2J59A

Crystal structure of the arf1:arhgap21-arfbd complex
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
165
structure length
165
Chain Sequence
b'GSMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGLDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-RIBOSYLATION FACTOR 1
publication title Structural Basis for Arf1-Mediated Recruitment of Arhgap21 to Golgi Membranes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 59
structure length 165
sequence length 165
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-09-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2j59A00
3EZ6A 2B6HA 3AKDA 4L15A 1HE1C 3UATA 3Q9LA 2I1QA 1FL9A 1U90A 1ZUIA 2B7CA 3IO5A 4B44A 2IYUA 4C7OB 3QSYA 1MV5A 1CJKC 1JEDA 2IHBA 4Q1DA 1CR1A 1UF9A 4QJ4A 2QM8A 2IBMA 1ZUNB 3A1UA 4Z51A 1U0JA 1KJZA 3X1WA 4FMCF 3ZVNA 1XJQA 4JSYA 4TLAA 5GJWC 4QKQA 4DDWA 2MSCB 3CPJB 1NY5A 4B6FA 3NWJA 1MRNA 5L3QB 2YJTD 3IDQA 2FFQA 3PIRA 4NZYA 3PVSA 3CF2A 3L2OB 2V7QA 4M22A 4EFNA 2F1JA 1UDXA 4G5GA 4KSBA 2HYDA 4G3XA 1GL9B 2GEDA 3BD9A 2WICA 1DO0A 2XNDD 4A9AA 2GXAA 1ETUA 3GLFB 5GVRA 1ZC3A 2DHRA 3ZYCA 4LYFA 1W2HA 2MSEB 3U44B 1JBKA 1ZM2A 4Q9LA 5DYGA 4DSUA 1TUIA 4DUGD 1R0XA 1R5OA 1QDEA 2WPDA 4KVGA 3H86A 4K8OA 4IHQA 1RZ3A 2IT1A 3AEZA 3C5CA 5EZ5A 5KTYA 1GTVA 1MABA 3X1XA 4C2TA 3AF4A 4AKIA 5TARA 4CIDA 3OAAA 4RZUA 4B43A 4MRVA 1NVVQ 4HAVA 1TEXA 2H8KA 2ZREA 4JLAA 1E2GA 2FPKA 2PH1A 1AGRA 2Z6VA 4KCGA 4NCHA 4Q21A 4RCZA 3AKYA 1CR4A 2HLDA 2VQSA 1TEVA 1PZNA 3BC1A 1G8GA 3OEEA 3QKTA 3AVYA 3R20A 1L4UA 3FGNA 3IPYA 4OHWA 2IWHA 2BMEA 4I1UA 2F9MA 1FTSA 4DSTA 5KO2A 3K70C 3L8ZA 5CM8B 2EYUA 2C96A 2ZYUX 3VX3A 2O8CB 2AL7A 2XTMA 1KI3A 1II9A 4X8MA 1XXHB 5HCNA 3I62A 4TYNA 4NYMR 5J4LA 1XTRA 2ZI7A 4IDPA 1OT3A 1QF9A 1PVOA 1JALA 4IEIA 2E1RA 4JT2A 4Y0VA 1ZD1A 2C9YA 3KXLA 2Q3HA 3W34A 1US8B 1KIMA 3LLUA 3QKUA 2FU5C 5BYKA 3ADDA 3U60B 1LV7A 5LB4A 3U4QB 4DLYA 1G7SA 3MUFA 3LW7A 1R4AA 2ODBA 5GJVC 3BJIC 4MRSA 4G0NA 3W5JA 1FUKA 2WAYA 1A82A 2ATXA 2B8WA 2FEOA 5CIWA 5J4HA 3VTKA 1FNMA 4GL2A 1JJ7A 1KZ7B 5IDVA 1P72A 4OHVA 3BORA 1GILA 4KFRA 1AZSC 2ZSDA 1BKDR 5DIFA 4GRAA 4MRNA 2QM7A 3FYHA 4UJ3A 1UEJA 3LD9A 1XJ0A 2FMXA 2HUPA 1JR3E 1Z28A 2ORIA 3CRQA 2UZ3A 5HKKA 1FX0A 1L4YA 1OXTA 1M7HA 5AUQA 1XWIA 2IW3A 4MGZR 1RYFA 1MH1A 1I4DD 5JEEA 5TDHA 3GFOA 4LX0A 5BW8A 4C0KA 2QP4A 5IT5A 1I4TD 2UVQA 3I8XA 3MCAA 3OE7A 4BASA 2G88A 3EWSA 4A82A 1ODFA 2JJ2A 5CB6A 4Z8XA 2QP3A 2DFKB 2JIZD 5HPYB 4CZ2A 2ZJ5A 1QVAA 4CF7A 4QM7A 2J0SA 3ZVLA 2QTHA 5EE1A 1E2IA 2FN4A 1DAFA 1R0ZA 1G3RA 4AC9A 3Q85A 1YZGA 4YQFA 2V1UA 1J8YF 1OH5A 4Q7KA 2A3RA 2R6AA 1NG1A 1TQ6A 1SZPA 2NOAA 3KKPA 3KKMA 4JVLA 4US1R 2EFEB 1C4OA 3LXXA 4JS0A 2EU8A 4DIDA 3DOFA 1CR0A 4Q7JB 2VA8A 2REBA 3BERA 1KSHA 4HAUA 4M1WA 4C30A 2PJZA 4M0LA 3UG7A 4EJSC 3TW4A 4Q1EA 5KU1A 2OBMA 3BS4A 4YMUA 1AJEA 4XSGA 4PHGA 4JKIA 2C8VA 2G0TA 4DRZA 4D4KA 1SKQA 3ZIAD 2RAPA 1VIAA 2IYTA 4YDHB 2QAGA 1ZM3A 2ZE5A 4C0LA 1AS0A 4HZIA 3TQFA 521PA 3GCGA 4TMWA 2RMKA 1MO5A 4M1KA 5KDDA 5KUTA 4LY6A 2FSIA 3AP3A 2VRWA 1T0HB 3GJ8A 1S0UA 1E9EA 3BFKA 5FTMA 4ZKEA 4MKIA 1QVRA 1ZMXA 4ACAA 3VKHA 4C0BA 2VHJA 2BBTA 4M4SA 4M21A 1W46A 4X8HA 1DE0A 5SZKB 1NKSA 4W7SA 5DO9A 2DWPA 2QAJA 2VSOA 3BE4A 2FWRA 3GFPA 2W0MA 4OQFA 4IXMA 2ZYTX 5EZ6B 1N6KA 5AJWA 5HZKA 1YZTA 1E2NA 3GLIA 3EASA 4AY2A 2IEZA 1KK1A 2G77B 4CT4B 2JASA 3OESA 4WXPA 2XNDA 1Z08A 5FBRB 2ZETA 2JLSA 3B78A 4Q01A 2YINC 5CYOA 121PA 4L9SA 4Z8YA 1E9BA 4MA4A 4KITB 4IEEA 4DUGA 3R7WA 3E5HA 3KQKA 2GKSA 2JDID 5TVKA 2AN9A 2A5YB 2J9RA 4WA7A 4A4DA 2IYWA 3AKEA 2D62A 4GDFA 3DM5A 2O8EA 3FPAA 3C41J 4UXIA 3EC1A 4TLCA 3CRVA 3TBKA 1IN6A 2O0JA 2WJHA 3A8TA 2ZR9A 4GI7A 2KBEA 2FGJA 1KI9A 2GHIA 1E9FA 1RW4A 2VP6A 4DT1A 1T5LA 3SJBA 3PEYA 4JLJA 1Z6GA 2D2EA 1F5NA 4Q4HA 2F43B 3B1XA 3BB3A 1GVNB 5EE5B 4FINA 1XP8A 4KYUA 1T3HA 2L0XA 4KFTA 4P0TA 3GJ7A 3HYTA 5HE9A 3MWLA 1FFHA 2RCNA 3DEFA 4JSTA 4JVMA 3ASYA 5CLLA 4R2HA 1IN4A 2KI5A 5FBLB 3X2SA 5H68A 3B2EA 2QRZA 4PZLA 2OEPA 2GEVA 3NVAA 2O8BA 3L0IB 3EZFA 5B57C 3EAQA 1VYTA 4TLEA 3UPUA 2BV3A 3KDSE 1G6HA 4KFUA 3TAUA 2ZJAA 3PEWA 2BEKA 2ODNA 2P3SA 3EPJA 1UBCA 3A1VA 3IO3A 3IIKA 3EPLA 1EGAA 2K5UA 1T3SA 1ZRHA 1M7GA 1UEIA 2XXAB 2R8RA 3EA0A 3ADCA 3ZJYA 3LH5A 1G7TA 4GFDA 2VP2A 4L16A 1QHSA 4ON9A 4A8JC 2ZRFA 4RD6A 3PQCA 5E7JA 3SZRA 2R65A 4JBXA 3A1SA 3BRWD 2ZJ2A 4C9BA 4OK6A 3K53A 2BCGY 1TPZA 5F9HA 4JLOA 5CLQA 2IS2A 4I99A 3GLGA 1N3BA 3EZ9A 2J87A 2WWFA 1XD2B 3E2IA 1KHTA 4HB0A 5L8VA 4EPVA 2P6UA 4F4IA 2D06A 2OFXA 1IJFA 1VKJA 4N1AA 5JSZA 2BIFA 1VIYA 2BMJA 3W3AA 4UKDA 1G19A 4RKEA 1ZJ6A 3R9WA 5FUVA 4V0LA 4I4LA 3Q72A 1D8TA 3MD0A 1Z0KA 4B3XA 1CF4A 2QSZA 4PFSA 4PC7A 3CLVA 2ZUBA 3TH5A 1VHTA 4GT1A 721PA 2HJGA 1WE2A 2JIZA 2RGDA 4DDVA 3QE0A 1K5DA 3NC1C 4HAZA 4TL9A 1SXJD 2ZVQX 3F5FA 4Q9IA 3TUZC 4O3MA 4LJ7A 2VPPA 2BOVA 3RABA 3MG9A 4EPYA 5FOVA 1OYYA 3JZAA 5LDDC 2IUSA 4TTPA 1P75A 1ZM7A 2QTFA 3BH7A 4BLSA 3W5IA 3WBKA 2IWRA 5IHPA 4LYJA 3GJ3A 4Q5IA 1AK2A 3Q7PA 1ZNZA 3LDAA 1QRAA 1W4BA 1HUQA 2YOFA 3LQRA 4HB4A 4RZXA 4QJ3A 2GCOA 1LVGA 2IYXA 2DR3A 4A1FA 1OKKD 3GLFE 1FTNA 1XBTA 5DHFA 1W4AA 3QXJA 3VHXA 4CEIB 2H17A 1N25A 2OT3B 4PQYA 3AUYA 1S4QA 1VYVA 1L2TA 4Q02A 4TTRA 2CE2X 4TTQA 3ZIAA 2QNRA 2WJJA 1A2KC 2YOGA 3KJHA 4TL8A 4Z1MD 1NP6A 2ZROA 3QPUA 2IXEA 5AJXA 1Z22A 4WZBE 2XB4A 1S8FA 4A8JA 1KZGB 2A78A 3CBQA 3TUJC 1GZSA 1FX0B 4TSFD 3DL0A 1QG4A 3CM0A 3D31A 3UXMA 3T5DA 3THXB 3DVLA 4XVRA 4A15A 5J40A 3AVQA 4EQ6A 3P4YA 2O5VA 1W4CA 3CW2A 3MJRA 3M1IA 1Z29A 1EFCA 4NL4H 5F3WB 4FCWA 3UK6A 1Q22A 2DCUA 3MFYA 4HZUA 1AKEA 2HCJB 2QRNA 4LBYA 2OFWA 5CJ2A 5D3MA 1OIXA 2NGRA 1KSJA 4WBSA 1XXHE 1OH7A 2IYVA 5J4KA 221PA 3SC3A 2W83A 1KOFA 1XPRA 4NU0A 1ZIPA 4FWTA 3UWKA 3K8YA 1WB9A 2IYZA 2JDIA 4LK2A 3H1TA 3ZLJA 3I1FA 2GVZC 4A92A 4NP6A 4B76A 2JLXA 5LBIA 1MO6A 1RRFA 1JAIA 2GZHA 2O52A 3W6PA 3DKVA 1BO6A 1XZQA 2HJVA 3K70B 2D7DA 2VP9A 3KJIA 3QBVA 1M74A 1UKVY 3HWSA 4Q4JA 3I92A 1NJFA 2ONJA 3V9PA 3ZGXA 3KJGA 2HXYA 1YZNA 3AV0B 3H84A 1KO1A 4NYMQ 5EE0A 3AH8A 2X8AA 2AFHE 1P5ZB 3P20A 4XD7D 4BQSA 1HA3A 2GJ8A 5DLQC 3FKQA 4EPTA 1UBFA 1KJWA 2WWHA 1G1MA 1TQ4A 4Q4AA 3BGWA 1OFUX 4NH0A 4UXHA 4DB4A 1N6RA 2KJQA 1NL3A 2WWYA 1Z0FA 1Z0IA 2DWQA 2Z4RA 1CXZA 4PHFA 1M34E 3AVXA 3I4LA 4OJKA 2CL0X 1LB1B 3ADKA 3DZDA 5F9FA 2N42A 3NEYA 2Q21A 3IHWA 3X1DA 2TMKA 3ICEA 1M2OB 3SDZA 4EPRA 4RD1A 1WBDA 1W2GA 1HH4A 1BIFA 2E9SA 1QHNA 2ZRGA 1WDTA 4C0AC 1TAGA 2MSDB 2Q3MA 1IXRC 1G3IA 3SQWA 3LV8A 1A5TA 1P73A 2OXRA 4M8NE 2XSZD 2ZRLA 3GLIB 1NIJA 1Z07A 5C18A 621PA 5FUYA 1ONBA 4DDUA 2Z4SA 3CWQA 3OAAD 1DOAA 1W4RA 2FNAA 1DADA 4E07A 1BH2A 2I1VB 1PLLA 4NCIA 2CXXA 4OK3A 2WV9A 2A5GA 1H8HD 1GFIA 3KL4A 2KWIA 4TQUS 4DLWA 1UBEA 2R6CA 1S96A 2P5TB 4LJ6A 4V0ME 4OQXA 2R62A 1R10A 1G5PA 1VG0B 1KAGA 2O8EB 1KO4A 1Q44A 3RS3A 4I81A 2I4IA 4QGFA 3TSOA 4URVR 5EP1A 1E6CA 1N2CE 4TYWA 1U8ZA 5JJKA 4KO8A 3KQNA 4NYJQ 4R98A 3I5XA 5CK5A 1Q1ZA 2YC2C 1JXMA 3S1AB 2AWNA 2XB2A 2OCBA 1SXJA 1F2UA 2ZAOA 3T1TA 1DELA 2VLIA 2JCSA 2V6IA 4DCUA 4GP6A 4MRRA 4KSCA 1RKBA 2ASEA 4HI0E 5BYJA 1T6NA 1GITA 4H9GA 2J0QA 2O8BB 1W7AA 2ZSBA 5TMPA 2F9LA 1S1MA 1CBUA 1JPNA 1G4UR 2VP5A 4PQFA 4NHOA 4AG5A 5KDOA 4V0OA 3K0CA 2IF2A 4TMXA 1Q0UA 2B8TA 2J7KA 5DHAA 5EE3A 5JBQA 2BCJQ 1MKYA 1N5IA 1GOTA 1NMZA 3RC8A 2Q9AA 4GZMA 4HDQB 1O87A 2HF8A 4B47A 4WOPA 4NYIR 4FI3C 2ZUDA 2AKYA 1GP2A 1OKKA 2OV2A 4H1UA 4Q1AA 3VMFA 3AM1A 1NLFA 4LV5B 2G1JA 1KI2A 3ETLA 5ANRB 1OFTA 5L3RA 4TZ0A 4GMDA 1ZNXA 4JL6A 4V0NA 4DEYA 5DI3A 4QL3A 3TJZA 4OK5A 4WAUA 1OH6A 2ZIAA 1Z0DA 4KI0A 4Z1MA 2RH5A 3CO5A 3KKOA 3GLGB 4JLDA 5L3VA 3U6BA 4GNKA 3RNLA 1NIPA 2CL6X 1IM2A 3GLHA 1KK3A 2QT0A 2PMKA 3CWZA 4XIGS 4RCYA 2QPOA 3VR5A 5JSZB 2X19A 4BZXA 1P9WA 5DGXA 4TSFA 3VR2A 4BFXA 1G8PA 4RZ3A 1FQKA 2RGEA 4AYTA 5IF9A 4LYAA 4PO1A 4LDJA 1Z6AA 3BWDD 2IA5A 3U7FB 3W90A 5CB8A 2YHSA 3FFAA 4EFLA 1J7KA 1UFQA 4TQAA 2W2VA 3RRZA 1JNYA 2C5LA 1NBMD 2WBLC 1JQJC 4C0HA 2QA5A 1W0JD 2G0NA 3QF7A 4M9QA 1U94A 3B9PA 4BZQA 1L7VC 3QY0A 2F55A 4DCVA 1K8RA 1JR3D 1TTTA 1OB5A 4G5QA 1Q1BA 2N1BA 2PT7A 2R6FA 2X1VA 2VIIA 3IBYA 3B1WA 2ONKA 4BRUA 4F7WA 2WKQA 4LC0A 2AK2A 4TYPA 2ZRBA 2CHQA 3BH0A 1E4VA 1E0AA 4Q1BA 2RGAA 1LF0A 1CJTC 1S3SA 1ZYUA 4TT3D 4B35A 5LPNA 1VCOA 3GEIA 2GCOB 1Z83A 1W47A 1YE8A 1J8MF 1DG1G 4XD7A 4QOSA 2IEYA 3VHLB 1RYHA 2VP4A 4A6XA 2XZLA 4ABYA 1UAAA 5EXSA 2PBRA 1P61B 1G3MA 4NE2A 3DZ8A 3ZZUA 3KKNA 4JBYA 5SZHB 4PSAA 3IIJA 4HUQA 1T4GA 3KJEA 5B64A 5BN4A 5JWOA 2CE7A 3FMIA 1CU1A 1G7CA 2PJRA 2JLVA 1FP6A 4OYHA 3QXXA 1OXXK 3LNCA 1NVUQ 4LBWA 1N0VC 1Z3IX 4B74A 1PLJA 2O0HA 1ESNA 3Q5DA 4A8JB 3LX8A 2JLWA 4JJZA 2OBNA 2OXCA 3GJ6A 4V03A 3TMKA 2GZAA 1ZP6A 1HE8B 2BHRA 2XEXA 4P4SA 2H5EA 2OESA 1QG2A 2J1LA 2XSZA 1HT1E 3IEUA 1QHIA 3NKVA 3NH6A 1M7BA 3LBIA 4JZKA 2OG2A 1N6OA 4JYCA 2J46A 1P4SA 5DE3A 4PQRA 1FP7A 2GJ9A 2W6ID 3D3QA 4FMBB 1ELOA 5D3MB 4IVQA 1UPTA 3MWKA 1Q20A 1VPLA 4MGKR 1U8YA 2IXFA 1MO4A 1H8HA 3LW8A 2NPIA 4B48A 2CL7X 1AA9A 2C9OA 2HT6A 2ZRIA 1IY0A 2QMEA 2ZUCA 3CH5A 1LW7A 4ZI3A 4GMXA 3THYA 1CJMA 1NLYA 2XX3A 3QQ5A 2VTKA 1P9NA 1OPXA 1GNPA 2XGJA 2F6RA 3BB4A 4Q7LA 4URUR 1G17A 5FPYA 3NDPA 3ZDQA 3T35A 3EW9A 4Q4JB 5FH9A 4OKSA 5DSZA 3B8HA 2A5DA 2NO1A 5C4MA 3ZS8A 4E5UA 3U7GA 4CYMA 2HF9A 4W5HA 4M1YA 4LJ5A 2HV8A 2J0UA 1D2NA 1R6BX 3AP1A 1ZD8A 4NCNA 1U99A 2YV5A 1Q1QA 3HU1A 4AIIA 2W00A 4BFVA 2ATVA 3CPHA 2WAXA 4D80A 4MKHA 2QAGC 5BXQC 3GJ5A 3L0OA 5KHOC 3EIEA 4O25A 3R8FA 5JRJA 1N5JA 2BMFA 2DFTA 5DYIA 3AVUA 2BWJA 3BAFA 4LJ9A 1YR8A 2CJWA 1R8QA 4DHEA 2XNSA 4D81A 4BGDA 1GAJA 4MUBA 3FE2A 3SQXA 1EWRA 5GJBA 3QKRA 3KQLA 1KI6B 1E79D 4QGHA 5B30A 1OYWA 1GNQA 2GXQA 5KSZA 4QHSA 5C1BA 4ERNA 2H18A 3RS0A 3DMDA 4DLSA 1LS6A 1JPJA 2GDJA 3VFDA 1M6NA 2ZRJA 2UKDA 3K9GA 1A2BA 1KKMA 5EE9A 2ZU6A 1KKLA 3FTQA 3GJ4A 3C16C 3PEVA 2IYYA 2ZS8A 1QHGA 3FHCB 2Z43A 4XH9B 2ORVA 1FNNA 3VU9A 4DCSA 2ANBA 1HV8A 4C2UA 5FBWB 2VP0A 1YR7A 4NBSA 1WMSA 1WP9A 5AUOB 5BN5A 1Q57A 2GF0A 4F91B 4OI4A 2NTYC 3WMEA 4NCKA 4EPWA 4BEBA 4E22A 4AURA 4U7DA 3K0AA 4IOKA 3NBXX 1OIVA 3Q5EA 1GIAA 5F2EA 4B73A 5EUQB 3CPEA 4MUAA 3MRSA 5FTLA 4IVRA 5KPJA 2NO0A 2RGBA 4Z54A 3KTAA 2CHGA 1W48A 1JEEA 1XMVA 4FMDF 1Y3AA 5K8LA 1P9RA 2CBZA 1DS6A 3VR3A 3CNNA 4M1SA 1NNEA 1XEWX 4PZZA 2JEOA 2CCKA 1XCMA 3OHMA 5EP3A 1NBMA 2EFCB 2YWGA 1EWQA 1E0JA 1W0JA 1SXJB 4Q9JA 1YU9A 1SQ5A 1F2UB 3A1WA 4QBFA 2GK7A 4DLZA 1UKZA 1JR3A 3FMPB 1G9XA 2OSBA 1OXVA 4PC6A 1U0LA 4W5JA 3CZPA 2BJVA 3O8CA 2ZI5A 4QFMA 1GKYA 1IN7A 1GG2A 3CRW1 2BMDA 4POAA 1NN3A 3GLIE 2VHUA 2XJ4A 4FMCB 4TT3A 4JL5A 1WA5A 5JECA 1F6BA 4JLKA 1XX6A 3NBZC 4PC2A 2J41A 4UJ5A 2WKPA 4M9XA 3UMFA 1RRPA 4FD2A 5JWRA 2ODWA 1E1QA 1HEIA 2O8DB 2GTPA 4QG7A 4DZZA 1X3SA 1FPMA 1HT2E 1DTSA 5DI3B 3U3OA 2XTZA 3QNUA 4Q18A 1EFUA 2CNWD 3GPLA 2R44A 3HR8A 2VHTA 3GLHB 1E99A 2IYQA 4DCNA 1IXSB 4OL0A 4MGIR 3GFTA 2ZAMA 2RGXA 1CP2A 3UG6A 1W5TA 4CGZA 2F1RA 1YR9A 4W9MC 2C78A 4FIDA 4A2QA 4MGYR 3BBPA 1N6NA 2WIBA 2PLFA 3WHLA 1J70A 3OIWA 4BUJA 3DO6A 3VR4A 2FSHA 1N0WA 2V54A 1IAQA 2AHOA 2W6IA 3SFZA 1SHKA 5AUPB 4P33A 2RB4A 4D26A 1Z47A 1ZC4A 1YZQA 2Q6TA 4QGAA 4B6EA 1Q1EA 3EZ2A 3ND8A 3TRFA 4CW7A 5JS8A 3T61A 2BBSA 1KI4A 5EXPA 4QGGA 2WHXA 5JHGB 1T91A 2ZM5A 2PMDA 4WZ6A 1KI1A 4BFZA 1AS2A 3NTUA 1X1RA 4OHXA 1R0YA 1E96A 1RJ9A 1RRGA 1D9ZA 1EFRD 2ODEA 1PUJA 2FEMA 1BOFA 2QPAA 2V4ZA 3PUWA 5DN6D 1VYUA 4OI2A 1AQYA 1COWD 3A4MA 1D6JA 2YWEA 1ZM9A 3O8RA 5P21A 5GADl 2ZITA 3SBEA 1BYIA 4EAQA 2XITA 4M1TA 4PXAA 1YJ5A 4N3NA 2FFBA 3I3SR 2PEYA 4RD2A 1I2DA 2G83A 2MMCA 3Q3JB 4BECA 1DAGA 3TAHA 4A2PA 1T9HA 2QMOA 1RPZA 2QQ0A 4B3GA 1OIWA 3GLGE 4Q1FA 3P26A 5BWMA 3LY5A 1V5WA 3CX8A 2DBYA 1JB1A 2REOA 4XTRA 4BFYA 4NYIQ 4OQMA 2HYIC 3IILA 4IOLA 4PSVA 1FQJA 1YHNA 3CF6R 4AKEA 5DISB 1JXOA 4KYIB 1E1RD 3WP1B 1FOEB 3U2QA 3F8TA 2GXUA 1XTQA 4O0MA 1TUEA 1FZQA 1XEXA 4YDSA 3X1ZA 1E79A 3NH9A 2GF9A 3B85A 2N46A 1YZLA 4MYHA 3RS7A 3W6OA 4P4SB 1Q21A 1R2QA 3RRMA 4TMTA 2EYQA 4US2R 1SGWA 5G3YA 1OW3B 2CK3D 2ZI6A 2GA8A 1MABB 2JATA 5JEDA 2J7PD 4BLQA 3BIFA 2LWIA 2JGNA 3SBDA 4QXAA 1ZU4A 4XWAA 1Z5ZA 2PL3A 3ZVMA 3QXCA 4JJKA 2G9NA 2FF7A 4EFMA 2PZEA 3RDPA 3W8NA 1CJVC 1CULC 2RGCA 3JZMA 5BN3A 2C98A 1GWNA 2QP9X 5HTKA 3I8SA 2DYKA 4UNQA 4HLUC 4DDTA 3U3MA 4M2LA 1F2TA 1KTVA 5J4YA 4BPBA 1KSFX 3THYB 1NN0A 1KK0A 3TNFA 2JA1A 2R6GA 3SR0A 1VDZA 4R7ZA 1YRBA 2FZLA 2V9PA 4JVSB 4FMDB 2BKUA 3U61B 1XJCA 2H92A 4QNRA 4S2EA 4UNPA 1IOZA 3B1YA 4JLVA 3VR6A 5EP2A 4U00A 2EWVA 4EPXA 1W44A 4PO9A 1KNQA 4RFSA 5AR1A 1U81A 1RRCA 1TQ2A 2P67A 3ZZTA 3C4JA 2J0UB 3LQQA 4PAQA 2WJGA 1SVKA 2CCGA 1XDBA 3OF5A 3NBFA 1XB2A 3QG1A 2BBOA 1E2HA 2ZJ8A 1HQCA 2WSSA 2WJIA 2ZS7A 3LO5A 2ECKA 1KO7A 2PZGA 4WZAE 3QENA 5CDFE 1OHHD 4FXPA 1YRAA 5KSPA 1ZCAA 5KNCA 4OJQA 4IDOA 1EXMA 2ZSFA 1G16A 3ZH9B 2CJWB 4IOJA 1BMFD 4L5BA 5CM9C 4ASUD 3KQUA 1IY1A 3GJXC 1UM8A 1R7RA 1Z0JA 3QKRB 3TW8B 1PLKA 5H8WA 1UKEA 2WJVA 3MGCA 3DHWC 4D0LB 4UXJA 2GK6A 4DLRA 1IQPA 2WKRA 4LI0A 3BFXA 4UNSA 3LRPA 1VG8A 2E87A 1FUUA 2VBCA 4KLZA 4Q4LA 3B5JA 1SVOA 1OH8A 1UJ2A 2ZE6A 2ZANA 5TXGA 3VU9B 3VKGA 1IXZA 1S2MA 1OLOA 2H57A 2QZ4A 2WJYA 2J0VA 2ZYWX 2WTUA 2CNWA 3KB2A 2FFAA 3CR8A 1E0KA 2GZDA 2D3WA 1LFDB 5FPKA 2GILA 5AWFC 3SU8A 2HDNB 4ZV4A 3AVTA 3O47A 4MKFA 3PENA 4TWZA 4CRWB 3K0AB 3P27A 1V43A 4GP7A 3ONWA 3GLFA 2VH5R 1W1WA 4F38A 4QHTA 5GVSA 4G01B 2OM2A 5FPTA 1PJRA 4HLUA 2CVHA 4HAWA 2BKEA 2B7BA 4JVNA 1XFAA 3I5YA 1N6PA 1NMYA 3N5CA 2ZPTX 3CH4B 4P3YA 1F3OA 5J47A 2BEJA 4CEJA 3N2IA 1XTKA 1SXJC 1CS4C 1MOZA 2ANCA 3FWYA 4LV6A 3C7KA 5H1YA 2OAQ1 2CLDX 1WCV1 3RLFA 1YQTA 2ZR0A 2ZR7A 1NJGA 4NPHA 1AKYA 4WVFA 5CIQA 5KSYA 2H16A 421PA 5KSOA 1N5LA 4RD4A 1EFRA 4HDCA 4C0QC 5M04A 5DN6A 3L43A 1R5BA 2ERXA 1COWA 4LOAA 3RWOA 3K0CC 1CLUA 3A37A 4MYTA 2J3EA 3JVUA 2QAGB 3TKLA 4DSOA 5JWHA 4IOMA 4HATA 4ITRC 2RKOA 2O8CA 3WNBA 2A5JA 4P4TA 4KBFA 4I1SA 4ZIRA 5JFGA 3AVVA 1XXHA 2GCNA 4J0QA 4M9SA 2JAQA 3RANA 4F93B 4V02A 5FUWA 4JL8A 5H70A 1OSNA 1P62B 1R0WA 4P31A 4JLPA 4HDOB 3QI2A 3SHWA 4DCTA 2CEAA 4A0FA 4JLNA 2C2HA 5C4GB 4BE7B 2VSFA 2V1XA 4B3DA 2ZRNA 1E1RA 2WOOA 2ZQ5A 1BYUA 3NDBB 3LAWA 5JCZA 1K5GA 1NY6A 4LGMA 1YZUA 3IBGA 5EQTA 4G1UC 3FFBA 3B6EA 4KFSA 1Y63A 2HXSA 3V4FA 1A4RA 2QE7D 3M4YA 3MJHA 3EZ7A 3AB3A 4NCJA 5CJPA 1PV4A 3R7WB 1S9HA 2QPTA 4S35A 5F98A 1DEKA 2ZJZA 1G291 5FOSA 3CX7A 2CK3A 2KE5A 4JLMA 4KHZA 3MLEA 3O8DA 4Y0AA 1TF5A 1SXJE 4XWOA 3K0SA 3CF0A 2J7PA 2O8FA 1S9DA 2H1LA 1O3YA 2GVDC 2O0KA 4GPTA 3V00A 4LHYA 3EIQA 1AS3A 3P32A 2IXGA 4QRHA 3E1SA 2ZXUA 3WXMA 1E4YA 3QG5A 3MAAC 4K46A 2H7VA 2PCJA 2I3BA 4DT1B 1E2MA 1HTWA 3PUZA 5EJEA 4Q4HB 1E2PA 3OEHD 1MRSA 3U3RA 1RJ9B 4B75A 4AWXA 3QEOA 2FPMA 1OXSC 2XAUA 4LC1A 3WNCA 3WMGA 4C4PA 1X6VA 4OHYA 1HY3A 1SVSA 3NC0C 3T06B 4YMTA 5FI1B 2FX3A 2CDNA 4QJ5A 3QUSA 2IX3A 3LXRA 1ZNYA 1ZUHA 4W5WA 2VYFA 4LJYA 2A5FA 3KUCA 5CK4A 3D7MA 2XZPA 1W36D 2QQEA 4BLOA 3P1JA 5CYPA 5UKDA 2PCLA 1QHHA 4UNNA 3CZQA 3H0KA 4V0MA 3GLHE 1OHHA 3LVRE 4DVGA 4KAXA 4ZKDA 2P0EA 3ECCA 5FR1A 3UMRA 2BDTA 4PPFA 4XTCS 1FW6A 2F3TA 4ESVA 2V3CC 3QEJA 1BMFA 4ASUA 1TL7C 3FHTA 4OI0A 3PV0A 4Q1CA 2OAP1 1XEXB 2W6JD 2YVUA 3QPWA 4XOIA 3B9QA 1KI7A 4XVUA 4BLTA 4HLDA 5K8IA 4M1MA 3KXKA 1E2QA 3SOPA 1G8FA 1I4LD 3QKSA 4AK9A 2AFIE 1GRRA 3J81k 3MWYW 2ZRCA 4GSYA 4D25A 2ZJOA 1J2JA 1NSFA 4D82A 1X8LA 4BFWA 3N2EA 2GJKA 4U02A 1NRJB 1AGPA 3ZQJA 1I2MA 4ZCLA 1R5NA 4ZO4A 2HEIA 3T15A 5JCPA 2FA9A 2X2EA 1XMJA 2AD5A 2ZJYA 3B1VA 4PPGA 3U3JA 2GAOA 1ZNWA 3VAAA 3FVQA 1JJVA 1N6LA 1EFTA 1QZXA 5FTNA 2QU8A 4PHTA 1TQDA 4FWIB 5AJZA 1CTQA 1LNZA 1T3LA 2OHFA 2ZSAA 2IS4A 1EFHA 3MWJA 4URZR 3RRYA 2BM0A 4RFSB 2QBYA 1ZAKA 2EWWA 5EXTA 1GSIA 1E0SA 5KNDA 4LWZA 1G64A 1Q12A 1DAIA 2QT1A 2ORWA 4CEHA 3ZD7A 3OZXA 1SVIA 4TL6A 3T12A 2C95A 3RS5A 5FBQB 1N6HA 2W0SA 1GRQA 1MT0A 3UWOA 2YZ2A 1F48A 1UDWA 2IUUA 3EXAA 4LHWA 3PEUA 1JQLB 1KMHA 1E94E 4Q9KA 1EK0A 3BOSA 4R2IA 2KSQA 1TMKA 4IW3B 5JHHB 3K1JA 1KMQA 3QVVA 4M53A 4PAMA 1E1QD 3OFND 3FMFA 2IUTA 2YWFA 4HB2A 3SYNA 1W36C 4JBWA 1C1YA 2Q0HA 1VG1A 2VO1A 3SYLA 2PT5A 2FZ4A 1D5CA 4CVNA 5KYKA 1QHYA 4BLRA 4JYBA 2YOHA 4B2IA 4ZDWA 3CR7A 2OILA 1XU4A 2FE4A 4EUNA 3U7HB 4IDNA 4X8OA 3RS2A 1NSTA 2FJUA 4G5RA 4LV8B 1LY1A 2ZRMA 1E9SA 1G5RA 3QPVA 4EQ6B 1G3UA 4L8GA 2JLZA 1X1SA 2D7CA 3NG1A 3LBNA 2NZJA 1AQUA 3HP1A 1J99A 5TB5A 2DB3A 1MR3F 3LVQE 3C15C 4HZUB 4Q47A 2FGKA 2XXAA 2Q9BA 2WSMA 3DKPA 1W0KD 4HUTA 1RFLA 3NIBA 1KNXA 5GJCA 2QE7A 2GWHA 2RGNC 1KYIA 3KFXA 2NZ8A 4K81B 4FN5A 3WMFA 4B34A 2ZEJA 1OF1A 1Z2CA 2SHKA 3GEEA 3HDTA 4I1VA 1E2FA 2D4HA 2OFOA 1NN1A 2XOKD 4OHZA 1KDPA 2AXNA 3CNLA 1GL7A 3T1QA 1XD2A 2ZVPX 4PPNA 3AKCA 4IRUB 3EX7C 4CEJB 3SS8A 1WXQA 5C46F 3LWNA 3IQXA 4Q7MB 2FV8A 2FG5A 4HLCA 5K8UA 2MMGA 1ZINA 5KPDA 4LRWA 4RVCA 1XEFA 2JLUA 2QUZA 2P2LA 3OEHA 4DEXA 1JR6A 2VHCA 1Q3TA 1Z2AA 2CLSA 1ANKA 3I72A 3Q7QA 3SN6A 3TSZA 1ESMA 1U2RA 3EPKA 1GDDA 1Z8FA 4NMMA 4Q4AB 1F60A 1TU3A 5IK2D 1Z0AA 3AGPA 1KDRA 3FB4A 1VCMA 4B3CA 4B2LA 5J4VA 1NN5A 4M1OA 5E95A 4ZIRB 4GBMA 5JI3E 5DH9A 3G0HA 4PSKA 1E32A 4DJTA 1H8ED 4JKYA 1CR2A 2PEZA 3F3YA 4FW9A 5DI9A 4D4MA 4PC1A 3W9YA 4LPKA 4YLGA 1ZIOA 1Z06A 3MMPA 821PA 1NLZA 2QY9A 3A36A 1E69A 5AJVB 5FPHA 1HYQA 5A5GA 3CRRA 4E03A 1OV4A 3B1ZA 1U9IC 3KUDA 3ZQ6A 4BEJA 3HU2A 3QF4A 1E9DA 4QNMA 1AM4D 1P2VA 4CT5A 3SJCA 3CKLA 2F7SA 1GKUB 3U3KA 3NHBA 3X1YA 3IUYA 2HT1A 4R9UC 2QI9C 2IL1A 2W6JA 4BLPA 4CEIA 4OI1A 3VR1A 4DKXA 2OCAA 4HSEA 2DFNA 3VX4A 2W2TA 3K0FA 2ZI9A 4LUCA 1XTJA 2WVJA 3K09C 4U5XA 4O2RA 3BK7A 4BWYA 1NBME 4TLDA 3WBJA 3NHAA 3KB1A 3OIYA 5AUNB 4N0DA 5FOUA 2O8FB 2NO9A 4UQOA 3ZZ0A 4B2PA 2RGNA 2W2XA 4IFEA 3VNUA 1FMJA 2LKDA 1B0UA 1VCIA 4Q00A 2AWOA 3RWMB 1IHUA 2IHYA 5D3QA 1ZBDA 2GBLC 1CJUC 1XTIA 2IYRA 3I73A 2EFHB 4LCBA 2IS1A 2J45A 3THXA 1DBSA 2QL6A 2R6DA 3CX6A 4TMKA 4CDGA 1XMIA 2ZRDA 1TU4A 3D6TB 3Q8XB 2GJSA 1U8AA 1TADA 3ICQB 2A30A 4HLQB 1TNDA 2NQ2C 2VSXA 2WSSD 3C8UA 4TYYA 2WWIA 2JJ1D 3SEAA 1N6IA 2QSYA 1ZW6A 5DNYB 1RC8A 5FUXA 5SZIA 1X8KA 2J5XA 1VMAA 2NO6A 3FDIA 4E09A 1KK2A 3KFVA 2DFLA 2WZQA 2C99A 4Q48A 3CRMA 5EUMA 3THWA 5EP4A 5FR2A 1SKYB 1XF9A 1T0JB 3UMSA 1FMLA 1KJYA 2AD1A 3FKSD 3T1VA 4NYJR 1G21E 1QHHB 3UKDA 4IJMA 4QC2A 4DB2A 3I32A 2FH5B 2KBFA 2BVNA 4GZLA 3FHOA 1R8SA 5A4JA 3AVWA 4Q19A 4RD0A 3WY9A 2QENA 3OFNA 4Q66C 2YKGA 1Q3HA 4B3FX 2J59A 1KDTA 1G41A 1KDOA 2CHVA 2X77A 4KU4A 5JS7A 1DVRA 3K9NA 2NIPA 3O8BA 4Q03A 2F3RA 5AK0A 1IONA 1OJLA 2Z0MA 1GUAA 4P4UA 1U9IA 2YNMA 3EARA 1XTSA 3REGA 3QKSB 4ARZA 4YMVA 4NTZA 3EWAA 1P2SA 3GMTA 5AJYA 2Y8EA 1XCGB 4WIAA 3QXHA 3A6PC 2WMOB 5JRZA 3IKJA 1TX4B 3R9IA 5K8TA 3AF3A 2C03A 4B33A 1UKYA 3D8BA 4HYYA 4LYHA 3K09A 3AF1A 1DAEA 3WP0A 1E9AA 3B60A 1JI0A 2AKAB 4QBHA 5KDLA 1CEEA 2RGGA 1P60A 3HYRA 4BRWA 2QMHA 4HAYA 1W0KA 1U98A 3PUXA 1WF3A 2CLCX 2ZTSA 4TMVA 1P7CA 2GESA 3L82B 3WRXC 4AI6A 3UANA 2V8OA 1S3GA 2GBLA 2FPLA 3H2YA 2PZFA 2QBYB 1VTKA 4TLBA 4KVAA 3REFA 2XOKA 2GXSA 4WW0A 3SJAA 1Z63A 1NVWQ 1KGDA 1P3JA 1RE0A 4DLUA 5LD2C 3R8CA 2D74A 1DG3A 2LCFA 5E4FA 2F1IA 1AIPA 1DARA 3THOA 4CEHB 3T1OA 3WRYC 2WIAA 3DDCA 1LTQA 1Z6XA 2P65A 4D4LA 5G40A 3QBTA 4LBZA 2ZJBA 4OQNA 2B92A 1Z6YA 2ZE7A 2EQBA 4ZCIA 4B71A 1KMHB 4KXFB 1ZM4A 4A2WA 5JMTA 1KO8A 5FFMA 4AYWA 1ZCBA 3V4RA 1D2EA 3PUYA 4RD3A 3R9XA 2R9VA 1YZKA 2OBLA 4LJ8A 4M9ZA 2QGZA 1P6XA 2VF8A 4HUQB 4HAXA 5IK2A 4YXWD 1JAHA 3S1AA 2PX0A 2OO7A 3ND9A 4D4JA 4KV9A 2VF7A 3BB1A 3WNDA 4MKGA 4EJSA 1H8EA 4NDZA 3CUEF 4KBGA 1M8PA 3EG5A 3DM9B 3IEVA 3SNHA 1B23P 1E3MA 1XRJA 3H4MA 1KSGA 4JIMA 2Q3FA 4L4UA 2C77A 1NI3A 3W6NA 1TF7A 1ZD9A 1ZVQA 1E2DA 4MITA 5FPSA 1II8A 4DSNA 1OFHA 1GNRA 4F4JA 2IS6A 3RAPR 3EC2A 3SI7A 3AGQA 4DBLC 1N5KA 2AK3A 3AP2A 2B21A 1G8HA 3OIUA 3F0TA 4G5SA 2IF0A 1PUIA 2GNOA 3QOFA 2CMKA 2X2FA 1DAMA 3RVBA 4R71A 3P4XA 1P2TA 5FOTA 4IDHA 4JLBA 2QG6A 4PR0A 2D2FA 3EA5A 3PXGA 4H1VA 1E9RA 3AVOA 4YMWA 5C2JB 1AZTA 1QHXA 2ZRKA 5FL7D 4P32A 3UIEA 1RVDA 1NMXA 2QEQA 3T34A 5KNBA 3RHFA 1KY3A 2P6RA 4PANA 2YWHA 4PC3A 3RYTC 5FTJA 2A7QA 4LZZA 1X86B 2CCJA 1NVVR 3KQHA 1MO3A 2Z83A 5E7MA 1T8TA 2G6BA 5HE8A 2ZS9A 4KLNA 4OQLA 1A1VA 2F1HA 4IVPA 4WXRA 5G53C 2ERYA 5L3SA 1XD9A 2JJ1A 1G5TA 1WRBA 4N0EA 4PHHA 4MDEA 3QIAA 5FL3A 3GJ0A 1HURA 4X8LA 3TLXA 1L8QA 1W49A 4TN1A 4URYR 1TF2A 1IN8A 3AVPA 2GJAA 4ACBA 3I61A 4US0R 1E2LA 4AD8A 3B82A 3FOZA 1G4AE 4ILEA 1W36B 2PLRA 3FKSA 3GD7A 3A1TA 3NEJA 1XEWY 4UNRA 3AF2A 4HEJA 4C7OA 3SJZA 1NG9A 3IPXA 3QF4B 4IDQA 4RZ2A 4JMPA 2EW1A 4GOJA 1S1CA 3B7GA 1QBKC 1DPFA 3TVDA 2DY1A 4LSGA 1E2KA 1SVWA 1G20E 2V55B 3K0FB 2HCBA 4QBIA 3GEHA 5FOWA 2IYLD 3LA6A 5L3QA 3ZD6A 3BH6A 2JJ8A 3L8YA 2ZU0C 5JLJA 1GRNA 1SVLA 4TL7A 4FCVA 4DXAA 4YONB 3C14C 5CDFA 3TK1A 3K9HA 4D6PA 3L0SA 4DWJA 4RSGA 4D2IA 1U0HC 2OCYC 1G7RA 4YC7A 5JZVA 5BQ5A 3U44A 3HU3A 4KJZA 2OUKA 3KTAB 4MH0R 3IGFA 2RHMA 3ASZA 2QN6A 4LJAA 4B3BA 4BFUA 5HR5A 2GETA 3AQ4A 4ZDJA 2A2ZA 2FFHA 3KXIA 3EPHA 3BXZA 4URXR 3PR1A 2UZIR 3IQWA 2OE2A 4PPQA 4C0SA 6Q21A 4HB3A 5G3ZA 4EIWA 4DIEA 1XPOA 1KAOA 3TE6A 1BS1A 3IHLA 1K6MA 4RY2A 4NONA 5LB2A 3THWB 2ZRHA 1E2EA 1NVXQ 3TUIC 1GM5A 4URWR 4MYCA 4D0NA 5TV2A 4F92B 1VHLA 2IC5A 1G3QA 4A6PA 3TR0A 4PTLA 1E9CA 2FDCA 1GL6A 1SVMA 2LKCA 3M6AA 3VKWA 4PO8A 3TR5A 1WQ1R 1H65A 2GRJA 2QROA 3N70A 3ZVRA 5KOYA 2G1KA 2OLKA 1EESA 1N0UA 2WWXA 4TQ9A 3RRNA 3KX2A 3VQTA 8OHMA 1OB2A 3K0EA 4DLTA 2QTVB 1KI8A 1II0A 4RKFA 4DLXA 4TMZA 2VL7A 4YXWA 2KB0A 4BZPA 1US8A 1G8YA 5HCIA 3HR7A 4ARZB 3AUXA 4QHYA 1G6OA 5B2ZA 3RC3A 2V7QD 3U5ZB 1EG7A 1IN5A 3U4QA 1T8UA 1LF5A 3A4NA 1CKEA 5TY0A 5FTKA 3QJYA 3SFVA 1UADA 3NBYC 2PX3A 4GOXA 1LS1A 1DO2A 2JLRA 2Q9CA 1Z6TA 4LHZA 4A0HA 1KI6A 3U6KA 1SULA 1XD8A 3KZ1E 2A9KA 3VNVA 1D2MA 1SHZA 4PZYA 2EFGA 2FSFA 2REXB 2WPDD 2NPFA 5CITA 1VECA 2GCPA 1EX6A 3FMOB 4EKDA 1HQYE 3IIMA 2IK8A 5FBVB 4XWKA 3WYAA 1KO5A 1X8JA 2ZSEA 4TZ6A 1VCNA 2OZEA 4ZCMA 4ZPXA 2WWWA 3EIHA 3GQBA 3NXSA 4TYQA 1NKTA 2W58A 5HZHA 3U7EB 1SKYE 4LPSA 2NMVA 5E3HA 2BBWA 4C0JA 3LX5A 3SYKA 5EXXA 3PFIA 4MRPA 4ZI2A 4BFTA 2HLDD 3OEED 3TVTA 5FL7A 2QORA 4GOKA 2FOLA 5JI2E 3CB4A 3CIOA 1JECA 1NF3A 1C9KA 1XMSA 2R2AA 3PUVA 4ZDIA 2IYSA 1YVDA 4KODA 2NO7A 3ZS9A 3RS4A 1XPUA 1XNJA 4F4CA 3PCRB 5JJLA 1M1YE 4BFSA 1YR6A 4ESHA 3DPUA 2JLYA 5G41A 3KKQA 4PAOA 2WOJA 1J90A 4MDFA 1OXUA 4QM6A 5IRCD 2NG1A 4QBGB 4IKEA 4XSHA 2VEDA 2YYZA 4RFVA 2CVFA 1DAKA 4LHXA 1IJEA 1CIPA 3W8RA 3TQCA 4EJSB 3LBHA 1GKIA 3GP8A 3PITA 2EFDB 1XCPA 4JT4A 3SE0A 5SZJA 4V0KA 2WWGA 4FCTA 2GEUA 4IXNA 3RSOA 1ZU5A 3WYGA 3CNOA 4NKRA 2GAAA 4LHVA 2XTNA 1UBGA 4A0GA 2XZOA 3K9LA 1E98A 4II7A 4LBVA 3DOEA 4A36A 1II8B 1XZPA 2DPXA 1T5IA 2BC9A 1OFIA 2ZI4A 4C3ZA 2OLJA 3OIVA 3SHFA 3RSLA 1DAHA 2DWOA 2C04A 2JLQA 5FOXA 3PJRA 2RHDA 4OBEA 1P2UA 5FI0B 5B58C 3M0EA 3LLMA 1VG9B 5A0FA 2O8DA 3HPQA 2WMNB 5HKKD 1IY2A 2OCPA 2ZI3A 3WYFA 4D0GA 4AKHA 3TIFA 3C5HA 1F2TB 4MQBA 2ZRPA 4B32A 3DMNA 4AKGA 5J5CA 1OE0A 2AR7A 2ZYVX 2P6NA 2QMUA 2WM9B 4MYUA 1IBRA 2YC4C 3OE7D 1W5SA 1RIFA 2BM1A 2JJ2D 3CONA 3HJNA 3MSXA 4RJLA 4XVQA 3TSWA 3LFUA 4AYXA 2P5SA 4O2LA 3A4LA 4L9WA 4AG6A 4DLVA 5JJIA 1D9XA 2XJ9A 4EDHA 2QGNA 1CRPA 1WBBA 1YKSA 3BFVA 2FSGA 5E7IA 2ZRAA 1E2JA 4A0RA 5LD2B 3T5GA 2VHQA 3G5UA 3TGPA 1KY2A 1G18A 2C9CA 4G5OA 2AX4A 4YMSA 3L0PA 3B13B 5ELXA 2G3YA 3JVVA 5L3SB 2ZE8A 2EVWX 4Q9HA 3QXSA 3WHKA 3K70D 1AN0A 3G82C 4LJ4A 1EX7A 3HPRA 3PG5A 1CRQA 3W3ZB 4DC9A 3QVUA 2V6JA 4ZDKA 4I1OA 1A7JA 2AXPA 4PX9A 3ADBA 4IFBA 4XJXA 2BJWA 2F43A 3AF0A 3E70C 2Z5FA 3A58B
chains in the Genus database with same CATH superfamily
1HE1C 4EITA 2I1QA 1WMEA 1XF1A 4B44A 1JVNA 2IYUA 2BFFA 1QLHA 2EG5A 1MV5A 2X13A 3AUKA 1EXNA 5MF6A 1T8WA 3L9WA 2CBGA 3JQRA 2UXDB 1W59A 4EKGA 2I22A 1I0ZA 2BR4A 3RYIA 2PKQO 1U0JA 4TWRA 4EO4A 3ESRA 4RCVA 4X1YB 3DULA 2VNKA 3X1MA 5ADWA 5CT8A 4DLAA 4RORA 4TSKA 1GPJA 4BO6A 3AOGA 3ZVNA 3EEBA 4QKQA 4DDWA 3JATA 1TA0A 3DS8A 4B6FA 1XP5A 2ZJ7A 2OZVA 4NZYA 2C0CA 1VOTA 4H7IA 4C2AA 1CUZA 1KC3A 2FMHA 2JLAA 4M22A 4MQUA 4NS1A 1Z2EA 4CL3A 3H5LA 1PQYA 3VR5H 5A3JA 2CZGA 1TQ8A 4KSBA 2I7XA 1HFWA 1GL9B 2GEDA 2JVJA 2XZDA 3BD9A 3V4PB 4AZSA 1DO0A 1B41A 4G85A 4A9AA 4ARBA 2IKSA 4IH4A 1ETUA 2QRHA 4M0MA 2UYYA 1AVTA 4IQ4A 4AP6A 1WIWA 5DNCA 1VI2A 2WK1A 1W2HA 1A4UA 1ZM2A 4AP9A 1TUIA 4DUGD 1R0XA 1R5OA 2VRNA 2WPDA 5B37A 2WF8A 3G5LA 3G2LA 2X0RA 1RM4A 4UUMA 4G8DA 4R69A 2HV9A 1GTVA 2NXNA 5I9TA 5KTYA 5F2NA 3T7EA 1KZYC 4K9QA 1TJNA 3KRTA 1I2BA 1WXXA 5ICFA 1UZLA 2JFYA 4R8RA 4RZUA 2WT8A 3A4VA 1J8QA 3E4CA 4REOA 1E6EA 1NVVQ 5CJJA 3G2QA 4KCGA 2QK4A 1B73A 1H4VB 1IBCA 1Y3DE 3FDZB 4CCSA 2VQSA 3OEEA 2QM0A 2NZUG 5BN1A 3AVYA 2EZ4A 3ROMA 1L4UA 2XDYA 4YS6A 3WICA 3FGNA 3LQYA 4OHWA 1V8FA 4GAEA 2IWHA 3WIUA 5IABA 3DYVA 2BMEA 3HCEA 3PGJA 4GC5A 4I1UA 3RVSA 3ZV3A 5PNTA 4DSTA 2V7BA 2Y1WA 3L8ZA 2EYUA 2C96A 4BBPA 5C1PA 3DEZA 2O8CB 2AL7A 2PMEA 2V4MA 3V4VB 2XUKA 3HP4A 4O2BF 4R6WA 3WGVA 2QDXA 4JUDX 1XXHB 5HCNA 2BGIA 2YIJA 2R86A 1WZEA 2YYYA 2Z04A 3MTIA 1MX3A 1U2TA 1XTRA 2NN3C 1OT3A 5EWLB 3PGA1 4R1LA 4I36A 4FQ8A 5HKAA 3O93A 2WABA 4PEVA 1MA3A 1QMGA 2HLNA 3KXLA 3QWIA 1XL1A 4YMHA 3W34A 2WE8A 1KIMA 3HB5X 3LLUA 3MQ4A 2BKAA 4HX9A 4GPZA 3GLRA 4K1LA 4DMFA 4X6XA 4IIYA 3U60B 5LB4A 4CLOB 1YR3A 3C1AA 1CSEE 4DLYA 3LJKA 3EVGA 2LNDA 3O8LA 1J97A 1R4AA 1NP3A 2YZKA 2I66A 3F7TA 3NNDA 3U4IA 3FPLA 4MRSA 5GJVC 1U31A 4C1BA 4EA9A 3QYJA 3WIOA 3UVEA 2B8WA 1C1DB 2J3IA 2GD6A 3L7LA 4RYDA 4DR6B 5KYGA 1NOJA 1IUPA 1IBKB 1UINA 1FNMA 2QX4A 4FI3F 1KZ7B 1M0TA 1IJBA 1WTAA 3O26A 4PX3A 3P9IA 1VHDA 2EBHX 1UBNA 4KFRA 3IAS6 3LQ1A 1KP3A 4EY3A 1EB8A 4W5QA 1BKDR 2G9QA 3CW8X 1V7ZA 2ID7A 2QM7A 3L7MA 4LYGA 4O33A 1XJ0A 1IPFA 3ENVA 5LQSA 4XJVA 3LUPA 4PLTA 5THKA 1QU3A 3T7RA 1Z82A 5GZ1A 1GQSA 1DBRA 5DT9A 5EVCA 4EA7A 5JXIA 3S68A 2CV1A 3C39A 1Y6GA 1FX0A 2WR8A 2ZPAA 4CQMD 1P7ZA 3I9LA 1M7HA 3MUOA 3KSAC 2QNIA 5C5EA 3DV0B 3EIUA 1GAXA 4KK4A 4EHKA 1W9MA 2IW3A 1GU1A 1EBFA 3BFPA 3ANYB 4K9RA 1Y6FA 3ND7A 1OC4A 5JEEA 1Q6YA 3GFOA 5TDHA 2AR9A 2QP4A 1Q14A 5IT5A 2GNPA 2OV8A 4AL4A 3TSCA 3WKEA 4WT7A 2R87A 3RYFB 1ODFA 2EEZA 4OYHA 2DFKB 2JIZD 3R3HA 4LRYA 4U39A 1C9DB 3ZWNA 4CZ2A 3RYCA 1OXKB 2R7LA 1N1DA 4QATA 3T38A 1UDBA 4P9NA 4ETNA 3Q7EA 4X7PA 5EE1A 3TL3A 4EHAA 4C87A 2FHPA 5KJEA 3GMIA 1RBYA 4ND7A 4YJ3B 3AG6A 4YJ2A 2V1UA 3A9UA 5BP7A 1KQ3A 2DKFA 3PCTA 4D3SA 1JIIA 3F9RA 4WVLA 4JXZA 4QUHA 3E18A 2R6AA 2YS6A 4XR9A 1IWOA 3GFBA 1PDWA 5EKSA 2B1RA 2DAPA 2VOEA 2ZDQA 1EVJA 1L7XA 4JS0A 4DIDA 2YV4A 1NHWA 3SM9A 4E5KA 2VA8A 1EZ1A 2XWSA 1BWSA 1L7BA 1X9IA 3GT4A 2PUBA 4M1WA 4C30A 1BVRA 1R4MB 3KDAA 2C31A 1ZWLA 4JBGA 2DQ4A 1UAGA 3AI2A 2GS9A 3PQEA 4FFNA 5BQPA 2ZCJA 1PR5A 1S89A 3BS4A 2TRSB 5ALYA 3UV7A 4D0RA 4E2XA 4RS3A 2VNSA 4F8JA 3GCWA 2G0TA 4NU8X 2G9VA 4UUOA 2R2GA 4DRZA 4YGXB 5KAMA 1SKQA 2RAPA 5IT4A 3WZ2A 3BMCB 3O3NB 2GHTA 4KTVE 2ZE5A 4WEQA 4KWCA 4C0LA 1AS0A 4YO8A 4F3CA 4Z3KA 1PSDA 1ZMTA 4L73A 3H1FA 3L1UA 1M2EA 4U63A 2JBHA 4QGSA 1MO5A 4M1KA 5KDDA 4TRMA 4LY6A 3AP3A 3MGGA 5EQDA 1T0HB 1E9EA 2X41A 3BFKA 4LDPA 4B6OA 4IX1A 1UKBA 2PUJA 1IOLA 4C0BA 4KEAA 2BAGA 1YBMA 5ITVA 1WF6A 1TAQA 2I2AA 2IHKA 1BVUA 3F97A 3CLTD 3FG9A 4AJIA 3GFPA 4BO2A 1OWNA 4WZZA 4B3TB 3WLJA 4AY2A 3HZHA 3BSWA 1CY0A 3TXAA 3OZFA 3OESA 4WXPA 2I87A 1V8ZA 2XCOA 3U48A 1ZL2A 4CV0A 5FBRB 1OAAA 2GM4A 1A88A 3A4TA 4Q01A 3DEKA 3DA8A 3CS3A 5CYOA 121PA 4BO8A 5TGTA 1B2LA 5CURA 4KITB 4UU0A 5ESRA 3E5HA 3KOMA 2I1WA 4ER3A 5AOCA 5TVKA 4DDKA 1DCKA 2A5YB 1NU8A 4WA7A 3V8MA 1JJIA 4C0WA 3UJCA 1YDHA 4F60A 5I45A 1GTJ1 3N9IA 4GBED 1NR5A 1W25A 4BB9A 4CF6A 3NOXA 5B64A 5B53A 4IR7A 1HYHA 3C41J 4UXIA 3HBMA 1DUSA 3EFHA 4UARA 4YJ2F 3UAWA 3WFJA 4MKZA 4D96A 3CRVA 1ECPA 3TBKA 2O0JA 2WJHA 4I46A 3RVKA 5ES4B 2ZR9A 2HRBA 3IUPA 4RHFA 2Q7OE 3ROXA 3M3PA 3CN9A 4D79A 3F3KA 4DL9A 1B15A 2C29D 1FFXA 2A1UB 2IGTA 4LNUA 4CKZA 1RW4A 2JCGA 3OE4A 3OTHA 1G0OA 4NDNE 4QTUB 5C5IA 3LXUX 3PEYA 2WUWE 1DI0A 4RJJA 2P78A 3NIGB 4DG9A 2JBWA 5F4BA 3W5VA 4LXIA 2FRDC 4OMUA 3ROGA 2WTEA 1VBFA 2OZPA 1NQOA 3GJ7A 4M1ZA 5HE9A 1KDZA 3BUSA 1GG5A 3B7WA 3DEFA 3P9ZA 1JBEA 1LPAB 2IZZA 1L7AA 2QSJA 4LQCA 4UFNA 1RRMA 4XFKA 1IN4A 1EI9A 3BF8A 1ORIA 5F21A 3E3LA 3L6EA 3ZDXB 1M83A 1NT2A 2VDNB 4PZLA 1JQEA 5K3BA 5THXA 3NVAA 1VIDA 1O7JA 3TBFA 1AF4A 1V7QA 1UZNA 1FQOA 2I3GA 3ELBA 3D5QA 3L7YA 2FXVA 2BV3A 1CQZA 1D6NA 1DKLA 3LL4A 4ZJPA 3PEWA 2ODNA 1SZCA 2XA9A 2IV2X 1PL0A 4J76A 3MFQA 4V2IA 4E30A 3EPLA 3DVAA 1FDUA 1T3SA 1M7GA 2C57A 2FFJA 1XZEA 4ND8B 3ZV4A 1CDOA 5DXAA 1XR3A 3EA0A 2GLXA 1IJKA 4BV8A 3WGGA 4DQ0A 4ON9A 2X7XA 4MMYB 1O94C 5E6UB 1J2TA 1LUAA 2YQ5A 3LX6A 2WFLB 4O4JB 4JBXA 1L5ZA 3A1SA 3BD6A 1GPWB 3RM3A 3K53A 3EG9B 4ZU3A 1WZNA 4M0DA 4I99A 1QH0A 4KIJA 2OYCA 2OV6A 3U26A 2QMQA 4KRYA 4EPVA 1FJ2A 2AR0A 2D06A 2J6BA 1XDGA 1IJFA 2H59A 4B40A 2H2FA 3ENNA 1VKJA 3GRFA 1Y7LA 3C3DA 2BIFA 2VDLB 3IAM6 3JD2A 3W4IA 3WGTA 1O9HA 4ND5A 1AGXA 3VDQA 2CYCA 3NVKI 4GRIA 3SVZA 4JJGA 1TTHA 3I2JA 1C3OB 2HH9A 2V74B 3KAJA 4IV0A 3DXXA 3GDGA 5CT5A 3TIIA 3UJNA 3FH0A 1DHTA 1Z0KA 1K1EA 4BKOA 2FWIA 2QLNA 3H3FA 3CLVA 3OIDA 1SBQA 1TK2A 2ZUBA 4GT1A 4LFAB 1C7EA 3ER6A 1RHMA 1N1MA 1WE2A 2XYPA 3KEOA 4D9BA 4DDVA 5BV7A 2I4OA 3L7IA 1UK7A 3NC1C 4OXQA 1XV5A 3WC4A 3PFHA 2PGDA 1SXJD 4L6CA 4W7IA 4O3MA 4LJ7A 2VPPA 4HL6A 1QC5B 3E22A 4NF2A 3RABA 4UTVA 1QR6A 5FOVA 4CJXA 1RAIA 2KS6A 1J33A 2B0CA 5U4QA 3PPXA 2PWZA 1OYYA 4F8YA 3RRBA 3AHEA 2IZ1A 3WQSB 2XPCA 1O57A 1PBNA 2GR9A 2PGIA 4GKBA 2QPLA 5FV7A 1L5OA 3EXEA 5F4ZA 1NXSA 1KP2A 2IY7A 4EP1A 4GXRA 5JCOC 1J1UA 3HXLA 5IDWA 3WBKA 2IWRA 3V3TA 2EV9A 1V4VA 4CTKA 2YIVX 1VDMA 3EEQA 1USGA 3M34A 1QRAA 4XGIA 3MCTA 5MHTA 1E3WA 4CFYA 4ZT3A 2GCOA 2GTHA 2FPIA 2HIHA 2IYXA 2NSYA 1EEXB 3MWDA 4A1FA 2QYOA 2EZ8A 2JIPA 3CT4A 2HU5A 3HKDB 3QXJA 1T36A 4Y2UA 5INTA 4CEIB 3U9TA 3AUYA 1A8QA 1U3UA 1UJMA 1VYVA 3F4BA 3MELA 3NTVA 1R8XA 3OJ0A 3Q3EA 3QPDA 4RA6B 3GNLA 5H81A 5C80A 1E7QA 5J4YA 3SVTA 4RDXA 1A2KC 1KDVA 1E5VA 3CNBA 1PRYA 2K87A 3TLZA 3VZSA 1H1LA 4F5EA 4CE6A 1C9JA 3T9AA 3PNQA 4Z1MD 2ZROA 3N0VA 1FRZA 4FEYA 4KXQA 5IM5A 1T0UA 1U8EA 5LP6C 3EULA 3JYNA 4WZAA 3RBVA 3WOVA 5D7NA 5M3BA 1Z22A 2DWCA 3CWCA 5D6NA 5F5NA 2P79A 3VSBA 2XB4A 5CXUA 1PEDA 3W2GA 3TB6A 3VR5D 2A78A 1XAJA 2INGX 1HNZB 2VJKA 4CM5A 3DL2A 5L6MB 1T6XA 2Z2KA 4MAAA 2APJA 3D31A 2HX1A 1B8VA 1SEPA 2BONA 3A3NA 4G0PA 4GNRA 4JDPA 4L5IA 5EZYF 5J40A 4XDGA 1XMQB 2O5VA 5IZCA 2VDOB 3MJRA 3M1IA 1LBHA 1EFCA 2VDWA 3PPVA 4IQGA 1TT5A 4GI2A 4ZA2A 2OD2A 4GPEA 5BR1A 1D4AA 4I5EA 3NM6B 3B48A 3DV2A 3RAFC 1GPAA 1KSJA 3VR6H 1QPZA 1OH7A 1DV2A 2F3UA 4O5OA 5DXJA 2R8YA 1D09A 3RJZA 4AF8A 4KFCA 1KOFA 5ADUS 2WZCA 1XPRA 2FPXA 3OX3A 1H1DA 1ZIPA 3BSSA 1WB9A 3H6GA 1DRUA 1A9YA 3BIXA 4QTYA 2J0SA 1SQ6A 3GDFA 4M49A 4NZOA 2QR3A 3TINA 3GA0A 5JQGB 2HNAA 2GZHA 3WLEA 2ZTMA 4ITVA 3RT9A 4G0MA 4I1IA 2HJVA 3NS7A 3D6VA 2DHDA 4A0QA 3JX9A 1GZ5A 2QVYX 3C43A 2UZ0A 2G9UA 3NNSA 4RPIA 5ALGA 4J75A 5C8DA 3VZDA 2E55A 1UWCA 1YE5A 1N32B 3NKFA 2X40A 2ZVJA 5DBFA 1P3Y1 4ENUA 2DBRA 3AEUB 3AH8A 1TQHA 2X8AA 5AKEA 1SUSA 3GVIA 1UC8A 2FY8A 1JEQA 1MAWA 4OLAA 1E3TA 1HA3A 2GJ8A 2OHOA 4ZV9A 4ND3A 5EYPB 2BKLA 2H1SA 4WH0A 1G0NA 1NQWA 3WLTA 4J29A 3I04M 4LXGA 3FVVA 1TQ4A 1UJ5A 3TDMA 2JAXA 4X1IA 1GQQA 1OFUX 4RU1A 2RG1A 5DEIA 4PQEA 3LT2A 2KJQA 1Z33A 3AETA 4FJ2A 4FFVA 3CUTA 5DJ5A 1Z0IA 5FI5A 2WU8A 2WWYA 1CXZA 2Y1XA 5FWYA 4OHFA 4Q3AA 2EW2A 1YBAA 2CVQA 1LB1B 3ADKA 4GP9A 5F9FA 1DXQA 3X1DA 1NQAO 1M2OB 2D0DA 3SDZA 5KYVA 4GYWA 1WBDA 2I71A 1BIFA 1JJAA 2PLWA 1Y8QB 3D7KA 3BL5A 4C0AC 2H9AA 5KYXB 2MSDB 2Q3MA 4L8YA 5BRJA 5EHZA 3ILXA 4UULA 1A5TA 1P73A 2B8EA 2OXRA 4JGGA 4N5DA 4DXDA 2Q1SA 4G4SP 1Z07A 4DYVA 4D57A 4B84A 621PA 3HV0A 1S4MA 3EEYA 1JNXX 5K0NA 4DDUA 2XODA 1EUDA 3OCWA 4EMUA 3SHQA 2DBVO 1DOAA 2AE2A 2FNAA 3AONB 1BH2A 3T9CA 2BMAA 1PLLA 2VF5X 3EF1A 4INZA 1ZH8A 2WV9A 2BM8A 5D85A 1UOQA 3K9CA 2JCBA 3N76A 3V6MA 3U5ZB 4TQUS 2R6CA 1N3IA 1S96A 3F1KA 4YALA 2JFBA 2RH4A 3MQFA 1FMTA 2PU5A 2QRPA 3DL7A 5BPFA 1ISIA 2VHEA 5JUWA 2FMTA 2O8EB 2QX6A 4ITUA 2QRJA 2D1SA 3SYRA 2C88A 4KI7A 1Y3IA 1J2RA 1Q44A 3CRNA 3RS3A 2SKCA 3VSEA 2J09A 2I4IA 2IS6A 3JAKB 1H2EA 1PHPA 2PR2A 3GBSA 4HS9A 2PMWB 3DLPX 1E6CA 3R9XB 5REQA 5JXHA 1LK7A 5JJKA 4HDAA 1FPQA 4Y98A 4EHJA 2VZ0A 5CK5A 3UT0A 3I0ZA 4RQBA 1Q1ZA 1A98A 1UPCA 3F98A 5LOVA 1X2EA 2D8MA 3E3OA 3OCZA 4UTXA 4ZI5A 5E2IA 4ADSG 5IRCD 3U17A 5I5EA 3UM9A 5ILOA 2I33A 3S2FA 4E3ZA 1DELA 2DJ5A 2VLIA 3MMZA 2CDCA 4GP6A 4MRRA 1NBHA 1INLA 1RKBA 2HIAA 2R3SA 2ZBFA 4CLRB 4N76A 2DQYA 1A9TA 4J3JA 4D41A 4H9GA 4KAAA 4MLZA 2ZSBA 3D2AA 5D6OA 2F9LA 5TMPA 2QR5A 1JJBA 1FLVA 3GGDA 4YV1A 1G4UR 2XQKA 4UMVA 4PQFA 2GTIA 1Y33E 2R7NA 2B8TA 2J7KA 3T9FA 2PFGA 5F7OA 2BCJQ 3VKVA 3RD5A 1MKYA 2WTNA 2Q9AA 3HXPA 1A8PA 1QKIA 4QSHA 4G0OA 2HF8A 4WOPA 3WGNA 2BGGA 2HEGA 1HTBA 1H94A 1EJ2A 1CUWA 1I7PA 1OKKA 1NPYA 1PZEA 1WZIA 2PXHA 3Q3CA 1Q6ZA 4H1UA 5HDBB 3VMFA 4ZYZA 3AM1A 1K8QA 2H65A 2P9HA 4LV5B 4P98A 4UAJA 1YIOA 3ETLA 5ANRB 1HE2A 5KYUB 4TZ0A 1QVZA 2WIKA 1PFKA 2EOAA 3IPRA 2ZWVA 4QL3A 2V59A 3PGKA 1GCUA 1OH6A 4YUYA 1GGVA 1Z0DA 2ZIAA 3DEAA 3HKCA 2FPWA 3N6XA 2W43A 3EOZA 4LYYA 5J2UB 5BSEA 3GLGB 5J58A 3QH4A 9MHTA 3T3MB 3QLJA 3TYXA 1Y8AA 3WVNA 5TJHA 1LI4A 2CL6X 1FYDA 2I4TA 1IM2A 3PD0A 3GLHA 4M98A 4Y9UA 2BCEA 2SKEA 4GOLD 3ROFA 5IG2A 3TFQA 2X19A 1T5DX 3U31A 1G8PA 3VOSA 4WXEA 1ZQ9A 1TZBA 1X0XA 3E9YA 5DM0A 2BHTA 4DQDA 1EUCA 1BGVA 1CQJA 2Z08A 1O8CA 4OKNA 2D2XA 2JNWA 2YN0A 2QD2A 5AVXA 1MC5A 2YHSA 4LWPA 4DQXA 1S3FA 2YBEA 5K5EA 1LNQA 4KR7A 6CHYA 1OWLA 4YRQA 2DUUA 2BFCB 1J7KA 4ZVRA 3VU0A 1UFQA 2J48A 3IR5A 3PNLA 3ZWMA 2W2VA 3V46A 1NXTA 1Y1KE 3RRZA 2C5LA 2WBLC 1NBMD 4DJDC 3QF7A 1W0JD 3SX4A 3FRHA 4M9QA 1A4IA 3OE1A 2G0AA 1B26A 3QY0A 4UD2A 5AI9A 4HK4A 3PVZA 3DDUA 4B85A 3K0KA 4R51A 5LOVF 2FUG1 1CZNA 4D02A 4EK9A 3IBYA 3HFJA 4J0DA 3RVLA 2WKQA 3P0RA 2AK2A 4LC0A 4CMCA 2FP4B 2ZRBA 1T4MA 2CHQA 2M2IA 5F1YA 3OMXA 1C3XA 4ZQCB 1GZHB 4QAJA 1T1SA 2DKNA 5LPNA 1ZYUA 1S3SA 2IV7A 4B35A 2XDAA 1FTGA 1LSSA 2Q8QA 5EIHA 4UNIA 5LQMA 3OZSA 5BRAA 1Z26A 4F12A 1ILWA 1XVVA 5KJFA 4QOSA 2IQ5A 2XZLA 4JC8A 2C2BA 4UOEA 3LA8A 3LWZA 4ZOQI 3H11B 5BWCA 2E49A 4J91A 1V3QE 3SC2A 3O4JA 2PBRA 2MWMA 1G3MA 2FEXA 3GUVA 4NE2A 4UQLA 3KKNA 4GBGA 3VNRA 5IC6A 2ORED 2PR7A 4Y6PA 4XXHA 4QGBA 2I2DA 3IP9A 2WJZB 3PJEA 1P2DA 4UZEA 2OORC 3HQ4O 1JIKA 4PG7A 4B74A 4FT4A 5DOZA 5FFNA 2GNAA 3PBKA 1JHQA 3ELYA 4A8JB 2C58A 4P82A 1Y8ZA 1X1AA 3ZI4A 3IHKA 4ZT2A 4NK5A 1ULUA 2CNNA 2WD7A 2GZAA 4OU5A 2XEXA 4JITA 4P4SA 4RNCA 3K4PA 5COBA 4HPWA 3RUAA 1PG5A 2XSZA 5FO1A 4B9EA 3IEUA 1QHIA 3WLLA 3NH6A 5JJ5A 1SKMA 1CRZA 3F1LA 4JZKA 1QFSA 2XVYA 2OGUA 3R3ZA 4LF7B 1RXUA 2HRDA 3I2GA 1FP7A 1IHXA 1H42A 2QW1A 3D3QA 3S2UA 1NRWA 2IKQA 2TMGA 3HXOA 1UPTA 5BV8A 3HO1A 3BZBA 3BAZA 4Q05A 2PGJA 4MGKR 3T5TA 4DJEC 5KYTA 1FYFA 4IUCS 1H8HA 1ISMA 2NPIA 5IFKA 2CL7X 1I32A 1AA9A 2CKMA 2OECA 2DU8A 3OTGA 5ERYA 1RACA 3UJDA 3TL6A 3WJ1A 1DXYA 1A5ZA 2QMEA 2VDVE 4H2DA 5CT9A 1ZIYA 4ZI3A 4GMXA 5EA2A 1CJMA 1NLYA 4MIOA 4FGSA 4E3WA 1OPXA 5KNLA 1GNPA 4I4NA 4Q7LA 1BCRB 1M5UA 5GAJA 2C5AA 3O8OB 3CSDA 3T35A 3SD7A 4TTJA 1X1TA 2ZBVA 1P5HA 5JZMA 5C4MA 3WBBA 3ZS8A 3D59A 3U7GA 3KVYA 1LV8A 4PYLA 2C2MA 4JAVC 4D9KA 2J0UA 2MTBA 4XAQA 2P3QA 1FC0A 1LLDA 2FK8A 4M83A 5KOJB 1ICIA 1WWKA 4NCNA 4TMFA 1MG0A 4AIIA 3I64A 4W1RA 4BMDA 1X7DA 4ENTA 2P7IA 5JY6A 4FCCA 5J3JA 1Z37A 3GNQA 1QDLB 4L4SA 4MKHA 4LTMA 2C3PA 1X42A 4KN9S 5H3HA 2N75A 3ET5A 4X44A 1NYTA 1Q7TA 4JQOA 2HMUA 3MJDA 4ODIA 1MJNA 1E4EB 3UB4A 2P2SA 2BN4A 3AVUA 5DYIA 5IWAB 4KPEC 1TCAA 3IFSA 1LFAA 3AM5A 2XNSA 5H4GA 4BGDA 2YUIA 2O6LA 3FE2A 5GJBA 4N8EA 3D1VA 1KI6B 2EJTA 2NVUA 1OYWA 1VFPA 4YREA 4QHSA 5J2TA 2H18A 3W2EA 4E14A 5F7XA 4RKWA 2ET6A 2JS7A 3N2NA 2GDJA 4RXUA 1VB3A 3CFYA 1A2BA 1KKMA 5D86A 5EE9A 2RGUA 4D92A 2CXOA 2EARA 3D8HA 5DW3A 3CLKA 3BZUA 3GZJA 3NX4A 3JY6A 3R6DA 3MF4A 1GG8A 1H2YA 1QHGA 2Z43A 1ZONA 1TYAE 4DCSA 2ANBA 1HV8A 3UFXA 3KTDA 1NWCA 3CV3A 1I4OA 5FBWB 2VP0A 3ROTA 1WLSA 1YR7A 3OZRA 2QNBA 3WWDA 5K8CA 5D84A 1I51A 3C48A 4KQCA 4X45A 4IDEA 1WCYA 4OI4A 3WMEA 2HMAA 3PNPA 4YUXA 2PD3A 1O6ZA 2P5UA 3DOUA 4H3VA 2DBQA 2XW6A 1EK5A 2C7PA 4QWWA 4M0CA 4YT8A 3LPAA 4AURA 4U7DA 1YIAA 1T0BA 4IJ6A 4LWOA 4G4SO 1N8TA 4MJLA 5DNWA 4B83A 4RBNA 2DT5A 5EUQB 5DT2A 1VPTA 2G17A 4MUAA 3MRSA 4PBTA 1M1XB 3F5MA 4AS2A 2HM7A 5FTLA 4NOJA 2AI2A 4Z54A 5KPJA 1ZAYA 3KTAA 1EK2A 1W48A 3ZX5A 2Z3VA 3WIEA 2FPOA 2G63A 1J8DA 5IYZA 4M1SA 2GFQA 4EUSA 4ZAYA 4WPGA 3I9V6 4WCFC 1S3IA 2YJ4A 4FOOA 1XRPA 2CCKA 3KSBC 3LYUA 5T8KC 1RJWA 2EKPA 2FZEA 3FFTA 2EFCB 4UHHA 4K9KA 4WKOA 4HLNA 1YU9A 4KXVA 1FQWA 1SQ5A 1F2UB 3H9BA 4ZVLA 3A1WA 3WYCA 4NH4A 4BVAA 5KTPA 1UXGA 2GK7A 1PFYA 4ZVPA 1JR3A 3FMPB 3FYDA 1BSVA 3H4IA 3T1YB 1OAKA 2I54A 4YWHA 3KZXA 2OSBA 4LRSB 3V8RA 1K6EA 1NJSA 2OQIA 3OD5A 4X3PA 3CZPA 3O8CA 1ZOIA 2ZI5A 2GN0A 5K0EA 5BUSA 1IN7A 3EUEA 1M2HA 1WX1A 3CRW1 2BMDA 4ANFA 4P22A 3RPEA 2VHUA 2XJ4A 2OP1A 3WNZA 1P77A 2CLHB 1K5PA 2WLSA 3NANA 2AQHA 1YQUA 2WB4A 5HHTA 1L4KA 1A5SB 1F6BA 2JKZA 1PTKA 1XRMA 3R5KA 4JLKA 4MI1A 4GMFA 4RANA 4RVNA 2ZUFA 4QXQA 2CMHA 5E1BA 4FGWA 4M9XA 2HN9A 1K7YA 3L18A 3S2IA 4FD2A 4HH0A 2ODWA 4N8DA 3UGKA 4EGAA 4F3TA 2SCUB 2O8DB 3AV3A 1Y34E 5J2TF 2CUKA 2XGGA 1P18A 3OA0A 4DZZA 1LVHA 4IHKA 4TWIA 3QM1A 5KTRA 4JYAB 4G1BA 4RK7A 1EFUA 2JGIA 1PJQA 3W6UA 1KORA 4ECEA 5EINA 3A9WA 4GL4A 1XLVA 5BXYA 4L9AA 3BK1A 3UAVA 3NV7A 4WJZA 2IW1A 1N9KA 4HYTA 4OL0A 4BUZA 4MGIR 3LIPA 2D2IA 4YP0A 3D5TA 4JDUA 2BEUA 4IG4A 4AZ0A 2D2VA 4L22A 1TA9A 1JQAA 2HD4A 3EH2A 4QDTA 2Y2VA 2E4UA 4LXTA 3SZGA 5BNZA 5HM6A 2C00A 5IXSA 1DRWA 4W9MC 1MA0A 4N0QA 4IPTA 3WB2A 2AMVA 2FK7A 1RU3A 2OK7A 4LDNA 3MN1A 3TE7A 1V1MB 4WOBA 4JMLA 3PGLA 4BUJA 4DCOA 4DLLA 3VR4A 1UZAA 4HH1A 5HF5A 3BULA 1UIRA 2QX7A 3GROA 3MJEA 1S2IA 1S2GA 1Z47A 5EPOA 5IVPA 1G98A 4B6EA 1Q1EA 4P7BA 3EZ2A 4KWTA 3T95A 3TRFA 3CZCA 3A9RA 5CAEA 5JS8A 4YAFA 3INNA 2EJVA 4UE6A 1N34B 1WXWA 3EVZA 1AHIA 1RKXA 3OTOB 1RZVA 2H4FA 5A4AA 4CDNA 5KQSA 3C70A 4BFZA 3HA7A 1AS2A 1ZD2P 1JYFA 3NTUA 3ZWVA 1R0YA 4P0QB 2V4ZA 3KR9A 3MJVA 3SFTA 1PUJA 4CKYA 5DN6D 1GU7A 2HI0A 2OCXA 3PQ7A 4GYYA 1UXJA 1AQYA 1COWD 4OI2A 3WLAA 5CDUA 3TPCA 3G1TA 4PZ0A 4XX1A 3V1UA 5EMNA 2AOUB 2XITA 1YJ5A 4YV2A 1HZZA 2PEYA 5JS2A 4BECA 1I2DA 1V3VA 3D4NA 1DAGA 4M38A 4DJAA 3FZEA 2R1VA 2I65A 3TBHA 2PWPA 5AVRA 2C2YA 1PT6A 3KDPA 1U7ZA 3OQIB 1ZI9A 3S99A 4DR4B 5BWMA 1ZZGA 3LY5A 2HJSA 2PNFA 4OIFA 1NUHA 3QUBA 4XTRA 4BJHB 3WKDA 5AVYA 1D1SA 3TOSA 3VJLA 1DAPA 4FD3A 4X65B 4QU0A 5I51A 4LI3X 1EJBA 2JFHA 1XZDA 1PGOA 4TTSA 3L1JA 3SZLA 3USCS 1CJBA 2XEDA 1E1RD 3IT2A 3WP1B 1FP2A 2QRVB 3TX2A 3WDSA 1L4FA 3O73A 1GV1A 2NAPA 2A0UA 1R0BA 2GXUA 3ORSA 3OT1A 3DHVA 4GLOA 4LMRA 2IE8A 1FZQA 4O0MA 3JYPA 4PGFA 4YDSA 3EBLA 1DJNA 2GPBA 3S8YA 2N46A 1UOPA 1ZI8A 4ETIA 4ETMA 8ADHA 1YDGA 3GEGA 4H6XA 5L7WA 1QF6A 1JLRA 2WNIA 3H2ZA 1M1ZA 5AVKA 4US2R 1Q2UA 1MP0A 1Z7YA 1OW3B 3AWDA 3HB4X 5G3YA 1RHKA 2QI9F 3MTBA 2G5GX 3BGSA 2XKJE 3F5QA 2HSWA 3PT5A 5AM0A 2X1HA 1T8YA 4FLFA 3M6UA 5JEDA 3ZIUA 3GPBA 1LLQA 3M8KA 3ZY2A 1OLUB 5G4LA 2TS1A 2OBYA 4G5YA 4GXQA 2EX1A 1ZU4A 3QOYA 1Z5ZA 3SS9X 2PL3A 3JRWA 3QXCA 2HCRA 3UCFA 3KOZA 1CJVC 1CULC 3UAYA 2C98A 1GWNA 5DLPA 5G0SA 4UNQA 1AK9A 1GV0A 4FJ0A 4R54A 1DT5A 3GUUA 3HRIA 3A3PA 3KPJA 3QJGA 4NEHB 4BPBA 3WLMA 3WKAA 2CNDA 3O8QB 1R18A 4IF6A 4U2BA 5HZGA 2FZLA 2V9PA 4FMDB 3U61B 4PRZA 1XJCA 2H92A 3O9VA 4DUYB 2PXAA 2CLIB 2NTEA 1GQ2A 2YWCA 1KU6A 4UNPA 1VIMA 3ZWXA 4LKRA 4L5AA 4F56A 1RQRA 4MP3A 3EJWA 4EPXA 1Q7CA 1W44A 2XECA 3LQKA 4RFSA 5CVJA 4BOYA 1BROA 1RRCA 1TQ2A 2VNIA 4DA0A 1ZN2A 3IDOA 2WJGA 3JAWB 3OU7A 3RVOA 3ZDAA 1Y1PA 1XDBA 3GFVA 1BE0A 3NBFA 1ESDA 2FSUA 4ZVTA 4RPLA 1MDFA 2WSSA 2ZS7A 3LO5A 2W2KA 3OWXA 3CZ5A 2O1EA 1KO7A 4RELA 4WZAE 4ISCA 5EMHA 4MV6A 1LBTA 2WAMA 2Q4OA 4FXPA 3S5UA 1YRAA 3TZ6A 1UBUS 1ZGJA 2WE7A 3DMTC 4IDOA 4P2BA 3RVDA 4CKCB 4FEAA 3KO8A 1MPXA 1OA1A 2X6RA 3ZHUA 1BMFD 3KQUA 4K6MA 1ZH0A 1GRCA 3BXHA 3LK7A 4MULA 3WS7A 4E2FA 5AQ1A 1FP4A 4R2XA 3QKRB 3TZEA 8ATCA 3UK1A 3D02A 3JALB 3ZKAA 2QS9A 3R0JA 3FNIA 5EMKA 2JGMA 3UICA 2IBTA 1B43A 5DIZA 5JO9A 5JAZA 4HQLA 1QIFA 1ZJ5A 3VYUB 2IDMA 2A9RA 4D0LB 4WLUA 5EKTA 1IQPA 4AJ4A 1RI3A 1KAQA 2V7GA 1YOVA 1XZMA 3S7ZA 1FUUA 4HWGA 3B5JA 4P6VF 1NQXA 1H5NA 2DTEA 3ITEA 4HRAA 4NMLA 5TXGA 3VU9B 5BR8B 3VKGA 4I1PA 5HWSA 2QZ4A 1RCFA 3GO4A 2ZYWX 4H0CA 2QVGA 4MQLA 2RAUA 1JA1A 2VNAA 3H8SA 3KB2A 5HSGA 5KCZA 4LFBB 2FFAA 1Q17A 3CR8A 4UASA 4CNQA 2GZDA 5IF3A 3GGPA 1LFDB 1SU8A 1DQPA 4MR9B 4OLHA 5HQ3A 3TLJA 3AVTA 3IUJA 5TF4A 3NXKA 4P3PA 4RSHA 4V0RA 3PENA 3T3IA 4TWZA 5F73A 3NDIA 5FNVA 3LQ2A 3L3BA 2PKYX 3P27A 3RIYA 3RQIA 4KR2A 3E0XA 4FFPA 3P9NA 4L0QA 4X00A 3NO4A 5EAIA 1EIZA 1W1WA 1XKXA 2VH5R 4YUZA 3C3EA 5GVSA 1JDSA 5FPTA 1JZQA 4HLUA 1F6WA 1MXFA 2BKEA 3IKMB 3B5EA 3PPWA 4IJVA 3ROKA 1YRWA 2B7BA 3ZI7A 4KQ9A 2WFZA 3LLCA 3N5CA 4YV7A 4Q82A 1GTSA 2ZPTX 1XLTA 3GEPA 4P3YA 1C4KA 5AHWA 4MQFB 4V0QA 5G2OA 4EJFA 4H31A 1X7YB 1YQEA 5H1YA 2OAQ1 2PZMA 3I9NA 5AVWA 4Q9AA 1GFZA 2OVFA 2XT9A 1CPYA 1RWBA 2ZR7A 3NAQA 4NPHA 5EJGA 4B8ZA 1KYWA 2YL2A 3L4EA 3OOHA 4FFOA 4NLLA 3S40A 3BMNA 5BMOA 3W2TA 1NDQA 1XZLA 4J0JA 5NLLA 1EFRA 4HDCA 2BP7B 3AY7A 1FNSA 5K3AA 4C0QC 5BVHB 4PG4A 1MEOA 4CR8A 1JA9A 2ERXA 3I6BA 3Q7SA 4M55A 3K0CC 4PG5A 3LP5A 2QJWA 1XSEA 3D3JA 5JWHA 2RKBA 4DSOA 1IZZA 2A84A 3TW0A 4ZIRA 2HZ7A 3E5NA 2ADFA 4WOKA 1DT3A 4LTNA 2X86A 3UUGA 4DV1B 2IP1A 2J4CA 4O4IB 4IG9A 1VP3A 4N0MA 4OJYA 4R01A 4RK5A 3V2UA 1GPDG 1OSNA 2W98A 2II6A 3GAZA 3D8NA 4MWEA 4P31A 3QEAZ 3SHWA 1XDWA 2CEAA 4LRUA 1MQ8B 4BDTA 4B3MB 2X42A 4JLNA 3R7NA 3P2KA 5C4GB 4DNPA 2V1XA 2V3VA 1OJ7A 4Y8VA 2ZRNA 3WLOA 3CLUD 2I6TA 3NDBB 2LRHA 2PSSA 3LAWA 3W1WA 5HUQA 3QUQA 4LGMA 1FUEA 2WVGA 1NATA 4CWAA 2XMZA 1Y63A 2B4TO 4JSRA 4R7TA 2YJZA