B 1X2BA 3VVMA 2VSQA 2GYUA 4Q3KA 5DLPA 4XX1A 2B20A 2EDCA 4OB6A 3MVEA 4G8CA 4UBKA 4RGYA 5C8ZA 3LCRA 3VJMA 3AIKA 1HLGA 4GECA 5FLKA 3WKBA 1BCRA 3Q8WA 5AKXA 2BJHA 4OD0A 3N2ZB 3ZLUA 1H2WA 5AI5A 2XUQA 1QIGA 1VE7A 2PUHA 4G8BA 1GPNA 5IH7A 4LIPD 2AJBA 5LZ2A 5LP1A 4BC1A 5JAPA 4BB0A 5CT5A 4DLNA 1UXOA 4U2GA 4E14A 1OCEA 2VJCA 1IUOA 1QIKA 4BAUA 4G5XA 5AH0A 2PBLA 1J06A 3PICA 3A6ZA 4UUQA 3G9UA 3QH4A 1QIMA 4J0CA 4G9EA 1XLVA 5ALWA 3G0CA 3O95A 4B0OA 1QIHA 1W76A 1LPMA 5LZ9A 2HRRA 4OUKX 3NOXA 4DNOA 1TCBA 1A7UA 1RP1A 2WIJA 5ALSA 2DQZA 5FXMA 5C81A 4Q05A 2XQIA 2GBIA 1XZMA 4B82A 4EB0A 2BUBA 5JZ9A 2QZPA 3FVTA 2XMZA 4QEKA 3A2LA 2WIFA 4BP9A 4Y7DA 1FFEA 3DCNA 3I2GA 3STUA 4BE9A 1TIBA 2GBGA 5LZ8A 3X3HA 3IBTA 4UFNA 1JU3A 3HACA 2QJRA 5FUMA 3DDUA 5AICA 3ZLVA 2ACKA 2XQJA 1Y7HA 5FOQA 4EA6A 5BV7A 1DX4A 1AQLA 3NWOA 1ZI6A 4U2CA 3WKAA 3WK9A 1CFJA 3V9AA 1UOPA 4DMKA 1U2EA 4WJLA 3DNMA 1R9NA 2GBFA 3I2HA 4EY7A 2VATA 3DQZA 4KR0A 1WB5A 2ES4A 5A2GA 1DTEA 3PF8A 3WIBA 3ESBA 4OU5A 1ZD5A 4MYSA 1N5RA 2CKMA 3VJKA 1Q0ZA 2OCKA 4K6KA 4UHHA 1NU6A 2QOEA 2Y6UA 4H7HA 1BCSA 3LS2A 3MGAA 4H7FA 5CRIA 3STYA 1X2EA 5F4ZA 5IVDA 3W9UA 1U8EA 3QITA 1AX9A 2HA4A 1R88A 1TK3A 2DQYA 1XZDA 2WLSA 3C87A 2WG0A 1EX9A 4WFJA 3AINA 2ZJ6A 1HPLA 1XRMA 4N5HX 4CG3A 3ICWA 4QDZA 3HABA 3BF8A 2HA6A 3RK4A 3LLCA 1UK9A 1MNAA 1QTIA 3I6MA 4JYPA 3WK4A 1ZIXA 4UBLA 2XMQA 2PL5A 1ZOIA 4KEAA 4QDUA 4FFVA 3E0XA 1L7AA 2WKWA 5E4YA 3GROA 2VQ6A 3L1HA 3WYDA 5EIHA 3FCXA 3A2NA 3VDXA 4S0XA 4KAAA 1BROA 4UHFA 3TRDA 4C88A 3W04A 4BAGA 4BVLA 5JD5A 4LYDA 4W1RA 4X97A 4DYHA 1VKHA 1HL7A 3ANSA 3KSRA 1ODCA 3H2KA 4OB8A 2CUTA 1UZAA 1WB6A 1YASA 2V97A 1MPXA 1HBJA 3K9BA 1XZJA 3WK5A 3QPAA 1YA8A 4HRYA 4C87A 4MQLA 1LPPA 1QTRA 1UT6A 3T52A 2E3JA 2WIGA 1MNQA 3H0CA 3QMVA 4QWWA 1R1DA 5KBYA 4ZWNA 3EQ9A 1QO9A 5AKHA 1L7RA 2Z8XA 4N5IX 3YASA 2QRUA 1HDEA 2ZSHA 5JD6A 3FNBA 4DNPA 5EIEA 1XFDA 3NGMA 1LPOA 3VJLA 2OXEA 4A16A 1GQSA 2JGMA 4N8EA 2I3DA 4Y2TA 2AJ8A 1XZAA 4Y9SA 4MEAA 2ZJ7A 2XUAA 3IVMA 4HRXA 1VJ5A 1XRQA 3BIWA 3WWEA 5DYYA 3F67A 3WI7A 4KYVA 4J7AA 4IHAA 3TGLA 2HHAA 5DTIA 1ORVA 1F6WA 3I1IA 3C43A 4P93A 3D4LA 4FLEA 4HAIA 4UHBA 3SC2A 5JARA 5JZBA 3SX4A 2DHCA 1MN6A 1MTZA 2H7CA 4E15A 1E89A 1PJAA 1TAHA 1X70A 4UBOA 2ORYA 5HCUA 3BDIA 5FV4A 1SCIA 4FLMA 4UHCA 2C5GA 3WKDA 4C4XA 3O9MA 1UKCA 3GA7A 4E11A 4F0JA 5ALDA 1U65A 3DKKA 3C45A 4L9AA 3GZJA 4M0FA 2VTVA 4U2FA 1U4NA 2O2HA 3E4DA 4O08A 2ZVDA 5AI6A 1ZD2P 4TPKA 3WWPA 2ZYSA 1K5PA 3WIOA 1KU0A 4QE3A 3F97A 1ORWA 4WFKA 5EHZA 4ZV9A 4I19A 5EI5A 5DWDA 1JMYA 3OURA 2BUAA 2JGEA 2XUKA 5AK6A 1AUOA 2WJ4A 1GZ7A 1NU8A 1FFBA 2XDWA 1R3DA 5EGNA 4KE6A 5AK5A 1IUNA 3TEJA 2VAXA 3DL4A 1SFRA 2ZSIA 3ZWQA 2XE4A 1Y7IA 3WKEA 4INZA 4U2EA 3H04A 4KE8A 2XMSA 1UK6A 1ZICA 2W22A 3F8SA 4CCYA 1XZGA 4DNFA 3C6XA 4FLFA 3MUNA 3R3XA 2VT7A 1F0PA 5AM5A 1DWPA 2Z3ZA 2O7VA 4JH0A 5T4BA 1VXRA 1FFCA 1W4LA 2V96A 5AOBA 4QA9A 2H7XA 3FVRA 3D7RA 2G5TA 3WL6A 4DMCA 1H2ZA 2QMQA 4Y2PA 1XLWA 4HS9A 2WUGA 1TCCA 4PNZA 4F21A 3HRHA 5LYYA 4Q1VA 5A7HA 3H2JA 1T4MA 4FFWA 4AN0A 1LPAB 3M3DA 1W75A 1T2NA 3ILSA 4XJVA 4J0JA 1W52X 3OPMA 4BC0A 1TQHA 5LZ5A 4MXDA 4WCVA 5K3EA 2BCEA 2GYWA 2CJPA 2DFPA 1Q84A 3FYUB 4YX9A 3F98A 2H9YA 5E4JA 5J3JA 5HQ3A 4AMYA 3C6YA 3ESAA 1XQXA 1F0NA 5JIBA 1XZBA 5C8VA 1D07A 2DR0A 2J3QA 7YASA 1XZKA 5ALUA 2PSHA 2FJPA 1A8UA 1EB8A 2Y6VA 4X93A 5HF9A 3D0KA 1EHYA 4B9EA 2WHRA 3WKCA 4DNQA 2RAUA 2XUOA 4B85A 1CUVA 1XROA 3PDCA 1XKTA 4Y2XA 1GKKA 1JU4A 1HKHA 4X94A 2Z5GA 1JMKC 1EK2A 2BAGA 3V1MA 3C8HA 2H7YA 4EY8A 1DQYA 3FSGA 2WG1A 2OQIA 3C5WP 1CUXA 5HK8A 5HFNA 4HVTA 1VA5A 4K6HA 2J4FA 1LZKA 1YS1X 5ALLA 3UUFA 3ZI7A 3STTA 5LZ4A 5ALHA 5EHNA 3FYTA 2GYVA 5T4FA 1EVQA 3DL7A 4J0DA 5KREA 1LBTA 4DM7A 4GWLA 1GPKA 2LIPA 1S8OA 4HXEB 3STXA 5ALGA 5AM2A 4H35A 1QFSA 4PF1A 1CUCA 5H3HA 4PSDA 1K6EA 1GKLA 4XVCA 3ESDA 1Q83A 4EUSA 5AP9A 3R41A 1P0QA 4BZWA 4G9GA 5IVIA 1CUBA 3PI6A 3B12A 1WHTA 1ZJ4A 4ZV7A 3GELA 3DS8A 1LPSA 4QWMA 5LLSA 1USWA 2JGJA 2VJAA 1F8UA 2J4CA 2PKYX 2XT0A 2HM7A 3BE8A 3AJAA 4WDRA 3LIIA 4DSAA 1YB6A 3JWEA 3IUNA 3AZQA 4H7JA 1EDDA 4BAZA 1N5MA 4FNMA 3G7NA 4X3CA 3KDAA 1QIJA 2J3DA 4B84A 5EIAA 1MJ5A 1EXWA 1IVYA 3W06A 5BWBA 2PU5A 1CUGA 5AKZA 3PF9A 4UBIA 1VZ2A 5AOCA 5ALYA 2GZSA 1EINA 3RKSA 1XLUA 3R3ZA 3FAKA 3P2MA 4WY5A 4UHEA 3CCBA 3G9ZA 5AM3A 4EY4A 1J07A 1A8QA 4G4GA 1ZJ5A 3CCCA 4WDQA 1ZGBA 2C58A 3D5EA 4FHZA 3BJRA 4AZ3A 3MUOA 5ALZA 5ALPA 5AM1A 3AUKA 4QZVA 1W6RA 2XUIA 5CT6A 3DEAA 2QR5A 2QXTA 4AQDA 2RGUA 4B6GA 4UFOA 2WIKA 3TJMA 5ESRA 3EQ8A 4FBLA 5KWJA 6YASA 3PUHA 5IVHA 4I3FA 1ZI8A 4FKBA 2C0PA 2X5XA 2QXUA 5JASA 4YASA 5D6OA 3O4IA 5A6VA 3AZPA 2C7BA 3KD2A 3VISA 1ZIYA 2VAVA 4FMPA 4OCZA 2PPLA 2IIVA 2Y2VA 3R3UA 3W9BA 2VT6A 5KWIA 5AI0A 1CUFA 3WJ1A 4RE6A 3IUMA 3HXKA 3IULA 1UOOA 4DTCA 3R40A 5C8XA 2WHPB 4CFSA 4MJ3A 2VA9A 3PFBA 4LXGA 3ZPXA 2EEPA 2WU3A 3CXUA 4ZREA 2DSNA 2WM2A 3K2IA 2WUEA 4ZXFA 4FTWA 1WB4A 4RPCA 4YPVA 1ZD4A 3WL7A 3WLAA 4BVKA 4KJXA 4L0CA 3O4JA 5JAOA 1G4HA 4NS4A 5AKLA 3WK6A 4GXNA 4DGQA 3KWJA 5AKYA 2AJDA 5ALKA 1R9MA 1QONA 1UKAA 3HYSA 4XIIA 2JEYA 2BGNA 4AZ0A 1E8NA 1W1IA 5JYCA 3DOHA 5E4TA 5FKJA 3D3NA 3C70A 4EZIA 2PU7A 3N0TA 3AIOA 1VOTA 3OOSA 2PX6A 4W1SA 4Q34A 2ROQA 3QBJA 3HLKA 2WG2A 2RI6A 5ALOA 4X90A 2HFKA 1XZHA 2OAEA 3OM8A 3STVA 3DJYA 3H2GA 3BF7A 4ARAA 3CN7A 3R3WA 4UBJA 1XRRA 3AFIA 4P9NA 5A7GA 2RHWA 2FUKA 3LP5A 3ZLTA 4OPMA 4EY6A 3KWFA 2ONCA 5LKRA 3ANTA 2D0DA 5LZ7A 2XUFA 5HK9A 4UFPA 4CG1A 4ZGBA 4Y2YA 2HIHA 2XUGA 4AX4A 1GPLA 2WILA 1QFMA 5AOAA 1WM1A 1QIDA 2OGSA 3L1IA 2O7RA 4CG2A 3I28A 3EQ7A 2FJ0A 2V98A 2PUJA 1DQZA 1EVEA 4PQEA 1SCKA 3V1LA 3WA6A 4CIBA 4W9RA 4JYMA 3FLAA 3T4UA 2OPHA 1H2YA 1LPBB 3I2FA 5AKJA 2YYSA 4WFIA 1BN7A 2G4LA 4HXGA 3A2MA 3DYIA 2OG1A 1BE0A 3S2ZA 4Y2QA 4KRYA 5DJ5A 3STWA 4NZZA 4J0KA 5ALMA 1CUIA 3SK0A 3F9CA 3U1TA 5AIBA 1UFOA 3PFCA 5AHXA 2PVSA 2QUAA 1YCDA 4PV7A 2DHDA 3WWOA 2XB6A 4RNCA 3V1NA 5JALA 3BXPA 3FSGD 4GW3A 4IQ4A 3IURA 1ETHA 4QNNA 4NMWA 4DSZA 2BKLA 1VZ3A 2QT9A 3GUUA 3HZOA 1ZGCA 2H1IA 5BWCA 1P0PA 1Z68A 1B41A 1EDEA 5ALNA 2OCIA 5YASA 2HFJA 5FPPA 4Y2VA 2XQKA 3FYUC 4X6XA 1XRPA 1VE6A 4Y2JA 2WJ6A 4W63A 5JADA 4H18A 5K3AA 2QJWA 1QIIA 2AXEA 2RONA 3I2IA 1SC9A 4I4CA 3W2TA 4BVJA 2OLEA 1CUHA 4Z49A 2CB9A 1CVLA 4U2DA 2QKYA 3PE6A 1XKLA 3H2HA 4MEBA 4P92A 4H7IA 4MQMA 1QIFA 5CMLA 2QTBA 2DHEA 2VJDA 4RE5A 1AKNA 3K6KA 3L1JA 4FNGA 1CUUA 1J1IA 2JGLA 4GBGA 3WL5A 5ISMA 3QPDA 1YB7A 4OSEA 2G5PA 2AJCA 4W1PA 5CTAA 4OU4A 5SYMA 1MX9A 1QE3A 3G0IA 5IKXA 4ROTA 5AJHA 4YK7A 1K63A 2IX9A 1H2XA 1ODSA 5AIAA 3I2JA 5AKEA 4Q3OA 2WTNA 3QMMA 1VXOA 3EF3A 1QIEA 3WZMA 1NX9A 5AKGA 1XZLA 3G0GA 5FRDA 2RIPA 1XQVA 3H1BA 2HADA 2WFZA 4CI9A 2QVBA 4CIAA 3AIMA 1BEEA 3HC7A 3U0VA 3FYUA 4EHBA 1C7IA 3DOIA 1QO7A 4HZGA 2XUDA 3FWHA 1N8SA 5JANA 2EDAA 2ECFA 2C0QA 5ALRA 4U2BA 5T4HA 1O6FA 2WFMA 4Y2RA 1GXSA 3WJ2A 4L72A 3KXPA 3DYVA 2JGIA 4TGLA 4N8DA 1PV1A 5FDFA 2OCLA 2BFNA 1JJBA 2XUHA 4JUIA 2WHQA 1CUAA 4KAJA 4JNCA 3R3VA 5CT4A 3R0VA 3D2BA 4PW0A 4X91A 3WWCA 2JGFA 4QDTA 4KAFA 1O6GA 2OCGA 2WFLB 4BP8A 4FWBA 2B4KA 5AM0A 1EI9A 1BU8A 1G5FA 2V9ZA 3M82A 5AI9A 4KACA 4MWSA 3WK8A 4W1QA 1BN6A 1OILA 5AI4A 5ALJA 3FCYA 1A8SA 5BOVA 4HTAA 3C8DA 1YR2A 1G66A 1KEZA 3WQHA 2VEOA 5IVKA 3NUZA 5AM4A 2I78A 4LYEA 1FJ2A 1THTA 5CH5A 2HA7A 3IB3A 1JI3A 3IA2A 1E8DA 4PSCA 1TRHA 1FFAA 1Q0RA 1AZWA 2PM8A 1CUSA 1CIJA 2ACEA 3C5VA 2UZ0A 1IUPA 4ETWA 1ACLA 4Q3LA 1CRLA 3JW8A 5DNUA 4BDSA 2JBWA 3S8YA 2OGTA 1EK1A 1CQWA 5AI8A 3WL8A 4J0IA 3I6ZA 3FLEA 4XWGA 5I7UA 3ZV7A 2ZJFA 1CR6A 2JIDA 1DT5A 1GGVA 1E8MA 2HA3A 3H1AA 4TVKA 1H22A 1EB9A 3DKRA 1YA4A 5JAHA 1MX5A 3AILA 5AKKA 2QUBA 1AMNA 3VKFA 3DD5A 1MAHA 1BEZA 4J3JA 1WHSA 4L3WA 3O4GA 5AO9A 4IH9A 3HEAA 2WUDA 3A70A 5FPQA 3UMJA 2B9VA 3IIIA 1CUEA 1XZCA 4C01A 5JZSA 4JEIA 4BCDA 3O9VA 2C4HA 4EBBA 1L7QA 5A62A 4NVRA 4C4ZA 3QMWA 1KU6A 5DNVA 1ODTC 1YAJA 5HFAA 4FOLA 1CUYA 3M81A 5CURA 3I1YA 1LPNA 1YSCA 1CUDA 1C4XA 3H2IA 1MT3A 3QYJA 4GEGA 4K5QA 2XMCA 2XQGA 1XZIA 2W6CX 4Y2SA 3F96A 2HA0A 4MYDA 1TKRA 2RHTA 1H23A 5D7BA 4QDXA 4F5ZA 4UPDA 5HKAA 1E66A 4A23A 3HI4A 2XMRA 5DNWA 2HL6A 1EH5A 4OYYA 2Y2UA 1AURA 2WSLA 1J2EA 1LZLA 5I9IA 2XUPA 5ALQA 1GT6A 5AK3A 4QDOA 5K5EA 4BCCA 4BTLA 1QJ4A 4H7DA 2ZYHA 1IZ8A 1CUWA 5SYNA 2HA5A 2I3ZA 4C4YA 1M33A 1XZEA 2BGRA 4GLBA 3EIOA 1BRTA 1CPYA 4EY5A 3OG9A 1RWQA 2XMDA 4H0CA 3B5EA 2VJBA 3QVMA 2WTMA 3WYNA 2WHPA 5K3FA 4LHEA 3D2AA 4QLOA 4H7KA 2Z3WA 1R4ZA 4BDTA 5DYWA 1ISPA 2YH2A 4ZI5A 4LXIA 3WK7A 3G9XA 4J0GA 3QZUA 3LIPA 3WWDA 2VF2A 5DTJA 2HU8A 4G8DA 5CBKA 4KE9A 1PFQA 4KE7A 1WOMA 4OYLA 4ARBA 2PSDA 4LXHA 1LBSA 1MO2A 4BZZA 5LIPA 2X76A 5K3FB 1AC5A 5CXUA 2WJ3A 3AZOA 5ALFA 4G4JA 3BIXA 3ESCA 1DX6A 3UUEA 1CUJA 1WPRA 1VLQA 3GFFA 4GI1A 4X6YA 4X6UA 4J0HA 2QM0A 4M0EA 4DIUA 1AGYA 4AN1A 3RLIA 3OC0A 3V1KA 4CCWA 1FFDA 1JKMA 2OGZA 3QM1A 4B81A 3RM3A 1UKBA 4HXFB 3BJMA 1EA5A 1G42A 1Y37A 5HF8A 4C6HA 3H18A 5D3KA 2ZYRA 2YXPX 2C5FA 3D59A 2I03A 1MU0A 5JAUA 4X71A 3Q0TA 1FSSA 4AB1A 1BS9A 3W05A 4AO8A 4BTVA 1MAAA 4X00A 1DT3A 5ALVA 4DMFA 3JYHA 5D3ZA 1IMJA 3V48A 4FDMA 1JFRA 3VXKA 2OQVA 5K3CA 4E46A 4X95A 2Z8ZA 5A71A 4F60A 1ZI9A 1N1MA
chains in the Genus database with same CATH superfamily
4WNIA 1YXMA 3O3NB 3JXEA 4W5WA 3JVIA 4PZUA 3OVMA 3AV0B 2P2NA 4LXQA 4NBRA 4C0JA 4HWGA 1L4BA 2I22A 4IS3A 4O4LF 1WCYA 2YWEA 3EAFA 4BYMA 4GU5A 1W0JD 2AW3A 3SQOA 2TS1A 5I7VA 3LGAA 1Z47A 1HL3A 1HQDA 3BXFA 1K5GA 4ZDIA 5G0VA 4BGIA 3X2SA 4Q37A 2IITA 2ZVJA 4CTNA 1G60A 1WDTA 1QC5B 2ISCA 2JCVA 3NHMA 3ZU3A 4BE4A 2DC1A 1REQA 3NHUA 3F7NA 2WSMA 4V2UA 1QFJA 4FM9A 1KQOA 2Q2WA 3GBSA 4XYMA 2I3GA 4G1MB 5F64A 2WWXA 3RFTA 3W5UA 4XTCS 5TMEA 1R0YA 2QBYB 5TPZA 1ZMRA 4DA8A 4L5BA 4BNJA 1RT9A 2WOJA 3WV4A 2AV6A 1ACJA 4R98A 3DMTA 3GRFA 5J43A 4BRWA 1LD3A 3CLTD 1DV1A 3CR8A 1KYTA 4W6QA 4FOSA 5AW5A 4WY8A 4D4LA 5LJLA 3PEEA 4ISCA 4HN4B 1QK5A 3LUJA 3DVQX 5EMMA 1U02A 2HWXA 3ZW9A 2LPMA 4N8SA 1T0PA 3NANA 3K2QA 1HT1E 5TV2A 2PFGA 1XXHE 2AQKA 4UU7A 4MS3A 4PYNA 4I2NA 4YACA 4CDMA 5T4EA 1VMKA 4YUAA 2HJHA 4P7GA 5LQUA 1WMBA 2JNWA 4LDQA 1SC3A 1UJ4A 3I8SA 5K3DA 5INTA 4MDEA 1XD8A 2CSXA 2ZCUA 3TLYA 3QE9Y 4B6PA 3VOAA 1DCKA 2A14A 4PHGA 3UGKA 4HMOA 4RKRA 1XNHA 2VP9A 4XB2A 1SHJA 2IDMA 5CT9A 3KR2A 2D13A 2W8BA 2D7CA 5I8ZA 3UK1A 4XPZA 1RABA 3Q7QA 2J1LA 2GD6A 3PXGA 2QR2A 1ID8A 4JJIA 3BE4A 3TDKA 3VO9A 2PSFA 5C7IO 2C9DA 1JIUA 1ESZA 3DE2X 2B6HA 2PCLA 1NJSA 1FP2A 2LNDA 2NN3C 3CSDA 4FP9A 3T7SA 3ACCA 3HKCA 2XQFA 3NVMB 4NYIR 4C0KA 5LPNA 3LI2A 3FR8A 4J16C 3I3OA 3AK4A 3B5JA 1W5SA 1XG5A 2YWFA 1SG6A 1OPRA 4NF2A 4ZEVA 1X3SA 4C20A 3OWOA 2J0VA 3KZNA 4MKGA 3VPAA 3ZVLA 4BS9A 4KIUA 2QROA 4CM9A 1T1SA 2D2XA 3QTBA 3GXOA 3OLVA 4WBNB 4PAQA 2XI4A 3ZBTA 4XWKA 4M49A 2BR3A 4TV8A 5EFZA 5FFNA 3WB0A 1OFUA 4A1OA 5JCOC 4RTMA 3C7TA 4CFZA 5HBRA 4MRRA 1RC0A 1SQ6A 5HDBB 2J5KA 2WD8A 2WZDA 3IT1A 1EG2A 4YAEA 3T0FA 4HWTA 1KK3A 1YWGO 2WKRA 3M9LA 3PNPA 3WL4A 1A04A 1W5EA 1ZW1A 3O92A 4HEJA 4AZTA 1CV2A 3NVDA 1C1HA 1WWKA 2DFDA 2FAXA 3GAFA 4Q66C 2VTBB 2CNDA 3U60B 4YQYA 3BEOA 2VBIA 4RIGA 3JQ8B 5GJBA 2G7MC 2B4YA 2GFHA 1PS8A 4RZQA 2WUFA 1L5YA 2CL0X 1ZL2A 2XNSA 4C7XA 4YQZA 5M2QA 1NBIA 3KXIA 5CJJA 5GJWC 4Z3OA 1O57A 5JQGF 2ISSD 1KI4A 3I62A 1UPCA 1KBQA 1L6IA 4W8OA 1OIWA 4XVQA 5IJAA 1VCHA 3VZQA 2ATXA 2DPMA 5FBLB 5BVGA 5GIPE 3RVKA 1E61A 2B5WA 2P9YA 2ID4A 4O4IA 1E2NA 5FHRA 3AF6A 2QYOA 1VBKA 2EL7A 1DTWB 3G8YA 2DPHA 1CK4A 1M1ZA 1R6DA 1ZMBA 3DMFA 3LT4A 5TE9A 4CXMA 5AXCA 2QIOA 5FFFA 5HRUA 3BQ9A 3ZNQA 4DLWA 3C6BA 3A1UA 2C4MA 2XLBA 3TLZA 1QRSA 4ZRDA 1N2OA 2FV8A 5JY6A 1RI5A 3ZY2A 1TKBA 2DE0X 3NHYA 3C3DA 2QSYA 3B20A 3FNRA 2DBRA 3R9IA 2GTHA 1BMQA 2ZIGA 2R3SA 3I12A 4BBZA 5FCDA 1YZQA 5JVDA 5FWAA 1OR8A 4DMHA 3K15A 4AO7A 1G20A 2O2GA 3E1KA 4Z2YA 3EXHA 3G2QA 3OFVA 3K96A 1M6VB 1UDXA 1U7HA 2XIJA 2IYOA 1F8YA 3E22B 3PUWA 4TXNA 3VU1A 3RC1A 4B3SB 2BW0A 1V4VA 4EYGA 4XRGA 3R76A 2NTEA 3BWYA 4BV3A 1UOQA 2OKCA 5F2OA 3DR5A 5D1HA 3TVDA 3WQSB 4DEXA 3T3DA 1GOTA 2CZQA 3QWBA 4GX1A 1PS9A 4IJUA 4YJFA 2C7OA 4FDLA 5CX4A 1OB2A 1TCUA 3LZCA 3CKYA 2Z09A 3O9ZA 5JRZA 2G8LA 2HU5A 4IO0A 4KTVE 2JCYA 1CQXA 4QBFA 1SIUA 4II3A 1RR6A 1CG6A 3L7AA 1NPTO 3PITA 4BVEA 5P8WA 1ZD1A 2UVDA 1DADA 4BY9E 3N2LA 4JY7A 4Q3DA 4HWKA 3F4KA 2R6AA 2PZ8A 4EI2A 2QP4A 5GM2A 2FPRA 2HA2A 3HZHA 3DF7A 3SHFA 1R8JA 2YTZA 4DC1A 3F2VA 3F9IA 5HIIA 5BW8A 1UBUS 1XRLA 5C18A 1DUSA 2GN2A 1BWSA 2V5VA 2QW8A 4HDNB 3R2JA 2TMDA 5DYTA 3I9V6 1VPTA 5I9BA 4DC0A 5E2BA 3L4BC 3B13B 3Q1LA 4RORA 1P4HA 4UC0A 4W99A 1IHXA 4ZOCA 2C54A 4XA8A 4LOKA 1AZLA 2BTQA 1WZUA 1SUEA 4BTEA 5A06A 4D5EA 3BGIA 4HPXB 3EMDA 8AT1A 1U3DA 1ZM9A 1X9IA 4FK8A 5EY5B 1TYAE 4FBMA 4GMXA 4RF2A 1GEGA 2B94A 1VSUA 5EUQB 4ZT6A 3W5SA 4CU2A 4N6OA 4TLEA 1IVSA 3FTFA 2R0QC 1RADA 2O2IA 2IIPA 4D3FA 4X85A 4IGFA 1Z25A 2Q3HA 2YXLA 2VT3A 2F3QA 3P32A 1XQYA 4GOMD 3VVLA 2O48X 2WWRA 2DERA 4CN8A 5KQLA 1XNRB 1T5DX 5FOWA 4CM7A 1DL5A 1SCUA 2JCXA 3ZGXA 2XMBA 5KPJA 2QQ5A 4OQFA 1P1FA 4OFXA 4OGKA 4XQGA 1UPFA 3KVYA 3QIVA 5CT8A 4LYFA 1N2XA 4L7VA 2EW8A 4LHXA 2RKWA 2NZVG 4EARA 1B14A 2IXEA 3LECA 3UWMA 4P7KA 3GZNB 4C89A 4AY6A 2Q0XA 5CTJA 1PV4A 3I2KA 3T5DA 1VLLA 2X8LA 1KORA 2AKAB 1OW3B 2WFLA 3HNOA 1IBCA 3GLHB 4M88A 5GY7A 3S1AB 3ZCTA 4GKAA 6GPBA 4TWBA 2BRUC 5EHXA 3GNSA 3DTVB 2H52A 1CQIB 3HNPA 1VSBA 2N47A 5FYQA 3REOA 4BEWA 4H1WA 2IEGA 3KUUA 2XOKD 1JG6A 3OCWA 3EAGA 2HU7A 1ZKDA 3L43A 4AP9A 2PQ2A 4P53A 2FSVA 4WGFA 5FPHA 2F1HA 1HSZA 3FBWA 5JXWA 1C30B 4V0MA 4NECA 1GA6A 1U2GA 3FPJA 2BCJQ 2IU6A 2GEKA 1XZFA 4GBED 5EMJA 4IV8A 4M0MA 3VFDA 4AS3A 5LYJB 1CBUA 2QM3A 3IUQA 2X8JA 3PNMA 2EP5A 1BXKA 3AKYA 3GJRA 4H3SA 4WADA 4MJ7A 2PWYA 5HKLA 1ZA1A 1QZ3A 3ZWMA 1X1TA 2HMYB 1X7ZA 1V1MA 2Y1KA 4NCIA 5AUQA 3HJUA 4MWOA 4LBYA 3SS7X 3GGDA 5EE9A 2HJVA 4GR4A 5IJZA 3UAXA 3EZYA 5LXTF 4G09A 2NM0A 3LWDA 5F3WB 2N0SA 3W3AH 4BFCA 4MROA 1ENZA 2JEZA 3MYYA 4K05A 4NCKA 1ZD8A 4OI0A 1SKYE 2FCAA 4YLEA 2Q3FA 4KO1S 4G85A 4QQFA 1NQVA 3GN2A 4FWIB 2PCJA 1HNXB 2YN0A 5HJ2A 3NO4A 3IP7A 2DCMA 1BHJA 4ZTUB 1O89A 4G1BA 1QLWA 2JLWA 2YYZA 4IDPA 5DYNA 4CYMA 1Z7BA 3AVYA 3BBPA 3KT6A 1Z83A 4EGFA 2ZYVX 2VEDA 1WX1A 4ZRMA 3CG0A 1R5NA 1KE2A 1LS1A 1WBJB 4A0SA 3RS0A 3H8SA 3GEIA 1EM6A 3PQFA 3SSAA 4O3MA 1OLSB 4L9RA 2YFKA 3VTAA 4NZPA 1E5TA 2K2QB 3ROXA 5AQ1A 3RVOA 2GK6A 5BP7A 4B2LA 4HAZA 1QGED 1PHPA 2QAIA 3TW8B 1BAPA 2XWJI 3CRNA 4R8SA 3VVMA 3INYA 3ZHQA 3Q12A 4JB2A 2W8ZA 1LRKA 4KPGA 4M54A 3WSWA 3H5VA 2VXOA 4HWSA 5AVTA 2ZBFA 4TMWA 3EZGA 2XGSA 2LWIA 1E7YA 4XX1A 4MR8A 2B20A 3S4YA 1RC8A 1P2BA 3QLVC 1P9WA 1V11A 3JQFC 1AGXA 2HW8A 1RC1A 4KQWA 2BTEA 1A4RA 3ZBPA 4M46A 2L69A 1W4ZA 2J7KA 2UZ1B 5ESXA 3RJTA 4YUZA 3GLFB 4YN3A 4FMDF 1FUEA 4GECA 5FLKA 4JJ6A 4RMIA 1FCJA 1DBQA 2QNBA 5EZSA 2ZCVA 4YMTA 1BCRA 4U7TB 5IUJC 4Z7OB 2D2FA 4OD0A 3HJBA 5ENDA 3K5HA 2JCGA 1B2LA 4PEVA 3JQAA 4OMDA 3PV0A 4AY5A 1JHAA 5AI5A 2XUQA 1MB2A 1B0UA 1YRYE 2NYAA 3PKIA 1TFRA 4DG5A 2BVNA 3JQ7B 2VZEA 1GPNA 5DT9A 2C2WA 1Z33A 4KQFA 4KXUA 2G0AA 2CDNA 3UC5A 1V6SA 1DE0A 2IHNA 2ODNA 3PC4A 1AKYA 1ZITA 4PGHA 1RQ2A 5LP1A 3AR8A 3LQ4A 1QR2A 1JEAA 4COOA 2P2DA 4EZEA 3HKBA 2UYHA 1D6MA 3BTOA 4ZYYA 1UXOA 3DEYX 4I9HA 1UP6A 4PR0A 3A9VA 1TF2A 1LTQA 1WV0A 1Q0SA 1X7XA 1ESMA 1UZMA 1VLHA 2JK0A 4Y7DA 4JA0A 5CLLA 1KMIY 1TXGA 3HUEA 3VUFA 2VJCA 4H3KB 1B0PA 5B58T 4EFKA 1FEZA 2G82A 1NJFA 4C2UA 1PBTA 4OVKA 3QOYA 4YJKA 2AMVA 2IL1A 1F20A 2JLAA 3BGVA 4FFBB 1ZK2A 2KE5A 3JD1A 5EMHA 5EJ8A 1GTSA 3DWGA 3FVWA 3D8NA 1NMZA 3AONB 5LQNA 4MYRA 2YIVX 3WDLA 2V7TA 5K8CA 1IN7A 4A3SA 2ZSKA 4Q24A 4YUVA 3TL2A 3SE7A 1IEVA 3BWEA 3COPA 3MCZA 1MC8A 5CNMA 1JHXA 1PFGA 2C3OA 2GDJA 3INGA 1I5OA 1WTCA 3QH4A 3F1KA 3ZD7A 4KZKA 3HCOA 1NVGA 4QXPA 3EPLA 3EC7A 1FVFA 1KYQA 2C03A 3VPBA 3MTQA 1G9TA 2I3BA 2VOEA 5FR2A 3THSA 3AOEA 2OC9A 4TM8A 1QGZA 4J7XA 5EPUA 5K6AC 4XZ3A 1QIHA 5LWQA 2PX3A 3HBLA 1LPMA 1LDGA 5LZ9A 1S1MA 4OUKX 2IZOA 3PFHA 4TRJA 3BE5A 1M67A 1RJ9B 2HHLA 1UPUA 2C2MA 2WT8A 3KK0A 4OXRA 4PICA 3DE7X 4KR9A 3HEMA 1ZM4A 2YBDA 3A6GA 3LXRA 5EC8A 2DQZA 4EI9A 2BFCA 1B8UA 1J90A 2I6UA 4RS4A 3HSKA 3AB8A 4RLHA 3VC1A 3NAMA 5KIAA 1DIAA 4P7BA 3Q6MA 1A8HA 4JLBA 3R9WA 1OPXA 3ABOB 3ZWAA 1I3CA 2QX4A 4TTSA 2FR1A 2DSTA 2BHLA 5C81A 1QK4A 1QVZA 1R4MA 1S2MA 2JDID 3HFJA 2VXCA 3ZW8A 4BMCA 4DY4A 1MO3A 1XYYA 1SXJA 3C6MA 4KLNA 2GBIA 1L4NA 4MPJA 2DETA 1WKBA 3FKSD 2BUBA 1OT3A 2P78A 5DWQA 3ZQ4A 3RT9A 4CUZA 1PX2A 4D9GA 1DAGA 1CYDA 2C5SA 4IOJA 2O2JA 3AQ4A 3G2PA 5DBFA 3SEZA 3PWTA 3WGIA 3SKVA 2PZKA 2IV2X 2AQIA 2CLDX 3TMYA 2QE7D 4KGDA 5TS2A 1RWVA 2NT3A 1STOA 2Z9DA 3P9ZA 1EWKA 2BIFA 5NLLA 5JXHA 3A2LA 3QVSA 2OENG 3ICCA 5TGTA 4D80A 2J3IA 1ZH4A 2OL4A 1E3TA 4JLUA 3STUA 3NTQA 2GBGA 5LZ8A 5ADHA 1XPOA 3VR2D 2OMEA 1JU3A 1HE5A 4U7DA 1ZVQA 3A31A 4RDCA 1E7WA 4NJOA 2AX3A 4PFKA 1EP3B 2XYPA 2O7QA 2HGZA 5J5CA 5LP6C 4QGHA 2VYNA 4O02B 4QAQA 5AICA 4UTOA 3UV3A 4LE0A 3ZLVA 3D4PA 2YOGA 3GQVA 2XQJA 2X1LA 3L05A 3OZUA 1RQ7A 1BW9A 4KXVA 4V3CA 4JZYA 1Q2UA 5EKDA 4EA6A 4FR5A 1F2UB 1DX4A 2P9JA 2P2GA 5JYDA 2JLUA 3EIXA 1OAOA 3CG4A 1Q74A 3DZBA 3L04A 3JS5A 4GSLA 4U2CA 5KJ6A 2J59A 1GG9A 2LVBA 4CV0A 1B3BA 1YC5A 3WKAA 2YJ5A 4NDZA 2CF6A 1E18A 4ZI7F 2ZSAA 3DPIA 4KHZA 4CHGA 1PJLA 2D0OB 1NUQA 3GT0A 3SAJA 2BHNA 4KQXA 3V9AA 3WYCA 3ZIAA 4P4UA 3OOJA 1UOPA 2IDJA 1U2EA 3PT5A 2EEZA 2N42A 4UPEA 4QBIA 2ZBQA 3GAZA 2YNMC 3THWA 2QA5A 3K35A 3T3NA 1D04A 4D2IA 2CDCA 4KR0A 2B37A 1RYFA 3RPEA 1FFWA 4ILKA 3C48A 4WXEA 4EB6A 5B3LA 5C35A 4AWAA 3I5MA 2NU8B 3WY9A 5A2GA 1DTEA 2H5JA 3QEMA 4RABA 2WNHA 2Q6OA 3ZTYA 3PXCX 2Y05A 2XJ4A 3JD2A 5CLIA 2BFOA 3CMCO 5DU2A 2ZAIA 3I9FA 4DIDA 3O1IC 1T9ZA 3DCIA 4KQ2A 2JAWA 1N5RA 3WNDA 4NZOA 2QG4A 1E9SA 3VYTB 1Q0ZA 2AN5A 1LXCA 1VKZA 3MWLA 1ISHA 4LZZA 3KELA 2J67A 3QPVA 3N7AA 4DV2B 2QOEA 4CV1A 3SSMA 1DGQA 2IYXA 4LTMA 1FLAA 1V1RA 2W2VA 2OGWA 2ALJA 4Q1CA 4HGRA 4MUFA 3SM9A 4UJ5A 1QP0A 2ZVQX 2HJWA 1EJ6A 1Y8RB 3L8YA 1JG3A 2R2GA 3DEKA 2CXQA 1ZESA 3JQGB 1BXRB 4FDUA 3BRCA 3DWIA 4L73A 4I9FA 1X7HA 2JZNA 2MTBA 4AK9A 1DCMA 3VR4D 4MVJM 1R88A 1DDIA 2DQYA 1L0BA 4JL8A 1AM4D 1H0RA 1Z88A 2IHTA 2R47A 3AUAA 3TIXB 4DPKA 4YRIA 3TK1A 1V5WA 1SXHA 3TUIC 4TV8F 2QUHA 2VAPA 5EP4A 3LU1A 4ZJZA 1RYZA 3HH8A 5C46F 5JNRA 4OMUA 4V0SA 4WLVA 3M6XA 4MKXA 1XEWX 5BR4A 2UZ3A 4ZDWA 4R2IA 3ZOZA 2OYSA 3BF8A 5D86A 3H86A 3TOSA 4LYJA 4OMFG 3OA2A 3Q9SA 2C5HA 1NWCA 1FPMA 4H1TA 1Q5PA 1RQXA 1XB2A 4PPYA 1JIQA 1PLLA 3OIGA 1QTIA 3I6MA 1IJKA 4EHKA 4GP6A 4QPZA 4HH0A 4ZAXA 2YQ5A 1N6IA 4PLHA 4Q7LA 2V7QD 3FZGA 4XFKA 2O7SA 4ENQA 4FFVA 1WDMA 1SPXA 3E0XA 1J1UA 5MFZA 2RAVA 4G0OA 2YY5A 3T6KA 1N8TA 2ESRA 2ZUDA 4HTFB 1L7EA 3DHWC 5F1YA 4YCCA 821PA 2WKWA 1D4OA 3GROA 1NBOA 2CHGA 4D9HA 2V7XA 5IC5A 2V54A 3NH9A 3A2NA 4LRWA 2C42A 3I3SR 4S0XA 4KAAA 2BEWB 3R9XB 1BROA 3Q5DA 2B4RO 2QPOA 1QAOA 1VG8A 3QVTA 4UU0A 1P2GA 4LMBA 1L5VA 5FBRB 5F2EA 3O91A 3NHWA 3ELYA 4OBWA 4CI0B 3R8CA 4CMEA 2Z3VA 4YCDA 4F1WA 3WP0A 1NIPA 2FP4B 3DCYA 2OMKA 4W1RA 5BSFA 3CYFA 1QKJA 5E9JA 4YPFA 2YHBA 1Z7EA 2C4VA 2R5WA 4R16A 4O2RA 2JLSA 4FXPA 3P96A 2IODA 1O1YA 1DBVO 3QMPA 4IDGA 4JC8A 2WT9A 4J0FA 1XMPA 4TXMA 3SY8A 2V97A 4HGYA 4MV9A 5DIZA 4LS3A 3WFZA 2VDJA 3EXG2 2IEAA 4OQZA 4I8IA 3K9BA 2UYQA 4CQMD 3DR3A 4MUKA 4HRYA 4B3HA 4MQLA 1RCFA 4H0FA 1LPPA 3D6FA 3SS9X 1QTRA 4F4IA 1T9HA 4RGQA 3V7YA 2JKZA 3CJQA 4DVJA 2WIGA 1YUMA 1YZTA 4WX2B 1DOHA 5DF1A 1A7JA 4C4TA 1TM2A 1D1PA 3H0CA 1TK2A 2VK1A 1V71A 2CNOA 4R2LA 4RXMA 4ZPXA 1VJDA 1G41A 2KQUA 4YRRA 2FE1A 4NG5A 3WWYA 2VZ8A 3ORQA 3QKRA 4HFRA 4Q4CA 4INOA 4GPD1 1TGYA 1U4SA 1XXLA 5FEMA 3SYLA 4IIJB 4LJ6A 5KBYA 2JJMA 3EQ9A 4TKUB 5FI3A 4B2PA 4N3GA 2PUDA 3BX1A 2ET6A 4ZEOA 1RJDA 1L8LA 5A4KA 1J24A 3HN7A 1R5BA 3LJKA 4HN2A 4ERXA 2D3TA 3GC6A 3V9PA 2ZS9A 4ZYXA 3YASA 2Q41A 4POAA 3MRTA 3WOVA 2QRUA 4CVNA 3KZXA 2LGJA 3E35A 3REQB 1JL3A 3A6DA 2ZSHA 4URXR 1D1TA 1Y34E 4HDSA 4QYSA 1MVNA 3GRCA 3FR7A 1IN8A 3SOPA 1XFDA 2E6UX 3A1TA 1DKRA 2AK2A 2REQA 1Y89A 3Q7PA 5CM2Z 3E7FA 3IEPA 3QV2A 5JFGA 1YFLA 2X3UA 1U94A 4PFSA 1KQNA 3C1OA 4JJ7A 4FC7A 2C61A 4G0XA 2EBWA 3F6RA 1Y3FE 3H4VA 3CRZA 1KYIA 4G81A 4AG5A 2NO9A 5KYWB 3E3MA 1ESCA 4H31A 3BMOA 2I3DA 3ZEIA 5IF3A 2HLDD 3HBMA 1XZAA 2ILVA 4GO1A 2AIRA 3MTDA 5H0IA 5CA1A 3W3ZB 1XNJA 4IOMA 5HOEA 3T38A 5JR3A 1CS0A 2QLFA 2IQIA 3BCHA 2AI2A 3PQ4A 4FPXA 3H3JA 1VJ5A 1KQ3A 2C9CA 2FZLA 4RVNA 3H6GA 5ER6A 3F67A 1O3YA 1CY6A 3CPSA 1O6CA 1SK9A 1RAAA 3GNLA 3EVFA 4L6AA 1A1SA 4IHAA 4NYJQ 3OZ7A 1E9BA 1FTQA 4PLYA 2JHCA 4Q12A 2JRLA 2HHAA 2NV2B 2VPIA 3EGDB 3IR5A 2A5YB 4L8FA 1SIBE 1OLUB 8OHMA 4WWHA 1F48A 4L5YA 3I9KA 3PXEA 1F6WA 4ZMSA 1FNDA 1Q3HA 1CJUC 3I1IA 2D2EA 3C43A 1V47A 4MUGA 4HDMA 5GONB 3FX2A 4QHSA 3UKOA 3THRA 1XJQA 2ZUWA 3RYCB 2NSHA 3U5ZB 1RMYA 5F2KA 5GM1A 1XRSB 3BCRA 3CX6A 2ODQA 1KC3A 3DBLB 5JARA 4UEQA 2IGTA 4ID9A 1F8XA 1MPTA 1WZIA 3SX4A 2DHCA 1MN6A 1Y9EA 2OHXA 3PFIA 2H7CA 2YINC 3R0ZA 4AJPA 3G68A 3ZWDA 4E15A 1L1RA 1QYXA 4DSTA 1UPBA 3SGLA 4E4YA 2W4QA 2G9RA 2QZZA 3K9NA 3AFOA 4X64B 5KKCA 1PJAA 4JLNA 2IC5A 1TAHA 4CM4A 3IO3A 1ADFA 4REQA 4X45A 1XVIA 5HCUA 4A0FA 3WGYA 2IRWA 3N58A 1VDMA 2WP0A 3TB4A 4BX8A 5KOYA 2IYWA 2RBGA 2VRCD 2W93A 3LCUA 4UHCA 3C8MA 5DCLA 3WJAA 4B09A 3BTUA 4K9MA 2C8JA 4RCVA 2Y9PB 4KXWA 3CNOA 1Z45A 1LVGA 3DMRA 3E9ZA 2XZDA 2J08A 3WKDA 1YA6A 1TU0A 1UM9B 3VR4A 3ZVRA 1OBFO 2BKEA 4WZBA 3U4CA 4OLFA 1PEKE 3PZRA 4U2KA 1C2TA 3MS7A 4D3XA 1U6IA 3EXFA 3DKKA 4UEOA 2PZAA 3C45A 3GGOA 1K98A 4I1RA 3AFMA 1YKFA 4NAHA 3GZJA 4OJNA 4YHBA 3KFVA 5G1PA 1RRCA 2IS4A 2WJVA 1M1NA 4BIMA 5K03A 2ZG6A 2AHOA 4U2FA 4F96A 3E4DA 5BMVB 4OXNA 3BULA 4B6QA 1ZD2P 1S7GA 4HNSA 2HRCA 4IHJA 3E7XA 3U3RA 1YL5A 2HRBA 3LAWA 1QK3A 1E7QA 3C5CA 3HFSA 3EOBI 5THQA 3ENQA 3ZS8A 2P4HX 3AUXA 1WQ4A 1K5PA 2IHJA 2JI9A 3FPLA 2C7QA 3GLQA 4B6SA 1PNOA 2NSJA 3MM4A 3V1UA 4QD3A 1KU0A 4QE3A 3WGKA 3DFUA 5JU6A 4WY2A 1O03A 2WMYA 3I76A 2IZZA 2WD7A 4Y98A 4QJ3A 1EXNA 4PVDA 3H87A 5AJWA 2YDXA 3A9UA 3AL2A 5EHZA 2QAJA 2O14A 1IIBA 3OJWA 1T0HB 2B7LA 3OURA 1UAGA 4DJEC 2JGEA 3NVKI 1GDTA 3KR0A 1NUUA 2OV2A 3FLMA 4AF8A 3PR3A 4JKOA 2X4IA 3IEMA 3DPUA 1JWLA 4RCYA 2YCBA 5J59A 3QKTA 2C7GA 3HKEA 5AK6A 1B76A 2XYRA 5ARDA 4YAWA 3G9QA 1FMCA 2K7FA 3WRYA 5HMMA 3ZXSA 4FBGA 5EGNA 1CZOA 1R3DA 1XTJA 2F1OA 1WD5A 3L3BA 3OM9A 1V45E 2HMVA 4BGUA 4DWVA 3TSYA 3KHUA 2J46A 2VAXA 4CQNA 1AKRA 2WP8J 4HVLA 3U7RA 1NE2A 3GJSA 2G72A 3T0IA 4ZVUA 3O31A 1L7PA 2F17A 4ZQEA 1GEEA 2GNOA 5CYPA 3HP4A 2OCYC 1GPWB 2ZSIA 3M1IA 3ZWQA 4CMIA 4RSMA 2D7DA 2E5LB 1E3SA 1NQAO 1Y7IA 3G2MA 3L6BA 2EF0A 4INZA 4U2EA 3TPZA 1TEHA 1W2GA 5HQTA 1ZICA 1SEPA 5AR1A 4P2GA 2AXPA 3EVNA 1NM5A 3NKLA 3HPRA 3IP9A 3DOOA 4FQ5A 2IYPA 4FLFA 4FFRA 1V5GA 3UB2A 1IBLB 3IAS1 3TAHA 2VT7A 1F0PA 1ZLYA 4RHEA 5HS4A 1QS0A 5JS7A 1UKZA 1Q50A 1RM5A 3J81k 2HBQA 4GP9A 5JSYA 4KWCA 3A3NA 1AHNA 4YDQA 3JYOA 4M1WA 3HPQA 4WESB 3IKTA 1PZXA 4YRFA 4OI1A 1FFCA 4CQMA 1T5SA 3OM1A 4LYGA 4DS3A 1GNPA 3QEOA 1TMYA 1DFIA 3QXXA 4N5NA 2HBYA 3C7KA 3FVRA 3H9JA 2F3RA 2DULA 2V6JA 3G85A 4MX8A 1E0SA 2TSYB 1PYDA 1YI0A 4NEQA 3TLEA 2A9KA 2XCRB 2VXBA 1XCPA 4DMCA 1ST3A 1A69A 1U1IA 3C8UA 4HMQA 4EFDA 4FB5A 4HS9A 1TUGA 1QUEA 2WUGA 3E58A 3BK1A 4PNZA 1FB5A 3SE0A 2PD3A 1YZYA 2Y67A 3NHBA 3QUQA 3IAXA 1G5QA 2H1FA 5LYYA 2ASVA 2W37A 3CUUA 5EP3A 1SD1A 3TQFA 4YV1A 4Y9DA 3MOSA 4YJDA 5A7HA 5HOQA 4MRAA 3V4FA 2CYCA 4Z9YA 1SQGA 1JIXA 3EQZA 4HX2A 2MSEB 5K0BA 1RWBA 4BZPA 4OF4A 1G5IA 4UAJA 4GKKB 1II8A 4DKXA 1NY5A 1OROA 2JIZA 1TVMA 1JQBA 1KDTA 1XKQA 5JNUA 4W9MC 2FXVA 4IXDA 3WRXA 2JFFA 1W8IA 3PUKA 4LRTB 1Q1AA 2BEUB 3ETGA 3IODA 3ESZA 3K0AA 3KTAA 4DREA 3GG2A 5DHAA 1GNQA 1U8YA 4YV7A 1T5TA 3T7AA 2EJTA 5BOSA 2H4JA 3PRKE 5A4JA 3Q8LA 1UKVY 3GFVA 3ADCA 3RADC 3BC1A 1XJ5A 2IYRA 4IRUB 4P82A 2VZ0A 1X1SA 2WB2A 1PI3A 2ZWPA 1TM7E 1NFRA 3QF4B 4F1KA 1NI3A 1QR6A 4CMBA 4UCQA 3KB2A 5EAIA 1Q84A 2WYWA 1G3UA 2W2TA 2MDTA 3DTTA 2O3TA 1TD1A 3MWDA 4B3IA 2H9YA 5E4JA 2ZYAA 1URPA 4HFJA 5ESWA 1WEKA 2P68A 5DM2A 1WU8A 1DBWA 3C6YA 4JLPA 1XUOA 4CV3A 4J43A 3EH2A 1QVVA 2XPCA 4NV1A 1F0NA 3VMMA 2PUGA 3WS7A 1MIHA 1P91A 2OO5A 4GLFA 3RG8A 4E4TA 1BKYA 2OLKA 3PFKA 4IDNA 3RUPA 3T9FA 1D4AA 1XJCA 2OD7A 1VQ1A 2BMWA 2DR0A 4NOMA 1S02A 3GCWA 5ALUA 1GXSB 4XRRA 2PS9A 4LWQA 5HUHA 2QTLA 3AM4A 3TSOA 2YUIA 5IJWA 3EQ6A 3JSXA 5DBEX 1A8UA 1C3LA 2LCFA 4BX0A 4GRIA 2Y6VA 1QV9A 4KB5A 1VPEA 2VT2A 5CB4B 5HF9A 1Z74A 3P1JA 1EHYA 2FEAA 2GPBA 1PYGA 4KG7A 3I37X 4B9EA 3OX1A 4RMNA 4W5OA 2HCFA 3OKAA 4B85A 1VYHA 4MRMB 3PDCA 2FZ4A 1XKTA 1P5JA 2QZJA 3Q0IA 2EARA 2VH1A 1GPAA 4CN9A 1LSOA 1IXRC 5FA5A 4QOSA 3PPVA 2ONJA 5KSZA 3HGTA 5I45A 4RKEA 2BAGA 3M6FA 3PA8A 4FI3C 3V1MA 3C8HA 1QTQA 2B82A 3O73A 2XADA 3DMNA 1PFKA 3RHZA 4UCXA 1T3SA 3ML1A 3C41J 3QUTA 2ZIEA 1WL8A 1F5NA 2E1PA 2ANCA 1BH6A 2O50A 2OILA 2Q2VA 3QF7A 4WRRA 1IPEA 2I29A 5DTRA 2AR0A 4Q3EA 1KAEA 1QRTA 3O26A 3B1KA 3C5WP 4WN9A 1NXTA 4NABA 1KP2A 4L4XA 4YGYA 3HJFA 2QMUA 1C9JA 4EY3A 3OJCA 3COYA 4XJSA 2QX7A 4DJTA 4O2BA 2BN4A 3CO5A 1YS1X 2ZR9A 5AT1A 3PDUA 1DJMA 1NYRA 2ZI3A 3AMVA 1X92A 3LY8A 4Q6WA 4M9SA 3RUCA 1L2TA 1X9GA 1BGWA 1B00A 1OA1A 2YCLA 3E05A 4HX5A 4CIVA 3VSDA 1RACA 3PCRB 3RNLA 2A57A 1X13A 1Z4MA 4LJ8A 1E3LA 2GYVA 1GG5A 1FRQA 1MMFB 5D3QA 1OVMA 3R0JA 5T4FA 2C04A 3DL7A 4J0DA 1J9ZA 5DCWA 3V8VA 1YJCA 2PUCA 4LRYA 3UJ6A 3HR7A 3AR7A 3IKJA 3L82B 4ZO6A 4GWLA 3JD3A 1GPKA 2LIPA 3R74A 1VHLA 2P90A 1QPBA 1LW7A 4GOLD 2GSWA 3STXA 2Q50A 3N70A 1N8NA 4H35A 2XNJA 5CBPA 5BSWA 1DNPA 1QFSA 4L8VA 3FNFA 1Z0IA 4ZAVA 1CUCA 4ZD6A 3T7CA 3EVEA 4CIDA 4DV6B 1WD7A 2PWAA 5E4FA 5H3HA 4C0XA 1RE1A 4ZT7A 3PUYA 1NKSA 4J2TA 4NV0A 1I94B 1WUIS 2EJUA 4BUCA 2FK8A 5TQ2A 3W5BA 4HDAA 2XWQA 3ESDA 1Q83A 3G2KA 1IEXA 2OO3A 2V7BA 5CK4A 2YV3A 4R1OA 1UDAA 3F5FA 4HSGA 1O9BA 5EIFA 3RCBA 5JNTA 1EFCA 1GV1A 1AB5A 4G9GA 2ZBRA 5IVIA 3VSBA 1Z4PX 3EISA 3O93A 1WHTA 4RWEA 3FMIA 3NEJA 3DS8A 3PL5A 4J1NA 4XYBA 4RQUA 5LLSA 4DM3A 1NVVR 4RIEA 2VJAA 2X0NA 1OFIA 1YOVA 2VNSA 4ABTA 4K8RB 3FNIA 1TUBA 1ZBQA 1L6RA 2QRKA 5E6UA 3ND7A 1VKNA 4GMFA 1OXSC 2PKYX 4XB6B 4DLYA 2XT0A 3D3EA 3O8LA 2MINA 3E9DA 1DQNA 2H5EA 4LVNA 3FFBA 1P44A 1V3QE 1JKXA 2OXCA 4G01B 4EUNA 1RW4A 4WDRA 3LIIA 4DSAA 3TTWA 3CSSA 4TUYA 4WI1A 1PL6A 3GZ4A 5U4XA 3P2OA 4PHHA 1MA0A 2PLFA 5BR8B 1BGXT 1NTOA 3EODA 3IP6A 4LYAA 3ZWNA 3JWEA 1OWMA 3AZQA 5KDLA 1E9CA 4E1VA 2ZRFA 4REMA 4EMTA 3I61A 5PGMA 1W48A 3FRJA 1EWTA 3ETCA 1U7XA 1AV6A 3F6EX 4A15A 2X0KA 2G09A 4IBOA 2YFHA 3AQIA 2NACA 3IEXA 1YCHA 2QPTA 4D4KA 5A4DA 2V4ZA 1NSTA 4B84A 4K9KA 1MJ5A 2RJ3A 1GRCA 1GPBA 2PQ0A 3IV6A 3W06A 2FPOA 2C2HA 5ED0A 2JIMA 2IPAB 2W11A 5AW7A 1NL3A 2VHXA 4ZVTA 1SK8A 4R9SA 5BSTA 1E9AA 3HN6A 4KQCA 4R8KA 2NTJA 2OHFA 2ZAGA 1YJ5A 1NJGA 3ADKA 3R3ZA 4PCLA 1JAYA 2VPWA 3FAKA 1ABEA 3KJIA 3TZLA 2AF4C 1E2QA 4WY5A 4FX5A 3D8BA 2AVDA 3OUZA 4JUDX 4HQ0A 4BV2A 3N0RA 3DDWA 1TU3A 4RVUA 1X7GA 4NNOA 4RMGA 1DC8A 2CE7A 4EY4A 1Q1GA 1J07A 4BQEA 1Z6ZA 5K2MA 3BPSA 2SICE 3GFBA 3DBVO 4Y6GB 1Q0QA 2Q3BA 3O8BA 1QSGA 2CXSA 3D7NA 1NMEA 1ZGBA 4TMVA 1G2QA 4KV7A 4NK5A 2FSGA 2BHSA 2C58A 3R0XA 3ZTTA 4CTMA 3EVCA 3OFND 4KLZA 3GRUA 2VCEA 4FHZA 3L8FA 3HVHA 3FYDA 4QO7A 2IW3A 3U4DA 4AZ3A 3OOHA 5ALZA 1VLJA 2FETA 3LDHA 5J4YA 2H92A 4EJ6A 2V0GA 2G9NA 3E2IA 4KO8A 2ZIAA 2WYUA 2ZSBA 1DCTA 1NOKA 3ASYA 1UAAA 1W6RA 5BQFA 3NGXA 1SRRA 2X7JA 4UHJA 3CIFA 4DANA 5CA1F 1Z82A 3U4MA 1GNVA 3A9SA 2IZ7A 3EIEA 2WIKA 5EJIA 4ZI2A 1M2OA 2CJWB 3MTJA 4FQ8A 4XGIA 3TIGA 1M5UA 5BO5A 1FP6A 2XVXA 3EQ8A 1RZRA 3EUAA 3OOEA 4FSHA 4WAUA 1E77A 1GRQA 4DT1A 3U3OA 1E6CA 2GK3A 3I8OA 3PR1A 1ORTA 4EG8A 2IQ5A 4IW3B 1YJXA 2ZBEA 1NYQA 4XOUA 2Z6AA 2FXIA 2WWTA 1S2IA 4IEEA 1SH7A 1TJPB 2Q6VA 3HGQA 4FKBA 4LNHA 1KC1A 4MRPA 5FUYA 3UGTA 2FPWA 2OHJA 5JTTA 3Q2OA 2XKKA 2P75A 4E5SA 4EW1A 2FGKA 2O2SA 5D6OA 2FKNA 1SD5A 1A0OA 5JMOA 4QPCA 2QX6A 1PNVA 4XEUA 4ZGGA 2P79A 1UPAA 3PHJA 4F4DA 4B32A 5HIAA 1Z8DA 3GLTA 3DHEA 1JSXA 4RK5A 5LL6P 4PZZA 1M6HA 2H5LA 3NTXA 3QLEA 1FTYA 3IBFA 4C4AA 5KNLA 2A2ZA 2II6A 1TPZA 5HGJA 3M4ZA 4B40A 1ZIYA 2VAVA 2XE7A 3T35A 2XKJE 4U4AA 5JHHB 1MQ9A 1TI7A 5E8RA 1V39A 3ZDEA 3I9OA 4C3ZA 2DXIA 4E5MA 3UVEA 4KITB 1V2HE 1KBOA 4JT4A 1Q2XA 5FTWA 2RB5A 4BN5A 5KWIA 3L9XA 2FWMX 4RVCA 3JRWA 1M8KA 1ES9A 2E4UA 3B48A 4M9CA 3ESXA 3MEQA 4MWBA 1HH4A 2OHVA 3HY4A 3NBYC 3T1HB 2HO4A 3L0BA 1B8OA 3R5TA 4Q16A 2DYKA 4FJ2A 2GERA 3FVVA 3GT4A 4KBFA 1N6NA 2PH5A 4OM7A 5GVRA 4FN5A 3R5JA 4DTCA 1GPJA 3IPAA 3R40A 5FUXA 3IESA 1XTKA 4WIAA 1LDNA 5C8XA 3OCUA 2HJSA 2ZJYA 3ESQA 3KKOA 3QFHA 4UAUA 1CULC 2XVZA 5HIKA 4CFSA 1PFYA 3H3XA 2ATVA 2YICA 1ZHHA 1RYMA 2OFXA 1RLMA 2EKLA 4KFUA 4WZAE 4P7JA 3PFBA 2VCYA 4WUVA 4RLSA 2ZJ0A 1GGHA 2FSPA 1TO2E 5JC8A 4XD7D 4YLYA 4FGSA 3VHXA 4DRXB 2WM2A 1N1EA 4OH1A 5AJUA 4TQ9A 3SF8A 3K2IA 1EK6A 1W9HA 3LO5A 2WUEA 4ZXFA 2IZ0A 1C1XB 4ZO4A 4CKYA 1G291 1WB4A 1L4LA 3K1AB 4PSAA 4RPCA 3TKYA 2HJ9A 1Y6GA 5K1ZA 1GA1A 5L40A 2C2YA 2FW0A 4EGQA 2GN6A 2Z83A 4L0CA 1PWHA 4V02A 5IJ9A 1IOWA 1NX6A 2GXQA 3EF1A 3K8ZA 1YACA 4PS1A 4RYDA 3OPVA 5FPKA 3A4VA 4NS4A 1G1AA 1UXHA 3P52A 4LISA 2PIDA 1OXKB 2MYNA 2PG3A 4L4SA 4IHJF 1X7DA 4GXNA 5CD9A 3TECE 3PHCA 5AKYA 1YJAA 3RFCA 3O38A 4EEKA 3KYIB 1FJGB 4HQNA 3JPYA 3PEFA 3S99A 4D8YA 3N9IA 1KARA 1UKAA 3FDZB 4KMOA 4QO8A 1P6QA 4PG7A 3DXFA 3GVXA 1O94D 4AZ0A 1RRKA 4DLVA 1AXRA 4PE5B 1P60A 1FMTA 3KJGA 1O87A 4AZVA 5HJEA 2Q3LA 1MDFA 3OKPA 1XWWA 3DOHA 2ZP1A 2XYHA 3FOCA 3VR1A 4EELA 1EUCA 2E6KA 2EATA 1W73A 5FWNA 1NI5A 3CUVA 1KFBB 1IHUA 3NXSA 2O20A 2CSUA 3EWAA 4LK2A 4I8DA 3N0TA 3AIOA 3ABIA 3RRMA 2CXXA 1JVSA 3WNQA 2ID8A 1HFKA 3QFRA 4WD3A 2PX6A 4FHDA 1GTRA 4AECA 1RLOA 5D5QA 3RT1A 3TRFA 5K8LA 4MQFB 2HSZA 2HCTA 2JJYA 4C7OB 1DB3A 2ACVA 3OU2A 4LMRA 5BNWA 1ISIA 2DJIA 2C31A 4JEUA 1U0HC 5ALOA 3RFXA 3UFXA 2VDUE 1SVMA 2QRZA 3I9JA 2BMAA 3O3OB 2HFKA 1WW3A 1LDBA 2GCOA 4INJA 2CLCX 3VOTA 2ZPUA 3LQFA 1MENA 3UV6A 3DFFA 1ZUWA 3W6OA 3STVA 3H05A 5EXXA 1ZMTA 4X1IB 2QU7A 3T3OA 3CS3A 1J5PA 1CJMA 1YUNA 4MB6A 1ZYUA 2BONA 2VDKB 4LX0A 4Y1RA 3TLGA 4D6XA 3AERB 4EG1A 2ZW9A 4EL0A 4DQXA 4C03A 3R3WA 1S9DA 1JSZA 3GPIA 1Z2NX 4L6IA 4KFTA 5H4GA 3IQDB 5ICMA 3NPAA 2NQTA 3AGPA 4A8JC 1SHLA 2ZUCA 2DPXA 3D6TB 3RUHA 3ZLTA 4IGIA 1A5SB 3D3KA 3LA8A 4H1UA 4EY6A 3B6KA 3KWFA 1ZCFA 1Z0JA 2ONCA 3ANTA 2D0DA 2C82A 4IIVA 5IASA 5LVAA 2BFDA 4W7HA 2XUFA 5HYVA 5HK9A 5CGQB 3MCTA 2CY0A 3HCRA 3NVAA 4JQSA 4WACA 4Y2YA 2HIHA 3VYSB 3EJ6A 3BXGA 1GPLA 2EIHA 2IYEA 2PEYA 2YS6A 3CF0A 1QFMA 4ANFA 1WXWA 1WM1A 2OD9A 1DIBA 4DPMA 4ENUA 4BB9A 2W6ID 5DI9A 1GTJ1 2Q7DA 4URWR 1Y1PA 4O5OA 4HPWA 3H99A 4CG2A 3ADBA 4C4OA 2WPDA 3SZLA 4GNRA 3QEBZ 5B64A 1R6XA 2PGIA 4FCTA 2V98A 1QHXA 3UIEA 1JLKA 4JVNA 3O5AA 4Q7KA 3VZBA 1NXPA 3V1LA 1OFTA 3GL9A 4W9RA 3RASA 3K9WA 1WZEA 3BWDD 2OV8A 4HDQB 3FOFC 1CEEA 4LVOA 4Z51A 3B78A 4ZVSA 1LPBB 4FMCF 2GD0A 1I2BA 1G64A 3AHGA 3I2FA 4OY3A 4EKYA 1PLJA 5KNBH 3AEUB 3WNVA 2RGXA 1U7WA 1U04A 4WFIA 3EX7C 2G4LA 4HXGA 3A2MA 4TYQA 3BSYA 1XPJA 3LMKA 2YXEA 3DYIA 1Z2AA 3L6OO 4WN3A 2VK8A 4A2PA 3THYB 1RKVA 3KHSA 4FHEA 4WNAB 2QG6A 2KMLA 2OB2A 2N1BA 4Y2QA 3S2ZA 1WKVA 3T54A 3IAFA 5F23A 3PUVA 1TVKA 2P62A 2RI1A 2M6KA 1TNDA 5DLDA 1YE8A 2PKRA 1SC4A 4I66A 3DFKA 3F9CA 5F12A 3RVMA 2MSDB 2GM3A 3U1TA 4X5OA 1ISJA 1Q3KA 3UKJA 1TEXA 4YR7A 2PLRA 2QUAA 3PQ3A 4PV7A 1RXSA 2HQOA 1Q7BA 3RS2A 3P0EA 3QUAA 2DHDA 2WKQA 2XB6A 2VPXA 2CYAA 4RNCA 3ID6C 3CISA 3FMFA 3OKFA 3FHLA 3FSGD 2CL5A 4IQ4A 3RGGA 2H2GA 5T8KA 4PG5A 1X1QA 4H16A 5EJ7A 1XVLA 3LKDA 1I4LD 1FLNA 1LI7A 2D00A 2IS6A 1T3ZA 2BKLA 2ATIA 1VZ3A 3CLVA 4P4TA 3E27A 1RWXA 4CMCA 1G8MA 1HMPA 1W85B 3EVTA 4GLLA 5BWCA 4M0CA 2OESA 1JWBB 1P2SA 3IDFA 3EZFA 4UXHA 5KX5A 1J5EB 2PA0A 1SCNE 2FSHA 2JGAA 4JSYA 5CDYA 4PZ0A 3JZFA 2P9QA 1U8TA 4I55B 5EVJA 1SUPA 1X7YA 4YJ3F 1G7SA 5KCMA 1UMBB 1DAMA 4TXHA 2XZPA 1GNLA 2HFJA 5J2TA 4B3BA 2OFOA 3HZZA 2PRKA 2WVAA 2XQKA 4LXUA 4QNRA 1VE3A 1BGVA 4JD5A 1L3CA 1XRPA 1GGMA 1VI5A 4TLAA 5EHGA 5DGTA 4BNDA 3WGNA 5BWNA 3O0TA 1ZQ1A 2PS0A 4Y2JA 5BVHA 3T3EA 5CA0F 1G59A 5JADA 5F1PA 3UK2A 1XD9A 2BISA 1JSRA 1LX7A 1WDKA 4RY8A 2AE2A 3KBOA 4TXLA 4F72A 2O8FA 1EYZA 3KZVA 5SV2A 1JFTA 4RDHA 2QJWA 4BLTA 3KOWA 3ROPA 4O2BF 1I2ZA 2AXEA 2X58A 4P4SB 1KI1A 2JARA 3I2IA 4I4CA 1ABBA 3D5TA 4PZLA 5EP1A 1IXYA 4RIIA 1QX3A 2J8ZA 2OLEA 1PR5A 1X38A 2JGRA 2BFEB 1TZ2A 5LA6B 3UENA 1A8PA 2CB9A 3NJ4A 4A8JB 4HH3C 4CUJA 1V48A 2R2AA 2FQQA 1C1DA 3A14A 1IB0A 2Q0HA 2J6IA 4DFDA 3W3AD 4Z4IA 4JHLA 3SJZA 1JHPA 4C0WA 2JFYA 1B6TA 3EGVA 3N86A 1QIFA 4P98A 1FL9A 1G0NA 4NYJR 3ODPA 4RC9A 3V3KA 5CMLA 5K0JA 2E5WA 3U56A 4TVSA 5CLJA 1JEDA 2VJDA 5IYZB 1AKNA 3K6KA 4ZU1X 1KRWA 4RZUA 1ZJ6A 3L1JA 4UEJA 5ELXA 1GFSA 4FNGA 3M4XA 1A50B 3FZNA 2JGLA 3O1HB 2P27A 1YB7A 3SHVA 1G3RA 4I3HA 3PHLA 1GCUA 3GMDA 1SU6A 2AJCA 4MB2A 2XE8A 4CKXA 4W1PA 4I4TB 2RHLA 1AUVA 3G5LA 2B36A 4PLTA 5B6PA 1QHIA 4C4RA 4DDTA 4QYTA 1WSAA 5EJMA 3EQ2A 4YP0A 5IKXA 1TKAA 4HB4A 5AJHA 1Z5VA 4YK7A 1K63A 1TQDA 3VGPA 2ZULA 4E1AA 1M1UA 3KX2A 3ANMA 2JIPA 4GZ3A 3E6AA 4YWJA 1ODSA 3ZJ4A 4K8OA 4LJYA 1E1MA 1K7CA 1Q20A 3AW9A 1NVUQ 3SYTA 2WTNA 3MWYW 4FX2A 4O4JA 4HLUC 2H9IA 4ED9A 4GPAA 3WZMA 1FFGA 3P4XA 4R71A 1XZLA 2KWIA 2QRVB 1HORA 4IJMA 3K5PA 3G0GA 4K9NA 3SNHA 5CDHA 3JD4A 4LC1A 1UBTS 4OJYA 4WUTA 2RIPA 5F9FA 4MS4A 1GRVA 1C3OA 2QTRA 2C20A 2OWEA 3FGNA 1X87A 1S2NA 3RO7A 3IOEA 1H8HD 1QG4A 1MXFA 4A0RA 4DEVA 3GA5A 3FJOA 1D0VA 2ON6A 1J56A 2QVBA 5B7QA 1C8VB 2XRMA 3AIMA 3MGCA 4N6GA 1M2FA 1GY8A 2H9AA 3MB5A 2W6NA 4TUYF 4DG8A 3FYUA 4EHBA 3D54D 3AVUA 4R8LA 2F4VB 3G23A 3VM6A 1P9RA 4EEXA 4Z7JA 1QO7A 4HZGA 4IXNA 3T1VA 1TUEA 3F6YA 3K5IA 3KZ1E 2GD1O 3EZXA 1C7FA 3H2BA 2AFIE 5JANA 2VIIA 4RTNA 3IPLA 1FDWA 4IJKA 2ZTLA 3TLJA 3TAUA 5ALRA 3RU3A 4LJ5A 4EAQA 1O6FA 1YHZA 1R0LA 4IV0A 2H6EA 3OI7A 4JN6B 5I7EA 5FAKA 1DO8A 4Y2RA 4PNPA 3UJBA 1PEYA 4MR7A 1SVUA 4EKIA 3DTNA 4I5IA 4DVGA 5A0TA 3S28A 3TSCA 3KXPA 1RCTE 5LM3A 4M6WA 3L8ZA 4NU6A 2C4NA 3TM5A 5LOVB 2QYHA 3FTNA 1PJSA 1LX6A 1CDDA 1ZM7A 3LVQE 4U3JB 2IU0A 4RYLA 3KEMA 1MEJA 1O6ZA 4GX0A 4V3BA 1UJCA 1WUYA 1Z13A 1JGTA 2IA5A 2O0LA 1BJKA 2XUHA 1YVRA 4R2WA 4O4LB 3CRQA 4HYTA 3AVTA 2V9PA 4HLNA 4RXUA 1T6BY 3S0JA 1D09A 1CUAA 4ESOA 1F60A 2ZI7A 5FI1B 4L4YA 2P35A 4JNCA 4CLOB 1F2VA 3A3YA 1CNFA 1EQUA 3N0WA 3E7WA 4G6ZA 5KEIA 1Q77A 4EVRA 4OOEA 1GKYA 3DZHA 4R84A 4XWYA 1FFSA 1F2TB 2WU8A 3P9QA 1KH1A 5B36A 1F1BA 4KFSA 1SVKA 1H8ED 3P2KA 5E0KB 4WERA 4DIFA 1K8YB 4R31A 4DLKA 3UGJA 2IUEA 5CDFE 3G7SA 3NHPA 2B83A 4XIYA 2PDAA 4WGGA 5LP6B 4EGSA 3KOZA 3PGMA 2YZKA 3I2YX 3IMEA 4OQLA 3O74A 3QTTA 2VP0A 3RC9A 4BMSA 5HUJA 5EFOA 2VYVD 1AK9A 5B5SA 3GI1A 3KKZA 1O6GA 4RHFA 4AJLA 1JDPA 3PYMA 5H82A 2DTXA 1QE5A 2UYGA 1W59A 4LRUA 4LHVA 2VNAA 1RHJA 2B4KA 1EUYA 2PT9A 1MABA 2WMOB 1M2VB 2RHGB 1N9KA 1CWUA 4M36A 1GYRA 4JZKA 1IB6A 2PO5A 1XQ1A 1G5FA 2PRJA 5AI9A 4MIOA 5B1HA 4MWSA 4J90A 4EQZA 2HDHA 3I45A 4KXXA 1E7MA 3A1EA 4LQDA 4OSPA 4DIBA 1QH9A 5GVSA 4CEIA 3DV2A 5D7NA 1EFUA 3EIQA 1RWNA 4PYJA 3E48A 5DM60 5BOVA 1QQ5A 5HRCA 1NQUA 3C8DA 3M4NA 1YR2A 4IDAA 3U6BA 1G66A 3FF4A 2UUCB 3KNZA 4LZWA 2E1RA 2VJMB 3OUUA 1MHTA 2GM9A 2HAEA 5AM4A 2Y1OA 2JLRA 1THTA 3LBIA 4KQHA 1TQ2A 3DZIA 4HUQB 3ZE8A 4RJ2A 5I7RA 2IUTA 4GGOA 3GJ7A 1E8DA 1HY3A 1FP1D 1TRHA 4X8LA 5FJIA 1Q0RA 3UH1A 1AZWA 5CLGA 2A9OA 4MVJA 4UMDA 3ECSA 4LQ4A 4HFMA 4Y2HA 4JP8A 4RPJA 1SY7A 1ECBA 2IXFA 1HE1C 4QOHA 4RD3A 1R8XA 4ETWA 1ACLA 5BV2P 4AKGA 2X8AA 1J23A 2MR6A 2A67A 1C8LA 3S8YA 1S89A 4R51A 4YMWA 3MT8A 4Z54A 5AI8A 5JAMA 1GITA 2R4QA 1GDHA 3UW1A 2Z5VA 3Q85A 1Z0FA 4CTOA 3PE3A 3C97A 3FLEA 4WLNA 1HTWA 4MHOA 5A6SB 3U0BA 4BMPB 5I7UA 4DZZA 2D74A 3KBBA 4YT5A 1LNZA 3KZOA 3SZOA 2X86A 2C7VA 3L7NA 3ZI4A 5BXQC 1BX0A 1D6NA 2EZ8A 4UD2A 3WMXA 3ZKWA 1CR6A 2ZJ3A 3NHLA 3PDIB 1GU1A 2R87A 4AJ1A 1AIPA 3NJ8A 1DT5A 4ZU3A 4K9LA 3FUCA 4OLHA 4KI7A 4UUPA 1B8NA 4I50F 1N5OX 5JQGB 5C1PA 2PD4A 5EA2A 5MF6A 1MX5A 2QUBA 2G76A 1RU3A 4EPVA 4JITA 1ZOOA 1AMNA 5JSZB 4ZCRA 2LXNA 4ETMA 2C4TA 4PVCA 3HVKA 4GEKA 1Y5NA 4TTJA 1BEZA 5CYOA 3OEHD 1ENPA 5AVYA 4L3WA 3BH7A 4D3DA 4DV3B 4PHCA 3UT5B 3E3LA 1FOEB 4R0VA 3QU5A 2E4ZA 4UE6A 4G0QA 2WUDA 3A70A 4HNAA 4LFBB 2AOVA 3IIIA 3SIXA 5D5PA 1HLFA 2DH5A 5KTSA 1SD2A 4C01A 1NJ5A 1E5DA 5EJAA 3KOYA 2BM0A 3GW8A 3JR7A 5H81A 3K05A 4C0SA 4BCDA 1LK7A 4NE2A 5IZ4A 3DEZA 3KO8A 2X6RA 4PLWA 1Y1TA 5JROA 5G0WA 5DISB 3KKEA 1K1EA 4GT1A 4F6RB 3PQ7A 3KYDA 1QBGA 2NU9B 2RAPA 1P5HA 4G0NA 4G3XA 2IZ6A 2ZCJA 4JIMA 5LIRA 1UMDB 1H5NA 2M9MA 3AR2A 4MH0R 5L7TA 5DNVA 1PK7A 3PFWO 4NH4A 3V4ZA 2WT4A 4TYYA 4K28A 4X84A 5A02A 2C1ZA 1PVVA 4UMVA 3QHQA 2RCNA 1MEOA 5CURA 3TLKA 2FU5C 1NIJA 3F74A 3LDFA 5FEUA 2QN9A 3PLRA 5K3OA 1C4XA 1M2HA 1CZLA 3PHBE 2V8OA 3Q1KA 1K8RA 3EVGA 3FPKA 2W2OA 1N75A 4K5QA 4FE4A 4LECA 4OV6B 4IDDA 3QVUA 2W6CX 1G8AA 2AZDA 1YRWA 3FE2A 4DSOA 1J9EA 2ZYTX 1B16A 3B52X 3F96A 4YAIA 5DX0A 5K0NA 5DT2A 3DXZA 4PZPA 2FDRA 1F2DA 4F5ZA 1H23A 3EGEA 4IQFA 2VQDA 4M9UA 1M76A 4XUEA 5G0SA 2YMMA 4B1FA 1PW7A 1WPGA 2VPTA 3KE9A 4FFLA 1JLHA 1HE8B 4QREA 1NASA 2QVXX 2COKA 3S2IA 1IZ0A 3NH6A 3ZWXA 3VKUA 1EH5A 4YMGA 3IDOA 1V9SA 1OB5A 3BG5A 1HTTA 4B4OA 1GPH1 3TVTA 2CVFA 4MK4A 2AEJA 2J09A 5I9IA 1YMQA 5BYJA 2BKXA 3IVAA 3MPUA 5KYYB 2ZQ5A 4UM9D 1JHZA 3M89A 3WVNA 4D8TA 2Q2NA 1UBNA 5TF0A 1HYGA 2R8ZA 2XCSB 4LF5B 1RMQA 4OAQA 2Z95A 3TSAA 2R84A 4RKFA 5AK3A 4BLSA 1GSIA 5ARBA 3H75A 1A9SA 4RHXA 4GMHA 3ZE0B 3GARA 1QJ4A 3Q5EA 4BTLA 5LFAA 3LDGA 3QFSA 3HDJA 2ZYHA 5HA5A 1FQOA 1NT4A 2C92A 2BE9A 3KR1A 4YRPA 3BKXA 2DFNA 3AF3A 5BT8A 1JDJA 1AB6A 1ACMA 4C4YA 3C98A 2C2GA 4MI6A 1KEWA 1HA3A 2BY4A 3IPRA 1JAHA 5CHEA 3DLHA 3E53A 1M33A 4GLBA 2PXAA 4DRYA 4CQLA 4CEJB 5LDDC 2ZI9A 3EIOA 5H68A 1TOAA 3A1VA 3DMGA 2RCYA 4BBJA 4U9IS 1O0CA 2Y27A 4HDKB 5KJEA 4ITUA 1IU9A 1VE1A 3UAOA 4FOOA 3TX6A 2WTMA 4UTRA 3OWHA 1TGVA 3WYNA 4A8PA 4PG8A 3RTGA 1K08A 3D2AA 2J6HA 3B9BA 4QUIA 5PNTA 4EEZA 1N2ZA 1XL1A 3A6KA 2DLNA 4YCBA 2B7BA 2G9VA 3KSUA 4I3GA 4FFOA 5C1OA 4B3RB 3ONFA 5ED4A 2WV9A 2YH2A 4L15A 4HDCA 5EWLA 4B6OA 1P0FA 3WK7A 2OORC 1PO7A 2O1WA 4B35A 1Z8FA 3ZJ5A 1UC9A 3ZCUA 5CFLA 5JECA 1E62A 2CJYA 1L4UA 2B30A 2FLVA 4NP6A 3OZEA 4FKZA 5FL3A 4X60A 4F12A 1W5TA 1RVDA 4JODA 2HU8A 4M86A 3UKDA 3EG9A 1E1QA 1P5FA 4GI2A 4I1YA 2QENA 2OFPA 4KE9A 5LXTB 4RD2A 4EO7A 1GG8A 1UPTA 1TMGE 4ARBA 5IKEA 3RJ5A 5HKOA 1ZZEA 3ZS9A 3FOZA 3K6SA 1O95C 1SKQA 4BQPA 4BZZA 2PJRA 2UUPA 1UQUA 2P4SA 2P7HA 4NSNA 2EQAA 2TMKA 2R6HA 3LOUA 4NX2A 4Q47A 3QFFA 1F06A 4X9XA 2DWUA 4Q9KA 3X44A 4EX6A 1QZXA 3P97A 2HNAA 4D4GA 5L8VA 3AZOA 5KMGA 1XDBA 2YFYA 3Q7TA 5J2TF 1XSEA 3ESCA 5JPDA 4P0PB 1DX6A 1NT2A 3VTZA 1K92A 1QM5A 1ENYA 4OP3A 3EDRA 2CHUA 4BNZA 1NHGA 3EG5A 4N39A 4D97A 4G86A 5HM6A 2OKGA 1WXIA 2Z4SA 5FTKA 1W4RA 1VLQA 1XAIA 1INLA 4N7BA 2GI4A 4UTPA 2P77A 1U31A 2W6OA 1FJHA 1A96A 1BRMA 1COZA 1P1IA 2IUFA 3H11B 1GA4A 4FEGA 4GI1A 4NMLA 3R7AA 1SVIA 2LBPA 4X6UA 4ZARA 4J0HA 4OHWA 4PYRA 3USZA 4P31A 1M0TA 5K4HA 4DIUA 2WF9A 4RK7A 3N8KA 2O05A 4LXYA 4D6YA 3X1MA 4FMDB 5EUMA 1XV5A 4EPYA 4O4HF 3WGJA 3RDPA 1K7XB 3CW2A 3NP7A 1FFDA 1JKMA 3AI7A 3P5SA 5TQ0B 1G6Q1 1I8TA 2OGZA 2XDQA 2IX3A 1WCWA 3DMTC 2ZRNA 1EIZA 1V8PA 4GOOD 4ZJUA 3WAGA 3N1UA 1UBJS 2CUNA 1U0GA 1YJ8A 2L0XA 3KRTA 3PT9A 1HDZA 1UQTA 3QG1A 4QUKA 5HF8A 3WQRA 5KNDH 3A05A 3H18A 1N7IA 3AESB 4UREA 2MSCB 2H1RA 5IARA 4KO3S 5ITSA 2PZFA 1KPIA 3T99A 4N0DA 3UG6A 5EMKA 3Q3JB 4A5OA 1BOOA 3K6JA 1M1YB 1GPUA 3T15A 5KOIA 4CTJA 3LM8A 2O8BB 2YXPX 2C5FA 3D59A 2B4AA 2R79A 4P58A 1OY1A 4YCAA 3H7IA 3W0LB 2C98A 4DV5B 4LI3X 421PA 1J8FA 4N40A 5ITZA 5LUAA 1P72A