5EUMA

1.8 angstrom crystal structure of atp-binding component of fused lipid transporter subunits of abc superfamily from haemophilus influenzae.
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
255
structure length
250
Chain Sequence
KDDGAYKAEPAKGELEFKNVSFAYQGEELALNNISFSVPAGKTVALVGRSGSGKSTIANLVTRFYDIEQGEILLDGVNIQDYRLSNLRENCAVVSQQVHLFNDTIANNIAYAAQDKYSREEIIAAAKAAYALEFIEKLPQGFDTVIGENGASLSGGQRQRLAIARALLRNSPVLILDEATTESERAIQSALEELKKDRTVVVIAHRLSTIENADEILVIDHGEIRERGNHKTLLEQNGAYKQLHSMQFTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lipid A export ATP-binding/permease protein MsbA
publication title 1.8 Angstrom Crystal Structure of ATP-binding Component of Fused Lipid Transporter Subunits of ABC superfamily from Haemophilus influenzae.
rcsb
source organism Haemophilus influenzae pittii
molecule tags Hydrolase
total genus 84
structure length 250
sequence length 255
chains with identical sequence B
ec nomenclature ec 3.6.3.-:
pdb deposition date 2015-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5eumA00
3KQNA 4LPSA 4V0ME 3CNOA 1D8TA 2IYUA 3UATA 4IVPA 2V54A 3DPUA 3NWJA 1ZW6A 3NDPA 4JLAA 1E69A 2IL1A 2OV2A 3K0FB 4LJAA 4B48A 3LV8A 3PITA 3QXXA 1ZNZA 3QJYA 4Q18A 5L3SA 1PZNA 5BYJA 2IS1A 1OIWA 1LW7A 1XRJA 2IBMA 1E2EA 1GTVA 1D6JA 2CHQA 2XTNA 3OEHD 4XWKA 1N25A 1TNDA 4KODA 3RS4A 4H1UA 5KDLA 1Q12A 1TPZA 4AYWA 3U7HB 4LZZA 4BQSA 1N6PA 3QG5A 3SFVA 1OFUX 2X19A 1ZMXA 4B6EA 1N5LA 3EZ9A 1ZVQA 3LX5A 2WPDA 2F7SA 4FIDA 4PSVA 4QNMA 3CZQA 1VG9B 2FSHA 3P20A 2VLIA 5L3QA 5KO2A 3OE7D 4KFSA 2VHCA 3Q8XB 3P26A 2CLDX 2Z6VA 4IEEA 1MKYA 1W4CA 3U61B 4B34A 4MRVA 3KJGA 3GFTA 4YQFA 1GKIA 2NGRA 5SZJA 2EFDB 1Z07A 1QHGA 2GTPA 4BGDA 5DIFA 5FOUA 2GILA 2H1LA 3BH7A 2QMHA 5FBWB 2DFLA 2G83A 5DYIA 5IDVA 2RCNA 2JA1A 3QF4B 4QOSA 3JZAA 4EQ6A 2BV3A 4CIDA 2HF9A 3CM0A 4L4UA 1E32A 2NOAA 3U44A 5HPYB 3SQXA 3S1AB 1A7JA 4PO9A 3F0TA 3LBNA 2H17A 3ZQJA 5FBLB 2A78A 1SXJB 3N70A 3KJEA 4UXJA 3ZD6A 3SC3A 5LBIA 1NBME 2NIPA 1ZRHA 1DTSA 4JYCA 4D26A 2QAGB 2F1JA 1EFCA 4JLPA 2F1HA 3EXAA 4OQLA 4FW9A 3IIMA 3SZRA 2WM9B 4TT3D 4DXAA 2GEUA 5DSZA 2ZYVX 1SVOA 4LYJA 1Z6AA 2DBYA 5HTKA 3ZVLA 4UNSA 1CF4A 2JEOA 4JL8A 2JDID 4TWZA 5DI3B 4C0KA 1C9KA 1OPXA 3QENA 2Z43A 3KUCA 4TZ6A 2P6RA 3OAAD 2PX0A 1W1WA 3PEWA 4QRHA 1H8ED 1RKBA 4B73A 1R8QA 1MABB 2XB2A 2W6JD 4TMKA 5M04A 1DAFA 3THOA 2ZS9A 5DN6D 2DB3A 2JAQA 4OI1A 3C7KA 4D4LA 1OIVA 1EFTA 4O2RA 3TSWA 5A4JA 1BYIA 4NP6A 3T12A 4JBXA 4EJSB 4KBGA 1UKEA 1ZD1A 4DT1B 4PPQA 3LLMA 4JSYA 5CK5A 4S35A 1R0XA 1N6KA 2I1QA 2OCAA 3REFA 4TL6A 4NYMQ 3B1WA 4LWZA 3TW8B 2FN4A 2KE5A 3QE0A 3GLIE 3BAFA 3OIVA 1E2LA 1MH1A 5EUMA 3ND9A 1AKEA 2JLWA 3CRW1 5A5GA 3GEIA 2H5EA 1UF9A 4HDQB 4O2LA 4BFZA 4GMXA 4XTRA 1KK1A 1G8PA 2R6AA 3LRPA 1LVGA 4HZIA 4O0MA 4NCKA 2C96A 2RGGA 5F9FA 4HYYA 3B9QA 4FN5A 3ZGXA 4TYYA 4DC9A 3O47A 4II7A 4NYJR 2RHMA 2FFHA 1XJQA 2HYIC 1JBKA 4ARZA 4EIWA 5FPTA 4AKIA 1DO2A 1YZKA 3CLVA 4LYAA 3THXB 4B3BA 3WNCA 3U6KA 1JPNA 3ADKA 3O8DA 2XZOA 5EP3A 1G17A 3C15C 2ANCA 2G0NA 3KFXA 4MRPA 1XCPA 1LB1B 2XB4A 3BGWA 3NH6A 4JBWA 3VHLB 2QMOA 2YC4C 5JSZB 2IS4A 1M74A 3CWZA 4IOMA 3FMOB 1Z0FA 1Z0JA 5UKDA 4A6PA 3ADCA 1RZ3A 2QA5A 3P32A 1G8YA 4DSNA 2IS6A 2ZROA 4C0AC 1TADA 1P2TA 3AEZA 4QHYA 1NJGA 1IN7A 3EZ7A 1WE2A 4YC7A 3LVQE 3EA0A 3RRNA 3W8NA 4F7WA 2A5YB 3IEUA 1M7GA 2J0VA 3UKDA 4AIIA 4C4PA 3K70C 4TTRA 1AS0A 3BFKA 3ZVRA 1E2FA 1OH7A 1DS6A 4TYNA 1SVIA 2WMOB 2CE2X 2P65A 4URWR 4QGAA 3PENA 1XEXB 2F3TA 2WKPA 1E79A 3B1XA 4DB2A 1ZUHA 3F3YA 5HCIA 5JS8A 1QG2A 5GJVC 2EFEB 4HDOB 2J0UA 3IO3A 4MQBA 2REOA 2ZRLA 4MYCA 3A36A 1WXQA 2X2EA 3ZD7A 4PQYA 4GBMA 1OFIA 1IONA 1ZM9A 3D3QA 5E95A 2RGCA 2ORWA 1VMAA 1T5IA 4JLVA 3HR8A 1FTSA 1KJWA 2OXCA 1E0KA 2FGJA 3KXIA 4HUTA 3M0EA 5IK2D 4CEHA 2QENA 2IYXA 1B23P 1LF0A 4Q66C 4M9XA 3B85A 2R6CA 5EE9A 1UAAA 2ZRHA 3NDBB 4Q7LA 1FTNA 3RSLA 4G5RA 1FP6A 2X1VA 3U3RA 3DM5A 4HUQB 2F43B 1OFTA 2ZI5A 2O8BB 2ZI3A 4GZMA 2R62A 1P9NA 4OBEA 4KHZA 3VU9B 1H8HD 1DG3A 4RZXA 2FSIA 4WZBE 2FWRA 4R98A 4QXAA 1OXTA 4ON9A 1Z63A 2NO0A 2GCNA 4R9UC 3FE2A 5CK4A 3Q5DA 1QF9A 5L3RA 4LJ8A 2CDNA 4JYBA 3K1JA 1TQ6A 4ZIRB 3WNBA 4Q9HA 4XVUA 2QL6A 1JEEA 5LDDC 4Q1AA 4G0NA 2QZ4A 4M9SA 2XNSA 1ZP6A 3AVUA 2FF7A 3PXGA 1N2CE 4PZLA 2GJSA 1QZXA 2R2AA 4YMSA 2WHXA 4JLDA 3VX4A 4DJTA 1GWNA 3KJHA 1CEEA 2O8FA 4URYR 4P4SB 1OHHD 3W6OA 1X8JA 2WWWA 3LH5A 4H9GA 4LCBA 3QNUA 3NH9A 1RFLA 1T8UA 3O8BA 3FMIA 4Z51A 1BO6A 1N6NA 4IW3B 1CIPA 4YXWA 4R2HA 2W2TA 3QI2A 1OXVA 1Z28A 4JVMA 5JWHA 5JCPA 1XTIA 2HCJB 1Z83A 1SKQA 2MSDB 3KZ1E 3Q7PA 2HCBA 4IDPA 4LYFA 2CCJA 4TSFD 3W5JA 1ESNA 1UKZA 2PT5A 2B8WA 2PCLA 1SVWA 4BZXA 4DVGA 4I4LA 2BJVA 5TVKA 1CJKC 3E1SA 3H84A 1XCGB 1KDTA 3A1UA 5FUWA 3MWJA 1VKJA 2Q9BA 2ZS7A 3ZJYA 4KVAA 2WKQA 3UMFA 2HDNB 4NH0A 3Q7QA 4XD7A 4UKDA 5J40A 4AG5A 3EIQA 4ZDIA 3AF0A 3C4JA 4Q21A 2OG2A 4Q47A 3B13B 3KJIA 3QXCA 1RRFA 2ZSBA 4RD3A 3R8CA 3LBHA 2BC9A 4W5WA 4BFUA 1JI0A 4WXRA 4CDGA 4BUJA 1Z6XA 4XSGA 4EFLA 1GRRA 1ZU5A 3R7WB 1IJFA 4I1UA 2G77B 4XH9B 4DWJA 3ZZ0A 3U7EB 2WWYA 4KSCA 4IOKA 2IUSA 5JWOA 5E3HA 1NP6A 4Q03A 4JBYA 2JCSA 3R20A 3X1ZA 5JRJA 4PHHA 2GETA 1T0HB 1Q20A 1EX7A 2CE7A 4NYMR 1Z06A 2CK3D 3KKOA 4QNRA 1NN1A 2CL6X 2A5FA 2X2FA 5F9HA 2AX4A 1Q57A 3E70C 3LAWA 2Y8EA 4JLOA 5HZHA 3B60A 1MO6A 1SKYB 1II0A 1FUUA 3TSZA 3GP8A 1YR7A 2ZRNA 3X1WA 1GAJA 1KI6A 3LQRA 4Q9IA 1GUAA 1COWD 1KO1A 5J5CA 3E5HA 4WBSA 1AS2A 1AQYA 1NSFA 2YJTD 4NYIQ 4Q9JA 2AKAB 3GLFB 3RC8A 4XIGS 4IDHA 1AK2A 4D81A 3BB4A 2WWHA 1DAEA 4PR0A 1DO0A 3B6EA 4JLKA 4Q4JA 1XD2B 2ONKA 2ZVQX 5B58C 5B30A 4AC9A 3GLGE 1TQ2A 2OILA 2W2VA 4QBFA 1TUIA 3NC1C 4PHFA 4NE2A 3AP3A 4NCNA 4A2WA 2O5VA 1JJVA 1TUEA 3SJBA 4DLYA 2IT1A 1ZBDA 3BH6A 3RLFA 4S2EA 1IJEA 4LX0A 1LS6A 4C30A 3UXMA 4F91B 1RRPA 5KNBA 3CNLA 3EX7C 2RAPA 4DRZA 2ODEA 2Z4SA 4LYHA 3QKRB 4GP7A 2GEVA 1G3IA 1FX0B 1WMSA 3GLHA 1TF5A 1OF1A 3JZMA 4A82A 1XMIA 3V4FA 5KSZA 3U4QB 3EAQA 1W46A 2FPKA 4LSGA 4E09A 2VP9A 5C1BA 2GJAA 1PV4A 1II8B 1TL7C 1BS1A 4BFYA 4CEIB 1FZQA 2WOOA 3VKWA 3WHLA 1AKYA 3WP1B 1MV5A 1VDZA 4Q1EA 3W34A 1UBGA 5EUQB 4A1FA 4D2IA 1HUQA 5AJWA 3CH4B 5GVRA 1HQYE 2ZETA 1J70A 1ZD8A 3EPJA 2G1KA 4DCSA 1BYUA 3KKQA 3B9PA 5ANRB 2W00A 1PJRA 1COWA 1E96A 1ZM3A 3NHBA 2QGNA 5AJXA 3SJZA 4DLVA 1S4QA 1KJZA 2EYQA 1UBFA 3WYFA 1EWQA 5L3QB 2OFWA 1KO4A 4RD0A 1Z2CA 1EXMA 2J0SA 2Q6TA 4R2IA 2NPIA 2XGJA 3AGQA 4QJ5A 1E3MA 2OCYC 2OCBA 1G291 1RJ9B 2D2EA 3AVOA 3SN6A 1UEIA 1NI3A 1R4AA 2VHQA 2Z83A 4N1AA 4QJ3A 4CZ2A 2GCPA 2FX3A 2ZQ5A 3IUYA 2FEOA 3PUWA 4WVFA 5K8TA 2JLUA 1MRNA 1VIYA 2BMDA 4RSGA 3RWOA 1G7RA 4LJ4A 1U2RA 2ZRJA 3PUXA 4U00A 1P2UA 3NVAA 4LHXA 1FOEB 4PC1A 4TLAA 821PA 1R5OA 3W6NA 3A37A 3CX8A 1E2KA 1XEFA 4XVRA 4ACBA 2GK7A 5H1YA 1LY1A 2I1VB 4B74A 4DIDA 4AKGA 2ZYTX 4BEJA 1KMHA 2GESA 5BXQC 1RVDA 1KIMA 2JIZD 2GF9A 2DWOA 2YKGA 3AB3A 4Q48A 1KNXA 2GNOA 4QFMA 4EPVA 3I5YA 2YV5A 4AYXA 4QBIA 1XZPA 4DZZA 4MH0R 1US8A 3KQUA 5EE3A 1TX4B 1KY2A 3JVVA 1YZGA 1AM4D 1X1SA 2QT0A 1CULC 1R0YA 2Q3MA 1N5IA 4LV6A 5G3YA 4DLZA 1UDXA 5CB8A 5L3VA 3TR0A 4C2UA 1P60A 4BFSA 1OLOA 1ODFA 1CR0A 4OHZA 1QHXA 3H0KA 3GLIB 2H8KA 4C0HA 3H4MA 3BK7A 4YMUA 1KYIA 5D3MA 1XTQA 2NZJA 2HLDA 2KBFA 3BBPA 5FTNA 2GK6A 1VYVA 2PEYA 3LVRE 5TMPA 4AY2A 4B32A 4JL5A 2J45A 1JAIA 1W0JA 1GILA 2G1JA 5FTJA 2QQ0A 4QGGA 4DUGD 1CTQA 4QGFA 4TQAA 2FJUA 5A0FA 3CUEF 2QG6A 2RGBA 4PO1A 2NPFA 3CBQA 2ZJBA 4KO8A 1G4AE 1RC8A 2IUTA 2VSXA 3OIWA 4TLBA 1OKKA 3K0AA 5CDFE 2JIZA 4NCHA 1GDDA 2CMKA 2C03A 1LNZA 4V0KA 3GFPA 5JRZA 1KKMA 3B1YA 2XOKD 2BCGY 4U02A 4A2PA 3REGA 2BKEA 2GKSA 4KV9A 1VHLA 4MUAA 1CR2A 3X1DA 4PC6A 2OFXA 1U0LA 4ZCMA 3OHMA 5CYPA 4MDEA 1U8AA 1VCNA 3ICEA 1NSTA 1J2JA 3I73A 3T15A 1D9XA 2AXPA 4BLOA 3TGPA 2A2ZA 3SYNA 1FW6A 3B1ZA 4JJKA 5H8WA 4DDWA 1DEKA 2ZRCA 3PEVA 5SZIA 2IUUA 1LFDB 1N6IA 1KDRA 2XXAA 3K8YA 5E7MA 3OZXA 4BECA 1EGAA 1UDWA 2BKUA 4IKEA 1XU4A 3VQTA 1E2GA 4L16A 3U5ZB 3B78A 1R0ZA 2WIBA 1NVVR 5JJIA 5CM8B 1E94E 4RCYA 1YJ5A 2JGNA 3A6PC 4IOLA 4FCWA 1HE1C 2K5UA 1W36C 5SZHB 1QHYA 1XD8A 5C18A 3PCRB 3AF1A 2O8DA 4OK5A 2Q9CA 4BRUA 1E0JA 3WMEA 2HV8A 1G7CA 4D25A 4PQRA 4HAXA 3W3AA 2GVDC 3QKUA 1KTVA 2P5SA 2CNWD 2DFTA 2XOKA 3MJHA 3ZDQA 4W9MC 2BEJA 4MGIR 4DLXA 4I1SA 4HAVA 3TMKA 3CWQA 1TF7A 1W4RA 1YZQA 4CEJB 1XJCA 4C9BA 1Z22A 2FE4A 1RW4A 2YOGA 5LPNA 4F4IA 4D0LB 1OXXK 4RJLA 2QSYA 3KB2A 4I99A 1G3UA 1ZM4A 4TLEA 1AZTA 1IY2A 3KDSE 4OI2A 5SZKB 5CYOA 4K81B 5EXSA 1OYYA 4C3ZA 1V43A 4Q00A 3TW4A 4D4MA 4HLUC 2WJIA 3DHWC 1XD9A 5J4LA 1Q22A 1ZNXA 1EFHA 1GKYA 4IFBA 2WPDD 3TKLA 2BBTA 3AKDA 3SI7A 4HATA 4KLNA 3IDQA 2FGKA 3IGFA 1TU4A 3R9WA 3R9XA 1NY5A 1XTKA 4GZLA 2GRJA 4RFSA 5DI9A 5HCNA 4B3DA 1KI2A 1K5DA 4KFRA 3FHOA 4JLNA 1CJUC 5JJKA 1L7VC 2HF8A 3D31A 2RHDA 2C78A 1YVDA 2JASA 4D0NA 1KK0A 4J0QA 2YWHA 2H57A 2CEAA 4HAWA 1KO5A 3VR6A 4HLCA 4DIEA 4O3MA 3TIFA 3LDAA 4DCTA 1XWIA 2VP0A 1G16A 4HAYA 2WWIA 4XJXA 3VR5A 1DAKA 4B75A 5G40A 2R6GA 2PLRA 2QN6A 4R71A 1FMJA 3AVWA 1VECA 1RPZA 4Z8YA 2QRZA 4LC0A 3MFYA 5FTLA 2CCKA 2BBSA 3CX7A 3AVPA 1QDEA 2DHRA 4P0TA 3KTAA 5LD2B 1ZC4A 4E07A 1ZM2A 1G3RA 1OH5A 1DE0A 3SBEA 3C41J 3NBFA 5CJ2A 1L4UA 3IHWA 4UNRA 1OW3B 2ZI6A 5HZKA 1D2MA 3NKVA 2DFNA 1HEIA 3B8HA 4MRRA 2WKRA 1U99A 1XZQA 1F2UB 2GVZC 3IIJA 2F1IA 2FA9A 4JJZA 4KCGA 4MRNA 2Q3HA 1G4UR 2JLRA 4DLUA 4DDUA 2XITA 4UJ5A 3CRRA 3CONA 2O8EA 4JIMA 1GP2A 1I2MA 1SHZA 4YONB 2PMKA 1KGDA 3T5GA 1SVKA 1KI7A 1Y63A 2VP5A 2ZIAA 4UXHA 1MO5A 2PX3A 3GCGA 2C99A 3VR2A 1T9HA 4V02A 4U7DA 4ERNA 1JR6A 1YR6A 3GPLA 4AK9A 4MITA 2HT1A 2V1UA 4PZZA 4GP6A 3ZIAA 4LBZA 4TQUS 2FZLA 1X8KA 2PZGA 2VRWA 2WSSD 4UQOA 3RANA 3A1WA 1K8RA 1JPJA 4LHZA 2VL7A 4JT4A 3VAAA 1E6CA 2V1XA 5EE1A 4X8LA 1MRSA 5J4KA 3KKPA 1DBSA 1KY3A 1FFHA 4HLDA 3QKSA 4G5OA 4EPRA 3D8BA 3OF5A 2EFGA 4IHQA 3AVXA 2LCFA 3FPAA 2N46A 3F5FA 4HLUA 2QBYB 2OSBA 1E1RA 3CB4A 3NG1A 4Z1MA 2OBLA 3GLGB 1KZ7B 3Q72A 1HQCA 4R7ZA 3EC2A 5AJVB 5DO9A 1KI6B 3A1VA 3AP2A 3CPHA 3GFOA 5FOWA 1Z5ZA 4M21A 4OQXA 1KDPA 1E0AA 2GCOB 3BOSA 1W5SA 1Q3HA 1ZIPA 1UFQA 2GEDA 1G20E 2LKCA 3GJXC 2CJWA 4G1UC 5FUVA 4N0DA 1Q1ZA 1CKEA 3T5DA 1OE0A 4V0LA 1KHTA 1GKUB 3X1XA 2QPOA 2B6HA 1KI8A 4Q1DA 4HEJA 1CU1A 1J99A 1A5TA 4WZ6A 4XWAA 3DEFA 8OHMA 4WW0A 2WSSA 2WJYA 3QXSA 5GJBA 4WZAE 1BIFA 2PZEA 2EVWX 4BLSA 3BWDD 5E7IA 1ZU4A 3KQKA 1GZSA 2P2LA 1F48A 3RS3A 2ZE8A 3UWOA 5IHPA 1J7KA 3U7GA 3LBIA 1XDBA 1E2JA 4M8NE 1Q1BA 2Q21A 3CIOA 1W4AA 2PH1A 4DDTA 1CBUA 1ELOA 3FYHA 2EWWA 1Q0UA 3T1TA 4GNKA 1FL9A 1IXRC 2YZ2A 3MAAC 4MGYR 5AJYA 2O8CA 1E99A 2D06A 2A7QA 2QQEA 1E79D 3ZVNA 3THWA 5HE8A 3AP1A 3SYKA 1HY3A 4LHVA 4HZUB 3AVYA 1GOTA 5CLLA 5FL7A 3FB4A 4LJ7A 3QEOA 5E4FA 3H1TA 2IYTA 1S3SA 3EWSA 2ANBA 1G64A 5FH9A 1P3JA 1XF9A 4P4UA 4F38A 3GJ4A 4Q01A 4NTZA 4A0RA 4XOIA 1S0UA 3LNCA 1JJ7A 121PA 4FWIB 1N0VC 3MUFA 3SQWA 1BOFA 3IKJA 1FQKA 1VCOA 4OI4A 2HJGA 1UKYA 2WWGA 1KOFA 4A0FA 1SZPA 1YU9A 2GAOA 4BLRA 1J90A 1U9IC 3UG6A 4US2R 2AWOA 2F6RA 2IYYA 5DH9A 5BWMA 2ZXUA 2AKYA 1ZYUA 3THYB 3TR5A 2YHSA 3U3KA 1EFRA 4LDJA 3X1YA 2FSGA 1W49A 2ERYA 5E7JA 3T1VA 4PO8A 2IYQA 4LV8B 2QNRA 5FOXA 3UIEA 4G5SA 2ZJYA 3ZYCA 3QPVA 5FUYA 4LJ5A 2J87A 2YC2C 3LW7A 2JLSA 2ZR9A 4UNQA 1XTSA 1WCV1 1XTJA 3TSOA 2QGZA 1Z08A 2F1RA 4Q9KA 1BMFD 2W83A 3VTKA 5J4YA 2EU8A 1V5WA 4WOPA 4GL2A 4Z8XA 5LB2A 3K9NA 1T3HA 3OESA 1T0JB 1R7RA 1OXUA 4M1YA 3U6BA 3ZQ6A 1DAHA 4L5BA 1YE8A 3GQBA 3WRYC 4YXWD 3V9PA 2C2HA 3OFNA 4PPFA 1DELA 3UANA 4EPWA 1P75A 1SVSA 3L8ZA 2OEPA 1HT2E 2WJJA 4PHTA 1M34E 3I3SR 4L9SA 1SXJC 2ZJ2A 4WIAA 5D3MB 4D0GA 5KYKA 4DCNA 1Q44A 2FDCA 2QAGC 4YMTA 2NMVA 1G1MA 3BORA 2VP4A 4NPHA 1U90A 4PQFA 4A8JB 5JZVA 2IYZA 1F6BA 2XEXA 2GZHA 3CW2A 1N6LA 2GF0A 4XD7D 1Q3TA 1QHHB 4L9WA 3EPKA 2A5GA 3K70D 3VNUA 5EZ5A 4B47A 2YOHA 1GSIA 2CBZA 3FKQA 3QG1A 1KO8A 1UPTA 1ZC3A 2WWXA 5FI0B 4B3FX 2J46A 2IYVA 2D74A 2WAXA 4TTPA 1NN0A 4JVLA 2V3CC 1T8TA 1G5RA 2VP2A 4KXFB 4Y0AA 1I4DD 1KI9A 2O0KA 2ZRDA 3RC3A 3KQLA 1BMFA 2WJVA 2ZTSA 2QY9A 2XX3A 4TZ0A 4FMDF 2QTHA 5TXGA 1JXOA 5DYGA 2IYLD 2GBLC 4KSBA 2TMKA 1PUJA 3BC1A 1M6NA 4LJYA 3BE4A 5JS7A 1F5NA 4OQFA 3HJNA 4EJSC 3LA6A 1G18A 2IEYA 3BERA 1DPFA 1X6VA 2RB4A 4TL9A 1K5GA 2IXFA 3CR8A 5CIQA 2CHVA 4RZ3A 1P2SA 2ZSAA 2GXQA 1Z0KA 3HWSA 5HE9A 5KNCA 2C98A 2CHGA 3L0PA 3L0OA 4B2PA 4C2TA 3Q85A 1IM2A 2YOFA 2C9OA 2ZAMA 4B44A 4ESHA 3VKHA 3K0FA 3MWYW 1IY1A 4IVQA 4RVCA 4RD4A 1U9IA 1M8PA 2AXNA 4GOJA 4FMDB 5J47A 2G3YA 3EPLA 3TUJC 2XXAB 621PA 2P6UA 1CP2A 4IEIA 2XTZA 1GL9B 1VCMA 4HDCA 3UK6A 2IHBA 4ZDJA 4KFUA 2ZEJA 2ZE6A 5CIWA 4FMCF 3DMDA 1GNPA 2J7PD 2YWGA 2E9SA 3C14C 4OJQA 1BKDR 4C0QC 2Q9AA 2BVNA 3BXZA 2ZSEA 3QPUA 1E9EA 2WZQA 5FPSA 5GJCA 2VF7A 2ZYWX 2NO9A 1G21E 2G88A 3BRWD 2C9CA 2YYZA 4EPTA 2QROA 2EW1A 3R9IA 1JXMA 4UNPA 2XZLA 2OFOA 1JR3A 1N6HA 3QF4A 1NVUQ 2OM2A 2O0JA 3M1IA 1Z6YA 4LHWA 4A15A 2ORIA 1S3GA 3EA5A 3PIRA 4JSTA 4DLWA 1NIJA 4TTQA 3S1AA 3CRQA 3GJ6A 1GRNA 5BN3A 2C95A 5KSOA 1SXJA 5BN4A 1IN4A 1QHSA 1KSGA 721PA 1KI1A 1JB1A 3TNFA 4A4DA 1DARA 2ZJOA 1CJVC 3AF4A 1U0JA 2FFAA 1M7HA 4LI0A 3MLEA 5KSPA 2HEIA 3VKGA 1PLKA 3QIAA 4NKRA 4TMVA 2QTVB 2UZ3A 2QU8A 2ORVA 1IHUA 3ETLA 1VG8A 4F93B 5DI3A 3RS2A 4DDVA 4GI7A 1UBEA 1U81A 1F2TB 1OH6A 1QVAA 1ZUNB 4CVNA 3DDCA 1M7BA 2J7PA 2OLKA 3MMPA 3ASZA 2VPPA 2HXSA 4ZCLA 4KI0A 2QEQA 2FFQA 2SHKA 3SJCA 3W3ZB 1MABA 1KK2A 2BMEA 5FUXA 3SNHA 3GJ7A 2YNMA 2F55A 2ZSDA 5EQTA 4QBHA 3P4YA 3RWMB 4CRWB 1E1QA 2GBLA 2PEZA 4LBYA 1P7CA 2QM7A 1L8QA 2AK2A 2VP6A 3B82A 4PX9A 4HI0E 3PEUA 1IAQA 3W6PA 5EXXA 4TMXA 1A1VA 3U3OA 4DT1A 2V4ZA 3WYGA 2PJRA 4PC7A 4M1MA 2ZRGA 5L3SB 3D7MA 4DBLC 3FKSA 3KTAB 2B92A 4C7OA 3FHTA 2AFHE 1UKVY 1CR1A 1G8FA 1DVRA 3GLHE 3ZS9A 3MCAA 3WY9A 3W9YA 2ZJZA 3A1SA 5G53C 3VX3A 4B2IA 4IXNA 5FFMA 2F3RA 4LBVA 3L82B 1S1MA 4M1WA 3ONWA 4G01B 4PC2A 5C4GB 1EESA 1M2OB 5L8VA 2WMNB 4IOJA 4LK2A 2G6BA 2HLDD 2J7KA 5CJPA 1S8FA 1GNQA 1U8YA 4KLZA 2L0XA 1I2DA 4EKDA 2QAJA 3MRSA 4FWTA 1DAMA 1W0JD 3LWNA 3NEJA 1N6OA 4RCZA 4URXR 1G7TA 3THXA 4PPNA 3RRYA 4EQ6B 1XFAA 2QE7A 4OHXA 2ATXA 3NTUA 4G5QA 3U44B 3EIHA 5JI3E 1OJLA 2QPTA 1QBKC 4AKHA 1Z8FA 3DZDA 4TLCA 2FOLA 2X77A 4LHYA 1KSHA 2WOJA 2ZJ8A 1OKKD 2DPXA 4C0BA 5KU1A 1TTTA 5FOSA 1E2MA 4OQNA 1XBTA 3A58B 4F92B 4OHYA 2YWFA 3ADBA 4KU4A 4M9ZA 1KNQA 2ZPTX 4BZPA 1W0KA 2OUKA 1VG0B 3TUZC 3FFAA 421PA 5TDHA 4DLRA 2GHIA 3SR0A 3BIFA 3AM1A 5D3QA 3CR7A 4A0HA 2FNAA 3PV0A 3RHFA 4HAZA 2Z0MA 1JAHA 2HT6A 2VTKA 4WAUA 3NC0C 5KOYA 2JLYA 1U8ZA 1WDTA 1XEXA 3OEEA 1E2HA 1K6MA 2F9LA 3BH0A 4B3XA 1KAOA 1KZGB 1F3OA 1NMYA 4YDSA 5JLJA 4YLGA 2GZDA 1KI4A 3P4XA 2BMJA 3EWAA 5IF9A 2EWVA 2IEZA 2JJ1A 2CJWB 1G9XA 1YRBA 2VHTA 2BOVA 4X8MA 4D4KA 2R8RA 4B2LA 3AKYA 3QKTA 1GVNB 5FL3A 1B0UA 1YKSA 3HP1A 4LBWA 5EE0A 5JEDA 3GD7A 2GDJA 4M2LA 4X8HA 4AG6A 1ANKA 2R6DA 2PZFA 4Q7JB 5KUTA 3BFXA 4B3GA 2ZANA 2QMUA 4AYTA 1NN3A 4KJZA 2Q0HA 3WRXC 1RRGA 3FHCB 1NKSA 4MGKR 1Q21A 2GAAA 4HUQA 2VF8A 2EQBA 2MSEB 4MRSA 3SEAA 2ZRFA 1P9WA 3KXKA 3AKCA 3VU9A 4DLTA 2P6NA 4JLMA 5HKKA 1E9DA 4ZI3A 4BFXA 3NIBA 1LV7A 1SQ5A 2VH5R 4DEXA 3THWB 2PL3A 2GXAA 1CLUA 4NCIA 5CLQA 1JECA 2FV8A 4ZIRA 1U94A 2IHYA 4XSHA 4ASUD 4ARZB 2AR7A 3C16C 1ZINA 2ZUCA 5KDOA 1R2QA 4TQ9A 2BEKA 2XZPA 3K9HA 1X8LA 1O87A 2XJ4A 3LQQA 4ILEA 4QC2A 5C46F 3SFZA 3CPEA 1W44A 4DSOA 4E03A 3LO5A 2D3WA 5IRCD 3CF6R 2GA8A 3QBVA 3CRMA 2C04A 1WB9A 4IRUB 1DAGA 1NMZA 2NTYC 2QSZA 5FOTA 2JJ2A 4M1TA 3EZ2A 3Q9LA 3PUVA 2P5TB 3T1OA 1RYHA 2W0SA 3U2QA 1FUKA 4B43A 1J8MF 3K0EA 1G5TA 2KI5A 3PQCA 4NYIR 2AHOA 3AVVA 1NRJB 1ZCAA 2DWQA 1Z6TA 3IEVA 2AWNA 2G0TA 2WWFA 5EP2A 5KHOC 1Z29A 4Q02A 1S1CA 1Z0IA 4FINA 4GPTA 2P3SA 2ZAOA 2BWJA 2QP3A 2Q3FA 3FFBA 1G6OA 4PHGA 4BZQA 5FTMA 5DE3A 2DY1A 1GIAA 1CRQA 2IYWA 5KPJA 2J0UB 2QM8A 2D7DA 2WV9A 2XAUA 3WBKA 1SGWA 2B21A 3EG5A 4ASUA 2AFIE 3ECCA 2J0QA 3T1QA 4N0EA 2CLCX 4FMBB 4TN1A 4M0LA 5CITA 2FG5A 4LRWA 4MA4A 3DOFA 3GJ0A 1RRCA 3VNVA 3U7FB 1SVLA 2CLSA 5H68A 4YDHB 1JNYA 4Z54A 2XNDA 5JFGA 1NLZA 2ZI4A 3DMNA 4Q5IA 1XXHA 3A4NA 1CRPA 3BD9A 1FPMA 3UMSA 2UZIR 4CEHB 3I8SA 1XCMA 1AQUA 4US0R 4RZUA 3SJAA 2C9YA 1U0HC 2AL7A 2C5LA 2O52A 3UG7A 2W6ID 2D62A 3C8UA 3GEEA 4PANA 1L2TA 3CF0A 3CRVA 4XVQA 3ZZTA 4BEBA 1X86B 2CL7X 4PAQA 2V6JA 1CXZA 2V7QA 1W36D 2BIFA 2W0MA 3I92A 1LS1A 5AUPB 3QOFA 1XXHE 5JI2E 3ASYA 5J4VA 3IPYA 5JBQA 1YZUA 4CF7A 3DM9B 2OAP1 3ZIAD 1T4GA 1WP9A 4TL8A 1QHNA 4JLJA 3WXMA 1E0SA 5CB6A 3R8FA 4ZO4A 3EZFA 4V0MA 2G9NA 2DWPA 3ZH9B 1WF3A 1G7SA 1ZD9A 4CGZA 4QL3A 2O8FB 1XB2A 3WHKA 1NLFA 4RD2A 3TAHA 4M4SA 1IXZA 3DOEA 3SBDA 4JLBA 2PMDA 4MKGA 2ZVPX 4C0LA 3QKRA 1AGPA 3U3MA 3MWLA 1NL3A 5G3ZA 4BLQA 3LXRA 4U5XA 1VPLA 1E1RD 1EG7A 1YHNA 2N1BA 1A2KC 2IXEA 4QG7A 4BFVA 4Z1MD 1VYTA 2UKDA 4JVSB 3BJIC 4O25A 3UWKA 4GMDA 1II8A 3DKVA 4CEIA 5B2ZA 5AUNB 2W6IA 4Q4AA 2A30A 4ZCIA 1OB2A 2ZRBA 2MMGA 2AK3A 3EC1A 2N42A 2P0EA 1HE8B 1KO7A 5KSYA 3AUXA 3RRMA 2BJWA 1HT1E 3KKMA 1OB5A 3K70B 3PEYA 3FTQA 3IPXA 5FR1A 2BCJQ 3SU8A 4Q9LA 3B1VA 3VR3A 4KVGA 2OESA 3KXLA 3RRZA 3SS8A 3V00A 1ONBA 4KYUA 3TQCA 3N2IA 1MT0A 5JEEA 4BRWA 1T3LA 3C5CA 1G5PA 1J8YF 3K9LA 2ZRKA 3IQXA 1RJ9A 2ZI9A 1YZLA 1Z0AA 2FPMA 3IBGA 1NBMA 3PUYA 1ZCBA 3P27A 2WSMA 1II9A 3LD9A 4D82A 3EIEA 3BFVA 4NZYA 6Q21A 5F3WB 1HYQA 3Q5EA 4F4CA 2H16A 4GOXA 3K9GA 2ONJA 3KFVA 4DHEA 1Z47A 5DNYB 4I1VA 2XSZD 1T5LA 5B57C 2A5DA 3RS7A 4TLDA 3CF2A 3LXXA 5F98A 2FZ4A 2HYDA 4FI3C 1TMKA 3WBJA 1XMVA 5FL7D 4POAA 3CH5A 4EDHA 3HU3A 2IS2A 1JALA 2XTMA 1YR9A 3IHLA 4URZR 4V0NA 4QHSA 4ACAA 5FBQB 1XEWY 1FNMA 3TVDA 1E9CA 2J3EA 1S2MA 4OHWA 4TMWA 1VIAA 2Z5FA 2GJ9A 3UMRA 1N3BA 3OEHA 1T3SA 5BN5A 4Q4JB 4QBGB 2MMCA 2OBMA 2YWEA 4DSUA 1AZSC 1HA3A 4W7SA 5IT5A 3DVLA 4EUNA 2HXYA 5TY0A 3U60B 2LWIA 2W58A 1A82A 1T6NA 1PVOA 3QY0A 5EP1A 2VSFA 3OE7A 2PCJA 4ESVA 4G3XA 3GLIA 4A9AA 5K8IA 1D2EA 1Y3AA 2VSOA 1EFRD 2WJHA 2PT7A 2ZUBA 2RMKA 4P31A 4B71A 2J9RA 2VHUA 3GLHB 4TMZA 4BLPA 3TJZA 4BFTA 4FD2A 2KWIA 2PLFA 4DCVA 3CZPA 4PTLA 5K8UA 2I4IA 3AUYA 3CKLA 3K0SA 2XSZA 3OIUA 3FMFA 1KSFX 2OO7A 3BS4A 4HAUA 4GFDA 4M9QA 1OH8A 3DO6A 4MDFA 1N0WA 4C7OB 1OV4A 2R9VA 5KNDA 2E1RA 2GXUA 2PJZA 5JCZA 3G0HA 5TB5A 1E9RA 2F9MA 1E2IA 5TARA 1AN0A 1D9ZA 3SDZA 1IN5A 1HH4A 1IOZA 3M6AA 4NBSA 5GJWC 1ZJ6A 3OFND 1XPOA 4TT3A 1W2HA 4JS0A 3LX8A 4LC1A 1XJ0A 3GMTA 4XTCS 4FXPA 2EFHB 1W2GA 1H65A 4DB4A 1HTWA 4AURA 4Q19A 2JDIA 2MSCB 2JLZA 3PJRA 1P61B 4LGMA 2QUZA 3DL0A 2IW3A 1P62B 3OAAA 5DGXA 1W48A 2ODBA 5EZ6B 1YR8A 2NZ8A 3RABA 5FPKA 1T91A 2ZU0C 3ADDA 1E2DA 1G8GA 1H8EA 1Z2AA 2LKDA 5LD2C 3VMFA 2X8AA 5KDDA 2OAQ1 4CT5A 2W6JA 1ETUA 5EE5B 5AWFC 1UM8A 4GT1A 4UJ3A 4TYQA 3PUZA 5DN6A 3TVTA 4LJ6A 2NO6A 2V8OA 3M4YA 4JL6A 4V03A 2PBRA 3RDPA 1IQPA 5BYKA 1OSNA 1KMHB 1AGRA 3LY5A 2E87A 2IK8A 2J1LA 1SULA 4BE7B 2VA8A 4LPKA 5FR2A 5FPYA 4QKQA 1TQDA 4IXMA 2FSFA 1VG1A 3AF3A 1C4OA 4M22A 1XTRA 5G41A 4EFMA 3LLUA 2BM0A 1NJFA 1US8B 2NO1A 3BB3A 5HR5A 4C0JA 4QJ4A 1QRAA 3EARA 2IXGA 4N3NA 3VFDA 1KDOA 4I81A 4OHVA 4EAQA 4MYUA 3MJRA 1LTQA 2DR3A 2R44A 3KUDA 2JLVA 2ECKA 3Q3JB 4RFVA 3SOPA 2P67A 2NQ2C 4CEJA 1X1RA 1XNJA 3B2EA 3KL4A 3NBZC 2ATVA 2OBNA 1CJTC 2BHRA 3QPWA 2J59A 5ELXA 1S9HA 5K8LA 3D6TB 2GZAA 4PFSA 3HPQA 1GITA 3AKEA 3LFUA 1U98A 3GJ8A 3T06B 3UPUA 1AIPA 1QHIA 1QVRA 2R6FA 2V6IA 1SVMA 2CCGA 2CL0X 5DLQC 1R5NA 1G6HA 1WQ1R 2A9KA 1GRQA 2ZSFA 3RNLA 4EPXA 1KJYA 2ZYUX 3K0AB 1P2VA 2AN9A 2OXRA 2ZRMA 3VR1A 4DCUA 4HB0A 4E22A 4NL4H 4YMWA 1W47A 2AD5A 2D7CA 2IF0A 2BBOA 3EPHA 2ZITA 3FWYA 2B8TA 2DFKB 4Q4HA 3AV0B 2IYRA 1JR3D 4NMMA 3GJ5A 1D2NA 2VBCA 4DEYA 2OHFA 3IIKA 5FOVA 1MO3A 4B3CA 3G5UA 3ICQB 1W4BA 3GJ3A 3I72A 3K53A 2FFBA 2AD1A 4JT2A 3L2OB 2QTFA 4OK3A 4Q7MB 2QORA 2VHJA 1SXJD 1JEDA 3BB1A 4YMVA 1NMXA 5C2JB 2GJKA 2REBA 2NO7A 2YVUA 2RGNC 3I4LA 4BFWA 3N5CA 5EJEA 1XX6A 3HYRA 1JQJC 3FDIA 3NBXX 5AUQA 4LV5B 3CO5A 4L8GA 3TQFA 4HB2A 3AF2A 4EPYA 1E4YA 4NONA 1DAIA 1R8SA 4RY2A 3RAPR 2QMEA 4K8OA 1F2UA 5IK2A 3A8TA 3N2EA 2B7BA 5AK0A 1XEWX 2O0HA 2Z4RA 3MSXA 3MWKA 4ZDWA 1YZTA 1BH2A 2ZS8A 4WXPA 3T61A 1PUIA 3L8YA 4JKIA 4NHOA 1Z0DA 2O8DB 1UADA 3TLXA 4FCVA 3SYLA 1EWRA 1EX6A 4MYTA 1H8HA 2QT1A 3AQ4A 4AD8A 1E9AA 1E9SA 1OYWA 1E1QD 4TL7A 4C0SA 3TAUA 5FBRB 1UEJA 1JQLB 2OZEA 2ERXA 4IJMA 4RKEA 1VCIA 2RGXA 1OXSC 1N0UA 3QQ5A 3DKPA 3EASA 4Y0VA 1XPUA 1GNRA 3L43A 3E2IA 2REXB 3FKSD 2J41A 1X3SA 3VR4A 4Q7KA 1E2QA 2OLJA 4IDQA 4FMCB 1G3MA 5JHHB 3QXJA 3K09C 2GWHA 3G82C 2IC5A 1OHHA 2UVQA 1XXHB 2VEDA 4QGHA 1W5TA 2VO1A 3PVSA 1ZM7A 3GEHA 2FPLA 2QAGA 4TMTA 2BBWA 3WMFA 4QM7A 4MUBA 2ZJAA 2ZREA 3IQWA 3RYTC 1JR3E 4CYMA 3QBTA 3MGCA 3QEJA 2QBYA 1RIFA 4GSYA 2H92A 4H1VA 4HSEA 5FTKA 3TRFA 2FEMA 4RFSB 3GLGA 3CNNA 4KAXA 1SXJE 4EFNA 1N5JA 4QHTA 2V9PA 4M1SA 4TSFA 3B7GA 1NVVQ 3WMGA 3W5IA 1WRBA 2GCOA 2R65A 4PSKA 2QE7D 3SHFA 3PR1A 3VHXA 5GVSA 1O3YA 2QP4A 3EW9A 4RD1A 1FP7A 3RS5A 4OL0A 2B7CA 4LUCA 4EJSA 1C1YA 1TEVA 3EZ6A 1KKLA 1NF3A 3F8TA 4HLQB 3QSYA 1NVWQ 2ZJ5A 4A92A 1WA5A 4M1KA 4HB3A 2XJ9A 3FMPB 1NN5A 4A8JC 1W0KD 2DYKA 4LY6A 1TU3A 4MKHA 3J81k 3AH8A 3TK1A 3KX2A 4D80A 5H70A 2RGNA 2BDTA 1ZUIA 2H7VA 2FMXA 2VQSA 1ESMA 1ZIOA 1XPRA 2ZE5A 3ZLJA 1NY6A 1SHKA 2O8EB 1TEXA 2CK3A 3OEED 1EK0A 4RZ2A 2EYUA 3LW8A 4B33A 4Q4AB 2ZRIA 1KK3A 4BPBA 3PG5A 4HZUA 3FGNA 5LB4A 4A6XA 4ZV4A 2JJ1D 1W36B 1R10A 3HU2A 2QPAA 3L0IB 3FVQA 1KMQA 3O8RA 4MGZR 5CM9C 3W8RA 4ZDKA 3I8XA 3MG9A 1IY0A 2VIIA 3TUIC 1FQJA 2CVHA 1IN8A 2W2XA 2QP9X 4K46A 5BQ5A 4GRAA 4MKIA 3C5HA 1IXSB 2WVJA 1OT3A 3X2SA 5JSZA 2EFCB 4W5HA 5JHGB 4KBFA 4BLTA 1YZNA 3CX6A 4P32A 4OK6A 1Z3IX 5HKKD 3QKSB 3AGPA 4P4TA 2IF2A 3KQHA 3JVUA 4JMPA 2D2FA 2RGEA 4IDNA 3THYA 5GADl 1DG1G 1WBBA 2YINC 1G19A 3K09A 1G8HA 4DLSA 1P6XA 4IVRA 2ZM5A 4CT4B 2CVFA 4JZKA 3QVVA 1AJEA 3A1TA 3HPRA 4OYHA 1TF2A 2OT3B 3NBYC 2ODWA 1A4RA 4WA7A 4A2QA 1NKTA 5B64A 2RH5A 2V55B 2HUPA 4FCTA 2QRNA 4AWXA 1S9DA 2JJ8A 4IFEA 5EP4A 3IO5A 1R0WA 2ZRAA 4ITRC 5TV2A 1OIXA 2WIAA 1MO4A 5DISB 1P72A 3RS0A 2RGAA 1ZAKA 1KSJA 1VYUA 3NEYA 4V0OA 4A0GA 3ZZUA 3KKNA 3OIYA 2ZE7A 3I5XA 1AA9A 5FPHA 3W90A 4X8OA 2JJ2D 4CW7A 2H18A 4OKSA 2KJQA 1W7AA 1FNNA 3NHAA 3I32A 1E4VA 1G3QA 2A5JA 4OQMA 2WBLC 5C4MA 4PPGA 4P3YA 2O8BA 1TAGA 5BW8A 2F43A 1N6RA 4F4JA 1YRAA 4E5UA 1ZNWA 5CDFA 1GL7A 2OCPA 1NNEA 1A2BA 1S96A 1MR3F 2FH5B 4B6FA 1HURA 4A8JA 2IX3A 3P1JA 4LJ9A 1CJMA 4P33A 4ZKEA 1QHHA 2O8CB 4D6PA 4D4JA 2CXXA 5AUOB 5F2EA 3WYAA 2DCUA 3K0CC 4OJKA 1Q1EA 2ASEA 2RGDA 1E2NA 3IILA 2NG1A 4QM6A 2IWHA 1R6BX 4Q1CA 3PFIA 1UJ2A 3NXSA 4AKEA 1KI3A 3CPJB 1Z6GA 1IN6A 2KB0A 3QF7A 3SE0A 4AI6A 2FU5C 1PLJA 2XNDD 3IBYA 4P4SA 521PA 1P9RA 4PSAA 1E98A 1ZNYA 3SHWA 5AJZA 1CS4C 2ZU6A 4M1OA 5FI1B 3I61A 4NDZA 5J4HA 2HJVA 1QG4A 4URVR 2ODNA 5JMTA 5JECA 1Q1QA 4BASA 5KTYA 1RYFA 4RD6A 4Q1BA 4NU0A 2V7QD 4GDFA 1XP8A 1RE0A 3U3JA 2WTUA 4GOKA 1R5BA 2D4HA 2WICA 3MD0A 4TYWA 1NG1A 4KYIB 4W5JA 3ZS8A 4ZKDA 1E9FA 2WAYA 4XWOA 1GM5A 3O8CA 1P4SA 1EFUA 4MKFA 2OE2A 5KPDA 3I62A 2JATA 4Q4LA 4PAMA 4DUGA 1DOAA 3TE6A 1UBCA 4KFTA 5EXTA 1WBDA 3QUSA 1G41A 3B5JA 4I1OA 3KB1A 4PXAA 1NVXQ 4PC3A 3FOZA 4NYJQ 3R7WA 1CR4A 2QI9C 1E2PA 3HR7A 3V4RA 2C8VA 5DHAA 1YQTA 1GG2A 2KSQA 4M53A 4UNNA 3AVQA 2KBEA 4ZI2A 4B35A 1AS3A 1GL6A 3QVUA 4NCJA 1NG9A 4IDOA 221PA 1OFHA 4DSTA 1IBRA 1PLLA 3H86A 5P21A 3T34A 2A3RA 2ZUDA 3ZVMA 2RKOA 4RKFA 1D5CA 2VYFA 2GXSA 2I3BA 1E9BA 5JWRA 2BM1A 4ZPXA 4LOAA 1LF5A 1KAGA 1NLYA 1L4YA 3RSOA 3HU1A 1N5KA 5JJLA 2ZR7A 1FMLA 1VTKA 1TQ4A 2IA5A 3A4LA 4UXIA 2ZR0A 4BWYA 4HB4A 4DKXA 3GLFA 3L0SA 1I4TD 1NIPA 2JLQA 1HV8A 3H2YA 3WP0A 2ZI7A 1MOZA 4PZYA 1XD2A 4OI0A 5FBVB 4KITB 4Q1FA 3HYTA 3T35A 4TYPA 3K0CA 2IYSA 1DADA 1SKYE 1I4LD 4JKYA 1F2TA 2WJGA 2C77A 4ABYA 1NBMD 3QXHA 2J5XA 1P5ZB 4URUR 4L15A 1XMSA 3I1FA 5AR1A 4PAOA 4MYHA 3TH5A 2GJ8A 3ND8A 4US1R 3A4MA 4B76A 3WNDA 1GFIA 2ZRPA 4Q4HB 3AVTA 1F60A 3GLFE 3RVBA 4JVNA 3DZ8A 5DHFA 3HDTA 1P73A 1M1YE 1XMJA 4A36A 5EXPA 2JLXA 1FX0A 2IWRA 2BMFA 1VHTA 2CNWA 3U4QA 4G5GA 3TBKA
chains in the Genus database with same CATH superfamily
1C14A 2R6JA 3CNOA 3DMTC 2IYUA 3R3ZA 4GH5A 4LSMA 4ZVMA 4FYMA 5DIZA 3NWJA 1CD5A 2PJUA 3WWCA 2OZLA 2FK7A 5KQMA 1YONA 4JLAA 2IL1A 2OV2A 4LJAA 4QYXA 5TX7A 3UJDA 3LV8A 3ZHQA 3PITA 1PR0A 3KZOA 3Q3EA 1KE2A 3LUGA 1ZNZA 4Q18A 3V7UA 3JYOA 1YFLA 4XWKA 2HHCA 1D6JA 2XTNA 3OEHD 1HDGO 3LHSA 4RACA 3NTOA 1PEYA 1AXGA 2SKDA 5H82A 1V47A 5KDLA 3ZNPA 1V5FA 4Z4IA 4L1KA 1N6PA 2X19A 2FZKA 4ZP1A 3EZ9A 4FIDA 2EZUA 4V0SA 2WPDA 1HG1A 3A2NA 3D9QX 3KEFA 4HPWA 4QNMA 1ULSA 4NBLA 5CPBA 3OE7D 4KFSA 3BYZA 2VHCA 3Q8XB 3UUGA 1I14A 1QMPA 4OSOA 1BCRB 2Q3DA 2FY8A 1T8YA 2Z6VA 3PL5A 4Q3AA 3U62A 2JFOA 2V9CA 4GPBA 2UYCA 3GT0A 3FDZA 3KJGA 1F0PA 2DFVA 3TI7A 1EUYA 3ANSA 3PNYA 4ZA2A 3U1BA 2WWVD 1UP6A 1GG9A 5G4KB 5DIFA 5FOUA 4XR4A 2GILA 4H7PA 2CW5A 2QMHA 3H7IA 1VRCA 3EQ2A 4E4TA 3WDKA 4R84A 4EB6A 4IBOA 4YJHB 1A5SB 4RHCA 4YWHA 4LFCB 4CIDA 4G0WA 3GO4A 2P0YA 1P5RA 5HPYB 2JFXA 1GN9A 4B8ZA 1HKUA 4PO9A 4QATA 5COBA 3F1KA 2A9OA 5BN3B 2B3DA 2GCEA 4LN1A 3RB8A 1KFJB 4EKEA 5I7UA 1NQ5A 1QFYA 1FFWA 4HL6A 3NQ41 1F12A 5SICE 4CMCA 1DTSA 2DY0A 2NSLA 1NRWA 1UJBA 3B70A 4JLPA 1WPGA 2F1HA 4QWMA 5CX1B 3IVXA 4FW9A 3N59A 1Y7PA 3BEDA 3IIMA 2I76A 4M7OA 4TT3D 1G20A 4P83A 3HMQA 1XTVA 1KYZA 5IU6A 4GGOA 1TQ8A 3DP9A 2DBYA 3MUOA 4H6PA 4IIJF 4LYJA 4MS4B 4UNSA 4LZLA 4RXMA 2JEOA 1V71A 2X2PA 4U6NA 1USKA 1C9KA 2X5XA 2XMPA 1OPXA 3QENA 3EZXA 3QU9A 1TJ3A 4JUAA 4TZ6A 4PRKA 1IIBA 4FILA 1V3UA 1QR6A 4ZT2A 2WUWE 2Y0CA 4J94A 3OZCA 1I0ZA 3PEWA 2XMRA 3H8VA 2VJNA 3C6BA 3NOQA 4TXMA 1JL3A 2OGUA 2VDJA 3T52A 4Z4QA 4R1MA 2W6JD 5JVDF 1WNFA 2PDAA 3OZIA 2C2YA 5A3SA 2OCXA 1ZICA 3E8XA 2NU8A 4CKYA 5KTSA 2W6ZA 4FYVA 3WRWA 5LQKA 3C7KA 4D4LA 1P2BA 1VBNA 3BIXA 3NTXA 4FFSA 3PD7A 2ZT7A 1BVUA 3IQEA 3EDQA 4JELA 2FW8A 2QJFA 4MWOA 2FPSA 4KBGA 2FKAA 4AZSA 3Q88A 3QSGA 1K06A 4MQ5A 3LLMA 4JSYA 5TMBA 4DT1B 5KQGA 1YVUA 1QU2A 3ZCSA 1FP1D 4S35A 1NBEA 1N6KA 2FAXA 4CQNA 4FSHA 3WGOA 3VHQA 4LWZA 2QN1A 3HCAA 4YUVA 4IEFB 2NAPA 3OIVA 4MQLA 1E2LA 4NU5A 4B8YA 1YZFA 2CT8A 3KC2A 3ZCQA 2BHLA 3VXKA 1NVTA 1SC9A 3G2PA 5A5GA 4C4ZA 1UF9A 5KWVA 3BA6A 4B84A 1CZHA 4GI3A 1I8TA 3CF4G 2XE6A 5J2UB 4BFZA 4GMXA 3VO9A 2WG0A 1KK1A 1P1FA 4H7JA 1JDJA 1EB9A 3TFQA 1G8PA 3JQBA 4XFKA 5CCXA 1NV8A 2H9AA 3CNBA 3HHPA 4OMCA 3FI0A 3HVRA 3HK2A 1FTYA 4MEBA 4I4CA 2FEAA 5LXTA 4M88A 4JI5B 1XT6A 5T6BA 4JXZA 2EV9A 2R1TB 3DWIA 3H0EA 3P9QA 3B9QA 1WXXA 4ETMA 3WYDA 1A7KA 3PUJA 4TYYA 2O2YA 3CUUA 3LC1O 4D41A 3O47A 3A70A 2JCBA 2RHMA 1G9TA 2EG5A 3LHIA 3V42A 3ZXIA 1RAHA 1OU4A 5LQJA 1EVIA 3LZ6A 2A9JA 2IH5A 4M37A 5LJLA 3DMHA 3CLVA 1TCBA 4B3BA 1ICIA 3I23A 3VZSA 1JPNA 3N58A 4KX3A 1SUDA 2PKXA 1K6JA 3OLZA 3VBCA 2GDZA 2HSZA 5AVJA 1XCPA 3EGDA 3JQ8A 5BQFA 3BGWA 4JBWA 3UJ6A 2G4LA 4PLFA 5ICEA 1E6UA 1F9AA 3FMOB 1Z0FA 1Z0JA 5FD8A 2X2OA 3W2HA 1DWUA 2DCMA 2EIHA 4A6PA 2QA5A 1N57A 1CW2B 3FCAA 3PI6A 1I4WA 3L9XA 4C0AC 2XGSA 3WWZA 4EZIA 1OYVA 4P5EA 4QHYA 1NJGA 1DJMA 4KZKA 1IN7A 4O1MA 3GZTB 3RRNA 5GMOA 1Q91A 4F7WA 3G02A 1PSDA 2J0VA 3GPIA 1N7IA 4C4PA 2FWPA 2GSDA 1QB7A 5BRNA 4ZGBA 3L8DA 2GD1O 1M2VB 1DS6A 3DLCA 4EM6A 1QRUA 1QSGA 2P65A 2X4IA 4URWR 1MVOA 4BBAA 1XZGA 2PQ2A 2F3TA 4IH9A 5BMVB 4LF4B 1YBAA 2YTZA 1SD1A 3B1XA 3MAJA 4DB2A 5HS6A 2ABWA 4O8CA 1QQ6A 1T8SA 4U6QA 3TG8A 5SY4A 3TLCA 4HDOB 3DXZA 3U4HA 4EZBA 1EFAA 5KYTA 1PGNA 4MYCA 2VUHB 1WXQA 1TTPB 1DBPA 3NT4A 1XVVA 1L5HA 1OLSB 1E92A 2I4LA 1C9EA 5KCZA 1SKMA 3FNQA 3Q1KA 3UQZA 1T5IA 4UREA 3CCCA 2ACKA 3HR8A 3LL7A 4NS1A 4R54A 1LZKA 3IJPA 1P9LA 4MV9A 5T57A 5I47A 5IK2D 2WAMA 3SIPA 2IYXA 3Q87B 1V26A 2OYSA 1LF0A 3B85A 2R6CA 1U8XX 3FCUB 3BQMB 4G5RA 1CNFA 3KU1A 4HUQB 1EI9A 4L5YA 3WK8A 2EKBA 5B2FA 3N2KA 5JAMA 5JDCA 3WKEA 4Z4FA 4OBEA 1P9NA 4N5IX 4PYRA 4U3JA 3A9SA 3VU9B 4JH0A 4WOJA 2HD4A 1H8HD 4U7HA 3I9OA 2FSIA 3GLUA 4XSVA 3CZRA 1H42A 4QXAA 3TOSA 1GAEO 3PGLA 2NTJA 4AUMA 4RTRA 3CZCA 2R7AA 3GPBA 2GCNA 3D0KA 2JFYA 1RI1A 3REQB 5I51A 5C53B 1QF9A 3A3OA 3AF6A 1KZHA 1IUNA 3UC5A 3BCSA 5K03A 2YZKA 4XVUA 3RUAA 1QUEA 3F9CA 3CNEA 2XNSA 4QIHA 3AHIA 5AKXA 3ESYA 1UM9A 1GTJ1 1YVRA 4HWGA 2C58A 3C3KA 5EKDA 3VR4D 4IDAA 5EKXA 3TOXA 1QZXA 2LW7A 3AFIA 4JLDA 4YMSA 3VX4A 3SEZA 4B79A 4NJEB 1Y81A 3KJHA 4KLAA 3D64A 3V4PB 4LHEA 4URYR 1OHHD 3W6OA 2R8PA 4BE9A 1H4VB 1DC8A 2WWWA 2ODTX 4JNCA 3S7TA 4LCBA 1N2BA 3QNUA 3P96A 3NH9A 2WF6A 3O8BA 1ZK0A 4O4HF 1P1CA 2QQFA 1AB5A 3FMIA 3KJNA 3TNDA 4Z51A 2I65A 1J25A 1V16B 3LGXA 1V1JA 1N9GA 5E9WA 2A35A 1B7GO 2PMWB 2Z9DA 1O95C 3GCWA 4QNNA 1TVKA 4R2HA 1WQ3A 5ESDA 4C08A 5JALA 1ZJJA 3QI2A 3PZBA 2G0AA 4FYPA 4KQGA 3VJMA 4L4XA 4BV9A 4EI2A 1U7OA 1XTIA 3L7CA 2Y0PA 4Z0PA 5A4MS 4IF6A 3CKMA 1Q16A 3PFNA 3EGOA 4EA8A 2HCJB 3GDOA 3MMXA 1Z83A 5E4TA 2C0PA 4LYFA 2CCJA 3GEBA 1WDKA 2D7JA 5E8RA 2B8WA 4FR2A 4CU2A 4TRNA 1R37A 4BZXA 4Y6GB 3USZA 4DVGA 4I4LA 4CWAA 3SHQA 4JBIA 4MWSA 2XQIA 4BNDB 2ZGVA 3R6LA 5GM1A 1XTBA 3A1UA 3A1DA 3VZQA 1VKJA 2RC6A 5GZ6A 5MN5A 3S2UA 2QJRA 3GNQA 4XD7A 5J40A 4TWRA 1CUHA 1S3FA 3EXG1 3NLLA 1Y6GA 1SZCA 3DBLB 3T9EA 3PFWO 5IAAA 5DNWA 1KZ4A 4FE7A 4B81A 3B13B 3DMRA 4K9OA 2ZSBA 4KXLA 4LZOA 3UAVA 4TRMA 4Q7QA 5LP6F 4MWCA 1RPNA 3UWDA 1GGNA 3AILA 2DKNA 7MHTA 1CFJA 1VKHA 4O33A 4I1UA 1EFKA 3R7WB 2YWBA 4L76A 3INYA 1X94A 4WA8A 3PFHA 3U7EB 3ZV7A 3TLGA 4N03A 4Z9YA 1FFXB 2PZMA 4FGSA 4S1WA 2POCA 5KMGB 1MB0A 1H2RS 1P0QA 4UPEA 2IUSA 1R00A 1Z56C 3T3MB 2AMLA 4DA0A 2RK6A 3T3IA 1L9XA 2JCSA 5LLTA 1JLKA 1UWVA 3NBAA 4PHHA 5AK5A 1K0FA 1Q20A 1R0SA 4D3YA 4NYMR 4C3UA 2BMWA 1FYEA 2ECPA 4PGHA 2VXBA 2X2FA 4UFOA 5HZHA 1XLWA 2B5OA 2Y8EA 4JLOA 4CDNA 1I2CA 3B60A 5BV0A 1MO6A 1ULAA 1WTAA 1QAOA 1MG5A 3KHKA 4B4VA 4KDFA 3TSZA 3NANA 2K7FA 4JR1A 3VGJA 1MX1A 2E7ZA 2H59A 4QSHA 1GAJA 1KI6A 3HDYA 4Q9IA 1E63A 1GUAA 5ARCA 3CX4A 2MINB 4A8PA 5AESA 3HGMA 4Q9JA 1P1KA 1TVMA 2AKAB 3C43A 3NM6B 5JQWA 3GLFB 3K15A 4Y7DA 3RADC 4IDHA 1AK2A 4D81A 4H4EA 1DAEA 2C54A 4Y0NA 4PR0A 4F3YA 4Q4JA 3CVYA 1KJQA 5FIUA 5C31A 3C5WP 1J9EA 2IE0A 5B58C 1A9RA 1J5PA 3D1LA 5IANA 4BNJA 1YDHA 1QO7A 3I1JA 4AIRA 5B30A 3EUAA 5IAKA 1JFFB 1TQ2A 2YYSA 4P6VF 4QBFA 4HRVA 1C8BA 3AJDA 3AP3A 4FDAA 4G8JA 4NCNA 2H0RA 4A2WA 3TXXA 5BSWA 2E4XA 2WHPA 4DLYA 3F6CA 2IT1A 3D7KA 2WQ7A 4BNLA 3UXMA 4F91B 1V96A 4HK4A 3X44A 1RRPA 3A1CA 1NJ6A 2RAPA 4DRZA 2Z4SA 2QRMA 4EMSA 3OTWA 4RS3A 1ECPA 1G3IA 1YH3A 1BXRA 1OF1A 3TZ6A 1VP9A 5CDGA 4RJ2A 4ALKA 5C80A 4CL2A 3RTEA 4PRZA 2ENWA 2GJAA 2AR0A 4J0FA 1YZ3A 3T7TA 1X0VA 3VKVA 1TL7C 1PV4A 4CEIB 1FZQA 2OBYA 3CH6A 3FF1A 1QM5A 1AKYA 3ORRA 3WHLA 4FJ2A 3WP1B 3ZKWB 4CMKA 1VDZA 4Q1EA 3OJFA 1PEDA 3H1PA 2YIJA 3PPIA 3JQRA 3R3UA 3GUHA 4IXTA 1HUQA 1U1FA 4AICA 1XNHA 2XWQA 1OWOA 1J70A 2WAOA 4PRLA 2G1KA 4C20A 2FPPA 3B9PA 5ANRB 1DJNA 3INTA 4DCGA 1TYBE 1LTHR 3NHBA 3UW1A 4OF4A 1MC4A 3EDCA 3GHHA 4UE3S 3CH7A 1S5PA 3R0JA 2XGMA 4MPRA 1CR6A 2EC5A 3QU4A 4OGWA 1IB6A 2O8VA 2XTJA 4U7JA 5CVEA 4ZV9A 4I50A 2EP7A 3ZU5A 4ES6A 5L3QB 2XBUA 2AN1A 4P98A 5K6AA 3A3PA 5TF4A 2CNDA 2J0SA 1TAUA 2W4IA 2VT2A 1J21A 2NO5A 2OCBA 1G291 4U7GA 4UC0A 2Q27A 4DY4A 1SPBS 1FP2A 3QLTA 3CISA 4CZ2A 4KVFA 2Y1CA 3PUWA 1J8QA 5AI9A 5ENZA 1U4OA 5K8TA 1WB5A 4CM5A 2JLUA 1MRNA 2E55A 4HNVA 3O4JA 4KWTA 4X6XA 1YUNA 3F2VA 1G7RA 3MWEA 4LNUB 4ND8A 4U00A 4UD6A 3PRKE 3LUHA 1FOEB 3PQ2A 1WSBA 3M8KA 3AB7A 4A6DA 2Q2OA 1N2JA 1YMVA 4WT7A 2QR2A 2I1VB 5ARBA 5B64A 3DAYA 5JBIA 1RKXA 4LMPA 4BEJA 3IE1A 4PZ9A 1SG9A 1NXWA 2FWJA 3CW9A 4YMLA 4YJ3F 1AQLA 5C1DA 1IXYA 1P8JA 1U7HA 2DWOA 2IEGA 3T41A 3ZOKA 4QD3A 4MQFA 1GPYA 1M5TA 2O8NA 4Q48A 1H0SA 2GNOA 1KAQA 3WKBA 4A73A 4AYXA 2HPZA 4M8SA 2I71A 3PB3A 2W5UA 4ZAFA 2PAAA 3R44A 2CZCA 2ZCVA 3HDJA 5I4IA 4REMA 1E8DA 4NCAA 1UQUA 2Q3MA 4DIOA 1N5IA 2EZ8A 4PSCA 1VIVA 2QIPA 2WF8A 3TR0A 2IX9A 4C2UA 1D6SA 2XQKA 1CR0A 4WRRA 4E15A 3GLIB 2PYDA 2H8KA 4JKOA 5AW2A 1ZIDA 3BZWA 1H2EA 1KYIA 2Z57A 1QP0A 2FOXA 1MFPA 1SU7A 2HLDA 2F90A 1GR1A 2ADMA 2NZJA 2XMSA 3BBPA 4X71A 3RVMA 1FVXA 1Y3HA 2J6HA 1UIRA 4JP1A 5JROA 4H35A 4D45A 4F2WA 3IQFA 2B9EA 4M1ZA 1GILA 2G1JA 2XCQA 4WI1A 4DXDA 2HIMA 1M0EA 2CJXA 4QU5A 5EQFA 1C0EA 2ONZA 2FFRA 1QMGA 2XDQA 3CUEF 5CT5A 3HKBA 2RGBA 3F7OA 4PO1A 1U0FA 4R6WA 3O9ZA 4R51A 3D8RA 2TMYA 5DXAA 2W93A 3WSTA 3QX3A 2MSWA 5HQ3A 2I54A 2JKVA 2L69A 2OMKA 2IUTA 3CMMA 3NIGB 4CIAA 2VSXA 1RC8A 4UAJA 3IPLA 5CDFE 4DCPA 3QELB 5CM2Z 1MX9A 3DHNA 3M2TA 1GDDA 3NDJA 2PSEA 3INRA 3OCVA 4KOEC 3GFPA 4W8HA 3B1YA 2Q3EA 1K9VF 4A2PA 1CUDA 4K9PA 3GDGA 3REGA 2O5CA 1S7GA 4KV9A 4D9CA 1NQWA 3HO1A 4K9SA 4CDMA 4RW0A 3D4LA 4I1PA 5KTRA 3LECA 3FOBA 2NZXA 3C6YA 3PI7A 1YBHA 1VE5A 1WV0A 3QVMA 4FHFA 4FLEA 3X1DA 4L8YA 4EVRA 4PC6A 1LPBB 2OFXA 5KYWB 2VT3A 3ZCTA 1NAIA 1O6CA 1Q7GA 2YL2A 1U0LA 3FPHA 4TV9A 4WGFA 2WP8J 5CYPA 4C6SA 4MDEA 1VCNA 3ICEA 2PSFA 4IUYA 3AG6A 1QYDA 3HO8A 3P9XA 4MVJI 4KQ9A 4BX8A 1ORHA 2A2ZA 2XB9A 2JIRA 3SYNA 4BKOA 3B1ZA 1MNAA 5H8WA 1PP4A 1WMFA 1N6IA 1XZKA 1WCWA 1KDRA 2II6A 3AUUA 4H3VA 4HX9A 3K8YA 2XXAA 2RG7A 3UV7A 5CCDA 3RTDA 5DEOA 1EGAA 4JBGA 1UDWA 2HPHA 1XU4A 1WU8A 2P2YA 5D01A 4J07A 1NBOA 2BGIA 1TZJA 4UHJA 1PR4A 3DVSX 1CUSA 3LTNC 1FLVA 4FCWA 4F21A 1W36C 2I9KA 1XD8A 3K4PA 3TQOA 5C18A 3M89A 1JR2A 3AF1A 3Q6IA 2B1IA 2E3JA 4FDVA 2H2AA 3G23A 1JHVA 2Q9CA 3GN1A 1AOXA 3FJ1A 1E0JA 1JLHA 2GBGA 1ZIYA 1O96B 2BGUA 3K7EA 3MTEA 4YJKA 4BGVA 4D25A 3JQEA 1XZFA 3MWFA 2Y99A 3ND6A 1G59A 4G41A 4HX5A 4DE5A 4D8TA 1QDUA 4MGIR 2C9MA 5I6DA 4KMSA 3N8KA 2FR0A 2E4AA 5J63A 5FADA 4C9BA 4DBZA 3WV4A 2YOGA 4NHEA 2IPLA 1VMDA 2ZBDA 1XZEA 3V80A 9LDBA 4TLEA 1CRZA 3Q41A 4G36A 4KIUA 4MWEA 2H29A 3HL0A 4NABA 5CYOA 4K81B 3A1FA 3AHCA 4MP8A 5EXSA 1CCWA 1PJTA 1YIDA 2RHHA 3KR0A 4LS3A 1PD1A 4Q00A 5DBHX 1IEXA 5B4UA 2BEVA 1R74A 1SD5A 3DEYX 2QD1A 1XD9A 3IR7A 4ZEVA 4EF4A 3MMZA 2XE8A 3ZR4B 1U04A 1YAJA 3TKLA 4B6QA 2BBTA 3O1LA 1J06A 4KLNA 4D8YA 4DJAA 3IGFA 2UUPA 4X41A 1KF0A 4DANA 4MAFA 1SJ9A 2JAHA 2DMRA 2C7BA 2PGIA 1TK3A 1ZO8A 4KFRA 3FHOA 5DNAA 1IHOA 2MWMA 1VHJA 2HF8A 2YYYA 1SM4A 4HEHA 4XVHA 2JASA 1YVDA 1Z73A 3JQFA 4L28A 4QUIA 1L7DA 3VPXA 4DQDA 1KK0A 4UOEA 3KOOA 4J0QA 4CV1A 5K99A 2YWHA 1FSSA 4H7FA 1I7DA 2I6SA 1PBTA 4DIEA 3L1KA 4HLCA 4LGYA 4O3MA 2H06A 1K7SN 4V0RA 1S3IA 4EGQA 1DCKA 4HAYA 5TQ2A 1GADO 3FHLA 1E89A 4CLRB 1UXKA 4YV1A 5ESRA 5AKJA 3WYCA 4YDRA 1FMJA 1X3LA 1AHIA 4FHGA 1VECA 4PFQA 1RPZA 1GO2A 3FRJA 4O4IB 3HV2A 1P0CA 4PVCA 2QRZA 4NBVA 1NOIA 4GE0A 4H27A 4LC0A 1MIOB 4MVJF 4YRJA 4BO3A 5FTLA 5IAOA 4OQPA 2UZ1A 3BSWA 4PN3A 5EIHA 3KV1A 2XVYA 3QIVA 4E07A 5CA0A 2XMBA 3V8EA 4JC5A 5CJ2A 1UANA 3AY3A 3P9NA 3MM4A 5LU8A 1N2SA 5CVUA 5HZKA 2PWZA 4F4DA 2DFNA 2YCLA 4BB0A 2I8AA 2WKRA 1U99A 5BP7A 5HJ7A 2GVZC 3IIJA 2F1IA 3N05A 4JJZA 4KCGA 4WFQA 2X8JB 4DLUA 1NBAA 5DTMA 5E4JA 1RU3A 2XITA 1VL2A 3MF4A 5BO5A 2HMSA 3CONA 1WS6A 3KSBC 2O8EA 3R0ZA 1DBWA 1UZLA 3B6MA 4I8DA 4R1NA 2ORED 3T5GA 5K0TA 1K2VN 3JD3A 2GFIA 1KI7A 1Y63A 2A67A 1E5VA 1CNMA 2ZIAA 3ENNA 4JJ4A 4NFSA 4ZVKA 1PSZA 2JGLA 4DY6A 1HL3A 3GCGA 3VR2A 1ES9A 2FZCA 5JNLA 1AF4A 1JR6A 3AESA 4AK9A 4MITA 3NTRA 1DFGA 4UCWA 4LOIA 4UW9A 4PAWA 3G6KA 4W1PA 2V1UA 1Y5RA 1JG4A 2D13A 4GRIA 4MWGA 4MW4A 4TQUS 2BSXA 2PGOA 4EF6A 1X8KA 5DNVA 1PZXA 2PZGA 3QX8A 3KYJB 4UQOA 2Q28A 3RANA 3A1WA 4POOA 1TZMA 1T24A 3G0OA 1BVHA 2IIVA 3M1LA 4HQ6A 4JT4A 2WV7A 5FAKA 3L46A 3UTCA 3KP1A 3VAAA 1B0AA 3G8BA 4BTLA 1MRSA 2W2PA 2QYOA 1DBSA 1KY3A 2GN6A 3OFSA 3UJCA 1SQFA 4EPRA 4FGLA 3MNFA 4WDQA 5KHLB 2ES4A 3QLVA 2WF9A 3COYA 4JN6B 1HLGA 1XTTA 2CKDA 4IHQA 4K1LA 3FPAA 1XRLA 2HV9A 1VKNA 5FULA 2FQQA 3G0CA 4UVDA 3DKIA 4HLUA 2QBYB 3C6MA 3PBKA 5HP4A 1QIHA 2ILTA 4I2NA 1SOMA 2G1UA 1E1RA 1QP7A 3U17A 4N7RA 1AZLA 3GARA 1NPYA 3GLGB 2Q7XA 3Q72A 4K03A 4R7ZA 3H7AA 1GEEA 2SICE 5DO9A 2HTEA 3DBRA 3RYHA 3CPHA 2BISA 3WO0A 3K1AA 5A05A 1KDPA 1U8CB 3BOSA 1W5SA 5JAIA 4O5OA 1SUEA 1GQFA 2GEDA 4S1TA 1Y5NA 5JPDA 4H31A 3QP9A 2CJWA 2GHQA 4G1UC 5MFZA 3NR2A 3OZTA 4N0DA 5BSGA 1Q1ZA 4KN6A 1CKEA 3H2SA 3PHJA 4FJ1A 1OE0A 1LK0A 3BE8A 4V0LA 5ALDA 3UN1A 1GKUB 1WPXA 1IATA 5JYBA 3DCJA 3DYVA 1KI8A 2JF0A 1ZH2A 1J99A 1A5TA 2C83A 4WZ6A 3W4JA 2ZBPA 2QSUA 1ZONA 1P1HA 1XQ9A 3DEFA 3DT8A 4WW0A 3QXSA 1RWKA 1SIOA 1UMCB 2C4KA 2WINI 2YN2A 3FA2A 3I28A 4N3GA 4HQFA 1BWSA 2IYPA 2V5UA 3BWDD 3OQIB 3OETA 1KXZA 2GBFA 5HJ2A 4KHPB 1F48A 2XE4A 4YJ2F 3UWOA 1U7DA 3U7GA 1E2JA 2G04A 3JQGA 3K3PA 3PEEA 3ZWKA 2Y1WA 1ZG3A 1NW7A 3EISA 3PS9A 1W4AA 2PH1A 4YRRA 3QEMA 4CMGA 2R6R1 3WIDA 1WEHA 3GRUA 5F7XA 2LIPA 1JEYA 1KH1A 2QX7A 4NARA 1IXRC 3T7DA 3WA6A 3IJ5A 1I01A 2OZVA 4JU9A 4IWNA 1FXSA 3PHIA 3QA3E 3SYKA 4ALLA 3KAQA 3PC4A 3R3WA 1UJMA 2PNFA 2ZYAA 3FB4A 5FL7A 4D8UA 5M2QA 3QEOA 4GSLA 4HJRA 2HK6A 2ZJFA 3FAKA 4J4BA 2IYTA 2X5KO 3PE3A 2YQZA 2OO5A 1DC3A 4YUWA 3EWSA 1XA4A 1QAMA 2ANBA 3PPXA 1WD7A 3R6WA 4PR3A 2B2XA 5JC8A 1P3JA 1XF9A 2MTBA 2H11A 4NQRA 1GQ2A 4Q01A 1F51E 4NTZA 5AT1A 1UZUA 3PLRA 4XOIA 1A8QA 1LC0A 1P81A 1SWWA 4FWIB 2C97A 3ZI0A 4JDPA 5E2IA 3PWKA 4YK7A 4LF9B 4OI4A 4BJ5A 1Y3DE 2HJGA 4C5AA 4GD3Q 3RD5A 4JWTA 1TECE 1LC3A 4LMBA 4X44A 4F85A 3DNFA 3LUAA 2GAOA 3E22B 4OA8A 4CUZA 2IYYA 2VRBA 4CG2A 2AKYA 3I12A 3DV9A 4ZU3A 3THYB 1KVUA 4QQRA 3SDBA 1EFRA 4LDJA 1QJCA 2C0QA 2X8BA 4I3FA 1WUJS 4LEIA 3KQMA 5G1NA 3IT2A 3P0HA 1CQWA 1OD6A 4U9HS 3BGOS 4PO8A 1QE3A 4EB8A 3JWPA 4LV8B 3KB6A 3E8SA 1T0IA 2IW1A 2I66A 2Y3IA 3F73A 3PNPA 2Z9CA 4LJ5A 2YC2C 3MWGA 4PQEA 5DTIA 4G4IA 3SGLA 2VFAA 4UNQA 4PLZA 1TRHA 1XTJA 1P5JA 2NYRA 3AIIA 3SS7X 3ZK8A 1M34A 2QGZA 1T29A 4CXMA 3VU8A 4I46A 3NAMA 2OVFA 4JOBA 2PSDA 1YF3A 4OH1A 4X3PA 2R6ZA 4B31A 3MT9A 1V5WA 3G5AA 5JARA 2CHUA 4M87A 5FX2A 1OGYA 2JGRA 5LB2A 1UMDB 3HY4A 3OESA 1R7RA 2I03A 4HRYA 1OXUA 3WKCA 4M1YA 3CX3A 3N86A 1KXJA 2Q5OA 5ICMA 1IVSA 1GU1A 4QU0A 3WRYC 1W29A 3OFNA 3UANA 3GAZA 3GCZA 3C1OA 4AXBA 4F7DA 2P3QA 4LAFA 2J6CA 4FNAA 5K45A 2IZOA 5K4HA 1SBCA 3N9IA 5CR9A 1PQ4A 2ZBRA 4WIAA 5D3MB 2XKAA 3BDVA 2OG1A 4TKUA 5KAPA 1VGVA 4QPDA 5DBOA 3CN9A 2NXJA 2Q49A 1Q44A 2AUTA 3C3AA 2QAGC 2NMVA 5IDYA 3DC2A 4TKZA 3BORA 4NPHA 3GW8A 4NAHA 1GSOA 3RGWS 3QNWA 4KK4A 4ND6A 4WUTA 1ISIA 3QE3A 2QXTA 1DQPA 1W9HA 1ST2A 2HU7A 1E1CB 3TE7A 1L3CA 3U3DA 4CT0A 1QHHB 1FDOA 1UP4A 1W94A 4P38A 1E4OA 1PZMA 5KNCH 2E0IA 5EZYF 4R0VA 4FHZA 4PIVA 5CH3A 2W6PA 5EZ5A 3GJZA 1P0FA 5HTOA 4JHLA 1AKNA 5E0KB 3O93A 1HYGA 4QVKA 3T0GA 3UWSA 1GLVA 3WR5A 4A23A 3HXKA 3KR1A 2D74A 3RAFC 2WAXA 3V8MA 2B98A 4KXFB 2CXNA 3OCXA 1KI9A 4OGGA 1L7QA 1BXZA 4HGPA 1J2UA 4Y2HA 2ZTSA 1EZ1A 2QY9A 1VMEA 2YNMC 3NWPA 4Q0MA 1SCKA 3QV2A 2IYLD 4GBED 1FS4A 4U0JA 2GBLC 2PUVA 5IC5A 3EXHC 1PUJA 3BC1A 1M6NA 3N0WA 5JISA 4DCMA 1X7XB 4K6CA 5J3JA 3O21A 3HJNA 4OQFA 4IRXA 3LA6A 2PT9A 4EYKA 3KR9A 4AWBA 1X6VA 2V7WA 1K5GA 4L07A 5CIQA 1JV2B 2F3QA 1PIWA 2CHVA 4HKTA 4P35A 5FF9A 2GXQA 5HE9A 3HA7A 1BG6A 3L0PA 1K7EB 1RXCA 1USUA 2L2QA 3MSCA 4JBLA 5F35A 4C2TA 1IM2A 2YOFA 3VM6A 2ZAMA 4B44A 1TAHA 4LXGA 5DGIA 3OM0A 2IRWA 4CFZA 3O74A 1P7PA 2RHJA 4RD4A 4MO2A 5T7BA 4GOJA 1NUAA 1AX9A 3VNBA 2QUKA 3TUJC 2MT9A 4KGDA 4BB9A 1QCZA 2YXDA 4IEIA 2ZM6B 1G8AA 4HDCA 2PPLA 4B7CA 1ZAYA 3GIWA 1OFVA 4TXHA 4XQCA 1FMCA 4Q82A 1Y7LA 2XWJI 2PMBA 3DMDA 3M1AA 4FMCF 4K88A 4LXIA 2J7PD 5CIWA 1YK0A 4FDUA 1RD4A 2CSXA 4G2TA 4NF2A 3QMMA 1BCRA 2PXXA 3QPUA 4W7IA 9MHTA 3RC2A 2WZQA 5FPSA 9ATCA 5ITWA 4BO2A 2GB4A 3AOEC 3WL3A 1G21E 4F46A 3PFBA 4EPTA 3BRWD 2QROA 5I7AA 3SDSA 1ECJA 5JSQA 3LYLA 1KE1A 3R9IA 3ESAA 1QX3A 2C2MA 4OSEA 5DBGA 3QKWA 3U56A 2HREA 3IRVA 4YP1A 1RYZA 2M6SA 5GTDA 5LDGA 4RTOA 1RWBA 2OFOA 5EHXA 3IVAA 1D1SA 1F2VA 1NVUQ 1O95D 2L82A 4V38A 4YJHA 1SG0A 2Q6KA 2O0JA 3ST7A 1Z6YA 1DIRA 3VDNB 2ORIA 1R9GA 1S3GA 2FRVA 3AUJB 3LBFA 3S2ZA 4OHFA 1Y8RB 4NSNA 1MC8A 1IXKA 3JQCA 5BN3A 2UXBB 4J1NA 1IN4A 4RKWA 1JB1A 1M8GA 1Y3FE 3TNFA 3OPMA 1GT91 5IH7A 2XRFA 1GPDG 1A9PA 1KARA 5CX1A 1BN7A 4QYMA 1F5SA 1XAHA 5JNTA 2ZK7A 1ACLA 3QIAA 13PKA 2PGAA 4R9NA 2PNJA 4DG8A 2QTVB 2UZ3A 1DJLA 1OLXB 2HSJA 2QU8A 1DXHA 3GMSA 2ORVA 3PSAA 1OA1A 2HDWA 4MUGA 4JDUA 2WIGA 3ETLA 3QVLA 1JTVA 3WADA 1QHEA 2PGXA 5DM4A 3ICWA 3QY9A 4PYQA 1MX3A 3RIMA 1UBEA 2HGSA 3ZLTA 3EXIB 4IDBA 1OH6A 1SBNE 2IKSA 5EG5A 4FDTA 1EK5A 4A6EA 3MMPA 2Q3LA 3ASZA 1RKVA 3LQFA 3WLHA 5EJ6A 2PV7A 3KCQA 4YCNA 4C43A 5DWDA 3SJCA 1HQKA 3SNHA 2BLNA 2YHAA 1Z5WA 2F55A 4J0DA 2X1MA 2ZSDA 4J1TC 2A5LA 2BLLA 2QLBA 4CRWB 1JW9B 1NI4B 3L77A 1PWEA 1P7CA 2HDOA 2QM7A 3RAJA 1M1XB 3B82A 1JU9A 1JLMA 5JS2A 3S5JA 3W6PA 4JT9A 2OK8A 5EJIA 4DT1A 3COWA 3MQFA 2C7RA 3WYGA 1LLCA 3BE5A 5HOQA 3LBAA 5KB3A 2PJRA 1FNDA 4L27A 1XRPA 2RARA 2LV8A 5L3SB 2BP7B 2ZTVA 2J3MA 1T1GA 1XOIA 2B92A 3AFHA 3E4CA 4G9GA 5K4AA 2Q5JA 1VE9A 4F6RB 4C21A 2AOVA 2F17A 2LXNA 3L7KA 3C24A 4ARBA 2C0CA 1OASA 3OPVA 1JKMA 1WZ2A 1ST3A 3I5UA 2HBYA 5DYNA 2OUIA 3CTMA 3MCAA 5J2UA 3A1SA 2VDRB 3JYQA 1VGQA 5FFMA 3FTNA 2PX2A 2X9GA 3CCBA 3PE4A 4LBVA 2W48A 2HMUA 1VHDA 5A9RA 1M83A 5LA6A 3BZBA 4K1XA 4XJSA 1A2OA 4IOJA 4LK2A 2BR3A 2G6BA 2HMWA 3F3KA 3SLGA 2QXYA 1EUCB 3P2IA 3FPCA 2NU6B 3CLSC 5HBRA 3ZHUA 4FU0A 5JYEA 4KLZA 1LWNA 3G7SA 4R4JA 4P84A 2I29A 2L0XA 3H5RA 3HJRA 2QAJA 4PXSA 3FUUA 1TT5B 1VBKA 3NEJA 2JGDB 3EHEA 4WJLA 2Y66A 1V11B 4URXR 1X14A 2GPAA 2OKCA 2ZG6A 4ZOLB 1XFAA 3ESZA 4BCBA 2QE7A 5F51A 3OA0A 2PKQP 4GYJA 3P2MA 3GVCA 1DCTA 3NTUA 1L8XA 2PD4A 3U44B 5JI3E 1KOGA 3SVTA 4PGGA 5LVAA 1NNSA 1CHNA 2QPTA 2XE7A 1Z8FA 1P9OA 4P3NA 5DX0A 5EUBA 3I37X 3T5MA 1RFGE 1O0CA 3HY3A 5T5QA 1SELA 3P2YA 1CV2A 4C0BA 5CBPB 3NC4A 1PR3A 4HQNA 1XBTA 4OHYA 5JU6A 4XGRA 4KU4A 1H05A 4M9ZA 5IJWA 4F11A 1EAYA 2BMVA 5HGJA 2Q8QA 4H1WA 2GVNA 5C1OA 1FYXA 3FFAA 5ERXA 1ISGA 4WERA 3RFCA 4N12A 3WOHA 4L6IA 3SR0A 3I9NA 2OHOA 3AM1A 3GEPA 5D3QA 3RBXA 4EITA 1EUDB 3S0JA 4DMUB 3PV0A 4WKBA 1JAHA 1R6XA 1T5HX 4NFHA 2FXIA 3ER9A 4K9LA 4Q3BA 1N2IA 4NU6A 1JZSA 1K6MA 5BMVA 4RK5A 4WZAB 3KKLA 5K05A 1GCGA 2DKFA 3BH0A 4B3XA 4BPRA 4Y6RA 3KDPA 5DHTA 4D0RA 1NW5A 4G0YA 2RDMA 3PYLA 1NUQA 1ISJA 4FD3A 4R3UC 2GZDA 1KI4A 4YLGA 4ZT7A 1EFPA 3VYRB 4YJ3B 2IEZA 3FHTA 5JAHA 4GM1A 3A1NA 2IXBA 4CM9D 4TTIA 3KT3A 2R8RA 3M2PA 3F96A 3QKTA 5KOIA 2V5AA 2C4HA 1SMKA 5DSXA 3IDSA 3SX2A 4NAVA 4LNHA 4ZICA 5L9AA 4LTNA 4H4CA 3D2BA 4LBWA 3FWNA 4ZD6A 1CUBA 4JC8A 5JEDA 4DTIA 3TWOA 2B9VA 1IK6A 1QRRA 2FN3A 3KYCA 1JEQB 3CZ9A 3W7BA 1JKIA 4GX1A 1OJ7A 1DRKA 3GEDA 3FWHA 2D1FA 5FJIA 3NBKA 3MK31 4CMEA 1H85A 1D7AA 3BM5A 4HUQA 3RRBA 5KYUB 2EQBA 2PUFA 1TO6A