2J59A

Crystal structure of the arf1:arhgap21-arfbd complex
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
165
structure length
165
Chain Sequence
GSMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGLDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ADP-RIBOSYLATION FACTOR 1
publication title Structural Basis for Arf1-Mediated Recruitment of Arhgap21 to Golgi Membranes.
pubmed doi rcsb
source organism Mus musculus
total genus 59
structure length 165
sequence length 165
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-09-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2j59A00
2QAGA 3W6OA 4GPTA 1E79A 1JR3E 2Q0HA 3W5IA 3QVUA 1KJZA 1Q1BA 2F3RA 4PPFA 1YZTA 2VSFA 4N1AA 5DISB 3THYA 3RRNA 2IYLD 2YV5A 3GP8A 3X1WA 3K0EA 3DKPA 4ZI2A 4JVSB 3ZZTA 621PA 1EFUA 2QPTA 5GJVC 3W6PA 2AK2A 2Q9BA 2XEXA 3VR6A 4DLVA 4LPKA 5JJLA 1ZAKA 2WSSA 4D0NA 1AGRA 2V55B 4WAUA 4ABYA 4HLUC 1BH2A 1DO0A 4FWTA 4B33A 3AP2A 5FUXA 2BM1A 5KTYA 1PVOA 1E0SA 4A2WA 4MA4A 1P60A 2YYZA 3AKDA 4CW7A 5FBQB 5TMPA 1B0UA 3QSYA 5DO9A 4EPVA 4P4SB 2GHIA 5LB2A 3TJZA 1SKQA 4A36A 2IS4A 4G3XA 4CEJB 2H16A 1JB1A 5FTNA 2VF7A 2WJGA 3KQUA 1XTJA 4E09A 3KB2A 4TZ6A 1CS4C 1FZQA 1R2QA 1TQ6A 2DWQA 4LUCA 4YDSA 4ASUD 1OB5A 2ECKA 1CLUA 4Q4HB 4U00A 4B43A 2OILA 4US1R 2O8EB 4M0LA 4ACBA 3FHCB 5CM9C 1G8YA 4HLDA 4LBWA 1IN5A 3DZDA 2D4HA 4LCBA 1UF9A 2FF7A 1KOFA 1US8B 3VNUA 1NI3A 2ZE7A 4ZIRB 4LV6A 3CWZA 2GKSA 2PCJA 2W0SA 3RS3A 2GCOA 5JCPA 4U5XA 2JGNA 5LD2B 3IBGA 3LBIA 3CR7A 1TU3A 1D2MA 2R62A 4RD6A 2RGAA 5BYJA 2WAXA 1NN5A 2VP6A 1CXZA 1G1MA 4TMXA 2WJIA 3OIWA 1YZUA 3ZGXA 1TUIA 5IK2D 4WBSA 3BH0A 1KSGA 4ILEA 4NCIA 1IXZA 2YKGA 3NIBA 3ICQB 2XTZA 3TQCA 2Q9CA 4B35A 1Q22A 4DEXA 3F5FA 2P65A 3GLFB 4XVRA 1TQ2A 2NPFA 1E9SA 4LYFA 1EFRD 1N6KA 2XSZD 5TDHA 3FHTA 1QDEA 2F1RA 2OG2A 4EIWA 1AGPA 1GVNB 2JEOA 3NH9A 5KSZA 4Q5IA 4HDCA 1G7RA 1W46A 4XSHA 1AZTA 4YMUA 4YMSA 1JAHA 3AP3A 5J4VA 1MABB 2FPLA 4JJZA 2CNWA 1KMHA 1D6JA 4DSTA 1KY2A 1SXJC 4OQXA 3QIAA 3SHWA 2OHFA 1XCMA 1XPRA 5L3SB 4XWOA 4WVFA 2PMDA 1W36D 1ZYUA 3CW2A 4GOXA 1H8EA 4Q9IA 3W3ZB 2P2LA 4GDFA 4TLDA 4A4DA 3E5HA 2WWIA 1F6BA 4NYMR 3BE4A 1ESNA 1TMKA 2HYDA 1DS6A 1S9DA 1NBME 4K81B 1SHKA 4KV9A 4BGDA 4KYIB 2XGJA 2CLDX 1GL9B 1OSNA 4M9ZA 4HLQB 1CU1A 1E2JA 4Z1MD 1ZM7A 1MRNA 3PEYA 1U8ZA 1XEWY 4GOJA 1OPXA 4JVMA 4I1VA 4Z51A 1YR6A 3GLIE 4Q01A 2HV8A 2ZJZA 3A1UA 3DOEA 2EFEB 1P61B 3B5JA 4OI2A 1E79D 3PFIA 2GXUA 3IEUA 4OQLA 5CB8A 2ZRIA 3ND9A 4BE7B 2MSDB 2O52A 3FTQA 4B76A 3DHWC 4AKEA 2RHMA 1PJRA 1NRJB 2P6NA 2JLZA 1JAIA 3UK6A 4MYUA 2NIPA 4DIEA 1TPZA 2ANCA 5FI0B 4MGIR 4BZPA 2QEQA 1VTKA 4PZLA 4ESHA 4LC1A 2ZRDA 4QBGB 5KO2A 1NBMA 2C95A 4QM6A 5JI2E 3LBHA 1P6XA 3K9GA 4QGHA 1UKZA 3VX4A 3WBJA 4HAXA 1KK0A 1S2MA 4HDQB 4TLEA 1M7GA 2RGEA 3QKUA 4NL4H 1ZINA 1YR7A 1WA5A 5KSOA 3GLIA 4POAA 4LJ8A 3LQRA 3CRQA 1TU4A 3LVQE 3AVYA 1SVWA 2A5JA 2CLSA 4MDFA 3QKSA 4IVPA 2BCGY 5D3QA 1CR0A 3FYHA 3REGA 2V4ZA 1EXMA 4CF7A 4D81A 1M7BA 1XWIA 3O8DA 2OUKA 3AV0B 1JI0A 4D4MA 2F43A 2GXAA 2QTFA 2IUUA 4DRZA 2EU8A 3LY5A 4MYHA 5IHPA 3X1DA 2FPKA 3MAAC 5KHOC 1J99A 5BXQC 1NF3A 1HTWA 1G3MA 3MJHA 4XWAA 1DPFA 2ZE5A 4Q7LA 1IN6A 1ZM9A 3N5CA 2X8AA 1R0XA 2GETA 2YOFA 4HAUA 4NYMQ 2ZUCA 3KKNA 3B1VA 2XITA 4A6XA 3HU1A 2IYWA 3A4LA 4HB0A 1CULC 3MD0A 1KHTA 1O87A 2VP0A 5E7MA 3LBNA 3RHFA 3GJ4A 5FPKA 4LHXA 1E9DA 1U9IA 3R8FA 1Z0JA 4OHZA 2Q21A 1UBCA 4F92B 3EWAA 1K5DA 3DM9B 4RFSA 2ATXA 1HURA 4QFMA 1T8TA 1ZUHA 1KY3A 3U2QA 2ZANA 2BKUA 2VP5A 5HKKD 3ZS8A 2O5VA 4MGKR 4PHFA 3SN6A 1ANKA 2CNWD 1Q44A 3GEIA 1G7TA 3KKOA 3TVDA 3EAQA 4XTCS 3GJ8A 4KFRA 2ZRPA 1RJ9B 3QF4B 1E0KA 4V0LA 1WRBA 1GAJA 2XB4A 3AUXA 2ONJA 5IT5A 1UKVY 1X6VA 5TXGA 4QC2A 2ORVA 4JLDA 4V0OA 1H8ED 4BECA 1Z0AA 3DVLA 1E0AA 3C15C 2GCPA 4G5RA 2AFIE 5FTLA 3B9QA 4A1FA 4OK5A 3G0HA 1N2CE 4D26A 3W90A 4PQFA 4TL6A 2F55A 2P5TB 1R6BX 4CT5A 3NDPA 3LDAA 3T1OA 2AWOA 4WA7A 3BFVA 2J7PA 2W2XA 1XJ0A 4KSBA 1U94A 4QRHA 2YWEA 4F93B 3KTAB 1FNMA 4MH0R 4B74A 4PFSA 1E98A 1VG1A 3AB3A 2PBRA 5FTMA 1WE2A 3QBVA 3PV0A 3A36A 1XTQA 3GFOA 4IHQA 2ZRAA 2ZM5A 3ADKA 2G0NA 4CZ2A 3CRRA 5JWOA 3GPLA 2BHRA 2HUPA 1YRBA 1Z29A 1Z5ZA 1OIWA 3UATA 1KTVA 4UXIA 2V54A 4C7OB 4P4UA 2GEUA 4PX9A 3KXLA 1X1SA 1Z07A 2ZI7A 2AHOA 3ZD6A 4D80A 1R8SA 4IDQA 3OFND 1P3JA 4JVNA 5IRCD 2G1JA 4DLSA 5JHGB 3K09C 2CHGA 3B2EA 2WKRA 3DL0A 4EPXA 1ZM2A 1YKSA 4PC1A 2J45A 4K8OA 2CCJA 2TMKA 1DOAA 2O8FA 3A1WA 2GBLC 3BB1A 2RMKA 3GFPA 4LI0A 2A5YB 2IYZA 3GD7A 1XX6A 2ZR0A 4M9XA 4DB4A 2GZAA 5EP4A 3EASA 1S1CA 2ZVQX 1G4UR 4ON9A 4FMBB 1M8PA 1XEXA 1D9ZA 4TSFD 4TTRA 4B3GA 2BMJA 2B8TA 2DYKA 1KMHB 2LWIA 1CP2A 2J5XA 2ZSEA 5AJXA 2EYUA 4M1YA 4B73A 4F4IA 1N6RA 4QJ3A 1JNYA 4PO8A 4B75A 3K53A 3WMEA 2GEDA 1ZC3A 2HXYA 4O2RA 1KK1A 2EQBA 3D6TB 4KODA 4U02A 4D0LB 3U3OA 4HLCA 4NYIR 3CONA 3QBTA 1ZVQA 2AXPA 5C4MA 1W2GA 5L3RA 3KL4A 4DCTA 1N5IA 1DBSA 2G0TA 2PLRA 2ZJAA 2CE2X 1FOEB 3PEUA 3WY9A 1VECA 4LDJA 4RZXA 1P2UA 2H17A 3AF3A 2OCYC 2ZSAA 3Q8XB 1KDTA 1RE0A 4KCGA 2R2AA 4Q4JA 1DAGA 1XD2B 3I32A 1P5ZB 3QUSA 2OSBA 1IY1A 2CEAA 2FSIA 1FTNA 5E7IA 4A82A 4C7OA 421PA 4DC9A 3Q7PA 3EA0A 1M74A 4GMDA 4RD4A 1N6IA 3SYLA 4HSEA 1M6NA 4LX0A 2EYQA 3C16C 3RABA 1E2LA 5H68A 3U7FB 2WIBA 1XTSA 5AJVB 3ZYCA 1Q1QA 4TMVA 4WZAE 4TL9A 4PQRA 3PUYA 3QXXA 4KHZA 4IXNA 3U61B 1GSIA 3CNNA 3WNDA 1L2TA 3HU2A 4WW0A 3NC0C 4NCNA 2PLFA 1E2QA 2OESA 2OFOA 3BJIC 4JLKA 1XTKA 2OM2A 1VCMA 3PG5A 1GNRA 5E95A 4LHYA 2IUSA 4FCWA 4UNPA 4NCKA 3RS2A 1OIVA 2Z43A 3IGFA 2LKDA 4EKDA 5K8UA 3IIKA 2GESA 5KDOA 2JJ8A 1SVLA 2GWHA 2EVWX 2QGNA 2GTPA 3LLUA 2QA5A 3KUCA 5FPTA 3AVQA 1UDXA 5FFMA 1G18A 3SBDA 3K0CC 1S1MA 2J87A 1G291 2H18A 4PPGA 3I62A 4LV5B 2ZREA 5G40A 4Q4HA 2QMHA 1WBDA 2C9CA 2JJ1A 3SYNA 3SBEA 5GADl 4GT1A 1H65A 2ZXUA 2O8EA 2VEDA 2DCUA 4NCJA 4EJSC 1JALA 4I1SA 4LHVA 2F1IA 4QL3A 2IYXA 1Q1ZA 1G64A 1RRCA 2G88A 1RIFA 1EWQA 3WMGA 2FSGA 1NVVR 3B7GA 2ZRMA 3MGCA 1OH7A 4NYIQ 2R6DA 4G5SA 4WOPA 3V4RA 3UG6A 2ZROA 2W58A 4DLZA 3WRXC 3Q5DA 1X8JA 2YZ2A 3SJAA 3ZIAA 4A8JB 4JLVA 4NH0A 4KLNA 1FNNA 4UNNA 5AUQA 2V3CC 4Q4LA 1DG3A 1JXMA 2ZJ5A 3MJRA 3CZQA 1OKKA 2QT1A 3PR1A 2SHKA 5FTKA 4BZQA 2J0VA 4EPRA 4UNRA 4D82A 1NMXA 1AK2A 1J8MF 1NVWQ 3W5JA 2BJWA 2H7VA 5K8LA 4Z54A 2CJWB 5CB6A 3GLFA 4RFSB 1SVKA 3EZ7A 1AS3A 1M1YE 3IILA 4Q4AB 3UPUA 1XZQA 5KDLA 4BFXA 2FGKA 2C99A 4XSGA 3EZ9A 4BZXA 2W6JD 3BFXA 3EXAA 4XVUA 5TVKA 4RJLA 1GZSA 4PHGA 3D3QA 4TZ0A 2Z4RA 3AVXA 1MABA 1E6CA 4V0NA 4DLXA 1E69A 3E1SA 1A5TA 2QAJA 4MYCA 1M2OB 3QG1A 2C5LA 3RWOA 1X1RA 3JVUA 2CL0X 3OIYA 4XIGS 5CYOA 2CVFA 5FPYA 2OFXA 3RVBA 3VU9B 4UXJA 1AKYA 2F1HA 1W47A 3AEZA 3QENA 1C4OA 2B7BA 4QXAA 4A9AA 2NOAA 3GEEA 1UKYA 2NZJA 3SS8A 2XTNA 4Q9KA 3R7WB 2J59A 1GL7A 1E99A 3T1VA 2VH5R 1MH1A 3TNFA 2EFGA 3FKSA 5J47A 5JEDA 1SGWA 2MSCB 4MKFA 4C0BA 4JLBA 2H5EA 4PZZA 2QT0A 1MO3A 5DI3B 2HCJB 2ZAOA 1JQJC 1KNXA 2IYQA 2PJRA 4E07A 3QJYA 3NEJA 4EDHA 3THWB 1ZIOA 4WXRA 4AY2A 2V7QD 4C0AC 2CLCX 3FMOB 4DLTA 1ZM3A 3U44B 2YVUA 4MKIA 2KBEA 1E9RA 4DUGA 1D2NA 1IXSB 2ATVA 3QEOA 2GEVA 2GK7A 4FMCF 3X1XA 1FP7A 1KDRA 3WXMA 4PPQA 4S35A 2ZVPX 4WIAA 1ODFA 1W4AA 1KSHA 3EPJA 3KUDA 4LWZA 2ZETA 4HZIA 1CKEA 1PLKA 3CRMA 2FWRA 3IIMA 3RC8A 4C3ZA 1G19A 3A8TA 1NLZA 2FX3A 1U0HC 1LV7A 2ZUBA 3GFTA 5CYPA 5KNCA 1XB2A 1RFLA 3AGQA 4TYQA 4FWIB 2A5DA 2A7QA 3B9PA 4TLAA 2ERYA 2IHYA 4F4JA 1Z63A 1GM5A 2BCJQ 2EFCB 1KZ7B 3ZQJA 2F9MA 4GMXA 5G53C 2DHRA 1TNDA 1XEXB 2RGCA 3OHMA 4JLOA 3REFA 3F8TA 4CVNA 1GOTA 3KQKA 2R44A 2DBYA 3TK1A 5J4YA 3QXHA 4DLWA 1TUEA 2NPIA 3ZS9A 2REXB 1J7KA 1ZRHA 1E2MA 4LOAA 5FOTA 3WYFA 2VHCA 2QENA 2VHQA 4NP6A 1R4AA 5FBVB 4M9SA 3CF6R 4JT4A 1BYIA 4UJ5A 1J70A 2ZRKA 5DH9A 3B82A 4FW9A 2FGJA 3FB4A 2ZS9A 2WZQA 1XNJA 1Z0DA 4LJ9A 2AXNA 3S1AB 1Z08A 2R6FA 1OKKD 4MQBA 1JQLB 5FBLB 4JLMA 2OE2A 4CEHB 1IOZA 5JECA 1RKBA 4P33A 4B3CA 1UM8A 2GDJA 4Q9JA 3VTKA 4B6FA 3MRSA 1T4GA 5H70A 3GJXC 4A15A 3NKVA 4JSYA 2KE5A 3AQ4A 3M4YA 1COWD 3RS7A 3SE0A 5KU1A 4M53A 4MUBA 1NLYA 1SXJB 1WMSA 1T3HA 3FFBA 4KYUA 4RZ3A 4A2QA 4X8HA 4PR0A 2F3TA 3RANA 3U5ZB 4LV8B 3AVVA 4EQ6A 3SJCA 2CE7A 2VTKA 4QHSA 5L3VA 1VCIA 3SNHA 1P75A 3A4MA 2QU8A 4RVCA 2XZLA 2IK8A 1ZCAA 1G3QA 3IQXA 1OHHA 2GJSA 2QPOA 4Q1CA 1E9CA 4Q7JB 4URVR 4KU4A 3C4JA 4HB3A 1Q12A 2V1XA 4BEBA 1B23P 2D06A 4AKIA 4HUQB 4OHWA 2BOVA 5J4LA 3GJ3A 1RJ9A 3QF4A 1OH6A 1MT0A 3RS4A 2KWIA 2H92A 1NY6A 3FMIA 1GITA 1ZMXA 2WV9A 3L2OB 3SU8A 2A30A 4TL8A 3PIRA 2QTVB 1YHNA 1HYQA 3U3KA 4JKYA 4V0MA 2BC9A 3KKQA 3ZVRA 2P6UA 2ODWA 1II9A 1IBRA 1JR3A 3R9WA 3PENA 2KSQA 5FL7A 2H57A 4MYTA 1CJKC 1P72A 3A4NA 2F6RA 2RGNC 4A0FA 1KI1A 3I4LA 3KTAA 3OEEA 2ZRFA 2NGRA 5BQ5A 4B71A 1QHHA 2KBFA 2VHUA 4GZMA 1I4DD 4D6PA 2GF0A 3AVWA 1P7CA 4N3NA 1P73A 4YMWA 1P2VA 3FWYA 1JJ7A 4D0GA 2HF9A 4KI0A 4FMDB 5HZHA 4P31A 3EPKA 5FOVA 3NBXX 3SDZA 4DUGD 5KPJA 2WWYA 5C18A 2VF8A 3BRWD 1S4QA 5EP1A 1BIFA 2PT7A 4NHOA 1XPUA 2CCGA 2IYSA 3ZJYA 2UKDA 2QQEA 2R6GA 2VO1A 4DCUA 1DO2A 5CDFE 3CRVA 1WCV1 1E2KA 1TQDA 5FUWA 3PQCA 3TSZA 2FZLA 4H9GA 1GUAA 3O8RA 2BJVA 4KFTA 2RKOA 3AF0A 1QBKC 1E9EA 3BOSA 3MWYW 2B7CA 3CPHA 4DDVA 1W4BA 3VR2A 4QNMA 3LVRE 1XMJA 3N70A 1AKEA 1LTQA 1ONBA 3CX6A 4HYYA 1W0JA 2MMGA 3TE6A 1VG0B 2ZRLA 4P3YA 4QHYA 3HYRA 1E1QA 2E9SA 1Q20A 4G01B 3RSLA 1UBFA 1J90A 2ZR9A 4M21A 1ZJ6A 4W5WA 5D3MB 4CYMA 4B3XA 2GJ8A 5TY0A 4XD7A 2QTHA 3A1TA 4ACAA 2AX4A 3WHKA 4DVGA 4ZCIA 2QSZA 4L4UA 2ZRGA 4IRUB 3BD9A 5L3QB 4DDWA 5EXTA 1AN0A 5CDFA 1ZNZA 3B6EA 3NWJA 2X1VA 3K0FB 4RZUA 1L8QA 1N0VC 1RYHA 2FV8A 2UVQA 4QBIA 3FFAA 3IO3A 5HR5A 1OFUX 4IVQA 3Q5EA 5JS7A 1NY5A 2GZHA 2IXEA 5KOYA 4B32A 4B3BA 1Z47A 2ZU0C 1W5SA 2IYVA 2CDNA 5FUVA 4BFYA 1XCGB 1T6NA 4AG5A 4C0LA 3SQWA 3BWDD 4LBZA 1XD2A 3VX3A 3QF7A 4JIMA 4KVAA 4TQ9A 4P4TA 1CJTC 4HZUA 2FMXA 2Q3HA 1CJVC 1JECA 4K46A 4LK2A 3GJ0A 4AD8A 4GBMA 2BBOA 3U3MA 3TUJC 2BMEA 3EIHA 4GI7A 3K8YA 1ZP6A 1F2UB 3T15A 1OLOA 1P9NA 3CX7A 4BFUA 5A5GA 4BPBA 1G5TA 1KO8A 1IQPA 4KVGA 4Q19A 3KQHA 2NO1A 1E2PA 2PZEA 1LVGA 1OHHD 2QN6A 2WVJA 3TRFA 1NMYA 1XEWX 4BLOA 1V5WA 4ZPXA 4DKXA 2WSSD 1GRQA 1X8KA 2BWJA 3Q85A 4FIDA 4Q1BA 1IM2A 2NO0A 1SKYB 2WJYA 3CIOA 4EFLA 2BBSA 5P21A 3A1SA 1PZNA 1CR4A 2NO9A 3NEYA 2WJHA 4BLRA 4ZDKA 4FI3C 5CLLA 2ZI5A 5KDDA 3LRPA 1FPMA 1GP2A 3SC3A 2JJ2A 5KUTA 1EX6A 3X2SA 1QVRA 2PX0A 5FUYA 4DLRA 3KFXA 4NDZA 1MO6A 2UZIR 1JEDA 3M0EA 1OXXK 2UZ3A 1I2MA 3NBYC 1JR3D 3GCGA 5FL7D 5JLJA 3LFUA 2FE4A 5JWRA 521PA 2IYTA 2ZS8A 3L82B 2J0QA 2V9PA 4FCVA 4NCHA 1KK3A 2ZYUX 5ANRB 1GRNA 2DFLA 2ANBA 3OEHA 1OXSC 4YONB 1L7VC 1EX7A 4URXR 121PA 3RS5A 2XOKA 5LD2C 4G5OA 3EW9A 4KXFB 4LSGA 1H8HA 5JFGA 2ZIAA 2N1BA 4I4LA 3QKRA 3EARA 2GJAA 3NG1A 4B3DA 2PCLA 2VIIA 2OBMA 3M6AA 1NSFA 5G3YA 1GDDA 5GJBA 4IEEA 1CRQA 2OXRA 5JJIA 4DDUA 1OXVA 1G9XA 1G16A 4HUTA 4FINA 4A8JA 2ZU6A 2CHQA 2ODNA 1YQTA 1BO6A 2WKQA 1U2RA 4A0RA 4IDNA 1KO7A 1TF2A 3BB3A 4IOKA 1Z2CA 1XCPA 3H2YA 5EZ6B 5B58C 1N25A 2CJWA 1Q3TA 5EP2A 1E1QD 2BVNA 2RGDA 4KAXA 3QQ5A 4Q4AA 1A82A 3RLFA 4NONA 4EQ6B 2EWVA 3BGWA 3E2IA 4KSCA 3RRMA 2QQ0A 4XD7D 2EFDB 4QGFA 1OJLA 1T8UA 1GKUB 2IA5A 4TYYA 2JLQA 3ADBA 3FMFA 1R5OA 2D7CA 2QORA 2G1KA 3PVSA 2HJGA 3UXMA 1R8QA 4U7DA 3U4QA 1E2FA 5CLQA 1XD8A 2QSYA 5FI1B 1ZD1A 8OHMA 2ZRCA 2R9VA 1KJWA 2N46A 3VU9A 3I5XA 2ZAMA 5JWHA 3I5YA 4OI4A 1G7SA 4QM7A 1MRSA 3AUYA 4AG6A 4FN5A 4HDOB 1G5RA 5DIFA 5HZKA 3BS4A 3WBKA 5E3HA 3BK7A 3R7WA 1QRAA 1HT2E 4ZDIA 2XNSA 1OYWA 4C0HA 1FQKA 1W1WA 1SVIA 3HPQA 2PZFA 1GWNA 1S0UA 3LAWA 4UNQA 5DYGA 1QZXA 5DN6A 4FCTA 1QHHB 1R10A 3ECCA 5DI3A 2JLSA 1LNZA 5TB5A 4Q48A 3C8UA 1NVUQ 3L0PA 1N6PA 1Z8FA 1CJUC 4DT1B 2ZRNA 4HLUA 1Z3IX 3OE7A 3THWA 1QG4A 1JPJA 2HCBA 2RGGA 4W5JA 2DY1A 3FOZA 1TF7A 2CL7X 2PZGA 3D7MA 2NO6A 4UJ3A 4ERNA 2IYUA 3U44A 2OLKA 5AJWA 1WQ1R 2REBA 2Q3FA 5KPDA 4YXWA 1F48A 3TUZC 2CCKA 4IXMA 5CK5A 3SJZA 4TYWA 4JL6A 3SHFA 1NBMD 2IYYA 4XVQA 1DTSA 2OLJA 2I3BA 2YJTD 3L8ZA 3T34A 4MDEA 3NDBB 1DAHA 3GJ6A 2PT5A 4PXAA 4C2UA 4G1UC 4TYNA 1ZC4A 2X77A 4TYPA 1A2BA 1ZD8A 4MRPA 1FUUA 5AJZA 5DHFA 5DLQC 2OCAA 1FW6A 3PUVA 2WMNB 3EC1A 5C1BA 2JLXA 1LB1B 1D2EA 2RCNA 4Y0AA 5DI9A 4CDGA 4L9WA 4RD2A 5FPHA 5LBIA 1J8YF 5BW8A 1TAGA 4EJSB 1OH8A 1XMIA 4W5HA 4TWZA 5B2ZA 3NBFA 4V0KA 4R71A 3L8YA 5BWMA 1UBGA 2ZYVX 4V02A 1DARA 1BKDR 2GXSA 1JJVA 1W36C 3FGNA 1YZQA 2V1UA 1UFQA 5DNYB 4BUJA 1SXJE 2YWFA 2OV2A 4JT2A 1H8HD 3CKLA 5HCNA 1SHZA 3UIEA 3WRYC 1DAKA 3CM0A 1IONA 1KZGB 4PHTA 5TARA 3G5UA 1QHGA 4X8OA 5EE3A 1FUKA 4YMTA 3RDPA 2J0SA 4DWJA 3I92A 4DDTA 4IOMA 4DLYA 3R9IA 2WBLC 1E9AA 3KFVA 3WP0A 5FR2A 1G7CA 1KI6B 1MKYA 2LCFA 2CVHA 4TQAA 4EFMA 2KJQA 2JAQA 2QAGC 1BS1A 5FR1A 3S1AA 3DEFA 3UMFA 4LBYA 4M9QA 2ORIA 4CEHA 2ZS7A 4HZUB 3QXJA 4TTQA 3B85A 2VP4A 4ZCLA 4D2IA 4PZYA 4DIDA 1QHIA 5K8TA 2P6RA 1DELA 4PSKA 2XJ9A 1ZW6A 2HT1A 4AI6A 4Q1DA 1DAEA 1E2HA 1SXJA 1FMLA 2RB4A 4GZLA 1E2GA 3AVOA 2I1QA 3SJBA 1TEXA 1JR6A 3G82C 3U7HB 3EZ2A 1II8B 3EG5A 3GJ7A 3MLEA 4OJKA 2O8BB 3DKVA 2ZJBA 3BIFA 4RD0A 3LWNA 3VKHA 4HUQA 2IL1A 5M04A 1G8FA 3TKLA 3VR1A 4GFDA 5DE3A 2ZSDA 1Z6XA 3IPYA 4F38A 4LRWA 3ZH9B 4D25A 4II7A 1Q21A 1VG9B 2EWWA 3F3YA 2ZEJA 2QM7A 2VHTA 1N0UA 2W6IA 3U3RA 2J7PD 4BQSA 3IDQA 3KJIA 4YMVA 3IHWA 3T5GA 3UKDA 3BXZA 5KSPA 1OH5A 1P2SA 1VCOA 2D62A 2FH5B 3IBYA 5JRZA 4KBGA 3BERA 2GF9A 2VBCA 4RCYA 2FFBA 3QKRB 4DSOA 1KAOA 2ZSBA 2PL3A 2O0HA 3F0TA 4TLBA 3LX5A 2B92A 1TEVA 3EWSA 1D9XA 4AK9A 5KNBA 2GCNA 3KDSE 2C8VA 4XWKA 1G17A 4O2LA 1HV8A 2WM9B 2C77A 5E7JA 4CRWB 1QF9A 1YZNA 4YXWD 3BORA 3I3SR 4DCVA 3PUWA 6Q21A 1IY0A 3Q3JB 2JCSA 3B1ZA 3N2IA 3DPUA 3RYTC 2IW3A 2AKAB 1E0JA 2AL7A 2ONKA 2AN9A 5GJCA 1P2TA 1U0LA 1HT1E 1GTVA 2P3SA 1VDZA 2ZYTX 4PSAA 5C4GB 3TVTA 4DZZA 4AKGA 3TAUA 1HH4A 3K9LA 2ODEA 5TV2A 3LW7A 2QMEA 2JLRA 1VYVA 2IUTA 2A5FA 4LHZA 4R2HA 2RGXA 4NZYA 1S3GA 5GVSA 2J1LA 4DJTA 2ZRJA 2ORWA 1E4VA 2FOLA 1N6NA 1YZKA 1SQ5A 2FSFA 5D3MA 4Q03A 2NMVA 2HT6A 4RSGA 1KI4A 5HTKA 4ZKEA 4MUAA 4LC0A 1N6OA 3U4QB 1GFIA 3SOPA 4X8LA 2O0KA 2IF0A 1T9HA 1V43A 3DOFA 3BH6A 1W2HA 5L3QA 1VIYA 2MMCA 3K70D 2QMOA 2ZI3A 5J4KA 1EESA 2HXSA 3U3JA 4KJZA 4AC9A 1NP6A 3IQWA 4OQFA 3K0FA 2WWHA 3PCRB 4NE2A 5DGXA 3UWOA 2QBYA 1FX0B 3CX8A 4CGZA 2ZE8A 1ZNXA 4ARZB 2AD5A 2BV3A 3SR0A 5KNDA 1Z6AA 1NKSA 1SKYE 3HWSA 1UADA 4TT3A 1KI8A 2H8KA 5IDVA 1N5JA 3I8XA 1S8FA 3NC1C 4HB4A 2IX3A 3D8BA 2QE7A 5SZHB 2F1JA 3EC2A 4M1WA 3X1YA 3CF0A 3HU3A 1KDOA 4KFSA 1O3YA 4O25A 4LYJA 2GJ9A 2YC2C 3X1ZA 1D5CA 3R9XA 2HF8A 1SULA 2C98A 2FA9A 2WHXA 1SXJD 3FKQA 4JBWA 1SVSA 3VQTA 2RGBA 4BFSA 2VHJA 4TMTA 4XH9B 1WF3A 4NMMA 4E5UA 1UJ2A 2B6HA 3KQNA 1F2UA 1QHYA 2WWWA 4R7ZA 2ZI9A 1G41A 3EZ6A 4B34A 4JVLA 1Z83A 3PEVA 1XZPA 3TSWA 1Z6YA 3ZZUA 4ZCMA 4B2PA 2F9LA 2W00A 3H0KA 4MRSA 5IF9A 1F2TB 4M1TA 3UG7A 2ZR7A 5AK0A 4D4LA 2QNRA 4LGMA 2FFHA 4R2IA 2HYIC 4IDOA 2NQ2C 3ZQ6A 4BRWA 3QG5A 3AKCA 4OL0A 1U99A 3VR5A 1RVDA 1NG1A 2BMDA 1K8RA 1W5TA 3CUEF 4Z8XA 4B2LA 5A0FA 1XPOA 3T5DA 4RD3A 2QUZA 5FOUA 1X3SA 4YC7A 2C9OA 4IJMA 1DE0A 1MOZA 2ZTSA 3C14C 4F4CA 1GRRA 3WNBA 5SZIA 4BLQA 3I61A 821PA 3I73A 3U7EB 1KSFX 4HEJA 4BFVA 3CPEA 2JJ1D 1T0JB 3QXCA 1I4TD 5JRJA 5B57C 4DXAA 2C78A 1SVOA 1W7AA 3U60B 2QP4A 4H1UA 3PITA 5HE8A 4GOKA 4GL2A 2P5SA 5EUQB 3B1XA 1N6HA 2A5GA 2XSZA 4A0HA 3K09A 4OKSA 5FL3A 1I4LD 2GK6A 3ZLJA 1NJFA 2DFNA 1AQUA 4DB2A 2X2FA 4F7WA 2Z0MA 1U9IC 1ZM4A 2FNAA 2WPDA 3ZIAD 2WTUA 3TW4A 3MWLA 1ETUA 2C03A 1A7JA 1HE8B 1TL7C 3FDIA 2GBLA 4WXPA 1XJCA 2W83A 4JYCA 1YR9A 4PC6A 5FTJA 3AKYA 1U8YA 2G83A 3KJEA 4RCZA 1XDBA 1R0ZA 2CBZA 2R65A 5BN3A 1DG1G 1E96A 1XXHB 2DPXA 2NZ8A 4PSVA 3VR4A 4LBVA 4LJ5A 3LD9A 2GJKA 4NPHA 3ZVNA 1EWRA 4URWR 1XJQA 2GILA 1II0A 2FPMA 1KJYA 5CM8B 2XB2A 3K9NA 4IW3B 2D7DA 4HATA 2ERXA 3K0SA 3R20A 3WYGA 2N42A 4MRRA 2VSOA 1Z6TA 2CL6X 5AWFC 4Z8YA 4G5GA 3CBQA 4LJ7A 4OQMA 3E70C 1KMQA 1EFTA 4D4KA 2QRZA 4Z1MA 5GJWC 1CIPA 3L0IB 4OK6A 5CIWA 4BEJA 1Q3HA 3OZXA 1RZ3A 2WIAA 1AA9A 1E4YA 2BDTA 3ETLA 5FBWB 1FMJA 3C5CA 1UKEA 4M1SA 2B8WA 3LH5A 4UXHA 1S96A 2C9YA 2WAYA 4GSYA 3T35A 4NBSA 5FH9A 4TT3D 1UEIA 1K6MA 2D74A 4H1VA 5L8VA 2AKYA 3TSOA 5EP3A 2AFHE 4I99A 2REOA 3KJGA 3QEJA 5LDDC 2FFQA 3P4XA 2QE7D 1IAQA 2QI9C 3FKSD 1TF5A 2IWRA 4YLGA 4AYXA 3IKJA 2WOJA 2CK3A 4F91B 1E9FA 3FPAA 3LXRA 5AR1A 4LJ6A 4GP7A 2G9NA 4Q1AA 4S2EA 2VP9A 4XJXA 4LJ4A 4DT1A 3T1TA 3K0AB 4JJKA 1RRGA 1DVRA 3KXIA 1RYFA 3N2EA 3MWKA 4X8MA 3WYAA 2BBTA 2XX3A 3TLXA 2QROA 3EPLA 4CEIA 3QKTA 3SZRA 1L4UA 3RSOA 1VYUA 2R8RA 2FU5C 3B13B 4IDHA 4AURA 1EG7A 1EFHA 4FMCB 3WMFA 2BEKA 1E3MA 3WHLA 1OIXA 1U90A 4FXPA 1AQYA 2FEMA 721PA 3TBKA 1VCNA 2WOOA 2G77B 1S9HA 1Y3AA 2D3WA 1ELOA 3K0CA 1KAGA 2E1RA 4MITA 4LYAA 3THXB 3KQLA 1ZU4A 3OF5A 5SZKB 1XF9A 3EA5A 1UPTA 1G3RA 2NTYC 2J3EA 3RS0A 4C0KA 1NIJA 1OXTA 3IPXA 4EJSA 1EFCA 2C2HA 4UNSA 4JSTA 3V9PA 5BN4A 3K70C 1YVDA 1GKYA 3TMKA 4B6EA 5BYKA 1UDWA 3FMPB 1FP6A 4WZ6A 3IUYA 1J2JA 1LF5A 4Q9HA 2QM8A 3CZPA 1KDPA 4EFNA 2GAAA 2A9KA 1JXOA 5J4HA 2XXAB 5JI3E 3ZDQA 2QBYB 2PEZA 5JSZB 1XBTA 4NYJR 4PO1A 2QY9A 1LW7A 2ASEA 5B64A 4PTLA 1L4YA 1C9KA 2NG1A 5BN5A 3GLGE 2WPDD 5HKKA 2B21A 3B1YA 1E32A 4OI1A 1KI6A 3CH4B 4M2LA 3LNCA 2V8OA 3OIUA 5EXSA 4JLPA 3RAPR 3HDTA 3LA6A 1YE8A 1BMFA 4A92A 2L0XA 3AVTA 3TQFA 5AUNB 2OAP1 2QL6A 3PUXA 4JZKA 4L8GA 1P9WA 2DFKB 4JL8A 3DMNA 4L5BA 4O0MA 3CNLA 1AS0A 4RFVA 3I8SA 1I2DA 3QE0A 3NVAA 4DCSA 4D4JA 5E4FA 1ZBDA 1CBUA 2J0UB 3T1QA 2BBWA 3LLMA 3GLHB 2BM0A 3HYTA 4UQOA 2J9RA 3IHLA 4AIIA 4M1KA 2JDIA 4MKHA 3OESA 3SQXA 4Q18A 5CITA 3FE2A 2VL7A 1II8A 1IY2A 4URYR 1N6LA 3OIVA 4JKIA 1N5KA 5SZJA 2XAUA 1KNQA 3IEVA 4QBFA 3NTUA 2O8BA 1KYIA 1ZIPA 2DWOA 3GLGA 2WMOB 5EXPA 2HEIA 3MMPA 4JLAA 4QHTA 4L16A 3GJ5A 1ZD9A 3QPVA 4GNKA 5F9FA 2Y8EA 2ZITA 1XMVA 1NN0A 2FDCA 4ZKDA 2JLWA 5DSZA 4ZDWA 3SFVA 1LS1A 1RRFA 1W49A 4G0NA 3LXXA 2OBNA 3JVVA 3MCAA 2XNDA 1D8TA 2VYFA 4I1UA 4QNRA 5JCZA 2J41A 5J5CA 1GG2A 1NVXQ 2RH5A 3MFYA 3SFZA 3W8NA 5EJEA 4HB2A 1F60A 1GNPA 4Q1FA 1FL9A 1VYTA 2ZJ2A 2PJZA 3EIQA 3T12A 1U0JA 5JS8A 4Q7MB 3OFNA 2GZDA 2ODBA 2CK3D 3IO5A 3OEED 5A4JA 3AVUA 4PC3A 4N0DA 1T5IA 3AP1A 3P4YA 3W6NA 1WP9A 5HCIA 4EPYA 5F98A 3DZ8A 5JZVA 2FJUA 5LB4A 3FVQA 2QRNA 4B2IA 1E2DA 4PC2A 5EE9A 3NXSA 4JS0A 1TQ4A 4NYJQ 4IKEA 1KGDA 2C96A 3QXSA 5UKDA 4G5QA 2QG6A 3DMDA 4EPTA 1JEEA 4PANA 4E22A 1E94E 4TSFA 1KI9A 1LF0A 1OF1A 5LPNA 3TGPA 1CR1A 4Q9LA 1YZGA 4W9MC 4V03A 3O8BA 5F2EA 1P9RA 1U8AA 1C1YA 3HR7A 5HE9A 4NU0A 1W36B 1OV4A 2KB0A 3H4MA 3CWQA 1GL6A 1W0JD 5CJPA 1YJ5A 1HEIA 1XTRA 5ELXA 4BRUA 1T5LA 4TL7A 3U6KA 3WP1B 1U81A 2HDNB 4ITRC 3TR5A 4BFZA 2X2EA 4DSUA 4TMKA 3NBZC 1CRPA 2EFHB 1VPLA 3ASZA 2IT1A 4ZO4A 4Y0VA 1NJGA 3AGPA 4LJYA 2RAPA 3VKGA 2IXFA 2Z6VA 4OJQA 2IXGA 1E2IA 1G3UA 2QAGB 4JLNA 3UWKA 2ZYWX 4LYHA 5JBQA 1NLFA 4BFTA 5KYKA 2JLYA 1HUQA 2AK3A 1W48A 2QP3A 1RC8A 2OZEA 1UBEA 2BMFA 5H1YA 3T06B 5AUPB 1FX0A 3THYB 4ARZA 4M4SA 5EXXA 4KITB 4YQFA 2D2FA 1DAMA 2ZQ5A 1Z0KA 3B8HA 4PQYA 2VQSA 1W0KA 1WXQA 1GILA 4QOSA 4PAQA 1N0WA 5G41A 2QMUA 1R5NA 1K5GA 1BMFD 3GMTA 4MRNA 1Z28A 3LX8A 1HY3A 5JJKA 3AVPA 1FTSA 5FOXA 2ZJOA 4JBYA 4ZDJA 1ZNWA 4MGYR 4L15A 4LZZA 1LY1A 2ZI6A 1AJEA 2YWHA 1RRPA 4I81A 4PAOA 1IHUA 1OE0A 1TADA 2RHDA 4OK3A 1G8PA 3QY0A 4LPSA 5EE1A 2JDID 4CEIB 1PUIA 3DDCA 3KKPA 1IN4A 3UANA 3ZVMA 1CR2A 4Q66C 1KI2A 4C30A 4IVRA 4A2PA 1KIMA 1N5LA 1WB9A 2CMKA 2ZUDA 1OFIA 1EGAA 3TIFA 3VFDA 3KXKA 1MR3F 4JBXA 4N0EA 2HLDA 1W4CA 1G6OA 2JJ2D 4IOJA 1F2TA 3VAAA 4AYWA 5CK4A 4AWXA 3I72A 3QNUA 2BIFA 4ESVA 3KKMA 2Z4SA 3BB4A 1OXUA 1XP8A 2RGNA 4TMWA 4OI0A 2XNDD 2DFTA 2HJVA 2A78A 4URZR 3U7GA 2QGZA 3KJHA 2GCOB 1S3SA 3C7KA 2I1VB 3MSXA 1X86B 2FEOA 3EPHA 3AF1A 4M8NE 4URUR 5F3WB 1R7RA 2XJ4A 2ZRBA 3ONWA 2XZPA 4NKRA 4HAWA 1G8HA 2GNOA 1G3IA 4IEIA 3DM5A 3TUIC 2PH1A 1XXHE 3W34A 3BBPA 2C04A 2JIZA 1G4AE 2JLUA 3OEHD 4I1OA 2FN4A 4C2TA 3Q9LA 2XOKD 3CPJB 2D2EA 3VNVA 2OCBA 4E03A 2AR7A 1KO4A 2ZE6A 2YC4C 2WWXA 3BFKA 1W4RA 3TAHA 1YZLA 1G6HA 4MGZR 4US0R 5GVRA 1WDTA 4Q47A 3AM1A 4OYHA 4QGAA 1IN7A 3ASYA 2A2ZA 3WNCA 1VIAA 4GP6A 3SI7A 3I1FA 4Q02A 2W6JA 3H1TA 3RC3A 3L43A 4O3MA 4B48A 1DADA 4TMZA 2LKCA 1MO5A 3W8RA 3VR3A 4NTZA 4B3FX 2IBMA 5JHHB 1JBKA 4BASA 3NH6A 2YWGA 1XEFA 1QG2A 2ZRHA 4DCNA 1AM4D 4KBFA 1SZPA 1NN1A 3RNLA 1Z2AA 2W2TA 4PAMA 4RZ2A 2IWHA 1BYUA 3ND8A 2DR3A 1XXHA 3CO5A 3LO5A 2YINC 3MG9A 4HAZA 2IS1A 2O8DA 2VP2A 3GEHA 4C9BA 3H84A 1FFHA 2GA8A 4A0GA 5B30A 5EUMA 4RKEA 1VMAA 2Q6TA 1CEEA 4QG7A 1X8LA 3AF4A 3B60A 3BAFA 1LS6A 1XD9A 5FPSA 3EZFA 2VRWA 1Q57A 2JATA 2OXCA 4BWYA 2O8CA 2GXQA 4M1MA 2K5UA 3GLGB 2WWGA 4MRVA 1E1RA 1OW3B 2OFWA 2X19A 5F9HA 2GVZC 1F5NA 3L0OA 4DEYA 4EPWA 1F3OA 2IC5A 5H8WA 3B1WA 1T91A 3LQQA 4HI0E 3A58B 4PO9A 4LJAA 5EE0A 1W44A 3AH8A 3B78A 3W9YA 4ZV4A 1KKMA 1NIPA 5FBRB 2V7QA 2A3RA 1UAAA 2AWNA 2V6JA 1DEKA 1G5PA 2PEYA 2IHBA 3ZVLA 1GKIA 4OQNA 1IJFA 4LY6A 1W0KD 3ADCA 3RRZA 1KKLA 2G3YA 1M34E 2OAQ1 4DHEA 1ZUNB 4HAYA 1UEJA 3C5HA 3H86A 2FSHA 3P20A 5EQTA 1NG9A 3KX2A 1R5BA 5DN6D 3L0SA 1RPZA 5DYIA 1NSTA 4Q21A 2Q3MA 4DSNA 4US2R 1QHXA 2EW1A 2GRJA 4B44A 3OE7D 1VHLA 1YR8A 1KK2A 4P4SA 1VHTA 2P67A 5KSYA 3K0AA 4C0SA 3KB1A 3GLIB 4CEJA 2OEPA 4AKHA 1TX4B 2MSEB 2ZJYA 4CT4B 1G20E 3QKSB 4MKGA 1N3BA 2CHVA 3V4FA 3GQBA 4R9UC 2WJVA 2BKEA 1Z0FA 3THOA 2R6CA 3PUZA 4FD2A 4Q00A 4BLPA 2W2VA 1HA3A 1XU4A 1OFHA 2F43B 2ZI4A 1ZUIA 3MUFA 4QKQA 3GLFE 1HQYE 2P0EA 2HLDD 4HAVA 3KZ1E 3TR0A 1Q0UA 2VLIA 4DBLC 2NO7A 2CXXA 3JZAA 3THXA 1XFAA 1US8A 3HP1A 4ZIRA 3JZMA 1ESMA 3AF2A 4ZI3A 3BC1A 1OYYA 3DO6A 1Z6GA 1E9BA 2OCPA 3ZD7A 3CB4A 5CJ2A 1GIAA 1VG8A 1PLJA 3CR8A 1E2NA 2AD1A 1PUJA 3R8CA 3RRYA 1PV4A 2FZ4A 4M1OA 1CTQA 4OHVA 4RY2A 2QPAA 4M22A 4UKDA 2JIZD 4R98A 4BLSA 2YNMA 3OAAA 2YHSA 3GLHE 2WWFA 3A1VA 3CRW1 221PA 4C0JA 3HJNA 1COWA 2G6BA 3NHAA 2XXAA 2Z83A 2DB3A 1M7HA 5JSZA 2XZOA 3CH5A 1A1VA 1JPNA 1NKTA 1Z22A 2GVDC 3Q72A 3QI2A 3PXGA 1G8GA 4XTRA 1IN8A 2VSXA 1AZSC 4PPNA 1Y63A 5G3ZA 3ZZ0A 2FFAA 5C46F 1MO4A 1XTIA 3VHXA 2XTMA 3HPRA 3HR8A 3P1JA 3TH5A 2WKPA 3FHOA 1A2KC 5FOWA 1OT3A 4OHXA 5L3SA 5FOSA 2ZPTX 2IS6A 2J0UA 1QHSA 4KLZA 4L9SA 1GNQA 4WZBE 3K9HA 5DHAA 3UMSA 3P27A 4KFUA 3EIEA 2WICA 3GLHA 4JMPA 3TW8B 1R0YA 3ADDA 4EAQA 1ZNYA 4TLCA 1SVMA 2YOGA 2J7KA 2PX3A 3EX7C 1PLLA 5HPYB 4XOIA 1A4RA 1NN3A 3ICEA 4QJ5A 1DAIA 1E1RD 2ZSFA 1P4SA 4ASUA 4CIDA 2PMKA 4P32A 1KSJA 4A6PA 1P62B 3P32A 3PJRA 2JLVA 2QP9X 4YDHB 2GAOA 4C4PA 1ZCBA 2W0MA 4FMDF 3BH7A 2H1LA 4Q1EA 3RWMB 1QVAA 2E87A 4RD1A 2ZJ8A 4IOLA 3D31A 4OBEA 4IDPA 4B47A 3QPWA 1NVVQ 3VKWA 2F7SA 1NL3A 2W6ID 2YOHA 3VHLB 4LHWA 2JA1A 5J40A 1KO1A 3CLVA 3J81k 1VKJA 1AS2A 1XRJA 1Z06A 3A37A 3P26A 1Z0IA 2OBLA 2VPPA 3V00A 2KI5A 1IXRC 2WJJA 3Q7QA 1ZU5A 4JL5A 1QHNA 1Q1EA 2J46A 1RW4A 4JLJA 1T3LA 2R6AA 5C2JB 1NNEA 2IS2A 3MWJA 1T3SA 2BEJA 5IK2A 3NHBA 3T61A 2QZ4A 4RKFA 4BFWA 5JEEA 4QBHA 4PC7A 3QOFA 1E2EA 5EE5B 1T0HB 4IFEA 3CF2A 4A8JC 2O8FB 4PHHA 3SEAA 4QJ4A 1BOFA 1EFRA 5CIQA 4EUNA 3O47A 2IF2A 4JYBA 5EZ5A 1AIPA 1OB2A 3PEWA 3SYKA 5AJYA 3QPUA 5AUOB 3LW8A 2OT3B 4C0QC 2V6IA 1CF4A 3UMRA 2IYRA 1DAFA 2OO7A 3CNOA 1CJMA 2IEYA 2VA8A 4AYTA 1HQCA 3K70B 2JASA 3LV8A 2Q9AA 2DWPA 1YU9A 1NMZA 4TQUS 1LFDB 3M1IA 4KO8A 4W7SA 2FG5A 1EK0A 4BLTA 2O0JA 2O8DB 1HE1C 5JMTA 1KI3A 4QGGA 1MV5A 3A6PC 4P0TA 3O8CA 2WSMA 1TTTA 4OHYA 4Q7KA 4TTPA 2Z5FA 1U98A 1XMSA 4Q4JB 3AKEA 4DLUA 4TN1A 1R0WA 2O8CB 1G21E 2IEZA 1OFTA 1KI7A 1WBBA 3QVVA 3VMFA 2I4IA 4IFBA 3W3AA 5K8IA 3U6BA 3OAAD 1KO5A 1IJEA 3K1JA 4J0QA 1FQJA 3C41J 1YRAA 4V0ME 4GRAA 3IIJA
chains in the Genus database with same CATH superfamily
3OT5A 3EY9A 2WHPB 1E79A 3GUCA 4QVIA 3Q5GA 3QVUA 1KJZA 4PPFA 1V2GA 1YR2A 2AZ4A 2LR0A 2VSFA 3THYA 1P4AA 1KFEB 3MBKA 3BL6A 3QEMB 3EK2A 1IM5A 3RRNA 3X1WA 3H2JA 4A8TA 3DKPA 1WZNA 1B8OA 621PA 1MT3A 1YULA 4HCJA 2V7XA 2QU7A 3W9BA 2QSJA 3WYBA 4DLVA 4LPKA 3V1YA 2WSSA 3L7OA 4FBGA 3AY6A 2R8ZA 1L5HB 1V3UA 1BH2A 1Z4KA 2C59A 2IOQA 3MW8A 4ZJPA 4ZJUA 1ZMOA 4FWTA 3A9SA 4PLCA 1FU4A 2BM1A 1J56A 3HH8A 2YZNA 4YAEA 1YFLA 2X9VA 2YQ5A 2YYZA 4H1HA 5IXJA 1EKXA 2H48A 4XCXA 3VSBA 3IPLA 3QSYA 4TV8F 3TPFA 1A7KA 2ALJA 1BXZA 3BGVA 1TI7A 2PTHA 1SURA 1M76A 2QTLA 2GHIA 4NBWA 1CETA 2JCXA 2W2LA 3VAZA 1K06A 5KJ6A 4O4LB 2H16A 4LJRA 4CEJB 4A36A 2UXCB 3AM3A 3D3JA 1UXOA 1L4FA 4AU1A 1W9HA 1B73A 2VF7A 5FLKA 2VJCA 4QA9A 3ZZ1A 3GQBB 4ZQIA 3SK0A 4CE6A 2Z2IA 4D4HA 3G7UA 1TCBA 5JQWA 2GYWA 4U00A 4Q4HB 5B5SA 4B5KA 2E5FA 2P2NA 4PW0A 2OILA 1G59A 1NGSA 1LXCA 4ACBA 1GNVA 5ER9A 3FHCB 5CM9C 3MJVA 4YNBA 4B4UA 4DJEC 4RTPA 3HCFA 1RZUA 5ERXA 1BDJA 2VDOB 1F0PA 3D81A 1ONNA 5ICMA 1JTEA 3LIIA 1NI3A 1WB5A 2ZE7A 3H19A 4LV6A 1GJRA 2DPHA 5LA6B 3NM5A 5AKZA 1MQ9A 2WUWE 4ALIA 2NUAA 1YFKA 2O05A 3PPWA 4HBGA 5DX1A 5IKEA 3IBGA 4KAFA 4AJ1A 4V2UA 1D2MA 4NE9A 2R62A 4RD6A 1EFVB 3OU2A 1GZUA 3DCNA 5EC8A 1G1MA 1ZJWA 1FFAA 1EEXB 3MS7A 4UEKA 3D0KA 3RSFA 1R4NB 1G20B 4IWXA 3V80A 3G1WA 3COSA 2WG1A 2ZWMA 4I8IA 4L0QA 1QGOA 2NV6A 1YZUA 4U6SA 1TUIA 3UGJA 4YAFA 1XZMA 3QVXA 2B61A 1KSGA 4F3YA 4IINA 4WD3A 3EYAA 1GAQA 2YKGA 4AZWA 3L46A 3LYUA 2XTZA 4HRVA 3MPOA 4NC9A 1USIA 4XGQA 4B35A 4E1BA 1PE0A 3R3WA 3GLFB 3TOZA 1E9SA 4ZZ1A 5IVPA 1EFRD 1N6KA 2XSZD 2FW6A 4UVEA 1QDEA 7YASA 2OG2A 4NJOA 3CTPA 1AKNA 4EIWA 1QKIA 1KYQA 1SUDA 2VOJA 3NH9A 4BLWA 3UPDA 1YMQA 3R0VA 1W35A 4HDCA 1G7RA 1ZN8A 2D4AA 3G02A 5AQ1A 3K8QA 3QOYA 4YMSA 4BWFB 2FPLA 4JJZA 3U4AA 1KMHA 1Y7PA 3JARA 3FWNA 1NVKA 4O59O 1P9OA 2HWUA 3QIAA 1U28A 2OHFA 4OBBA 3VC2A 4ECAA 3AEQB 4INAA 1W19A 5LQMA 1R3UA 1NTOA 1ZYUA 2GGSA 2Y1EA 3OBBA 4CKBB 5A5VA 3PRYA 4JGGA 1O08A 3GFGA 3PE3A 4DZTA 4R9NA 1H3EA 1F6BA 2VDUE 1SM4A 1S9DA 1CVRA 3FSRA 1K88A 1XKXA 4MR8A 3O84A 4K81B 2C42A 4KV9A 1A7AA 4Z7NB 3VO9A 4YAKA 1Q0ZA 4MPPA 4BGDA 4E5PA 2XGJA 1M1YB 4BO5A 2VG8A 2WJ6A 4M9ZA 4O2AA 1EVKA 1PK9A 3QE4A 3VUEA 2H2DA 1E2JA 2C4MA 1C4KA 2EHDA 3OIFA 1ZH4A 2A9JA 1X7HA 2QRHA 3STVA 3O91A 1DKLA 2YR0A 2Z3WA 2QJOA 4XYEA 5ALZA 4IIJA 1OPXA 4JVMA 4I1VA 5EN4A 3RAFC 3UUWA 1YR6A 3SZ3A 3A9WA 4X66B 4EVIA 3J81A 2UUOA 3DOEA 3ZEIA 2NXCA 3LSTA 1E79D 2OHJA 4R8RA 1TO6A 5HVNA 4X91A 2JVKA 1RLUA 2DSTA 3LP6A 2C2OA 3B52X 3HSKA 5ELLA 1I7NA 2P7IA 1JA1A 3FTQA 4B76A 2HWKA 3ZWVA 1PJRA 3L7MA 3MWDA 2IOHA 4TPKA 3K9FC 3DW1X 1LPAB 1Y5MA 2ID8A 1J24A 2OXEA 4WOKA 2IIPA 4I1PA 1CRLA 4BZPA 4PZLA 4LC1A 3UEOA 2PZAA 3P5BA 3NGMA 1SBTA 3S2ZA 3AKZA 5D3ZA 4DXDA 5JI2E 5JCJA 4BVGA 4DG9A 4OAPA 3MD9A 3RRXA 3V4ZA 1P6XA 3D9QX 5J43A 2BLLA 4YJHB 3FOWA 2XBUA 3A28A 4GH5A 1IHOA 3VTFA 1BTOA 1TT5B 3VH2A 3PWKA 1BX3A 1ESZA 3ITKA 4TLEA 5E0KB 1M7GA 1N5OX 2RGEA 3LE8A 3K2QA 1ZINA 1YR7A 3IE2A 1M72A 2INGX 3GU3A 2Z5GA 3KAKA 4POAA 4WLFA 5FNVB 2GDZA 3CRQA 3HP7A 3LVQE 1NA5A 1EZZA 2GF2A 1SVWA 1PL0A 2A5JA 2R5FA 1YB4A 3GWGA 1RCTE 1LPNA 1WW2A 2WF9A 3L8FA 4IVPA 3RTCA 4C5AA 3KR9A 4OHRA 1CR0A 5FEMA 5I7HA 1VLZA 1ECGA 4CF7A 1JUDA 1H2RS 5ARDA 1ZY2A 1WCYA 2QL7A 3OE1A 2MU1A 3D2AA 2RSLA 3HR4A 2GXAA 5FI3A 5KQPA 1X15A 1EIWA 2BSXA 1YO6A 3CBGA 4RTQA 4GXTA 2O2EA 1NBOA 1RXUA 3EG9A 1M2VA 1E60A 5AVQA 4DR4B 3X1DA 2AV6A 3MAAC 3P96A 4G4IA 4YJDA 5KHOC 1REQB 3C3CA 4NENB 5A6SA 1CC1S 5CVDA 4GICA 2VSYA 1U7PA 3QLJA 3HGMA 4RE6A 1J23A 1YRHA 4J1TA 1FRFS 2ACEA 2FN8A 4IIHA 3NAGA 4Q7LA 2X8AA 1R0XA 2C7GA 3I05A 4Q4DA 4U2DA 2YASA 3VISA 3IMEA 4RPJA 2DHCA 4EHBA 1B26A 1D2HA 2XITA 4P1ZA 2VP3A 3A4LA 1OZGA 2YWRA 2PU5A 1CULC 3SG0A 3ZGNA 1X42A 2Q5LA 2VP0A 3LBNA 3GJ4A 4MI3A 4CL3A 4LHXA 2XMDA 3EVCA 3FYDA 1E9DA 1KMMA 1U9IA 1ZN7A 2Q99A 3QLUA 4GPIB 5TPWB 3WIBA 3WI7A 4AROA 1QGUA 1FY2A 5TMBA 5JMWA 2FZVA 4JXZA 1SB9A 2XMPA 1P31A 2BHNA 5P8WA 3DM9B 3L7BA 4O4JF 4I5FA 4CFZA 3LRXA 4HQLA 4AJJA 2CYAA 1KFCB 2Q2WA 4MWOA 4QFMA 4WBNA 4R2WA 2FZEA 3BMOA 4PNPA 3GP3A 5HTOA 1MG0A 1I7LA 3C1AA 1DKMA 3HJAA 2ZANA 2VP5A 4HDMA 5IJ9B 2R7MA 5HKKD 4X62B 5I9LA 2O5VA 1Z2PX 4L6AA 3MK31 2GJ4A 3DNFA 2O20A 3AT1A 2FKNA 3OLQA 4K88A 4DFDA 3SN6A 1ANKA 3H9QA 4MARA 3GEIA 3PC4A 2EARA 2X58A 4AJHA 3GJ8A 2DY0A 2VNAA 4L02A 4NVRA 5EJMA 4PZAA 4E5SA 1IEXA 2ZRPA 3PNQA 4OA5A 3GROA 3WLTA 2FLVA 2G0AA 2XB4A 3IE0A 1UKVY 4GOND 7ABPA 3W2IA 1PT7A 4QC2A 2EEPA 2ORVA 4V0OA 5HEKA 2ZYRA 4BGUA 4F86A 3CV3A 1P1IA 4UOQA 5D51S 1E0AA 3FB1A 1PZXA 4GR9A 2GCPA 1T5HX 1TCAA 1E1DA 5E9JA 3B9QA 5FTLA 4OK5A 4X6YA 3RH0A 3UCXA 4D26A 3W90A 2C2MA 3SVLA 3TW8A 2F67A 3NDPA 4MHOA 3QTLA 5I9MA 1ABEA 2QVBA 5CFMA 2O3JA 3BFVA 4WA7A 2MYUA 3C74A 3DDNA 1EFKA 1ZA2A 4IDDA 3KKEA 3ON5A 4KSBA 2XRZA 2NV0A 2O3RA 4QRHA 1DC7A 5HMLA 4OL9A 2EAUA 3C3KA 4YTEA 4IVNA 2ZTLA 3AB3A 1P80A 5FTMA 3DBHB 1E4EB 1JPVA 3EC7A 2UYHA 3QBVA 3BSYA 4GGMX 4NQZA 4F6CA 1RBYA 1XTQA 1L1FA 2ZRAA 3OPYI 1IPHA 2DBZA 2QJRA 4FGWA 5JFTA 3HUTA 3JAMA 2P6PA 3KALA 4K5QA 3ENWA 5JISA 1PR6A 1Z5ZA 3NS7A 1OIWA 6REQA 4EQZA 2BGTA 2A0XA 2DE0X 4MVXA 4P4UA 4M36A 5FWXA 5L7WA 1X1SA 4KPEC 3C3AA 5G0VA 2ZI7A 3KBOA 4OFZA 1LRJA 1FDRA 3WIDA 2V8BA 2Q5CA 3AR9A 5JCJD 4JVNA 4QBKA 1P3JA 2AN4A 3WTCA 1TYAE 1RWQA 2E4XA 5IRCD 1SOMA 4DLSA 1H1DA 4BX2A 2WIFA 1SKAA 3G9ZA 4W63A 1YSCA 3VYTB 2NUTB 4NBUA 2DSNA 2GN2A 2FMIA 3FETA 4HTAA 4AULA 2J45A 1BD3A 3RD5A 2CCJA 3GA7A 1M9NA 4GRIA 2FZCA 3BILA 1E6MA 1M2NA 3UJAA 2WTXA 3HDVA 2GBLC 3VJKA 3GFPA 1OA1A 3BGOS 2A5YB 4MI9A 4PCAA 3BN3A 2SKDA 3IELA 5EP4A 1L7DA 3R3JA 3NIDB 3ZUGA 1GKKA 2VWPA 2COEA 4B3MB 4LF8B 4JASB 3R7NA 5JXGA 2XQIA 1XJ5A 1EDBA 4QPJC 4X97A 1NYTA 4EG0A 2YV4A 2ZSEA 4JI6B 2PL1A 3BHNA 4B73A 4EZBA 1SC3A 3FGZA 4KPUA 1ZLXA 5CH5A 1JFFB 5CD1A 5JRJA 2B9EA 2AH5A 4V1CA 2OGSA 2A3NA 1OYVA 3AY7A 3ECSA 1HF3A 3H2KA 2OGUA 4MA5A 1W2WB 3U3OA 3RO7A 4FFDA 1ZVQA 3MJSA 2AXPA 3V4SA 1PR9A 2DQZA 4YGXB 4OVKA 1NONA 3ETEA 1DBSA 2G0TA 2ZJAA 2PRKA 3UT0A 3ED5A 4BEWA 3PEUA 5EKXA 5FLYA 3SQNA 1U7UA 1P2UA 1Q0LA 2H17A 4C07A 1M8KA 4BVKA 3RCBA 1RE0A 4O1IA 4KCGA 3FMVA 5EL0A 1XD2B 1QS0A 4HN4B 1PJ2A 3CG4A 3EVTA 4H4CA 1KE2A 1O9HA 2W90A 2GPAA 3HN7A 3QUSA 1K4KA 1E4OA 3FM9A 1FTYA 4CLOA 3V3KA 4LGYA 2FP4B 2GFIA 3KZKA 2IKSA 4QFDA 1VKNA 4O4JB 4ZU6X 1YJXA 2VRBA 2XVMA 4TT8A 4RHUA 3Q7PA 1M74A 4WKBA 4RD4A 5LYJF 5FXMA 4CM7A 3TFOA 4MI6A 3SYLA 1M6NA 1T1SA 3QELA 3RABA 1BJTA 2JD1A 1JG3A 3U3ZA 4CM6A 1IJBA 5AOAA 2XUDA 1XTSA 1VBKA 3CLKA 3SD7A 5AJVB 4Z4HA 3M3HA 5E3IA 1P4GA 1YNOA 4WZAE 2O1EA 4ZOBA 3H1FA 2VYVA 3NWEA 2QUBA 1GQ2A 2QUAA 4IXNA 4KHZA 4PFQA 4YJ3A 3CNNA 4IH4A 3DO8A 4ZQEA 1WOMA 3ZHBA 2WV7A 3F97A 2PX2A 2ON6A 3B3QA 2R5NA 1O4WA 3F6RA 4M7PA 4WW0A 4DJ5X 3ZWDA 3LT4A 4BLVA 1VSVA 1GQRA 1BH6A 1XTKA 3B5EA 1V16A 4RGQA 1Y4UA 1LVHA 1QB8A 1VCMA 2FTKE 5CDSA 4NDAA 5E95A 2UUCB 4XPIB 1HYBA 2G8NA 4UNPA 3RS2A 4EKDA 1OIVA 2Z43A 4LZAA 2HPZA 5DM1A 5KDOA 1IUKA 2R7KA 4IJWA 3GVPA 4PLPA 3TW6A 2GWHA 2EVWX 4H4EA 2P79A 1WUHS 4LXGA 4IZHA 3TKAA 3G2NA 3HGTA 3RVRA 4Y2HA 1MQ8B 5DHUA 2GAFA 2V59A 1A9SA 3SBDA 3CCCA 3IUQA 4H6XA 4NF2A 1LTHR 4PPGA 5FV4A 4Z9BA 3O1LA 5FP0A 2OHHA 2HKIA 5JH7A 4M55A 1R37A 2HJ9A 3IP5A 3OUTA 3VI3B 4OFBA 5CB4B 5HS4A 2Q7XA 4H16A 2C9CA 3SYNA 3T9AA 4DCMA 2R7LA 1JJFA 5AKKA 4MQ5A 3CQ9A 2DFVA 1A77A 2C82A 4I1SA 2F1IA 2HQRA 3BL8A 2IYXA 5BNWA 1Q1ZA 1G64A 1TKRA 2XQKA 3F74A 3P9QA 2HA5A 4LZPA 4QUEA 4WK4B 4KXXA 2ADFA 2ZJ0A 3AUJB 3SXUB 4UASA 3WGUA 1NVVR 2PMFA 3B7GA 5AW0A 2VOEA 1OH7A 3OCWA 5BSHA 2ZDQA 2R6DA 1XAGA 3H42B 3ORQA 2J3LA 1B15A 4OREX 2H4JA 1K97A 2W58A 4K6OA 4DLZA 2C9DA 1EWVA 1TVEA 1X8JA 2YZ2A 5JANA 4RX1A 4R7GA 1FNNA 1C3VA 2PUFA 2V3CC 1PU2A 3BRCA 2IW1A 4Q4LA 1F0NA 3FAZA 1JXMA 3WLNA 1AUQA 3ZGOA 3CZQA 2W9XA 1JLLA 3PR1A 2ZYIA 3RU2A 3TLCA 2FOXA 4Y2SA 1SA0B 1O6CA 4WJZA 4YB8A 3O9VA 4GX1A 4LECA 4YFYA 2BHLA 4D82A 4U3JB 1R4MA 3LPNA 5I4BA 4MR7A 1OX5A 3TBFA 1VSBA 2JL1A 1QONA 4FFMA 3AFNA 3TOXA 4CQLB 2H7VA 5IU6A 5K8LA 4Z54A 1SVKA 3RHSA 4LDAA 2VRCA 1M1YE 3E1KA 3IILA 3L7CA 4RJJA 3VOSA 1OAOA 4CU5A 1PQYA 1XZQA 2D2VA 4BUZA 5KDLA 3M6LA 4PBSA 5HJEA 2C99A 2GNAA 1QK5A 4NATA 3EZ9A 4KH1A 4BZXA 2W6JD 3BFXA 3SMVA 2C92A 1YZ3A 5DX0A 3RT9A 4XVUA 1PL6A 1GQFA 2Z4RA 2P7HA 3GGCA 1MABA 2REQA 2II6A 3CLTD 3I12A 4V0NA 1T0BA 4J2TA 3S70A 3ZCQA 5JAUA 4AL4A 4BOYA 1JGTA 2FZKA 1M2OB 3FYCA 4MYCA 4R01A 4D3FA 5JD6A 2G63A 3RIMA 5TLSA 4DWWA 2HFJA 1X1RA 1UMBB 1VMKA 3JVUA 4BNYA 4XIGS 5FPYA 1ES9A 4PBTA 5FBKA 3WTBA 2VJMB 4ENPA 4CMIA 4M0KA 4M98A 5IWCA 1F5SA 1TK9A 5TMDA 4KRFA 2BELA 1ZW1A 2F1HA 1JKJB 2EG5A 2ZQZA 2ZXFA 4YCDA 1V41E 3AEZA 4L08A 3SSNA 1C4OA 2B7BA 2CJFA 4QXAA 4A9AA 5A4JA 1LSOA 1UKYA 4IHJA 4ZGWA 1J00A 1K6EA 2XTNA 3R7WB 3EIOA 1A2OA 4W5NA 1EWKA 4M8IA 5CT6A 5JSFA 1Y8QB 1DC4A 1O96A 3KOYA 3M33A 4YA6A 1L8AA 4YJ2A 3ZDRA 3ZWKA 3FKSA 5JEDA 1SPXA 3HKEB 4MKFA 1GSOA 4XGRA 4KR2A 2FEPA 2R7NA 5HM8A 4FM9A 1XLVA 2HCJB 4RYDA 1Q2XA 4RS3A 4HVAA 2IDMA 3GLSA 2GBGA 3NEJA 3QJYA 3THWB 4WXRA 1C7JA 2ZW9A 3MB5A 4FI3F 4BCDA 2V7QD 4HN9A 4CQMB 4AY2A 4C0AC 2QTAA 5D85A 2CLCX 1QMGA 5ALQA 4DREA 1MQSA 1TK2A 2PDAA 3NORA 1I5RA 1NJ1A 4A73A 1PG0A 4DUGA 1DL5A 5CTJA 1BDMA 2J3JA 5BSUA 3OOYA 3X0DA 2ATVA 3QEOA 1Z0ZA 2IV3A 2WEKA 3JQAA 3DBRB 3NWOA 1KDRA 3WXMA 3AUSA 2VYVD 1NXOA 2VCHA 1WXDA 2H1HA 1NYLA 2ZVPX 2EBUA 3UBMA 4X3PA 5K0GA 1W4AA 2VVTA 2HWYA 3Q88A 4AZ0A 3GCDA 3HFJA 4TRNA 4B84A 3NM6B 1JDVA 3OQ6A 4BVFA 5J2TA 3E0XA 3CRMA 4ZO9A 2FWRA 4DBZA 3I5MA 4DSAA 1NF9A 1UPAA 5CGZA 5DYYA 4ETMA 5TE9A 2DTXA 3OQNA 5BPFA 1LV7A 4LMBA 1DP4A 5ER6A 1HETA 5CYPA 1SZCA 3ZXUB 2RC5A 3C87A 1PJQA 1BWQA 4TLAA 1XMXA 2IHYA 4ZXPA 4QDTA 4HJRA 2BCJQ 4IGIA 2ZP1A 4GYWA 3TL6A 3TZEA 1GDTA 1FSZA 3DZCA 5G53C 3WK6A 4OKIA 4LF7B 4PX2A 3OHMA 3OIGA 5TQ2B 4D3YA 4DA0A 4OHUA 2EOAA 3BHJA 3GJQA 1GOTA 2R44A 4KQKA 1VJDA 4I0WB 3ZXIA 3FNHA 2QZPA 1CUIA 3VGJA 1BDIA 3GFBA 2XYHA 4EJ0A 3S2FA 1E2MA 4LOAA 4RTRA 1T10A 3KLOA 4UEQA 2VHQA 3GRPA 4NP6A 5FBVB 3G2IA 4AVYA 1CIVA 4Z3KA 4PLVA 3Q8WA 1NQAO 3EXFB 3FTDA 4UJ5A 1J70A 1DFGA 3T3IA 5EMKA 4DLAA 3KHSA 3UJHA 3DBLA 3EQ7A 5GIOE 1ULAA 1QRTA 1Z4IA 3OZVA 5BVGA 2EZ4A 2A9VA 5JZSA 5J1TB 2FPIB 4KWIA 1UR5A 4O3FA 2AXNA 2NVWA 4W5QA 1Z08A 5HIIA 1SBQA 4TN5A 3H8SA 4ESOA 2G1AA 3RTAA 2ZULA 1WXXA 2OE2A 2C7OA 3NHRA 1OQAA 5T5QA 2E3JA 1IZ8A 1ODSA 2BT4A 4WLVA 2HJRA 2GDJA 2B4YA 4P3NA 1OVGA 5DCYA 1UUFA 4GX5A 1VE3A 4Y7DA 1ORWA 2C3YA 2E4AA 3IH5A 2JIBA 5H70A 4DAEA 3RS7A 3SE0A 1LGYA 4EAAA 4M53A 4NOKA 1C30A 1Y1PA 4MUBA 4RZ3A 1T3HA 2VRCD 2VTBB 2R86A 4C7OB 3LP8A 1JKIA 4MAAA 4X8HA 4CM4A 4JXKA 3EIXA 4WERA 3CVVA 2VTKA 2YHAA 3HA7A 4AUEA 5L3VA 1VCIA 3LBAA 1E64A 1P75A 3AFOA 4LJLA 2QU8A 3ZJ4A 2XZLA 2YHIB 5CNKA 3A7EA 3OQBA 5JAPA 2GJSA 2IITA 3CX4A 4PNZA 1LD3A 2IHUA 3OLXA 4BP1A 3QFHA 2G8LA 4LVCA 2FYTA 3WWOA 2V1XA 5KQLA 1QTIA 3EXIA 4IIGA 4OHWA 4ZT7A 2DAPA 1NDQA 2QXYA 4RMIA 3QF4A 2PSSA 2GR9A 1J0CA 1B8UA 1YKGA 1OH6A 3L41A 2HA4A 5I5EA 5I4IA 3WK9A 4EF4A 5FADA 1QOPB 1NY6A 2XT0A 4EO7A 1K7SN 3L2OB 1EVLA 5JDCA 4AJ2A 1T4DA 1EM8B 2VA9A 1FVFA 4JKYA 4V0MA 1BD4A 1CUEA 4BV9A 1TIBA 2BC9A 5T3UA 3PVCA 3T7TA 5IT0A 1RT9A 2JFBA 2DKFA 5AHXA 4G9GA 4QXMA 5D01A 1JR3A 3OM9A 9MHTA 3HCPA 1R15A 1XZHA 2G9VA 2KSQA 3PENA 1QZZA 2F6RA 2PUHA 3U40A 2AZMA 2RGNC 4PGAA 3LC2O 4G1VA 1ZDMA 2X9LA 5ENZA 2IH4A 3AW9A 2HRCA 3PXBA 4CIWA 4GZMA 5G1NA 5ARCA 3JQ6A 1MX3A 3BKWA 3S55A 1YJCA 2RI0A 1VL1A 2ZYHA 5K0SA 2HF2A 4YMWA 1P2VA 1JJ7A 2QE6A 1MEEA 5JVDB 1SIWA 3GN2A 4Y8VA 5HZHA 4WUVA 1YBFA 5EWJB 3KJQA 3D3WA 3ETDA 4P31A 4QO8A 4DUGD 2QJWA 3S0JA 2I2BA 5KPJA 2WWYA 4G4SP 1G2PA 3MTIA 2X7JA 3JQAD 4R2XA 1JE1A 1DEAA 4QIHA 1NW6A 2OB1A 1XCBA 2WJAA 3ZJYA 3D0RA 2YXNA 4BNZA 5CXUA 2YZ7A 4J1NA 4DCUA 5C53B 1DO2A 1Z4JA 4MQ4A 1E2KA 2OP0A 5FUWA 1FFSA 3PQCA 5D86A 5DGTA 5A02A 1GTSA 1L8LA 4KFTA 1E66A 1E18A 2RKOA 3P97A 3V2UA 4EVQA 3OQMA 3BZUA 4P34A 3MWYW 4UMVA 1G5IA 1BWRA 4QNMA 4B7ZA 3HE3A 1F8XA 1Q0TA 1XMJA 5K8VA 2ZTUA 1RHKA 1Z6QA 2RH4A 3G8CA 4ND8A 1ONBA 3STXA 3GY0A 5K0TA 3QE3A 5BRNA 2IZ1A 3ZE1B 4PZDA 3HK2A 4F2GA 3L5OA 4QHYA 2PH3A 3GIWA 3RBAA 3HYRA 5C8YA 5IM4A 4G01B 3UGKA 3EIUA 4CYMA 4JP5A 4FYKA 1Q91A 2DHQA 3PGXA 4OHKA 5BSMA 4B3XA 4R51A 5ALNA 3FOEC 3G8DA 4O8CA 4JYPA 4U7TB 1BDHA 3M1LA 5AKLA 3K71B 2VJBA 5TX7A 2FP3A 5IW8A 2VK8A 3PCXA 1RZVA 3SGLA 2LVBA 1NW9B 2P9QA 3FPFA 3O7WA 3B12A 4MYDA 3UM9A 3NAZA 5D84A 1DQZA 2X0RA 5EXTA 4DDWA 2CUNA 2L82A 4CMAA 4PG8A 1IPEA 3PEEA 2W42A 1X1QA 3ITDA 3I9OA 1VKHA 4Q9DA 3SEFA 2K7ZA 3CISA 2AN1A 1N8NA 1U02A 1L8QA 3HN2A 3ZHRA 1X80A 4N40A 1PWYE 1T8PA 1RI5A 3COZA 1EUCA 1QGAA 1L7QA 2CXHA 3DBIA 4QBIA 4QUDA 5LLTA 4MV6A 1PR1A 4CIBA 2XMCA 4XUEA 1ONOA 4IVQA 4JQOA 2RK4A 1MCZA 2FW1A 2X3YA 3II6X 3Q5EA 3KE8A 3O92A 1NY5A 3ZJVA 4K28A 4B32A 3SOPA 1ISPA 4EBFA 2ZU0C 3D0OA 4H3HB 4MS3B 2VS1A 2CDNA 4C0LA 1Y6QA 1UPBA 1YONA 4Y6RA 4MZXA 4CLEA 3UB4A 3ZVKA 4IICA 3QF7A 4JIMA 4TQ9A 5JSHA 4P4TA 2K2QB 4RK1A 4NJEB 3ZIAA 1MDBA 3EQ9A 4BEVA 3B51X 2FMXA 1EGQA 1R6DA 4UDNA 3GJ0A 4UVGA 3H13A 4TWRA 2IX9A 4FLFA 4GBMA 1N0IA 3U3MA 1BXRA 2BYTA 4UEOA 1FUYB 1KVUA 2LV8A 4JJIA 4GI7A 4Z3DA 2B2CA 3ETJA 2X8WA 1F2UB 3IEKA 1OLOA 1BCSA 1P9NA 4X93A 1J2TA 3T15A 4B7XA 5KQSA 4Q19A 4B3SB 4QUHA 3OI7A 5JR3A 3O8QB 1QNLA 4GLOA 4BYGA 1DT3A 2QN6A 4DKXA 4BLOA 4CKCB 2X5KO 2J3QA 1DRVA 4N8DA 1JR2A 1KA9H 1GNTA 3ZE6A 5EKDA 1ECBA 2OZVA 2WJYA 3CIOA 1NMEA 4ZP1A 4IIEA 1CR4A 2VBGA 3BDAA 2NO9A 3NEYA 5HRAA 2UYYA 1MIHA 5CLLA 3RIHA 3LRPA 1P0PA 4MR9A 4TKVB 4JT9A 5KUTA 4E31A 3S8YA 4B6GA 4U7PB 1JX6A 5DVZA 5LQJA 4B6JA 3CNQS 4K87A 4K6FA 5FUYA 3TW0A 3UWDA 1U0SY 4BMCA 3I6ZA 4EDFA 3A9VA 2OV6A 4EG7A 5B2EA 1NI5A 1IHDA 4IZOA 1QFJA 4TV9A 2H3HA 2CZGA 3L1JA 5EMHA 3WWPA 1I2MA 5DWQA 2NPOA 1JR3D 4TXHA 2W6ZA 1ARZA 2PGIA 4P84A 3QMVA 1E5VA 4MTLA 4C3OB 3L82B 3GRCA 3ETGA 2WQZA 2V9PA 5HYVA 5D5PA 4FX2A 3O73A 3E5NA 1YA6A 5K9ZA 1IULA 4LE0A 5EJ4A 3TIIA 1XVVA 4QUGA 1W6UA 2GM4A 4KREA 1F12A 1RWMA 2QLTA 2J08A 3BSWA 3IV6A 2JKZA 3IVMA 4FZ5A 2WA1A 2P69A 3N05A 2ZIAA 3MZ0A 3JTEA 4K9SA 4KXFB 4RENA 1BXGB 4UBKA 5B3LA 3U4IA 1A9RA 5MN4A 1MB2A 5G3YA 1U63A 1GDDA 3H1GA 2JFVA 5K45A 5GJBA 4IEEA 1CRQA 3WE7A 3ZV7A 2GZSA 2Z5LA 2IZ0A 1ENPA 2PRSA 4LCEA 1NE2A 4KLAA 5G4KB 2VH1A 1UPCA 1QQTA 3P52A 4BIIA 4F21A 3C6MA 4KW7A 2HK6A 3DT8A 3ANMA 1GGNA 1SQFA 3TLGB 4A8JA 4RLSA 1Z3CA 2ZU6A 3UV7A 1GLVA 1U31A 4JSRA 4IMRA 1YQTA 2P11A 3LKBA 1B7GO 4B3TB 1PTKA 1P1JA 3KYDB 4TRMA 2E4ZA 1QBGA 1TF2A 5BSFA 1ST3A 3M4ZA 2FQQA 2VSQA 3GEMA 4CCYA 1VQ1A 3VMMA 3SLGA 4MINA 2AI2A 5ULLA 4Q4AA 1TLLA 3RLFA 3H87A 1PGJA 3BGWA 3TEFA 4HLNA 3WS7A 3ZCPA 4KSCA 3RRMA 2R8PA 2QQ0A 4F60A 3K6JA 1SU8A 1KE1A 1T8UA 1XDSA 2IA5A 4TYYA 4CKXA 1P44A 3FBTA 2YV2A 3PVSA 4Q3EA 1WDKA 1GZ7A 1CF2O 5B7QA 1NASA 1QYRA 3AR3A 1MEJA 5ELMA 4HDKA 2JK1A 3U39A 5K7SA 2O19A 1UKCA 5FI1B 1QVZA 4N5MA 8OHMA 3JQ8B 3LFHA 3HVUA 4QD3A 3C3MA 4ZQBA 3L6RA 3NOXA 3HV2A 2Q0XA 1KJWA 2YMMA 1UWCA 3I5XA 4HQNA 4EEXA 4OI4A 2VHZA 1HZJA 2RJNA 3PWZA 4YPOA 5LWHA 3DVAB 1MV8A 4QM7A 3UKOA 8LDHA 2I87A 5E0OA 1X19A 2J4FA 4TXLA 4B3GA 4D9JA 5E3HA 3LT0A 3CN9A 5M5BA 4C22A 4ZDIA 4IJ5A 1JHAA 1G1AA 1FFGA 3CJQA 1K98A 4JCCA 3ZNQA 4ODIA 1T35A 2PQ6A 3IAEA 3T8YA 5SICE 5CBPA 3V2HA 3AONB 1YTUA 3A2NA 2PZFA 2BMWA 2FR8A 1QZXA 4R6WA 1RAGA 1QHHB 1ZJJA 5DI3A 2BMVA 5TB5A 4JR0A 2WA2A 3HFRA 1N6PA 1WPRA 2B1GA 2W22A 3OZSA 3EUAA 4D5EA 4WX2B 5DGHA 1N2GA 4HLUA 1Z3IX 4AZSA 1NRIA 4ZOQI 3OJLA 1TLFA 4W5JA 4ALNA 3FOZA 3D43A 4G23A 2NO6A 5K3BA 1I7SB 1J8VA 3FDZB 5JROA 3SKXA 3PX2A 1LDNA 3CUTA 4AMUA 4Y18A 3ZTYA 2GRUA 4NRDA 3OJFA 5CCEA 4G6ZA 1U9CA 4GYJA 2V98A 3MVEA 2REBA 3IQGX 1URPA 3TE7A 1B1AA 3N7TA 4FFLA 3SJZA 3ZHUA 1AQ6A 2WFLB 4JL6A 4RV4A 3ZH2A 4K0KB 1N2CA 1NBMD 3IL2A 1DTSA 4DKJA 2YJTD 3L8ZA 4Y9UA 3T34A 1DAHA 1BHSA 1QVWA 5KYNA 4KGXA 1L6IA 1ZC4A 1CYEA 5F12A 3DL4A 2R66A 2YN4A 2XB8A 4WN3A 1FUUA 5DHFA 3U3DA 1VJCA 4RIFA 4AXBA 1FW6A 2SKCA 3PUVA 3NUGA 2BGNA 1ZEJA 2FDRA 5JSKA 1E3DA 1Q19A 2I5PO 3CZRA 1CVIA 4YAWA 5JASA 1J8YF 2AZTA 4MPTA 1TAGA 4WY8A 5AKEA 3DA8A 4H08A 4TWZA 5B2ZA 4GEGA 1Z34A 4G63A 2Z2XA 2B82A 4Q3KA 4R71A 2XE7A 1MIOB 1J4AA 4CM8A 1L8XA 2X0NA 5BWMA 2ADMA 4UQPA 3L8EA 4V02A 4W6ZA 5MHTA 1JJVA 1E7MA 4N41A 4Y98A 5KWIA 1A3CA 2MIIA 3FGNA 4PG5A 1JV2B 1UZMA 3PL1A 3R6GA 5TMEA 1IEVA 4BUJA 1SWWA 4JT2A 4E5MA 3CKLA 1KP2A 1OBCA 3KKZA 4U2KA 4BY9E 3W1WA 1KZGB 3D4BA 1V1MA 4ZANA 1JHDA 1Y9AA 3CCBA 4X8OA 3S3TA 3MELA 3VC7A 4CNBA 1YOBA 2J0SA 3A4TA 3QLEA 3VKFA 4DWJA 2EQ5A 4PN7A 1OI2A 4DPLA 3HLTA 4IOMA 4EKGA 1SN7A 3R9IA 5J2UA 4RS4A 4RZIA 1GCAA 1OFVA 4GO1A 1I9GA 4TSRA 3KNZA 1CR6A 2QRUA 4MQFA 2UZ0A 3EZYA 4BX0A 5BORA 2KJQA 3KZMA 2JAQA 4OJTA 1BS1A 3ICVA 3IUNA 5FR1A 1H5NA 2WFMA 3S1AA 5JXWA 4NLLA 1FRVA 3HG7A 5KVAA 3OZFA 4KQ6A 1U5CA 4MQMA 2JB9A 2ORIA 1A9PA 3T5MA 4EYGA 2J31A 1AKQA 2DXIA 2QM3A 2NYRA 1YE3A 2Q5EA 4AWBA 4ZCLA 3GRKA 2OHXA 4QTXA 3QVGA 4BFLA 3Q1KA 3HRKA 4DA8A 4K6GA 2IOYA 1YUNA 4HDSA 4GBJA 2PX4A 2G36A 3CLUD 4PSKA 3ZBTA 3ZE7A 2R00A 4IZIA 4Q1DA 4FZRA 2PX5A 3R2JA 1GN8A 3TNYA 3TZKA 1L8OA 2PX8A 1JR6A 5IWAB 1GSAA 3R4CA 2ZYDA 4G1FA 4D6YA 1NV8A 1II8B 3P2YA 2CSUA 1J09A 2D1RA 3MLEA 4ZAVA 3V7WA 4BRSA 2TMDA 4OJKA 4G26A 3MGGA 5JXJA 3HZRA 2C83A 5K3FB 2HJWA 2PD6A 1UM9A 2LE0A 2HMSA 2PR2A 3GRFA 5E6UA 5I9NA 2E4YA 3QVTA 1EXNA 4RD0A 1UFKA 4H3KB 4WUTA 2OECA 3LWNA 5E9WA 1LPPA 4HUQA 4X90A 3H9UA 5ALJA 2OA0A 2D5AA 1G8FA 1OBHA 1ZCZA 3CLHA 2QD1A 4KX3A 3RYHB 2HWXA 4MHSA 4J6EA 4D25A 1GAEO 3IPYA 4LRWA 1DO8A 2P3QA 4HH3C 4CM5A 1WD7A 1D2AA 1VG9B 4KAJA 3WAJA 3GRYA 2AOTA 2FUG1 2ZEJA 4QTZA 2QV0A 3RIGA 3WLKX 4CXMA 4MV4A 3L6CA 3PDHA 1SY7A 3PE4A 3PYLA 5KVCA 2J7PD 4QYXA 4E5KA 3IDQA 2R7AA 3V48A 1P2GA 2GWRA 2H9YA 3HJHA 2B4TO 3IHWA 2PD3A 3WFIA 5KBYA 3L7NA 4MRAA 1K7EB 4DMKA 3IBSA 3UOWA 1M2WA 1MPXA 3QBJA 3ZHZA 4P8RA 3ZNNA 3MT0A 4LWQA 3CC8A 3SLKA 5JRZA 2V0NA 1PJAA 4KBGA 4YRQA 2CV0A 3LECA 3MF4A 5BMVA 5LWQA 4I55A 3UGQA 2FFBA 4YRTA 2IUEA 4MP3A 1KAOA 2IZ7A 3TINA 2J6HA 3LX5A 5IBPA 2B92A 4D99A 1D9XA 1YB5A 4AK9A 4E4RA 1CDZA 2RHWA 3I2IA 5IC6A 1G17A 3OBIA 4O2LA 1IBCA 4FDUA 2WM9B 5DLDA 4CRWB 1QF9A 3TG2A 1FMTA 1XN4A 2I6UA 3PUWA 3I9NA 4ZT5A 1C0IA 3WLIA 3Q3JB 3PJDA 2JCSA 1RZRA 3B1ZA 3N2IA 5F52A