5EUMA

1.8 angstrom crystal structure of atp-binding component of fused lipid transporter subunits of abc superfamily from haemophilus influenzae.
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
255
structure length
250
Chain Sequence
KDDGAYKAEPAKGELEFKNVSFAYQGEELALNNISFSVPAGKTVALVGRSGSGKSTIANLVTRFYDIEQGEILLDGVNIQDYRLSNLRENCAVVSQQVHLFNDTIANNIAYAAQDKYSREEIIAAAKAAYALEFIEKLPQGFDTVIGENGASLSGGQRQRLAIARALLRNSPVLILDEATTESERAIQSALEELKKDRTVVVIAHRLSTIENADEILVIDHGEIRERGNHKTLLEQNGAYKQLHSMQFTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Lipid A export ATP-binding/permease protein MsbA
publication title 1.8 Angstrom Crystal Structure of ATP-binding Component of Fused Lipid Transporter Subunits of ABC superfamily from Haemophilus influenzae.
rcsb
source organism Haemophilus influenzae pittii
total genus 84
structure length 250
sequence length 255
chains with identical sequence B
ec nomenclature ec 3.6.3.-:
pdb deposition date 2015-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5eumA00
1R5NA 1TEVA 1XXHE 3X1DA 4C0QC 5E3HA 4DZZA 3O8RA 4ARZA 2EQBA 1E2LA 3UPUA 1UKZA 4PPQA 2WWFA 4NYIR 4ITRC 1X3SA 1W7AA 4A6PA 3OIYA 4WZBE 1Z6YA 1YZQA 2QPOA 3TAUA 4L8GA 3EPHA 2A5JA 1AIPA 1PJRA 4HAYA 1D2MA 3VR1A 2EFHB 1NVXQ 4OBEA 1QHIA 4CEHA 1T9HA 3LBHA 3PEVA 5IRCD 1ZNWA 4IDNA 5KPJA 4DDWA 3IIMA 3CWZA 1WF3A 2PT7A 1YZNA 3DDCA 1RKBA 1FMLA 3EZ7A 2JLZA 1RPZA 2WWWA 3PFIA 1DAHA 4RD2A 4JMPA 3GLHB 3RS3A 3R9XA 4Y0AA 5GVRA 4HAZA 2JDIA 3SBDA 1L7VC 1XPUA 4D2IA 3CONA 4XVUA 5JFGA 4C0KA 3K53A 1G64A 2GEDA 4LJAA 4Q5IA 4XWKA 2W00A 4BLQA 3TQFA 3KKMA 1KO7A 5F2EA 1G3QA 1QHSA 2RGNC 1OYYA 2PT5A 2BKEA 1P72A 1VYTA 2R8RA 1ZBDA 4BWYA 2BJWA 4LX0A 4M22A 1UBCA 3K0AB 4LYFA 4DT1B 1M7HA 4DIDA 4CEIB 3C5HA 3ZVRA 2CCKA 2WJJA 3EIHA 5JCPA 4IKEA 2ZJ8A 5CM8B 2ZYTX 3W9YA 1NF3A 3TSZA 3T15A 2R44A 1NIPA 4RD4A 2DFLA 1Z47A 4US2R 2F3TA 4G0NA 4LBWA 2WICA 3I5YA 4PO9A 2HUPA 2WSMA 3NDPA 2CMKA 1RW4A 2RGAA 1R0YA 1Z8FA 3CRRA 4NHOA 3ZYCA 1EWQA 4G3XA 3CKLA 2ZS7A 4CYMA 1ZMXA 4HEJA 3LRPA 4IJMA 1P3JA 2P65A 1S3SA 5KO2A 4UNRA 4LJ9A 4DLTA 3EPKA 2JIZA 2O0KA 3K09A 2XZPA 3CPEA 1IOZA 3MD0A 4JT4A 3LQQA 2V1UA 2CK3D 2IT1A 3RWOA 3K70C 1AKYA 2GVDC 1CJKC 2YWHA 3WP1B 3T1TA 3NC0C 4BZQA 5L3VA 4C9BA 1F48A 2EU8A 4NL4H 4XWAA 3U60B 4OQXA 4IDHA 1Q0UA 4M21A 1HURA 3HDTA 4B74A 1YRAA 4B48A 1XZPA 4I81A 1XDBA 3I73A 1P62B 1T91A 4DDVA 4R98A 1R0WA 3EXAA 4Q01A 2OV2A 3LA6A 1I4TD 2G83A 4TQUS 1F5NA 3M4YA 4JLMA 2WJYA 3N2IA 3LQRA 3VX4A 1QHNA 4BLTA 4FW9A 4QKQA 4NP6A 4PQFA 5CIQA 4MRPA 3VHXA 1NJGA 3W8RA 5K8IA 8OHMA 3BE4A 4LJ6A 3TAHA 3VKWA 1EFCA 4RD0A 4GFDA 3EASA 4LOAA 3EPLA 2JJ8A 5JLJA 2IXEA 4BZXA 3EA5A 4B44A 1WDTA 5FOSA 3RABA 5J4KA 1PUIA 1E2FA 3VFDA 4A4DA 1Q12A 2MSCB 4NCJA 2A2ZA 1X86B 1HTWA 2VPPA 1OF1A 2H16A 3M1IA 1E0SA 1LNZA 3I8SA 1CS4C 1E4VA 2N1BA 4XOIA 1Q3TA 2QE7D 5AJXA 1Z83A 2YYZA 2FPMA 5K8TA 3NEYA 2ZRCA 5B64A 2C78A 4M1WA 5DLQC 1CU1A 1IAQA 1FQJA 4I1UA 1P2VA 2CLCX 1OKKA 4PQYA 4CT4B 4DUGD 2RGCA 1N6PA 1B23P 1VCNA 5FOTA 1BOFA 2X1VA 1P75A 4AK9A 1U94A 3RRZA 3ZS8A 3RRNA 4HB4A 4C7OA 3TR5A 3IPYA 4LJYA 3ZLJA 4KJZA 4C0JA 2ZJYA 2FE4A 1KY2A 3WNBA 1FNMA 2D2EA 3LWNA 3PR1A 3QQ5A 4BFSA 2ZVPX 5DI3A 5GJWC 2VIIA 4IEIA 3LLMA 3MSXA 2GBLC 1FTNA 1G18A 4AKIA 3GLGA 4RZUA 1KK0A 1XCGB 1TQ4A 5DN6A 4CRWB 3BIFA 3P20A 3AF4A 3I3SR 4PC7A 4A1FA 3ZZTA 2P0EA 6Q21A 3EC2A 2HJGA 3MAAC 4DLUA 1DG3A 2A3RA 4D4LA 2ONKA 2DWOA 4D6PA 4PX9A 4UXJA 4AWXA 1A7JA 5L3SB 3MGCA 1XD9A 1G7RA 3FOZA 3AVYA 3AP1A 3LO5A 3QPVA 5K8LA 3S1AA 3SC3A 1E0AA 3R7WA 2ZREA 3QJYA 4DXAA 3IBYA 2AX4A 1XD8A 3DM9B 1K5DA 4EFMA 1W36B 2O8BB 5HCNA 5HR5A 2R6CA 3BWDD 2H7VA 2XTZA 1US8A 2VTKA 2NPIA 3LAWA 4IHQA 5B58C 4HUTA 2VP9A 2W0SA 2Z4RA 1NJFA 4V0MA 1GSIA 1W2GA 2XNDA 2VSXA 1YVDA 1Q22A 3CUEF 3QG5A 4LK2A 4PC1A 4BRUA 5BN4A 2F1IA 3QY0A 4M2LA 1WXQA 2WKRA 3HYTA 1Z06A 2Q21A 5F9HA 4A36A 5HE8A 3ZDQA 1QVAA 1OB2A 1AKEA 2G3YA 4KXFB 3FPAA 5IK2A 3TUJC 4KSBA 3W3ZB 1T3LA 2CVHA 4LV5B 4L5BA 3T61A 1GRRA 3BS4A 1SVWA 5JI2E 4D4MA 1U98A 4AYXA 4D25A 1VPLA 5FR1A 3CNOA 1E9BA 3PEWA 1NLYA 1SQ5A 2IA5A 3WHKA 5EE3A 4HYYA 1NKSA 3A4LA 1S8FA 2K5UA 4TMZA 4RZ3A 4MRRA 2G0TA 1MO3A 4IFEA 3GJXC 5CDFE 1ZUHA 3VR5A 2GCOB 1OE0A 1E2PA 3PUYA 1KSHA 3KQNA 4G5SA 1R5OA 1XMVA 2LCFA 2WMNB 4JLAA 4FMCF 4ARZB 4LCBA 4O3MA 1Z6XA 4KU4A 1OFHA 4CEJA 3A4MA 1G7TA 2ZRBA 2BMDA 3L0PA 5DYGA 3ADKA 3GQBA 4B3FX 1JEEA 1KO4A 2NZJA 5EZ6B 2IX3A 1E79D 1DAIA 3EIEA 4CEHB 4AD8A 1W4RA 3AQ4A 3KKPA 3QG1A 2FSIA 1YR6A 4BLPA 5HKKA 5JJLA 1NMYA 2DFNA 2QTHA 1SGWA 3TW8B 1PLJA 4B3XA 4PAOA 1K8RA 2Q9AA 3A8TA 1SKQA 4DSOA 4BECA 1SVSA 1G3RA 4IEEA 3JVVA 3SQXA 2RGNA 2DCUA 2XSZD 5FTMA 1T0JB 1J8MF 1JJ7A 3MWLA 4EPTA 4PO8A 4WZ6A 4KITB 3QXCA 2ZR7A 3UKDA 2H1LA 4ASUA 3UG6A 4QC2A 1XTKA 1I2DA 1MKYA 4F93B 4OQLA 2XZLA 1COWA 1JALA 3BFVA 3ECCA 3R9WA 3U3MA 4GMXA 4WIAA 2J45A 4TT3D 1HE8B 1Z6GA 1TX4B 3CNNA 3PITA 2GJAA 5TY0A 2IS2A 1DAEA 2GAAA 2DYKA 5B57C 2VP5A 1H65A 2YWGA 4EPRA 1G9XA 1Q44A 4JSTA 1W1WA 2ZU6A 2ZJ2A 4GMDA 2C03A 5HE9A 2FJUA 5D3MA 2CJWA 3U44A 5AR1A 1QG2A 2C98A 1NLFA 3PIRA 2YC4C 2ZE6A 1EFRD 2AFHE 3HU1A 3EWAA 3ND9A 2ZRFA 5CM9C 1YZLA 2ZI5A 2J87A 2RGEA 1ZUIA 1JB1A 1DS6A 3ADCA 3OEED 4CGZA 3ND8A 3IUYA 2H8KA 4ON9A 4R2IA 1GM5A 5FTKA 2IYVA 1XCMA 2P5SA 3GLFB 2A5YB 4V02A 3K0FA 1E98A 1TU4A 3NBFA 4YC7A 4OYHA 1L4YA 2RH5A 3PEYA 3AVQA 1UFQA 3DVLA 2ZR9A 4UNSA 4F38A 2HXSA 1QBKC 3AUXA 3GJ6A 2H18A 1E1RD 1YQTA 3CWQA 1YRBA 4B47A 4NZYA 5SZHB 2IHYA 2REBA 4DDUA 4LYJA 3AVUA 4B6EA 4QGHA 1CR4A 1IN5A 4D81A 1W0KA 1KK1A 2W6JD 1B0UA 1CIPA 1DAGA 1ZM9A 3EG5A 3W3AA 4JJZA 3REGA 5KYKA 2YV5A 2J9RA 2WWGA 2C77A 4AIIA 1EK0A 3VU9B 1G17A 1CXZA 5EP3A 2BBSA 2ECKA 5FBLB 2A5GA 2NPFA 1DAFA 4G1UC 1FNNA 3KQLA 4I4LA 1GTVA 3QVUA 3WNDA 3QOFA 1M6NA 4P32A 1JR6A 1RRCA 1Q1QA 4Z51A 3BORA 1E2HA 4P31A 5HCIA 4LPSA 1OIWA 2GK7A 3C5CA 3VR4A 3IEVA 1OHHD 1JAHA 4W5WA 3WP0A 1LF0A 5JJKA 1JECA 3GEEA 4B3GA 4B34A 3V4FA 5AUNB 4E22A 4PHHA 1NBMA 1OXUA 2OO7A 2VH5R 5LD2C 1ETUA 1ZAKA 1RE0A 1QDEA 4QNRA 1AGRA 1NSFA 4KLNA 2NO1A 1G19A 5EZ5A 1GIAA 3TVTA 5J47A 5D3QA 1H8HD 5DNYB 2J0UB 3AVPA 3C16C 2UVQA 3KJEA 5J5CA 2FPLA 1GKIA 3CRMA 1D9ZA 2QPTA 4G5QA 4C7OB 4LWZA 1NN1A 4GP7A 3CRW1 2GBLA 1G8YA 1X6VA 2FH5B 1OPXA 1Z3IX 5JWHA 1O87A 1Z07A 4EPYA 3HP1A 1R2QA 3VNUA 3Q5EA 2FFAA 4Q9JA 3N5CA 5TB5A 2ORWA 4FXPA 1G6HA 2JLXA 3ZZ0A 5G41A 2ZRHA 5DI3B 4EAQA 2ANCA 5G53C 2J3EA 4IW3B 5GJVC 4PXAA 5F9FA 2R6AA 2P6UA 1HH4A 3GLGB 3LH5A 4C0SA 2NQ2C 1AA9A 4OK3A 3ZIAD 3P4YA 4QGGA 2FEOA 4WXPA 4HATA 1G21E 5KDOA 2BV3A 4QG7A 2PJZA 1BKDR 3W90A 2YVUA 1XPOA 2GEUA 5G3ZA 2GJ9A 5DISB 4Q7JB 4HZIA 1OFTA 2VO1A 4Q9IA 3TE6A 3TSOA 3W8NA 4MKIA 2VP4A 3NHBA 4LYHA 5JWOA 2Z5FA 3CR7A 4ZCMA 4Z8XA 1SZPA 3RS7A 1Q20A 2W2TA 1YZUA 5JECA 2WMOB 3W6NA 3S1AB 1AZSC 1II8A 1R0XA 2WIBA 3R7WB 4JLDA 4JS0A 4TMTA 2AR7A 2XAUA 4Q4LA 4DSTA 1WBDA 3AKDA 5CB6A 2HLDD 1NN3A 1MT0A 2F43A 1JNYA 2CNWA 1IN7A 1T4GA 4E03A 3KL4A 2FF7A 3GLHE 1S96A 3RDPA 4AKHA 1NVUQ 3KDSE 4W5HA 3GJ4A 2BEJA 1KZGB 3EWSA 2CL0X 1OV4A 4P3YA 1M2OB 3AV0B 2FA9A 4JL6A 4D4JA 1T3SA 3THWA 4URYR 3UMSA 3ZS9A 1Q1ZA 5JRZA 1SVKA 4FMDB 2ZETA 4H9GA 4RCYA 4BGDA 4TMVA 4PANA 3L2OB 1GNPA 1T5IA 2GEVA 1ZW6A 3MWYW 1U90A 2R6DA 4PFSA 2A7QA 3RS4A 4A2QA 2ZITA 4QRHA 1KDTA 2YOFA 2BM1A 3CZPA 4YMWA 1VECA 3ZD6A 4Q7MB 3PJRA 2YC2C 2EFGA 5KUTA 1I4LD 5JS7A 1E96A 4GPTA 3MRSA 3OESA 3HR7A 4JLKA 2I4IA 3UATA 4JLNA 1R10A 5FH9A 1D2EA 2QM8A 1MOZA 1KK2A 1IN4A 4P33A 3OFND 1N6HA 3KXIA 1VTKA 4GL2A 3WBKA 3BFKA 4GI7A 1XU4A 1R0ZA 2IEZA 1EX7A 2DHRA 2OCPA 2WJIA 3E5HA 4Q1DA 1JR3A 4PPNA 4D0GA 3WMGA 4UJ3A 5CYPA 4IXMA 1XP8A 4PTLA 3T06B 3ZH9B 4JJKA 2QL6A 1OH8A 1JEDA 3FMIA 4CEJB 3FB4A 1U8ZA 1W47A 5L3QA 2JCSA 3IO3A 3LD9A 1DEKA 4M1OA 2KSQA 2BBTA 2PEZA 4BEJA 2R65A 1CJVC 1XMSA 2O8FA 1XTQA 4CDGA 2XTNA 4U7DA 1GNRA 1SVOA 1E3MA 1EESA 3KB1A 1KO1A 4NCNA 4POAA 1XXHA 3THYA 3B78A 1N6NA 1NI3A 2OBNA 3Q3JB 3DMDA 4TTRA 5C2JB 1XNJA 3EPJA 1E9EA 2QTVB 1XBTA 2MSEB 2XJ4A 3K0CC 4MYUA 2QI9C 4Q9HA 1EGAA 4TMKA 1Z0DA 2AWOA 4HI0E 4TTQA 1KKMA 1XTRA 3L43A 4TQAA 1P9RA 3RNLA 4BFYA 1HT1E 4Q4JA 2QAGC 2BWJA 1HA3A 1QVRA 2CHQA 3QIAA 4YXWA 4OHZA 2ZSFA 4EPVA 3I5XA 4MGYR 1ZNZA 2EWVA 4Q7LA 3NBZC 5FTNA 1A82A 4S35A 4CIDA 2QA5A 3K9HA 3QE0A 4ZO4A 3GJ0A 1KY3A 3TUZC 1W4AA 4LBYA 4JVMA 2FGJA 2FV8A 5JHGB 5D3MB 1PZNA 3LNCA 3AM1A 2CJWB 4Z1MD 3U44B 2I3BA 4WVFA 4PSVA 1OIVA 1NIJA 5J4HA 3LV8A 2RAPA 5FTJA 1PLKA 4L9WA 3K8YA 2RGBA 4N1AA 3JVUA 2CLSA 4XJXA 2C99A 1W0JD 2QGZA 1E0JA 1R4AA 3U6KA 4TYQA 4LV8B 1KMHA 3K0FB 1O3YA 2QROA 3OEHA 3VNVA 1XWIA 5EE9A 4KFTA 3KKNA 2V7QD 2CK3A 3FHCB 2QEQA 1TNDA 1UEJA 3K9NA 3QBTA 4MYTA 2ZPTX 3AUYA 2OILA 2E1RA 1Z63A 3PVSA 1SKYE 1WRBA 3A4NA 3T1OA 3VTKA 4M9SA 1NN5A 1SXJB 3VR3A 1KHTA 3RS2A 2BCGY 4NONA 2GZAA 2FEMA 3B60A 4QNMA 5FR2A 2GESA 4V0NA 4DLSA 5JMTA 5TDHA 1ODFA 1ZC3A 4A15A 5G3YA 3ETLA 4URVR 3K9LA 1GFIA 3PQCA 2IWRA 2W58A 3E2IA 1Z08A 2YKGA 3O47A 3HWSA 2IUUA 4NMMA 4I1SA 1LFDB 3T35A 3TK1A 2D7CA 2J0SA 2J0VA 4TLCA 2HEIA 1FFHA 5L3RA 1ZYUA 1FP7A 2WPDA 4O2LA 2ZRIA 3UANA 1WA5A 4LHYA 4AURA 2VHJA 3OF5A 3LBIA 1T8UA 2ZSEA 1WCV1 4Y0VA 5CK5A 5DH9A 2F1RA 1E2JA 2OSBA 1P2SA 2WJHA 2VBCA 5FPTA 4OI2A 2QE7A 5DHFA 1UBFA 2F1HA 1NP6A 2GJSA 1UKEA 2GCNA 2IXGA 4PC2A 4XH9B 4ZKEA 4A8JC 2KJQA 2VP6A 4OHWA 2HF9A 4DUGA 2ZRKA 1KSJA 1TF2A 3EA0A 2D06A 3BH6A 2GTPA 3P26A 4GOJA 1W2HA 1F2UA 4NCKA 2CL6X 2JLYA 3N2EA 4V0KA 2ZEJA 3C8UA 1W44A 3GFPA 1JBKA 4Q66C 4XTRA 2V9PA 3B7GA 3SU8A 2ODBA 4IVQA 4OI4A 2JLQA 4MRVA 5LPNA 4QBIA 4FN5A 2ZUCA 3FMOB 1SVLA 3AP2A 3VMFA 4AKGA 2NG1A 3RAPR 2ZXUA 4YQFA 3EAQA 4C0AC 1E1QD 2BDTA 4TTPA 3B85A 2HT6A 2P6NA 2QENA 3LXXA 421PA 3O8CA 1P2TA 1JXOA 4FWIB 4TSFD 4EJSC 3MWJA 2QP4A 4MH0R 4DCSA 1Z22A 2PL3A 3FDIA 5FPSA 1TADA 2Q9BA 2NGRA 1AZTA 4A82A 3A1VA 2P67A 2ZJBA 3KTAA 4LDJA 1F60A 1TQ2A 1CKEA 2FZLA 2D2FA 4RKEA 1GZSA 1YR9A 2QQEA 3Q85A 2JJ2D 4O25A 3BFXA 3VKHA 3TW4A 1ZM3A 1EX6A 3RRMA 1UF9A 2X2EA 4F4IA 2ZQ5A 1E32A 4Q9LA 3CF2A 1II8B 4DLRA 2Z0MA 1DOAA 3R20A 3LFUA 3TH5A 1KOFA 3OAAA 3QKUA 4D0LB 4UXHA 4G5RA 4TZ6A 4Q4AA 2F43B 3DKPA 3W6PA 1DO2A 1HY3A 1ZCAA 2ZJAA 3L0IB 4XSGA 3VQTA 3QVVA 3QXSA 2ZS8A 1SVIA 4BASA 2FSGA 4LJ5A 4Z8YA 1DAMA 2UKDA 4KBGA 2DPXA 5DE3A 2OAP1 2IUSA 3THWB 2EYQA 2RGDA 2Q6TA 5AJVB 2OCBA 1NVVQ 1C4OA 2LKCA 4XVQA 1PV4A 4YDSA 3QPWA 2AD5A 1JJVA 2NZ8A 3IHWA 1TU3A 1ZRHA 3TBKA 1ZVQA 2AHOA 4U00A 3KJIA 3B9PA 3RSOA 3NTUA 2JLVA 1BYIA 4WZAE 4EKDA 2JDID 1G4UR 1QZXA 2FG5A 5FI0B 4FWTA 3ZD7A 4Q4HB 1N5KA 5SZIA 2VRWA 2B8WA 4UQOA 3QNUA 2O8EA 5E7IA 5DIFA 4BPBA 2W0MA 2OBMA 2VHCA 5AUOB 4NYJR 1Z0FA 2QPAA 3Q9LA 4B32A 1J7KA 1FUKA 1HEIA 2N42A 2IYLD 3HPQA 1PUJA 2JAQA 2O5VA 5LDDC 2IBMA 3TRFA 3HJNA 4BRWA 5KSYA 1XPRA 4GOXA 4URZR 2EFCB 1G5PA 1OB5A 3HU2A 2HYDA 1ZC4A 2JASA 3IIKA 4YLGA 4TLAA 1E9AA 5L3QB 3GLFE 2QU8A 1IN6A 4FMCB 3GLIE 1YZGA 2ASEA 2BIFA 2ZRLA 2O8FB 2G6BA 1S9DA 2ZAOA 4MGZR 4OK6A 3ZVLA 5KOYA 1V43A 1NKTA 3C41J 4M9XA 2D3WA 2ZE5A 1HV8A 3FMFA 3K0CA 1XXHB 2ZYWX 4TMXA 3THYB 3TGPA 2QBYB 1GILA 1BH2A 1W5TA 4P4TA 2JIZD 2V54A 3W6OA 2R62A 4A0GA 5C46F 1OH7A 3TIFA 4HLCA 3WY9A 2QAGA 4JIMA 2A5DA 1DTSA 4JBWA 4O2RA 1EFTA 1GG2A 3AKYA 1GVNB 4TZ0A 3CLVA 3NBXX 4RSGA 4IFBA 2ZM5A 3WMFA 1G291 1G8GA 1ZU4A 3RLFA 3CRVA 4Q4JB 2AK3A 2ZYVX 1VG9B 1LF5A 2QUZA 2ZU0C 5KPDA 1IXSB 1DARA 1Z2AA 4B2IA 4OHYA 3NG1A 1GAJA 4OK5A 1UKVY 2IC5A 4TT3A 1AS0A 4OI0A 1KJYA 1FOEB 4KAXA 4RD3A 1ZIOA 4JYCA 5CYOA 1XRJA 2I1QA 4QJ3A 2PMDA 4Q7KA 3VAAA 1VHLA 2GF0A 2VLIA 4L15A 2KI5A 3H86A 4MUBA 2CCJA 3K1JA 1K5GA 4DLVA 1IY1A 1EFRA 1L2TA 2FNAA 1H8ED 3KZ1E 4US0R 5TVKA 1TQDA 4AG6A 1XCPA 2QORA 3FHOA 1MO4A 1C9KA 1KIMA 4R71A 3GEIA 4OQFA 4C0LA 2SHKA 5HPYB 2O8CB 3A1SA 1TF7A 1LTQA 5EE0A 5EJEA 3FKQA 4U5XA 2ZI9A 3NH9A 1N6OA 4NYMQ 2D74A 4KODA 4II7A 4W5JA 5FBRB 2OFXA 3BB3A 5KTYA 3U4QA 2XXAA 1G3UA 2NMVA 1ZP6A 3RC3A 2CE2X 3B13B 3A1WA 4BQSA 4RKFA 1N6RA 3FFAA 2AXNA 1CJUC 1I4DD 1OKKD 4PPGA 4Q18A 4TMWA 2GWHA 1J99A 2RKOA 4EQ6A 2VL7A 4F92B 3V4RA 4PSKA 2V3CC 3FE2A 1E69A 2DWQA 1Q21A 4KLZA 3WMEA 5CJPA 3U3KA 3SOPA 4A2WA 2W6JA 3J81k 4OJKA 1TMKA 2FGKA 3NBYC 5ELXA 5SZJA 1V5WA 4UXIA 2H5EA 5AUPB 2IYWA 4OQNA 4TYNA 5C4MA 1DAKA 2IYSA 4CT5A 4HUQA 2ZRDA 4PO1A 4M8NE 3ZGXA 1YR7A 3CX6A 5FI1B 1FTSA 5AJZA 4XTCS 2ZYUX 4BUJA 3KQHA 1RRPA 2ZRGA 2BBWA 4DIEA 5CITA 2JLUA 1N3BA 2RB4A 3WRYC 3AF0A 5LD2B 3ZVNA 1WMSA 1G41A 1D9XA 2BC9A 3P27A 3GP8A 4Q1BA 2OESA 4IXNA 5KU1A 4RZ2A 1OHHA 1NG9A 4A8JA 1ZU5A 3D6TB 1X1SA 3K0EA 4KHZA 3H1TA 5IDVA 5F3WB 5JJIA 4GBMA 5IHPA 3D3QA 4BFZA 4AI6A 4URWR 1MABA 1RZ3A 2ZUBA 4EIWA 3AVWA 2WAYA 1NL3A 1GKUB 3L8YA 2C9YA 3I1FA 2ZAMA 1H8HA 5EQTA 1T3HA 5FUVA 3LW8A 1KDOA 1BMFD 1LV7A 1FMJA 1F2UB 3IHLA 4RFSA 1F3OA 2DY1A 4RCZA 2GJKA 3VX3A 4ZIRA 1A5TA 1NNEA 1N5JA 3GCGA 2NIPA 2E87A 4EJSA 1Z0JA 1QHHA 2ONJA 2AKAB 4NH0A 2F55A 4FCWA 2ZRJA 2D62A 3KQUA 1NVVR 2NO0A 2DBYA 3EZ2A 1N6KA 4E5UA 3L0SA 4ZDIA 3WXMA 4H1UA 2GF9A 3CH4B 4F4CA 1UM8A 2B92A 3SQWA 4ZCLA 4NBSA 3I61A 4EUNA 5DGXA 4M4SA 2Q9CA 1S1MA 1P9NA 2XEXA 4BFWA 3H0KA 4UNQA 1D2NA 2OT3B 1II9A 3HU3A 3ZIAA 2F3RA 2O52A 2CVFA 5EP1A 2ZRPA 2WKQA 3AB3A 1KNXA 1L8QA 2IF2A 4KFSA 2IS4A 3SNHA 1E4YA 5BQ5A 4X8MA 2FFBA 1CLUA 5TMPA 5A5GA 1IBRA 4Q21A 4MQBA 3F8TA 3GJ3A 4Q47A 4DKXA 3QF4A 3BOSA 4OHVA 2G1KA 4P4SA 1DE0A 3THXA 4TYYA 4C2UA 1KJWA 4NCHA 4V0OA 4LJ4A 3AGQA 4JLOA 4DLYA 1AM4D 2IF0A 5CLLA 2ZJZA 3LX8A 5BYKA 5UKDA 4Q4AB 2HLDA 2ZI3A 4IOMA 2GVZC 4HDCA 2CL7X 1NSTA 4TLEA 1Z5ZA 4KYUA 4B73A 3ASYA 2MSDB 3HYRA 1ZD9A 4GZLA 2ZRNA 3KKQA 3Q72A 1IY0A 1OIXA 1G4AE 4FIDA 1XX6A 4LY6A 2F9LA 5IF9A 3THOA 1G7SA 2F7SA 2WBLC 1UBEA 3PUWA 4M1YA 2CEAA 1ONBA 3GLHA 2PZEA 3SDZA 2P5TB 1LB1B 1KI8A 3ZQ6A 4D4KA 4Q03A 1Z2CA 2BMEA 2O8EB 2IYQA 2D4HA 5BXQC 1AQYA 3H4MA 3L82B 1SULA 3K0SA 5H70A 4MRNA 5EE5B 4KO8A 121PA 3R8CA 1QRAA 4L9SA 1CR2A 3KFVA 4HLDA 1MO5A 5CK4A 4JBXA 2OFWA 3B1VA 2F1JA 3DOFA 3Q8XB 3EX7C 1YU9A 3WYAA 1W48A 1OJLA 2PCLA 3DKVA 1J90A 5JSZA 2QT0A 2REXB 1YKSA 1LS6A 5KNBA 2G0NA 1N6LA 4NYIQ 2HCBA 4IDOA 5GJCA 4HLUC 5FOUA 1GRQA 1G8FA 1MR3F 4NKRA 1IJFA 1JPJA 3K9GA 4BEBA 4A0FA 4QGFA 3DMNA 3P32A 4L4UA 4MUAA 1KAGA 2IWHA 1E9SA 1X8LA 2CHGA 5DYIA 2QRNA 2WWHA 5C1BA 2PBRA 4LV6A 1N6IA 4EPWA 2V1XA 3UWOA 2W6IA 2PMKA 3JZAA 2G1JA 5KDLA 1SXJE 1VKJA 2PZFA 3C14C 3G5UA 4XD7A 2VP0A 4ACBA 1RRFA 2VP2A 4NYMR 2F9MA 2IYYA 3AP3A 1EWRA 2QAGB 1P6XA 2JJ1D 4AYTA 2G9NA 1WE2A 1Z29A 2WSSD 2JLWA 1GUAA 1R5BA 2YNMA 4IVPA 2AFIE 3T34A 2G88A 4BFTA 3RC8A 1US8B 4JL8A 5AK0A 1C1YA 2WVJA 4LC0A 4LHZA 3GEHA 1M7GA 4Z54A 1SXJD 3A37A 3T5DA 3TJZA 3PV0A 3IQWA 2QP3A 4EFLA 3PUZA 4QHSA 4N0DA 2AWNA 3IGFA 2XOKA 1DPFA 3SJCA 4YMTA 1NBME 4QFMA 3AVVA 3U3JA 4DHEA 3PENA 4DB2A 5E95A 1FZQA 4Z1MA 4NPHA 2QMEA 1KGDA 3UMRA 1U2RA 3WYGA 3FKSD 4QOSA 5EUMA 2WWYA 2FMXA 2FDCA 4ZDKA 2GKSA 4JL5A 1D8TA 3BB1A 4DCUA 1UBGA 2NOAA 3KJGA 1R7RA 5J4VA 1CRPA 1W0JA 3I32A 3I72A 1XD2A 1NBMD 2A5FA 2KBFA 3B1XA 4KV9A 5JI3E 5LBIA 3TSWA 4FI3C 4C0BA 3U4QB 2XXAB 1ZINA 2KB0A 3REFA 2EFDB 3B5JA 1HT2E 3RS0A 1GDDA 2F6RA 2OCYC 1G3MA 2V7QA 2RGGA 2J5XA 4LSGA 4C3ZA 3FMPB 3FHTA 1GL7A 3ZQJA 3C7KA 1AN0A 3R8FA 3CPJB 2HXYA 1VCMA 3DHWC 4LHWA 3SFZA 5KDDA 4A2PA 2EVWX 1BS1A 1G6OA 5JEEA 1W5SA 5FOWA 3UMFA 4QHTA 1CULC 2ATXA 1OLOA 3AVTA 1NMXA 4US1R 1P4SA 1W4CA 1GWNA 4A0RA 5JS8A 2BKUA 4HUQB 4KVAA 5E4FA 1X8KA 4LUCA 1QF9A 1JQJC 1OH5A 3FVQA 4X8HA 2ATVA 3QKRA 3U7EB 4P4UA 5FPKA 3QXJA 4PC6A 3F3YA 4QL3A 5KSPA 1FPMA 2ZS9A 4ZPXA 3HR8A 2IL1A 1N0WA 1XEFA 2Z83A 1XJ0A 3RVBA 5HZHA 3G0HA 3M6AA 1Z0IA 3FTQA 4A8JB 3QKSA 2X19A 1UEIA 4TL6A 3MG9A 1YZKA 2IW3A 5JBQA 3ZZUA 1CP2A 1VG8A 1MABB 5B2ZA 3EW9A 4DEXA 1N5IA 1ZIPA 3UIEA 1EFUA 5FL7D 1JAIA 3KUDA 3AVOA 2R2AA 1M8PA 2OAQ1 3GJ7A 1P9WA 4TL7A 4QHYA 3TKLA 4DRZA 2BMJA 4ZIRB 3QXHA 3B82A 3O8BA 4A9AA 1P60A 3I92A 3IIJA 2AN9A 4EJSB 1XFAA 1QHHB 4K8OA 2DFKB 3IDQA 5FUWA 3SYLA 4HAUA 2PX0A 2AL7A 2HT1A 2Q3MA 1SHZA 2EW1A 5P21A 2P3SA 5F98A 3K70B 1FP6A 4PHGA 1XB2A 3DPUA 5DI9A 4MYCA 1E1QA 2R6FA 5TV2A 4D82A 2RMKA 1JXMA 1S0UA 2CCGA 4ACAA 1DADA 3LDAA 4TSFA 5BN3A 4AYWA 3CF6R 1UDWA 2HJVA 5HTKA 1PLLA 2QMHA 4I1VA 3IEUA 4D0NA 2GETA 4TL8A 3DL0A 1IXRC 4M1TA 1ZD1A 4DCVA 4IRUB 5M04A 2JJ2A 3MLEA 1IY2A 3QXXA 3B6EA 3BD9A 4ZI2A 5JCZA 3NWJA 1ZM7A 2NO6A 4KBFA 1DBSA 2DFTA 5JHHB 5KNCA 3QF4B 5BWMA 2QMOA 4YONB 3E70C 4P4SB 3B9QA 3THXB 4OKSA 4KFUA 1HYQA 4DB4A 3MJRA 2P2LA 3M0EA 4KFRA 4B3DA 4B2PA 4DSNA 2ZE7A 5FUYA 1G8PA 5DO9A 1X1RA 5AUQA 2J7PD 4JVNA 2VSOA 1QG4A 3TMKA 3AF2A 3MWKA 4JYBA 5IT5A 2J41A 5JWRA 2ODWA 3HPRA 1XTSA 4DCTA 4OI1A 5EXXA 2ZI6A 3RWMB 4LPKA 3CX7A 3SHWA 1M34E 2WOOA 1JI0A 4HAWA 3B8HA 4FCVA 1G20E 1RFLA 2QN6A 1E9DA 2BBOA 4K81B 1GKYA 2CDNA 4GRAA 4UKDA 3TQCA 4BFUA 4D26A 1II0A 1U9IC 4BLRA 4RZXA 2GAOA 1MO6A 1QHYA 1NVWQ 1M1YE 1ESMA 2BMFA 4V03A 4HSEA 1MH1A 1Z6TA 5BN5A 1Z28A 2YJTD 3T1VA 5EXSA 1W36D 5CB8A 3QEOA 2IS1A 4EFNA 1R6BX 4AKEA 4C0HA 2P6RA 2JA1A 3I8XA 2JLRA 2KWIA 3SHFA 2CLDX 3N70A 3AVXA 3FWYA 4HLUA 2VHQA 4OJQA 1E94E 4YXWD 1YZTA 3U7FB 3G82C 2XITA 1IONA 2VHTA 1Z6AA 5JSZB 4MA4A 5FOXA 1J8YF 1KJZA 3EC1A 1RYHA 2HF8A 221PA 4QBFA 3LW7A 4HAVA 3A1TA 2BHRA 5LB4A 4B6FA 1LW7A 3ASZA 1Z0KA 5GVSA 2YHSA 1MV5A 5J4YA 3I4LA 2RGXA 2V6JA 2OHFA 4UNNA 1EG7A 1A2BA 1HQYE 2MMGA 4BE7B 4AY2A 3IO5A 4AC9A 4FINA 3GLFA 1N0VC 2FSHA 3OE7D 3OEHD 4IDQA 3SI7A 2NO7A 5EXTA 4EDHA 3U61B 1Q3HA 4YMVA 4DEYA 1DVRA 1VHTA 1EXMA 3GLIA 3A58B 2W2XA 2ZUDA 1L4UA 2OXRA 2YWFA 5B30A 1CBUA 2ZANA 2IHBA 4L16A 4RJLA 2J0QA 3EIQA 4JKIA 2WKPA 5EP2A 3O8DA 4A92A 5GADl 1IJEA 1TUEA 3EZFA 3EZ6A 2GJ8A 4QJ5A 4DDTA 3BAFA 4R2HA 1G3IA 1VIAA 4OL0A 5KSOA 3LVQE 2IYRA 1E2QA 1T8TA 2XGJA 2PJRA 1SHKA 2B21A 3KXKA 1KAOA 4URXR 1KMQA 4QBGB 3CH5A 5L8VA 4MKFA 4YMUA 3RSLA 4EPXA 4B2LA 1SXJC 4PPFA 2DWPA 5FBQB 2WHXA 1VDZA 3VU9A 2QM7A 3KFXA 4JVLA 1ZNYA 2QY9A 2PCJA 2WM9B 3CB4A 1KO8A 1G7CA 2FWRA 1S3GA 2C9OA 2BVNA 1FQKA 2WPDD 1H8EA 3CR8A 2J46A 4R9UC 1KI2A 1N2CE 2FFQA 4M9ZA 5FTLA 3QKTA 1RIFA 1N5LA 4N0EA 3SJBA 1UJ2A 2NTYC 2A78A 3SJAA 1TUIA 2AD1A 2IEYA 2ORIA 4G5GA 1CEEA 1XD2B 1IXZA 4B71A 4GT1A 1KI7A 3SYKA 4F4JA 3PUVA 1EFHA 3SBEA 1UKYA 1X8JA 4PZYA 3VR6A 3NXSA 1BO6A 1XMIA 5K8UA 2OUKA 821PA 4GP6A 1U0LA 4FD2A 2WIAA 1AS2A 3LVRE 2QTFA 3PCRB 2J0UA 5EE1A 1XEXA 1T5LA 2XB2A 1E79A 1W4BA 2OBLA 4YDHB 3WRXC 5FL3A 3B2EA 3PXGA 2YINC 1OYWA 1P5ZB 4RY2A 1G1MA 4CF7A 2IYUA 4JLVA 3NDBB 5CDFA 4B3CA 4JSYA 5AJYA 4TQ9A 1AS3A 1U0HC 4IOJA 5KHOC 5DSZA 3U3OA 2YZ2A 4OHXA 2XB4A 1K6MA 5AJWA 2IYXA 4B35A 3UK6A 3B1YA 3QKRB 4Q00A 3IKJA 3VHLB 1OW3B 1NLZA 2QP9X 2XSZA 1TEXA 1SKYB 3BXZA 1OXTA 2BEKA 2Q3FA 1GL6A 3IPXA 1OFIA 5BYJA 5JRJA 3D31A 4Q1EA 2GCPA 4TYPA 2EFEB 1BYUA 3QKSB 4J0QA 2AK2A 4TN1A 3CBQA 5H68A 5C4GB 3GMTA 2V8OA 2D7DA 2ZRMA 1GL9B 1RJ9A 2IYTA 1AJEA 1F2TA 1YHNA 3P4XA 2VEDA 2UZ3A 3TUIC 1P2UA 2GDJA 2GXSA 3OAAD 3NH6A 4BFXA 3ADBA 4PC3A 4IDPA 2G77B 5KNDA 2ZSAA 3WNCA 1P7CA 1BMFA 2Z6VA 2O0HA 3A36A 2XZOA 4XVRA 1A2KC 3BRWD 4DSUA 4HB3A 3NEJA 1QHGA 4ILEA 5TXGA 2E9SA 1RYFA 2HDNB 4XSHA 3QI2A 1GP2A 4U02A 4WAUA 1JPNA 2GNOA 2H17A 3D8BA 3U2QA 4C30A 2VA8A 3OEEA 3E1SA 4Q1CA 5TARA 4LC1A 1XTIA 1Z0AA 4LJ8A 1KMHB 4MKHA 4CVNA 2Z43A 3L8ZA 4LZZA 4DBLC 2W2VA 1E9CA 4KYIB 4QM7A 1ZD8A 2PZGA 3LLUA 1LVGA 1IM2A 2WWIA 2ZR0A 1KI6A 2JATA 2N46A 1E1RA 3EZ9A 3GLGE 5AWFC 1CR1A 1NG1A 3MMPA 3CPHA 2YOGA 4I99A 1FX0A 2PLRA 1CRQA 1KTVA 3OHMA 4JLBA 4YMSA 4B3BA 1ANKA 3DO6A 4DJTA 4KSCA 1TPZA 2C5LA 4M1SA 3UWKA 3B1ZA 4RD1A 3U3RA 2J59A 3IQXA 3RHFA 3UXMA 4I1OA 4KI0A 1KNQA 1M7BA 5DHAA 1BIFA 2V4ZA 3ONWA 5FFMA 4D80A 1KO5A 3MCAA 1J70A 4DC9A 3KQKA 5EUQB 1GRNA 3SJZA 4TYWA 2C04A 3DM5A 4GZMA 3TNFA 3CF0A 4S2EA 4HDOB 4NCIA 2Y8EA 5DN6D 1DG1G 4PHFA 2MMCA 1XEWY 3DZ8A 1GOTA 2VQSA 3Q5DA 1U9IA 1WQ1R 3NC1C 1E2KA 4URUR 4QGAA 3A1UA 4ABYA 4ZV4A 5A4JA 3PUXA 1QHXA 2C2HA 4MKGA 1FL9A 4HB0A 4BLOA 1HE1C 1ESNA 1VG1A 1RRGA 2OXCA 2JGNA 4QBHA 2XNSA 4JVSB 4V0ME 4C2TA 1S2MA 2TMKA 3V9PA 2WTUA 4A6XA 4F91B 4K46A 2C96A 4KCGA 4WA7A 3U5ZB 2V6IA 2ZI7A 2EYUA 2FPKA 5H8WA 2ZRAA 4WXRA 4E07A 2Z4SA 1RC8A 4JBYA 3C15C 1LY1A 1Y63A 4NU0A 3GPLA 3X1XA 4GDFA 2O8DA 2WAXA 1LS1A 2GILA 3WBJA 3BERA 4XWOA 2KE5A 2WWXA 2VF7A 2OM2A 2V55B 1KI1A 2XNDD 4LYAA 2PX3A 4O0MA 4Q1AA 3V00A 1JQLB 5J40A 3SFVA 3TR0A 1W36C 4WW0A 4B76A 2IXFA 1DELA 2BCJQ 3QENA 3X1YA 5IK2D 1IQPA 3LX5A 3TLXA 4C4PA 1HUQA 3DOEA 2FU5C 2EWWA 2GZDA 621PA 2FFHA 1KDPA 4IVRA 3KTAB 3MJHA 3GD7A 4Q48A 2CBZA 4DLWA 2QAJA 4HZUA 4OQMA 2Q3HA 3IBGA 1DO0A 1ZM4A 1I2MA 1KZ7B 4LBVA 3QUSA 4RD6A 3W5JA 3ZJYA 2UZIR 2XTMA 4X8LA 4PAQA 2NO9A 1KDRA 1G16A 3KXLA 5EP4A 3FGNA 3AKCA 1NY5A 3A6PC 4G01B 5KSZA 3L0OA 3CIOA 4QXAA 5E7JA 4DLXA 2GHIA 2OE2A 3CNLA 2ORVA 2H92A 2ZSBA 1S1CA 2WJGA 3MFYA 3CX8A 3GLIB 1NMZA 4ZI3A 2JJ1A 3QBVA 1OFUX 2ODNA 1VCOA 2WSSA 1AK2A 2VHUA 4H1VA 2QMUA 2QGNA 2BM0A 3GFOA 2W83A 3OIWA 5GJBA 3NKVA 4MYHA 3ZVMA 1SXJA 1G5RA 1SVMA 5HKKD 3X1ZA 3BK7A 1Q1EA 4DWJA 1U0JA 4M1MA 2PLFA 1G8HA 3X1WA 4PAMA 1AGPA 3OIVA 1E99A 5FUXA 4JT2A 4QM6A 1CF4A 4Q19A 4WBSA 4PQRA 2DR3A 1UPTA 3MUFA 1R8QA 3NVAA 1MRNA 2RCNA 4B75A 2FSFA 1U8AA 2PH1A 3KJHA 3FKSA 1WB9A 3W5IA 1E2NA 1D5CA 4ASUD 4W9MC 1KK3A 4M53A 2AXPA 2OEPA 2X2FA 1CJMA 4NTZA 3OFNA 2A9KA 1E2IA 1TTTA 1N25A 2IK8A 3I62A 1COWD 1E9RA 2HCJB 1KSGA 3BC1A 2QZ4A 1XMJA 3IILA 4JKYA 4PSAA 3U7HB 3KB2A 3QEJA 1XJQA 3K0AA 3T5GA 4DT1A 4QJ4A 2JLSA 2R6GA 4CEIA 1VG0B 1XTJA 3BH0A 4M9QA 3QSYA 2WOJA 3LXRA 4NDZA 3SS8A 2HV8A 4BZPA 1TQ6A 1GNQA 4ZKDA 2RHDA 4Q1FA 2REOA 3BJIC 3CM0A 721PA 1XEXB 2O0JA 3SEAA 2PEYA 1E0KA 4TLBA 1UAAA 4N3NA 1Q57A 2GK6A 4FCTA 4R7ZA 5CJ2A 1T6NA 1P73A 2X77A 4E09A 1UADA 1GITA 3C4JA 4ERNA 4ESVA 5SZKB 3AEZA 1RVDA 1IN8A 2YWEA 3RS5A 4XIGS 2GA8A 3GJ5A 3K70D 4GSYA 2IS6A 2ZE8A 4IOLA 1R8SA 2C95A 4LJ7A 1KSFX 3BGWA 2C9CA 4PHTA 4MGIR 4JLPA 4Q9KA 3SN6A 2OZEA 3KKOA 2QSYA 1OXVA 2CE7A 2VF8A 4NE2A 1FW6A 2KBEA 1E2MA 4LHXA 4DLZA 2X8AA 2J7KA 4CW7A 2OG2A 1CR0A 3ICQB 2WZQA 3AKEA 4JLJA 3K09C 2XJ9A 1A1VA 3CZQA 3T12A 1WBBA 1RJ9B 1W0KD 3DEFA 5CLQA 1F2TB 1XF9A 1Y3AA 4ESHA 4LBZA 1TL7C 1ELOA 2Q0HA 5EXPA 2GRJA 2B8TA 1E2DA 5FL7A 1IHUA 4RFVA 1XEWX 4MDEA 2QSZA 2R9VA 4BFVA 4UNPA 3RRYA 1ZNXA 1G5TA 3B1WA 4AG5A 4HLQB 1ZM2A 1VCIA 1YE8A 3X2SA 3SE0A 2VYFA 2B6HA 3GFTA 1E6CA 4LRWA 1OT3A 2DB3A 5HZKA 2H57A 1VIYA 5BW8A 3AF1A 1HQCA 2ERXA 4HAXA 1NRJB 2QRZA 5ANRB 1AQUA 2ZJ5A 2IUTA 2OCAA 4TLDA 1OSNA 4MDFA 1D6JA 2B7BA 2BOVA 2C8VA 5JEDA 3SZRA 1T0HB 1N0UA 2FZ4A 5E7MA 4TWZA 1W49A 4HB2A 3H84A 3RYTC 4ZCIA 2CXXA 1YR8A 4KVGA 3NIBA 1KI6B 2ERYA 3NHAA 4M1KA 1A4RA 4Q4HA 2B7CA 4GNKA 1UDXA 3EARA 4EQ6B 5J4LA 3T1QA 3CO5A 3H2YA 1FX0B 1U81A 3PG5A 5JZVA 2LKDA 4JZKA 4V0LA 2ZSDA 3RANA 1YJ5A 3U6BA 3D7MA 3AGPA 4G5OA 2GXQA 3W34A 3VKGA 1XZQA 2OLJA 1OH6A 3AH8A 2ZI4A 4LI0A 5FPYA 5FOVA 4IOKA 2J7PA 3DZDA 3QPUA 1KI3A 1OXXK 2QNRA 1U99A 4B33A 1KI9A 1CJTC 2XX3A 4GOKA 2ZROA 1NY6A 3OIUA 3KX2A 3VR2A 4PZLA 1XJCA 2ANBA 2ZVQX 3CW2A 4PZZA 3WHLA 4MRSA 4BLSA 3CRQA 3P1JA 3F5FA 5FBWB 3SR0A 2W6ID 2ZJOA 1E2EA 1W46A 2QBYA 1TAGA 1MRSA 3F0TA 4MITA 5FBVB 5L3SA 2IYZA 4X8OA 1TF5A 2LWIA 2ZTSA 3BBPA 4XD7D 521PA 4DVGA 2VSFA 3Q7QA 3Q7PA 4F7WA 1U8YA 3LBNA 4Q02A 3BH7A 2ZIAA 3LY5A 1ZJ6A 1CTQA 2QG6A 1FUUA 3JZMA 1S9HA 3SYNA 1VMAA 2YOHA 3AF3A 4ZDJA 2QT1A 2O8BA 1ZCBA 2CNWD 4PR0A 4RFSB 2O8DB 4FMDF 3FYHA 4NYJQ 3OZXA 1E2GA 3ICEA 4HDQB 4A0HA 2I1VB 2WV9A 2BJVA 2QQ0A 1VYUA 1KKLA 2L0XA 4LGMA 4UJ5A 4DCNA 1M74A 1WP9A 2GZHA 2OLKA 5G40A 4ZDWA 4WOPA 4FMBB 3PEUA 2XOKD 2GXAA 4P0TA 1Q1BA 2A30A 1S4QA 3QF7A 3TVDA 3UG7A 1JR3E 3WYFA 1KI4A 1P61B 2RHMA 2FN4A 4TL9A 5LB2A 4HZUB 1NN0A 2GXUA 3BB4A 2CHVA 2JEOA 2J1LA 3GJ8A 2OFOA 1E9FA 2ODEA 4M0LA 3U7GA 1KYIA 1ZUNB 1PVOA 3KUCA 5FPHA 4W7SA 2HYIC 3R9IA 2WJVA 2O8CA 1J2JA 1OXSC 1F6BA 2AKYA 1VYVA 2FOLA 4LHVA 2FX3A 5A0FA 3FFBA 4MGKR 3OE7A 2GCOA 5H1YA 4CZ2A 4RVCA 1JR3D 5C18A 3ADDA 5CIWA 4B43A
chains in the Genus database with same CATH superfamily
4GXTA 4DZZA 1FU8A 3ZOKA 1GG8A 1LSJA 1QLJA 2EQBA 1Z73A 1G21B 1UKZA 2R66A 3GIDA 1RP1A 1IVYA 1ISGA 3OZGA 3TCXB 5CAEB 4WZBE 5CHEA 3B8EA 1Z6YA 3EPHA 1QYIA 4B4VA 1EFVA 1QZUA 2JIRA 1PJRA 3CTPA 4HAYA 2ZRQA 1QHIA 3QYJA 4BMSA 3LBHA 1JFFA 2IV2X 3BHNA 1UBUS 4DDWA 3L3BA 5CA1A 4YRZA 3CWZA 3RAFC 1WF3A 4AJNA 2PT7A 2JGDB 1X9HA 1TC1A 3DDCA 1QR2A 3IBSA 3EZ7A 4IDAA 2XDQB 5JNLA 1JN0A 2P90A 1MEJA 5JALA 3MOGA 4PZ9A 4DRXB 3EVGA 3I39X 3RS3A 3R9XA 4LVOA 4Y0AA 4W1SA 4XIIA 2VVTA 4HAZA 2YV1A 4R01A 1I2CA 1ODKA 3CONA 4K03A 3WZLA 4XVUA 5EJ5A 5JFGA 1PDVA 3CE9A 4L9RA 4HEQA 1DSSG 1K9VF 4S0ZA 1P31A 4MWZA 4RF5A 2I4OA 1G3QA 5EPUA 2R47A 2R84A 5IBRA 2NXWA 3O3NB 4OQQA 1WO8A 2PT5A 1JWBB 1VYTA 1ZA1A 2BKEA 3FDZB 3R6DA 1ZBDA 4AT1A 3ZHQA 4N9WA 4BWYA 4LX0A 4AKTA 1N77A 1UBCA 3K0AB 4GD3Q 4LYFA 4XA8A 1M7HA 1KC1A 3UT0A 3WGGA 4DIDA 3I4FA 1E64A 5JU6A 1G1AA 3VR4H 4QARA 1N2HA 4IKEA 1POWA 2VJAA 3HB9A 2JBAB 2ZJ8A 3OCUA 1SIUA 1PWYE 1ZGHA 3H0CA 3HB4X 3DE7X 3HKCB 1IPHA 4JB3A 1NIPA 1SC6A 3L07A 4RD4A 5A3VA 3T15A 5AESA 3IKLA 2F3TA 1C7JA 1FEZA 3H2SA 3I2KA 4RVGA 4NBLA 3ZE9A 5AVSA 5JAPA 4LNUB 4MS3A 5I7FA 4WEQA 4LHSA 3C3BA 2P5UA 1V3UA 3DV2A 1YRWA 2DECA 2NQ8A 3CKLA 1ZMXA 3R5SA 1NT2A 4ZI7A 2CT8A 1PJ8A 1CY4A 1XDZA 4AW9A 2ATCA 5AI5A 1P3JA 3DLIA 2P65A 1S3SA 4ARIA 3GCZA 2ZIZA 3TR6A 4YCLA 3KUXA 4YT2A 5B3LA 1U11A 2FMFA 2JGEA 3ZKAA 2JIZA 4MCIA 1PN3A 1ACMA 4EM6A 2W6ZA 4NMWA 4QYSA 2ZSIA 4BC1A 1V9CA 4JT4A 3ST7A 5DXJA 4MUGA 3GAMA 4WCFC 2WLSA 1T3ZA 4JFRA 1AKYA 1REQB 3P0HA 3G6WA 1D03A 3T4EA 4TUYF 1VRCA 4DSAA 3NC0C 2PPLA 1QQTA 4BZQA 5L3VA 2E5FA 1G0OA 2R1TA 4CNBA 5IMBA 5LC1A 3K5WA 4OQXA 4V2IA 1MTOA 4M21A 3WWCA 1HURA 1VI2A 3X1JA 3HDTA 3EIXA 4I81A 1XDBA 4O2AF 4P7GA 5KNCD 1T91A 3AW8A 3GI1A 3VPGA 1MB9A 1TYEB 3DEAA 4F3YA 3WQRA 4Q01A 4JXXA 3TIVA 3ZDYB 4TS3A 2WJ4A 1JKFA 1U5BA 5AHOA 4YPFA 2Z2XA 2XKBA 2PGXA 4DMKA 4ONEA 1I10A 1D3AA 3VHXA 5K8IA 3WAKA 1X7DA 4LJ6A 5E3HA 3CU5A 1ZRNA 3I0NA 1ESZA 4LOAA 2EZUA 2PSFA 3BRWA 3EPLA 3VU1A 4Y9UA 2WZBA 2HK9A 3TQTA 1U2DC 3VAZA 3B6MA 5FOSA 5IC5A 3RABA 1PUIA 4KNWA 3O8OA 1A8PA 1U0OC 2PUEA 2I33A 1QAQA 2EW2A 2ET6A 2I1WA 2VN8A 2FEWB 2XWBF 4OV6B 5DHTA 2OLEA 1BE8A 2QVLA 5CU7A 1E0SA 1CY7A 1ST2A 3E9DA 3I8SA 3R2JA 1E4VA 4XOIA 1Q3TA 3ZUGA 4HDRA 4PBRA 2Q2OA 3GUVA 1B8UA 1JE0A 4PG6A 5H0IA 3VDXA 3SNKA 4KWTA 2VYVA 4K5QA 5AM0A 4AJJA 1CU1A 2BH9A 1FQJA 4LJRA 3DR5A 5U1PA 4RTNA 2BFOA 1M2EA 4AVYA 5JW6A 5ALTA 4CT4B 1SAYA 5CB4B 1N6PA 4WLOA 5ADWA 3HI6A 5JDIC 2X1VA 3EEQA 5AH0A 5CPBA 1WKCA 3RRZA 3PQ7A 2OV6A 4KMRA 4C7OA 1BVRA 3N0TA 2LIPA 3ZGYA 3KKEA 3ZLJA 1VMIA 4HYTA 4I5GA 4KJZA 1Q1NA 1DCMA 2C2ZA 1GA6A 2ZJYA 3JASA 4G89A 5H3HA 1RHUA 2D2EA 1SZDA 5DMXA 5I7SA 3QQ5A 4M89A 1JR2A 5IJXA 1FVOA 1FS4A 3L7IA 1RSZA 2M98A 4K9KA 4MVJA 4XJTA 1H85A 4Y3UA 1Q0SA 2VIIA 2A84A 2CVQA 3LLMA 4RCVA 4W1RA 3TTVA 1G18A 4NOLA 3MAJA 4GL4A 4OVKA 5F76A 4N7JA 1KK0A 1QPGA 1XCGB 2FHPA 1TQ4A 4JI2B 4CRWB 4RU1A 2GAJA 5DM70 2JFOA 3EDMA 1M2JA 2HL6A 2JHPA 5HWSA 3MAAC 3B9RA 1DG3A 2FCRA 1PVDA 4R8VA 4ZYWA 1GZ4A 1NFRA 3RLIA 3R6GA 3BXHA 4FQ5A 3QUBA 4WECA 2EQAA 3FVWA 4UOEA 3A2KA 1ICIA 3CLRC 4BMXA 1NOJA 2NX2A 4HDSB 7MHTA 3H9JA 2I4RA 1E0AA 2DZDA 4N6NA 2Y6UA 1IZ8A 5BPFA 4DXAA 5TQ2A 4TV8F 1FS6A 4YAUA 3NTQA 1K5DA 1RZUA 1W36B 2FZWA 4JA2A 1BD4A 5KVQA 3GZTB 2BY4A 4AUMA 2G1AA 3PLRA 1Z7YA 1U7WA 2I87A 3LAWA 5E9QA 5B58C 3ZGZA 3VYUB 4MW4A 5C5CA 2Z4RA 4NBVA 3A32A 2VSXA 1DQSA 1HORA 2JAWA 3QG5A 4BKPA 1ZD5A 2Z1DA 3AOEC 4H4DA 5BN4A 2WHRA 4RHXA 4NCXA 5CUQA 5L7YA 3C3MA 3J80A 3F7MA 3GH1A 3HYTA 2Q21A 4A36A 4G5XA 3ZDQA 1AKEA 3W3ZB 3WMRA 1L4EA 4H4EA 4KSBA 4MMXB 1Q0TA 1B8NA 5D1HA 3RBXA 1CIJA 1HFWA 1URPA 3G79A 4CG0A 1MOSA 2R5FA 2PWBA 4IFIA 1ODLA 2WF7A 3EGXB 4G1CA 4AYXA 4D25A 1E1DA 2DQ4A 3PU6A 2I65A 3BILA 5FR1A 5LP6C 3WMWA 1E9BA 5JCOC 5KYTA 1NLYA 1SQ5A 3B53X 1OLSA 3ETHA 3WHKA 1LLDA 1GO2A 3ZCXA 4Z49A 1HSZA 3VOAA 1RYMA 4HYYA 1NKSA 2DKNA 2K5UA 4M1ZA 4OTZA 4RZ3A 4GRIA 4UEWA 4IS3A 2G0TA 2V5UA 1D1SA 1MO3A 4D9NA 2AMYA 2HJSA 2Q3CA 3GJXC 4IFEA 4LRSB 4M0UA 5G02A 2YX1A 4YAEA 3V80A 1TZKA 2IHUA 2TS1A 3VR5A 5F3RA 2SCUB 2IODA 3NYRA 3KQNA 3CMCO 5FT9A 1V3TA 1R5OA 1XMVA 1T1IA 1SBYA 4FMCF 1GYQA 1TO2E 1YACA 2ZZKA 3MMXA 4LZLA 1Z6XA 4MW9A 2XMGA 3SS7X 4EI2A 5TGDA 1UBTS 2BMDA 3MWDA 2MYTA 4LF6B 1D4FA 2PSEA 1BXGA 1AX9A 2QN9A 3I58A 1DAIA 1IQUA 3EIEA 1V9LA 1THZA 2EIXA 4U2EA 2PWPA 9LDTA 4G2NA 4B4WA 3KAQA 5AIBA 5GONA 1W4RA 3GD5A 4TXMA 1I7PA 1NMYA 4PLVA 4LWQA 1FLAA 1ZOLA 3WI7A 3C3PA 1BFDA 4OU4A 1PLJA 4ZZ1A 2H48A 4BMPB 2Q9AA 3PFNA 4H31A 3FR8A 1EFPA 4XGRA 2ENUA 1SVSA 2H08A 3QW2A 4HO1X 3VI4B 3W6ZA 1P4HA 4JSRA 1T5OA 2PT9A 4RF3A 2EWMA 2DCUA 4HGNA 4Q3AA 5FTMA 4IIGA 5BNFA 5LZ4A 3L8CA 5LUBA 4EPTA 4F8EA 1Y8AA 1Q7RA 4G37A 4RTRA 3UHPA 5CVVA 5EKTA 1AK1A 4WKOA 4EITA 4M36A 3NBMA 4EQZA 2X0FA 1RDFA 1XTKA 1UAYA 4PYIA 5CM2Z 4BCBA 1NDQA 3HFJA 1YKFA 4OQLA 5BW5A 3M3DA 1JALA 3D7LA 1XWFA 4LXYA 3U3MA 1E3SA 2HWWA 4GMXA 4P4LA 3LIPA 2AC4A 5IJ0B 4AIRA 4FYYA 1K8ZB 1HE8B 2IS2A 1TX4B 2JBHA 3INGA 2DYKA 3FROA 2YWGA 2J5QA 3KZMA 4C4OA 3IP7A 1W1IA 4EPRA 2HAEA 1MJGA 1OAAA 3H75A 4U0JA 5REQA 1Q7EA 3P9XA 1H0SA 1M0WA 3MF4A 5HE9A 5D3MA 5ALFA 3DAOA 4W6QA 1ORVA 5ER6A 2GZSA 1QG2A 3GMSA 3O8LA 4C1NA 4ERXA 3U44A 1YA6A 1U6IA 1YB1A 3AK4A 1J5XA 4BV9A 2XNJA 2ODQA 2NNLD 4N12A 2L42A 5CM9C 3BPSA 2I7TA 3VO1A 2WUWE 3T3MB 2RGEA 2JH9A 2Z9DA 3P4UA 4RTMA 2NPOA 4JELA 4WCFA 4CMIB 4CGZA 4HNSA 4MZDA 2E4UA 2E4YA 4ON9A 2RH9B 2EXXA 4R2IA 4UHCA 3JWGA 3NONA 3C43A 5FTKA 3HM9A 2ORYA 2A5YB 1QORA 2ZSUA 2QY6A 3K0FA 4YC7A 2Z2JA 4KW7A 2PMEA 5FWNA 5ED4A 1ISSA 4AN1A 1BEZA 4G67A 5J2UA 4CHGA 3AVQA 1O94D 4NDNE 3DVLA 1VM6A 2ZR9A 4UNSA 4M55A 1UPCA 1SKAA 2HXSA 1QBKC 5LWQA 1THGA 1GTSA 2VF5X 4PFJA 5HFNA 3WYCA 1YQTA 3KEFA 4CM9A 4NU6A 1GQQA 3RFFA 4F3RA 3G1WA 4B47A 2DU8A 4NZYA 3LA8A 5SZHB 1ETHA 3HGQA 2FK7A 3O75A 4LYJA 4WKCA 4L22A 4QUKA 3AVUA 2JS7A 3S2SA 5DW0A 5BNIA 1MVLA 3HUTA 3ITDA 4EF6A 3WOVA 1C9EA 1JFTA 4YRDA 1SXIA 2V7UA 3DT9A 3EG5A 4JJZA 4JJ7A 2Q9UA 5AI8A 5K03A 2IJGX 2YV5A 2J9RA 3C7CB 1I1HA 1RP7A 2WWGA 3ICWA 3OQHA 4UEJA 5D7NA 1U2DA 5AKEA 1BG6A 5TSDA 3K1AB 4P35A 3L7CA 5F1KA 3X44A 1TAUA 1RYYA 4CIAA 1G17A 1Y0BA 1Q0LA 1HKUA 2HZ7A 2R8OA 2BELA 2ECKA 2NAPA 3BWVA 3HBAA 5FBLB 3ZWYA 2A5GA 1AUOA 2YXBA 4REQB 2NPFA 1DAFA 1FDVA 1QO0A 1FNNA 3KQLA 3ZYZA 3QVUA 4YHBA 3QOFA 3K71B 1DQNA 3PGXA 4I5IA 4LTNA 3OX1A 3FOAA 4LOLA 1TJYA 1T9CA 3U17A 5CP8A 4A73A 5E2AA 2V7VA 2CFIA 5HCIA 5BV7A 5ES4B 3IEVA 4DG9A 3FWPA 4TWRA 5G0TA 5JPDA 1F0YA 3V4FA 4E22A 3GDHA 4IO1A 1UC9A 1RLIA 1OXUA 4X45A 5CFPA 3GEMA 5JDIA 3EMVA 3B38A 1QDEA 2DP4E 1OX6A 2V4UA 4DPMA 1F20A 1KH2A 1ZD4A 3TS1A 1ADCA 1ML3A 5EZ5A 3SP1A 3T5PA 1H5UA 5I9BA 1HPLA 5J47A 1H8HD 2WNSA 3UJNA 3AVPA 1AE1A 1CK4A 2P68A 5AW2A 1NR7A 2A1IA 1YA4A 4UHBA 3WL7A 1I7DA 3R4VA 2GPNA 1GKIA 4JQYA 3CRMA 1U0BB 3PGA1 4Q6BA 3KV3O 1D9ZA 1T9KA 4G5QA 5ESDA 5DU2A 1AKNA 3LUFA 2M9MA 3E03A 1BVHA 3TLZA 1PX2A 2QW1A 4FN4A 1OPXA 4MUIA 3WLNA 3CIFA 3UAGA 3PHCA 4M6WB 1KQNA 4BO5A 1C9MA 1E8NA 5TB5A 2ORWA 3E9ZA 5A4KA 1CQZA 3L46A 3ANLA 2JLXA 1XTTA 1VLQA 5FA5A 2E0IA 4Z4IA 5G53C 2J3EA 1LRLA 2XMQA 4PEVA 3RASA 4RX1A 4X1KB 3JR3A 4XSVA 3VDNB 1LVHA 3GLGB 1G2PA 4G26A 1E4EA 2FDXA 2YH2A 4YIHA 5JH7B 3ZXXA 1DZIA 1AA9A 3GFSA 3P4YA 3AIOA 3W1VA 4MVJG 2J3MA 1L4MA 1I8TA 5BQPA 5GTDA 2OXFA 1UQUA 2PJZA 4XGKA 3W90A 4INOA 4MV4A 2GEUA 1GGHA 1R37A 4DAOA 1WW3A 3O3CA 4EB6B 4MR8B 4M38A 1OFTA 2VO1A 3N7UA 4Y9RA 3TB6A 3TSOA 3W8NA 3N76A 3OJOA 4MKIA 5IJ9B 4Q3DA 3HZHA 4LYHA 3T3IA 5INTA 4ZCMA 5JWOA 1KEZA 1WDWB 5DHSA 4ZO7A 2I66A 5JECA 1KQGA 2HK8A 3W6NA 3UCFA 3AY7A 1AZSC 1XA3A 1R0XA 2WIBA 2X7HA 4DSTA 2UU9B 4TMTA 2AR7A 1FFSA 2XAUA 1M0EA 1QE3A 4PE5B 1IUNA 2HQOA 5K20A 1CUYA 1OWOA 4IEFB 3OQMA 2QLFA 1S7CA 3PA6A 4AZ0A 3UBTA 3AOEA 1R6VA 1XRMA 3AZQA 3EXHC 4X90A 2FFJA 1IN7A 1T4GA 4E03A 3AI2A 3IUEA 4K0KB 1S96A 5F3DA 3RDPA 1SIOA 1NVUQ 2W2KA 3JQQA 1STOA 3GJ4A 3O03A 4AJ2A 6PFKA 2SBTA 1IIRA 5HS6A 5K3SA 4LXGA 3X2FA 5HJEA 3NAQA 2HOQA 4D4JA 3THWA 3HXQA 3ISJA 4URYR 2QTGA 3DB1A 1I36A 1NGSA 2KQUA 4RCYA 2WHEA 1NZFA 4BO8A 2NTJA 2PGAA 3NWPA 1GNPA 3S68A 3W77A 4KXXA 1DBWA 1MB3A 4PFSA 4GKJB 3DHYA 5BVHA 5IDWA 5LP6A 1JDSA 3RS4A 5JCOA 3NEPX 4HFJA 4A2QA 3PIIA 3ICVA 2EL7A 2YOFA 5FF9A 1H4QA 1IB6A 2BM1A 2ADOA 2WMDA 3LPDA 3CZPA 2COKA 2Y67A 4FNGA 5E0OA 4IMPA 1SQ6A 3PJRA 1E5TA 5H80A 2YC2C 3CG0A 2EFGA 2PANA 3NJ8A 3OG9A 3UPTA 3HACA 5JS7A 1E96A 4GPTA 1CUSA 1USWA 5BWLA 4OD0A 1XVAA 3PRKE 1OPRA 3UATA 2BP7B 4HQOA 1KK2A 2FPSA 4P33A 1Z6PA 2LBPA 1V47A 1L5LA 4CKBB 3KHSA 1K7XB 2RJOA 4OM7A 4MWCA 4R1TA 3T7RA 5F5NA 4A3SA 5L4SA 3EGOA 2PE5A 2AFVA 3CSDA 1TW2A 2YZ7A 2ZDQA 1H23A 5G2OA 3E35A 5JMOA 4EKYA 2I3AA 4YT5A 2HHCA 5EIBD 5KHAA 1JDPA 2Q07A 2PUGA 3I28A 4UVIA 1NXTA 4U7WA 1TA9A 1W76A 3I09A 4JUCA 3T06B 3DL7A 1OH8A 1VRVA 1OJ7A 5D86A 3FMIA 4MQ6A 3F6RA 3FB4A 4QFCA 4XCQA 5H3CA 1H0KA 2ID9A 1ENZA 4FDMA 1V5GA 3EOBI 2KSQA 3O95A 4J1SA 2PEZA 4KC0A 4WRRA 4TV9A 4BEJA 3IQHX 3AERB 3X2EA 3OPXA 2J3JA 4DABA 1T26A 4CDGA 4COOA 1SUSA 2ZULA 5TMBA 3PNYA 3IKVA 2IZOA 2EBWA 1QIJA 4N6OA 3HVIA 1KAEA 1O2DA 5C0OE 4NCNA 5AM4A 4EG3A 3A6EA 1XXHA 2OBNA 1B6SA 3KKLA 1A8SA 3W1EA 5CNIA 1CUJA 3GFFA 4WN9A 4QO7A 1TVMA 3TQRA 1XNJA 3FOBA 5HM8A 1AUQA 4ZC8A 1N1GA 3QSGA 4QBTA 3Q12A 1XVIA 1L5RA 2MSEB 1RAIA 4L6IA 3DCIA 4YUWA 1JQDA 3I64A 4X6XA 1BDBA 4TMKA 4ZHQF 1SEPA 4HI0E 1DJOA 2XE8A 5M34A 3HB7A 4OATA 2PGIA 4OCZA 5FOQA 1P9RA 1EINA 2PRYA 3MJEA 4OHUA 4OMDA 1QRSA 2H00A 3GLQA 4Q4JA 1U1DA 3UQZA 2CC2A 2QAGC 3NBUA 2QNBA 4U7HA 2Z95A 1BN7A 3EZLA 4LJKA 4YXWA 4OHZA 1JH8A 5K3CA 4CETA 2GT1A 2EP5A 1LNQA 1LLFA 4Q7LA 5BOVA 1L5NA 5K0EA 1PR0A 3NKFA 4RL6A 3QE0A 2H63A 4FDUA 2QJOA 3AG6A 4QRIA 1LK5A 3G8DA 5ILOA 2YVAA 1M6YA 3CJRA 3FJOA 2GK4A 4EHKA 4X97A 5JHGB 1PZNA 4U6QA 1R50A 1SC1A 2I3BA 3IOBA 4PSVA 1SVNA 2HBZA 2YICA 4OP2A 1YDHA 1OWPA 5J4HA 3KOXA 5KQGA 2XLBA 4QDXA 1KWGA 1U3GA 4L9WA 1EGQA 4RNDB 3KE8A 2RGBA 4N1AA 1FFWA 1Z0UA 4QQKA 3O4FA 3JAKB 3K16A 4MVCA 4XJXA 3WLRA 2WG2A 3PF8A 3C7AA 5DM2A 1R4AA 1W73A 4JUAA 5C7OO 4PQEA 2L18A 1JV2B 5C7LO 1OTHA 2I2CA 2O6LA 1MMFB 1Y89A 2BFBB 4RELA 5EE9A 2OHOA 4EYEA 2WT4A 2JD2A 1FJHA 4WOKA 3AL2A 3D8HA 1L7EA 4WNIA 1QCCA 5DVZA 3VC1A 1JHUA 3IVMA 4CKXA 2VCYA 4YQYA 3DP7A 1BA3A 1EVYA 4BQFA 4ZO8A 1ZEJA 1ZMOA 2Z2KA 1W34A 1Z63A 3HFRA 3QUCA 3C1AA 3KAPA 3A4NA 3HWX1 1QKKA 1FP1D 4I2NA 1DX6A 3K1ZA 5D6OA 1RZRA 4EVRA 1WM1A 2F48A 3QA3E 3V3TA 4MW1A 3TTWA 2PX2A 4V0NA 5TDHA 4XX1A 4FLEA 4AJ1A 5G3YA 4URVR 4PAWA 3PQCA 1OZHA 4L74A 3RWBA 1W93A 2OSVA 2AFIB 1LFDB 5IC6A 3IAS1 2D7CA 4XYGA 2V96A 1GPH1 2Q99A 1G2QA 4TLCA 5HJ5A 3SHTA 3K8OE 1FFHA 3V33A 3RSCA 3R75A 3F4BA 3IMCA 4NNPA 1G38A 3UANA 5EEHA 1WA5A 3CUYA 2GPJA 4LHYA 2R0QC 3MPUA 2ECFA 2X3FA 3DYIA 1ZD3A 2ZSEA 2QJFA 4Y0VA 5EERA 5CK5A 1X7WB 5D00A 5DULA 4F3TA 5FHQA 4KWCA 1P74A 3V1MA 4F56A 3V1NA 3TTUA 5KWJA 1AB6A 3H1AA 5HFJA 1ENOA 1IEQA 1RXCA 2CD9A 2TSYB 3G5MA 2QE7A 3JQ9C 1ZI6A 1WQ4A 5DHFA 4W1QA 4WQMA 3OQIA 4ENRA 3IUMA 3GGGA 3H7IA 2GJSA 3P94A 4WKNA 5C31A 1TJ4A 2WF9A 3P9SA 4ZKEA 4A8JC 2KJQA 2VP6A 4MI1A 2I6TA 1CQJB 2HF9A 3USZA 3BQMB 1TF2A 4P7KA 5EJ8A 4MWGA 2HA5A 2QLBA 3CYFA 3RJMA 4UHDA 1Y3BE 3EZGA 3N2EA 4DUYB 3WGVA 1XLTC 3DKKA 4Q66C 1NXQA 4XTRA 3SU8A 2YJGA 1AK9A 5ALOA 1EYZA 2JLQA 4MRVA 4L78A 1YZFA 2BFNA 3ZWMA 1GPMA 1E20A 2GO7A 1SVLA 3AP2A 5EYPB 3VMFA 1E18A 5DM0A 4F21A 4YQFA 2BDTA 4BQOA 2QWXA 5ALHA 4AFNA 4DMGA 1UXHA 1RBQA 1Z22A 3FDIA 3R5FA 5CT5A 1VSVA 4DBZA 3D3EA 3WLAA 3UCXA 4P5EA 4AMBA 1G63A 4LDJA 1V2HE 1BDJA 4OFXA 1CKEA 2V6BA 1S89A 3C6QA 2VHVA 3KZNA 4RKEA 4JOSA 1QFXA 1YR9A 4CTNA 3WIUA 1E61A 2R6R1 2A94A 3KSMA 3Q85A 4NBKA 3JY6A 1NP3A 2JJ2D 2W2LD 5FWXA 3GCWA 3LNTA 2WU4A 4QFDA 5ALJA 3C3DA 4CU2A 4CL2A 5FWYA 2NWQA 1ZM3A 5EIWA 2XKKA 2WF6A 1AZLA 1DRUA 5T64A 2JFWA 3ROEA 1MQ8B 2VCEA 2XMRA 5IZCC 5HDQA 4F4IA 1PGOA 4HH3C 4P2BA 4Q9LA 3CF2A 5AJUA 2Z0MA 1A9RA 3LFUA 1VI5A 2RB5A 5HBGA 5BW4A 5KVSA 4CXMA 3NT2A 2EDCA 1SCJA 2F43B 2I7VA 3DKPA 5SY6A 4O8ZA 1ZCAA 2QVZX 4IZOA 4Z9FA 4DPLA 4KXWA 5IDXA 3VQTA 1QU3A 1WD5A 2HRZA 4LJ5A 5ILQA 2UKDA 4IMJB 1RQ2A 4F46A 5K0BA 1UMDA 1PGQA 1LUAA 5HHTA 4NPAA 4DA6A 3OX2A 2B4QA 4PLGA 2EYQA 5KAPA 2RGDA 2Q6TA 3I42A 5AJVB 5CCDA 1NVVQ 1Q7TA 1VBNA 2WJPA 2C3MA 2RFLA 1NQAO 1I4WA 2QL5A 4W5NA 5DM4A 3ZJ4A 1F5SA 2I4MA 3DBRA 1LI7A 3OJFA 2Y3IA 4QATA 1TU3A 5ENVA 1T3TA 2C3UA 4KEAA 4X60A 2IBTA 2C7VA 3JZDA 2GD0A 3KALA 4WMLA 5C5DA 4BTVA 2DXIA 1UJBA 3KJIA 3ADPA 3WLFA 2VSQA 1S8OA 5DB4A 3OZCA 1FTWA 1EDEA 1V37A 2ZJ0A 2FG5A 3UT5A 3H5WA 4FWTA 2MR5A 4OREX 3W9BA 1N5KA 1QK3A 3O2SB 4C4TA 3U7IA 1FLDA 2B8WA 5ENZA 3A9UA 2HMWA 5HMLA 1QM5A 1D0VA 3SLGA 3QJ5A 4E32A 2VK1A 5A7FA 2OBMA 3H8VA 1F1BA 1XO1A 1NQVA 2DH6A 4B32A 2GD2A 2R2GA 2VSNA 3VO2A 1MW9X 3CXRA 4MRMB 3EF0A 2PV0A 4R2WA 2QYSA 3WB2A 2PQ2A 1TK3A 1XYGA 4GXNA 3HJNA 4MARA 2BZSA 2JAHA 3TRFA 4URZR 3ZIDA 2EFCB 1ZK1A 4YWJA 3R5JA 1ZC4A 4YLGA 4KR2A 1GCAA 2QU8A 3OU2A 2HSDA 5DNCA 4FSHA 1JKJB 2BIFA 2DG2A 2ZRLA 1GQOA 5BORA 1QGED 3PVCA 4IDCA 3AI3A 4IXDA 4MGZR 2B7LA 1UBKS 1C0EA 4D9JA 1MDFA 2YUIA 3C41J 1MG0A 3ND7A 3AZOA 1BGWA 5LL6P 3ELDA 3OC6A 3FMFA 3LHKA 3S99A 4BDSA 2Q6OA 4KFCA 4J6FA 2UAGA 2DQSA 4RK1A 3UJBA 4IHJA 2HIAA 1G6KA 5MHTA 2V54A 4MYRA 4MQFA 4ZQHA 1Q7CA 4K9PA 3TIFA 1J00A 3VI3B 4D9BA 5HUJA 1QFMA 3QFTA 3DLCA 4C89A 1W4LA 3TM5A 4KVFA 2DHEA 2OBFA 2QAGA 3WKBA 1L5QA 4BJHB 2XRMA 2EKPA 2V6FA 1DTSA 1M34B 3QP9A 1GG2A 3KETA 2HJRA 4O29A 4TZ0A 4E30A 2NLOA 3IT3A 4IFBA 4L0MA 2XVMA 4RSGA 1EXDA 4KX3A 2H4HA 3E3AA 4O1HA 2Q7DA 5IM4A 2AK3A 5EG5A 1PNQA 2YJ3A 2HIHA 4YK7A 3O7WA 4TMFA 1YV9A 4KGDA 3UFXA 3OE1A 1DARA 4B2IA 4O08A 4J91A 4YRSA 1O97C 4QDTA 2YNMC 4RE5A 5DM60 1NX6A 1YB7A 2C4NA 2M1XA 2NV2B 2FP4A 3H5IA 3LUGA 3MT0A 1M2NA 4FYWA 3MZ0A 4G4JA 4TT3A 1M10A 3T3PB 4EKEA 2AZXA 2K4MA 4E70A 3MQ4A 3B12A 2I1QA 2PMDA 5F73A 2YVQA 3VAAA 4JMLA 1J8DA 1T2AA 2W6CX 4S1NA 1D6NA 4RK6A 2G1UA 3SR3A 2EIHA 3H2GA 5K6RA 5K0SA 1IY1A 1KF0A 2DWUA 4AG6A 1H8ED 1TQDA 1UT8A 4L8WB 4XYLA 2QORA 1N1DA 4DV0B 3FHOA 3FR7A 4UBLA 1MO4A 4I1IA 4YT8A 3GGDA 1KIMA 3V6LA 3GEIA 3OTGA 3NANA 1TF7A 5EJEA 4YAJA 2IYFA 4Q05A 4U5XA 2ZI9A 1XCBA 2NZYA 1DKRA 2IOQA 3DB2A 3F47A 1DMRA 1N6OA 3QHQA 4GBED 1L1RA 2D74A 3R5XA 4KODA 4W5JA 4E2XA 3VMMA 5ALQA 3T7IA 2XXAA 3IODA 1IULA 3BULA 3H16A 3VO8A 1KOLA 3RC3A 4DQLA 3B13B 1R88A 3RG8A 5NULA 4OLBA 1CJUC 1OKKD 1J99A 4UREA 5E8RA 5IH3A 3HA3A 2IHKA 1EA7A 1C1DB 4YI5A 2BGIA 1Y8RB 3KJZA 4LZOA 4WEOA 4W9NC 2I8CA 1WXWA 2FR0A 2QTAA 2Q4BA 3BL8A 2A88A 2GTHA 2IQ5A 3SIXA 3U3KA 1EK1A 3AEUA 1A4UA 4JI3B 1J8QA 3WTCA 3J81k 1X7XB 4HRYA 1TMKA 3NBYC 3PE6A 4JIGA 3T5MA 4FBGA 4KOEC 4TYNA 1GSHA 2IYWA 2H4FA 5C8VA 1DAKA 4IRMA 2OORC 5KNCH 3MLAA 5JNTA 1I1QB 3T38A 5FI1B 1JWAB 5AJZA 2LE0A 4UHKA 2E85A 4WDQA 3U0BA 1YQUA 1IHPA 4TTAA 1MB4A 5FORA 2JHAA 2C4HA 1UQRA 4U8HA 4DJFC 4YYZA 5CITA 1TUGA 1X77A 2JI9A 4XFJA 3PEFA 3ZI0A 3RVLA 1VKRA 3RYCA 4A0QA 2BC9A 2YN2A 3O2NA 2J09A 2JGFA 4L76A 1OHHA 1Y5MA 4FS8A 4A8JA 3DBLB 1T9AA 1V6AA 1ZU5A 2JFQA 3QYAA 3D6TB 4F1JA 2C4WA 3U80A 1ORDA 3KQTA 1CCWA 1PFQA 1SKBA 2Q1TA 3EW7A 4HH4A 5JJIA 3P9ZA 1F2DA 1KJ9A 1K2WA 1LXCA 2GN0A 2ZYDA 2ISSD 3Q1LA 1XLTA 1TUBB 1NL3A 1P0PA 5G4KA 4LOHA 2JK1A 1JJFA 1TFRA 5DM1A 4BLWA 3RVNA 5EQTA 1OI7A 1PCXA 3TW0A 1MG5A 1T3HA 4UQOA 5T3YA 1F2UB 4BPRA 3VX3A 4CUZA 2FW8A 2BTQB 4WXMA 1N5JA 2A9OA 2EG9A 3O4HA 4PZUA 4BBPA 2ONJA 2AKAB 4NH0A 2ZRJA 5JR3A 1YNOA 4P86A 2A4KA 3DBHB 4TX1A 2DBYA 3EZ2A 1ZK3A 3L0SA 4FK8A 1GNVA 2XGMA 3WADA 2VQ3A 3QVWA 4H1UA 1E3WB 4KRXA 1W52X 2ADMA 1KH1A 2RARA 3SQWA 1SOUA 3ESRA 1QC5A 3FCOA 3FI0A 3IYLW 4PIMA 4JI6B 2UUOA 4M4SA 4B3MB 2HSWA 4DPKA 3D3NA 3IERA 4G5HA 3RUCA 3HU3A 3ZIAA 5DTMA 5IZCA 2FCAA 1J42A 1CY6A 1FY2A 3PKIA 5EP1A 4DV5B 1GFZA 3B6ZA 4YJ2F 4YEDA 1C9YA 4FVTA 4K6FA 2IV3A 3VKVA 2VHWA 3IVRA 1CLUA 2FVXA 1T4CA 3UQYS 3FKJA 1IBRA 2R8BA 2JGKA 4EG1A 4CCWA 2AGVA 1AC5A 4PBTA 3LHSA 1R0RE 2FLVA 2WJWA 3F8TA 2YFQA 3Q9NA 4Q47A 3DEKA 4DKXA 4PSDA 3M83A 4OHVA 2G1KA 1RT9A 5H59A 2FUG1 1F4LA 1KJWA 1YL5A 3KC2A 4R9SA 2W11A 3AGQA 5TEVA 1AM4D 1FB5A 3KR0A 4OUDA 1HLGA 2PKWA 1QGAA 1QJ4A 2ZI3A 3C74A 1NSYA 3ZQKA 4UCXA 4FFLA 4NECA 1ODTC 3R40A 5I45A 4S05A 4N76A 3HCBA 1YC5A 1DV1A 1Y1QA 2YTZA 3B3QA 2ZBVA 1NQWA 1J8VA 4DYVA 2XUOA 3NPMA 5HIMA 4AF7A 3EEOA 3I2GA 3I5AA 4GZLA 5LLDA 3OZWA 3FOFC 1GGKA 4PAGA 4QU8A 2PWYA 5JAQA 1MX9A 3FUCA 3HCEA 2PQ0A 4H7DA 5T57A 1HZZC 1LC3A 2YV3A 5MGBA 3ZUPA 3U09A 1W88A 3TE7A 1QKIA 1TTPB 4OQPA 4BMOB 5IF9A 1XVLA 4PO3X 3THOA 5COAA 3L4JA 3RSGA 1YF3A 4DQXA 3THRA 2WBLC 1ZL2A 1ORIA 3RC1A 3PUWA 3H1EA 3HG7A 4J6EA 1ONBA 3FSGD 2FN8A 4K1LA 1LQTA 1GLGA 4BU0A 2HMYB 4JLSA 3ZQ6A 2DC1A 4OYRA 3FRJA 4KYTA 2O8EB 2BMEA 4D98A 2IYQA 2D4HA 3IAUA 1W581 5BXQC 1AQYA 4Y2RA 3GUHA 2PUCA 3WC4A 3NT5A 4DQDA 1GJRA 2G9QA 4KQEA 1G5FA 2P2DA 3PYMA 3QXGA 5DNVA 4EHLA 1VHWA 3KFVA 2PMFA 3MERA 4JBXA 4G0MA 3MBKA 4QVGA 5CK4A 2F1JA 3EX7C 1ULSA 1P1RA 2LDBA 2Z5LA 1B26A 3GYGA 1OJLA 2D0DA 1ODSA 3C3EA 2PCLA 3DKVA 1HOXA 4M88A 4R40A 5DP2A 3ZWWA 4BEWA 2XAAA 2ZGVA 2QT0A 4WCVA 4E2YA 4QZVA 5JSZA 1HNWB 1Z4PX 2PX8A 1LS6A 2Y9MB 3DTTA 1LEHA 1JYEA 1N6LA 1Y9JA 4CQLB 3VH1A 2BFCA 4ZAYA 1Z6ZA 1F4PA 1G8FA 3QWIA 4CR8A 3K9GA 4BEBA 1LH0A 3P32A 4C4RA 1K7SN 1VHQA 1NONA 4HXEB 2PXXA 1DC4A 1I2ZA 1WTAA 3LGXA 3ORSA 5FEMA 3UW3A 5DYIA 2B1JA 2WWHA 3PQ6A 1MB0A 2XD4A 4MUYA 1QG6A 4IJVA 3H87A 4XWGA 5CT4A 4EPWA 3SSMA 5CA0F 5K6AC 4QYMA 1CZLA 1AG9A 4JUIA 1TVKB 3K6JA 3JZAA 4IX9A 3NO4A 2V97A 4RPLA 5D8DA 1SXJE 1DDIA 3C14C 3ILVA 4LXUA 5AQ1A 3L7OA 5TGTA 2VP0A 1O58A 1LV8A 3MVEA 4C2BA 4B3SB 1O4WA 2EGHA 5EIXA 3ZK7A 4NYMR 1LC0A 4GLBA 1EWRA 3JQFC 2JJ1D 3LI2A 2XYPA 3I01A 1Z2NX 1Z29A 2WSSD 4YJFB 2ZKIA 3G9UA 1BQ4A 1Y48E 2H5JA 2YNMA 3T34A 2FWNA 4BFTA 1US8B 4JL8A 3AL0C 4ID9A 3HO8A 3U26A 3CUTA 3E53A 4PFKA 1C1YA 4JR2A 2WVJA 4LHZA 4RL4A 3SSOA 3W05A 3WIVA 4BNIA 1GPKA 1M7GA 4UOQA 5CTJA 5TC4A 3BTUA 4C07A 1F38A 2E48A 5IMSA 2Q5LA 3GRCA 1P33A 3ZKWA 4MK4A 3K9WA 3EDQA 1N2ZA 1XKLA 4JXJA 2QP3A 4ZJUA 4KREA 2D59A 2W4MA 3VZDA 2JVKA 1HZJA 2ETVA 1A4XA 4N0DA 3V42A 3QPCA 4GRDA 2XOKA 3SJCA 4I7EA 3IUNA 1JG2A 1NVAA 3IUQA 3HFSA 4QFMA 4I4TB 1HRDA 4DTCA 4WK4B 1LCIA 3GP5A 4MIYA 4Z1MA 2BFPA 2FMIA 2QMEA 3G2NA 3A6HA 3D4BA 1U2RA 3K8QA