2J59A

Crystal structure of the arf1:arhgap21-arfbd complex
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
165
structure length
165
Chain Sequence
GSMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGLDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Arf1-Mediated Recruitment of Arhgap21 to Golgi Membranes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords ADP-RIBOSYLATION FACTOR 1
total genus 59
structure length 165
sequence length 165
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-09-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2j59A00
2IX3A 2F7SA 4RD6A 3RS5A 1E0KA 2ORWA 5DE3A 4ESVA 1DBSA 2ZJ5A 5H70A 5TXGA 4O2LA 5J4KA 1Z6YA 2PLFA 3P20A 1W1WA 3AP3A 2JEOA 1E2DA 4B3FX 3I5XA 1SXJA 3P32A 2VP9A 3Q72A 1YHNA 1PLKA 2ZRKA 4M1OA 2GVDC 1XTKA 4PPQA 1ETUA 5DISB 2JA1A 3BB3A 2IYQA 2F9MA 2H5EA 4OK6A 2IL1A 2ZS7A 4HEJA 2JJ1D 3ZS9A 2ODBA 3E70C 1U2RA 2G6BA 1E4YA 2AFHE 1XTIA 2PEYA 3AVYA 1W0KA 4LPSA 4URVR 4QGGA 2IHYA 4US0R 3FHOA 1FPMA 2IBMA 3REFA 3GPLA 2OG2A 1H8ED 1I2DA 4A4DA 1XJ0A 1TQDA 3F3YA 1SVKA 2C9OA 5K8TA 5TMPA 1E2EA 1NN3A 3GJ6A 3QPUA 3RS7A 3TSZA 1SVSA 4QHYA 2YV5A 4IRUB 4PR0A 4W5HA 3QF4A 2KWIA 3BD9A 3DKVA 4P4SA 4DEYA 2FG5A 2KB0A 4MKGA 3QF4B 5H1YA 5KU1A 1W0JA 3I92A 1KDPA 1KAGA 3KJIA 5SZHB 2XNSA 5C4GB 3DVLA 4TSFA 2J0VA 4TZ0A 3JZMA 4HLQB 1TX4B 3HPQA 3QKTA 2ZM5A 2QE7D 4DLTA 3T61A 3QF7A 2FA9A 5J5CA 3CF2A 2XZOA 3WRXC 5KPJA 1ZNZA 1LF5A 3PUWA 3S1AA 1E6CA 4JZKA 3QJYA 3EX7C 5JEDA 3R8CA 4BUJA 1AQUA 1KNQA 4DIDA 5CITA 4AI6A 2OESA 1R0YA 3AVPA 2YYZA 3D3QA 4C30A 1DVRA 2GNOA 2I1VB 1JR3A 1FFHA 2AN9A 3PXGA 2JJ2D 2IA5A 3BB4A 1S96A 4WW0A 3GFTA 3GLGB 2A5JA 3NC1C 4BRUA 2BC9A 5IT5A 2CLCX 2QPAA 4PPNA 1FP7A 3NTUA 2EU8A 4O2RA 3THYB 3DMDA 1NVVR 1W0KD 1XNJA 2GWHA 1A7JA 1L2TA 2OHFA 3TR5A 1ZNXA 1DAGA 4JLDA 5E7IA 4A92A 3KL4A 3SFZA 2EFGA 1N25A 2UVQA 3FKSD 4QJ4A 3KQKA 4BQSA 3I5YA 4W5WA 2BEKA 2CCKA 1E2LA 5HKKA 2FGJA 4ZIRB 5JS8A 1T3HA 2ZREA 3UXMA 1DEKA 4RD2A 2A78A 3RRMA 2IYVA 3BJIC 3ADKA 2PMDA 4GL2A 2QG6A 4KFRA 4B34A 521PA 3RRNA 4FN5A 1GFIA 1MT0A 2CHVA 2NQ2C 4HZIA 2WV9A 4C0BA 1E2HA 1Q0UA 1YZQA 3SI7A 3TVTA 2F55A 4RD4A 3LXXA 4ERNA 2H57A 1IXZA 1G8FA 2EYUA 2QMUA 4MRPA 4M9XA 4DDWA 4PAQA 2P6RA 1NBMD 3THXA 1TU3A 3HU3A 2HJVA 1TTTA 1QHIA 3MJHA 2HUPA 2X19A 2IXGA 4CIDA 1ZVQA 5B2ZA 4UQOA 1C1YA 5D3MA 2XEXA 3LAWA 5EE3A 4LYHA 2V7QA 2Z6VA 1KK3A 1U0LA 2GK6A 1GRQA 2EFHB 2VP2A 2BDTA 3FYHA 3GLHB 3OFND 4DLUA 4LYJA 3E5HA 2XAUA 1E69A 2VRWA 1OHHD 3NBFA 1XRJA 2FGKA 2WKQA 4JLPA 4EKDA 1W2HA 2GCOB 1Z0DA 5FPHA 2GCNA 2ZJ8A 2XJ9A 2WHXA 4HZUA 2GEVA 2D4HA 1OKKD 4XTRA 1W4BA 5FBLB 4EPXA 1MO3A 2ZSFA 1EG7A 1Z28A 5JSZA 2L0XA 3MFYA 4KV9A 3LBHA 1EXMA 3LLUA 1P5ZB 4B2IA 4PSKA 3N5CA 5FL3A 2XXAB 2ZRHA 3T5GA 3ZVLA 2GJAA 2ZTSA 2P65A 5HZHA 2A5GA 4A2QA 1Z0FA 1E9EA 2NMVA 1MKYA 2C78A 5J4VA 5JCPA 4V0MA 2ZJYA 3NBXX 4C4PA 1Y3AA 5B64A 1G21E 3ZDQA 1I4LD 1U0HC 4FMBB 1Z08A 1NI3A 1SVMA 1FMJA 4IOKA 4UXJA 2TMKA 2MMGA 3ETLA 3W5IA 1XDBA 3NXSA 4EPWA 4B48A 2J59A 3X2SA 2O5VA 3SE0A 2GDJA 2IW3A 4BFZA 2ZXUA 3U7EB 1XEWY 3KZ1E 3MWYW 2IUTA 2QT1A 5AJXA 2AD5A 2WJJA 2VSOA 5CLQA 4TZ6A 1YZGA 1ZU5A 3CW2A 1EESA 4ESHA 5JFGA 4BRWA 1ZIPA 3DPUA 2NTYC 3WNBA 3QSYA 3BE4A 2O8BA 3MD0A 2XXAA 2R9VA 2C03A 3TAHA 2HCBA 1T4GA 1AZTA 1X86B 3B5JA 1U9IC 4MDFA 2IYXA 1Z6AA 3CRVA 3I62A 3O8RA 1KO4A 4LJ8A 2DWOA 1XFAA 5KSYA 3AVTA 3CR7A 2NGRA 4GP6A 5A0FA 4JYCA 2GCOA 4MGYR 3RC3A 4PC2A 1SHZA 3WBJA 5G53C 1G16A 4D81A 4WBSA 1KSFX 4JVSB 2JLXA 4DLWA 2D7CA 3DM9B 5LPNA 1XPUA 1JJ7A 3EIQA 4LJ5A 4A36A 1Q57A 1Z3IX 1R0ZA 1G17A 2YJTD 3QKRB 1ZINA 4LRWA 4MKHA 1Z22A 2AK2A 1RJ9B 4B2PA 5J4YA 1Z0JA 2CJWA 2B7BA 4BE7B 2ZUDA 3NEJA 2RB4A 1ZM2A 3AKCA 2WWYA 1R6BX 3Q5EA 4KODA 3ASYA 2GXUA 2OCPA 3W3AA 3EC2A 4LX0A 2CK3A 4TT3A 4BWYA 2RHMA 4US2R 1OXVA 2QAGA 4JSTA 4U02A 2ZRFA 2EFCB 3SR0A 3PCRB 1CXZA 2FSHA 2FFBA 1FTSA 2PL3A 4RZUA 4GI7A 2QPTA 2CEAA 1U81A 1QHHA 4Q66C 2VH5R 4Q18A 1TMKA 4LHWA 1HY3A 3LW8A 1W36D 3K0EA 2O8BB 1G4UR 2BIFA 2F43B 3N2EA 1MH1A 4G5OA 4HB4A 4LYAA 4A0FA 1UKEA 2NO0A 4NYJQ 3SDZA 1Z0IA 4LV8B 2GTPA 4C0HA 1VMAA 3GEHA 4DDTA 2J7PD 1M34E 2OAP1 4QGAA 4OYHA 4HLDA 2J9RA 3ZLJA 1U9IA 1P73A 1I4TD 2V1UA 4Q4JB 3KUDA 1KZ7B 3K9HA 3GJ8A 3NG1A 4EQ6B 1YRAA 4JKIA 4OHWA 4DLRA 4YMTA 1WMSA 2ZYWX 1EWRA 3IEUA 3SBDA 2FFAA 2CE7A 4LHVA 4POAA 3U6BA 3AUXA 4TMKA 3LD9A 1KI6A 1T3SA 3SS8A 3VHLB 2O0JA 3WMEA 3CWQA 4M1YA 3PEWA 5K8UA 3KJGA 5FOXA 3AVWA 2RCNA 4KBFA 4LHZA 2JJ8A 2NZJA 3KXLA 4JLAA 5FR2A 1N6LA 1AGRA 4DB2A 4AYXA 4PQFA 4KLNA 1KK2A 2ZRBA 2QTVB 4A6XA 1KAOA 4QJ5A 3OFNA 4IOLA 1E2GA 1DS6A 3SQXA 2IT1A 1W2GA 4GOXA 4EUNA 3P27A 4CDGA 4EPVA 3C15C 1QVRA 3LX5A 3QXXA 2QP3A 4HZUB 4UNNA 4AKEA 4YDHB 4JSYA 4OKSA 4A1FA 1Q1QA 3EA5A 2QU8A 2W83A 3M6AA 2R44A 4QBFA 2G88A 3CPEA 4QL3A 1ODFA 5DI3B 1X8JA 1FUUA 1X8KA 4XIGS 4IDOA 3R7WB 3GP8A 4QHSA 3WNDA 1XEXB 1VYUA 4YMVA 5G3ZA 2ZITA 2P6UA 1NN5A 1PUJA 1TF5A 1VG9B 1OE0A 4LCBA 4KLZA 4YQFA 1NVWQ 3TLXA 3F0TA 3QY0A 4M22A 2IYTA 4HAZA 2ZRNA 1F2TB 3B82A 3NIBA 1NIPA 2PT5A 4NHOA 3VAAA 2IC5A 3VKGA 4Q4JA 1Z5ZA 4URUR 4IXNA 5J40A 2DPXA 2FMXA 5KNDA 2GBLC 1DELA 1DO0A 4TL7A 4GMDA 5CDFA 1N6OA 5A4JA 1CRPA 5P21A 1H65A 5KNBA 1GL9B 4TQAA 2OBNA 1GWNA 2CJWB 4E03A 1J99A 1II0A 1KZGB 1N0VC 4ZDWA 3RWMB 3H1TA 2WOJA 3BXZA 3GFOA 3LVRE 1JXOA 4JLVA 2Z4RA 3B9PA 1TL7C 2WSSD 5ELXA 4BLTA 2EW1A 3ADDA 3DOEA 1T5IA 1KI7A 3EA0A 4YDSA 2X1VA 3SZRA 3X1YA 5BN5A 3U60B 1NY6A 4PTLA 1KO1A 2ZPTX 2JDIA 2V55B 5IF9A 5E4FA 5LB2A 3FB4A 3BORA 2QAGB 2VO1A 2X2EA 1FP6A 2ZRCA 3FFAA 1TAGA 4NH0A 2DY1A 3J81k 1XEWX 3B7GA 1A5TA 5CIQA 3TQCA 3VKHA 3MLEA 1XD2B 1E9DA 3SU8A 2AK3A 2GILA 4GOKA 3CZPA 2C04A 2ZI6A 2VHUA 4GNKA 1NL3A 2QE7A 1RJ9A 4IFBA 1BYIA 2Z5FA 4B3GA 1CP2A 3ZZTA 3HYRA 3MRSA 1FMLA 1GUAA 1ZIOA 4M2LA 1CR0A 5EXSA 2WTUA 3QKUA 2X77A 1KOFA 1G3IA 1R5BA 3THOA 3WYAA 2F1JA 1FTNA 1VDZA 4DZZA 721PA 2GEDA 5JBQA 2Q21A 4OJQA 4HAVA 1K8RA 4U00A 3OEHD 2YC2C 3CRMA 2QTFA 4A8JA 1FNNA 4R98A 2OXCA 1BMFA 2VL7A 2H18A 4L4UA 2QAGC 3P4YA 4TMVA 1NVXQ 1B0UA 1ZM3A 2WAXA 3AF4A 3C5HA 5DHFA 5GVRA 2RHDA 4C0LA 1M74A 2CL6X 2GAAA 2ERXA 2J1LA 2ZANA 3CX8A 2QN6A 3TW8B 1IONA 2QSYA 3CIOA 5DGXA 1Q3TA 3TNFA 1KK1A 1FX0A 2VEDA 3SHWA 1CR2A 1N6HA 2O8EB 4JL5A 4I1OA 2OBLA 1E2MA 4TYNA 1P9NA 2QNRA 2H92A 1NLZA 1G4AE 3KKQA 3O47A 1KKMA 4YXWA 4JYBA 1L4UA 1QG4A 4NP6A 1YZKA 4OI0A 3CWZA 2LWIA 4OQLA 4L9WA 1KKLA 3CO5A 3QI2A 5EE1A 1OB5A 4JKYA 4PZLA 1NNEA 1YRBA 4LC1A 4XJXA 3TBKA 4D82A 4D80A 3OZXA 2DHRA 1VHTA 4V0LA 2DWQA 2QMOA 4HSEA 2HT6A 1R8QA 2EFEB 3THWB 1Z83A 3LW7A 2QAJA 4A2PA 3W6OA 3GJ0A 5J4LA 4F38A 3BFVA 1SXJB 3WY9A 2JLQA 4M1KA 3AF2A 4II7A 3MG9A 3KQNA 3AVUA 2WJYA 4KU4A 4OI4A 4ABYA 2DCUA 4IFEA 3BGWA 4HAYA 1WXQA 5FI1B 4CT5A 1PJRA 2IWRA 3KJEA 4GMXA 4WOPA 1OSNA 3TSWA 5FPSA 2B92A 3I1FA 1E2QA 4M9ZA 4M0LA 5IHPA 1U8AA 3HU1A 5EXXA 2XSZD 1DE0A 1ZM4A 5FTNA 2O8DA 4FCTA 4LV5B 1IOZA 1CEEA 3QQ5A 2ZI5A 3C5CA 3KKMA 3QEJA 5DIFA 1NSTA 4OI2A 3ECCA 1CLUA 2C96A 1QRAA 4B2LA 2OV2A 5CIWA 1UKZA 1QHGA 3GEEA 3SOPA 1DAIA 1XB2A 4MKIA 4EAQA 2XZLA 4WXPA 4QOSA 5EE5B 2D7DA 1LTQA 1XZQA 4U5XA 5IK2D 1NBME 1E9AA 1GL7A 2VSXA 2IF2A 3PR1A 1G3UA 1QHYA 2SHKA 1DO2A 4V02A 4RSGA 3ICEA 3OESA 3U7FB 2IS4A 4A0GA 4HUTA 2GEUA 2FH5B 3EWAA 3IGFA 5JJLA 1T0HB 1JR6A 1E1QD 3OE7D 3PUYA 4DC9A 2GETA 4LGMA 4UKDA 2FF7A 4EQ6A 3VX3A 2VP4A 1NJFA 1MO4A 1Z6GA 2J7KA 4I1UA 4EFMA 4TLCA 3PITA 3CKLA 1S8FA 2PX3A 4DHEA 1ELOA 3PEYA 1NBMA 2BBWA 5FUYA 2VP5A 1U94A 3NH9A 2XZPA 4F4CA 5K8LA 1XXHA 2YINC 1SGWA 4Q7KA 1GP2A 4P33A 4M8NE 1XF9A 3L8YA 3R7WA 1Y63A 2FSGA 2REXB 3LDAA 5IDVA 4B3DA 5KYKA 4MRRA 2NPIA 4H1UA 1FUKA 4UXIA 2R6CA 1KO7A 4DB4A 1TPZA 1E2IA 3MGCA 3CRRA 3C7KA 5UKDA 4B6FA 2QQEA 3GLFE 4G5QA 3R8FA 3PJRA 1U0JA 4OJKA 1G3RA 3W3ZB 3H4MA 4R71A 4LY6A 2PZGA 3A36A 1ZD8A 3RS2A 3W9YA 2ANBA 1E98A 2G0TA 2J0UA 1KJZA 3BOSA 4CW7A 3PFIA 5JI3E 1OXSC 2QMHA 2NO1A 4HLUA 8OHMA 2E9SA 4P3YA 5DH9A 3GJ7A 1CULC 1JPNA 3GCGA 4B71A 1Q1EA 2R6DA 4F91B 4IEEA 1KNXA 2OM2A 4S2EA 4RD3A 1Q21A 2FPLA 1RYHA 2CNWD 2QORA 1TQ2A 2JJ2A 1US8B 4E5UA 3W8RA 1IY1A 4GZLA 3DZ8A 2JLVA 3WP0A 2KJQA 5EQTA 4Q4HA 3U3MA 1GIAA 4TL6A 3OIUA 1JQLB 1QHNA 1M8PA 5JRJA 3KTAB 4OHYA 1CIPA 1XTSA 4A82A 1TNDA 2ZRMA 4MUBA 4Q1EA 1EK0A 3AVQA 1HEIA 1G8YA 1ZYUA 2KI5A 3VR4A 3CPJB 4EIWA 5EE0A 1JAHA 1XCMA 1GILA 2P0EA 1RFLA 2BM1A 3DHWC 5JWHA 2BJVA 2EWVA 1NF3A 5AJYA 4C0KA 1YVDA 1YZNA 2AR7A 4URZR 4AKIA 2ZUBA 2FWRA 4JLNA 5IRCD 2VHQA 1G9XA 2MSCB 4OQNA 4YMSA 2FEMA 2H1LA 1NRJB 3EPLA 2FSFA 2GKSA 1D5CA 2PZFA 3IKJA 4N3NA 4LBZA 2Q6TA 5HPYB 1Z47A 1JI0A 2WWGA 3Q5DA 2R6FA 3EZ2A 2A7QA 3EW9A 4GT1A 4KVAA 5SZKB 4MRNA 4L15A 3UK6A 3LH5A 3A4NA 4BLSA 5TDHA 3LXRA 2PCLA 3QG5A 1Z29A 3QPVA 4X8HA 3IQXA 3KB2A 4NONA 4Q48A 1JQJC 4US1R 4CEJB 3A37A 4DLZA 4PQRA 4NZYA 1VYVA 2ZRGA 2YC4C 2QEQA 4OHZA 5FTMA 3K70B 2YHSA 3T06B 1J2JA 4UJ3A 4RJLA 3QXCA 5JI2E 4MGZR 3CRW1 2XNDA 3LQRA 4XD7A 2WJVA 3PG5A 1T9HA 2ZRLA 4TLBA 4B3BA 2WWIA 4EPTA 5A5GA 3BH7A 3AKEA 4BFVA 4URWR 3QXSA 4FMCF 4Q7LA 5CK5A 2JLRA 5F98A 2R2AA 3AP1A 3I32A 3B6EA 3RABA 3CH5A 4AG5A 1G7TA 3G0HA 5EJEA 3A1VA 1VHLA 4ZV4A 3VNUA 1EFHA 1GZSA 2AXPA 3BRWD 3UANA 1CJTC 2QTHA 1WRBA 4OQMA 2NOAA 4QNMA 3KDSE 5AJVB 3WP1B 4JL6A 1OIWA 4Q1FA 4TYWA 2KSQA 1Z2CA 2V7QD 4IVQA 2ZYTX 1H8HD 4Z51A 2PT7A 4ZDKA 1NSFA 2YNMA 2HV8A 3DKPA 2G3YA 4ACBA 2EVWX 1E2FA 3B2EA 3VKWA 1D2MA 2W2VA 4DUGA 4GOJA 4QM6A 1FZQA 1N6RA 1PZNA 1N0WA 2G77B 2WJHA 1KO5A 1UF9A 2W6JD 5HCIA 3T34A 3W6PA 2OZEA 1W49A 2BWJA 2RGDA 2D06A 4B44A 1HH4A 2WJIA 1XMSA 3Q9LA 2P5TB 2XOKD 1RW4A 4RKFA 2JGNA 5GJCA 2WZQA 3ZVRA 2PMKA 5E3HA 2QMEA 2XB4A 4UNQA 4BZPA 1HURA 1CU1A 5FPYA 5AUOB 1KMQA 1WCV1 2BMFA 3U3RA 2QGNA 4C7OB 1E3MA 3PUVA 1X8LA 2YOGA 3CZQA 2ZEJA 3K9NA 3AKDA 2ODNA 3ZQ6A 2QENA 4KFTA 1F6BA 2OXRA 3WYGA 3KKOA 3GLFA 1HA3A 2V1XA 1NG1A 3M1IA 3L0PA 4Q9LA 5FBWB 4XH9B 4Q1AA 2J7PA 3ONWA 5FTKA 5HCNA 1FX0B 1F2UB 3A58B 1NVUQ 4DSOA 1S3SA 5KPDA 3FHCB 1KIMA 3WMGA 3TE6A 4JLKA 1JB1A 3U44A 1TUIA 1KI9A 5KDDA 4C2UA 3GQBA 3DZDA 1YZLA 2DFNA 2DFTA 4BZQA 1P61B 3F5FA 2GRJA 3QXHA 4Q02A 5DHAA 2ZI3A 1G6OA 1NN0A 4V0OA 4Z8YA 2F1HA 2ZI7A 2P67A 2AXNA 4LOAA 2ZRAA 1IN4A 2G9NA 4G01B 2RMKA 4MGIR 4NYIR 4ILEA 2OCBA 4TT3D 1O3YA 2C99A 4Q4LA 5D3MB 1OH5A 1G8PA 1T8UA 2QP4A 4M21A 5FOWA 1KDRA 3EZ6A 4P4TA 3SNHA 4P4UA 2QRNA 5GJBA 5LBIA 4FCVA 2ZRPA 1AQYA 2B6HA 1YR7A 4WVFA 3CRQA 3QKSB 3SC3A 3HDTA 3AUYA 3WHLA 4DCUA 2PJRA 1H8EA 3FHTA 3K0CA 1RC8A 3ND8A 4KVGA 2C2HA 4C0AC 4DLVA 1R2QA 1HE1C 2QBYB 2WMOB 4XWOA 1E9BA 1DAKA 3JVVA 1AS2A 2NO6A 4MGKR 2W2TA 4B6EA 1GKIA 4D0GA 1GKYA 2RGCA 5HTKA 2JAQA 2MMCA 5K8IA 3U3OA 3B13B 4R9UC 4DSTA 4CEIB 1W5TA 1CKEA 2D2EA 1EFRA 3PEUA 1W4CA 3LBNA 5KHOC 3C14C 1COWA 4DEXA 3THYA 1ESMA 1KMHA 4GDFA 2ERYA 2YOHA 6Q21A 5KO2A 1C4OA 3QPWA 5LDDC 3GLGA 2HF8A 2C9YA 1G5RA 2FFHA 4Q01A 4MYUA 5DSZA 3B1XA 1F2TA 2W6IA 1MO6A 4IDHA 4QRHA 2J46A 1VIAA 2O52A 4MYHA 1KMHB 4BLOA 4CEHB 3S1AB 3EPKA 1ZU4A 1RPZA 2ZJ2A 2GHIA 5KUTA 5TVKA 2GZAA 1ZUNB 2ZROA 3D31A 3I8XA 1N6PA 1UBGA 1L4YA 3K1JA 1UKVY 2W2XA 4B76A 4Q9IA 3K70C 2AKAB 1XMJA 2D74A 4BFUA 2I1QA 2CLDX 2ZI9A 3ZS8A 4R7ZA 1D9ZA 2ZETA 3KX2A 4YMWA 1G3MA 3AF3A 3B9QA 3JVUA 2WKRA 4OL0A 1KY2A 1KI1A 5KNCA 2WM9B 3QVVA 1R5NA 3GFPA 1KI2A 1ZM7A 3IILA 3LY5A 1OB2A 3IUYA 4MDEA 1N5JA 4P4SB 5LD2C 3A4MA 4D26A 2VPPA 2WIBA 1P2UA 3IQWA 3R20A 4QBHA 1X3SA 5JEEA 4PQYA 2FV8A 3U4QB 1IXSB 5L3SB 3GLIB 3ZGXA 2YVUA 4B35A 1G3QA 3VHXA 4ARZB 1G291 4TLAA 2ZR0A 2VIIA 4ASUA 4D0LB 3BS4A 1S3GA 1ONBA 1OIVA 3I4LA 2OAQ1 4WZBE 3EG5A 1TADA 2BMDA 1ZMXA 4W5JA 4RFSB 2G0NA 4BFWA 2Q0HA 2FZLA 3UG6A 3DL0A 4Y0VA 1NKTA 4HB0A 1IXRC 3P4XA 3KFVA 1CBUA 3RVBA 3BBPA 3REGA 1D8TA 3SQWA 4QXAA 4BEBA 3KQLA 3RANA 1KK0A 4M1WA 1GRNA 2DYKA 2IUSA 4L5BA 1UEIA 2O0KA 2ZQ5A 4G3XA 4RY2A 2P6NA 2ZAOA 4AK9A 4WZ6A 1Q12A 4QGHA 2H8KA 4RD0A 2WWFA 4BFXA 4HUQB 4B33A 4HDOB 5B30A 4E09A 1G64A 2MSEB 5CJ2A 3VR3A 4B3CA 1JALA 2VF8A 2H17A 4AC9A 3SEAA 4LZZA 1G1MA 1HUQA 2Q3HA 3MUFA 2GAOA 2A9KA 3TH5A 2VBCA 3GJ4A 5D3QA 1OIXA 4R2HA 1JBKA 4TWZA 4CEHA 2A5YB 2CCGA 5HKKD 4Q00A 3I73A 4LHYA 3U4QA 2ZU6A 1RYFA 1S1CA 1FL9A 1HE8B 4AKHA 4M1SA 1CTQA 5C4MA 4XVRA 2IWHA 4NCHA 2ZE7A 2UKDA 1IAQA 2K5UA 4PHTA 4LJ7A 5FUXA 1Q20A 4BPBA 3QKRA 4CRWB 3K0FB 3A1UA 1J7KA 2PZEA 4FWIB 2WAYA 1N2CE 4MRVA 3NKVA 3E1SA 1SVLA 2A5FA 2WPDD 4IJMA 4Y0AA 4Q19A 2VP6A 3NC0C 1JR3D 2F43A 4RD1A 4WAUA 5J4HA 2OLKA 1OFUX 3K0CC 4DWJA 3TAUA 2J0QA 1SZPA 2AFIE 2XTNA 5DNYB 2RGBA 1JAIA 3TUJC 4B43A 4NCNA 4QG7A 4M53A 3T15A 4HLCA 2ANCA 1AN0A 3SJAA 4BLRA 1I4DD 1NG9A 2WIAA 3QXJA 5C2JB 4JT2A 1QG2A 3U7HB 3KJHA 4TSFD 4IVPA 2GJ8A 3BAFA 3T5DA 3VMFA 3CR8A 1J8MF 4PC6A 1GITA 1NMZA 2ZJBA 3EAQA 3UATA 5BYKA 3IPXA 1DAEA 3TW4A 3HJNA 3UPUA 1OFHA 1BO6A 1UFQA 1GNRA 3FOZA 1ZD9A 3V4FA 2WVJA 3B8HA 2ZJAA 1G41A 1P62B 3KXKA 1U90A 2OO7A 3LLMA 1V43A 2JDID 1KSGA 2IS1A 4LJ9A 3ZZ0A 1QHSA 4P32A 5B57C 1R4AA 4FINA 1AK2A 1A2BA 3B60A 3IO3A 1W4AA 4I1SA 4ACAA 2A30A 2REOA 2R62A 2WSSA 5FUVA 3KB1A 1SHKA 3CH4B 2XTMA 2ODEA 3U6KA 5AK0A 3LA6A 1NMYA 1PUIA 2BMEA 3KUCA 5AJWA 4WXRA 2XGJA 3VR5A 2Z0MA 2GBLA 2XTZA 4NYMQ 1KGDA 5G40A 1CRQA 5CYOA 4P0TA 3FKQA 3BC1A 2HXYA 3VU9B 2VSFA 4OI1A 4N1AA 1S1MA 5JJKA 1ESNA 3GLGE 4NBSA 4PAMA 3DDCA 4IDPA 4JBWA 1P72A 3A1SA 2JATA 4BECA 2MSDB 1OPXA 4PC3A 1ZBDA 3ZD7A 5AWFC 1MABA 1U8ZA 4D4JA 5BN3A 4PSAA 3GD7A 1TQ4A 1RZ3A 4GP7A 2B8WA 1E2KA 1AZSC 1W46A 1WA5A 2VYFA 2ZIAA 1A2KC 2FU5C 1GSIA 3GLHA 1N3BA 1Q3HA 3LVQE 4GRAA 1N6NA 1P2VA 1XCGB 2IS6A 4MYCA 2VLIA 1F5NA 1UDWA 1H8HA 2FJUA 1GG2A 2RGGA 1CS4C 1P9WA 1LY1A 1G7RA 3FTQA 1ZRHA 1VG8A 2CVFA 4TL8A 1P4SA 3VU9A 4C3ZA 1N5LA 3QENA 4KFSA 2CXXA 2RAPA 2RGEA 4PHHA 3THXB 1Z6TA 1CR1A 5G41A 4BZXA 2XJ4A 5IK2A 3W90A 4C7OA 1GKUB 2QL6A 2IK8A 1YZTA 2F3TA 2HCJB 1DAMA 2J5XA 1OJLA 1QBKC 1BS1A 1IBRA 2W0SA 2ZAMA 3I8SA 3K09C 4ZDIA 1WB9A 4QNRA 1G7CA 4Q1CA 3QIAA 3ADBA 1GAJA 3EC1A 1MR3F 3K0AA 5FTLA 1C9KA 1FQJA 4ASUD 2PLRA 3LWNA 1GL6A 1WDTA 3TQFA 2VP0A 1B23P 1A4RA 2GESA 2CBZA 1P2SA 3IBGA 4TN1A 4O3MA 2R6GA 1WE2A 3W34A 4ZKEA 2J45A 4TQUS 4IKEA 4G5RA 3CNOA 4I1VA 4V0ME 3ZIAA 1R0WA 121PA 2NG1A 2GZDA 2XX3A 2FE4A 4A2WA 5BXQC 1NVVQ 2XSZA 4F7WA 4P31A 1Z0AA 4FD2A 4KHZA 3EZ9A 4LV6A 5BN4A 2P5SA 4PANA 4DCSA 2F1IA 1XTRA 3KKPA 821PA 3N70A 2ZE8A 1GVNB 1R0XA 2W58A 5DO9A 3WBKA 1OT3A 4LYFA 1XPOA 2XB2A 1IJEA 5JLJA 1W47A 1JECA 4DRZA 1KJYA 4K81B 4NYMR 2Z43A 4OHVA 3RRZA 3V00A 1TF7A 1YQTA 1P9RA 2RGXA 3LFUA 4D4KA 2A2ZA 4HB2A 3CF0A 5JCZA 3LX8A 1E0AA 2FDCA 3FDIA 3QBVA 4Q03A 1RIFA 5EP3A 4DSNA 4I81A 1E9SA 3IIJA 5FTJA 1AGPA 4XOIA 5C46F 5DLQC 1II8A 1LF0A 3W8NA 4OHXA 1CJUC 2DR3A 2G1KA 3KKNA 2BKEA 4L9SA 1HYQA 1SVOA 2AWNA 4NL4H 1DAFA 2J87A 3G5UA 1T8TA 3K8YA 1KSJA 1IY0A 5EUMA 1D9XA 4B75A 4U7DA 1ZC3A 5FUWA 1P75A 3GLHE 1QZXA 4PO8A 3HYTA 1Q1ZA 4WIAA 5JECA 3PVSA 4YXWD 3PUXA 2CHGA 5J47A 2KBFA 1E0JA 4AY2A 2IYZA 4JS0A 4JVNA 2ZJOA 3IBYA 3C41J 1ZCAA 3ASZA 1JPJA 1ZP6A 4DLSA 2DFLA 1HTWA 3R9XA 4WA7A 1LV7A 4Q4AB 3AQ4A 2QZ4A 3HR7A 4JBXA 4DCNA 1JR3E 4JLOA 1E2JA 4DDUA 4FI3C 4RZ3A 5AR1A 3IEVA 5KSOA 1UADA 2QM7A 4V03A 4JLJA 2AHOA 3PENA 4J0QA 2FX3A 2G83A 2YZ2A 2N46A 3RWOA 1E9FA 1O87A 2VHJA 1W5SA 2WBLC 2OFXA 4Q9HA 2DB3A 4QKQA 1G7SA 4ZDJA 4JT4A 2AWOA 2BBSA 5FOUA 1XEFA 3L43A 2HLDA 1E4VA 1T6NA 2ZJZA 2D3WA 4MITA 2NPFA 5FFMA 2ONJA 2F9LA 3VFDA 3NEYA 3R9WA 1F2UA 2ORIA 1KHTA 3M0EA 2BM0A 3AM1A 3BH6A 3IIKA 3TVDA 1S0UA 5DN6A 1J90A 1OH6A 3EZ7A 2LCFA 4Q4HB 5EZ5A 1J70A 1FNMA 1MRSA 1BOFA 1X1RA 2ATVA 3RS4A 3WYFA 4A15A 2LKCA 1HT1E 1LS1A 4DSUA 3FE2A 1Q1BA 5AUQA 1W48A 1AKYA 1P60A 1SXJC 2PEZA 3OIYA 3BFKA 3AVOA 3AVVA 4D6PA 3IDQA 4UNRA 4AG6A 1UM8A 3U61B 1JNYA 4RVCA 5GVSA 5FOVA 1P6XA 1WP9A 3EPHA 1GDDA 4PXAA 4QBIA 4LBVA 4Q7JB 4HYYA 3ZIAD 2O0HA 4TMXA 2IYWA 4Q7MB 4DT1B 3VTKA 5TV2A 4KBGA 1S2MA 2ECKA 4PHFA 3EASA 4IDNA 1VPLA 4PX9A 2OCYC 1ZM9A 4DXAA 1S9HA 1YU9A 3HP1A 4I99A 2WWWA 1OKKA 1W4RA 2CLSA 2EFDB 3VR6A 1MOZA 4XVQA 1LS6A 1D6JA 4DCVA 1E9RA 3TKLA 2Y8EA 4BLQA 3CNLA 3UG7A 3I3SR 4W9MC 1AA9A 1KDTA 4S35A 3KFXA 2ZRIA 1DG3A 1HV8A 1UPTA 2IF0A 3L8ZA 4BASA 5KSZA 2AKYA 2JIZA 3H86A 2FSIA 4PO9A 1AKEA 1T0JB 2ZRDA 3PV0A 1VCOA 5CJPA 4NMMA 3TUZC 2ZVPX 4LK2A 4KSCA 3ZJYA 3PIRA 3AKYA 3WMFA 2V4ZA 1F3OA 4D2IA 2GA8A 4IVRA 2G1JA 3CPHA 1DTSA 2HYDA 3IPYA 4FMDB 1OXUA 4JVMA 3Q7QA 5DYIA 3U5ZB 4DLXA 2PBRA 1EX6A 1Z8FA 2E1RA 3B1YA 3U3JA 3WNCA 2GXSA 3CBQA 4HI0E 4CZ2A 4F4IA 2O8CB 2I3BA 4Q9KA 3SYNA 1XCPA 1TF2A 3CNNA 3LQQA 4W7SA 2YWEA 1HQCA 2HEIA 1GNPA 3A8TA 1F60A 3K0SA 4LUCA 2ODWA 2C77A 3LBIA 1G18A 3JZAA 4QC2A 1E79A 4MYTA 2QRZA 4MQBA 1S4QA 5AJZA 3CX6A 2XNDD 1PVOA 5F3WB 3FKSA 1TQ6A 3QKSA 5FI0B 4PZYA 3GEIA 4V0KA 1M2OB 5FL7D 2C98A 2DBYA 2ZR7A 5JWRA 4A6PA 5SZIA 1DPFA 2RH5A 3GJXC 3IO5A 3QEOA 3MSXA 5KTYA 1IN7A 2C9CA 1BIFA 5HR5A 3T1TA 1OV4A 3TUIC 3LNCA 1PLLA 3MWLA 1YR8A 4XSHA 3BFXA 2EYQA 3EPJA 4A9AA 2B21A 5ANRB 1XBTA 3DEFA 4AYWA 4ZCMA 4QFMA 1LB1B 2IEYA 4IOMA 3T35A 5GJVC 4FMCB 2JASA 3I72A 4JLBA 1CJKC 2GVZC 3T12A 1E99A 3THWA 4PPFA 4MA4A 1G8GA 2V54A 4UJ5A 221PA 3K9LA 4TQ9A 5DN6D 4ZI3A 3V4RA 1P2TA 3GMTA 3VQTA 1F48A 4C0SA 3L0OA 2BOVA 4IW3B 1TEVA 4AIIA 4DDVA 1W44A 5H68A 1EFCA 1VIYA 5JRZA 3EIEA 2JLYA 1XMVA 2HLDD 1W0JD 2GJSA 2BKUA 3NBZC 3CX7A 2CK3D 4CF7A 1GOTA 1KY3A 4B3XA 1E1RA 4Q21A 1OH8A 3I61A 2V8OA 4KFUA 3TR0A 3CF6R 4A0HA 3TK1A 1RRPA 4ON9A 1DOAA 3FFBA 3NBYC 3MMPA 1ZCBA 4GFDA 4HATA 5KOYA 4FCWA 3X1DA 1Q44A 3RS0A 4OK3A 4V0NA 2ZYVX 5JSZB 1VCMA 4XSGA 2CMKA 3QOFA 3L0SA 2FFQA 1PLJA 2BBTA 3DM5A 5FR1A 1NIJA 1XTQA 2RKOA 3DO6A 3E2IA 2Q9AA 2KE5A 5LD2B 3K09A 3O8DA 5FL7A 4WZAE 4MKFA 1EGAA 4BEJA 3KQHA 1II8B 3T1VA 3AGQA 2FPKA 3BERA 3B85A 1GM5A 3B1VA 4RZXA 4G1UC 4EDHA 3DOFA 2WSMA 3K70D 5EP2A 3V9PA 3FMFA 5BWMA 1QHHB 1K6MA 3FVQA 2BBOA 1SXJD 2LKDA 3OIWA 5JMTA 3RDPA 3K0FA 2B8TA 3QG1A 5EXTA 4JJZA 4UNPA 3TSOA 4ZI2A 1X6VA 1ZAKA 4HAUA 3IIMA 2N42A 3Q7PA 4UNSA 5EXPA 3VX4A 1OH7A 2DWPA 1W36C 3NHBA 2R6AA 1MO5A 2GF9A 5TY0A 1XXHE 1VCIA 5JWOA 4K46A 1NKSA 4QM7A 4BFSA 5H8WA 3RNLA 4L8GA 4DBLC 3X1WA 5TB5A 3LV8A 1E1QA 3OE7A 2WWXA 3QVUA 1IQPA 1NP6A 2D62A 3IHWA 1D2NA 2AL7A 1TEXA 3SJZA 5FBVB 2JIZD 3RHFA 4C9BA 3CUEF 3FMOB 3SJCA 3SYLA 3L82B 4A0RA 1OXXK 5FH9A 4NCIA 4XTCS 1KTVA 2VHTA 4TYPA 1IN8A 1NLYA 1JJVA 4TTPA 2HJGA 5E95A 4OBEA 5CM8B 3P26A 2Z4SA 2HF9A 1MV5A 2OLJA 621PA 3NWJA 1W36B 2EWWA 2OEPA 4DIEA 1OYYA 4PPGA 4LJ6A 3AEZA 3HR8A 4ITRC 1SVWA 4F92B 4B73A 4LBWA 2X8AA 3SFVA 3UMFA 3DMNA 4NU0A 4IOJA 4PC1A 1BH2A 5SZJA 2ONKA 3Q3JB 3VR1A 2CDNA 4RFSA 5GADl 4TMTA 1SXJE 2C5LA 2VQSA 4CT4B 4L16A 2D2FA 1DAHA 1E2NA 2BV3A 5HE9A 2C95A 4CVNA 1NLFA 3TIFA 1XEXA 2RGAA 1QVAA 1U8YA 4LPKA 4Q5IA 1KI4A 3A1TA 5DI3A 3CONA 2J41A 1UKYA 3SBEA 4DJTA 3O8BA 4FW9A 4ARZA 1KO8A 2JLZA 5F9FA 4OQFA 1WF3A 3X1ZA 4KCGA 1RKBA 5L3SA 2AD1A 1UBCA 2B7CA 4HDCA 3GLIA 3BWDD 2QSZA 4IHQA 4IDQA 3CLVA 5E7MA 2EQBA 2NIPA 1KJWA 1OXTA 3CB4A 4TTQA 4AKGA 2JCSA 5BW8A 3WHKA 3OAAA 1FQKA 3PUZA 2ZUCA 1ZJ6A 5L3QA 1OFTA 1L8QA 1Z0KA 5EUQB 2HDNB 4H1VA 2OCAA 1HT2E 1X1SA 3ZH9B 2H7VA 4URXR 1EFUA 2W6ID 1LVGA 2VF7A 1YR6A 1ZUHA 3MAAC 1VECA 2BJWA 5CLLA 4QGFA 3W5JA 1SKYE 1XJCA 3Q8XB 4NCJA 4RCZA 1N6KA 1IY2A 2BCGY 1A1VA 1RVDA 1QF9A 4YONB 4JMPA 1V5WA 1COWD 5JS7A 2QGZA 1LW7A 2QP9X 3B1WA 1GNQA 1YKSA 3WRYC 5AUNB 5CB8A 3L2OB 3U7GA 1VCNA 3AF1A 1XU4A 2OSBA 2QQ0A 4JLMA 1XTJA 3O8CA 1IJFA 1T91A 3NH6A 4EJSC 2Q9BA 2RGNA 4MH0R 1KDOA 1WQ1R 4H9GA 1QDEA 3UWKA 4KITB 1VKJA 3G82C 1I2MA 3ZVNA 3AF0A 4Z54A 3K53A 5L3RA 2PCJA 3W6NA 1E94E 4ZCLA 3RSOA 2P3SA 1G5PA 1D2EA 1T3LA 2IS2A 2O8FA 1JEDA 1E9CA 1II9A 4CEIA 5KDOA 4QJ3A 2OFWA 1M7BA 2ZYUX 1T5LA 4DT1A 4Z1MD 4XWKA 5C18A 2NZ8A 1XXHB 1Z63A 2OT3B 4Q1BA 1BMFD 2V6JA 1E1RD 1CR4A 3D8BA 3OEHA 1Q22A 1RRGA 2KBEA 1XD2A 1JEEA 1YR9A 4TYYA 2CE2X 2WWHA 1R5OA 1P3JA 4KYUA 4Z8XA 2QI9C 4QHTA 3SYKA 5CB6A 2FNAA 4BFTA 2OE2A 2Q3MA 2R65A 1M7GA 1ANKA 3FMIA 2DFKB 1MRNA 1A82A 4QBGB 1VYTA 4HAWA 1OFIA 1IHUA 2I4IA 2ASEA 4OK5A 4XWAA 3KXIA 3QUSA 1UDXA 2BMJA 2FEOA 1U98A 2QM8A 1N0UA 3U2QA 2QPOA 2F1RA 2WOOA 3AVXA 1QHXA 2IYRA 4X8LA 2CL0X 4G0NA 1OYWA 4ZCIA 2O8FB 3C4JA 1N5IA 1E2PA 1XD8A 3NVAA 5HE8A 4RZ2A 1TUEA 3ZD6A 1R8SA 1CF4A 2OBMA 5F2EA 5FBQB 5JHGB 4LJYA 4Q1DA 1E0SA 5JHHB 3QE0A 1IM2A 2WPDA 2X2FA 2GCPA 3SN6A 1UEJA 2IYUA 3FPAA 4LHXA 5EP1A 1MABB 2P2LA 3UIEA 4PHGA 5FOSA 1AJEA 4C0JA 2FN4A 3KTAA 2GJKA 3EXAA 4GBMA 5JJIA 3UMSA 1IN5A 4DCTA 1OW3B 5HZKA 1SKYB 2ZRJA 5FPTA 3HWSA 3A1WA 4Q4AA 3BIFA 1US8A 4TMZA 2ZR9A 3LRPA 4R2IA 1FW6A 2WKPA 2XOKA 1E79D 3EZFA 4KI0A 1Z07A 3H2YA 1AM4D 1IN6A 3BH0A 4I4LA 4PAOA 4X8OA 4AYTA 5BQ5A 1P7CA 2IXEA 3EARA 2CHQA 1BKDR 4LBYA 2OFOA 1AS3A 1M6NA 4LWZA 4NE2A 2CCJA 2W6JA 5L3QB 2O8EA 1XD9A 2IYSA 4IXMA 4JJKA 4UXHA 4DUGD 1KI3A 3BK7A 1Z06A 3ZYCA 1TU4A 3RAPR 5L3VA 3UMRA 3C8UA 4ZKDA 4N0DA 3U3KA 1WBBA 2HYIC 1Z6XA 1SQ5A 4EFLA 3TJZA 5KSPA 4LI0A 2J0SA 4BLPA 3ZQJA 4LSGA 2E87A 1KI6B 1G6HA 3AH8A 5JZVA 2PX0A 1N5KA 1XJQA 4M1TA 2NO9A 1U99A 1LNZA 1E32A 2NO7A 2VTKA 4HB3A 4NDZA 2GF0A 5CK4A 1EX7A 2UZ3A 2IEZA 2OILA 1XMIA 4KJZA 4DKXA 5CDFE 2A3RA 1UAAA 3SHFA 2R8RA 2GXQA 4NYJR 1K5GA 2REBA 4XD7D 4GPTA 2W00A 2BVNA 4BFYA 1L7VC 1SKQA 1UBEA 4M1MA 4JL8A 5EZ6B 5G3YA 2Q3FA 4CYMA 3MJRA 4LDJA 4LJ4A 3EIHA 4PFSA 1E96A 4F93B 2V3CC 3NDPA 3CM0A 2V6IA 1ZW6A 5TARA 4F4JA 2IYLD 5GJWC 1CJVC 4AD8A 4D25A 2HXSA 4AWXA 1BYUA 4ZO4A 1GRRA 2QROA 4HAXA 5EP4A 3RC8A 1GTVA 1EFTA 3VR2A 4JIMA 2N1BA 1NY5A 4FIDA 4ZPXA 4OQXA 1DARA 3K0AB 4EJSA 3HPRA 1PV4A 2ZSDA 5FBRB 3RSLA 2BHRA 5CM9C 3ADCA 4PO1A 2O8DB 4DLYA 3R9IA 1S9DA 3OIVA 3A6PC 5DI9A 1EWQA 4KSBA 4PZZA 3MCAA 1RRFA 1UBFA 2FZ4A 2UZIR 2BCJQ 4N0EA 4YC7A 1AS0A 4EJSB 2HT1A 3NDBB 2FOLA 4M9SA 2IYYA 2AX4A 4EPRA 4E22A 3MWJA 4K8OA 2ZI4A 1OLOA 4E07A 2WMNB 5FOTA 1ZNYA 4XVUA 3HU2A 4ZIRA 1R10A 4KAXA 2QBYA 2YOFA 2ZVQX 4FMDF 4HUQA 4EFNA 4C2TA 2YWHA 2H16A 2A5DA 3VNVA 1N6IA 2V9PA 4TMWA 1EFRD 2F6RA 3RS3A 4Z1MA 3C16C 5F9HA 2JLSA 3N2IA 2GZHA 1Z2AA 2Q9CA 2W0MA 3P1JA 3U44B 5DYGA 4RFVA 2CNWA 5M04A 1XP8A 2F3RA 4Q9JA 2VA8A 2YKGA 1YE8A 2ZSAA 4D0NA 3LO5A 5KDLA 4JVLA 4BGDA 5AUPB 1K5DA 3RRYA 4YMUA 4M9QA 4M4SA 5B58C 4G5SA 5C1BA 2IHBA 4A8JC 1ZUIA 1SULA 4NPHA 2JJ1A 2YWFA 4O25A 1FOEB 4RCYA 2JLWA 3RYTC 1W7AA 2IXFA 1G5TA 3ND9A 1VG1A 4NCKA 3MWKA 4LJAA 2CL7X 1HQYE 2C8VA 2Z83A 3BB1A 1G19A 3A4LA 2FPMA 1VTKA 2WJGA 3T1QA 1VG0B 3H84A 1M1YE 4IEIA 1NMXA 2QUZA 2J0UB 2VHCA 3Q85A 4MRSA 4TTRA 1DADA 3B1ZA 1KI8A 2GJ9A 3AP2A 4KYIB 3GJ3A 3GJ5A 2PJZA 1KYIA 3OHMA 2QT0A 4GSYA 2JLUA 3IHLA 3ZVMA 5BYJA 3GLFB 4A8JB 3OAAD 1AIPA 1YJ5A 4B47A 3H0KA 4KXFB 3TGPA 1R7RA 4DVGA 3PQCA 5CYPA 4B32A 1XWIA 1KSHA 1ZD1A 4KO8A 3F8TA 4G5GA 2BEJA 3ZZUA 2IUUA 4TLDA 4CGZA 2WICA 1NJGA 1WBDA 2ZE5A 3B78A 1RRCA 4NYIQ 3OEED 3KQUA 4Q47A 5LB4A 2QY9A 4HLUC 1YZUA 1ZC4A 1CJMA 2YWGA 4LC0A 1NN1A 2ZU0C 4MUAA 1G8HA 4RKEA 4TLEA 4X8MA 1RE0A 1JXMA 3M4YA 3T1OA 3ICQB 3OF5A 4FXPA 4JBYA 4O0MA 4EPYA 3UKDA 4FWTA 2ZSBA 4C0QC 3QNUA 2J3EA 3WXMA 1XX6A 3TRFA 2ORVA 2ZE6A 4PSVA 5L8VA 1XPRA 3FMPB 1ZNWA 2ZS8A 4D4LA 2O8CA 3X1XA 1XZPA 2RGNC 2XITA 3EWSA 1SVIA 4TYQA 4NKRA 3GLIE 3UWOA 1OHHA 2ZS9A 3RLFA 1G20E 4TL9A 3TMKA 4NTZA 4HDQB 5EE9A 3K9GA 3NHAA 4GZMA 2GK7A 3OEEA 4CEJA 2GXAA 3SJBA 3AGPA 1OF1A 2QA5A 3AV0B 1J8YF 4D4MA 4YLGA 1M7HA 2OUKA 1UJ2A 4URYR 3D6TB 2ZSEA 421PA 3L0IB 4B74A 2ATXA 3D7MA 1DG1G 3QBTA 2PH1A 3FWYA 4AURA 3PEVA 5FPKA 5E7JA 4PC7A 3AB3A 3FGNA 2CVHA 1LFDB
chains in the Genus database with same CATH superfamily
3CG4A 2IX3A 4RTNA 1MQ8B 4I4IA 1SZDA 2PUWA 3R5SA 5EIEA 3WE7A 1G38A 4NJMA 3L5KA 1DBSA 2BUAA 3F3KA 1JAXA 4MWSA 2Q1XA 1CFZA 3WOHA 5C37A 1W1WA 1VB3A 3AP3A 3WWPA 4N48A 1E2DA 4RMJA 1SXJA 3RUFA 3Q72A 4RGYA 5IJXA 1YHNA 3C6XA 2ZRKA 1M54A 4COKA 1XTKA 1ZJ4A 3FVWA 1L8XA 4CMIA 3BRCA 2JAHA 3OQMA 1PJAA 2O1SA 1VE6A 2GYYA 2XRMA 3BJEA 3PFNA 1GPNA 721PA 4GGPA 4YRPA 3RFFA 1Z4JA 1ULTA 1RAGA 3CXUA 4H6XA 2ODBA 3VR5D 2G6BA 2GPAA 2JCGA 4UU7A 1ONNA 3N28A 3A4TA 3IAAA 4RY9A 4E2XA 1DIOB 2AFHE 5K5EA 2O19A 3TRJA 4DV5B 2PEYA 1W0KA 4YJHA 3OJEA 2IHYA 2HK6A 3DLCA 5HIJA 2P9CA 3NJ8A 4N12A 3OUZA 2IBMA 2X2OA 2ARKA 3TTUA 4IJ6A 5FF9A 2O07A 2GKOA 4R1NA 4BP3A 1IPFA 1TQDA 3PQFA 4E51A 2EWMA 3QEMA 4EJFA 1SVKA 4MRAA 5TMPA 1X7YB 3QPUA 5KVVA 2O6HA 4AJIA 3FHJA 4IRUB 1OC4A 4PR0A 1JG2A 4QHYA 2ON6A 4F3RA 3QX9A 1IBKB 3BD9A 1JIXA 3Q7EA 5IUKC 2XZTA 3QLVC 3NALA 3ZCQA 2EF0A 1H2WA 1JR2A 3MOSA 4GH5A 2ZYSA 3BDAA 1A1SA 1CUEA 3PSHA 1ZI8A 3QF4B 5KEIA 5KU1A 5CH5A 4F9TA 4AU1A 4MS1A 4WXMA 1LSSA 2EARA 2GPWA 3DYBA 2QUHA 3MMZA 2ODAA 1W4LA 5SZHB 4X5OA 3KJQA 3STYA 1KJJA 3VC1A 1S8OA 3JZMA 3DHEA 1TJ5A 4HLQB 3EVFA 3TCKA 4E2YA 1G6Q1 4XEHA 4C7JA 1LWNA 3QF7A 2FA9A 4EG7A 5IJWA 3G59A 4K9QA 2XAAA 1UP6A 1IG3A 1QLWA 3RSQA 2IYNA 3RV3A 1H2AS 3EDCA 1ZNZA 1ECLA 2X76A 3BGDA 1LF5A 3MOIA 2H1IA 3PUWA 3OX4A 1E6CA 4BB5A 1KWGA 2CD9A 3QJYA 3EX7C 1GQSA 2EF1A 3R8CA 5E1DA 3QP9A 2F4VB 3A4IA 1PFWA 4OMCA 4BP9A 1Z13A 4OY3A 4EMTA 4C30A 2XHEA 1FFHA 2AN9A 4UAJA 1M34A 2NUAA 3BB4A 1SCJA 4FXOA 4GLFA 4R8KA 4LRTB 4BGEA 3KD3A 4WMLA 2CLCX 2QPAA 2EQ5A 3B5IA 3NTUA 2EU8A 2OXIA 2C84A 3EVDA 4HC4A 1H1LB 2OHFA 1L2TA 2V7GA 5EPOA 4JLDA 1DAGA 4GM0A 4LY0A 4A92A 3D6MA 3GFRA 3KL4A 4QT4A 5HKAA 5K01A 3GJQA 2W42A 4OP1A 2FXIA 2G80A 2YY7A 1N25A 1YKGA 4OAPA 4IL5A 4MVJF 4PYRA 2GPBA 3RPEA 4B5KA 1QOPB 2R87A 4YALA 4DQ0A 2FGJA 3WWDA 4ZIRB 2ZREA 5AFSA 1JFLA 1NQWA 2N0SA 3A6ZA 2A78A 3Q98A 3MK31 4H77A 4F2WA 1XJ5A 2IYVA 3BJIC 3RYHB 1PNTA 4ZEOA 2PMDA 2ZRQA 1VA4A 3UHAA 3MBOA 4KFRA 2O2GA 2D5BA 1C3OA 5K4AA 3RRNA 1BE8A 1PUXA 2SICE 3ZEIA 4U8HA 2NQ2C 4HZIA 2FW9A 3TPCA 1Q0UA 1YZQA 1ZX1A 3TVTA 3KKEA 1I24A 2F55A 1R9MA 2Y92A 4BNZA 3T94A 1IXZA 5DNCA 1Z15A 5G4KB 4IGFA 4FJ0A 4RHYA 4YMIA 1NJ8A 3WLMA 1ZIXA 1Z0UA 1JA0A 3H2SA 1PSWA 4M55A 4PAQA 3A70A 3SSOA 4D7AA 4M8IA 2ZULA 4XWTA 1CDOA 3MJHA 3OZRA 5JD3A 3EGXB 1XZKA 1F5SA 3GT0A 4XRRA 1ICIA 3H1BA 2XEXA 5EQFA 1YSCA 5JR3A 4LYHA 3Q3EA 4RADA 3TB4A 1WXHA 5J3JA 5K2OA 3EEOA 1WZNA 2IOHA 2GK6A 1GRQA 2EFHB 3ZQKA 1Y7PA 2XDQA 1I2CA 3V97A 1KMNA 2BDTA 3KZCA 4G56A 3OFND 3GRRA 3S4YA 4EEKA 3G9ZA 1E69A 1EJBA 1OHHD 3OT1B 2EKDA 3TLKA 1NXSA 5AI5A 5LLSA 2J85A 3U4AA 2WKQA 1RE1A 2Q2VA 1DJQA 1L7RA 3OE5A 3PQEA 3PHHA 4JT8A 4MV6A 1OT5A 1Z0DA 5FPHA 2HLHA 2XJ9A 2QW1A 2XQFA 3Q8LA 2PUFA 3ZUPA 2RJ3A 3INGA 1W4BA 2R8EA 4EPXA 5MN4A 4ND6A 1VLHA 1Z28A 2VH1A 3LI2A 5IAAA 4C22A 4KV9A 4NNOA 1ESZA 4N6OA 1F8FA 3M34A 4O4JA 4OXNA 4DCPA 2VF2A 5LQNA 4PSKA 2UZ4A 4TKVB 2Q1UA 3JQ8A 4LTMA 2ZRHA 2AH5A 1P8JA 1NPYA 3T5GA 3W9BA 3ZWNA 4C3VA 4KYTA 1RHQA 1E3IA 2CDCA 2RHJA 4K0KB 4KO4S 1DWUA 4E5PA 4O4LA 1PVDA 1E9EA 4A91A 5J4VA 2DX7A 2ZJ1A 3TTVA 1I33A 3CW9A 1WY5A 3NV9A 4KQ6A 4TKVA 1VI5A 2ZJYA 3WKEA 1E8MA 3GY0A 4C4PA 2FOXA 1UBMS 1XL1A 3GRPA 3QM1A 1Q0ZA 4O08A 1I4LD 3U1VA 2WUGA 4LA4A 4ZYWA 3PRJA 4RW0A 4UFNA 3AJEA 2I4LA 1IG0A 2ORED 2J59A 2Q3EA 4LFBB 3X2SA 4HFJA 1O94C 2BF7A 3OURA 4L0CA 4Q4CA 2EW8A 3OU6A 4K9SA 4M49A 4PN3A 2ZXUA 1H2ZA 1XEWY 1NYQA 3BZUA 3KZ1E 1U9YA 4YPVA 1O0BA 1BWSA 3TMAA 1B8PA 5T4BA 2HRZA 2W4IA 2WJJA 4IV5A 3V8VA 4KN8A 4X65B 4DQKA 3NTVA 5IJ9A 4LZAA 1EESA 4J4TA 1I7LA 4D4IA 4EYGA 4KXVA 4OYLA 2O8BA 2OWEA 2R9VA 3R7NA 2BMWA 2I6TA 3RHZA 3JQGB 1KXZA 1L3BA 2HCTA 3QVTA 1NX6A 2HCBA 3TAHA 3WZ2A 2DERA 2KPOA 1W96A 1QIFA 2OXEA 1U9IC 3B5JA 3BGSA 3BHMA 1F4PA 3CRVA 3LKBA 3E3LA 3O8RA 2G9QA 4ZO7A 3CZAA 1XFAA 2VRBA 4LG1A 2AG0A 2N3ZA 1T2CA 4GP6A 2CSUA 4RL4A 5A0FA 3KIPA 3RC3A 4PC2A 3AQIA 4QBTA 2XLBA 1PJSA 4F7WA 3HDJA 3KZMA 4YROA 5HKLA 2HU7A 1N2HA 4JVSB 1SKUA 6ADHA 5KOJA 2D7CA 3TOSA 4Z49A 3EGIA 3ESAA 3F9IA 3L92A 3S2EA 1DWPA 1N9GB 1Z9BA 2AFIB 1XPUA 3C3DA 1ZCJA 1MX3A 2XVYA 4HGPA 2GDZA 1M2KA 4X54A 2DPLA 3UMYA 2YJTD 1G17A 3KYJB 2D3TA 3AYXB 1QB7A 3FPFA 1U7OA 3IUBA 2SNIE 2Z98A 1ZINA 2GD2A 3QKRB 4N40A 5J4YA 5LD2B 3T3NA 4MHTA 1UDBA 1P0IA 2X7XA 3FF4A 2CJWA 5REQB 2WTNA 3PQ3A 1FDOA 1PBTA 1ZM2A 2MCFA 3GZNA 1IY9A 1R6BX 3B2QA 3FRJA 1WZUA 3QA3E 3RTAA 4HOYA 1EUCA 2HA6A 2AC4A 3A4YA 3OC0A 3TIVA 2C2MA 1X13A 3WWZA 1M6EX 1R4NA 3RHTA 5HUHA 3OLQA 4JSTA 3UMSA 1PFVA 4EF4A 5B1HA 5DM60 1CXZA 1NJ2A 2FFBA 3DDZX 3HEAA 2H0RA 4N3GA 4CIWA 2CEAA 1U81A 1QHHA 4LS3A 3KAPA 4DG5A 1A9SA 1TKAA 4MUKA 4DQVA 3G8AA 3HGTA 1HY3A 2V5VA 5ALXA 4D79A 3LW8A 1M0TA 1JL3A 1W52X 3VC7A 2F43B 1SC9A 2BIFA 4HB4A 4ZZ1A 2A3NA 4QXRA 1NOKA 3E9EA 3LBAA 4A0FA 2NO0A 3FBWA 4OUKX 5T6BA 3SDZA 4EHAA 2FPIA 1C0LA 5CG1A 3GIDA 1PWXA 3W2HA 3OTWA 1M34E 4QGAA 4P6VF 4HLDA 2J9RA 4CV3A 4JI4B 1P73A 1EVEA 2D1SA 2PSHA 4G9GA 5D01A 2YHAA 5H82A 5JAIA 3FMVA 3G13A 3NG1A 5EJ6A 4DLRA 4OHWA 1WKCA 5EXEA 3DWFA 1WMSA 2MR5A 2ZYWX 3VU8A 1EWRA 1QR6A 4GX0A 3IEUA 5LXTF 3SBDA 3U16A 2FFAA 2JFBA 4JQSA 3W2GA 4DMCA 4FYHA 1A4UA 1Q92A 1E6KA 1WB6A 3CLRD 1QH1B 4JBLA 3AEKA 3N6RA 4POAA 3AUXA 3LD9A 1FFXA 3OE4A 3SX2A 2Q4RA 2O0JA 3LUCA 1ADFA 1N33B 2WV7A 2V7XA 4H60A 3WYCA 1PK7A 5J2UA 2RCNA 1O03A 4B09A 3KOZA 4TS1A 1USVA 1DU4A 1N2CA 2CLHB 4MW1A 2DZDA 4X41A 5FR2A 3EQ8A 4RABA 1I3KA 4BO0A 2AOUA 5EIFA 4CTNA 5IAEA 1KK2A 1NBEA 3WGZA 3ENWA 4LE2A 1OZAA 2X8LA 4LIPD 5J2TB 3CUTA 2XCTB 4QGSA 1V41E 5DGDA 2NU8B 4I5DA 4EUNA 4PCVA 4IINA 3SSMA 1AT1A 5B7NA 2C9MA 2JFZA 2QP3A 4LMBA 4DR1B 1GPMA 2I34A 1UC9A 2Q5EA 3EBLA 3BWCA 3FF1A 4JSYA 4YDHB 4A1FA 2P2YA 1L5RA 4JR2A 3SXJA 4RF2A 4KGXA 2R44A 3STTA 4QBFA 3CPEA 1O95C 1VRVA 3FUWA 1HGXA 5G0TA 3CVVA 2WAOA 4QHSA 3GN2A 1OU4A 3KWFA 1QV7A 1QV6A 3M5DA 2H1OA 3M2TA 2BRUA 4P7FA 4EVSA 1JTEA 1SZCA 2ZITA 5IABA 4GYKA 2L42A 2JFNA 3U4GA 1VG9B 3U9TA 1OE0A 1P4AA 4YQFA 3FHLA 4HX2A 3DBOB 4OMUA 4XD2A 1XE3A 5KHLB 3EMBA 3F0TA 3G9QA 5B1DA 2EP8A 3MTJA 2IYTA 1FFGA 4FKBA 4DNFA 3NNNA 3T1YB 2GUWA 2IC5A 3RIYA 3VKGA 1Z5ZA 4EO4A 4IXNA 2EBFX 5J40A 1DFIA 4I5IA 3PC6A 1K9SA 2GBLC 1Q0QA 1NZDA 1DELA 1X74A 2X1MA 3LA8A 1DO0A 1Q0LA 2HQOA 1R6UA 5AOCA 1WZ2A 2WFZA 3LPCA 1YGPA 3O4HA 1CRPA 2GBFA 1K9VF 4LF5B 2FSSA 4ZDWA 3BXZA 4P2BA 4UU1A 5ULLA 1W88A 3AHEA 5F2NA 5HFAA 3R5HA 4HDAA 5B12A 3PK0A 3L4JA 3DOEA 2B0JA 4M8KA 4R3UC 5LWQA 2AV6A 2X1VA 1NZFA 2AS0A 2W2KA 2VR1A 4FW8A 4Y6GB 2YJGA 5KYWB 1WHTB 3FOBA 4RC9A 1UCFA 2C4HA 3T4XA 3AEUA 5HIIA 2FYTA 3FIUA 3OBBA 2DPYA 4G1CA 5EZQA 2V55B 1C9EA 5IDYA 2BHNA 2BEWA 5E4FA 2NQ8A 4P83A 1AZWA 1E92A 1V7PC 3I1JA 3TQQA 1R50A 2VO1A 2EZUA 2Y67A 4EUSA 2DHEA 3VUFA 3MTQA 3SOZA 3ILSA 1A5TA 4OHPA 5CIQA 3TQCA 3C4QA 2RG7A 3OWXA 3JATB 1SUFA 3ISJA 1E9DA 4R81A 1QRDA 4UM8B 2JAWA 2HGSA 1ONOA 4GNKA 2AUNA 2IZZA 1RXUA 1LSUA 3A0UA 1F2VA 4CG2A 4ESOA 4IFBA 1TLTA 3DDUA 2A9RA 2I62A 2J3QA 4I55A 3ZZTA 4YV0A 1CUWA 3DQPA 1NU8A 5JDCA 1YBMA 1F8YA 1KOFA 1UMCB 1QVVA 2DE0X 3QKUA 4FE3A 3ZW9A 3VDNB 3ESRA 2R86A 2PMBA 1WUHS 3DOCA 3FOAA 1VE5A 5CDUA 5D00A 3VKFA 4N6GA 3OEHD 4U00A 2QTFA 1MA0A 1FNNA 4A8JA 1BMFA 4S04A 4Y2GA 3VOBA 1B0UA 1E3WA 2XZDA 3C5HA 3OIGA 1QONA 5GVRA 3SX0A 3UFXA 1JDBC 1UAYA 4M86A 2I4OA 3PPXA 2P4QA 2DQKA 1KFEB 2J1LA 2W37A 3L7LA 1FBTA 4BX0A 2ET6A 6REQA 1QZ3A 4Q9DA 4H4DA 4B9EA 5FTWA 2WUVA 4UHBA 3CIOA 2COUA 1Q3TA 4J07A 4HMPA 2VEDA 3UT5A 3SHWA 2JRCA 2I91A 2I6SA 4JL5A 4BQOA 5DT9A 2CNLA 5E1BA 4B6OA 2QIPA 1IVYA 1E2MA 3C74A 2IYFA 1RP1A 2AR0A 5JQGA 2ZATA 1G4AE 4IS3A 1WOMA 1UXJA 2HO5A 2C31A 4J03A 1P1CA 1DHTA 1GPBA 2AFRA 1U8CB 1QG4A 1YB2A 2FEKA 1YJQA 1YZKA 2XBLA 4G07A 2F9FA 4KXNA 5EJFA 2Z04A 3HKDB 3ZIDA 4YHHB 4MAMA 1C9YA 3D5QA 3O83A 3PJFA 3B3FA 4JEUA 2CXOA 4H3HB 1AMUA 2M1XA 3CO5A 3HV0A 4NI5A 1XVAA 2GAFA 3O4IA 2MINB 4MR9A 2HY7A 4L9RA 5IMBA 4YYZA 4GBGA 2NTNA 5JNTA 4D82A 4XJXA 2HJRA 2X86A 5G1OA 5AJZA 3OZXA 3GOQA 3HU5A 1XKXA 1LDBA 1VHTA 3BSWA 1A98A 2QMOA 2PJUA 5L3ZA 1FMCA 2AE1A 4PYIA 1R8QA 1EGVB 2UYOA 1ZRNA 2EFEB 5TQVA 4E30A 3HGQA 2IH5A 2GPNA 2UYYA 2RH8A 3W6OA 2H0QA 3EEFA 3GJ0A 3RWBA 2JGJA 1ODCA 1NVTA 5EHGA 2FRDC 1NJ1A 1CE8A 3WY9A 5AK5A 4PXSA 4B0PA 5JUWA 2FFJA 5CUQA 1J0XO 3MG9A 4ZYLA 1K06A 4CPDA 1W9HA 1V47A 3UUEA 1DQRA 4XGIA 5EFOA 1EEXB 2WT8A 2G0AA 3V48A 2DCUA 5I7OA 1FU4A 2PX6A 2HM7A 4IFEA 5JH7B 3BGWA 3IHTA 3W2TA 4CT5A 1TD9A 1JQEA 1L7QA 3L79A 1J21A 4J2TA 3A9TA 2I9PA 4O5AA 3USES 4OLBA 4R69A 4WOPA 1OSNA 3TSWA 4AWBA 4EO9A 1MD9A 2C97A 3I1FA 2QXYA 1GGMA 4V1CI 3UMBA 4D9CA 2O8DA 1YQDA 1E1KA 1ZM4A 4FCTA 4KQHA 1IOZA 2JEZA 2WYVA 5BV2P 1CEEA 4Z7QB 2XWQA 2P5YA 1VSUA 3CMCO 4NFSA 1EP1B 2G1AA 1NSTA 1T1IA 1ZN8A 2GM9A 3ECCA 3O94A 4CKBA 4K6OA 1IK4A 3BK1A 3ZG6A 4HVCA 1BEUB 2ZYGA 4F6RB 1SG9A 1I01A 2OV2A 5CIWA 4ZMBA 1UKZA 1Z2NX 1QHGA 1UXHA 4HV4A 4YR7A 1KHHA 4XJVA 5EVCA 5BSVA 1QIKA 4MKIA 4G1FA 5NLLA 1E5VA 3JQ7A 4KDEA 2A35A 2D7DA 1LTQA 4Z86A 2A57A 5TQJA 1JLLA 1SUEA 2FPGA 2YVAA 2VAVA 2PUVA 4X6YA 1DZIA 1Y1PA 3AJ9A 1GL7A 3PQ5A 2VSXA 4LF7B 4RTQA 1CY0A 2ZVJA 4JI7B 2QE6A 2JAUA 4U63A 3OQJA 1L8OA 4FOLA 2WD9A 3GPBA 1SRQA 3WJ7A 3I0MA 2YV4A 4A0GA 4HUTA 4Q7QA 1L5FA 2OBXA 2G7ZA 1NPDA 4Y1EA 1UIMA 4ZPXA 5ALLA 1T0HB 4ZVLA 1MJNA 3OE7D 3OTQA 5LZ2A 4Q82A 2GETA 2XT9A 3SQDA 2B82A 3SSAA 1NF2A 2ADOA 1UODA 3VX3A 1Z6GA 2OENG 2J7KA 2VYVA 3RYHA 5IEBA 1QYWA 1VPVA 1H3NA 2NO5A 3EXG1 2ZG6A 1HETA 1X15A 2BBWA 5JZ9A 1D4OA 4PZ9A 4G8BA 3SVLA 1O6ZA 2YINC 4Q7KA 4CN9A 2PFKA 4O4IA 2UUPA 1WHSA 4G1VA 1WSDA 2ZIWB 4P3OA 2GB4A 1YZVA 3L8YA 2WU8A 4B3DA 4WBNB 4BNIA 3OLXA 1AKQA 1KVQA 2EJWA 2B9VA 4Y2QA 2Y4OA 5AHWA 5CLHA 5AK4A 3IR5A 1Y42X 4UXIA 1KO7A 1SCQA 4RUKA 2OLEA 2YV2A 4GSLA 4LYYA 4BNDA 3SEFA 3MGCA 4WNAA 1RAIA 1WMEA 4JUIA 3CRRA 3PFBA 4MQ6A 4AIRA 4D6XA 2IEDA 2R1VA 3KOXA 4G5QA 4WLFA 1R4ZA 1K8YB 3F74A 5E1MA 5AQEA 4DMRA 2VRNA 2XXJA 2O05A 2Z1DA 1P18A 1TVKB 1TZMA 2AEMA 2VPQA 3BOSA 3TLAA 2V3VA 4FNAA 2QMHA 4YASA 5EQJB 1BQ4A 3RSGA 5M2QA 1P0MA 1WW8A 1NVGA 4QQKA 3ZBQA 5JAZA 1M0EA 4RDCA 1UOPA 3ANYB 3KZXA 4NLLA 4P4LA 1KNXA 3VU1A 4DNPA 2K7FA 3FPCA 4RD3A 1Q21A 4I1PA 2FPLA 2CNWD 2H7YA 1TQ2A 2JJ2A 2QORA 5DHPA 1I5RA 1NXOA 2WTMA 3DO8A 3SZUA 2VDJA 3W8RA 3ZU3A 1SXPA 4YHBA 2AJLI 3CEPB 1MA3A 5FNZA 1DAPA 5CFMA 1CG6A 2ZT7A 1DBRA 2IV3A 1JQLB 2QLNA 4I50A 1QHNA 3O8OB 4R5HA 1IBSA 3OX3A 2AQIA 2QZZA 1XTSA 4A82A 4J8PA 5KNLA 3AEYA 4OV6B 3PHJA 4I9GA 3RAEC 4MUBA 3EDMA 4IZHA 3RIXA 4K8RB 4YQZA 1UPXA 4QYIB 1RLIA 1EK0A 5EIWA 1HEIA 4NOMA 2PUDA 2WIKA 5SYMA 1EE1A 3CPJB 3DE2X 4JYAB 2PS9A 1OOEA 1Y6QA 2X7HA 5HSGA 1D1QA 1C1XA 1U5AA 1U5BA 3TXAA 4EH1A 1L4BA 1QAMA 1ZOIA 2EWVA 2UU9B 2LP4Y 2O06A 1Q17A 2AR7A 1PWZA 5M34A 1ZI6A 2X14A 1RWXA 3FAZA 2CNKA 2IHZA 3RVRA 2YS6A 2H1LA 3NR2A 1ECFA 5DHSA 2GKSA 4CIXA 3EBPA 3U7IA 1D5CA 3GIWA 4YRIA 5EKXA 2HB6A 2PS1A 4N3NA 4LBZA 4R6XA 2QD2A 4MVJG 4A5SA 1JSXA 5E6SB 3ZI4A 4L9AA 4QX6A 1LRJA 2OCXA 2EBHX 1MCZA 2IP2A 1DDGA 1G5FA 2R6FA 3EZ2A 3KQWA 3Q5DA 5K3DA 4GT1A 3HV2A 2SKEA 4JC0A 3TNJA 4KVAA 5ENDA 4PCLA 4KXLA 3KPWA 4ZRNA 5FULA 3RKRA 3UK6A 4BLSA 4DV0B 2AXEA 5TDHA 2DFDA 2PCLA 4FZ5A 1Z29A 3JPYA 2QWXA 3KB2A 3PE6A 4CU2A 4CEJB 1ITZA 1LLCA 5KYGA 4X66B 1BGXT 4NZYA 2JBAA 3MELA 3N3AC 2I22A 1DKQA 3MB5A 2QEQA 4H4EA 4OHZA 2BEUB 2RGYA 4UUOA 4BV9A 2DBZA 3K70B 3ESBA 1W34A 2YHSA 3EMKA 4QIHA 2R96A 1QKJA 4LOLA 3HXQA 1JWAB 3OX2A 2EP5A 3GA0A 2FXVA 3BULA 4MMXB 3NP7A 2P27A 3QFFA 5KNDD 4B3BA 1D0VA 2AG8A 1Z88A 3BH7A 3AKEA 4URWR 3MMNA 3QXSA 4FMCF 2CLKB 1ODSA 3WV4A 2JLRA 4ALJA 4CDRA 1G2OA 5IHXA 5F98A 4KHPB 2WTAA 4JMLA 1HDEA 8LDHA 3CH5A 1PFGA 4AG5A 5P8WA 1U3VA 3A1VA 4XYEA 4ZV4A 3VNUA 1MZPA 3K2BA 4ENUA 2A1TR 2AXPA 2OG1A 3BRWD 4FEGA 4W63A 3UANA 4CKCB 1PR5A 3ENNA 1I80A 1FTQA 2ZTHA 2DLNA 1C50A 4J0KA 4PY2A 2QN1A 4QUDA 4UM7A 1EDBA 1QK4A 4MP6A 4Q1FA 1MFPA 4QARA 1IQUA 2V7QD 3HR4A 4ND8B 4IVQA 4TTSA 1LDYA 1H8HD 2ZYTX 3I9V6 1OLSA 3ASUA 1TTHA 3DC7A 3L8FA 4ZDKA 3OOSA 1WG8A 5A9RA 5BQ3A 3TLGA 3DKPA 2G3YA 1X1TA 4EP1A 3NAQA 3W2IA 3R6GA 2F3QA 4FGKA 1D2MA 2W2VA 4QM6A 1J23A 3WKBA 1FZQA 1N6RA 1N0WA 2WAMA 1A9ZA 3K31A 4NK5A 1G2QA 1U6KA 2W6JD 1QU2A 1BMTA 1TM3E 1CIJA 4ZOAA 1L1RA 2AI1A 4YRAA 4HQLA 3TM5A 4Q4DA 5HUQA 4MJ3A 2VJCA 1T2VA 3TIGA 2BWJA 3GFFA 4KZPA 4XXHA 5HTOA 2FW1A 1O5IA 1A7KA 1V5IA 3Q9LA 2P5TB 4BMNA 1RW4A 1UJCA 3GCWA 3H1AA 2WZQA 4RF3A 4TZTA 2PMKA 5CX1A 3ZVRA 2NYUA 5E3HA 3TSYA 1JZQA 3MCZA 3DMHA 4EHKA 2H52A 2EKLA 5EKUA 5HGJA 1ZICA 3O0TA 4UNQA 1WDMA 4BZPA 4NZZA 2O1EA 3IAFA 3RSFA 3STVA 3WIBA 2VLBA 3ON5A 2XQGA 4YRTA 4DPMA 3C3CA 1YE5A 2YOGA 3CZQA 4D98A 3D64A 5AW9A 5TE9A 4DR5B 3P45A 4UHHA 2YWCA 4KFTA 5E6UA 4J7XA 1HA3A 3NW9A 1BJKA 4D5EA 4GPD1 5ADWA 3NAGA 5CYFA 5FBWB 2Y1FA 4CFYA 5C34B 4ZYVA 3OQOA 4YN3A 5FTKA 1KFKB 3N39C 4MWGA 5HCNA 3A7DA 2QMQA 1V1MB 3A58B 1HC7A 1T9ZA 4K1LA 1VZ2A 5ESXA 4AUMA 1XPJA 4YRMA 5KPDA 3ERCA 1KIMA 3BQMB 4JLKA 5A4KA 5KJCA 2REQA 1KI9A 3C6KA 3F5QA 3H0EA 1YZLA 2AMFA 2DFNA 3LUHA 4X90A 4CLEA 4EW1A 1X1CA 3QXHA 4WOBA 3DAHA 1KBOA 3AF5A 2QTNA 4S0XA 4HYQA 4JOQA 4BDSA 2GVNA 3CJRA 1TO2E 1XRQA 3WL8A 3FPGA 1NPTO 5TQ2B 4C6TA 2OGZA 3UHPA 5J63A 4AS1A 2Z30A 2I33A 3WNVA 3KAQA 4K40A 1QS0B 2C8LA 3A6FA 2QN8A 5EIBC 3LQ2A 2XB9A 2RMKA 4UATA 5TJ9A 1JKJB 7YASA 1SKMA 4E15A 5L45A 3MJEA 3L8CA 1Z6PA 2D5CA 4CMGA 4WK2B 1PFUA 1JP7A 3PUKA 1IK6A 3GX1A 3R0JA 3UV3A 5JZOA 3DA8A 3EZ6A 2BGTA 4P4UA 2XA2A 4NK4A 2C9ZA 5FV4A 3IBTA 3HZOA 4RKRA 3DXYA 5LBIA 4FCVA 4RDHA 4C4AA 1M2OA 2GK3A 2ZZMA 4KPFC 2RE8A 3CH7A 1Y6JA 3HDTA 3AUYA 1N9ZA 3WHLA 1H8EA 3BTUA 4IJQA 2WU3A 3EN0A 4D6YA 5ALVA 3H7AA 5I51A 3MRVA 5I9TA 1NI5A 4DLVA 2P77A 3WBBA 3FRHA 3CLUD 4XWOA 5I7VA 2GASA 1BVRA 4F8EA 2NO6A 1D04A 3RC9A 1W36D 3OU2A 1V26A 1FYEA 1GKIA 4KXUA 5TRTA 5JCXA 2RHCA 4TSKA 5HTKA 2MMCA 3U3OA 1FSGA 4DSTA 3EXFA 1CR6A 3K20A 3R44A 4GVPA 1CKEA 2EJCA 1M1NA 3LBNA 4ITVA 4RELA 3C24A 5FLYA 5LP6C 2A0WA 2PKEA 4IGEA 1QNLA 4PTZA 3OD5A 6Q21A 4KDCA 3SY8A 2Z57A 3FBGA 3LC7O 5LDDC 2W6QA 4BO7A 5IT4A 4MW2A 1OLSB 3QEKA 5IN4A 1CEQA 1I3LA 1MC4A 2Q2QA 3K16A 4KGZA 1J1ZA 2E37A 1U9ZA 2O5RA 3CVXA 2W6IA 1KGSA 4M36A 4U7WA 2NXJA 4E5KA 3LYHA 2YXBA 2NTEA 5IANA 3Q40A 4ZAGA 2O52A 3ZGVA 1L4EA 1TA4A 4DCJA 2ZJ2A 2FHSA 1MB3A 2GZAA 2Q3DA 4OAQA 2VYVD 1UBGA 1WL8A 1XV5A 3K1JA 4G0QA 4Y2VA 3WLFA 4WKGA 4B76A 4Q9IA 3K70C 2ISQA 1UBLS 2ZDHA 4QPDA 2AKAB 1TXGA 4JBIA 2BFBB 2I1QA 4N03A 3ZS8A 2ZI9A 1UXGA 4R7ZA 1P1BA 4EMSA 1RWKA 1E63A 1M6HA 2HSDA 4KIFA 1DEHA 4PU0A 3O3CA 4BRSA 4YMWA 2WHQA 1S3FA 3HB7A 2YJ3A 4RGVA 4Y2UA 3AF3A 3B9QA 2YVQA 3A1DA 4OL0A 1VLJA 3KOOA 3BFPA 2HK7A 2FSVA 2XIQA 1A9OA 2WHPB 3IILA 4MDEA 3IUYA 4FPXA 2JKVA 4D8TA 4DIUA 3K8QA 2SBTA 3PZRA 5ALIA 1U2SA 1CUSA 1MXFA 3R20A 3UAWA 1X3SA 1V16B 5ERGB 3STUA 3U4QB 1LBIA 4B40A 1OY1A 1KKUA 2JIQA 5L3SB 4O29A 3GLIB 3ZGXA 1K6XA 3BD6A 3I6QA 2YIMA 1G3QA 1QP0A 3VXKA 1O95D 3MINA 1CX9B 4P3NA 4ZQGA 5JTUA 4TLAA 2VIIA 1QKIA 1QQ7A 2PDAA 4ASUA 4DV6B 1Q84A 1OX4A 4UBIA 5ALEA 3KHSA 5HDBB 3EG5A 5E9JA 4DMMA 3B6MA 1CVRA 1X7WA 3LYAA 4UBLA 4W5JA 3L0CA 1J4AA 1JMVA 1TZJA 4RFSB 3HUFA 4CLOB 1DV2A 3IJEB 2D8MA 2OK7A 1IXRC 2A9JA 4PLPA 3USZA 1BCSA 1GTG1 1RCTE 1T5SA 1H2XA 2DLDA 2O7QA 1CBUA 2PM8A 2WNSA 3GXOA 1T2DA 4HFNA 4IF6A 3OZUA 3X2EA 3SQWA 1JHQA 3ENKA 4EATA 1A9QA 3KQLA 4E1VA 4LSMA 1KK0A 4M1WA 1E4EA 1PQ4A 4GUAA 1HNXB 3PFWO 1SM4A 2IUSA 5IF3A 4PLYA 3KT0A 3ILYA 3JX9A 2ZQ5A 1O4VA 3JWJA 2NVBA 3NM6B 3OJLA 2E6KA 1LKZA 3K94A 4RY2A 3D4BA 5DWVA 1OGJA 1UPBA 3PNVA 4AK9A 5LOVA 3OM9A 4CE6A 1KPGA 1Q12A 5ESDA 1B8UA 1ZSNA 4RD0A 5AKJA 3FCUB 2D4AA 3Q6NA 4BFXA 2P9QA 4B33A 4HDOB 1TA0A 1BXKA 4INPA 4PAGA 4MYRA 4BP8A 4C20A 2QZ9A 5A4IS 2OHGA 4LKOA 1XA4A 1T35A 2YZ7A 5D5HA 4P5PA 3IX7A 2VCEA 1XAJA 1DIRA 3HUDA 3JV7A 3DLTA 5TNXA 4LZZA 3SEAA 5C1DA 1G1MA 3HBJA 4KXWA 1U9JA 3GR6A 4DDHA 4LF8B 4B4VA 2GAOA 1CFJA 4QSHA 2E5WA 2IELA 3BJRA 4JP3A 2ZJ6A 4YK7A 2PUEA 3DE3X 5D3QA 2WIFA 4RV5A 5ADVA 3O4JA 2Z8XA 3ZE9A 1MJFA 1V48A 1FVFA 3H11B 4D97A 3ANNA 5I9BA 4ZI7F 4EG3A 2CCGA 4RKYA 4O8ZA 6AT1A 3FW1A 3CE9A 5DNEA 2ZU6A 3L6CA 1RYFA 4J3FA 3BIWA 4C3OB 4E2WA 1FL9A 2OXFA 3FETA 3N8IA 2WYIA 4ML3A 5DMHA 1Q7CA 2IWHA 1GL3A 1R64A 1ISFA 5GONA 3LBYA 4LJ7A 2PTHA 3LHDA 3ECSA 3K0FB 1W25A 4BOYA 5M7EA 5A6VA 3TLMA 4HDRB 1KQOA 3H4TA 4BX9A 5JSUA 3E1SA 1SVLA 2A5FA 3JR3A 1AD2A 3GMIA 4EVIA 4Q19A 4XB2A 4UCQA 1JR3D 1YBHA 2EAUA 5HF5A 3FZYA 4U2FA 3OMLA 4REOA 5F7JA 1Z33A 4WXHA 3TAUA 3ZZMA 3OCCA 5DNYB 2BHTA 2RGBA 4Y18A 4CHTA 3ILHA 4B43A 1JAYA 2Y1XA 3AV3A 4O4HF 3BBLA 4HLCA 3GLSA 1DC5A 5J5VA 2WP0A 3LFHA 3FWKA 4H0FA 4EA8A 1U3UA 2V4MA 1NG9A 2IXTA 3FWHA 2I3ZA 2WIAA 3QXJA 3ZY4A 3FI9A 3U7HB 1IPEA 4H7JA 3UGTA 5IXJA 3TFWA 3T1HB 4WXYB 3GAAA 4EO7A 3CR8A 1QIGA 1WBJB 2XNCA 3EAQA 4EYKA 1I7NA 4KN9S 1DAEA 4C5AA 4HDRA 3QFSA 2P9BA 1OFHA 2E49A 2EX1A 3HSYA 1PI3A 2GD1O 3AILA 4HFMA 4I3FA 5FI5A 3EOZA 1JBQA 2I8AA 1E0DA 5DNUA 3AB7A 4MIEA 4Q34A 2VHWA 5T64A 3LLMA 1V43A 4X1YA 2WJ3A 2D8AA 4KQIA 2JDID 3VGJA 4DVJA 5I01A 1DHRA 1YL7A 2JVJA 1AXGA 3ZZ0A 1XTPA 3M6LA 5ILOA 5IT9A 3INNA 3NBAA 2RGRA 2YZKA 1LK5A 4R2XA 1X87A 3TPZA 1FXWF 3EZXA 3NUQA 1IZ8A 4Z6KA 2PD6A 3HJFA 3EIFA 3U3XA 3KB1A 3TL3A 4EB6A 1Q5PA 1SHKA 3CH4B 2VTBA 1R37A 1V3UA 1V5GA 2ODEA 4L72A 4FTWA 5AK0A 3U6KA 3ZY3A 1NMYA 1PUIA 5CDYA 2H0AA 4WXRA 2HJSA 4HN2A 4EW6A 2Z0MA 4D02A 3VZPA 3K8OE 3BWXA 5CYOA 2P2CA 1QCCA 1GCUA 3VSBA 5IWCA 1V11B 2VSFA 4OI1A 3P0FA 1UAGA 3FPBA 1VSTA 2H1VA 3EBOA 5HZGA 1PGPA 1FDTA 5LDHA 1QZUA 1XOIA 2PYDA 5I9LA 3O3NB 4NBSA 5EKDA 3L9WA 1ISSA 1SU7A 2FW6A 2MSDB 1PS9A 4C89A 1JNXX 1AB6A 3C5EA 4RXTA 1A95A 4MJLA 3OCXA 2OZLB 1L6RA 3BA1A 3LJKA 4ONEA 1P7VA 3ABZA 5C1OA 4B6RA 2O3UA 1SD1A 1TTQB 2Q3CA 3GD7A 3SEQA 1P0QA 3GEGA 5SY9A 1Y5LA 2PKQP 1IAVA 2VAXA 3C3XA 3GRCA 1OMOA 3O7MA 3OY2A 1W46A 4M9CA 4Q9AA 1EWKA 1A2KC 2FN3A 5D1NA 2X4LA 3HBMA 3L6OO 3LVQE 4D0RA 1Q3HA 2LVBA 3GG2A 4KC0A 4GRAA 3KLPX 1P2VA 3FYUC 5B3JA 1X19A 1EQUA 2A58A 4F4HA 4FUTA 2IS6A 3PNKA 4ZOLF 4CM8A 4H7FA 4LOKA 3GDWA 1LY1A 1BE0A 3I42A 1JEQB 3VO9A 1ZRHA 3D6JA 3R75A 3VI3B 3M9XA 4G4JA 1JHMA 4C3ZA 4D9MA 4E5VA 2WUDA 1U7UA 1FYWA 1B3BA 3N2GA 3QENA 5HMMA 4CR7A 2J3DA 1CR1A 3AJ8A 5G41A 5LCXA 4BZXA 4EELA 2XJ4A