3H75A

Crystal structure of a periplasmic sugar-binding protein from the pseudomonas fluorescens
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
340
structure length
328
Chain Sequence
LTSVVFLNPGNSTETFWVSYSQFMQAAARDLGLDLRILYAERDPQNTLQQARELFQGRDKPDYLMLVNEQYVAPQILRLSQGSGIKLFIVNSPLTLDQRWIGSMVGDDEEAGYRMLKELLHKLGPVPAGHGIELLAFSGLKVTPAAQLRERGLRRALAEHPQVHLRQLVYGEWNRERAYRQAQQLLKRYPKTQLVWSANDEMALGAMQAARELGRKPGTDLLFSGVNSSPEALQALIDGKLSVLEAGHFTLGGWALVALHDDALGLDARRLGGPDWQLSLFQALTPAQARQLLRLGDQVGTRVDFRGLSAQGKPDSYRYPFGLQLLLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic sugar-binding domain protein
publication title Crystal Structure of a Periplasmic Sugar-binding protein from the Pseudomonas fluorescens
rcsb
source organism Pseudomonas fluorescens pf-5
molecule tags Sugar binding protein
total genus 99
structure length 328
sequence length 340
ec nomenclature
pdb deposition date 2009-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3h75A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3h75A01
4Z4EA 2JBAA 5T7BA 1ZH2A 4YGXB 1GLGA 3M9XA 3C3WA 3I5AA 4IF4A 4G0YA 5JNSA 1ISRA 1NXOA 1JBEA 3LUFA 2OENG 5DGCA 3IP6A 2P9HA 4PEVA 2E4WA 3G85A 1NXSA 5KC9A 3SQNA 3Q15C 1FFWA 1U8TA 4YLEA 5CNIA 4NV3A 3LUKA 4E7PA 4Z4FA 2RJNA 1DBWA 3LUGA 3QEMB 1SXGA 1T34A 4EVQA 8ABPA 3MM4A 3CG0A 1ZAYA 2FN9A 4LX8A 3HUTA 3R0JA 2L2QA 1USGA 4OTZA 4NQRA 2MSWA 5TPZA 3O2SB 3HXMA 3Q41A 1MAVA 3Q9SA 1M2FA 4GNRA 4XAQA 4KMRA 2A9QA 4UHKA 3HK2A 4G0OA 1P6UA 3JPWA 5CHYA 4IMJB 1PEAA 1ZH4A 4F3TA 1EWKA 5BR1A 1QQAA 2FLKA 3O75A 1LJLA 3ROTA 1U04A 1ZY2A 3O74A 4YP9A 2CHFA 4MAAA 1QP7A 1FFSA 2PUDA 1QKKA 3O21A 4RK5A 2PMCA 5E3JA 2AYZA 1DRJA 6ABPA 3VNAA 2V0NA 5JNTA 1QNLA 3H6GA 5EWLB 2IOYA 3C3KA 1Y1LA 4KVFA 4MS1B 4EYQA 1CYEA 3JS5A 3OLYA 4KREA 1DCMA 4PZ0A 1LK0A 3RVSA 4KK4A 3LKBA 5EWLA 4N41A 1D5WA 1XHFA 1DC8A 2WJAA 3FGZA 5IBQA 1PUXA 3EQ2A 3CS3A 2PUCA 4YRZA 1F51E 1NXTA 4IRXA 3OMWA 3OM1A 1M5UA 3TMYA 5DCLA 5KQLA 3DBIA 2L17A 3LKVA 2FQXA 4HNSA 5CNKA 5DLEA 5TPZD 1WETA 4QPJC 2HSGA 1KMIY 1M2EA 4JAVC 4MYRA 3HM9A 2FMKA 3B2NA 3T95A 2PUAA 2FMHA 2IKSA 5DTEA 1NXPA 3CNBA 2F8TA 1OXBB 3RVKA 5KI6A 2X7XA 3CG4A 1QQBA 1DBPA 3N0XA 4ML3A 5TPWB 2IYNA 5IUJC 5JNRA 1JDPA 5KQPA 1Z2EA 3H1FA 2VK2A 4YV7A 1EAYA 1D1PA 2H3HA 1Z12A 1AB5A 1YIOA 3GA5A 2WRZA 3C97A 5TPWA 2WJWA 4MS3B 3H5TA 4ETIA 1C4WA 3QX9A 2FMIA 4G97A 1ISSA 1JX6A 2IDMA 3I09A 1PEYA 4YR7A 2NUBA 1Z18A 1Z26A 1VLZA 2RJOA 4O5AA 1JYEA 1XWWA 4Z0NA 2FXIA 3A10A 4MS3A 4G0XA 4MR9B 5TQ2B 2HQBA 5IUKC 1KRXA 2IPLA 1ZVVA 3GWGA 2A9PA 2QV0A 2PKXA 2QW1A 3FMVA 4JP1A 4XXHA 4TN5A 3QLUC 3DGFC 4YS6A 2XDYA 1W9HA 5TQ2A 4KQCA 2PAFA 2GX6A 4OBBA 4ZJPA 3KG2A 3A0RB 2FKAA 2MYTA 1FSPA 1QP4A 3IPAA 2J48A 3KCNA 4HNRA 3I45A 2WY2D 3GBVA 4IILA 4YCSA 5KQMA 4MR8B 2ZAYA 2B4AA 1Z13A 4WZZA 4H3HB 4RU1A 2KYRA 2CD7A 2HQOA 2R25B 4OLBA 3EDCA 4JASB 1JFVA 3NHMA 2FQYA 3KTOA 3SNKA 3VNBA 3BILA 1JLKA 2PUFA 4MR8A 4JA2A 1JL3A 1E6LA 4MPTA 1BDIA 1QO0A 4NCAA 3QK7A 1BVHA 3OO1A 3P9YA 3T6KA 4G0PA 3HJFA 3FFXA 1USKA 1TLFA 3HV2A 3TD9A 1RZRA 1MB0A 2FEPA 4Z4CA 3L49A 3DGEC 4RY0A 4HYEA 1OXKB 4MR7B 5ED4A 2PUEA 4RXMA 3BRQA 2Q5CA 4ETNA 2O20A 2F8SA 3KSMA 2JVIA 3N53A 3KS9A 1FFGA 4G0ZA 5TE9A 3Q7TA 3BRSA 3E61A 3N75A 3QEMA 2JVJA 3IP7A 3H1EA 2QZJA 3KJXA 5HM6A 2E4YA 3HUUA 2QR3A 4E7OA 3W9SA 2TMYA 1A0OA 2QVGA 3Q7RA 3ILYA 4RK6A 1JF8A 4TLMB 3D8UA 3RH0A 2RGYA 1JH9A 1PHRA 4Z4GA 1KGSA 4PYRA 4F11A 1QPZA 2PUBA 3EODA 3LFTA 5EWMB 1MIHA 1SXHA 2NT3A 4RKQA 4PE5B 3N0WA 3H5WA 4ETMA 2HQRA 4WT7A 4WWHA 1ZGGA 4Z9AA 3EAFA 4W5QA 2CHEA 5HSGA 7ABPA 4P98A 3ROFA 3DLBA 4D6XA 5EWMA 4LE0A 3NNSA 1NXVA 3RVJA 3A3KA 3LUHA 4OLAA 3HZHA 1QO0D 2FEKA 1EWTA 2PL1A 3MA0A 3OO0A 3OM0A 1YTUA 1GUDA 4QYMA 1GCAA 4LZLA 1BA2A 1RZRD 2WB4A 3BBLA 3F7NA 2FVYA 3C6QA 5EWJB 1QP0A 4MS1A 1RXIA 2ID9A 1NY5A 3K4HA 2QVCA 2QU7A 1EWVA 3HVRA 5T3YA 4XARA 5DKFA 4F12A 5B3JC 1NTRA 3CTPA 3RQIA 1A04A 3EULA 3KYIB 4RK0A 3LUDA 3QELB 3OQNA 5EWJA 3EGCA 3JVDA 2WMYA 4M88A 1ZHHA 2MYUA 5KWSA 1Z2DA 4G0MA 2H0AA 4RK7A 2PUGA 4HNQA 1JFTA 3CFYA 1QMPA 3GRCA 1XHEA 4KNYA 1E2BA 1DC7A 4RV5A 4YO7A 4LE2A 3QELA 1VKRA 4H3KB 4RY9A 3CZCA 3HCWA 3RVMA 1NXWA 1D4ZA 9ABPA 3QLVC 1Z17A 4XLTA 2FQWA 1TMYA 2BGGA 3GYBA 5IC5A 4CBVA 4EVRA 3CZ5A 1P6QA 3LUCA 3LUJA 3T8YA 3FDFA 3RVPA 3SAJA 3TO5A 1J56A 3H5VA 2YHBA 2R48A 5JNVA 4KK3A 3LTEA 1JHZA 2VUHB 2VYCA 3N8IA 4N0QA 4NICA 5PNTA 1H9CA 1FQWA 3S99A 2QSJA 5CNMA 3H6HA 3I42A 3IDOA 1HEYA 4MS4B 2JB9A 1DJMA 5IX8A 2B1JA 3GT7A 5JS1A 3UUGA 3OLZA 4N0PA 3CU5A 3UKJA 5B3JA 3N6VA 1DCFA 1PNTA 1AB6A 1CEYA 4L4UA 1KRWA 4RS3A 2NZUG 4N47A 5F64A 3O1IC 1DZ3A 4RK4A 1YVUA 3TB6A 3F6PA 4MR9A 3F73A 1LBIA 4Y9TA 1I3CA 3E3MA 4DADA 2MSLA 2L19A 4IMIB 4Z4IA 1W25A 2E4VA 4Q7EA 4LE1A 3QX8A 2GBPA 3O2QB 4TLLB 3D02A 3H5IA 4JB0A 3QLVA 3ILHA 4W5TA 5CNJA 1D2AA 5TQ0B 2LPMA 1E6MA 3OLVA 4LDAA 1JDNA 4KPYA 2JCGA 2FEWB 5BRAA 4RDCA 3JY6A 4MQEB 3LUAA 3RVRA 2CWDA 2A9OA 2OQRA 2LUOA 1Z25A 5FWXB 4GPAA 5TQ0A 3NNDA 5JNUA 5KC8A 3Q7SA 4FE7A 3HSYA 3A0UA 4F06A 4EVSA 4RKRA 4KQ9A 1L5YA 1S8NA 3JPYA 5GOTA 4D6YA 4MQEA 5I4CA 2ZWMA 4B09A 5IULC 4RK1A 4KRFA 3FFTA 2FLWA 3IP5A 4UHJA 5FWXA 3SM9A 2IPNA 1EHCA 4KZKA 4WUTA 5GQSA 3K9CA 4MRMB 1ZN2A 3QLUA 1JYFA 2R4QA 4RSMA 1ABFA 1RPJA 4ZYLA 1YMVA 1U0SY 3LMKA 5TQJA 4WXEA 4MR7A 3RVLA 3M9WA 3O1HB 1SRRA 1DBQA 4TMYA 3SY8A 1GCGA 4MLCA 4MRMA 3UK0A 1URPA 4KV7A 5IEJA 1BDHA 2WWVD 3NNNA 1E6KA 4Z4HA 3H75A 4WXMA 3MIZA 5JNWA 3CHYA 4OG2A 2MYNA 1VPWA 4PICA 4Q6BA 1JWLA 3EQZA 3OLWA 4QYWA 4YWHA 4XASA 5HQJA 3F6CA 4G86A 4KFCA 3MYYA 3OLXA 4ZPJA 3RVNA 2R47A 3MMNA 1U2QA 4S05A 3BREA 3DLHA 5C5EA 4RWEA 2JK1A 2FN8A 2ID7A 2GKGA 2W42A 2L18A 1GUBA 1RNLA 2PJUA 4G0QA 2LIVA 4IGAA 3QLTA 5HKOA 1L5ZA 1NXXA 1F4VA 1Z16A 2HPHA 3OMXA 1ZGZA 3DZDA 1TM2A 2FTKE 3GL9A 5KQGA 2MYPA 2QXYA 3KLOA 4N76A 1SD5A 1R8JA 2P4UA 2JRLA 1D1QA 3KKEA 5FWYB 2IPMA 4D74A 1JFSA 4LRQA 3FFWA 1P8AA 1MVOA 1U2PA 2E4ZA 3HDVA 3JTEA 4MGEA 4DN6A 4EUKA 2PE5A 4EYKA 2JVKA 4OATA 3GBPA 4Z99A 3O1JC 1MB3A 3MF4A 2E4XA 1DG9A 3IPCA 4MQFB 1B00A 3HO1A 3M6MD 5IEBA 2E4UA 3KYJB 5FBHA 5FWYA 4W5RA 1UDRA 1VRVA 5D2CA 4EY3A 4FB4A 1DRKA 4MLDA 4FE4A 5ABPA 3SG0A 2IPAB 3LOPA 3HS3A 4O1IA 4MQFA 4N03A 6CHYA 3N0RA 2YHAA 3CLKA 1M5TA 4ZMSA 1EFAA 1TVMA 2GI4A 4O1HA 3QEKA 4RXTA 2PL9A 1APBA 3URMA 4NCBA 1YS6A 1USIA 2LP4Y 1YK0A 4L85A 1K66A 4P1ZA 1LJUA 1K68A 2GWRA 4RZSA 4QICA 1P2FA 2NZVG 2LBPA 1BDJA 3NBMA 3EJWA 4Q6WA 1NATA 3TX6A 4ZMRA 3GV0A 3RVOA 3T38A 2N9UA 5C5CA 4Z9BA 3H1GA 2A9RA 2AYXA 2FMFA 5BQ3A 1IIBA 1PNRA 3H5OA 1RXEA 3RVQA 4H60A 4MS4A 2NT4A 1YS7A 4RXUA 1BAPA 1A2OA 1DCKA 2DRIA 3JVIA 1YMUA 2RDMA 3H5LA 4F8JA 2I6FA 2HJ9A 2MSKA 3MQ4A 3O2JA 1LBHA 1ZESA 3C3MA 4S04A 4XFKA 5BRJA 3IP9A 2FW0A 4JOQA 2M98A 2VUIB 4W5OA 5JS2A 3OQOA 4EYOA 1SXIA 1DP4A 4RY8A 5IUNC 1TJYA 1ZDMA 1YK1A 4EGSA 3OQMA 3CKMA 3NHZA 1ZITA 3HDGA 3CRNA 4JB2A 4EYGA 2JBAB 2FSPA 4W5NA 2PLNA 1C0EA 3HEBA 3KLNA 5FBKA 1Z15A 3KHTA 2M1ZA 1CHNA 1ABEA 4LDZA 4DQDA 3G1WA 3L6UA
chains in the Genus database with same CATH superfamily
1V1MA 2I6UA 4KC0A 1G0OA 5EMLA 1YCFA 1IXZA 1HSOA 2ORYA 1HH4A 1TUBB 1NP7A 2QI9F 3IJPA 3LW8A 2XTAA 4GZLA 3VH4A 2O54A 2QT9A 1G8GA 2NNWB 5ALEA 3KQNA 5REQA 3LC7O 1U1GA 4RD2A 4EG3A 1Y6ZA 3AK4A 3DE7X 1LRKA 1TU4A 4PEVA 3UKOA 2VYND 1YQWA 3W4IA 4AKSA 1YB5A 3O7MA 1XZAA 1ZKDA 4QU0A 3MMSA 1NW8A 5JAUA 4L7VA 2P9ZA 2YHIA 2IE8A 3VOBA 1SXGA 4HN2A 2QAGB 2F4VB 4BN5A 1E8DA 3KU1A 3O3OB 4FMPA 2FN9A 4NCNA 1D04A 1T2UA 2Z2XA 3WB1A 3MPOA 1T8WA 3PZRA 3H1TA 2GN9A 2OT3B 4K6CA 4FJ0A 2C9OA 1QGED 1Q21A 4XB1A 3HGMA 2HIHA 4ZK2A 3G8BA 3CEPB 5CYOA 3RTEA 3TQRA 2V7EA 3WO0A 5I7EA 2OCYC 4U6QA 5FBZA 2QAGA 2C20A 3P0EA 5T8KC 4LIPD 5DI3B 3U6BA 3VJKA 1NT2A 3PQ7A 2OLEA 3G0OA 1Z9BA 4HX5A 5KTPA 4N0MA 4L72A 3FYCA 1ONNA 4UASA 4MUIA 3OU6A 3OTQA 1X2BA 1WHSA 3ASZA 1L9XA 3DAOA 2PUDA 2GD0A 2B69A 1Q0LA 5AUNB 3MOIA 1EJ2A 1OI4A 4G9EA 1G7TA 1HFEL 1OBFO 4BMOB 3VX4A 4C7KA 2DSNA 3FUCA 3UJNA 4HB4A 3P9NA 1V8FA 2IOYA 3M6IA 3VMMA 4CV3A 4G81A 3CE6A 1BH6A 3FTNA 3AI2A 1A95A 4DEYA 2LV8A 4MS1B 4EW3A 3JS5A 3CB2A 2C7OA 4OK3A 2B25A 1GYPA 3S2SA 4E09A 3K1ZA 2Q7DA 3H9UA 2MCFA 4DLYA 2VJYA 4TRRA 2VL7A 4N0DA 5CT4A 3O4GA 4N41A 1Z5VA 4EHJA 3TQOA 5EHZA 1X7ZB 2FK7A 2Q0SA 4NBVA 1C3LA 2GA8A 4OP1A 4ZOLB 2YINC 3LQQA 4HDQB 4DBLC 2QZ4A 3WRVA 3GRRA 5C8YF 2C9DA 2W48A 4IRXA 2FPKA 4MCHA 5C81A 1J2RA 1Z29A 4XGQA 4JFAA 1G41A 4JU8A 1U9YA 2BFDB 4BTEA 1GKIA 4MKZA 3FBTA 1NW7A 4LGVA 3QJ5A 4ZOLA 1WJGA 4FMCF 4PY2A 3B2NA 2CDBA 3B1XA 4YUXA 2PKCA 2FOIA 1Z6ZA 2CF6A 4D99A 5AIBA 3G0BA 3IIEA 5LM3A 1E61A 1VCNA 1CUYA 1Y42X 4AMZA 2Y99A 1L5VA 1R8QA 2VTVA 1KH2A 2G67A 4JJ7A 2VK2A 2YWCA 2Q0XA 5GZ6A 4P9NA 4V39A 1X87A 1J0DA 2ODEA 2RSLA 5AVTA 2ESRA 3O47A 3AP3A 1VMEA 1DPGA 4JOCA 2RGNA 1KY2A 3ZY3A 5IT9A 3L8CA 2C9CA 1KTVA 3I2GA 5HOQA 3F8TA 3RIGA 1W88A 3ZWAA 3Q5EA 3U4AA 2WF7A 1GUAA 1CF9A 2PMWB 2XRZA 1L7EA 1N2CA 1PEYA 3KQPA 2RJOA 4O5AA 4B74A 3IV7A 3HKCB 2PT5A 3ELDA 3FGPA 4KDEA 1LF5A 3LT0A 3QFFA 3L8FA 3SC3A 2OD9A 4X7BA 1EK0A 5C80A 1M34B 4HD8A 3U5TA 3IE2A 5EE1A 4DMHA 1VYUA 2O23A 1ZIDA 4X95A 1I10A 1MQSA 2CBXA 2I03A 2WIKA 4BTVA 4Z6KA 1XRRA 1G6OA 2IYEA 3M89A 3NVAA 3R5FA 2AQHA 3HKCA 4I50F 4A5OA 5KJ6A 5AKGA 3GX1A 3DDSA 1C5KA 1N9GB 3BGSA 1M34A 4Q3EA 2V7TA 2D00A 3DMNA 5KOIA 4DQUA 1RDFA 2REBA 2FQQA 1C8VB 3ICQB 2ZUDA 3OH8A 5H8WA 4DIBA 2FKAA 2YVUA 3A04A 3IT0A 1FSPA 2EL7A 1D09A 4MMYB 2ZYVX 2IYSA 2P90A 1XPOA 4CT4B 2HCFA 4L22A 3J81k 4YIHA 1LJ8A 2H2HA 2ADMA 3N2NA 4J94A 2YZMA 3ADOA 2X7HA 4U2CA 4E30A 2VHUA 3BDIA 4EUHA 2AXEA 4OLBA 4JASB 4Z53A 3ZXSA 2JJ1D 2PR7A 4ZREA 3AG6A 1TEHA 3RF7A 3D3JA 3NDJA 4BVAA 3QVVA 4K6GA 1JL3A 1YBAA 2JFNA 4H7EA 1GZ3A 3CH6A 3I76A 5BW6B 2XE8A 3UCXA 3WIUA 2P9QA 3C24A 3O9VA 4PCVA 2DBZA 5JASA 2I6SA 1AMUA 1UBTS 3D7SA 4IPTA 3HJFA 3D1JA 2GD1O 4B48A 2W2VA 1L4UA 3ZZUA 2ZJOA 2BHNA 1WZCA 2PY6A 2F2TA 4GXRA 3PPVA 5KCMA 2NG1A 2TMDA 1O94D 1P0FA 3BRQA 2WVGA 4ZYTA 4BJ3A 4P36A 2HRQA 1N2HA 3B36A 3I1JA 5EZSA 2JZCA 2ZXUA 3K09C 4IIBA 4KXNA 3V1KA 3WICA 3I83A 2E4YA 3JD1A 3ZXIA 1R2QA 2Q6TA 4DTCA 5B57C 4I5IA 1L5KA 1PLJA 1MOSA 4EI9A 4C7XA 4B75A 3OE1A 4J2HA 1KZ7B 3AB8A 2WJYA 1B8VA 4Q03A 5JSFA 2ZE6A 3BWBA 1W36B 3KEOA 3QYFA 4C2AA 1W8DA 3Q4GA 4NH0A 1QO9A 3H5WA 1QGUB 3F1KA 3BQ9A 1QG0A 5TSDA 2ACEA 2VP5A 4WWHA 4CVNA 3CNQS 4R1PA 1EBFA 4OQDA 5BT9A 3SI7A 1SVNA 4L5JA 3RI3A 2AZXA 5K3FB 3KVYA 1HDXA 4ZQIA 1M66A 4BGDA 5D8DA 2PVCA 1IHDA 5JVDF 4QBFA 5CPFA 4BLTA 3BX1A 1JIVA 1FDIA 3F6RA 3JQAA 3MWEB 4HRVA 4ZCMA 1DUVG 1QVAA 3RGWS 1N6KA 1AHIA 1M0WA 2P3LA 5D6NA 1HT3A 5IXJA 3WV4A 4JROA 3FKSD 1C30B 1EJBA 4FKBA 5K3FA 1E20A 2ANBA 4UDNA 2OD7A 1RZRD 3C3BA 2DC1A 4AW9A 3DZBA 1DZIA 4MB6A 1NF8A 2BUCA 3B3AA 3OCZA 2HBZA 5PGMA 1W34A 3A1UA 3AB7A 1ZMTA 1C30A 1COZA 1JR2A 3JWPA 3QXJA 4P4SA 1B0AA 1NRWA 2LW7A 5T8KA 1NQAO 3TNJA 2YWDA 3CCBA 3QIAA 1GPJA 3ASYA 3CUYA 4UE3S 1QIKA 5FLXA 1KP9A 1ENOA 3Q0TA 1RRCA 3JWIA 3GH3A 5MFZA 3PGKA 3GRCA 5JW6A 1J2YA 5BN5B 4DMFA 4ME6A 4YO7A 3IOMA 1KWKA 1NIPA 4RY9A 1YL7A 3HCWA 4A7PA 2PD3A 2DFVA 3FDXA 4RYLA 3RYHB 3R5KA 3QLVC 1RWKA 4MQMA 3A9RA 1TMYA 3F3SA 1L3CA 3GYBA 3NJ8A 3CZ5A 3TCNA 4D4MA 4EVRA 5BN5A 1E0AA 2JIBA 3ASVA 1JLMA 1ULTA 4ZAGA 3IURA 4PR3A 4DJEC 2FJ0A 3BF8A 2BGNA 3RYHA 4UOZA 1HDRA 2REXB 2KMLA 2Q5FA 3GJRA 1CVIA 3H0KA 5FFFA 1X19A 4QJ3A 3ADDA 3WADA 3TSCA 1W0KD 2FFBA 2VF4X 2HSEA 4MV0A 4N0QA 4E15A 4DVGA 3B2QA 1OGJA 4PFJA 3R7DA 2G76A 1N5LA 2W43A 1M0EA 1QKIA 3I37X 3TWOA 3LHKA 2XE4A 2Z2KA 2OYRA 4J3JA 2JB9A 3CM0A 2B1JA 2UUOA 5IZCC 3GPIA 4N0PA 1UEXC 3KTDA 2HU2A 3X3HA 4EJFA 1ESDA 4M99A 4I1SA 2NTNA 3VR4H 4JYCA 1ZOOA 4DIFA 5EYPB 3LL7A 4HGNA 1EJ6A 1VGQA 2R3SA 4Z4IA 2E4VA 4FHCA 1A5BB 4LE1A 2C04A 2GM5A 2J4FA 3H5IA 3MB5A 3PWZA 3KQQA 1S2LA 3GJ4A 1R27A 4CHTA 2J3EA 4NS4A 4TWIA 1Q44A 1ZH6A 3UJ9A 4FZVA 3VM6A 3GRAA 3STXA 5B3KA 3VV3A 5JRDS 4R7TA 5BRAA 2Z4RA 2B35A 3KPVA 1DC3A 3IOBA 4MQEB 3SHQA 2R5NA 1O2DA 2V5AA 3NYQA 1RYHA 1Z5PA 2OFOA 4ANFA 1N75A 3QOFA 1SUIA 5KC8A 3TF5A 5DTQA 4Q9NA 1ISPA 1ZPDA 3KQLA 5KOHA 2QRLA 1S8NA 1GPH1 4MQEA 4RK1A 4PIVA 3DE4X 2JIMA 4RMJA 4XLZA 4PBSA 5CT9A 1U02A 1NQVA 2ZTSA 4NDNE 4OX9B 2XNHA 3F67A 1QYIA 1PRYA 2ZETA 4PSKA 3PI6A 3B6IA 3M4JA 2QN8A 3RUIA 3ETJA 4N5MA 2GRJA 3L8ZA 5AJUA 5EVCA 1MEOA 1ODJA 1VSBA 2Q29A 1IJKA 4J1QA 4B3HA 1TYDE 2NVUA 5LUBA 3AKZA 2CXQA 1IB0A 4G5SA 1QO7A 5G1PA 5THXA 2AVNA 3RVLA 3UHJA 4C5AA 4BNNA 3INRA 2Q6IA 4DB2A 3L5KA 4YUWA 1BWPA 1G20A 3HY6A 4C7BA 5B2FA 3THXB 2GZSA 2RGCA 3OY2A 1Y5RA 4K3VA 4DLPA 4E13A 5J23A 1E60A 5DWQA 4QUJA 5D1HA 3H0EA 3I8SA 3H75A 1W30A 2XGGA 4WXMA 3SK0A 1IQRA 1RJEA 3SS7X 4DAEA 2MYNA 3ICOA 4XDGA 2R84A 3RU2A 2PX6A 4ND5A 4IAOA 4OGKA 3THXA 3C1UA 4JLVA 5I8ZA 1P33A 4XASA 2PEZA 5HQJA 5C7YA 2I6QA 1T5SA 4GQIA 4E07A 2CLLB 4E2ZA 3H87A 2I66A 1IPFA 4LG1A 1Z5WA 4JC5A 1XTVA 3D7LA 3R24A 4X8LA 2JK1A 2ZJ5A 3CUKA 3ABQB 1QHIA 2ACWA 3CX7A 1I2ZA 3PEEA 4HATA 2I62A 5DISB 5FQOA 1UWVA 1NXXA 2OK8A 3N58A 3OEED 4LZWA 1RS0A 3FFBA 4PZUA 4H1WA 4HLDA 4D3DA 6LDHA 3ZE7A 2O0HA 1N33B 1PN3A 3PNYA 3ROXA 1YS9A 2ZAGA 1GHTA 3L1HA 3R6GA 4NU5A 4QOSA 5KQGA 4RUKA 1BXGA 1E4EB 2NYVA 2M6KA 3FNFA 1GL3A 3K09A 4KRGA 4PLPA 3W8FA 1Z22A 1BGVA 1QDLB 1TTPB 3P2YA 1DB3A 3EGDB 3KZNA 4H16A 1QFMA 2ZYTX 5FWYB 5IKPA 4BNMA 2IE0A 1JFSA 4G41A 1P8AA 1MVOA 4S0ZA 2E4ZA 2VT6A 1ZINA 3DEYX 3MEQA 3P9RA 4GYJA 2X0EA 2GJ9A 4P35A 4HXEB 5FOVA 2HJGA 2EP7A 3N2EA 3WS7A 5TLSA 3O1JC 4IZOA 2C7PA 2I91A 2O1SA 3KLPX 2A5GA 3WLAA 5CITA 4JJKA 1R4ZA 2WT8A 2C2ZA 3E3AA 5BNIA 5FWYA 1ZCAA 3A4YA 4HEHA 2JGRA 5HIKA 1U9IA 2JL1A 2K2WA 4W9RA 3WLHA 3I8XA 3PR1A 4DV2B 4RHXA 1CZKA 3EB9A 1MV8A 2BHRA 4N03A 5GAJA 1SKMA 1EFAA 4H4EA 4YRDA 1E2JA 2XJ4A 4I4TB 4FDLA 4L51A 1ORHA 2DQSA 2PL9A 3OE4A 1P5JA 2C92A 1YIAA 3BBPA 5E6UB 2QVYX 4JI5B 3FCYA 3SEAA 4XSHA 5J4LA 2JLVA 1N25A 1SM4A 1UXHA 1IN7A 1Z47A 2LWIA 3DUFB 3HSKA 4BC0A 4EJ6A 3BPSA 4KOEC 4RANA 2VXYA 4I4TA 2OOSA 2V58A 3PC7A 4HWOA 3TX2A 4BQQA 2CZGA 3ZQJA 3H6KA 4ZT3A 5GZ3A 4ROSA 1W94A 3N2IA 5AI8A 4ZODA 3SZ3A 3W2IA 4ZMRA 1VQ1A 1XALA 2DBRA 3ISJA 3N6XA 3AF0A 3DUFA 3AY0A 5JSUA 3K6JA 1T2CA 1ZC4A 2Q3EA 3K9BA 1GA6A 3WGOA 2FY8A 3MRXA 4JQCA 4OBEA 3T94A 1YCGA 1PGQA 1YQXA 2DHEA 4MGIR 4C21A 4ZC8A 5FCDA 1OU4A 2W2TA 2WD8A 4J0FA 5A4KA 5KTKA 2ZT8A 10MHA 1TUEA 4O2RA 4HQLA 2J5KA 3KKLA 1YJCA 1IUPA 1W85B 3SHVA 5ECGC 1DIGA 4MO2A 3U7EB 3FWKA 2AWOA 2WG0A 3A6ZA 1MZPA 1KI7A 1ZEMA 3GZJA 1E2DA 3C3MA 2D2FA 4ICIA 4L57A 1ZUNB 4JOQA 2WVJA 1E6WA 1PD1A 2AVDA 2HU7A 4KUGA 3O8CA 1KJZA 5HBRA 2XZOA 1W85A 4PLVA 2C2HA 3LQ2A 4ISBA 2FR8A 3EY4A 1XDZA 2W93A 4EPRA 2PFSA 4LNAA 3PXBA 4XVCA 2XVXA 1RJGA 2X1LA 3WBKA 3DR5A 3BWYA 2EFEB 3L6DA 3GUZA 1ZUNA 3HDGA 3I6MA 5J59A 5J3JA 5L7WA 2EF1A 4LJSA 4WAUA 3SHTA 4GC5A 3EVNA 1KYWA 2XRFA 4ZCPA 3KJNA 2VJAA 2AFHE 3RS8A 1H65A 1B0UA 1HORA 1L5SA 1CDZA 1VLHA 2QAJA 4IQGA 4PPFA 5T6BA 5KB3A 4PONA 4F4HA 2R00C 4EJ2A 1HURA 2H5EA 1RC1A 3G9UA 4REQB 1GRQA 1JBEA 1E1NA 3R7SA 4DRXA 1SVMA 3C41J 4DE5A 1GU1A 4ZAZA 1V47A 1AK9A 3FUWA 4PC2A 1NKVA 5DP2A 3MAJA 2GZ1A 4YBRA 5HIMA 4NV3A 3O4RA 4EA8A 4EEZA 1G66A 1BFDA 1DAKA 2XQJA 1DFGA 4N8SA 5EKUA 4ZHQF 4A5SA 5ALLA 3F5QA 3KUKA 3JD0A 3R3UA 4AK9A 2VUUA 4KLCA 3JD3A 2BE9A 4LX8A 3HUTA 1I32A 1ILEA 2R68A 1U9JA 4C2UA 3O3MB 4IUCS 2CT8A 4RLQA 2ZITA 1KS2A 2BWJA 2PPVA 2IDKA 5DRTA 2AR9A 2M2IA 2IV7A 5I01A 3ADKA 4QHTA 1KE2A 2XD9A 3GY0A 1KXJA 2AG8A 2P2LA 2GASA 3KTFA 4R2JA 5CHYA 5AM0A 3RNLA 3HK2A 4OK5A 4EJSC 2XCUA 3SS8A 3HZRA 1RWOA 2BUBA 1QQAA 4PX5A 2FLKA 2CLMB 2UUPA 1WG8A 1Z2CA 3AINA 4G8JA 1M8JA 4WKCA 2WP8J 4DZZA 1AKEA 1P1RA 1PO7A 2QDXA 2YMQA 3I9JA 4ENRA 1DGQA 4LDAA 4AB1A 2O07A 2AYZA 1DRJA 2ET6A 3CXRA 5F33A 4LFCB 3WNDA 3UEOA 1V2GA 5JDCA 4TRMA 3KKPA 3D1VA 2OC4A 3BCHA 3KQSA 5EXPA 3KSDO 4M1ZA 4E2XA 5F7OA 1PSWA 4RVHA 1G16A 3ZVRA 1JHUA 2W11A 3U7GA 2BHSA 4LK2A 2XT0A 2N0SA 2KLBA 1SUWA 1M1YE 3T1OA 2OXRA 1ENPA 1F7VA 1WBDA 2HMUA 1UZLA 2XX3A 2COKA 4WESB 1IZZA 4X85A 4FI3F 1Z82A 4FFSA 4LZOA 5EP2A 3C39A 2EZ4A 2VSYA 4PVCA 2AN1A 3ESDA 1OPXA 4BGIA 4IWYA 4BXOA 1KNXA 1XCGB 5BV7A 2IXBA 2ISSD 1PFQA 4GLBA 1TVCA 4Q1DA 4ZCSA 1DSSG 3DHEA 3K0CA 1PZHA 3BXZA 1H93A 2W2PA 4WZAB 2YVKA 3DEJA 3SX0A 3DMGA 1KQNA 3PQ3A 3H13A 1AZTA 2WIAA 1TYAE 2JLYA 1XKXA 2HMSA 1SHJA 2QZPA 4J3FA 1J9EA 1P1CA 1R3UA 4L9WA 5CW1A 5KI6A 3UQYS 2X7XA 1U3FA 2D4HA 2O2IA 4WNCA 3SE0A 4I4NA 4AJ9A 3B6MA 4ILKA 3KVVA 4I14A 5EY5B 3TKYA 2VK8A 4R2XA 2HQSA 3FPEA 3GFQA 3LQ1A 4LMBA 5ILQA 3VH3A 4DV1B 5MN6A 1QGAA 1ODTC 1E1DA 4NOJA 1MVNA 1XNHA 3WGUA 1KK1A 2WI8A 5KNBD 2XRMA 2H1HA 2BVNA 4BS9A 1SC1A 3P52A 4OOFA 3DWGA 3HB9A 1SKAA 2EG9A 3UYLA 4F4UA 3EVTA 4YR7A 4G1BA 4CMKA 2UXCB 5KREA 1TUGA 3GYGA 4BASA 3DM5A 1LS6A 3D59A 3U3ZA 5TQ2B 3ICVA 2C3UA 1F2UB 2M6LA 1FFYA 5ICMA 5TT1A 5ALSA 2E4AA 3S1AB 5CA1A 3BCRA 4RA6B 3FPKA 3ZC3A 5EZYA 2O0KA 1B41A 4ZTBA 4V24A 3H4IA 3IEMA 2JF0A 3SNHA 4G07A 4HWGA 4BVKA 2W0SA 5TQ2A 1TD9A 2R2GA 1F2UA 4JDPA 4UDYX 1VYVA 2QRUA 3EEYA 3NI2A 5DT9A 1DLIA 3S1AA 1T1SA 2F90A 3KPUA 4KO8A 4RA6A 5CJ2A 2ZYAA 3WTBA 1KZ9A 3IUQA 3PPYA 3O3CA 3OU7A 4FEYA 4JLMA 4RFLA 2QE7D 5JY1A 3R20A 3LX8A 1RZVA 4WZZA 2IL1A 2CD7A 3TQCA 3UBMA 1FJGB 3QE9Y 1N32B 3CLVA 3PQ8A 2CYBA 4F86A 2R751 1IBSA 1GAEO 4CCYB 3U49A 3RAPR 4QXOA 4QDOA 1ZR2A 1Q7TA 2CXHA 4FW9A 4K1XA 1MAWA 1ND5A 2AFVA 2GK7A 1YDHA 3AHGA 3DFZA 3LNTA 5TJ9A 1RYFA 2YOHA 5DM4A 3HKBB 1F60A 3K20A 4PCLA 4ZYWA 2WOJA 2ZB8A 3T6KA 3ONDA 3JVVA 1CFJA 5D7BA 2IY7A 3DLAA 4CCYA 1XLUA 3BE4A 3DXXA 3L1KA 3K96A 1N1DA 5HR5A 3PGA1 4HYEA 4M6WB 1NVAA 2DUUA 1KEZA 1SWWA 2CE7A 4MR7B 3L6BA 4ZDWA 4N40A 3HKBA 1DJNA 5A5GA 1GAXA 5CP8A 2ALJA 1JJ7A 3GN2A 4NOLA 3B20A 2ZR8A 2CLHB 4FFLA 2O20A 3G68A 5T64A 3UH1A 5FWNA 2XF2A 4UU0A 2I2CA 3S55A 3FAKA 3QEMA 4M6WA 3KJXA 1JMYA 3JSXA 4G3XA 1VDZA 5FQNA 5CA0F 4LA4A 4LDPA 2NO9A 2I6GA 4C0LA 1JF8A 1IATA 1W8IA 1G20E 3C3JA 4JUCA 1KR2A 3LFTA 1DAPA 3OCYA 5CURA 4AN1A 1DIOB 3UB3A 2CEKA 2QBYB 3HFJA 4NVRA 4TVBA 4EHNA 4HUTA 2G1PA 3R5JA 2R00A 3NAQA 4YAFA 2VUTA 3NC0C 1PTJC 4PC3A 4R2IA 2G28A 4QU5A 7ABPA 4NYJR 1TCVA 4WSOA 2W2OA 2Y71A 5H7XA 3LWNA 3GJQA 2QBYA 3WWEA 3BFPA 1MXFA 1NVDA 1EUDB 1X14A 4JP8A 4C3ZA 1PR5A 2FFRA 3OZEA 2QUHA 3CC8A 3MHPA 5FNZA 2HJHA 3DL7A 1L7RA 1X7XB 4M1TA 3SXPA 1E4OA 5F52A 4ZOAA 3PXGA 1R6DA 4ER7A 1GM5A 2QTNA 1RWPA 5IKXA 1JVSA 1PLKA 3VX3A 4GE0A 1JJVA 2HDNB 3KFXA 2XWQA 4XX1A 1ZIXA 4ZWNA 5A7HA 3SBDA 1YVPA 1NMYA 3W3AA 4YDSA 3KLMX 1CR6A 2FRDC 1EUDA 2UVPB 3CZRA 3QG5A 4HGOA 3SKYA 3D7NA 3Q5DA 3ZCPA 2IY8A 2QU7A 2ZJ7A 5ER6A 2HHHB 4UVGA 3E9ZA 1X7XA 4WASA 2VR1A 4DBZA 4YJGB 1SOWA 5T3YA 1LWOA 4K9QA 2H52A 4V1CA 4CM9D 7MHTA 2M9MA 2XKBA 1WUYA 4BVEA 4YCAA 3KQTA 3ZHBA 4ECEA 4CEIA 3IAS1 2UVPA 2GJKA 4AJIA 4RVSA 4EJSA 4FEAA 2GBGA 2HIMA 2QLFA 1KZGB 2QRNA 3B1ZA 4YJGA 1SG6A 1V45E 3L0SA 2O7SA 4LXXA 1AX9A 4RTQA 4MTLA 1EXDA 4R2LA 1AG9A 4YDHB 3U7QB 3FMOB 5CB0A 1O6GA 4LSWA 5SYNA 1GTG1 1RABA 2ZT6A 3EDQA 5HK8A 2JLBA 3NHKA 4ITUA 3VTAA 1G17A 3DKIA 1QK5A 2VDVE 2V6FA 3B7PA 3LUJA 5DNWA 4AJ4A 2AJDA 3U7QA 3ETNA 3G0HA 4PTZA 2IX9A 4FGKA 5DWVA 4ZO8A 1WKVA 2KSQA 4HDKB 5B12A 2VUHB 4LHSA 4XWTA 1J8YF 3EG9B 3L77A 5FUYA 2PSHA 4CF7A 5MN5A 4HK4A 1NYRA 3DWEX 4WBNA 5K3DA 3WLSA 2Y0PA 3CSUA 3L1JA 3P19A 5HCNA 3KT0A 4E0BA 2B8JA 5AVUA 1B4DA 3G59A 4XQ9A 4WCVA 2OO5C 3LPAA 3IQWA 4INAA 4HDKA 4MQUA 5DNEA 1WUJS 5CDFA 3S7ZA 4ZO7A 2X6RA 4IIGA 4NSNA 2YXEA 3VU8A 1F4LA 3IHTA 1QHHB 1BJTA 1M7HA 1SELA 1I8TA 2DWOA 5F64A 3VZPA 2YUIA 5JCXA 5LLTA 4HH4A 4MYHA 3REQA 2FPIA 1EVJA 4K9KA 1EWYA 1EXWA 1L8QA 5E8JA 5F23A 2W8BA 3VKWA 4HNHA 1IUKA 4QYXA 5IAOA 1NBMD 2JGJA 2H00A 3T1HB 1B6TA 3EVAA 4C30A 4NYIR 1NE2A 5EIFA 1EX1A 2GBPA 2Q3MA 1GXSB 4GSLA 4YUYA 2ECOA 2VDUE 2PYZA 2P5SA 3ODPA 5GOZA 5CNJA 3UAZA 4C7JA 2PS0A 4U9HS 3KEQA 4UE6A 2AOTB 2C2MA 1EDZA 3KQWA 1WNTA 1CK4A 2FH5B 2H2DA 3UJAA 3V7WA 4NYMR 5FPHA 3X1YA 2XMCA 5AKLA 3CO5A 1JIKA 2WF5A 1YNSA 4BNWA 2G04A 4MV9A 3ZLTA 1GXSA 1UK9A 5KU7A 3BZWA 3QFHA 4YLYA 2B99A 2I1QA 1TQHA 2PG3A 1KE1A 1CF2O 3SIWA 4EIWA 3A36A 4MV3A 4F72A 3Q7SA 2GERA 1ZU4A 2XNDD 2QUKA 3TLXA 4ETWA 5K7SA 3JALB 3MPUA 1L5YA 1HDCA 1ONPA 1RE0A 1YR9A 2H9IA 2VYVD 5GOTA 4DSTA 2ZSKA 3VR6D 5BUZA 4NAVA 4UDOA 3A25A 2G5TA 4E2YA 3IB6A 3KUUA 4MZXA 1M72A 2JFOA 4HLUC 4OQQA 4YRCA 4ZALA 1KDYA 3SVZA 1Q74A 4HFJA 3S2FA 3HE3A 1C7RA 2H51A 3EASA 3GJ5A 1WR8A 3K0KA 4ZYLA 3GLQA 9LDTA 4GWGA 4WXEA 3QXXA 2R8BA 5L6MB 1KO7A 3OA0A 4C08A 4AO7A 1DBQA 1GCGA 4BFSA 4DV3B 2IFTA 3P9KA 5E9WA 3QHAA 2Q1SA 3JQ6A 3GPCA 3SU8A 1NW9B 3MJEA 3R41A 5H9VA 1E6KA 3FWPA 4R6XA 2BD0A 1GPKA 5JNWA 1MGPA 2EP5A 2IHBA 1NPYA 5ERXA 1AF7A 2FPLA 1YDMA 3IPYA 1HRKA 1IHUA 1UBNA 5DHRA 3RV4A 4DM7A 1U63A 1RKVA 1CIJA 4P4NA 4ZOEA 2E2WA 3O8RA 3KAPA 3SSAA 4LCBA 5E7JA 4CTKA 1E8NA 4GWLA 3M6WA 3ZE6A 1U2QA 4JBXA 2G07A 1JTEA 2I0FA 2K2QB 3B3JA 3WDLA 1WPQA 4RZUA 2XZLA 3HEMA 2W6MA 1HOTA 1MLDA 2CJXA 2RIPA 4GYYA 5DYWA 4G0QA 4UEKA 2OE2A 1JA1A 1E7MA 2HX1A 3GP5A 4HAOA 3LSTA 4I1IA 5DMXA 2HPHA 5JXHA 5FOWA 1KI2A 5TT0A 1K8RA 1AKNA 1T5LA 3BB3A 2QQ0A 5F7ZA 1Z7EA 3AFGA 2X86A 1I3NA 1C3VA 5IP5A 5FR1A 2G77B 3ZJYA 1I7PA 5B5SA 4MB2A 1U0RA 4I8IA 2G70A 4FMDB 5B36A 3QMMA 4RMNA 1QK3A 5HW0A 4E51A 3OCCA 4HRYA 1SEVA 4QU8A 4WFIA 1M8PA 3TOVA 1RQXA 1TYBE 2E4UA 3RHZA 1WU8A 1S8FA 3ZKAA 4ACAA 2VJMB 4PYLA 4KR0A 3OLQA 1PTJA 5I7WA 5JCJD 3TGLA 1IOZA 1DRKA 2QD5A 2GVZC 2A9KA 2X15A 2VSNA 3OX1A 1HPLA 2WYVA 3L8DA 2IYVA 1SHLA 1A71A 3P9PA 2IWHA 1WV1A 4PO1A 1NVVR 2Q45A 2BM1A 3VPFA 1C8LA 1WSWA 5J2TA 3QUCA 3D7RA 4CM1A 3MJVA 3ACDA 4NCKA 3DZHA 4FW8A 1XV5A 2A57A 2OVFA 5AI6A 2ABWA 3Q2OA 3E3LA 3LX4A 1FS5A 4HRAA 3ZZ1A 2NZYA 3AKCA 1SGWA 2OHIA 2XUZA 4DLAA 2FRDA 4B4DA 1AUPA 1TK9A 1C7ZA 2WSYB 1RI4A 4UBOA 5HHTA 1E18A 3WLIA 1U0NA 3SSOA 1E63A 1G1AA 1WP4A 4ND6A 1GKYA 2QD1A 3EHEA 5C5CA 1NUHA 5JALA 2Q46A 4DA6A 1CFZA 5B1SA 3VSBA 4R69A 3U39A 5AVQA 3PYXA 4HTAA 3HVKA 3LXRA 4KFTA 5ADUS 2CLCX 2IZZA 3H8VA 3OUUA 2RB4A 2YOGA 1ZP6A 4IIFA 5JCPA 4LC1A 2RDMA 5T4BA 1I4LD 1CUJA 1MO3A 2IYZA 2G83A 1X80B 3PI7A 2MSKA 1MJNA 3D43A 2P40A 2IUTA 2CLDX 4ZOLF 4KG7A 1YB6A 4IDFA 2WQ7A 5JPIA 5E7MA 1ZVKA 1ZM7A 1GA1A 4HFMA 4Y98A 1RAAA 3ANLA 1OLSB 2VZ9A 1RQPA 2XQKA 4U1RA 3AFIA 2XY4A 1LDNA 4W8OA 5DJ5A 2A5DA 1EFTA 4RVCA 1Z38A 1X80A 2WFLB 1ONBA 5KVSA 2B4QA 3K70C 2A0XA 1IXYA 3GAZA 4A8HA 1NR5A 1S4MA 3NGLA 2AUTA 3KQYA 1OLSA 5KYYB 1EDOA 1XWFA 5DBIA 3WK6A 4D9JA 2PX0A 2KQUA 2OO5A 2WFLA 4I1UA 1WMSA 5DYNA 3FLBA 4YALA 1VZ2A 4UTVA 4UC0A 3ND5A 3DE5X 3QKTA 2R8XA 2OQIA 3L6UA 4L8WB 3KYBA 2DJ5A 3WSWA 1QH8B 2VEDA 5KYYA 3ZHOA 1TK2A 1T0JB 4GRIA 4MRSA 1IJBA 3F6YA 2VRCA 2BFCA 4J07A 3WV5A 1TJPB 1IC6A 1W93A 3CRMA 4ZT4A 1YULA 4GMHA 2C82A 1J9GA 3D3WA 2JPDA 4JZKA 4TXLA 1QH8A 4UAGA 2E9SA 2HSDA 1SU4A 1JDBB 3NBXX 1C0IA 1B74A 1IQPA 1CS0B 5EEGA 3R6LA 1NLUA 5DK4A 3TZEA 2Q5OA 4G1VA 3N7AA 1CNEA 4G26A 3ZUPA 4PLGA 2Z30A 3GD5A 2WPDA 3OKFA 3NWPA 1ZAYA 4U00A 1GNRA 1E3LA 1SVLA 2A6PA 2F3QA 2VP2A 2EKBA 3OY7A 4YQEA 1J06A 1BE1A 1E3IA 1NURA 3G8AA 1CS0A 1WBJB 1H2HA 1YHZA 3ETCA 3RWOA 1B76A 4ID3A 1GSAA 1M2FA 2Z5VA 1DBVO 4IH1A 2X5NA 5KVVA 4H7FA 1QHXA 4YH1A 1R4MB 1KI9A 1J0CA 2P2CA 1G8HA 3K7EA 4O3MA 4IH9A 2B36A 3C15C 1NUPA 1QHFA 3SFVA 3F78A 3BM5A 2Z5LA 4G5HA 3IUEA 5H4HA 3M5WA 4EGFA 2ZI4A 3DEZA 4TXMA 1OB2A 2XB8A 4NZMA 3T3OA 3NO4A 3IA7A 3NQ41 4OB6A 1BH2A 2YJGA 2VXOA 4LC9A 4F3RA 5E3JA 1EE9A 1OKKA 3GELA 3LKZA 4FZRA 2IU0A 4C43A 4BFWA 1ZWLA 3CQ9A 1FDVA 2EL9A 3OQPA 3PF9A 1WB9A 2CUTA 1OJ7A 1W5TA 2ZT5A 4L0QA 4FQ7A 4KW7A 3RM3A 1UQRA 5F2NA 2VWHA 4XUEA 3EVCA 4Q02A 4D8TA 5IDVA 5FT9A 4JIMA 1II0A 1L6IA 1KPHA 3OEWA 1KOLA 1DC8A 1H1DA 2W9XA 4UW9A 2CSXA 2D4AA 1ZD1A 5CDYA 1V8PA 3DBVO 2FCRA 4M0LA 2BTEA 3NHLA 3KETA 4CIAA 1B93A 1KERA 1RYNA 4UXIA 2Y1DA 5KQSA 1FX0A 3PHCA 1QK4A 4QD3A 3G2NA 1J21A 2HSGA 2VKTA 2I7TA 3KB6A 1YZFA 4MYRA 1CUBA 1ONOA 4MAFA 4B5LA 2PUAA 4JLSA 3ZWDA 1UJ2A 4OL0A 4BO8A 4DTIA 1YVRA 1Z0SA 1E3DA 1P77A 1TF7A 1ZL2A 2DLCX 4C4RA 4PAMA 5TPWB 3PQEA 3FSRA 1C9NA 2UYGA 2XUIA 5IUJC 3DTNA 3UM9A 1AGRA 4G85A 2N42A 2Q9BA 1C9KA 1TJ3A 1VLQA 2YOFA 3A31A 3QU2A 4X8MA 1EAYA 4U7FA 4F5EA 4LXGA 1AKYA 2JFQA 3RROA 3ZPXA 3R7AA 3UWPA 3BSWA 4FDMA 2AJCA 5KAMA 4PANA 5TPWA 2CC2A 4HYQA 4MVJE 1DVRA 3BRCA 4FYYA 4RFSB 3HB7A 5BW8A 1PW7A 4E22A 5K0EA 4TL6A 4YI3A 4RFVA 3V6MA 3DLIA 4OJNA 1R0YA 1ID8A 1A69A 1YAHA 2PT6A 1GLVA 5DYIA 2ZSEA 5CLQA 3CEMA 3B52X 4MUEA 4LY9A 1ECJA 2GAFA 2EFJA 4RFSA 5KSPA 4EW6A 3KEFA 5DM70 3JYPA 1KRXA 3QEOA 4IDQA 2ZUFA 5AKHA 4LFBB 2R6DA 1X1CA 4BECA 2WZBA 4J6FA 1CZNA 4YP6A 5KX5B 2IF0A 5D3ZA 2VLBA 2IEDA 3H2BA 1F6WA 4AWXA 5C1BA 3ORSA 5ER9A 1R88A 4FDTA 1PQPA 1X0XA 3SE7A 4EYSA 4Q34A 1P72A 2ONKA 2B4YA 2XJ9A 2YFYA 3FHOA 4GECA 4W63A 2XYQA 5BSVA 3MTJA 1QRUA 5KX5A 1J2UA 1XZQA 7AT1A 1VHJA 2C4UA 1GGKA 3HRKA 8ADHA 4ND1A 4O59O 2WT9A 5BWOA 1C29B 3I3OA 2A58A 4FFNA 4LVUA 2DHQA 2FFQA 2HQOA 1Y4UA 5EESA 4DLUA 4W99A 4HBGA 4WI1A 3RC3A 4CLEA 2WFMA 3RT1A 3GO4A 5H70A 3C6YA 4DLNA 1FDTA 2OPHA 3HADA 1DDOA 1DDGA 3KX2A 2I4MA 5IJ0B 2C42A 2XAAA 2CNOA 1GTMA 3DOCA 3CCFA 3HDYA 4OQZA 1R5NA 3GJ3A 1JU3A 4DYDA 3A3OA 5G53C 1XLWA 1E1CB 4IHKA 5LQJA 3Q1LA 4KJXA 3K70B 2V6BA 3UWSA 3UMYA 4TMXA 5BPFA 2FEPA 1ZRMA 5IJ0A 1YUMA 2PUTA 4OFWA 1MB9A 2P67A 4O6VA 4RVUA 2GKOA 4M7WA 5HDQA 4EHDA 1J8FA 3PSHA 2HMTA 3W1EA 4WIAA 1DUIA 1ZJ5A 3PNKA 3AUUA 1K7SN 3R3ZA 4M89A 4NMHA 1E1CA 4QVGA 5FTWA 4Q66C 3S44A 4FHEA 2DECA 1F20A 3ROGA 1W1IA 4IXTA 4RTLA 3KSMA 2G3YA 1KVRA 1WDTA 4TXHA 3TI7A 4C07A 4C78A 5ISMA 3CUUA 5A1TA 2G09A 3PEUA 5TF4A 5A02A 2HMAA 3LA8A 3C5HA 1ZM9A 3MLAA 4CG1A 5B58C 5HKOA 3GUUA 2GBIA 4Z4GA 4IUYA 4OQXA 1HZZC 2C98A 1V5WA 5G0UA 4F11A 5CIYA 3EODA 4MUYA 4ZGGA 3MCWA 5DLYA 2MMCA 5JRZA 1CCWA 4AJPA 3QKSB 3CZMA 3MAGA 2P0YA 3RVDA 3VZBA 1MCZA 3FVWA 2A0KA 1ZVMA 2ISCA 3F1LA 1FU4A 4PZZA 4KXFB 4Q9AA 1IG3A 1U7ZA 4R1SA 4RNDB 4V0OA 4COOA 4D6XA 5BMVB 5KNCH 4KAJA 5EJAA 2A1IA 3KJHA 1OVMA 2CBGA 1C7EA 1E98A 1KPGA 2X40A 3NTVA 3QKSA 4H9GA 3OO0A 4I6JA 5IAEA 3ZJ5A 3FPLA 1YTUA 1VKJA 5F1YA 1X15A 2GEJA 2B98A 1ZHOA 3UIEA 3KAJA 4OQNA 5BMVA 1JBQA 3DEFA 3KHSA 3ONFA 1VL5A 2I3AA 4DA7A 3Q2KA 3GNLA 3IKLA 5E2AA 5L3VA 1P1JA 1JEDA 1QHGA 2AN3A 4TMTA 1IONA 4YDRA 1YE8A 4JI2B 1Q92A 3K4QA 1SCAA 4ZOBA 1A04A 2ODAA 2HUNA 3FR7A 3A3NA 3R44A 5FA5A 3V00A 3DQQA 1M33A 4MCJA 1R6AA 1XZEA 1IK6A 1GGEA 2G4LA 4UTRA 2FZGA 5C4MA 3I9KA 3ENWA 5AO9A 2HA4A 3PB3A 2FK8A 1GKKA 1NUAA 2O7RA 1XTUA 5AM5A 2JLRA 3W4KA 1NV9A 4CG2A 2VA9A 2YFKA 2OFPA 3SKXA 2XDQB 1W35A 2CBZA 1DWOA 2QRGA 3RS7A 5DYTA 3UT6A 2QM3A 4N5LA 3N5CA 5B6PA 4CDRA 4HSGA 3RVPA 4B4OA 4HH3C 5LQCA 2VT3A 5LYYA 2ZPUA 1J56A 1S2GA 2GFQA 3AEKB 2VRNA 3UA4A 1SUSA 1O4WA 6AT1A 1JHZA 2XDQA 1FLVA 2JKZA 4BO5A 1VYHA 2I7CA 3EWIA 2CMHA 5SICE 5HRUA 2QUZA 1OT5A 3EDRA 4EFDA 4A82A 2JFWA 3ANXA 3DA8A 1A2BA 3TZQA 4R98A 2WTUA 1RTKA 5B3JA 2ZIVB 3VZDA 2ZCJA 1JEQB 1R9JA 4E6PA 2QUIA 2DB3A 1M54A 2JGLA 2FX5A 2YWHA 3KDAA 1YRYE 1QIFA 4OBXA 5EKSA 1MW8X 1BE0A 1Q1ZA 4DQLA 3INTA 3OFND 2GARA 4NU6A 5FOUA 4AJKA 1OWPA 1SWVA 5COQA 4WPGA 4Y0VA 3HXKA 3WIEA 4MGZR 3ZDYB 4WXYB 3L6RA 4DADA 2MSLA 1AA6A 3T3EA 3U4HA 1L5HB 1YZYA 2IYPA 3QFRA 4UM7A 4PWYA 1JA0A 4EATA 2W7TA 4DT1B 1NU6A 4NEHB 3QSGA 2FI1A 1N4AA 1K0UA 4NZPA 4MA0A 4TVKA 3ZI4A 5CD1A 3PFHA 4PZYA 6YASA 3E9MA 2HL6A 1MG0A 4QFCA 4JP3A 1X7YB 4UARA 4KPYA 1AM4D 2FEWB 2R11A 4IR7A 4KYVA 4UVIA 1YQEA 1E1RD 5FV7A 1OYWA 2CJWA 3RVRA 2P4HX 1LSUA 4BLUA 1A8HA 3EYWA 4U39A 1UAGA 5FWXB 1B42A 3UK6A 1N5RA 4G56A 2VZ0A 3GFPA 1MJFA 1JEAA 1N9ZA 1R18A 1ML3A 5C4GB 4C2BA 1TVKB 2QX7A 3A0UA 1TLTA 4KQHA 4RTJA 4D6YA 5SZJA 3SN6A 4B2YA 3TTVA 2MTBA 2Y1XA 2H4ZA 4RKYA 5SYMA 1VZ3A 4YQZA 1KH3A 3GGJA 1ZIOA 5FWXA 3H11B 4WY8A 2E6KA 2V54A 4K26A 2BHTA 1TVKA 2EX4A 1F2VA 4DJTA 2VOJA 4C6RA 3PXUA 1M10A 1Q1EA 2ZVDA 1UXIA 3ELBA 1Z0UA 3ICEA 3CNNA 2QKYA 3H11A 3A11A 3IUYA 1Q15A 2W83A 4FFPA 1JAXA 2OBYA 3GJTA 3ZGYA 3K16A 2D1QA 3EG5A 4LYJA 2X8BA 1UK8A 3FTDA 3IMCA 3JASA 4YAEA 4HGPA 4IG4A 1BHO1 4DGSA 3K71B 4L9AA 1XZBA 1ZICA 2B34A 2I2AA 2XYRA 4AG5A 4EQZA 3AHCA 2DPMA 3T0IA 2BBOA 4DCSA 4WACA 3TRFA 4AICA 5KMGB 1L5FA 1G2PA 4X6UA 3Q85A 1O03A 4BNFA 5C7OO 3VHQA 1UJMA 1VCOA 1Y4SA 2PGIA 1Z0IA 2G4VA 1R4AA 2C9YA 2QGNA 2RCNA 2W98A 3F6CA 3GFSA 4QJ5A 3IODA 1QH1A 4PHCA 2WOOA 2XKAA 3CWQA 4CV2A 3I53A 3FDZB 2IYAA 2GEDA 1A3CA 1UPXA 2QX4A 5CTAA 4K87A 1KJWA 4I1OA 2RONA 3GRPA 4AUKA 2GKGA 3D6VA 2WINI 1SU6A 1GUBA 4I6EA 4X90A 4G0VA 2XHEA 2O2JA 3QLTA 4C0WA 3QJGA 3L0DA 3GRYA 2I67A 2J87A 3THWB 2P6NA 3OMXA 2G0NA 5CX4A 1KU6A 2X6TA 2D0DA 1EVYA 4CLHA 3QJYA 1N92A 4F8YA 4RKEA 2Q07A 4ARSA 1MG5A 3FVVA 1YH3A 1JR4A 1QMGA 1I30A 1SD5A 1K4YA 1HNNA 3DCIA 1XCJA 3THWA 3E82A 3TLYA 2BIFA 5LZ9A 1NN1A 2CHUA 4CMCA 4QL3A 4PVDA 4UD2A 1DJLA 1K9SA 2BEVB 4KQFA 4L5AA 1DTWB 1IRIA 3R7BA 2FXVA 1XA0A 4EABA 2O50A 2OV6A 1TZKA 4JI1B 3VR5A 1YZKA 3VGJA 2E4XA 5KSYA 3HJGA 3R77A 1MO6A 2P11A 3JQBC 1T4MA 4KDRA 3JCZA 5FBHA 1QB7A 5FOTA 1W19A 4BVJA 4W5RA 3J7TA 2BEVA 2JLUA 4YACA 2VA8A 1JVNA 4F3CA 3E4DA 5ABPA 3IE0A 2IPAB 4IIDA 5JAMA 3KKZA 4RCZA 4BZWA 5GIOE 2OOKA 1PX0A 2P41A 3E8MA 3JYQA 2XCTB 4MP6A 1RIIA 2F1IA 2EFHB 3HBLA 4LISA 3OQVA 2DPLA 2E1PA 3GPDG 3V33A 4D0LB 221PA 2JH8A 2XDAA 3AMVA 1MNQA 4WNIA 4FKMA 3OZ7A 1A88A 2LP4Y 3IT3A 4LOJA 5CPBA 1T91A 5LP1A 4D9GA 1YK0A 4ALMA 5EZ5A 1AJEA 1Q1AA 1EHIA 5D87A 3Q9UA 1DO2A 4IS3A 5HJ7A 4S35A 3SQLA 4A0GA 3BIXA 1VJTA 3T52A 2B7LA 3TX6A 1H0RA 4LFAB 4TMWA 3L41A 3WGGA 1BMFD 4BZXA 2OQVA 4C6TB 1CRPA 3UB4A 1TFUA 3MBOA 1VP9A 4FYMA 4C0XA 1PT6A 2JCBA 4XDHA 1HYEA 3X1MA 2IH2A 3T1QA 4QNNA 3ZWNA 1BAPA 2Z6AA 3AIMA 3UC5A 2C78A 1J1IA 2X2PA 3IVRA 4C6TA 3GP8A 1AQUA 3PXEA 2J5XA 1UK7A 5B1EA 5E4TA 1LDBA 1R15A 3AY6A 4R1LA 4HQ0A 4QG7A 2EJVA 3O8OB 2ZRHA 4KRYA 4M98A 1F48A 2DE0X 3VXKA 1FUIA 1UFKA 1Q16A 2OECA 4WKPA 2IUEA 4W1QA 3LDUA 5LXTB 1GNLA 2BMDA 1J42A 3S5JA 3MD0A 4ED9A 3DYIA 4JVLA 1TJYA 1QOZA 4QLBA 3GVHA 4RD3A 2JA2A 3RBVA 2O0MA 3O8OA 4M21A 3BXFA 1N7GA 4NBRA 3OP1A 2RGXA 4JB2A 1HQDA 1T9KA 4FNAA 4DV6B 1G5RA 1C7IA 1CG6A 1M1NA 2BR3A 4KLAA 3HEBA 1OI3A 2W4QA 5LXTA 2IS2A 4F97A 3EQ8A 4IGFA 3WYBA 3OJWA 5IN4A 1M73E 3AP1A 5T4HA 1GZVA 1FXWA 1XZJA 2VWGA 1X8LA 1GG2A 4N0EA 3L8GA 4AZ0A 9GPBA 5IT5A 2XR1A 4ZAXA 2J46A 5IC4A 3R7FA 2RH8A 1L4BA 1Z33A 2XHZA 2XODA 3C70A 4G0YA 2UYQA 3FLAA 1ZWKA 4LMPA 3KQOA 3PKIA 5DGCA 3OBBA 4WK2B 2YZGA 3DLCA 3M6FA 4M0EA 5CA1F 5ALPA 1WULS 2I9PA 2J5QA 5EZYF 3EPLA 3T4UA 1G3RA 1OCEA 2OMEA 4WGGA 3LUKA 2K7ZA 1U94A 4QJIA 1JSCA 2WAYA 4D8WA 4EVQA 3TFQA 1K86A 1AURA 4P82A 1GGJA 2RK3A 1WB6A 4CL2A 1P9RA 1RAGA 1P9WA 2XWJI 2BUAA 4DB4A 5KWJA 2A2ZA 4NBSA 4Q37A 2W2XA 4TGLA 3TVYA 1N6LA 2A8YA 3AWDA 1MDFA 1E2IA 2QN2A 4C1NA 4HUJA 2A1TR 1AUXA 2C1EA 3ND8A 3PNVA 4CEJA 4MAMA 3HJRA 2OC9A 3KSUA 3MCZA 4JLAA 2R7KA 4N01A 1VB5A 1QKJA 5CLGA 3SF8B 2FDRA 1XRQA 2AD1A 2UUAB 4YRPA 1FDSA 1S01A 3LECA 3KALA 1G4UR 1ZH8A 1G6Q1 1LJLA 1RVV1 3E27A 3FAZA 2VDKB 2IHJA 4JX8A 3ROTA 2DBQA 5A4AA 5LWHA 3R3HA 3WQRA 1H8EA 1QFYA 1NNI1 2EV9A 2KBFA 4NJEA 5JEEA 4P0PB 1U6IA 2ZTHA 3DZJA 1LTHR 4RJKA 1XIVA 2C5AA 1XNGA 5AKKA 5KYTA 1IAQA 2C96A 3UMBA 1SUAA 3PVCA 4QAQA 2C4WA 5K0LA 2WQ6A 3IAXA 4QUBA 4TV9A 4FP9A 2I5PO 4IDOA 1C9DB 3C5WP 4OP2A 4MGHA 4DMMA 1FZTA 1PV4A 5DK6A 3A1NA 1I6MA 4K9LA 2G80A 1P7VA 2O3SA 2F1HA 2XMGA 1PAUA 4QSHA 4E33A 1TO2E 1YJQA 5HGJA 2ZUBA 4UU8A 2C58A 3K4PA 3RS5A 3PBKA 4Y2QA 3SGLA 1O0CA 1R5OA 4YROA 1K97A 3CXUA 3FNRA 4KXXA 4PU0A 3VVCA 1F51E 2HHJA 3WA6A 5MF6A 4D9BA 1K8QA 1V71A 2TSYB 1M5UA 1P5HA 1PKEA 5DV9A 3SD7A 4DMUB 4D8VA 1TKBA 1SUDA 1XKTA 1E6UA 1A7KA 4W5WA 1HE4A 1SXQA 1YMQA 1DARA 1KA9H 2Q3JA 1JJIA 1G2IA 3HM9A 1P39A 2JFXA 2ZB2A 3K8ZA 3PNMA 1OXBB 5E1BA 3S2ZA 1R50A 4ND8A 4TYMA 5JIBA 3MOGA 2XYHA 4J43A 5JNRA 1CUZA 2Q6LA 1GT6A 3WOHA 1L6RA 1Z2EA 3ZI0A 2FV8A 2VFAA 4DYHA 4ENVA 3WX0A 3QFTA 1C3XA 2Z8XA 1TU0A 2OGUA 3VSCA 1NWCA 1HEIA 1YIOA 1HZJA 1HTWA 3LHFA 2VJLA 4CM4B 5M2QA 1OSNA 4U7PB 1JT2A 3EZ6A 3RSLA 2VSXA 3ORRA 1PZMA 3BIOA 1N8SA 1RQNA 2I8AA 4G8CA 3F6SA 4X44A 5TMPA 2P75A 2O4CA 5AW0A 2EWVA 5DHPA 5G4LA 3EZFA 1W4AA 2H2FA 4RIIA 3R9WA 3D3EA 3BXXA 4HNAB 1P75A 1P2TA 1Z18A 2PZFA 4RTMA 3OCJA 1WXQA 4TSFD 5H81A 3RTGA 1CJBA 4DCVA 1JQLB 2GPSA 4MYTA 1XA4A 4XB2A 3HDTA 1AS0A 3CF2A 1NYQA 1KFJB 1OZ0A 2GPYA 3CX3A 4HNAA 2IUFA 1T9HA 4DHWA 1VL6A 3FFAA 2C31A 2BI8A 3B3QA 1CE8A 3GT0A 1E77A 4TN5A 3TE6A 4B82A 2QYHA 3TUZC 1BVRA 1FUEA 3P9IA 4FT4A 4H17A 4HEJA 3JAKB 1DE0A 3W5UA 4X9XA 4NX2A 3RIHA 4HWPA 1YV9A 3ZYCA 5KPJA 1H0HA 2WSSD 4PC6A 3IUBA 1I7DA 2MYTA 1U7DA 4DA4A 1ODIA 4I1YA 4ON9A 3O9ZA 2QMHA 3A1FA 3ZDFA 4MVJF 3PPIA 1XCMA 3CH4B 1GT91 2X19A 3JAKA 2ZAYA 1U1IA 2W8ZA 4L0CA 2FZ5A 4G1CA 4JEHA 3T4PA 2PZEA 2ZIUB 3DCYA 3ZTYA 1SU8A 4FVTA 4DSAA 4JBLA 4US0R 4LTNA 4ZCIA 4LWPA 3HN2A 1G5TA 3VYSB 2UXDB 2XUJA 3DVAB 4WBNF 3LLSA 1RXWA 1BX3A 2OWEA 2PUFA 1LRLA 1I1HA 4HTFB 2O5RA 4MNTA 4F4CA 2PQ0A 5K0JA 3ZV6A 2AFIB 2F43B 4P3XA 3UOWA 3UQZA 4ZQFA 3JWEA 1SUFA 3CWCA 4XUDA 3DVAA 2ZJ8A 2CJPA 3EOBI 4OL9A 5FOXA 1Z6YA 4PLYA 2RE8A 4HTFA 1S3GA 1JHXA 4LV8B 3AQ4A 1SKYE 4REOA 1P0MA 1JTFA 1WM1A 2AFIA 4JZYA 5FH9A 5K5EA 1EGHA 2A59A 4RQAA 4K6OA 1IU9A 1JBKA 2VRWA 1JHMA 2BR4A 2DQYA 3TLAA 3UAGA 1S2DA 3VR4A 4AUMA 3W9UA 3SX2A 3W6UA 1FW8A 3VYRB 1Y89A 4FJ2A 2CHVA 1LDGA 4ZVTA 3E61A 1KP3A 3N75A 4KGXA 2FRVA 4O4HF 1YDGA 4TYNA 2CLOB 4ZK6A 3NHAA 4OBWA 2F3PA 3OM9A 4J7XA 4QUDA 2C29D 2LKDA 4XDZA 4ZOCA 1H3FA 3D0OA 1CP3A 3SXJA 5EG5A 5IK2D 1CKEA 2PUBA 3TSYA 3RYCB 1DRUA 3TR0A 1KP2A 4C6SA 4EA9A 2XOEA 2XUDA 1U7PA 4RY2A 3MTBA 1PQWA 2W37A 2C94A 3G2JA 4G1UC 5H80A 3DBLA 2OCGA 2PM8A 1G9XA 3I30X 1TZ2A 4PGFA 5A7FA 2GM4A 1GPNA 1WDLA 1Z83A 3BERA 3GW8A 4UNPA 5EPUA 4XE5A 4OMDA 3RYCA 2HD4A 1NXVA 1WCV1 2FPRA 3Q40A 1E0JA 1G63A 1O7JA 3FM9A 4U3JA 3FYUC 3AY7A 4DNXA 4RULA 3OIYA 1LPOA 3JAWA 3OM0A 4FD2A 4YRRA 3EPJA 5EA2A 5LC1A 2XCQA 1SD2A 3IUPA 1SUEA 3HJHA 3ZHZA 4EG0A 1JQEA 2W6PA 1G59A 3BL5A 1GZ5A 4LZLA 1BA2A 2QUAA 2ST1A 5TVKA 3BBLA 3TM4A 2W70A 3B89A 5KNLA 1CLEA 2QVCA 3UG7A 1FFHA 2CYAA 3C87A 3NYIA 1KFKB 4ENUA 1VSQA 2F62A 3OZAA 4FIDA 3IPLA 3WJ1A 1VLVA 1YIDA 2X7JA 3EUWA 2VF5X 3T1NA 1TCCA 3DKRA 3BGOS 3OU2A 1Q0HA 3PQCA 4V0LA 5BT8A 3TS1A 1YTLA 4YPOA 4MINA 1WW8A 2XKKA 4JC4A 2ZRJA 1BE6A 2GEVA 4GPD1 1K4KA 3R7LA 5K9ZA 2XSZA 4YMHA 3NHUA 4HN4B 4LJ7A 1Z2OX 5EI5A 1W76A 1L8AA 1UEJA 3VTZA 1FDWA 2BLLA 1OAKA 4HQFA 1YR1A 3IUJA 7ADHA 4M22A 2GH1A 4DLLA 5JJBA 1JQBA 4NDZA 2IZ7A 1CT9A 4PG7A 3RVMA 1NJ2A 3KWFA 1TEVA 3SP1A 4BKUA 4R2WA 4DOMA 1VL2A 2GK6A 3CYFA 5JSHA 4JUBA 5CFLA 3HJUA 5IC5A 3TL6A 1JUDA 4FHGA 2Y0DA 1YL6A 2QU8A 4UCFA 2UYYA 3IAUA 2QSUA 2Y66A 1I7LA 1TO6A 2FGKA 3W5HA 3UWMA 3THRA 3VKGA 2KE5A 2OCKA 3N8GA 2ZAMA 5A2GA 2GD6A 1YR3A 3WB0A 4JI4B 4Z5XA 2UZ1B 1U2EA 3UV7A 1GTL1 5CVEA 4DR5B 2IT1A 4CU5A 1P19A 1A5AB 3VPDA 1FK8A 3A9WA 3H6HA 2YL2A 1SC3A 3NUGA 3U44B 1YCHA 4BBZA 3WNZA 4YY3B 2P9TA 2BYTA 3DAPA 4KPUB 5P21A 2PHZA 2GOYA 2I33A 2ZRIA 2ZU0C 4L8YA 4UUAA 2CL0X 3DF9A 4UUNA 4B3FX 4EMSA 5HZMA 2UZ1A 4X6LA 3WQQA 3UBTA 1JDZA 4LYYA 4R2KA 4FNGA 8GPBA 6ADHA 3TB6A 2ZIAA 1N1GA 3GUHA 5ELLA 5A4FS 1MC8A 3PXXA 5AW8A 5JXJA 3JAMA 4BHTA 2BHLA 3U44A 4TL8A 3VBEA 4P5EA 4XM1A 3EPKA 4O4IB 1RRKA 3WGJA 2XUQA 3EOAI 4IMIB 4Q7EA 2WU1A 4TLEA 2FWRA 4EITA 2WF6A 1L5MA 2ZBGA 4R3UC 2Y4OA 1LPNA 3RV3A 2WU0A 3ILHA 4QVKA 1X8XA 1ZCJA 1Y8QB 1NKTA 3M2TA 4QODA 2VPYA 5J2TF 3TKAA 4BVFA 4X1YA 1C41A 1NRIA 1LVHA 1P2GA 1W4RA 5I51A 3BHJA 4O4IA 5G3YA 1N36B 4HNTA 1S0UA 1CDOA 1PL8A 3DXYA 4PQEA 3JZMA 2JGKA 4YCJA 2CUKA 1UPBA 1UPFA 5BSUA 4UQOA 1DAHA 5BOVA 5EJ4A 2BRUC 1B0PA 3HDHA 4INPA 1SOMA 5J63A 3T7IA 1ZM4A 1MFPA 2H16A 2IK8A 4OQMA 4OU4A 1ECFA 4QX6A 3AF6A 1S9DA 5AKYA 5ES4B 2CUZA 2LR0A 2OKGA 3EEFA 5FAXA 4AD8A 3OE7A 1XKLA 3GIDA 3QF7A 5H68A 3QTBA 4INOA 1KJ9A 3V8EA 4UHJA 3JRNA 3D3KA 2JJYA 2V5UA 1B3RA 2X5OA 2PZJA 1PNQA 5IVIA 4Q4LA 2BM9A 2QGFA 3K0AB 3DAHA 3RUEA 1CUUA 1P3Y1 1YB1A 3UMSA 1RRVA 2FWJA 3RF6A 3WMEA 4BLWA 4DY6A 3I28A 1HDYA 3KC2A 3NC4A 2O19A 4YMLA 2Q49A 3BA1A 2OXFA 1AKWA 1RRGA 2H4YA 1YQQA 4IX1A 3BWCA 3VYWA 3A58B 3NTQA 4IGEA 3THYB 3ZBQA 2AR0A 3GFBA 1CUDA 4G23A 2EERA 3CRRA 4H7KA 4DNQA 2UZ4A 3HI4A 4H27A 2BJHA 3GVPA 1COWA 2P2GA 1OHHA 3D4NA 5HF8A 3T5GA 1CIPA 2BFNA 1LLFA 1KZ6A 2P3SA 4RL4A 5E1DA 3THYA 4ZYVA 1J24A 1PBNA 3FJ1A 1PW5A 4GQAA 1NNSA 5TY0A 3UO8B 5HMMA 2M1XA 2D8AA 2J9XB 1D9ZA 1WB4A 3OMLA 4LPKA 4ZPJA 2CUNA 1I7QB 4KR7A 3TQIA 3M1AA 1DEAA 2YW2A 5CMLA 4K46A 4FIZA 3P9ZA 4FHZA 4ZEVA 5C5EA 3WGMA 4URXR 1JHDA 3KVNA 4YJ2B 3U9LA 2SNIE 1FYWA 4YDQA 3HBJA 4BNXA 3HXTA 1UUFA 3A4LA 1WWKA 4IDEA 5HQTA 3U61B 4DREA 1F8GA 3ZW9A 4CODB 2I99A 1A27A 2QXYA 1MRSA 1JG2A 3QV1A 4YJ2A 2ZWAA 2ZGVA 3I2FA 4CR7A 4BAUA 3R0QA 4FGLA 1AHPA 2ZUSA 3CPJB 3T7AA 3GNQA 2HMWA 5LFAA 3DBOB 3ZY2A 1PLLA 2PX5A 3QF4A 1Z5GA 5K3SA 5A4DA 5KPDA 1LF0A 1UFOA 3PQFA 5U4XA 3VNRA 2PGLA 4F04A 3T1YB 1WXGA 1Z45A 5DP1A 4IEEA 1QE3A 4IFBA 3TLEA 2VBCA 3I5UA 3UAXA 4AMGA 2D1SA 4GOKA 3SG0A 2HEGA 4A6PA 4YONB 5F9FA 1DQSA 1JKXA 1R9MA 3WBJA 5LPNA 3ZVNA 3QWHA 3FF1A 1VBNA 3OAAD 1GG8A 5EKTA 2WYIA 1LPAB 3COZA 1TX4B 3JQPA 5BORA 2POQX 5K09A 2EWWA 2G25A 1QB8A 4P33A 5FPSA 5MFPA 3URMA 1W36D 2YVQA 1TIPA 3NTOA 5F12A 1PSDA 2O6HA 2PA3A 3WLEA 1SXPA 1U2DC 3DOHA 3VQTA 2KB0A 2IHZA 4W7SA 2CHGA 4UTNA 2CL6X 3DV9A 1M8GA 1BDJA 1RLMA 3RREA 4DRZA 4FB5A 2VHQA 4Q6WA 1Y1RA 2GNAA 3B1KA 2AH5A 1NR1A 4HQKA 5C8ZA 3WP1B 1KO1A 2ZBUA 3WMXA 1FU8A 2D54A 2OORC 1CXZA 2ZBQA 3H5OA 1I4TD 1RD4A 4LF4B 3B2EA 3QKRB 5BN3B 2WK1A 1P8JA 4DKJA 2PO5A 4TKUA 2ZDQA 1DCKA 4JJEA 3GLSA 3SHFA 4DIOA 2DUWA 1O58A 3PC4A 1TAUA 1KXZA 2HU5A 3ZU5A 1G60A 2FZCA 1SHZA 4Q39A 5CIQA 3LPLA 4KWHA 2Y0BA 4KAXA 1B2LA 4JODA 3F6EX 3FH0A 2FJUA 2TYSB 3HJCA 4P3OA 4XWGA 1E5TA 2ZBFA 3S29A 3U62A 2Z5GA 3NVKI 3DHVA 3B3GA 1DC5A 4PC1A 2R8OA 4P32A 4R83A 4JV5B 4W5OA 3U80A 2K7FA 4CGZA 1INLA 1DP4A 1GILA 1NASA 3CW8X 4WKOA 1HQYE 5B7QA 5HG0A 4MTCA 5GP1A 4KXQA 1CDEA 3H4MA 1J8QA 2VPTA 4P84A 2JKVA 2QTZA 3QVGA 1KU0A 3GD7A 4W5NA 1EX9A 4ZI7B 5B3AA 3BICA 1GGHA 3FR8A 3UAWA 1A4IA 1RYMA 1J39A 2VQ6A 4I2NA 5EKXA 2HIAA 2ZB3A 2Z8ZA 4WW0A 3S1SA 3WYDA 3PKZA 1O6FA 2ZJ6A 5BQOA 2VCEA 3N5KA 5EAIA 5LQSA 2CLIB 2B20A 3LBNA 1SHKA 1ND6A 1OGYA 3U17A 4EAQA 3OKAA 1YOBA 2YQZA 3NHJA 3EA0A 4IF4A 1G8FA 2PRIA 3O93A 1T26A 5JNSA 1UWCA 2R2AA 3BAFA 1OH6A 5IMBA 1RLOA 1F6DA 3RFXA 2DP4E 2AT1A 2PNFA 4OM8A 1VIVA 5L3RA 4BU1A 3P0RA 3ZGXA 4A1FA 1ADCA 1XQVA 1OX6A 5AI5A 2ZJZA 4PGAA 2HA6A 4HWRA 4JUDX 3M6UA 3II6X 1GFWA 3KOMA 4D9NA 3G2HA 1H85A 2O8VA 3PD7A 1USGA 2D2EA 7REQA 3GQBB 1IDOA 3IUSA 3RUAA 2GRUA 1Z36A 1VIMA 5CFQA 3S27A 3GFGA 5JJKA 2BRUA 3AZOA 4GBED 4I3HA 4WNYA 3V4VB 4UTOA 3QITA 1DEOA 1VPTA 3PG5A 3SLGA 3THSA 2PVSA 4KKVA 3GDFA 3PQ6A 4LVOA 3TUIC 5J43A 3A9UA 1J5XA 4NEQA 1HDZA 2KX7A 1GEGA 3GQBA 3PJFA 3UNXA 1PEAA 2C4HA 5BW5A 3MIIA 3QOYA 4E03A 4W9MC 1UBRS 2JAWA 4J6EA 3WJ7A 3KOZA 5BR1A 1KYQA 5I9SA 4DIDA 1X3SA 4RMHA 2X5KO 3OJXA 1V3QE 2F9LA 1YR2A 3ZVLA 1A77A 4PTLA 1W5EA 3OZCA 4JJ6A 2GTIA 2OCPA 2IHTA 2IV3A 4YQFA 1EUCB 1NOIA 1EK1A 1PWHA 1AUVA 2QLLA 5FI3A 4FFBA 4KVFA 4HVCA 1JHAA 1H69A 1QIDA 1QYCA 3I64A 1GKLA 1HYQA 1JXQA 2X1VA 2AB0A 4H4DA 5A05A 3ITKA 5LYJB 1J1ZA 2X0NA 3K6SB 4LXYA 3ZZTA 5CCDA 1AQYA 1EUCA 3NM6B 3PFBA 1SBNE 4KWCA 5FHRA 1CQPA 3KWJA 2C5BA 5G0SA 5IBQA 3VOSA 3IP1A 5AVZA 2HA3A 1TDJA 2PUCA 1L4HA 5I3CA 5LQUA 4KUHA 4OLHA 3AOEC 1IG0A 1E7WA 4A1OA 1E3MA 1X42A 2XVYA 4DLRA 1E8MA 3ILVA 4YV2A 2FA9A 3NIDB 2QDKA 4RO0A 3F2IA 3BEDA 4YJ3A 2NSHA 4YP1A 4UHHA 2CVPA 2ECFA 3QVWA 3T5PA 2I8CA 3R8CA 1SUPA 1W4BA 3CT4A 2I6XA 3OOHA 4WY5A 3IUMA 2DETA 3JYLA 3G5MA 4A73A 4A9AA 1YJAA 3CG4A 3KJIA 3WGVA 3UUWA 4J4TA 1JDPA 4YK7A 2XCIA 3CN7A 3H1FA 1HE8B 4FXOA 1A2QA 1L9KA 4AY2A 3AVVA 1D1PA 1PG5A 3B3FA 1AB5A 3IAHA 1VP3A 2ZYDA 1UR5A 4ZAFA 2QY9A 1GGVA 3KM0A 2XZDA 3EVDA 3HUEA 4BZZA 2XXBA 5I47A 4NHEA 1VMDA 3KT6A 4FXPA 3KT8A 2IZ1A 1JX6A 2EFDB 2I4LA 3DP9A 2Q3HA 3KB8A 2NUBA 5AHOA 1Z26A 4D79A 1VLZA 2GS9A 3ANTA 1YVDA 1ZLYA 1AT1A 1QHNA 3NEYA 1JYEA 2D1TA 4HRXA 2OGZA 1HBJA 4JWKA 4TKVB 4YT5A 3JQFC 1E2KA 5IUKC 5FUBA 5IM4A 1BCRA 2OB2A 4OM7A 1K2VN 4O4LB 1ZVVA 3A9VA 1NF2A 3MUNA 2WJVA 2ZTUA 5J5VA 3IKMB 1XC7A 3EA4A 3OQBA 4IIVA 4KEAA 3W8NA 2DQKA 1QGOA 4N6NA 4HLQB 2GXUA 4UHEA 4YS6A 3ZCRA 3LOQA 4GI2A 1JA9A 2G1JA 4IOLA 4BB6A 5JXGA 3FLEA 4M86A 1SR8A 2VF2A 1BGWA 4PYKA 5AH0A 4HVAA 4FHDA 3IRUA 4RD4A 3VNUA 2J48A 4S24A 2WY2D 4BX3A 2X9NA 2ROQA 4XIIA 4AT1A 1FSSA 2H8GA 2WUFA 3SC6A 4D9KA 2OFXA 2JLAA 1JXAA 3FYDA 3K73O 2J3KA 4H3HB 3IQDB 4TVOA 1A9OA 3U56A 1KFEB 4LNHA 5HTOA 5EP1A 2OORA 1I2BA 1NMXA 2G1AA 1G1MA 1XPRA 1RPNA 2GPBA 2Z04A 3SNKA 4UBLA 4B47A 1TQ2A 5KNBH 2JFZA 2OM2A 3AFOA 3PFNA 3WQSB 2NADA 1MORA 1L8LA 3PPXA 4BJ1A 4CMBA 5BQ5A 4F9FA 4UU1A 2O8EB 1T9ZA 5F9HA 3OZIA 5E7QA 3IYLW 2NVWA 4GAEA 4UNQA 1Q1BA 5FTLA 2Q1TA 3MWDB 3RLIA 1B8UA 3JU3A 3HU1A 2ZYIA 4LHZA 4OKIA 1QG2A 3TDMA 1WUIS 4ES6A 4D9EA 4J90A 3S8MA 4WY2A 1WLSA 5K05A 4B40A 4MKIA 1H3NA 1AF4A 1GYQA 3WP0A 2WIFA 4ZQGA 3CB4A 4GGMX 5BV8A 1E3WB 1FFGA 1DAGA 3KQMA 3KHUA 3D7MA 3AKYA 3CH7A 2JVJA 3MWDA 3OP4A 4HH0A 3TRKA 3RIEA 3L0PA 4ARIA 3ZBPA 4U9UA 4E7OA 4D0SA 2JLWA 5GVSA 1FS6A 2WWYA 1FVHA 4MPDA 3AI3A 1K5DA 3IJEB 4MPPA 4UAVA 4AG6A 3PPWA 5IH3A 2OKCA 3JQQA 1E3WA 4R41A 4PF1A 2EVWX 3ZHVA 3HHPA 4LZAA 1XTZA 5FOQA 3WLNA 4LEIA 2PWPA 4QDXA 2O52A 1QXSA 5M29A 2X1MA 4HP8A 1SBIA 1VPWA 4MO9A 4Y6QA 1H1TA 3DLBA 3ROFA 5FUXA 3IR7A 3LLCA 4QE3A 4R3NA 5DIZA 4JSYA 2OV2A 3L06A 3WISA 3ZXXA 1QPGA 3TSWA 2BL4A 5M04A 1C80A 2BJWA 3D0RA 2BKUA 5BMOA 1Y7TA 1K6IA 3ZLVA 5FFNA 2CLFB 2VT7A 1L7VC 2ZRNA 1A9TA 3N2KB 1ZW6A 2W0MA 4Y9SA 3OZFA 1EVEA 2Z2JA 3QLJA 4FGJA 1ZN9A 4H0NA 4ZV7A 1QP0A 2BFEB 3M5PA 4XD7A 4F6RA 2DR3A 1Q0RA 3WLRA 2J0SA 4XDYA 2IA5A 3AU9A 1DQYA 4D43A 3KYIB 4RK0A 3G5UA 4MWSA 1MVLA 2BFEA 4M49A 2PUGA 2W6ZA 3ZG6A 3W8DA 4YB8A 2HF9A 4Y1EA 4HJXA 4MUAA 3L4JA 1XTKA 4HOYA 1PZNA 1IN5A 1U0GA 3MGGA 2Y0EA 1U3GA 3ZX4A 1R6TA 4BQPA 1CERA 1YBMA 3DEAA 1EH5A 3E84A 2CNDA 1ISIA 1NJ6A 2XVAA 3GCWA 4HWSA 4LOIA 4P58A 4CN9A 4WZAE 4J8PA 3EVBA 1D2HA 4RAQA 5H0IA 3SQDA 1KOFA 4CBVA 1L4KA 2IHVA 1HX7A 2GXSA 3A4TA 3C3EA 2FPGB 4HAUA 4A10A 1OILA 3RARA 4INZA 1YCDA 3TH5A 3ZNOA 4X8OA 2ZJBA