5EUMA

1.8 angstrom crystal structure of atp-binding component of fused lipid transporter subunits of abc superfamily from haemophilus influenzae.
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
255
structure length
250
Chain Sequence
b'KDDGAYKAEPAKGELEFKNVSFAYQGEELALNNISFSVPAGKTVALVGRSGSGKSTIANLVTRFYDIEQGEILLDGVNIQDYRLSNLRENCAVVSQQVHLFNDTIANNIAYAAQDKYSREEIIAAAKAAYALEFIEKLPQGFDTVIGENGASLSGGQRQRLAIARALLRNSPVLILDEATTESERAIQSALEELKKDRTVVVIAHRLSTIENADEILVIDHGEIRERGNHKTLLEQNGAYKQLHSMQFTG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lipid A export ATP-binding/permease protein MsbA
publication title 1.8 Angstrom Crystal Structure of ATP-binding Component of Fused Lipid Transporter Subunits of ABC superfamily from Haemophilus influenzae.
rcsb
source organism Haemophilus influenzae pittii
molecule tags Hydrolase
total genus 84
structure length 250
sequence length 255
chains with identical sequence B
ec nomenclature ec 3.6.3.-:
pdb deposition date 2015-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5eumA00
2GJSA 1G5PA 4GMXA 1J8MF 4MRNA 5EE3A 1UPTA 2F9LA 4ITRC 5G53C 3VAAA 4EJSA 2JJ8A 3K70B 3KXIA 3EA0A 1TQ4A 1U9IC 1NVUQ 2OM2A 1QHHA 1SXJD 4BFZA 4FINA 5L8VA 2VRWA 5LB4A 4BLQA 1TU4A 1ZUNB 1JALA 2FEOA 1N6OA 2B8WA 1U0LA 2RGGA 1ZM9A 4NYJR 3TJZA 5P21A 4C3ZA 3K9HA 3FMFA 2BIFA 4B35A 1G20E 2MSEB 3AKEA 2PJZA 3A8TA 4A2QA 2ZSDA 5EE0A 5KSPA 2V1UA 3CLVA 2IUTA 2XSZA 3QY0A 4LY6A 1J2JA 1NBMD 2HUPA 4FWIB 4Q4HB 1F60A 1TNDA 3CZQA 1JR3A 1KJWA 1RJ9B 1CR1A 3I3SR 2X19A 1IXSB 3QIAA 1AJEA 1NI3A 3NDBB 4HLQB 1Z0FA 1HQCA 1DG3A 3HP1A 3IGFA 3QNUA 4N0DA 3TAHA 3TUIC 1QRAA 1EGAA 4BFUA 2OV2A 3TSOA 2VP9A 5SZHB 4RKFA 1TL7C 2ZS9A 1UJ2A 3A1UA 1KYIA 2GRJA 1OSNA 1I4LD 2A9KA 3QJYA 2X1VA 1E9DA 4DZZA 3NDPA 4FW9A 3L0OA 4A8JC 4YXWA 4N3NA 4D25A 2PLRA 2OSBA 3LO5A 2GBLA 1QHHB 1VHTA 3VQTA 2NG1A 4RD6A 4PQFA 1DPFA 1NN0A 1LY1A 4DCUA 4U7DA 2PMDA 1T91A 4KYUA 2VP6A 1XTIA 2ZI6A 2ZU6A 3WY9A 1KI3A 1KZ7B 3AH8A 4IRUB 3MUFA 1PUIA 3W90A 4DDVA 1R2QA 1DAIA 1ZCBA 5BN4A 1U0HC 1W0KA 2VL7A 4G5RA 4M21A 1MO5A 4EIWA 4A2PA 3VKWA 3VR6A 1TADA 2OCAA 4LJYA 6Q21A 4IDNA 4TMVA 3LFUA 1GWNA 1YR7A 4RY2A 5CB6A 5DO9A 4B6EA 2X8AA 1KKLA 1FUKA 5JRJA 2QTHA 3NHAA 1F5NA 1X1RA 5JJKA 1E0SA 3OEEA 1EFUA 1TU3A 3IDQA 3LLUA 4ZV4A 4DLTA 3SBDA 1ZJ6A 3ZIAD 2R6AA 1TEVA 5EJEA 2C9CA 2P3SA 5FUXA 2NMVA 1W4BA 1T6NA 1SQ5A 5KHOC 5DLQC 3LQQA 4M1WA 2ZR7A 1DAHA 4LHZA 4PAMA 5FBWB 2VBCA 4C2UA 2R9VA 4G5QA 5AWFC 1P2VA 1T3SA 2FSFA 4P33A 5B57C 2NIPA 4Q4AB 1XD9A 2ZXUA 4BECA 3U3OA 1E2HA 4US0R 4DB2A 1Z0AA 1Z6XA 4DLVA 2HJGA 3O8BA 4HB3A 2CJWB 2A5DA 3MWLA 3ZLJA 2IYYA 2ZI7A 3K0EA 1A1VA 1Z6YA 3L43A 4PC7A 3RS5A 5JWRA 3L8YA 2IXFA 1G3MA 2FU5C 2QTVB 1XPUA 4NYIQ 3VR3A 2QAJA 2YYZA 5E7IA 4PAQA 4Q01A 3U7EB 2BKUA 1NLYA 2R6DA 3Q5EA 4CT5A 4C0AC 2LKCA 3ONWA 2PZFA 1YE8A 3EW9A 3FTQA 2JLXA 1Q44A 4MRVA 4LJAA 5GJWC 3PQCA 2A78A 3FKSA 2ZJ5A 1FP6A 3G0HA 4LCBA 2PBRA 1ELOA 5FPYA 3HU2A 4DCNA 3B1ZA 3IIKA 1GNRA 5HKKD 4HUQA 5JSZA 1JQJC 4LHWA 1F2UA 5ELXA 4QXAA 4RKEA 3ZS8A 4YLGA 4QGHA 2IWRA 5AUNB 1AKYA 4OHZA 2CCJA 4PHFA 2GNOA 1LB1B 1M8PA 1XTRA 4K8OA 4AK9A 1O87A 4Q7JB 1GZSA 4L5BA 1E99A 1CULC 1W2GA 2AKAB 4M4SA 2J0UB 4QM7A 3GMTA 1FW6A 3MFYA 2ZANA 1TAGA 1CEEA 3PVSA 5G41A 2QM8A 2H16A 4NE2A 1NN1A 1NRJB 4LHYA 1TUIA 4PPNA 4QL3A 5EXSA 2P67A 1G8FA 2QMHA 4L4UA 1AQUA 2WJVA 3VR1A 3LW7A 3D3QA 2BM1A 4R71A 3LVQE 1PJRA 3C7KA 1TQ2A 4JVNA 5CM9C 3ZVMA 3B1YA 3KKQA 1I4DD 3DKVA 1IN4A 3AGPA 4Q1CA 4DB4A 3IHWA 1P60A 1XJQA 1A2BA 4ZIRB 2JA1A 5EUMA 4A8JB 2ZRJA 5A4JA 1E2JA 4I4LA 2G1KA 3RSLA 2W2TA 3CIOA 2OAQ1 1HT1E 1U8AA 2GJ8A 3LAWA 2D3WA 2PEYA 2ZRFA 1W4AA 3U3RA 4NL4H 4B43A 3ND9A 2IK8A 3ASZA 2NZ8A 4XOIA 1F2UB 2A3RA 2ZI9A 4G0NA 5J4HA 2YC4C 3ADKA 2WBLC 1HV8A 3D6TB 1CJMA 3WRYC 4PC6A 2VLIA 2V7QA 2V1XA 1RVDA 2XNSA 2WWHA 4IVRA 1OXXK 4TTRA 4DXAA 3IEVA 2BBWA 1A7JA 2ZUBA 3Q9LA 3W5JA 2VHJA 3NC1C 2BBTA 4Q9IA 1NVVR 2C03A 2ZYWX 4JS0A 3GJ7A 4POAA 1L4YA 1CU1A 1NG1A 3I73A 2ZIAA 2OEPA 1T8TA 2JLRA 4M9XA 3W34A 5JEEA 4KSCA 2AHOA 4EKDA 4F91B 2BVNA 2ODBA 4TMKA 3R7WB 2XTZA 4AKIA 4HDQB 4GP6A 1D2MA 2WSSA 3DOEA 3OEHA 4B3BA 5E3HA 1G7RA 2NPIA 3B9QA 3AB3A 5FOSA 2IS2A 3LX5A 2H57A 3TSZA 3PV0A 1PLKA 2ZJ2A 5CITA 3IPXA 2RGDA 3ZD7A 3HJNA 1HY3A 1HE8B 3THYA 4URUR 4OK3A 621PA 2V4ZA 3T5DA 3H84A 3Q5DA 1D2EA 3MAAC 1JB1A 1OXTA 2J0VA 4LC0A 4BLPA 3O8DA 4OJKA 1P75A 4FMCF 1A5TA 1D6JA 1KOFA 2V6IA 1SVOA 1GVNB 1YR9A 3AF0A 3E2IA 3EIQA 3K0FA 3CBQA 2DFTA 2OBMA 1OB2A 4D80A 5EXPA 1N5JA 2ZRIA 5D3MB 3VX4A 1DAEA 5DGXA 2HLDA 1E2DA 4M9QA 1KMHA 1II9A 3BE4A 5DYIA 1D2NA 4DSOA 3R8FA 4TMXA 1KDPA 4EFLA 1XF9A 1YR8A 2GJ9A 4EPWA 1P72A 4B47A 2UKDA 1ZD1A 1OH5A 3N5CA 3FKQA 2ZRGA 2FPKA 3U4QB 1XTKA 1OXVA 4V0KA 5FBLB 5KDLA 1U90A 5B58C 3ADDA 2R44A 3RS7A 5DISB 1K5DA 2IC5A 1Q1BA 1KK2A 4DT1A 2BV3A 4C0JA 3N2EA 3LXXA 1JI0A 4U00A 4HAVA 1MABB 2XNDA 1W0JA 1XCPA 4NYJQ 2YC2C 2R2AA 2OCYC 2FDCA 3IBYA 4QBFA 2R6FA 4QBGB 1IQPA 1EXMA 4RD4A 3SQWA 3U2QA 3W8RA 3MJHA 4BFXA 3QKRA 1FNMA 3GLHE 4Q7MB 5EE9A 1X1SA 1FPMA 5GJCA 1DBSA 3RS0A 3THYB 5L3SB 1DVRA 2BM0A 4LJ9A 4DCVA 3RAPR 3DDCA 3T1OA 1XEXA 3WBKA 2J7KA 2PL3A 1H8HD 3C5CA 3DKPA 2Q0HA 3OIVA 1HYQA 2ZYUX 5C4MA 1ZMXA 2JDIA 5FFMA 5J4KA 4LPSA 2QE7A 4X8HA 1C4OA 3H4MA 3UG6A 3THWB 2JEOA 1SXJA 5AK0A 4BLOA 1NVWQ 2DCUA 4MGKR 3UWOA 2PEZA 1BYIA 2WWGA 1UEIA 3CM0A 4FMCB 4JLKA 3GQBA 2Q9BA 2FFHA 4OQMA 3QPVA 1H8EA 5DI3B 3W6PA 2REBA 3I5XA 2ORVA 1M2OB 3WBJA 1O3YA 3OZXA 2ZJYA 4DT1B 4MGZR 4OHYA 4LV8B 3TUJC 4DUGD 1Q1ZA 1ZINA 2DFNA 4UNQA 4YMWA 1XJ0A 5E7JA 2ONJA 2F1IA 4FI3C 1G5TA 2WICA 1Z3IX 4GPTA 3ZVNA 4PTLA 4L16A 3QKRB 1OKKA 4LBWA 4L15A 3BD9A 2C95A 2WOOA 1XPOA 1Q1EA 2O8EB 2DWPA 5HE9A 4IDHA 2OESA 2Y8EA 1OFIA 5J5CA 3TSWA 5KDOA 2JJ1D 2FFQA 2RHMA 5LB2A 1XEXB 3KTAB 4MKFA 1A82A 4GDFA 2WKRA 4AWXA 4ZCIA 4C0KA 3WMFA 2XZPA 5IK2D 3VFDA 4YDHB 1UKZA 4FCWA 1WRBA 4B2PA 4WZBE 1M7BA 1SXJB 3TNFA 4G01B 3WYAA 4BRUA 2YWEA 4PSAA 1XEWX 3B5JA 2ZU0C 5JI3E 1KO8A 1YZNA 3BFVA 2H5EA 3IQXA 4BLRA 1GG2A 4CEIA 2FX3A 4PQRA 3EARA 3QXSA 4A0FA 1RYFA 4A4DA 4UKDA 1KO4A 4PX9A 1G3RA 2P5SA 3K0CC 3FGNA 4DIEA 1XXHB 4LPKA 4FCVA 2VH5R 1AM4D 3D31A 4LJ8A 1OIVA 1E79A 1IBRA 2QRZA 4IEEA 2PMKA 5FTJA 5AJZA 2GCPA 5AJVB 1ZCAA 3AF4A 4NDZA 4B2IA 2ERXA 4FIDA 4TT3D 3VX3A 1J90A 1X6VA 1QHIA 3NBXX 3QBVA 1MOZA 1ZNWA 4JLJA 1FZQA 4WA7A 5CYOA 5GJBA 2GK6A 2P6RA 3REGA 4O2RA 1TF5A 2AN9A 2KB0A 1S3GA 3DHWC 3SFVA 4WZ6A 1JAIA 4DEYA 4GFDA 4WIAA 4AD8A 4BEJA 1KI6A 2YKGA 4TZ6A 1G17A 3NC0C 2GILA 2IW3A 4XIGS 5A5GA 5CDFA 5HCIA 1ODFA 2RMKA 4XSHA 1K8RA 5HE8A 4D82A 5CLQA 3TLXA 4N0EA 4Q9HA 1KMQA 4BQSA 1N0UA 3LA6A 3EWAA 2AFIE 1N0WA 3KJEA 1E9AA 4C4PA 3VKHA 1OW3B 4B76A 1RYHA 1R8SA 1JR3E 3PUVA 1HURA 3TR5A 4TSFD 4MGIR 4P31A 1E9SA 1G1MA 1AS3A 1QG4A 2WKPA 2YOFA 3NBYC 4EPRA 2BMDA 1OPXA 3AF3A 4Q66C 1J70A 1BH2A 1NVXQ 1E94E 2REXB 4IDPA 3SE0A 1X8JA 2H8KA 2E1RA 1L2TA 3CPEA 2R65A 3IUYA 1RW4A 2OXCA 2C04A 3SYLA 4CEJB 1OF1A 5DIFA 4C0QC 3RYTC 1XX6A 3HU3A 4ARZA 1G8YA 1TQ6A 3B1XA 2GZHA 4TL6A 2JCSA 4RFSA 1IY2A 1NKTA 3WP1B 1Q57A 2GCOA 5FR2A 1E69A 1KJZA 1US8B 3TQCA 1G7SA 1U2RA 4KYIB 2WHXA 3PUXA 3WMEA 2N1BA 4BASA 2QMEA 2XXAA 4JZKA 1R0XA 4CRWB 2ZRBA 2B7BA 1N25A 1W5SA 1W7AA 4AKEA 1ESNA 4NCIA 3DM9B 4R98A 4W5JA 3GJXC 1E2PA 4JBWA 3AVQA 2GEVA 5KPJA 3RRYA 1KI4A 2N46A 3NBZC 4BZXA 3SEAA 3EZ6A 1GNQA 1MO6A 3I4LA 2HXSA 1XPRA 4PPGA 2OBNA 2ZSAA 4UNPA 4CEHA 3HPRA 1N6LA 1PZNA 3THOA 2HF8A 3A4NA 3AUYA 3WNCA 4IW3B 4G5GA 4A6XA 4CDGA 4C0HA 1ZYUA 1I2MA 1KHTA 2ZRNA 4Q1AA 2W6IA 3ZGXA 1ZM3A 1UBFA 1S9DA 1VPLA 3B9PA 3SZRA 3VR5A 4ZKDA 2HT6A 2JLQA 5H8WA 4ARZB 5FUYA 3LRPA 5IF9A 3P20A 2BDTA 5CB8A 2GCOB 2WJGA 4NYMR 3AQ4A 1IN6A 2BCJQ 2CE7A 1LV7A 2ZETA 1UADA 2X2FA 3MWKA 4JLVA 5DE3A 5KNBA 4A9AA 1GKIA 3SN6A 2XXAB 3AVYA 2WSMA 2J9RA 4HLDA 1RC8A 2TMKA 4TMTA 5UKDA 3SYKA 3LLMA 4Z51A 2AL7A 1OXSC 3REFA 2CCGA 4Z54A 4GRAA 3K0SA 1KDOA 5KPDA 3GEEA 4MQBA 4MH0R 1FTNA 1N5IA 4EUNA 1XMVA 2GJAA 1XWIA 4BRWA 1Z63A 5FTMA 3BH6A 1QZXA 3KKOA 1SVIA 4CEHB 3OAAA 1YR6A 3MLEA 1YZLA 3Q72A 4KFSA 4MYCA 5JMTA 1XP8A 4B44A 4TYWA 4O25A 2IS6A 1EFTA 4BUJA 1XRJA 3DMDA 2ZSEA 3NVAA 3ZDQA 4JBXA 4E5UA 3ETLA 4YDSA 4AY2A 4OQFA 4ZCLA 4CVNA 5FBVB 4JVMA 3AKYA 4CZ2A 2FH5B 4MDFA 2OZEA 1ANKA 1IHUA 2YJTD 2CDNA 2IYUA 5JBQA 1WDTA 5HTKA 5EE5B 3F0TA 2J7PD 3IKJA 1M7GA 5KDDA 1AK2A 4Q4HA 3ZZTA 2DPXA 3SR0A 3FDIA 5DSZA 1RJ9A 3EZ7A 4WAUA 4PANA 1LF5A 1OYWA 3AVUA 2DWOA 1Z2CA 1CR2A 3QQ5A 2VA8A 5IHPA 4B2LA 2HEIA 1ZRHA 2B92A 2XB2A 3HYTA 4DLYA 1W44A 1TPZA 3X1XA 4NH0A 3TGPA 4HUTA 1NNEA 1SVMA 2P6NA 1IONA 2W0MA 5F9HA 4BPBA 2W58A 3HPQA 4V0OA 1K5GA 5FH9A 3ZD6A 3RHFA 4YQFA 1Z6GA 2EVWX 3I1FA 4JLDA 1G18A 1Z6AA 2HCJB 4FMDF 5IDVA 4Q21A 4TQUS 3V00A 2GJKA 2IYVA 2QU8A 2LCFA 1UDXA 2XTNA 3JZMA 5SZJA 4KXFB 4NHOA 1E1RD 2MMGA 2WJJA 4HDOB 2IUUA 3SJBA 2NO6A 3CPHA 1RRPA 2ZTSA 1W4CA 5TY0A 3HWSA 1E96A 3ZH9B 2CE2X 3A58B 3V4FA 2R6GA 4Q7KA 1UKVY 4LV5B 1H8HA 1MR3F 4D0GA 1ZC3A 2FMXA 3FHTA 4ZCMA 2CEAA 3D8BA 1FUUA 2A5GA 4WVFA 3CX7A 5AUPB 3WMGA 3Q7PA 1QHGA 2CVFA 2VF7A 4DHEA 2GAAA 1GL7A 2D7CA 1VG9B 1CS4C 2JLYA 2IYRA 4A0RA 1VKJA 1W49A 4L8GA 4PSVA 3CNNA 3DZDA 5C1BA 1NIJA 3PITA 4W5WA 2VSOA 4P4SA 3TE6A 5JRZA 4Q4JB 5E4FA 5DHAA 1WQ1R 3KX2A 2Z83A 2QUZA 1YU9A 1P6XA 4Q4AA 4F4JA 4QG7A 2JIZD 2YZ2A 4HLUC 2XJ9A 2O8DA 2WPDD 3P4YA 3FMIA 2B21A 2VPPA 1R5BA 4JLMA 2CJWA 4M9SA 3RS2A 1EWQA 2AK3A 4M8NE 3FE2A 3BK7A 1N2CE 4EDHA 2J87A 1DAFA 4PHHA 4KU4A 2DFLA 3JVVA 2OFXA 1II8B 1NJGA 1UM8A 1ZIPA 2AD5A 4IJMA 2JJ1A 3T06B 2Q6TA 4FMDB 3W3ZB 4PZYA 1U0JA 2OBLA 4LV6A 4TYQA 4M1OA 1FX0B 1KSHA 4Q03A 1U94A 1U9IA 3B8HA 4PXAA 1R6BX 1XZQA 1DADA 3W8NA 1P9RA 3OF5A 2GXUA 2MSDB 4MRSA 1ZM4A 4RSGA 4QBHA 2OHFA 2BEKA 4P0TA 4PZZA 2EFDB 1NLZA 4D4MA 2RCNA 3L8ZA 3GLFA 2KSQA 3NIBA 3U60B 2GK7A 3LDAA 1Z47A 3PG5A 4P4SB 4US1R 4URYR 4OL0A 1N6KA 1SVLA 1PVOA 3T1TA 1GP2A 3T61A 4Q48A 4RD2A 2X2EA 2CCKA 2J0UA 2IS4A 1ZP6A 4Q47A 4C2TA 2O8DB 4RZXA 4NKRA 4J0QA 3U3MA 5EQTA 3LBIA 4XWKA 5F2EA 4ON9A 2X77A 2QMOA 1Z0JA 3ECCA 3GLIB 1HA3A 1E3MA 3MMPA 3EA5A 4H9GA 5DYGA 1Q0UA 5FOUA 1V43A 3I92A 2KWIA 1Q1QA 3AF2A 4HLUA 2O8CA 3PUYA 4ZIRA 4A8JA 4AKGA 2V8OA 1SXJE 4PO9A 2ZQ5A 4JSYA 1OH6A 2ZJZA 3EPLA 1VCNA 1E2FA 1E1QA 1Z28A 1TEXA 4FCTA 1XTSA 2ZJOA 1A2KC 5JCPA 1KO5A 3RRMA 3PCRB 1E0KA 4UXJA 4D4KA 2Q3MA 3K9GA 3GLFB 3KKMA 3VU9A 3TAUA 2WIAA 3NHBA 1QG2A 2OXRA 1ZNXA 4TL9A 4XJXA 4XVQA 4AC9A 1JPNA 3GEHA 2H18A 5FPSA 1WXQA 1U8YA 5FL7A 1XU4A 4E09A 3AVVA 2XITA 4Z1MD 4LK2A 1G64A 5SZKB 1QBKC 2P6UA 1UDWA 1VECA 2G3YA 4I81A 2RHDA 4DDWA 1MO4A 4NCKA 1AIPA 4W9MC 4TSFA 3AF1A 2OO7A 1YJ5A 4URWR 4C0SA 2IEYA 1IY0A 2GESA 3BXZA 3BOSA 2CK3D 2XB4A 4MKGA 1TUEA 4LJ5A 2RAPA 2PH1A 1E0AA 4H1UA 3C16C 3NEYA 4TYPA 3U3KA 1W46A 3CR8A 3AKDA 1Z07A 2AR7A 4M1YA 2SHKA 3R7WA 2NOAA 2GDJA 2A5FA 2O8CB 3EZ9A 4IOMA 2FFBA 4FWTA 4QGGA 5B2ZA 1N6NA 4NPHA 3SC3A 3CB4A 3EXAA 1G3UA 2JLSA 4Q00A 5FOWA 2D74A 4HAZA 4Q1EA 3B1VA 1QHYA 2JGNA 721PA 2J59A 4JT2A 5HZHA 5IRCD 3CRW1 4S2EA 1VCIA 1QHXA 4Q1DA 3MSXA 1MV5A 2REOA 4Q19A 3VU9B 3GEIA 4OI0A 1EX7A 1VHLA 4Z8YA 2IF0A 2BMFA 1ZIOA 2HCBA 4US2R 4Q1FA 4LYJA 5TDHA 4DWJA 2KI5A 4TMZA 3MWYW 3B85A 1CF4A 1E4VA 1E2IA 3DEFA 3RS3A 1N6IA 4EFNA 4F92B 3K1JA 3AM1A 2GXSA 2ZVQX 2QP3A 1AN0A 2Q3FA 1LTQA 2EWWA 4OHXA 4RZUA 5D3MA 1NKSA 3LY5A 3QUSA 1IN5A 1P62B 1SKYB 2VHUA 1ZD8A 2QTFA 3LNCA 2B7CA 4OHWA 4LBVA 2A5JA 2ZITA 4V02A 3GJ5A 2NZJA 2RGNC 3PENA 3CO5A 2FSGA 4JLAA 4JBYA 1JXMA 4U02A 3EPJA 1Z29A 1D5CA 1N5KA 3RRZA 3U4QA 1TX4B 3NKVA 3KKPA 4ZDIA 3VTKA 4XVUA 5KNCA 1VCOA 4WXRA 3UATA 3IQWA 5FTKA 1MABA 1X8KA 3TQFA 4O2LA 1W47A 2VP0A 3ZS9A 2D7DA 4OI4A 3P1JA 421PA 1CRPA 1UAAA 3FYHA 4QKQA 5CDFE 3NXSA 1CR0A 2YOHA 3B82A 4NZYA 4C0BA 5L3SA 1ZBDA 1DAKA 3IIJA 3GLGB 4EPTA 1EFRD 2EWVA 3TR0A 1ZUHA 3AP2A 2NTYC 2W00A 2O8BB 1BOFA 4OK5A 3OESA 5FI1B 1GKUB 4BFSA 3HDTA 2ODEA 2GCNA 4OQLA 1IXRC 1MT0A 4GNKA 4OBEA 5BXQC 3GPLA 4PR0A 2QAGC 1YKSA 1Q21A 2FZ4A 1KI7A 2OILA 3THWA 1SZPA 4CYMA 5KUTA 1P5ZB 4B75A 5KOYA 4ZI3A 2XOKD 4BFWA 1GDDA 2BJWA 3GP8A 2QP9X 4AYWA 4HEJA 4HZIA 4DLXA 1OJLA 5BN5A 4ZDKA 5DI3A 4QNMA 1KNQA 4V0MA 1LFDB 4XH9B 1XTJA 4QOSA 3GFTA 2NGRA 4KITB 5DN6A 5LD2C 1G3QA 2J5XA 4AURA 2J7PA 2NO1A 2FGJA 5FPTA 2J1LA 3CW2A 2NO0A 3T12A 4UXIA 3PEUA 1GRRA 2G83A 3QG1A 5E95A 3FMPB 3UKDA 2QBYA 2WJIA 1P4SA 5FOXA 1OV4A 1Q12A 3ZVLA 1LVGA 1R8QA 4DVGA 5TVKA 5DH9A 2O8EA 4OKSA 4ERNA 1ZM7A 1K6MA 1VG0B 1YQTA 2J41A 2QP4A 3EASA 3IO5A 3FFAA 4CIDA 4AYTA 3KTAA 1P3JA 4URVR 1JAHA 3C4JA 1G7TA 4MKIA 2HF9A 1QHNA 3QXCA 2ZEJA 2CLDX 2VHTA 3Q8XB 3QXJA 5BYKA 1SULA 2WTUA 4B3FX 2QMUA 3FB4A 3PEYA 2IUSA 3A37A 3KXKA 4TLAA 1G19A 1DOAA 1XD2A 2ZYVX 1U98A 5TARA 4M0LA 4QHYA 3SI7A 1Z06A 4YMUA 3WXMA 4XSGA 2BC9A 2WWYA 1G41A 3PUWA 4TMWA 3MRSA 1E1RA 4G1UC 5CIWA 2ZYTX 2FWRA 1U8ZA 4JSTA 2ZSFA 4P4UA 5F98A 4ZDWA 2JLVA 3AGQA 4NCHA 2ZRMA 3I32A 4LZZA 5FUVA 4RVCA 3SYNA 3BC1A 1YRAA 3K09C 1G8PA 2XSZD 2XAUA 1CXZA 2QAGA 3QEOA 4UJ5A 1XXHA 1CJVC 4DC9A 1F2TA 1KIMA 1NBMA 4UXHA 1MRNA 2ASEA 2VP2A 4I1UA 3UIEA 3KQKA 4QJ4A 1DS6A 3G5UA 1DAMA 1E9FA 1M74A 4B3GA 2QBYB 1GTVA 2C78A 3RABA 4EPVA 4KLNA 3SQXA 3QOFA 3CH5A 4IFBA 4UQOA 3SDZA 1PLJA 3F3YA 2V6JA 4M53A 5GVRA 1AZTA 1Z5ZA 5EZ5A 2XZOA 3ADCA 1DARA 1N3BA 5GADl 1KZGB 2C99A 2D4HA 4KSBA 4JLOA 3U7HB 2HDNB 3CONA 2IEZA 4YXWD 1ESMA 4H1VA 3CR7A 2WPDA 4BZPA 2PJRA 1XD2B 2IA5A 1L7VC 4KBFA 1G8HA 4PO1A 1XTQA 1N0VC 3GJ8A 2A2ZA 3IPYA 2OUKA 3QKSB 3I61A 4F38A 4HZUB 4C7OB 1FL9A 3CRVA 1TMKA 5DNYB 1Q22A 1OFTA 2WJYA 4QHTA 1KK1A 4EPXA 4B74A 4AIIA 4TYNA 3GD7A 3LBHA 4PQYA 2LKDA 1XCGB 2YNMA 4N1AA 4JT4A 3QPWA 4M1TA 5FBQB 4D0NA 4PPFA 1EG7A 3BB4A 3L0SA 4LC1A 2QAGB 5B30A 4HI0E 3F5FA 4IOLA 1F2TB 2H17A 1EFCA 8OHMA 3OEED 4OK6A 3LVRE 4A1FA 3SOPA 2B8TA 4I1SA 5A0FA 1DEKA 5BW8A 2XX3A 4LOAA 1BMFD 5JWHA 2JLZA 1KI2A 1NMZA 2G88A 4MYUA 3RDPA 1R0ZA 1UFQA 3B13B 3CZPA 5JWOA 5TMPA 4Q1BA 4OYHA 1HE1C 1R0YA 2HYIC 3TUZC 3R20A 1KAOA 1JQLB 1UF9A 4V03A 4CEJA 4A6PA 2J46A 3C8UA 4NONA 4D2IA 4TQ9A 5LD2B 1CBUA 4LWZA 3U7GA 2F43B 5FPKA 2FV8A 3BGWA 2AX4A 2JAQA 4M9ZA 4B3XA 1W4RA 3H1TA 1FQKA 1NIPA 1US8A 4DCTA 2O5VA 4QHSA 3TH5A 3I72A 2PT5A 3BB1A 5F9FA 3I5YA 2VYFA 5DI9A 3SJCA 3MG9A 2JATA 3K53A 1HT2E 4BLTA 4W5HA 3M6AA 2QNRA 1NSTA 4YMSA 3SNHA 4QGFA 2FGKA 2P2LA 2W2VA 2ODNA 3IILA 2V55B 2O52A 5BN3A 4II7A 2FFAA 3DM5A 2YV5A 2DYKA 3LW8A 3QEJA 2GEDA 4MDEA 4LUCA 1P9NA 4KJZA 3QF4B 2ZRAA 1HUQA 3QI2A 2ZR9A 1UBEA 4M1SA 1AQYA 2ZPTX 1XB2A 1T0JB 3AKCA 3AUXA 1BO6A 2QM7A 4Q9JA 5HKKA 1XMSA 3B6EA 2EYQA 4F4IA 3ZVRA 3VMFA 1KK0A 4A2WA 3K0CA 4TTPA 5EUQB 4JL6A 5JS7A 4M22A 4NYIR 4Z1MA 1XD8A 3J81k 1DG1G 1CP2A 1G6OA 4QFMA 4TLBA 4BFVA 1SHZA 2AWNA 4IVQA 3EAQA 2VSXA 3FMOB 1P61B 1E32A 3DPUA 5FTLA 3FWYA 1GUAA 5GVSA 2O0KA 3T5GA 4A82A 1W2HA 2WWWA 2ZRPA 2J45A 2QPOA 3FHCB 2W6JD 5K8LA 5LPNA 3QXXA 3VKGA 5G3YA 2CL0X 1E2QA 2YWGA 3MD0A 4A0GA 2ZUCA 4LYHA 4BZQA 3K70C 1Y63A 1ONBA 1GITA 1KSGA 3A4LA 1KDRA 5FI0B 2Z4SA 1NVVQ 1D8TA 2I4IA 3QG5A 4S35A 3TW8B 2P0EA 3JVUA 3GLFE 1G16A 2ONKA 2BCGY 1G7CA 2BKEA 4IKEA 4K46A 1FMJA 4KVGA 2QGZA 3BH0A 3ASYA 2BJVA 3QPUA 1N6HA 4MYTA 5C18A 4P3YA 4D6PA 2XGJA 3OHMA 1XCMA 4ASUD 2IF2A 1S9HA 1VG8A 3C15C 1COWD 2V7QD 3WHLA 2O8FA 2RGXA 1IJEA 3K0AB 2EFEB 4JYBA 1FQJA 1SVWA 4KODA 3A1SA 4IFEA 2BBOA 3H0KA 1OH8A 3U6BA 3KQHA 2PX3A 4RJLA 1W36D 2YHSA 1KJYA 1VG1A 3K9LA 4B71A 4LDJA 3EPHA 4TQAA 2WWFA 3UG7A 4YMTA 4FN5A 2VIIA 3PEVA 1ZD9A 2FF7A 4XVRA 4X8OA 1FNNA 3QXHA 1F3OA 4DDUA 4PZLA 121PA 3RC3A 2AFHE 4PC2A 5TV2A 3KUDA 5JFGA 2VHCA 1T5LA 3U44A 4JVSB 3AEZA 3TRFA 2FSIA 4EJSC 1R5OA 4TLDA 2FE4A 4OHVA 2V54A 5JEDA 5DHFA 1KDTA 2KE5A 4TL7A 3EIEA 5KU1A 1JEEA 4KFRA 1DTSA 1KGDA 4DLUA 3P4XA 2H1LA 4D81A 2OFWA 2IHBA 3L0PA 2PCLA 2C9OA 5G3ZA 3GLHB 1WF3A 2ZAMA 4MRRA 2ECKA 4GSYA 3Q85A 3VHLB 2D2EA 2ZI5A 1FFHA 3LV8A 3W9YA 4LJ7A 2QGNA 5CJ2A 3AVPA 1U81A 3P26A 2ZUDA 2O8FB 1Y3AA 1XDBA 1SKYE 1PV4A 3WP0A 2ORIA 5TB5A 3WYGA 3EWSA 2GVDC 1D9XA 2HLDD 2CVHA 2QROA 4URZR 1Q20A 1ZU5A 1OLOA 2ZI4A 3E5HA 5EP4A 3UMRA 2XOKA 4DCSA 2ZROA 3CH4B 3ZZUA 3X1WA 1XMJA 3CNOA 2FZLA 3VNUA 5FUWA 4RFVA 4ZO4A 4CF7A 2F55A 1E9RA 3RNLA 4W7SA 2JLWA 4Q4JA 3EX7C 3WYFA 1XZPA 1OXUA 4GOKA 3X1ZA 3A6PC 1G4AE 3BORA 1NF3A 3BFXA 4JLPA 3U44B 2E9SA 3HR8A 1N5LA 2XNDD 1FP7A 2QSZA 2OAP1 4GOXA 2AK2A 3ZYCA 1IN8A 5JS8A 1CIPA 2CNWD 1BS1A 1E2KA 3HR7A 2GBLC 2NQ2C 1Q3HA 3T1VA 2OLJA 2G9NA 2XTMA 3TMKA 3EPKA 4HAYA 2O0JA 4ILEA 1P2SA 1M6NA 3SJZA 2IYWA 5CK5A 3TBKA 4XD7D 3THXB 1II8A 4JJZA 1S8FA 2F3TA 3H2YA 1RZ3A 3OE7D 5H1YA 3EIHA 1FMLA 1S2MA 1VIYA 4B33A 2EW1A 2WKQA 1FX0A 2A7QA 2JDID 5G40A 1J7KA 2EFHB 1QDEA 3UANA 2QE7D 2D62A 2GTPA 4A36A 5CYPA 2QENA 1S96A 2KBFA 3SHWA 2J0QA 2F1HA 2ZS7A 3VR2A 5AUOB 3AV0B 3SS8A 1PUJA 4U5XA 4UNRA 1ZUIA 1M1YE 2BEJA 2ZREA 4HATA 4MGYR 3PJRA 3SBEA 1H65A 3W3AA 2DY1A 4V0LA 1UKEA 4ESHA 1H8ED 4BEBA 5EE1A 1E2MA 3KL4A 3CWZA 1IOZA 4M1MA 2DHRA 2OT3B 2WZQA 2AXPA 2E87A 1HH4A 2FOLA 3RANA 5JJLA 2YINC 2PX0A 1OIWA 1G3IA 2AWOA 1ETUA 2XEXA 3A36A 4UNNA 4BE7B 5L3QA 2R6CA 4DUGA 5HR5A 2CMKA 1AKEA 1N6PA 4GMDA 1AA9A 2QPAA 4BWYA 3PIRA 3AP3A 1DAGA 1OKKD 3FHOA 2KBEA 2OG2A 2H92A 1WBBA 4JL8A 1CTQA 2VP4A 4QJ5A 5EP1A 3S1AB 2GA8A 3GLIA 3PUZA 1BIFA 2EU8A 3TVDA 1M34E 5E7MA 3TIFA 3CF6R 3WRXC 1R4AA 5JECA 1NN5A 4EJSB 1ZNZA 4C0LA 2Q21A 5IK2A 2F9MA 5F3WB 4IOKA 2FPLA 3CX6A 4ACBA 2BMEA 3E70C 3AVXA 3OIUA 1D9ZA 4MITA 1E0JA 221PA 2DWQA 1FTSA 3AP1A 4V0ME 3GCGA 2V9PA 3V9PA 1OFHA 2NO7A 2QQEA 4HAUA 4K81B 5CJPA 1WB9A 2ZM5A 1KY2A 1SKQA 5KSYA 2RGCA 2C8VA 2JLUA 4Q5IA 4DSNA 4QRHA 4KCGA 1HEIA 2P5TB 5L3QB 5KSZA 1E79D 3X2SA 3D7MA 4I1OA 1JECA 1DE0A 1DELA 4O3MA 1CRQA 5LDDC 1WA5A 1BMFA 4UNSA 2C5LA 4TT3A 1KNXA 3W6NA 2P65A 2QT1A 1G6HA 2ZJ8A 4URXR 4HSEA 3I62A 2JJ2D 2RH5A 4HAXA 4DRZA 3TVTA 3QKUA 3GFOA 2CHVA 2XZLA 3E1SA 3NH9A 5JCZA 1G5RA 2ZR0A 4IHQA 4PAOA 2ZSBA 5H68A 4Y0VA 1NSFA 4Y0AA 3HYRA 5C2JB 4P32A 3NWJA 3T1QA 4G3XA 1WMSA 5FL3A 3KQNA 2GF9A 1JEDA 3GJ6A 1YZUA 1NY6A 2QEQA 2DFKB 3HU1A 4L9SA 3P27A 1SVKA 3KB1A 2QORA 1GM5A 3UK6A 4BGDA 1VYTA 1WP9A 4B3DA 1XXHE 4EPYA 1VMAA 5HZKA 2Q9AA 2WJHA 2VSFA 1NBME 1VYVA 4X8MA 3RS4A 4LHXA 1XJCA 1F6BA 1KO1A 1KO7A 1RFLA 4M2LA 2ZE5A 2MMCA 4EFMA 1LNZA 1E9EA 2FSHA 4DEXA 3MWJA 2ZRCA 1W36C 2H7VA 3T35A 2VQSA 3LWNA 4YONB 3P32A 2GZAA 2J0SA 1KI1A 4OQNA 1YRBA 1Z2AA 1T3HA 2ZRHA 4D26A 2ANBA 3JZAA 3U7FB 3GJ4A 4LYAA 3DZ8A 4LYFA 4LI0A 4PC3A 5AJWA 2C2HA 4A15A 2D06A 5EZ6B 1BYUA 4CW7A 1VYUA 1GFIA 3SFZA 2WMNB 1IM2A 1WCV1 4PC1A 4KVAA 2DBYA 4Q02A 2W2XA 2YOGA 4RD1A 2QA5A 3DOFA 5SZIA 3GLGA 2IYTA 1RRFA 2W6JA 4MRPA 3BB3A 4A0HA 4DIDA 1LF0A 2G0TA 2I1VB 3ND8A 2O8BA 4GT1A 2W0SA 1Z0IA 2FN4A 2CXXA 5FOTA 4Q9LA 2QN6A 1JR6A 4E07A 2RB4A 1Z0DA 3IHLA 4AG6A 4TYYA 4F4CA 4NYMQ 5KNDA 3U61B 4OQXA 1JBKA 1CKEA 5FBRB 2CLSA 1RIFA 3A1WA 5KTYA 4D4JA 4ABYA 4NBSA 2C77A 2ZRDA 5JHGB 3KFXA 1NLFA 4HUQB 5JSZB 1GNPA 4QC2A 2W6ID 2Z0MA 2ZRKA 2GEUA 4DDTA 3KB2A 1TF7A 2ZRLA 3EC1A 3LBNA 4PFSA 4HLCA 1GRNA 1II0A 1QHSA 4KFUA 1I2DA 5FR1A 5BWMA 1AGPA 3OFND 3KDSE 4ASUA 1QVRA 3DMNA 1SGWA 1COWA 1W5TA 2K5UA 2Z43A 3O8CA 2IT1A 1R7RA 1ZM2A 2QG6A 1EWRA 2I3BA 3PR1A 4IEIA 3ZQ6A 5AJYA 2ZE7A 4DLWA 2FPMA 521PA 5L3RA 2WAYA 1TTTA 4QM6A 3NEJA 1W1WA 4NU0A 2QQ0A 4JKYA 4AI6A 4EQ6A 2ZE6A 1N6RA 4ESVA 1I4TD 4B32A 4HB4A 1RPZA 4LRWA 3K70D 1RRGA 2BWJA 4DBLC 4PHTA 3G82C 1VCMA 4YMVA 4B48A 4A92A 3FVQA 1J99A 1OFUX 1YZQA 2GKSA 3I8SA 1HQYE 2EFCB 3IBGA 3L0IB 2QL6A 5ANRB 1L4UA 1C9KA 1XEFA 3X1YA 3BS4A 3EG5A 1L8QA 1SXJC 1Z08A 3OAAD 2CBZA 3UWKA 3QBTA 4XTCS 1KI8A 2ERYA 4BLSA 1ZAKA 4IVPA 3EC2A 2N42A 1JPJA 2CL7X 2ORWA 1RRCA 2ZJAA 3LD9A 1UBCA 4GP7A 3KUCA 1QF9A 1RKBA 1OHHD 2CHGA 2GVZC 1KKMA 4HAWA 4RCYA 5AJXA 1KTVA 2FNAA 3B2EA 3SU8A 1AZSC 1CJUC 3LX8A 4R2IA 3KJHA 2CL6X 4MUAA 2F1JA 4TZ0A 5JI2E 1KY3A 1R0WA 3QVUA 1OB5A 2OE2A 2GETA 3AVWA 1U99A 1OH7A 2RGNA 4RZ2A 5EP2A 1S3SA 1IN7A 1E6CA 3BWDD 1W36B 4NMMA 1AGRA 1S0UA 3ICEA 2IYXA 3RVBA 4EQ6B 4BFTA 2OFOA 2IHYA 4PO8A 1R5NA 4X8LA 4TLCA 3T34A 3DL0A 3SJAA 2IS1A 2Q9CA 2AD1A 1JXOA 4E22A 3R9XA 2Z5FA 3A4MA 2GWHA 4GL2A 1GIAA 2B6HA 2C96A 2CNWA 4IXNA 5JLJA 3MGCA 4IDQA 2OCBA 4CGZA 2R62A 1DO0A 1DO2A 3Q3JB 4LSGA 3ADBA 2UVQA 3QKSA 1G4UR 1B0UA 2UZ3A 4B6FA 1Z22A 2MSCB 3BFKA 4HZUA 4C7OA 1X3SA 4KBGA 3B78A 2V3CC 4FMBB 4WZAE 1VIAA 2F1RA 1T0HB 4XD7A 1HTWA 4MA4A 1EESA 2A30A 3KKNA 3OE7A 1MKYA 4WXPA 4IDOA 1P73A 1T9HA 2W83A 2WM9B 3U5ZB 4YC7A 3L2OB 1BKDR 2PZGA 1W48A 1G21E 3I8XA 3K0FB 4RCZA 3X1DA 1JR3D 4O0MA 4M1KA 4FXPA 1LW7A 3CPJB 3RWMB 3DO6A 1KMHB 1JJ7A 3QE0A 4JJKA 4CT4B 3K8YA 3U6KA 4I1VA 3FOZA 4AG5A 5K8IA 4OI1A 2IYSA 2RGEA 1NY5A 1B23P 1F48A 1IAQA 4JYCA 4MYHA 2IBMA 3NH6A 3CWQA 3TW4A 3EZFA 2F43A 2Q3HA 4KLZA 5J4YA 821PA 5JJIA 1T3LA 2PT7A 2JIZA 2VHQA 3DVLA 4KAXA 1VTKA 5EXTA 5L3VA 5GJVC 1E2NA 4ACAA 2PZEA 1T5IA 3OIWA 5FPHA 4PHGA 4DSTA 5JZVA 3IEUA 3F8TA 1GL6A 3V4RA 1NL3A 4JMPA 1JNYA 2F7SA 1CR4A 1W0KD 2VF8A 5FTNA 1E98A 2CHQA 1IXZA 4FD2A 4GZMA 2AXNA 3TKLA 4GOJA 3KQLA 3K9NA 5FOVA 2ODWA 2ZJBA 3VNVA 2HJVA 4TLEA 2O0HA 1MO3A 3C14C 3WNDA 4HDCA 3QF4A 1P7CA 4IOJA 2WV9A 2G1JA 5BYJA 1SHKA 2IYZA 3GJ3A 4DLZA 2IX3A 2YWFA 1GKYA 3B60A 2FG5A 3BIFA 5J47A 1CJKC 2IXGA 2IYLD 5B64A 4PPQA 3KFVA 2F3RA 1R10A 5C4GB 4JVLA 3K09A 2WVJA 2KJQA 4RD0A 4XWOA 3R9WA 5CIQA 3GJ0A 4ZPXA 2C98A 5J40A 4ZKEA 4OI2A 3KJGA 1G8GA 5AUQA 3NBFA 1RE0A 4QBIA 5J4LA 2QI9C 3C5HA 1GRQA 1NP6A 3WNBA 1GSIA 2ZVPX 1CLUA 4IXMA 4JL5A 5KO2A 2GAOA 1UKYA 5HPYB 1XFAA 1Z83A 1GILA 4UJ3A 4KFTA 1Z6TA 4WOPA 3MJRA 4TTQA 2ZAOA 4RZ3A 2IXEA 5CM8B 1NN3A 2JASA 1E9BA 2JJ2A 3PXGA 1GOTA 2FEMA 3KJIA 5JHHB 1OYYA 3C41J 2QZ4A 3BJIC 5EP3A 2CLCX 1NJFA 2BBSA 4R9UC 4AYXA 4AKHA 4KHZA 2HV8A 2XJ4A 1S1CA 2PLFA 1KAGA 2DR3A 4F7WA 1E1QD 1TQDA 3AVOA 1MRSA 3PFIA 4PSKA 4DKXA 2YWHA 5C46F 1P9WA 2GF0A 3FKSD 4GZLA 4L9WA 4LJ6A 3VR4A 5D3QA 4V0NA 5CLLA 1J8YF 1VDZA 1ZVQA 2PCJA 1LS1A 4WBSA 4I99A 4JKIA 3O47A 2WOJA 2VO1A 3RSOA 3M0EA 4EAQA 4CEIB 3QF7A 5AR1A 3M1IA 2YVUA 1AS0A 5FL7D 1LS6A 3TK1A 2NPFA 4D4LA 4KI0A 1UEJA 4DSUA 1NG9A 3BBPA 3K0AA 1YZTA 4G5SA 4KO8A 2ZS8A 1OIXA 3R8CA 1ZC4A 1IY1A 2ZI3A 2NO9A 3CX8A 1PLLA 3FPAA 1NMYA 3NTUA 4TWZA 2CK3A 2QPTA 1OE0A 3R9IA 2QRNA 3U3JA 3MCAA 2QT0A 3BERA 4Q9KA 3GLIE 2EYUA 3CRRA 4NTZA 1A4RA 1S4QA 2QSYA 3N2IA 3A1TA 1YZGA 1SVSA 2HXYA 3CF0A 3CNLA 3CRMA 2A5YB 1XBTA 4DLSA 4R2HA 4ZI2A 4B3CA 4MUBA 4LJ4A 3L82B 1S1MA 3H86A 3W5IA 3AVTA 2G77B 3QVVA 2VTKA 4HB0A 1KK3A 2BHRA 3BH7A 1YVDA 1M7HA 5K8TA 1KI6B 3B1WA 4QGAA 5H70A 1E2EA 1YZKA 3NG1A 1G9XA 1KSJA 1ZW6A 2WMOB 3GLHA 3SHFA 3IIMA 2HT1A 2F6RA 2OCPA 2GZDA 2G0NA 1IJFA 2GHIA 2GXQA 4GBMA 4LBZA 2WIBA 2QY9A 3KZ1E 2R8RA 1T4GA 2D2FA 3T15A 5BQ5A 3RRNA 2EFGA 3UMSA 2IWHA 4LGMA 1OT3A 4R7ZA 1FOEB 1CJTC 3FFBA 1QVAA 4JLNA 3OIYA 3CF2A 2ANCA 5LBIA 4B34A 1GL9B 2Z4RA 2VEDA 3RWOA 2WWIA 4MKHA 3GFPA 1JJVA 3B7GA 1Z0KA 4B73A 3W6OA 5M04A 3RC8A 3A1VA 1E2GA 4QNRA 3QSYA 3LXRA 2L0XA 2FA9A 4G5OA 2DB3A 3OFNA 4NCJA 2BOVA 4Q18A 3RLFA 2WSSD 3OEHD 4GI7A 2WAXA 3VHXA 3UXMA 4RFSB 1X8LA 3KXLA 2VP5A 2FJUA 3M4YA 4P4TA 3CUEF 5IT5A 1YHNA 1EX6A 2IYQA 3PEWA 4C30A 4JIMA 2BMJA 1XMIA 4JLBA 1KSFX 2IL1A 4LHVA 3KQUA 4F93B 2ATVA 3QKTA 3UPUA 3THXA 1EFRA 2C9YA 1KI9A 4Q7LA 2ZE8A 3UMFA 4BFYA 2RKOA 4LBYA 4TL8A 3ZZ0A 3Q7QA 2ATXA 4E03A 5TXGA 3QENA 2UZIR 4OJQA 4D0LB 3ZIAA 1AS2A 4QJ3A 2G6BA 2RGBA 1WBDA 3ICQB 2EQBA 4KV9A 1GAJA 3IO3A 1Q3TA 1UBGA 1C1YA 4RD3A 1T8UA 5J4VA 5CK4A 4NP6A 1Z8FA 1ZNYA 2WWXA 5KYKA 1P2UA 4WW0A 1G291 4TN1A 4HB2A 1XNJA 3WHKA 1EFHA 1MH1A 3LH5A 4Q4LA 1OHHA 5HCNA 3O8RA 4HYYA 4C9BA 3CKLA 4DLRA 5K8UA 3N70A 5DN6D 1NMXA 4Z8XA 4DJTA 1WE2A 2HYDA 1TF2A 2AKYA 1W0JD 3EZ2A 2LWIA 4LX0A 4XTRA 3BRWD 2GXAA 1X86B 1EK0A 3CRQA 1V5WA 2Z6VA 1E9CA 3LQRA 2OLKA 2I1QA 2RGAA 5KSOA 3GLGE 1P2TA 3ZQJA 3BAFA 2J3EA 1XEWY 5EXXA 1E2LA 1E4YA 3S1AA 4NCNA 4XWAA 3ZJYA 4ZDJA 1ZU4A
chains in the Genus database with same CATH superfamily
2GJSA 1G5PA 3PD0A 3FF4A 4RULA 4MRNA 2K7FA 1UPTA 5G53C 3RSFA 4EJSA 3H18A 5F78A 1Q50A 5IJ0B 4J4TA 3JQAD 1RYYA 1ISIA 3B70A 3EA0A 1DKNA 3MCTA 5F51A 4OYRA 4CM9A 3VPFA 3NBQA 1GAWA 1QHHA 4FYIA 4BMVA 2J08A 1IBLB 1U7XA 3P71T 1O95D 3RSHA 1RZVA 1PGNA 2RH9B 1TU4A 1ZUNB 5LB4A 3UAVA 2B8WA 2VDWA 1U0LA 4H0FA 1ZM9A 1JE1A 1T0PA 3L4BA 4NYJR 4WZBB 4CM6A 1W85B 4FQ5A 5AW1A 4KHPB 2N75A 3SNKA 2P91A 1NUTA 2EHJA 2UYQA 1T6XA 1T1EA 3GAFA 3KQTA 4GAEA 4I6GA 2IH2A 2PJZA 4A2QA 1XNRB 1SUPA 1JQ5A 2YMLA 2EARA 3CLVA 5DWQA 4CJXA 2AFIA 3PFKA 3HA7A 2YW9A 3PFHA 1SFRA 2A84A 2OO5C 2R6JA 2HFJA 2H2AA 5AOCA 4X7MA 1JR3A 1TJ4A 3F71A 1RJ9B 3PPYA 1CR1A 3I3SR 1P8JA 5BNWA 4ZYWA 1IXSB 2R66A 3QLTA 4M7PA 3NHFA 1RXUA 2ZTMA 1J06A 2IXBA 3B6KA 4HMQA 1DG3A 4HDRA 4MYDA 4KLAA 1V3UA 2IITA 3RSZA 1P1HA 4YVFA 4BFUA 2OV2A 4M88A 1M5UA 4OHFA 1TL7C 1FP4B 2ZS9A 1UJ2A 1YFLA 4BVFA 1NLMA 1RZRA 3FCSB 2XCQA 4NHEA 4UE2A 1T1RA 3UQZA 3SHTA 4UM9B 5CBPB 3OWHA 4HVTA 1FCJA 1T8YA 2HK7A 4B6GA 1E9DA 1CFZA 1OI7A 3NDPA 4MQMA 5K2OA 3RTGA 1YQ9A 3UJ7A 4A8JC 5CXQA 4YXWA 2WKSA 2G9VA 4MS4B 3WTBA 3EGEA 3LO5A 3WYNA 1VHTA 2CUTA 3PGXA 4U3JA 3G0OA 3HUEA 4RD6A 3VQTA 4EI8A 5ADWA 1NN0A 1RMTA 2F59A 5I9IA 1SB9A 4PO3X 1RM4A 1T91A 3ZW9A 3HCPA 1PO7A 2ZU6A 3AOEA 3WFJA 4Q9NA 3WY9A 3R40A 1JF8A 2HQ1A 3JAWA 2ZBFA 3ZD9A 4C0AC 4IRUB 1QMPA 5FO0A 3NYQA 5D5QA 4BDTA 1YNOA 1F1JA 3MUFA 4ITUA 3D4PA 3VU3A 4DDVA 3W90A 5LYJF 5ARCA 1EXVA 3C70A 4EIWA 3U9LA 2QD5A 3G5AA 3AK4A 4LCEA 2FCAA 4AG3A 1TADA 2XCUA 1DQSA 3DBRB 4LGVA 5MN5A 1U2DC 4IDNA 1TO1E 4GGOA 2PDAA 4RK5A 3R5JA 1OLUB 3NWEA 1E1KA 2IHTA 2JI8A 5LYJA 2DX7A 5EMJA 4K88A 6NULA 4FBMA 3LLUA 2FFRA 4H16A 1V1RA 3H1FA 4I5FA 1ZJ6A 2FUNB 4W4TA 1QRRA 2IZ1A 2BONA 3O2JA 4KNWA 2VNHA 2P3SA 1IUPA 1QF7A 2WUDA 2G09A 1H2EA 2DPLA 2Q3LA 2Y05A 3MWFA 4KTVE 3I1YA 5GM1A 3TIIA 1EM8B 3RF6A 3DV0A 4DQLA 5IJZA 2FQQA 5DLQC 1T6BY 2ZR7A 4LHZA 2R48A 3EN0A 3JQ9C 1Y1QA 5FBWB 3FZGA 1CCWA 2BUAA 2R9VA 3FYDA 4JA0A 4EB6A 1P2VA 2AN3A 1T3SA 5EJ5A 3N74A 3PNSA 1TJNA 2NIPA 4HWGA 4PINA 3Q1KA 1JQDA 3QUAA 1LBEA 2OHIA 4BV2A 1BKYA 4OHMA 3VAZA 2NXJA 4XGKA 2G76A 4OFZA 4DB2A 1Z0AA 4DLVA 3O8BA 1DEXA 5BMVF 4HSGA 5C34B 4QELA 3LP8A 2IYYA 5I5GA 3K0EA 4AUEA 2IXTA 1Z6YA 3RS5A 2WB4A 3H9UA 4RVOA 4ZT5A 3GRZA 1GRVA 1IULA 4DR6B 3L8YA 3KXDA 4YGXB 2IXFA 4K2HA 4INAA 1JG1A 3WRXA 3EEBA 2QAJA 2XUIA 3UV7A 3GAZA 4PAQA 1SBIA 4Q01A 2AFRA 5ALQA 1T10A 2CXQA 1SD5A 1YASA 1IZZA 1KC3A 1PNRA 1TM7E 4ARAA 3I6QA 3WQRA 3ONWA 1ADCA 4QVGA 3EW9A 4MRVA 1QYRA 4LJAA 4OJYA 4MR9A 3BHNA 1EYZA 2A78A 1G9TA 1FP6A 3PWSA 2RH4A 1JYFA 2ZPUA 3HKEA 4DXDA 5KQSA 2RJNA 3R6LA 3V7FA 3WADA 1SXQA 4H7PA 2WI8A 3RB8A 3IIKA 4DCNA 4QUGA 3ZC3A 2AN4A 5HKKD 1JQJC 1UZNA 4LHWA 3HZZA 1BRMA 4EGAA 2ZUEA 4RKEA 3L8HA 2QS9A 2JF0A 1XWFA 4OHZA 3DD5A 3ZBPA 1M8PA 1XTRA 1QM5A 5EWLA 3D0QA 3SX2A 1CY7A 4GSKA 5AVVA 1GV0A 1V11B 1CULC 1GEEA 1WPQA 2Q6OA 2YX1A 5TQ2B 2VRBA 2R7KA 4DZRA 4IUYA 5DTJA 2C4UA 4BIIA 1S8NA 2J48A 1JYEA 2JKYA 3LC0A 1GSAA 3AIOA 1CVLA 1XTZA 2C8LA 2J8ZA 2ZB7A 2O7VA 4QL3A 3GUZA 2ADMA 2AR9A 1I30A 3F8WA 4JJ6A 4D8XA 2QMHA 3E61A 1V8DA 4XPIA 3I9OA 3C7KA 1B6RA 2X6QA 1AU9A 1X80A 3DC7A 4JJGA 3ZLUA 3KKQA 4ADSG 3CUYA 4DB4A 2PANA 3A9CA 3TD2A 3NFRA 5E6SA 5GGYA 2JIPA 1VBKA 4J3FA 1BGXT 2BMVA 2ID4A 2JJMA 2O2CA 3DDOA 4PWYA 2YV1A 5EUMA 4ZIRB 1YF3A 3IVGA 1NURA 3LT1A 1HE2A 4BMSA 1AGNA 5A4JA 4DXHA 1Y6QA 3SKYA 1EBUA 1CS0A 1Z8DA 2RHWA 4BGUA 2W2TA 2CVPA 4QYTA 1HT1E 1TVEA 2PR2A 2A0FA 3IUSA 2ZRFA 4JGIA 4L5YA 3UXYA 4B6PA 1QYXA 4NL4H 3ND9A 1KQFA 2BGIA 2X9QA 2BHSA 2NZ8A 4WHMA 4H77A 3L7AA 2C54A 3ENKA 3F3SA 1N75A 3W0LB 2HCFA 2NXCA 2G5CA 5F7ZA 2PBLA 3P9ZA 2MCFA 1NONA 3JAKB 4TS9A 5EWMA 5DBFA 1HV8A 3ZXXA 1CJMA 3GA7A 2XNSA 1MC4A 2B83A 2Z1NA 4IVRA 3EIOA 5I7AA 4DXAA 2VP3A 1OYOA 3G9XA 4C4YA 2FZCA 1XTBA 5IKOA 2P3LA 3NC1C 1G5HA 1QQAA 4D3SA 3ZXUB 2PAAA 4POAA 2REQB 3VYVA 4LQCA 1IMJA 2QZZA 1NG1A 2G08A 5EHGA 3ZKAA 2OEPA 3W5SA 1LI4A 5JEEA 4DQXA 5K0SA 1R4NA 4QPZA 4C3OB 1YULA 1FX1A 4L8VA 5EJ6A 3R7WB 3A6DA 3KKZA 4E5VA 1Z75A 1J09A 2NAPA 4IIUA 4ZGGA 1TK2A 5E3HA 2B8EA 2ZBPA 2K2WA 3WI7A 4WASA 1J1UA 4JROA 4JX8A 3LX5A 1JHVA 3PV0A 2ZJ2A 3IPXA 4TT8A 5KJ1A 2R1ZA 4ZXPA 2PXXA 1HY3A 4MEJA 1XVIA 2EJUA 2FSVC 2R1VB 4R9VA 3WB2A 4EOGA 2WD7A 1CJBA 3ZPXA 1V3VA 3H84A 3Q5DA 3T5DA 5LQCA 1KJ8A 4GDMA 4MWZA 1N2IA 1N2CA 4UQLA 1PFVA 3OQJA 4N82A 4LC0A 3BPSA 1T6ZA 2QIPA 3ZWPA 3RRBA 3HDQA 4BLPA 3R24A 4ED9A 3KNZA 5C8ZA 3EF3A 3O8DA 4O4JB 3FTEA 3LM8A 4W1QA 3R7NA 3RM3A 3U48A 1DIGA 3M1LA 3AF0A 3EIQA 5F12A 3HUFA 3QX7A 1F7VA 5ESXA 1R6VA 2OBMA 1OV6A 1USGA 4BNFA 5EXPA 1G0NA 1OC2A 1N5JA 3O1HB 5D3MB 5K0GA 6GPBA 5DGXA 3HDVA 3PYMA 2HLDA 1BW9B 3DEAA 1ZXBA 3E15A 5DYIA 1D2NA 2YVLA 1JJIA 4B5LA 1XF9A 3JQQA 1HEUA 1YR8A 3V46A 3ZYZA 2GJ9A 4EPWA 1P72A 3N2GA 3AFGA 1Z17A 1ZD1A 4RZHA 5COBA 3AERB 5GM2A 4MB2A 2RE8A 1OXVA 3C3BA 3EBPA 4MO2A 2GPBA 4MPRA 4V0KA 3VU1A 3HO1A 5ELLA 2IC5A 1Q1BA 3K31A 3R3ZA 4IKOA 1IBSA 2GA9A 3ABSB 4C0JA 4YRNA 1I6MA 1JI0A 1W94A 1BVRA 2DLDA 4N5LA 4U00A 1PZEA 2XNDA 2Z98A 5F2NA 3BRQA 4L50A 3QU4A 4XD2A 1JX6A 5U1PA 2FDCA 5YASA 5IM4F 1IQPA 4MVYA 3MJHA 1RR6A 3F9IA 4QUDA 3W8RA 4Q7QA 1WXHA 1Z7WA 3FLMA 4WCVA 4YLEA 1GQ2A 5L3SB 1E58A 2AUMA 2BM0A 2XKJE 1S6YA 3VSEA 4F3NA 2JIQA 5CXXA 1ZGHA 1E2BA 1IXYA 3RARA 3LL4A 1P4AA 3F9RA 1LW6E 1NUSA 4RDXA 4GMHA 2IPMA 5CA0F 2YNMC 3DUWA 2AOUB 4YAGA 3HB0A 5AW8A 5KOHB 4EUFA 2A1UA 2N1MA 2PZAA 2H9AA 1EWTA 3QU9A 3UG6A 2JEOA 4DR5B 3KE8A 2R8PA 3T7KA 2C5FA 3GMSA 5AK0A 1LRLA 1PNTA 2H1HA 2DCUA 4H2DA 4BLOA 1WB4A 1J0CA 2PEZA 3DG9A 2EKLA 4MW9A 5F7XA 1BYIA 2WWGA 1UEIA 1KVQA 3W2HA 4ZFNA 5CA0A 3OJCA 4TUYB 5L51A 2R68A 4JLKA 1R37A 4LYEA 4MUMA 2FFHA 3GW8A 3P52A 4OQMA 3QPVA 1H8EA 1GZ7A 2XDQB 5F3RA 4V3BA 2E4AA 3HVIA 1XAIA 1PD0A 3OZXA 3GBSA 3SHQA 4RX1A 2HM7A 3ZH2A 3HY4A 2J5RA 4ZTBA 2DFNA 2OHGA 3BA6A 4YMWA 4HJXA 5CYFA 1UC5B 3MXOA 5IUJC 1G5TA 1XGKA 2NWQA 1WMBA 1FXUA 1NOJA 2BISA 4FFMA 4LXTA 3DQZA 4YA6A 3QKRB 1FB5A 4HHEA 4E5PA 2P75A 5JLAA 5B1YA 2OZLA 3EGVA 5HF9A 3DGEC 5KMGB 3MJVA 2NU7A 2Y8EA 3X44A 1HC7A 5J5CA 3F47A 3F7OA 1UM9B 2RK3A 2FFQA 3HUTA 1F1BA 1A82A 3NHYA 1A77A 4PU0A 4XCXA 3U0VA 1YO6A 3GPBA 3GCZA 3MMXA 3WOVA 1BHJA 4UDOA 4RNCA 4C0KA 4WUTA 4CTOA 4MVJD 1SC6A 2P8SA 1KQ3A 1M7BA 1SXJB 4LF9B 1MIHA 3MJCA 4DUPA 3SS7X 5AUNB 3NOQA 1EFDN 1XEWX 4OKNA 1GUDA 1PS8A 2DHCA 1TJPB 1Z68A 2XE4A 3JPWA 3L6DA 1ZIXA 3PHIA 5BYAA 3BFVA 5JQGF 3DUFA 1GG2A 4U6SA 2V7UA 1X7WB 3KQOA 3EARA 3HB1A 2BUCA 1RT9A 2JFOA 3LI2A 4BQNA 5JYCA 2I66A 4EKIA 2R8ZA 5IARA 1KO4A 2W98A 4UDNA 1W4LA 2P5SA 3C8MA 1O77A 4Q9AA 3RH0A 3A4VA 3ZDEA 1ENZA 5ERYA 3ZV7A 5C7OO 2XVAA 1I3NA 4BV9A 5K03A 1XXHB 4LPKA 4OVKA 1CY6A 3PD1A 1JEJA 3FWNA 4LQ4A 1AM4D 3D31A 4QU0A 2Z4TA 3W3ZB 2GVNA 1OIVA 2FPRA 5EEHA 3ZQ4A 3SC2B 3SG0A 4BB5A 1WY5A 1BU8A 1DEOA 2VOJA 3AF4A 1HE5A 1Z38A 3KVOA 4FIDA 4LJKA 1LUAA 2BF4A 3LGAA 1J21A 4B2IA 3HEBA 3DEIA 4YWJA 5K09A 1QHIA 1A5SB 1GG9A 3NBXX 2IZ7A 3QYAA 1LQ2A 5CX4A 4UBMA 3OJ0A 1DXQA 2E2WA 5DX0A 1DUVG 4D97A 4KH1A 2NUPB 3KO8A 2OXEA 2A9PA 5CYOA 1VZ3A 2GK6A 3MS4A 1FU8A 2ZBVA 3VI3B 4AWBA 1IHDA 2KB0A 3M4NA 1OGJA 3L4EA 3LC7O 1JAIA 3F8SA 4WZ6A 2PPLA 3KPUA 1DCTA 5E6RB 4F5WA 3PXEA 1PJZA 1QIDA 1WD5A 3THSA 4P4NA 5HIIA 1UQTA 4WIAA 5ENZA 4P3KA 1SU7A 1UMDA 1ZUD1 3OJXA 1UC8A 4TZ6A 3ZWXA 4G07A 1DC5A 3EW7A 4XGRA 1HFJA 3D6NB 1OAKA 2BFFB 2NPOA 3LY9A 3NPMA 4G65A 4C6TA 1GSHA 2AYZA 2AZDA 4OH1A 4PE5B 2G67A 4QU9A 2W2LA 1FFDA 2PGIA 3IAFA 3QSGA 1RADA 1N0UA 2VSNA 3HCCA 2HIHA 3UBMA 4QQFA 4J0IA 4RXTA 3FZQA 2BFCA 4J03A 3ZX4A 3AHGA 1GQOA 1ZN9A 4PRLA 3ZGLA 2VF4X 4DHWA 1U3GA 4FYVA 2I2AA 3C7TA 3D02A 3O4HA 1HURA 2A5LA 3OECA 3TR5A 3UN1A 3CCFA 2WKPA 3WYDA 1JHYA 1WZNA 2MR6A 2BW0A 4EPRA 3A70A 3BRSA 4G0QA 1H2BA 1J70A 3TF5A 3SMVA 5HFNA 3IERA 3SE0A 3WQBA 3ZZMA 3W5AA 2E1RA 3AR8A 1KVUA 2C2MA 3WV5A 3F5MA 3IUYA 4ZAVA 3FFXA 3TPCA 1RW4A 2OXCA 2ZPAA 3EHEA 1DZIA 1HDXA 2C04A 4M9CA 5AI0A 3SQDA 2AG0A 3KOXA 2GPTA 2HBQA 5DIFA 3R3JA 5A4FS 5AW2A 1FDRA 3EXEA 1H0SA 5JCJD 1TQ6A 4RA6B 4B84A 1PR6A 2JCSA 4HFRA 5CM2Z 3W3AH 4J1NA 3H6HA 1J6UA 3OO1A 3WP1B 4R2KA 3K5WA 1E69A 1US8B 4AZTA 3TLGB 4O4IB 4EMBA 2AZ4A 3NB0A 1WETA 3VV2A 4M55A 2WHXA 1EJ0A 4S04A 1P33A 3P96A 3CZCA 4H7FA 3WMEA 4QTUB 3QE2A 2B3DA 2XXAA 5EFOA 1E3LA 2ECQA 2O3QA 3PJGA 3S5UA 2C2GA 4C4ZA 1M0SA 4CRWB 3CKYA 2H5IA 2FN9A 4JJ8A 1N25A 3RJMA 2UZ4A 3K4HA 3QPAA 1ESNA 4AKEA 1FVXA 2I6UA 1H66A 3QTLA 4UZSA 1E2PA 1X42A 2B2CA 2H1CA 4JBWA 5KPJA 4J49A 4HEQA 5CX1B 1C0PA 1XIVA 1GNQA 1XRLA 2O23A 3EZ6A 5EKDA 4BP3A 2HXSA 5BN3B 2P2SA 5LP6C 5KNDD 1TI7A 1V95A 2PT6A 1EQAA 2IIQA 1XPRA 2CMDA 1Q16A 2ZSAA 3RK1A 1RCUA 2YZ7A 4EYSA 2HRBA 5IAOA 4A6XA 5HILA 4WT7A 1EI9A 4KQHA 4NJEA 2EJVA 3HUDA 5GIOE 3R5XA 2EC5A 4TRNA 2XB6A 4LZNA 2AQ8A 2G82A 3BWEA 3WL7A 3ZGXA 1J0XO 1D2RA 3ICVA 2Y0PA 3MJTA 5AW9A 2VG8A 2WAOA 2JZNA 3ZGZA 3SZRA 4BMDA 5HQ3B 2DTDA 3VR5A 5INTA 2E1PA 1X13A 5I7FA 3LS2A 3PI6A 4UW9A 1I6KA 1YS9A 1BFKA 2UV8A 3ZTYA 1KQPA 3Q87B 5H8WA 2QTRA 4Y6GB 4ZA2A 5JUWA 2OVBA 2OENG 3HY3A 3P20A 3OQBA 5LQDA 1OUMA 2DKFA 3KSMA 1IN6A 2H1SA 2GEKA 1Y6ZA 4F5EA 1Y37A 2CE7A 1DCKA 5DE3A 2ZETA 3WJAA 2X2FA 2HSEA 5KYWA 3NAQA 4BOYA 4CMEC 3R5KA 4A9AA 1GKIA 2HMTA 4H7IA 3AVYA 2J9RA 4KQ6A 3HLKA 5UKDA 4J4BA 3RVRA 3DMTC 3CWCA 2XECA 3LLMA 4J0GA 1C7EA 1G63A 1GFSA 5BT8A 4F72A 3K0SA 3I1IA 3IB6A 4AN1A 5KPDA 4EF5A 4MH0R 1QE3A 3S1SA 3PJEA 3ZHXA 4EVRA 2GJAA 2X1MA 2CXUA 3LUFA 5D2CA 5KYXA 3FOFC 4REQB 4RW0A 3A1DA 3PUKA 4KGZA 4RGQA 1JFFB 1QZXA 1L7OA 1JHMA 4BEWA 1SA0B 1YR6A 1YZLA 3Q72A 4JB8A 4MYCA 4Z99A 1HLFA 5IUKC 4EA8A 2IS6A 1JLRA 1EFTA 1PGOA 2W90A 1XRJA 2OHXA 3DD1A 1UZMA 4HTFA 2ZSEA 4ZYLA 2C7PA 4DMCA 4Y6QA 3WWYA 3ZDQA 3RVNA 1OLXA 1YS6A 2V98A 2AG5A 4JBXA 1F8FA 4OGWA 4P84A 4QXOA 2O48X 4L2IA 4CZ2A 4JBGA 2OZEA 2C59A 1I10A 1IHUA 4FR5A 4O63O 4TKLA 3WLSA 4RTSA 1QKJA 5HTKA 1MW8X 1V5IA 3F0TA 1E20A 2J7PD 4O0LA 1J9ZA 1PJLA 4R9SA 3IKJA 1M7GA 4EMTA 1JAXA 4L07A 3ZI7A 2UVPB 4ERXA 2XB9A 5KDDA 4RPGA 4KXQA 1UK9A 3GEPA 4MQEA 4MQ5A 4EG1A 3F6RA 5CLFA 2DQZA 1RAAA 1W9HA 5B1DA 3EHDA 1LF5A 1Z5PA 3CSDA 3GQVA 4G9BA 4RABA 4B7XA 1Z2CA 4FYMA 3AVUA 3G1UA 5JSYA 2HEIA 3AL2A 4K9NA 4UMEA 3TUZC 2XB2A 1RM3A 4J9VA 4K6CA 4X7RA 3D64A 1RQPA 5FYQA 3W4IA 3WGZA 3MT0A 2MINA 5A9SA 3KS9A 3PGVA 1CY0A 3PKIA 4NH0A 5AI4A 4M6WA 5DGHA 4HUTA 3PKJA 3IPAA 1PJ4A 1IONA 2BEVB 2W0MA 3OKCA 4BPBA 5EFZA 3FNIA 1Q3KA 4V0OA 4LRUA 2NO5A 1VKNA 1Q0HA 3R1IA 4FMDF 1RAIA 4TWIA 4TQUS 5C52B 4UREA 4RLQA 3ROMA 3RTEA 1Q2UA 2XTNA 5A3VA 2I9PA 2HREA 2EKZA 1C3JA 4NBTA 3PDIA 1E1RD 1G0OA 2MMGA 4O4HF 3SJBA 1VC2A 4EG5A 2O3RA 2ID7A 4AO7A 4NULA 2WG2A 4BBAA 2DPYA 3HWSA 5LQUA 2Q3EA 3RK4A 1ABBA 3UT6A 2B1GA 1WX1A 1UKVY 4Q7KA 3GCWA 1KP9A 4F8YA 1ZC3A 2FMXA 3DTVB 3I6MA 3GJZA 1Z5UA 1PT5A 5HRUA 4KG7A 4WVFA 3VNRA 4J6EA 1H5QA 3ZW8A 3Q7PA 2RIRA 4P2GA 1QOQB 2EZ9A 2W2KB 1A69A 4YY3B 4DS3A 3HNOA 3FAKA 3TKAA 2QTWB 5IJWA 3WL8A 4DHEA 2AEJA 2VH1A 1NVGA 1QORA 2YS7A 4A0RA 4O4LB 4TN5A 2UYCA 1D1TA 1L7MA 1SC4A 3EJ6A 1VI2A 4MVJM 4QOFA 1R0BA 3EXFA 4LYGA 3DS8A 3TEJA 3WZ2A 5CBKA 1NIJA 2VZ0A 5JRZA 2BGLA 4IIJF 1N1GA 4N39A 1TO2E 1SQ6A 3FCXA 5CNIA 2FWMX 13PKA 2QUZA 3RSQA 1T9BA 3SVZA 5BOSB 4Q4AA 5FPPA 4F4JA 4BQRA 4QG7A 3NFYA 4HLUC 3EXHA 3D8HA 2ZXFA 2GD6A 4YYZA 3IL2A 1L5FA 2XJ9A 4Q1VA 4IXWA 1RKUA 3GLTA 2PX6A 5ALIA 4EEXA 3S8YA 4RM3A 3QVOA 2JAOA 3TOVA 4DMHA 3HBLA 2ZJFA 4FFSA 2CJWA 3LRTA 3DT9A 4JLMA 4HADA 3U5TA 3R09A 3WA7A 4IO0A 5IEJA 2Q5JA 1XDSA 1EBFA 4RHYA 4YCDA 1MVOA 1S2NA 3HQ4O 2NVUA 4YX9A 2HF7A 2PSEA 4EDHA 1YDFA 1SC9A 2J87A 4BB9A 3AR3A 3C48A 2V7BA 3VPCA 4Q6BA 4DG9A 4EJ0A 3JVVA 5JD3A 1EJ6A 1XNHA 2F2TA 3KLNA 1UM8A 4U7GA 4IPTA 1TD9A 3M5CA 3T06B 5TMEA 4HQNA 3RADC 3R3HA 3ULKA 1Z62A 4M1OA 3H2SA 1U9IA 4PXAA 4V2IA 2WJ6A 2X8JA 1P9RA 3RYFB 4MJXA 2GXUA 2H3HA 3ACDA 4REMA 2H0AA 2PD6A 1O54A 4RSGA 2HBZA 4ZQFA 3DOCA 2OHFA 1PT7A 3LX6A 1I3MA 4PZZA 2B5WA 2EFDB 1MEOA 1YUNA 3GT3A 2OC9A 4N3BA 4MI1A 4UC0A 3WLHA 3KAQA 1CEYA 3NIBA 3H9JA 3ZHBA 4RTJA 1JDSA 3LDAA 4FOTA 1L7PA 2NLOA 3F4KA 1PSDA 4P4SB 4WKGA 4URYR 5COQA 1H2RS 4YRMA 5HXAA 1IHOA 4DCOA 1XDZA 4CIXA 1PVOA 2ONCA 2WFZA 4YJHB 4ZVQA 1B1CA 3LCRA 2GNAA 2BSQA 4WEOA 2UZ1A 2HHAA 2X2EA 5DRYA 3GYGA 1SUSA 5ECYA 1OGIA 1Y6JA 2QD1A 3I2FA 4FGJA 5DGDA 1T4BA 3UJ3X 5C0OE 4DCPA 5E1MA 3HXPA 3ES9A 1FFXB 1P45A 4FS8A 4J0QA 1HEYA 2PBZA 3IURA 4LVNA 4NKRA 2FEAA 1ZFNA 2NYRA 5AHXA 5B3JA 2AJ8A 4K6OA 3MWDA 4XWKA 3MMZA 1KERA 4ON9A 2BF7A 2Q8QA 1M6YA 3TZBA 4BVGA 2BI4A 4ZQHA 2I3AA 4FX5A 2PA0A 2RK6A 3LHDA 5DULA 1L1RA 2LBPA 3ECCA 1HA3A 2KLHA 5IEBA 4RVGA 3MMPA 5DYGA 1MB0A 2G8LA 3GU3A 5FOUA 2YV3A 2AR0A 4N76A 4N9WA 5K5EA 3PUYA 4I1YA 5KOJA 4CKEA 1EDOA 2V8OA 3OQIB 1MIOB 2ZQ5A 3CYFA 4EELA 2AH5A 5TS3A 2W4QA 3KJXA 3UF0A 4R8LA 1A8SA 1Y8AA 4GH5A 1E2FA 3EPLA 3Q9SA 2CLIB 4ZC1A 5CFZA 1PQ4A 5C31A 3U9TA 5K6TA 4C7MA 1Z39A 3QLEA 3ZDBA 1KO5A 2WVHA 4V0QA 1PZHA 1HX7A 2LVBA 4LWOA 2X9LA 3AB7A 5CNJA 2H1OA 3BIWA 1X7DA 4BMYA 5JNWA 5A0VA 4MMXB 4PLFA 3GLFB 4QJBA 1I7LA 2FKAA 1N7GA 3H2BA 3QWIA 4XVQA 4E11A 1N2EA 1K6EA 3SF8B 5IHXA 2H18A 3EFOA 4KR6A 1GO2A 4CTKA 3WLPA 2LV8A 2FWAA 4LK2A 3Q8MA 5SZKB 3O95A 1AHNA 1CYEA 2Q5FA 4Y1RA 3EK2A 3K72B 1ADGA 4Q93A 4XX1A 4C0SA 3HBJA 3PE3A 2CK3D 1QG0A 1GNSA 3ONDA 3OZTA 1RKXA 2AHRA 2VNKA 1NNI1 4JQZA 1TUEA 3HVKA 3QVLA 2RAPA 1R4MB 1RRKA 2NNWB 3NYWA 4NMXB 4MKRA 1DFGA 4NK5A 1NNLA 2BUBA 2O5RA 5GV8A 4B4DA 5M5BA 3U3KA 1NAHA 3AKDA 1X8XA 3IELA 3UENA 3UFXA 1NE2A 2AR7A 3B5EA 4KUEA 4M1YA 4C4SA 4D5EA 3W9UA 1WVIA 4FD3A 2GDJA 3TMYA 1HK7A 2FFBA 4FWTA 4IQ8A 4QGGA 1R4ZA 3FCEA 3HRKA 1YSCA 2JIDA 3C1OA 3EVGA 4WXYB 1QG6A 5FBHA 5BN5A 4WN9A 1O0CA 3EXAA 2JLSA 3ZY4A 1TT7A 3ACBA 1NXQA 1JLSA 3DB1A 5H82A 4Q1EA 1QHYA 2EZ8A 5A5VA 2FOXA 5IVIA 5HZHA 5EINA 3NBAA 1YDHA 4EARA 3ITDA 1CUCA 1QHXA 1T13A 4XB6B 1GPBA 8LDHA 1YR1A 4PGGA 4IHKA 4Q19A 1E1NA 5KVVA 5A5FA 1BOOA 2R47A 4GR9A 1WUJS 2V6FA 4K26A 3WK6A 1LVUA 4ZQBA 4O2BA 3AEYA 4WY5A 2EF1A 1IUKA 2PH5A 4H3VA 3IULA 3MWYW 4EX6A 1HRKA 3MB8A 2BFEA 3UJAA 1XROA 3AM1A 2Y66A 4OLFA 3I09A 1BEEA 5LQSA 3T3EA 1TO6A 2Q3FA 2PRKA 5DP1A 4O2AB 2EWWA 1RYBA 4RZUA 2HL6A 1NKSA 1IN5A 5T7BA 1GPKA 2QTFA 3IQZA 4OHWA 1ZOLA 4LBVA 4V02A 1QFXA 2RGNC 3BSWA 3BZBA 3JYHA 4L76A 1ORWA 2O3JA 1JU9A 3MERA 3JWHA 4KPUB 2CFSA 1E8NA 4U02A 3EPJA 2A57A 3E9EA 3RRZA 2Q5CA 2NU8B 1TX4B 1XVUA 3ENZA 3NKVA 5FWXA 3NEPX 4G4SP 3ISTA 3P0FA 3IE1A 4K7JA 1F9AA 3DE6X 4OG2A 1PK9A 1PQWA 4XYGA 1U0BB 2ZQYA 1EGHA 3ZS9A 1NVMB 3K6RA 2OXFA 3L8GA 3P1JA 1CRPA 2XGOA 4GF5A 2O14A 3RIMA 1UAAA 4IDGA 3QBDA 4QUHA 1E3JA 2EIXA 3H1GA 2AA3A 2P3QA 1U7DA 2DSTA 3IOEA 1SCBA 4I8DA 3WKDA 4R7GA 2PKQP 3IIJA 1DAKA 4EPTA 4AROA 1VSVA 4Y7CA 4N47A 3X3HA 4C22A 1ZUHA 2XCRB 1G59A 4YUWA 2PFSA 3V8MA 2VJMA 3DNFA 3OESA 5FI1B 1GKUB 4DAOA 2R79A 4M0DA 4UUBA 3K9FC 3HDTA 4I5DA 3RKSA 4OBEA 5BXQC 4FYWA 2FAXA 1XQWA 2O7NA 2FZ4A 1Y9EA 4AS1A 2AQKA 1YR3A 2OCDA 2OB1A 3ITEA 4O59O 3GOQA 2YWRA 2J3JA 3A3KA 1WU7A 5KOYA 1YJXA 5JVDF 4JUFA 3NIGB 4PQEA 2BJWA 2KQUA 2OGUA 4ARCA 4MS1B 4C4OA 2ZYSA 1M1YB 1DKLA 4BNDB 4ZDKA 2B36A 1IUOA 2MYPA 5DI3A 1UODA 5EXEA 3T9DA 1KNQA 1WDLA 3KYIB 2D1SA 1M83A 1V6CA 3ILVA 4JP2A 4QOSA 3E5RA 5TMBA 5EUCA 4FZ5A 5JDCC 3NUGA 1FPQA 1G3QA 1WSWA 4OMFG 5JMPA 5TT0A 2HK8A 2NO1A 5JVDA 5JT1A 5FPTA 2IH5A 2ZWIA 3ESZA 2NO0A 5C53B 4OY3A 1Z4OA 3E82A 1W73A 3H5WA 5JXJA 2YMQA 1QQBA 4G4SO 2VT3A 1Q12A 3D3WA 3ROXA 3PTAA 1B6SA 1WCIA 4OKSA 4EHIA 3H1PA 3WAJA 4ND3A 2X7XA 3E2MA 2C3MA 4URVR 4P82A 1JAHA 1FK8A 3C4JA 2GFQA 3IAM1 4LWPA 4B4UA 3IDZA 4WINA 5LR6A 2WTUA 4GHWA 1W2WB 3CUKA 3JQAA 2FQWA 2QMUA 2M6RA 3ZZ1A 4TLAA 1KMCA 1G19A 1XD2A 2J3IA 3MINA 1SPBS 2XQKA 4IIDA 1JLKA 1Z06A 3P2YA 1O95A 4H4EA 4QHYA 3SI7A 1KJJA 1QCCA 5F76A 3VR2D 5A62A 3WV4A 2C2KA 1NR5A 2BC9A 4HNAA 2SKEA 3LK6A 4GYYA 3GDHA 4TMWA 3MRSA 3W3AD 4ZZ0A 5CIWA 3IHKA 5KWVA 3JARA 2FPPB 3KSRA 1BXZA 3CC8A 2B5VA 4NCHA 3UEOA 1HZZA 4LZZA 2DFVA 4RVCA 1I3LA 3PC4A 4LRXA 1U1GA 1NQXA 4E2WA 1K6XA 4W9RA 3KZMA 1Z6ZA 4IJUA 4PZDA 5EKXA 2G9ZA 1BSVA 1CJVC 1GGNA 4DC9A 3P2KA 2GSWA 1KIMA 5FOQA 1RQXA 1EQ2A 2ATEA 3U19A 3NWBA 1ODTC 4B3GA 1E9FA 3HCFA 4X66B 3KQYA 4YI3A 1GTVA 1O9GA 5DP2A 2P9ZA 1L7RA 1QV6A 3ANLA 5AM4A 5FJJA 4E6EA 4HGNA 3SQXA 1W52X 2EGUA 4UQOA 2X9NA 3VZBA 1PLJA 2Q46A 1V1JA 3F3YA 3Q88A 2WHPA 3DPIA 2V6JA 4LJLA 3X1JA 4C01A 1KDZA 4U2CA 4E5MA 1SUIA 3RNOA 4DN6A 5CFPA 2JVIA 4E7OA 2ZM6B 1Z5ZA 3L6CA 2H65A 3F98A 3PT5A 3QX8A 4BO4A 4NFHA 4QQKA 2C99A 2DHEA 2D4HA 2I3GA 2CNOA 1P2GA 2C5SA 4H1VA 4IGAA 4D9IA 1YQQA 3C6KA 3ABRB 4BZPA 1PFQA 3KVYA 4EHKA 5A7HA 4XM2A 1NF8A 1G8HA 1ML3A 5ABPA 3K1ZA 3KJNA 3O3MB 4NENA 1U7OA 2VQ3A 1P0CA 3EVBA 5C81A 3SEQA 1SMKA 4DYHA 2OUKA 1F0YA 1P39A 3TDNA 2JH8A 3QKIA 4O4HB 4HZUB 2PD4A 4F38A 3N7UA 3FRJA 5GQSA 2RDMA 1Q22A 5AM3A 5BV1A 2Z1MA 4JLWA 1U3DA 4G36A 3TOSA 1RKQA 4B9AA 4EPXA 5JASA 2R6HA 4TYNA 3R7BA 5LMNB 4N1AA 5FBQB 1HYBA 3QPWA 1ECBA 2P41A 2EFJA 5F5XA 1EG7A 3L0SA 4LC1A 4YCBA 5SYNA 4YUXA 3LOPA 3F5FA 3VSCA 1EFCA 1H22A 5IFKA 2HRQA 1ORVA 3OEED 1CX9B 4OK6A 5AKEA 3KK0A 4PW0A 1PEKE 1Y9AA 2XT6A 3LZDA 3SOPA 5BW8A 2NQ8A 2XX3A 5JWHA 1V6AA 1NMZA 3L8MA 2G88A 4YTEA 4XOUA 4DQVA 2I2BA 5THQA 1CIJA 3EDQA 3L7DA 4RJIA 1UFQA 4JI1B 3ZWKA 1CF9A 4B4WA 2WLSA 2P9FA 2W48A 4OHOA 4Y2UA 5EIWA 3QV1A 2VYCA 1YCHA 2NU9A 2O0LA 1JB9A 2R00A 4A6PA 3P9XA 5A3RA 2DF8A 5TS2A 4XWYA 4JELA 3UT5B 4D2IA 4WBNF 5K0CA 1LNSA 4MV9A 2F43B 5FPKA 2FV8A 1RPAA 1JI3A 1T2DA 1U2SA 5DTIA 1GFZA 1W4RA 1WF6A 1NIPA 2BGRA 2EX1A 2XMPA 1CY1A 3LPLA 5TEVA 5JPCA 2FUCA 4G0WA 2YVAA 2I8CA 3L0BA 3ZV6A 3ETGA 4HGQA 2TRSB 5LMCA 1OJ7A 2RHJA 2VYFA 5DI9A 4BQFA 2ONYA 5T6BA 1JIKA 2A9VA 2VXOA 3PZRA 4KNYA 1BZYA 1TTQB 3OY2A 3PFWO 4MQ6A 4W5HA 4WA8A 3CVUA 3HXMA 1ODIA 4XQ9A 1G8KA 3G89A 4G0OA 3SNHA 2PMFA 3VR3D 2G5TA 2J6IA 3TLYA 1RKVA 4MV8A 2XGGA 5AI9A 2BGWA 3IODA 1L5SA 2E5FA 2J4DA 1R8JA 3DHVA 1BWSA 4M54A 2CXHA 3OP1A 1W581 5F4BA 1GGKA 3OT1B 1N34B 3LW8A 2BL4A 4MDEA 1S2GA 4LUCA 3A9UA 1XDUA 2HA4A 3QF4B 3VZSA 1HUQA 3QI2A 4PN3A 5AK6A 4LX8A 2C4KA 4M1SA 3O84A 4PZAA 3AUXA 1KMNA 1T0JB 3AKCA 4S1OA 3RVKA 1JIVA 5KEIA 1HYEA 2BLNA 3M6XA 2F67A 4ND5A 5HKKA 3MMSA 3U09A 1CUUA 1J0BA 1XMPA 4X1KA 4Y6RA 3S27A 4OQ4A 4NSNA 3VMFA 4F1KA 2Z6QA 2HPZA 2R1TB 5EUQB 2B78A 1B74A 2B4KA 4JL6A 3WGIA 5MHTA