5EUMA

1.8 angstrom crystal structure of atp-binding component of fused lipid transporter subunits of abc superfamily from haemophilus influenzae.
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
255
structure length
250
Chain Sequence
b'KDDGAYKAEPAKGELEFKNVSFAYQGEELALNNISFSVPAGKTVALVGRSGSGKSTIANLVTRFYDIEQGEILLDGVNIQDYRLSNLRENCAVVSQQVHLFNDTIANNIAYAAQDKYSREEIIAAAKAAYALEFIEKLPQGFDTVIGENGASLSGGQRQRLAIARALLRNSPVLILDEATTESERAIQSALEELKKDRTVVVIAHRLSTIENADEILVIDHGEIRERGNHKTLLEQNGAYKQLHSMQFTG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lipid A export ATP-binding/permease protein MsbA
molecule tags Hydrolase
source organism Haemophilus influenzae pittii
publication title 1.8 Angstrom Crystal Structure of ATP-binding Component of Fused Lipid Transporter Subunits of ABC superfamily from Haemophilus influenzae.
rcsb
total genus 84
structure length 250
sequence length 255
chains with identical sequence B
ec nomenclature ec 3.6.3.-:
pdb deposition date 2015-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5eumA00
3P20A 1Z6GA 4ASUD 2R6CA 5L3QB 2O0HA 1RE0A 4DC9A 5AJVB 4BPBA 4DLVA 2R8RA 3ASZA 5GJCA 4LGMA 4BWYA 3TW4A 4QC2A 1NBMD 1W5TA 1GDDA 4TTRA 4XVQA 3KUCA 1NL3A 1P9RA 2GNOA 2VHCA 2VSOA 4TMVA 3VR3A 4PSKA 2C5LA 1GIAA 3V4FA 1KZ7B 1KI3A 1T5LA 1XMSA 2IBMA 2PX3A 5E3HA 1E69A 2ZRNA 5EE9A 4CEHA 1I2MA 3LVRE 2CEAA 3VKWA 1IN8A 1AJEA 4PAOA 2DFLA 3U60B 3GJXC 2ZI3A 1OE0A 4A92A 2YVUA 2G3YA 3P32A 3ETLA 1IN6A 4ITRC 4DXAA 3EPLA 3CPHA 4QFMA 3WMFA 5GJBA 2ZJOA 1P9NA 2CXXA 2G88A 4G5OA 1F48A 2ZRGA 2ZTSA 3MUFA 4MRVA 1MABB 4BFSA 1KO1A 2FFHA 3ADBA 2C9YA 2WWWA 1KI2A 3AP1A 4Q9LA 5CLLA 3OF5A 1E0AA 2IHYA 1FQJA 3ICQB 3U7HB 5JSZA 2BKUA 3VU9A 2C9CA 2I1QA 4WZAE 4XTCS 1EFCA 5FTKA 4MDFA 3LWNA 3K70B 3TR0A 2X1VA 1IJFA 1G64A 1KKMA 3M1IA 3HR8A 5FH9A 1JXOA 3CUEF 1U99A 4LZZA 5JRZA 1OYYA 2V3CC 1P2SA 3K0AB 5DHFA 2NTYC 3U5ZB 1XXHB 2J0VA 3BS4A 3HU2A 1E1QA 1UAAA 3AKEA 3NG1A 4DWJA 2CHQA 2GEDA 4R9UC 3Q5EA 2C8VA 3G5UA 2ZRHA 3BK7A 3EWAA 4FMCF 4LHXA 2ORVA 1PVOA 1E3MA 2NO9A 1SXJC 2RCNA 2ZETA 1T3LA 3NH6A 2REOA 1XDBA 5CM8B 1CS4C 3L8ZA 3SR0A 5CDFE 4G0NA 5FL7A 4U02A 4PHTA 2O8DA 2BBSA 1UPTA 4CRWB 1XTRA 2GETA 3B13B 4QJ3A 2R6GA 1VYUA 1F60A 4C30A 2Z83A 3GLGE 1MO3A 1G8FA 3K9GA 2CMKA 2ZUDA 4XIGS 5JBQA 3B9QA 1UBFA 1KJYA 3QKTA 3SNHA 4M22A 4Q1EA 2JLQA 4EJSA 1EX7A 4JL6A 4M1WA 2CE7A 1CXZA 1M2OB 4G01B 3R7WA 1XD2A 2AR7A 2AFIE 1YZUA 2NO0A 2ZRBA 2ZSEA 2Y8EA 5JHHB 2OLJA 1XD8A 1HQYE 3HWSA 3OAAD 4S35A 1T5IA 3ADCA 4XOIA 4JYCA 4JKIA 3QIAA 2JLRA 4JBXA 4A0HA 4D4MA 1N6LA 3QF4B 2PZEA 3CRQA 4M4SA 5FOTA 2V7QD 3FHCB 2Q9AA 1N25A 1EESA 4EPXA 4BFYA 2BM1A 4BZQA 1JBKA 5EXXA 4PSVA 1OH8A 1E0KA 1IN4A 2YOHA 5DNYB 1GNRA 2Z4RA 5FBRB 2CL0X 3CWZA 1E6CA 5LBIA 4DCUA 1Z22A 2QEQA 3K09C 2CL7X 1OW3B 1D2NA 2BIFA 1A1VA 4XD7A 4JLKA 3BE4A 3I72A 4O25A 5SZJA 4ZIRB 1KNXA 4GRAA 4MGKR 1XRJA 5DISB 2ZS8A 1TAGA 3MWKA 1E2EA 4W5WA 4A36A 4IEIA 5H70A 1D2EA 3T34A 3C5CA 1R4AA 4CIDA 2XZLA 3IIMA 3QI2A 1KSFX 3GLIE 2HYIC 1NP6A 2ZUCA 4B2LA 4EAQA 2PJZA 4YMUA 5F98A 1I4TD 5GVSA 4MYCA 4DCVA 2OBLA 5G3YA 1AS0A 2VP9A 2ZS9A 2BM0A 1VCIA 3QBTA 4I1VA 4XWKA 1PV4A 1NKSA 5DI3B 4TN1A 1SVLA 4A1FA 2BCGY 2ZEJA 3N70A 1NNEA 3A1UA 3U44B 2ZI6A 2CLCX 4TLCA 4B2IA 3EASA 4C0LA 5JLJA 2J1LA 1R5OA 1GKIA 5J4LA 5C46F 3P26A 4AC9A 2H7VA 2B6HA 1HQCA 5EE1A 4CT4B 1Z0FA 3LQRA 3DZ8A 4Z1MA 5KUTA 2O5VA 3THWA 1YU9A 1A7JA 4LJ7A 4OHXA 2XGJA 1KK1A 1PUIA 1TEVA 3WBKA 2ASEA 1KI9A 3NC1C 3TAUA 3X1YA 1UM8A 2O8FA 3GLIB 3QBVA 4C3ZA 4NYIR 1G19A 2ZRFA 1T4GA 2B7BA 3R8FA 1XMVA 3WNCA 2PT5A 2GEUA 1E79A 3VR5A 2ZAMA 4OI2A 4CEIA 4NDZA 3CLVA 2IXFA 3QE0A 2QSZA 4QGAA 3EZFA 1Q21A 4A82A 2J7PA 4TQAA 1VIYA 4M1YA 2DR3A 2IYQA 3T5GA 2F1JA 1GILA 1OXUA 2VP6A 5DE3A 3NDBB 1M34E 4MKGA 4HAUA 1AKYA 5EP4A 2ZI5A 3U3RA 3AVXA 3BORA 1ZUNB 2A30A 4HAZA 2ZREA 4E03A 4R71A 2FPLA 2GZDA 5BXQC 2IEYA 1SXJE 2J59A 2VP2A 2IYSA 3K70C 3IPXA 1X6VA 3EXAA 4P0TA 1DOAA 2HXSA 3GLGB 3CPEA 2BJVA 2EFDB 4HB3A 4NBSA 3NXSA 1MR3F 3FTQA 2PJRA 3EWSA 4N0DA 1ZUIA 1R5BA 1G8HA 1G8PA 3BH0A 2VA8A 3RANA 3NTUA 4JL5A 2ODNA 3TSWA 2KE5A 3M4YA 3AV0B 1AA9A 2IYTA 4RZXA 2UZIR 5ANRB 2AL7A 1G1MA 5KHOC 1FP7A 5EP1A 1GAJA 1K8RA 2KSQA 4B48A 3NH9A 2G0NA 2WKRA 3W8RA 2BMJA 3CH4B 3AVQA 3PEVA 4X8OA 3D7MA 1LF0A 4AKGA 1UFQA 1DELA 1GL7A 1A2KC 1NMXA 5DYIA 5JS8A 3LA6A 1YKSA 2N42A 4B75A 4TLDA 2KBFA 2X8AA 1G3MA 1NJFA 3LX8A 4LSGA 3H0KA 3SOPA 1HE1C 3PIRA 1OHHA 4KVGA 4BFVA 2EWWA 1GP2A 1E9FA 4L9WA 2XXAA 1DEKA 2WWHA 3RS4A 2IHBA 4AKHA 1EG7A 4EQ6A 2XTNA 3K0FB 2OBNA 1E98A 1P62B 3ZVMA 1ESMA 3LFUA 2H8KA 4EIWA 2W2VA 1EGAA 4LOAA 8OHMA 4PC2A 1MRSA 2IWHA 3AKDA 3OIUA 5CIQA 2GESA 5C2JB 3ZQJA 1W36B 3WRYC 1G21E 1NN5A 2ZS7A 1KIMA 4G5QA 1OSNA 5DSZA 1NIPA 4XH9B 2XJ9A 2DHRA 2QN6A 4C2TA 5KSZA 2GTPA 2VH5R 2OEPA 5GJVC 2WJJA 4M9ZA 3UKDA 1ZM4A 1KI1A 5AWFC 4AD8A 4NCNA 1ZIPA 3UPUA 3RS3A 3HP1A 3CRVA 5ELXA 1K5GA 3SJCA 3R7WB 1E79D 1F2TA 1ZC4A 2E87A 3JZAA 3SYLA 3SBDA 3X1ZA 2ORIA 2XTMA 1NKTA 2WJHA 3BB1A 4LV5B 2DFNA 5DI3A 3AP2A 2H92A 3LLUA 1Z63A 1JR3A 3IDQA 5EXPA 1P61B 3W3ZB 4NKRA 3FKSA 1W0JD 4LBWA 3AF1A 3CW2A 2F1HA 3BFXA 4L16A 4BQSA 2WIAA 4LYFA 3ZQ6A 3CRW1 3WYFA 5DN6A 1TU3A 4PC3A 2LWIA 5FTMA 1N6HA 3A1TA 1DAIA 1JI0A 2A78A 2CJWB 2B92A 4P31A 4CEIB 4C0BA 1KSGA 4KHZA 1U90A 1GRQA 1L2TA 5AK0A 3B1YA 2OG2A 3MSXA 1DAGA 4ZIRA 2HF9A 4MGIR 4CZ2A 4NE2A 2JJ2D 1QHNA 2YJTD 3A6PC 4IW3B 2VL7A 2EW1A 3DL0A 4HSEA 4HB0A 2HYDA 1X86B 3B78A 1NBME 3PG5A 3QXCA 2O8EA 1JR3E 3CNNA 4LC1A 1FZQA 1UBEA 1XJCA 4KCGA 5KDLA 3TK1A 4ON9A 3Q3JB 2GJ9A 1OIWA 5C4GB 3REFA 4C0KA 1VG8A 1XPUA 3TVTA 1S3GA 1JB1A 1YQTA 5FPYA 3I62A 3PJRA 3SI7A 1II8B 1MABA 3GQBA 2VBCA 4Q4HA 1FMJA 1XD2B 1GUAA 1W47A 4GNKA 5K8UA 3C16C 3ADDA 4Q7MB 1NN3A 2C98A 2ZQ5A 2XNDD 2D74A 4FMCB 1E2GA 3ND8A 3GPLA 2JJ1D 1N0VC 3BH7A 3B6EA 4XTRA 1Z5ZA 3CX8A 4H1VA 3O8DA 3PFIA 2CCJA 5BQ5A 4IOMA 1QHIA 1ZRHA 3MCAA 4IFBA 3R20A 3K53A 3HYRA 2OESA 4DLYA 3VHLB 4DLSA 2FEMA 1X8JA 1OXXK 3BRWD 1ZAKA 4U7DA 2BBWA 1ZUHA 5FTLA 1YJ5A 5EE0A 1VCNA 4FW9A 3PEUA 4X8LA 3F0TA 1NVWQ 2H1LA 3GLFB 2W6IA 2V6IA 1LV7A 4B3XA 3AUXA 3CF0A 4BZPA 2ANBA 2BWJA 1E32A 2WHXA 2CVHA 4TQUS 1KO8A 4YMSA 3AF4A 2IWRA 2RGNA 2ZJZA 3U2QA 4WAUA 3MJHA 2HUPA 2ZM5A 1U0JA 2WPDD 1M1YE 4JLPA 3O47A 4B44A 3L43A 4CEJB 2AKAB 3C5HA 3I3SR 1UF9A 1US8B 5KOYA 2AN9A 1Z07A 4YMTA 1SGWA 2BDTA 4TMZA 5KDDA 3PVSA 2GA8A 4U5XA 1NI3A 3C41J 3U61B 2W2TA 1OKKA 2IEZA 1KJWA 2AD1A 1NG1A 721PA 3UWKA 3RWMB 4LHVA 4GT1A 2W58A 2JA1A 1DAEA 3IPYA 4DLWA 4M53A 5J4YA 1N3BA 5E7IA 2A3RA 4IRUB 3V9PA 1AQYA 3FKQA 4O2RA 1LS1A 1J8MF 1T0HB 2PMDA 1OIXA 3BFVA 1VG1A 4QBGB 2O8DB 3KXKA 1H8EA 3EA5A 4V0KA 2QP3A 1P60A 1S96A 1QG4A 2R44A 4TSFA 4LCBA 5L3VA 1P4SA 1N6PA 2ANCA 1WCV1 4PX9A 4Q66C 3T61A 1KHTA 1X8KA 3VR4A 4JBYA 2P3SA 4TLEA 5M04A 2IF2A 2FFQA 1VYVA 3FPAA 3SYKA 2WVJA 3AGPA 1TQ4A 3PUXA 4KVAA 1R8QA 1SQ5A 1MT0A 2F43B 1XXHA 3RNLA 2H57A 5G41A 3ZVRA 2JLYA 1E9BA 1G6OA 3GMTA 4DHEA 3T1TA 2D7DA 2OE2A 5KNCA 1FUKA 4MRSA 4HAWA 3RS7A 2RB4A 4I81A 4DIEA 1G8GA 2BEJA 2I1VB 5FPKA 4A2WA 5A0FA 3VX4A 2CBZA 4CGZA 1Q3HA 1ZW6A 2GJSA 2O0JA 4HYYA 4BLQA 4DB4A 5JSZB 2WIBA 4AWXA 2N1BA 3KQUA 3KKPA 2AKYA 3TQCA 2BMEA 2N46A 1G7CA 1O3YA 2BOVA 3EZ9A 1XPRA 5L3SA 4RY2A 4OI0A 1G18A 3MD0A 2WJVA 3IUYA 1E96A 4ARZB 2HJGA 4DBLC 4DT1A 5HE8A 3QXSA 4WXPA 1TUEA 4G1UC 5K8IA 4DEXA 4D6PA 1Q1QA 1XEWY 3KL4A 4MKFA 4WOPA 5TMPA 3JVUA 2Q9BA 2RGNC 4RD0A 1XFAA 2DWQA 3A36A 4CEHB 4JJZA 1WBDA 2ATVA 3I61A 3WMGA 4V02A 1P75A 2O0KA 4IOLA 5UKDA 5LPNA 5AUQA 5BYKA 1RYHA 4CDGA 4K8OA 1W44A 2EWVA 1XWIA 4LV8B 1GRRA 2PT7A 1Z28A 2AXPA 3T15A 5E7JA 4FMBB 2J46A 3K9NA 3W90A 1YZGA 2G6BA 3FB4A 2HT6A 4GSYA 4BFZA 1NLYA 5FTNA 2YHSA 2IYRA 3T35A 3TW8B 4BE7B 3OZXA 4XSGA 4M8NE 1E0JA 3IHLA 2O8CB 4X8HA 3DDCA 3GJ6A 1A4RA 2L0XA 4L5BA 2AXNA 1VHLA 2IK8A 3MAAC 3UWOA 5HZKA 4TSFD 2W0SA 3CPJB 1HT1E 2QP4A 1N5KA 5G40A 2GILA 4EPWA 1FW6A 1H8ED 4OJQA 1G3QA 4LWZA 4EJSB 3KB1A 2X2EA 2BC9A 2Q0HA 2HT1A 5FPHA 3UG7A 5J4HA 1FFHA 1R0WA 3PUYA 1JEEA 4P3YA 5JFGA 3ZZUA 1I2DA 3BWDD 4UNQA 3WMEA 4TL7A 1W0KD 4CEJA 2A5JA 2BBTA 2WKQA 1CJKC 1LB1B 1E1RA 4FINA 4GFDA 2IYUA 1QHSA 2NO6A 3OEEA 1T8TA 3TUJC 3IILA 1JQLB 2J0QA 1J90A 3OFNA 5KSPA 3GJ8A 2ZE7A 3TVDA 1KMHB 4ZKDA 1CR4A 2Z4SA 3DKVA 1AS2A 1DBSA 4RFSA 2PX0A 1ZNYA 3KKQA 4GL2A 3MGCA 1YE8A 4HZUA 3GLGA 5HCNA 4Q19A 3KX2A 3OE7D 2ZJ5A 3UG6A 4JVMA 1VMAA 1NVXQ 2A9KA 4IVPA 2GDJA 4DUGA 4EPTA 1VTKA 1CR2A 1W49A 4ABYA 4URXR 1KDOA 2FJUA 2NG1A 4ZI3A 4Q9IA 2GF0A 3M0EA 3EPHA 1YRBA 1DTSA 2QROA 4G5RA 1Z0JA 2VYFA 1M74A 4LHZA 2AK3A 1CLUA 1E2PA 1CJMA 1YZLA 1JAIA 2WWXA 4OHWA 5HE9A 3RYTC 2RGCA 1E2DA 1W46A 4XSHA 1SXJB 4M9QA 3ADKA 4NU0A 4O3MA 3QF7A 4P4TA 4NCJA 1OXTA 1P5ZB 2AX4A 3GLHB 1DO0A 2IW3A 3KTAA 1L4UA 1IHUA 2PEZA 4OHZA 2DWOA 3RWOA 5JJKA 3BXZA 3GJ5A 2EFGA 1YR6A 1RRPA 5F3WB 2BVNA 1YZNA 2FN4A 4Q00A 4DDVA 3RC8A 3PXGA 1A5TA 1FX0B 1RRFA 4RJLA 3ZS9A 4BFWA 3PUVA 1MKYA 3AUYA 1KMQA 1XTSA 1R2QA 2UVQA 3OIWA 2WOOA 4G5SA 3DOEA 4A0FA 2GVDC 2OUKA 4PPQA 4C0QC 3MWJA 3EZ2A 4LJYA 3CR8A 3IEUA 3S1AB 3U7GA 5D3MA 4HUQA 1P73A 3NEJA 2H18A 3CKLA 1W2GA 3U44A 1I4DD 2GAOA 1XCPA 3R9IA 1P72A 1GNPA 2KI5A 4PO9A 4RD4A 2YWGA 4POAA 5FBQB 2HCBA 2FU5C 2RGDA 5IRCD 2Q3MA 4URZR 4UXJA 1L4YA 2CJWA 2D06A 4W5HA 1GG2A 4JYBA 4MQBA 5FPTA 4FI3C 3SYNA 3NBXX 5JEEA 2QENA 4Q47A 4PZYA 3Q72A 4PPGA 1U9IC 1T6NA 2E1RA 3F8TA 4PO1A 2FE4A 1HTWA 4RZUA 4AI6A 2OSBA 1Z6YA 3X1XA 2RH5A 2P2LA 1QHHA 4F7WA 4P4UA 1Z6AA 4B47A 2BEKA 4Q1FA 3ZD6A 2JLVA 4BRUA 2C78A 2WZQA 1PUJA 1JR3D 4TYQA 1ZU5A 2ZSDA 3KJIA 4GMDA 4WZBE 5EP2A 1NN0A 421PA 4BZXA 1PLLA 4QBIA 1F2UB 2Q3HA 2CK3D 4P4SB 3OFND 5EE3A 4KXFB 2ZR0A 3QF4A 3U7FB 1QDEA 1OLOA 3QG5A 1JAHA 4M0LA 2ERXA 4YC7A 4A8JC 4DSNA 1ZJ6A 3K9HA 3FOZA 2R6AA 3WY9A 2XNSA 1DG1G 3KXIA 1Z29A 2QPOA 4AKEA 3WP1B 4FXPA 5DHAA 2AD5A 2QU8A 3SFVA 2D2FA 1D6JA 2QL6A 3K0FA 1QBKC 1ZM2A 4B2PA 4IVQA 2OFXA 4FCTA 4B35A 4D25A 1DO2A 4LJ8A 4ZV4A 2YV5A 2RMKA 4KJZA 4EFMA 5IK2A 5CB8A 5HKKA 2QAGC 4Z54A 3VR2A 3K0CC 1EFRD 4GZLA 5B2ZA 3B9PA 2B8WA 4MDEA 1LY1A 4Z1MD 5B57C 2J7KA 3RABA 3WRXC 2ERYA 2W00A 1A2BA 5F9FA 1IXRC 1UKEA 5IF9A 1Z08A 2QORA 5TARA 5CJPA 4MA4A 3LBIA 2W2XA 2FFAA 3BD9A 5FOVA 4OHYA 2QQ0A 3OE7A 2R2AA 4HLUC 3SQXA 4V0NA 2QMOA 4Q02A 5JS7A 2ZVQX 1W4CA 5FOSA 5FI1B 5EJEA 1NRJB 2DBYA 2OXRA 3QKSB 3OAAA 4Q7LA 5AJYA 3I5XA 2ONJA 2YC4C 5JJLA 2V6JA 4URUR 1RJ9B 1EFTA 1D9ZA 4A0GA 1KI6A 4HUTA 1B0UA 2WBLC 4YXWD 1P7CA 2P6NA 2ODBA 2WMNB 2OLKA 4QRHA 1ETUA 1UKZA 4US2R 2JEOA 1II9A 3BAFA 1Z0DA 4KSBA 1ZNZA 2D3WA 2IS4A 2CLDX 4XD7D 1J8YF 3TE6A 5J47A 4PQRA 5BWMA 1WXQA 2YWFA 4A4DA 5JJIA 4Q4LA 2OCYC 4RZ3A 3DOFA 2VHJA 3VHXA 3W5JA 4QGGA 5D3MB 2VQSA 1JQJC 1XPOA 3AP3A 1OH6A 4D4KA 3I32A 3R8CA 3AVYA 2QBYA 1BKDR 1D8TA 3WNDA 5JRJA 3GLIA 5EXTA 2JDIA 1Q57A 3QG1A 2JAQA 3THXB 3AQ4A 1GFIA 5JI3E 3V4RA 4IDNA 4OJKA 4MITA 3EA0A 3IGFA 2FPMA 5JMTA 2JCSA 3E5HA 4MKIA 3TQFA 3THWB 1U8ZA 4R7ZA 4Q7JB 2I4IA 1Q20A 4UNRA 2WV9A 4Z8YA 4DEYA 1L7VC 1HH4A 4MGZR 5EQTA 2ATXA 1R5NA 2GHIA 2NO1A 3ZZTA 1YR8A 4LV6A 3RVBA 1DVRA 1VCMA 1OT3A 2ZU6A 5L3QA 1DG3A 2ZRKA 1TMKA 4A6XA 1N6RA 2WJYA 4A8JA 1R6BX 2RGAA 4D0LB 2KWIA 2QT0A 2V1UA 4DUGD 2ZR9A 4PZZA 2J9RA 2PLRA 2ONKA 2V1XA 4XWAA 1KJZA 1KI8A 1IN5A 1Q1BA 1XP8A 5D3QA 4B73A 4HAVA 3THYB 1Z6XA 1H8HA 1E99A 2W6JA 1U2RA 4AYWA 3L0IB 1WP9A 3ECCA 4K46A 2O52A 2WJGA 1ZYUA 3B1ZA 1JEDA 5H1YA 2NPFA 2WSSA 1XZPA 2C03A 5HZHA 1C1YA 3CNOA 2IA5A 3HU3A 2HF8A 5DO9A 1CJVC 1R0ZA 1RKBA 3AVUA 1RFLA 2JIZA 2QMHA 3N2IA 3ZDQA 4C0JA 3FFBA 3UANA 1SVMA 4C4PA 1UADA 2FGKA 3W9YA 1XTIA 1W1WA 3LD9A 4IVRA 4JMPA 2BBOA 2DCUA 2WOJA 2XAUA 4GP7A 1TF5A 1Z06A 2WPDA 1CR1A 3RLFA 4URYR 4W7SA 4CF7A 1CP2A 3NBZC 3ZJYA 2IYWA 4YDHB 3AVOA 4Q1CA 2ZRAA 2A2ZA 3LAWA 2NO7A 2C04A 4MKHA 2VP4A 1WDTA 1Z0IA 5CDFA 2OCBA 3QKRA 4HATA 3L0PA 1FTSA 1FOEB 4TYNA 3VNVA 1W0JA 5AUNB 3NIBA 1D2MA 2FEOA 1W2HA 2IYXA 1FQKA 2P6UA 5TVKA 2GJ8A 1TQ2A 1BIFA 1W48A 1YR9A 3BBPA 1KY3A 2HCJB 1W7AA 1BOFA 6Q21A 2XTZA 4A6PA 3FMPB 2FG5A 3T5DA 4KSCA 1LW7A 3P4XA 2ZSAA 4KLZA 3X2SA 1CRPA 4TLAA 5FBVB 2WJIA 1GL6A 1LVGA 1ZD9A 3IHWA 3I73A 1NLFA 2A7QA 1G4UR 1XEXA 1YZTA 3DM9B 2G77B 2VP5A 3L82B 1KK0A 5A4JA 4EJSC 1AK2A 3OESA 1F2UA 4B3BA 3CIOA 1NVUQ 4HDOB 1JR6A 1OXSC 5FBWB 4FWTA 4RKEA 4ERNA 1II0A 1KNQA 2ZITA 2CHVA 3BH6A 3I1FA 3L2OB 3OIVA 4QGHA 4MYUA 3O8BA 2EFCB 1G7RA 4B33A 2MMGA 1KO4A 5DGXA 5JCZA 5KNBA 1OHHD 2FGJA 3MLEA 1WB9A 4KBGA 3NKVA 4OQNA 4PAMA 3AF2A 1VG9B 2EQBA 3H84A 3NEYA 5AR1A 4CYMA 4C7OA 4ZDIA 5K8TA 4Z8XA 2GXSA 5JEDA 1E1RD 1P2TA 1XTKA 2VPPA 1W4AA 1XJQA 4XVRA 3NC0C 5L3SB 1PLJA 4NTZA 3ZH9B 4ESVA 3KKMA 1O87A 2GJKA 2DY1A 3N5CA 1AN0A 4B34A 4LX0A 1VG0B 4NH0A 4WW0A 5FI0B 5TXGA 4PANA 2D7CA 3X1DA 2J87A 3CO5A 4C0SA 1HY3A 1JPJA 1KAGA 2YINC 3LRPA 4OQXA 1NVVR 2XNDA 3FE2A 5CYOA 3TIFA 3SQWA 1OF1A 2C77A 3E70C 2IS2A 3AH8A 2R65A 1BS1A 3CF6R 3GFOA 4NP6A 4K81B 4OQMA 4PZLA 4Q4JB 1AZTA 3BJIC 3S1AA 4LBZA 4JLVA 1EFRA 3DMDA 3IIJA 2REXB 3H1TA 1U0HC 2G83A 5AUPB 2FF7A 1XX6A 1QVAA 3OHMA 3VR6A 3U3KA 4Q4AA 1GSIA 3AVVA 1G5TA 1KK2A 2QQEA 3A1WA 1ZBDA 4M2LA 3EW9A 3L8YA 4FWIB 2OZEA 2QM7A 4L8GA 4HLCA 2Q6TA 3PEYA 5CIWA 1MO4A 1EK0A 4M9XA 4PO8A 2GWHA 4JSYA 2LKDA 2WAYA 1KO7A 1TPZA 1Y3AA 4BFXA 3V00A 1NMYA 2K5UA 4YQFA 1DAKA 2VLIA 4JZKA 1W36C 4IXNA 2P67A 2REBA 5KPDA 2JJ2A 1L8QA 1SXJA 1G5RA 3JZMA 1EWRA 2C95A 4KITB 4HI0E 4HAYA 3SS8A 4RCZA 2ZR7A 3PENA 1UBGA 1ZVQA 2FMXA 2VHUA 2XEXA 4QG7A 4BFUA 3D31A 4MH0R 3T12A 1LTQA 1JECA 2CDNA 4BEBA 1E94E 1WE2A 2IYLD 4F93B 3HYTA 3TRFA 4DDWA 1ZMXA 2OXCA 4JVNA 2H5EA 2GZAA 4F38A 3RRYA 3LV8A 2FFBA 3CB4A 4KO8A 1T3SA 5J5CA 1D5CA 2OILA 2RGGA 1C9KA 1QRAA 2F1RA 3W8NA 3UXMA 1CKEA 2RKOA 4Q01A 3QXHA 4UNNA 1JXMA 4WZ6A 3LX5A 4ZDKA 1D9XA 2Q3FA 2WWFA 4NCHA 5GVRA 3L0OA 3ZZ0A 2QM8A 4MRNA 1XU4A 2VO1A 1SKYB 4UXIA 4JS0A 4QJ4A 1ODFA 2KJQA 2WWIA 2ZXUA 2QPTA 2GCPA 4LYJA 1AIPA 3SN6A 1CEEA 3NVAA 2IUSA 3PUWA 3W3AA 3K09A 1XBTA 1NJGA 4QM6A 4LBVA 121PA 2TMKA 3THXA 1P2VA 3Q7PA 4DLRA 4IDOA 1N6OA 5HKKD 5FOWA 3EARA 3B1VA 2FSGA 5SZHB 1KK3A 1U81A 2C96A 4PR0A 4L15A 4DSUA 2QA5A 1GWNA 2ZRPA 3B8HA 1N0UA 3DZDA 2GCOB 4JLAA 3C14C 2OO7A 3QKUA 1E4VA 4F91B 5J40A 1U8YA 4GZMA 5CYPA 1OB2A 3QJYA 1Z83A 1ANKA 1KO5A 4M1OA 4MUAA 5LDDC 2NZJA 1QG2A 5JHGB 3QPWA 5AUOB 1T91A 3DVLA 2RGXA 1IOZA 1MO5A 3AVPA 1E4YA 4QBHA 4RFVA 3O8RA 1G20E 4TT3D 5HPYB 1FNNA 1SHZA 1TF7A 2WWGA 3UMFA 4B3CA 1XJ0A 1UKYA 1I4LD 3KXLA 1J99A 4AG6A 4Q21A 4JLOA 1RZ3A 2DPXA 3QENA 3SDZA 3IO5A 3WXMA 4KI0A 1EWQA 2ZRJA 1VIAA 1SVOA 3ZVNA 4NYJR 4WVFA 1ZM9A 3ASYA 3VX3A 1E2MA 1E9EA 2CLSA 2IUTA 4QL3A 3QVUA 4DT1B 3FVQA 2Z6VA 4HLDA 3Q9LA 3F3YA 4GI7A 5EXSA 4PHGA 1E2NA 4BECA 4OI1A 3TUZC 2OAQ1 3K0SA 2QMUA 4QHSA 2CE2X 1Q1EA 2GKSA 2QT1A 2F1IA 4C0AC 4QNRA 1N5JA 2FZ4A 4PC7A 4D4JA 1PJRA 1TU4A 1E2HA 1C4OA 2QUZA 2ZIAA 1ZM7A 1IY2A 4Q9HA 1F3OA 1NF3A 2HEIA 2RHMA 3QVVA 2QAGA 3ND9A 1BO6A 1JPNA 1LS6A 3SFZA 5KNDA 2MMCA 3CWQA 2JDID 5FPSA 1CTQA 1G6HA 1V43A 2JJ1A 1KYIA 2RHDA 2VF7A 2QE7A 3GD7A 4W5JA 5FR2A 3RRMA 5DH9A 1VPLA 3M6AA 4WXRA 1SULA 2F9LA 3I8XA 3CH5A 3KQKA 1E2IA 3SBEA 4Q1DA 2JLWA 5C4MA 3HPRA 2J5XA 2NMVA 1S8FA 1DARA 1VDZA 2R6DA 2MSEB 2MSCB 2ZE8A 2DYKA 4PQYA 4AY2A 2PH1A 5L3RA 4JVSB 2IXEA 4A2PA 1IXZA 1NY6A 2XZPA 1OYWA 2FZLA 4DVGA 1SXJD 2PL3A 2BCJQ 1SKQA 1S1CA 1T9HA 3ZD7A 1X8LA 4URVR 4XVUA 2QY9A 5CM9C 2F9MA 4UXHA 2XZOA 3GLHA 4B32A 2QRZA 4RSGA 3EIHA 4D0GA 4GBMA 1AKEA 4NPHA 3LXXA 4UQOA 4DLUA 3WYAA 1N6IA 3NBFA 1KKLA 3CRRA 1E1QD 1E2FA 4QKQA 2ZYVX 3SZRA 1Z0AA 2Z5FA 3TKLA 3RSOA 4L4UA 3C8UA 1LFDB 3I8SA 4DLTA 3QSYA 4LJ4A 1KI7A 2JJ8A 4FMDF 2YWEA 1FPMA 4G5GA 5H8WA 4Q9JA 3D6TB 3MMPA 2E9SA 2VRWA 2WTUA 3K0EA 4E5UA 1KI6B 1TF2A 2KB0A 1P9WA 2UZ3A 4HB4A 3T1VA 1BH2A 4BRWA 4ZCMA 4HB2A 2XJ4A 4BLSA 2VHTA 4TMTA 4UNSA 4JLBA 3QKSA 1WA5A 4M9SA 2AWNA 3RRZA 3VMFA 1WMSA 4H9GA 5FL3A 2VSFA 1OJLA 2EVWX 4LYHA 3GJ0A 4KODA 5SZKB 4KBFA 4LBYA 3TUIC 1G3UA 4C2UA 2HDNB 2QTFA 4P33A 2J7PD 1TEXA 4V03A 5KU1A 4DCNA 4BLTA 2V8OA 1K6MA 3T1QA 3FYHA 1S3SA 4LJ9A 3HU1A 4FCVA 3A1VA 1TL7C 3U3MA 1RPZA 1ZIOA 1DAFA 3MFYA 4OI4A 1P6XA 2A5YB 3TMKA 3QEJA 3HDTA 4EFLA 4D4LA 3VTKA 1N0WA 3T1OA 1DS6A 1HV8A 2CCKA 5EZ5A 1HE8B 4GOKA 1PLKA 2VEDA 3QNUA 4HDQB 5E95A 4Q4HB 2PZFA 1X1RA 2QRNA 2W6ID 4UJ5A 1AGRA 3EZ6A 3MWLA 4TLBA 5JECA 1QZXA 2J45A 3LW8A 1KY2A 4HUQB 1X1SA 2GK7A 1M7GA 3BFKA 3U3JA 3SU8A 4EFNA 3QXXA 1MOZA 2P5SA 3C15C 3W6OA 2EFHB 5E7MA 1ZNXA 2J41A 2QTVB 1JNYA 1YZQA 2O8EB 1QHXA 1U98A 2GK6A 1ZC3A 5EUMA 3VFDA 2D4HA 4D26A 2F6RA 1ZCBA 2ZRIA 2FDCA 4B6EA 3IEVA 1MO6A 3FGNA 3WP0A 4DLZA 3GEHA 4B74A 4IKEA 4AYXA 4QHYA 1F5NA 4OL0A 4IEEA 4AG5A 4BLOA 1XF9A 3N2EA 4RVCA 4W9MC 3K70D 4N1AA 5AJXA 2CNWD 3RRNA 3LH5A 4V0ME 4EPVA 4RZ2A 4KFUA 2DFKB 3I4LA 4DLXA 4DSOA 3LW7A 1XEXB 1MV5A 5C18A 1ZNWA 2ODWA 1N6KA 2BHRA 4OK3A 5BW8A 4PQFA 2A5GA 3TJZA 4JLNA 3BC1A 1GL9B 5BN4A 3BERA 5F9HA 3O8CA 1EFHA 2H17A 2V7QA 1PZNA 5KYKA 4HZIA 2OHFA 3U6BA 4OQFA 3CZQA 5TY0A 4C7OB 5C1BA 1H65A 1KI4A 2ZRCA 1RIFA 3CX7A 4L9SA 2OV2A 1E9RA 2J0SA 1XZQA 2CK3A 4BLPA 3U4QA 1SVWA 5IHPA 5DIFA 5CITA 1U9IA 2VF8A 3FHOA 3DO6A 5AJZA 4PC1A 4NYMQ 4YLGA 2ZPTX 3QPUA 3H86A 3QQ5A 4FIDA 4F4IA 1DAMA 1IN7A 1KDRA 2KBEA 2F7SA 2ZE5A 5J4VA 1G4AE 1TX4B 4NCKA 5G53C 4R2HA 2PZGA 1SKYE 4LPSA 1E2QA 4Q5IA 4X8MA 2W0MA 4IOKA 1WQ1R 4C0HA 2ZRMA 4QXAA 3W34A 3GFTA 3ZGXA 1CJTC 1OIVA 2H16A 4TMXA 2G1JA 4E22A 4M1KA 1QHHB 4IJMA 4DCSA 4Q1BA 1RW4A 4EUNA 1CF4A 4TL6A 3R9XA 4UKDA 2PLFA 3U4QB 3FDIA 2PEYA 4KAXA 3CBQA 1XXHE 2GZHA 5F2EA 3PR1A 4OYHA 5GADl 2GCOA 1UBCA 1DPFA 4ARZA 1GKYA 4DIDA 4WIAA 1ZP6A 3AF3A 4HEJA 1EX6A 1Q1ZA 3KJEA 3Q7QA 4TYYA 1E2JA 1OFTA 2AFHE 5GJWC 5E4FA 3ZS8A 821PA 4EKDA 1FUUA 1GITA 1NY5A 2FSIA 2V55B 4J0QA 4AKIA 1QVRA 2JGNA 2WM9B 1T8UA 4NYIQ 2QZ4A 3I92A 3ZLJA 5IDVA 4ZO4A 4JLJA 4NYMR 2R9VA 1XEFA 4P4SA 1NLZA 2DWPA 4V0LA 3F5FA 4YONB 3QKRB 4D81A 5LD2B 1S4QA 1FMLA 2ZJ2A 1COWD 2HLDD 2YOGA 3GJ3A 4TMKA 1KGDA 1G16A 1VECA 3QXJA 4D0NA 3PV0A 3JVVA 3B7GA 4PHHA 3KDSE 2IYYA 2MSDB 3ONWA 1SZPA 4Y0AA 2IF0A 3EPJA 2ZJYA 1G3RA 4B3GA 1Z47A 3QY0A 1G7SA 4QBFA 4S2EA 1ELOA 1OV4A 2G1KA 4ZI2A 3DHWC 5IK2D 2QPAA 1UKVY 4LUCA 3BB4A 1CJUC 2LKCA 3AGQA 3VU9B 4D2IA 4IDPA 2BJWA 4GMXA 1M8PA 2QSYA 4US1R 5HTKA 4AURA 4US0R 3B82A 3FWYA 2J0UB 4QJ5A 2F3RA 2ZROA 3A4MA 2XITA 4Q4AB 2FWRA 4QNMA 2CVFA 5SZIA 4M1MA 3U7EB 2XOKD 1NSFA 3GLFE 4A0RA 5L8VA 2B8TA 2V4ZA 4JBWA 4GOJA 2SHKA 1OKKD 2V54A 5JWOA 3CNLA 4Q4JA 3A37A 1Z8FA 2XX3A 3EG5A 3NDPA 4HDCA 3IKJA 4DSTA 2ZJ8A 4OBEA 4RD2A 1OFUX 2ZVPX 2GCNA 3EC1A 4JSTA 1WF3A 4A9AA 1YZKA 3B2EA 3IBGA 3B1XA 4RCYA 3W6NA 5KSOA 4RKFA 2FX3A 2OFWA 1FNMA 1UEIA 1TADA 5JCPA 1S0UA 1BYIA 3PCRB 4EPYA 2FA9A 4ZCLA 1DAHA 4DB2A 2GBLC 3DEFA 4DJTA 4DCTA 5HR5A 4GOXA 5KDOA 2J0UA 2OT3B 1U8AA 3WNBA 5CK5A 2HJVA 3REGA 1HURA 1M6NA 3MJRA 4MRRA 3KQNA 4IOJA 1FX0A 1EXMA 2XSZD 3D8BA 4I1UA 3UK6A 3TR5A 4NL4H 2YYZA 1AM4D 3NHAA 1Z2AA 4R2IA 3CM0A 4JJKA 3VAAA 1N2CE 2J3EA 3EIQA 4URWR 4LJAA 4TL9A 2HXYA 2W83A 3RHFA 2FV8A 4F4CA 3GLHE 4PAQA 1ZD1A 2HV8A 5FFMA 4AIIA 2IX3A 2X77A 3MRSA 1V5WA 1WBBA 1XCMA 4Y0VA 1ESNA 5DLQC 3IBYA 2C2HA 1AZSC 1KTVA 3GEIA 3THOA 2YOFA 1IM2A 2P5TB 3FMFA 1M7BA 3AF0A 4NHOA 5FUXA 3SJAA 3EPKA 4LPKA 3KUDA 1U0LA 1NMZA 5CB6A 1W36D 4BEJA 4LHYA 2OBMA 3A4LA 3LY5A 4ZKEA 4B3DA 1LF5A 2PCJA 3K1JA 4IFEA 3E2IA 5FOXA 3SEAA 2EYQA 4JKYA 3BIFA 3P27A 1NN1A 4B3FX 4MYTA 2OAP1 4LJ5A 4HAXA 2DFTA 1N5LA 1GM5A 4LYAA 4IXMA 4U00A 1FTNA 5JWHA 2GBLA 3AVTA 4NONA 4QGFA 1XMJA 3EC2A 2GJAA 2R62A 4BLRA 5J4KA 3AKCA 3LNCA 3GLFA 1X3SA 2ZU0C 3AVWA 1NG9A 2JLSA 4PC6A 1UDWA 2NQ2C 4M21A 1BMFA 4WA7A 5AJWA 4FD2A 4HLQB 3KKNA 4B6FA 1HUQA 2WSSD 621PA 2CL6X 3LXRA 4Q7KA 2NIPA 5EP3A 5TB5A 1GTVA 1W5SA 1S1MA 3LQQA 3L0SA 4LJ6A 4XJXA 3QPVA 1WRBA 221PA 5TV2A 4TZ6A 2XXAB 4QM7A 3C4JA 2NGRA 5KO2A 2G0TA 2JLUA 1KZGB 1J7KA 2FSHA 4E09A 521PA 4ACAA 5CLQA 3GEEA 4MYHA 1VKJA 4V0MA 1R7RA 1NVVQ 4KU4A 3LO5A 2B21A 2NOAA 3K9LA 4IHQA 5EUQB 2VTKA 3D3QA 1N5IA 1YHNA 3TH5A 3A8TA 3EAQA 3RDPA 4F92B 2YNMA 4LI0A 2WAXA 1XB2A 1SVSA 4FCWA 4ILEA 5JZVA 4G3XA 5FBLB 4IDQA 4OK5A 2XB2A 2G9NA 1Y63A 1RRGA 4JVLA 5K8LA 5BYJA 4FN5A 3NWJA 1T0JB 4BGDA 2R6FA 3X1WA 3KKOA 2JATA 4M1TA 3C7KA 1EFUA 2F3TA 1TQ6A 1TNDA 1F2TB 1IBRA 2FH5B 4JT2A 4BASA 4KYIB 2QMEA 2CNWA 1COWA 2HLDA 4GDFA 4V0OA 4B71A 3CR7A 3CF2A 4JLMA 1IY1A 2QG6A 3QUSA 2RGBA 3KB2A 5BN5A 1KSJA 3HR7A 3T06B 1J2JA 4ASUA 2QE7D 4UJ3A 3TAHA 4CW7A 2NPIA 1AS3A 1G17A 1Q0UA 3SJBA 4M1SA 2QBYB 1HYQA 1M7HA 5P21A 1S9HA 2ODEA 4CT5A 2JIZD 1SVIA 2ZI4A 1DE0A 4CVNA 3SJZA 1CU1A 1W4RA 1W4BA 1CULC 2O8BB 2IYZA 5JI2E 3AM1A 1GOTA 1SVKA 3RC3A 3RS0A 2JLXA 3CONA 3AEZA 3GCGA 4R98A 4A8JB 2O8FB 4LY6A 2IS1A 2ZANA 1TTTA 1Q3TA 4Q1AA 4BUJA 2IL1A 3LLMA 4BFTA 5JWRA 3KJGA 1NSTA 1XTQA 3ZIAA 2WSMA 2RAPA 2ZE6A 2QNRA 1KSHA 2OCPA 5A5GA 3BB3A 2F43A 4LC0A 3HJNA 1IONA 1QF9A 4PPNA 3W5IA 2PMKA 1AQUA 3TGPA 1VYTA 1NIJA 1RJ9A 4YMWA 2GXAA 2V9PA 4N3NA 3PUZA 3IIKA 2BV3A 1R0XA 5EE5B 5FTJA 3TLXA 4KLNA 1XD9A 5H68A 3W6PA 2BMDA 2JASA 2QGNA 2I3BA 3G82C 5FL7D 2WWYA 2QP9X 2ZSBA 3EZ7A 2ZI9A 4TL8A 5DI9A 1HT2E 3ZVLA 4JL8A 3BGWA 2IT1A 1OXVA 3OIYA 1RYFA 5KSYA 3LBNA 3ZYCA 2ECKA 1KAOA 3UMSA 3FFAA 3J81k 1ZU4A 2OM2A 1KDPA 2A5DA 5CJ2A 4I1OA 4A2QA 3VNUA 1IAQA 4PTLA 5FUYA 4II7A 4B76A 1OPXA 1N6NA 4TZ0A 1TQDA 3NBYC 3FHTA 3OEHA 5G3ZA 1Q44A 1IQPA 1US8A 2EFEB 2ZJAA 1NBMA 4PPFA 1HA3A 1VCOA 2C99A 4O0MA 4NCIA 2CHGA 3CZPA 5FOUA 4YMVA 4ACBA 2X2FA 2GVZC 3THYA 1GNQA 1R10A 3TBKA 1ZCAA 2A5FA 1BYUA 1VHTA 4LRWA 4OK6A 4RD6A 2GEVA 4ZDWA 3ICEA 4LK2A 1KOFA 1R8SA 1MRNA 3U3OA 1OFHA 4OKSA 3AKYA 1G9XA 1E0SA 1OFIA 2ZI7A 4YXWA 2OCAA 4DRZA 4PXAA 5FUVA 3KFVA 1CBUA 4N0EA 2WMOB 4TT3A 2YWHA 4OQLA 3TSZA 1Z3IX 2YZ2A 1G41A 1UDXA 4A15A 4HLUA 1FL9A 2XOKA 1MH1A 3DMNA 4DDTA 1S2MA 4B43A 5LB4A 1Q22A 3DKPA 4I99A 3MG9A 4DKXA 4MUBA 3GJ7A 2IYVA 1XMIA 1XTJA 1R0YA 1RRCA 3GP8A 2QGZA 3VKHA 2Q21A 1XCGB 1G8YA 3UATA 3KQHA 4YDSA 4XWOA 2FSFA 2DB3A 1W0KA 1XNJA 4F4JA 5DN6D 4MGYR 4TQ9A 2O8BA 1G3IA 1QHGA 4PFSA 4TMWA 1GVNB 2GF9A 2YC2C 4WBSA 4QOSA 2EYUA 5BN3A 3PEWA 5DYGA 1ZM3A 3UMRA 5FR1A 4JT4A 2ZAOA 4ESHA 2QI9C 2FNAA 2Q9CA 3QOFA 2P65A 2O8CA 2QAGB 1ONBA 2D62A 2UKDA 1CR0A 2CCGA 5KPJA 3R9WA 3IQXA 3B5JA 1RC8A 4KYUA 2GRJA 1GKUB 4JIMA 1J70A 2AWOA 2C9OA 4TYWA 3DPUA 4RD1A 1ZD8A 3H4MA 1E9DA 3Q85A 3K0AA 1XEWX 3U6KA 4RD3A 3Q8XB 2Z0MA 3IO3A 3UIEA 3IQWA 3GFPA 5TDHA 4PSAA 3H2YA 4QHTA 4Q9KA 4Q48A 2ZJBA 1UEJA 2W6JD 3A4NA 4ZPXA 1A82A 1YR7A 4DZZA 1JALA 1YVDA 1OH7A 4C9BA 4P32A 4ZCIA 3QEOA 3VR1A 2NZ8A 2ORWA 3RSLA 5EZ6B 5FUWA 1YRAA 2BMFA 3A58B 2P0EA 4LHWA 1FP6A 1SHKA 4EDHA 1UJ2A 4KFSA 1G291 4TTQA 3KQLA 3PITA 4OHVA 4LDJA 3RS2A 1E9CA 1P3JA 3FKSD 4KFTA 2PCLA 3KTAB 4NMMA 2ZYUX 3NHBA 5HCIA 3WHKA 2YKGA 5LD2C 3ZIAD 1IJEA 1DADA 2ZRDA 2QAJA 1IY0A 3TNFA 3VKGA 4EPRA 4Q03A 2VSXA 3I5YA 3P1JA 1JJVA 3E1SA 2VP0A 1AGPA 5CK4A 1U94A 4JLDA 3BOSA 1GRNA 3SHFA 5KTYA 2X19A 3OEHD 1BMFD 4GPTA 1E2LA 3CRMA 3B85A 3RAPR 3OEED 1S9DA 2IUUA 3GJ4A 2JLZA 4O2LA 1TUIA 4NYJQ 4FMDB 2ZUBA 5LB2A 2RGEA 4UNPA 3Q5DA 2IXGA 1CRQA 1LNZA 2FOLA 3DM5A 1F6BA 4Q18A 2OFOA 1H8HD 1QHYA 1RVDA 4GP6A 3SC3A 2Z43A 2EU8A 4IDHA 2XB4A 4RFSB 1G7TA 3LVQE 3G0HA 4I1SA 4AYTA 1E9AA 2ZSFA 2ZRLA 3K0CA 4D80A 2AK2A 2LCFA 3AB3A 1P2UA 3B60A 4KV9A 3KFXA 2QTHA 3FMIA 4EQ6B 2GXUA 3FMOB 1T3HA 2GXQA 1OH5A 4TTPA 4H1UA 2IC5A 5B64A 2WICA 1KDTA 4MRPA 4D82A 1Z2CA 2P6RA 1HEIA 2BKEA 2ZYTX 1Z0KA 4KFRA 2ZYWX 3CX6A 3HPQA 5IT5A 3EX7C 3LDAA 1CIPA 1K5DA 1GZSA 3K8YA 3PQCA 1Z6TA 2FPKA 4TWZA 4E07A 2IS6A 2VHQA 3LBHA 3P4YA 4NZYA 3WHLA 1B23P 2D2EA 3SE0A 1ZINA 2VIIA 1E9SA 4I4LA 4PHFA 3A1SA 4DDUA 1G5PA 1OB5A 4Z51A 2AHOA 2GAAA 2WKPA 3EIEA 4TYPA 2XSZA 3TSOA 3WYGA 3KZ1E 3KJHA 3RS5A 2F55A 3VQTA 2B7CA 2PBRA 3B1WA 4HZUB 1IXSB 5B30A 3WBJA 1Q12A 1JJ7A 3MWYW 4ZDJA 1E2KA 3SHWA 5B58C 1II8A 4AK9A 1KMHA
chains in the Genus database with same CATH superfamily
1YZ3A 1Z6GA 2EX0A 1P7YA 3PYLA 2BZ1A 4AJPA 3PK0A 1RE0A 2B1GA 2VXCA 3PQ2A 1WB6A 1XAHA 3ASZA 3V3TA 4ND8A 3VSDA 3LJKA 3HJBA 2AOTA 3FBTA 4M0CA 3TW4A 3WWYA 1YQWA 2Q5CA 5IC4A 3MZ0A 3MJSA 4YBZA 4X0EA 3HB0A 3PPIA 5DTQA 2GNOA 2I6QA 1CZOA 1SA0A 2EL9A 1JSXA 2EZTA 2VHEA 3GA5A 4TMVA 4WKOA 3S28A 1DKMA 2OQVA 1XZHA 5JXJA 1KZ7B 4J7AA 2H4YA 2YZ7A 3FPGA 3OT1A 5AKXA 4BX2A 1NYQA 1XMSA 4BYMA 5EE9A 4CEHA 3MJTA 1UOPA 1LQTA 5G4KA 3NHKA 1SEPA 2ZWIA 1IN8A 3B20A 3SEFA 1AJEA 4W8HA 1WBJB 3QA3E 2BHTA 4E2WA 4PRKA 3OC6A 3JYOA 4CF5A 3FOWA 1F8FA 4XKJA 2YVUA 1I1QB 2G3YA 3GAFA 1IN6A 3P32A 1U2GA 3JTEA 3CPHA 4ITRC 3C6KA 3DW1X 4QFMA 3ETJA 4S2UA 5EQFA 2RIRA 4GYJA 2CXXA 4NBUA 3WMFA 3ZK8A 2VTBB 4OJMX 4BFSA 1MABB 3F73A 4IHKA 1KO1A 3CJRA 1DJMA 5G4KB 1OROA 4M76B 1W1UA 2D54A 3JWIA 2C9YA 5ETJA 3UT6A 2PD6A 3AP1A 1H69A 4Q9LA 3WQSB 3TLMA 4LZLA 2YWDA 3IV9A 4BBAA 2JIDA 3WIUA 3H75A 1XNHA 2B20A 3FPKA 1L7EA 1LBSA 4I7EA 4J49A 4PG6A 2C9DA 1EFCA 2NWQA 4RU1A 1PHPA 4MW5A 1ABFA 3VTFA 3L1KA 2B61A 5B3AA 1DBPA 1IJFA 1KKMA 2R6JA 3M1IA 1WV0A 3HZHA 1NC1A 3ZY2A 4YUZA 1F1BA 3CO0S 4YMHA 5FH9A 3D3NA 1U99A 3Q6NA 2C97A 1OYYA 5DPMA 1DIBA 3ZX5A 1JHDA 4AXXA 1XPJA 2WUVA 2QSJA 4BVEA 1Y1SA 4KIWA 2ZYIA 4BQIA 4Q12A 3HCEA 4X5OA 1M9NA 4QYTA 5EZYB 3CVXA 2CHQA 2NU9A 3C98A 4M1ZA 4CG1A 1CS0B 3PT5A 1JIUA 2A9RA 1PEDA 3EWAA 1HDOA 1V8OA 3KT6A 1U8CB 1UANA 1Z8HA 4FMCF 4KK4A 5LOVF 4ALJA 2NO9A 2RCNA 1ISSA 3EQ6A 1Q95A 1RJFA 3NH6A 3ZWKA 1NUQA 3JVIA 1HDXA 1XDBA 1LLFA 1ISIA 2QX7A 2REOA 3DMFA 3FTDA 1TJ4A 3L8ZA 3MINA 3OOSA 5CM8B 1E77A 5FL7A 1E59A 4NS4A 4PHTA 5CDFE 2O8DA 1UPTA 2O5CA 1TLFA 1XTRA 3B13B 1WULS 2IDKA 4L6CA 1VYUA 1F60A 1H1DA 2XMBA 3CJTA 4FE4A 4GZ6A 1MO3A 4PLVA 1S3IA 1F4PA 2P6PA 3DKIA 4HNSA 4U7HA 3GLGE 3OSUA 2XUZA 3FLBA 2VAWA 4KO2S 4GL4A 3MB8A 3NUZA 3QKTA 1U7HA 1WMDA 2I4LA 2FN3A 3S68A 3SNHA 3NP9A 1EX7A 3W5UA 4YCMA 4XX0B 2GAIA 3JPWA 1Q16A 3O5AA 2X8JB 4M1WA 5CLIA 3U7JA 3TX2A 4EI2A 4OX9B 2DG2A 1A5AB 3U1VA 4PFJA 5KJ1A 2CE7A 3NUGA 3R4VA 1R0KA 3O4RA 1W88B 1CXZA 3S8EA 2JI7A 5K3SA 3ZLUA 1XD2A 2ZRBA 2AFIE 2NO0A 1KMNA 4MVJG 2VDJA 2Y8EA 5JHHB 1J21A 3PFWO 3ZW7A 2OAGA 1XD8A 2J9FA 2NTVA 3HWSA 3OAAD 4S35A 5EJ8A 1H3FA 1PFYA 2O2XA 2PXCA 1Q0SA 4JLWA 4V0RA 3ADCA 1C4WA 2J6BA 4JKIA 1D0SA 1ZGJA 4D4MA 3M6IA 2EKLA 2PZEA 5C5CA 5KQLA 1V4VA 2A67A 2Q0QA 3GRPA 3ZWQA 3VM6A 5KHLB 2JANA 3D6JA 2EZ4A 1I0ZA 3PPXA 3REOA 2BM1A 4BZQA 5CFNA 9ATCA 4PSVA 4CQMB 3NHYA 3IUJA 3K7EA 2GYWA 3ZU2A 5DNYB 4KVFA 1R37A 3OJEA 5FBRB 1Y8RB 4KDCA 4DR5B 3IKVA 4HFRA 1WZ2A 5I7UA 5LBIA 1RKVA 3RIXA 3WGNA 4DCUA 1YGPA 3CEPB 2CL7X 4D45A 5JAHA 3KSBC 1UPXA 3CY6A 4JLKA 1FYXA 3KPUA 3MFQA 3EHDA 4CNQA 3N7UA 4QBKA 4Y18A 1Y1LA 4PGHA 5CX1B 4BO2A 4DM7A 4ZIRB 3TIVA 2RG1A 1L4MA 5EJIA 4EY4A 1XRJA 4BNKA 3CLTD 3GWZA 2HF2A 1RJEA 1C8VB 1JT9A 4GKAA 4NFSA 4P4GA 3TL2A 4IEIA 5H70A 1D2EA 2DCMA 1RQLA 3YASA 1R4AA 5BORA 2D5BA 3IIMA 4E13A 3O8QA 1IXYA 3QI2A 1K2VN 3GJZA 2Z5VA 4BKMA 1T4CB 1JQAA 4JQZA 2HYIC 2ZUCA 2QLLA 4ER7A 3FWNA 3ST7A 4LZJA 1I4TD 4H3SA 1YMUA 2BAGA 1CJBA 1ZJ5A 4MYCA 3OTHA 4J7UA 4NJMB 3FUXA 1JTFA 3ND7A 3EGDB 4MULA 4N0MA 2VJBA 1HETA 3R5FA 4J7XA 5E6UB 4I1VA 3DNFA 3QBTA 1LU9A 2Q5QA 3KNZA 1Z4OA 2ZVJA 1W30A 2WUWE 2EF1A 4H4DA 4JUBA 4TN1A 2O3TA 3RCBA 1Y4ZA 1XLTA 2PM8A 3NEAA 2A0XA 2ZWPA 4B2IA 3DFFA 2Q2VA 4C0LA 4DNQA 3A3OA 1C8BA 1JDBB 3CTMA 2J1LA 1GFZA 3RYIA 5DNVA 2Q8PA 4L95C 1KOLA 5DNWA 4TWBA 3GNLA 4AC9A 2BP7B 1V7ZA 2B6HA 2JARA 3IAHA 3NOXA 5DCWA 4E4RA 3NVKI 1ZD3A 2CLOB 2GRUA 3GC6A 3NTVA 5EE1A 2ZM6B 2EBFX 5C8YB 3DB2A 3LQRA 3FPCA 3CUSA 3EEBA 5KUTA 2XVAA 3ZKWA 2BSXA 1A7JA 1PYGA 1DKLA 4LMPA 1TEVA 4BNMA 1K68A 3WBKA 2ADMA 3G6WA 1MPTA 2MJLA 1JHUA 2OCXA 1Z4IA 3GLIB 2BEVB 3PHHA 3QBVA 1SOWA 2Q8QA 3JAKA 3WRWA 4F4DA 4YRGA 2V3WA 5DM60 3R8FA 2B7BA 1JVNA 3WNCA 2NYRA 3HTXA 2GEUA 4BUZA 3A3YA 1QG0A 3ZI0A 4CEIA 1M8KA 2QSZA 4URFA 7ADHA 4RW0A 4A82A 3EUEA 4CV1A 2D59A 1L5HB 1KP2A 1XQVA 2ECQA 2W2KB 4P1ZA 5HKOA 2WILA 1T1RA 2FETA 2XD4A 1NBEA 1X19A 3GRKA 3QPBA 4QPNA 4DPKA 3L93A 1GILA 5HKBA 2VP6A 5D01A 3UK1A 1M34E 4MKGA 4CN8A 3SE7A 1BWRA 1MORA 2HWWA 3CC8A 2ZI5A 3OM0A 4GBGA 4HF7A 2EIHA 4KRXA 1UBUS 4QOFA 5FNVB 3GGDA 4HAZA 2RBEA 4WDRA 1XKQA 2BEUA 3D43A 1EPUA 3PQ5A 4ZU6X 4R71A 2RKBA 5JC8A 1U2DC 1D2CA 5EAIA 1SXJE 2H4JA 4FR5A 5BXQC 3K70C 1EVKA 3EXAA 4JDUA 2J3JA 4P0TA 2EGHA 1M0EA 4TV8F 2BEWB 3CISA 4X54A 4BS9A 3CPEA 4NBSA 4ZTBA 3G8BA 1AOXA 1MR3F 4P2BA 4QTZA 1Y6ZA 4L0QA 4N0DA 1ZQ1A 2VAVA 1R5BA 1KMIY 2CZGA 3FMVA 3L6EA 3WKEA 1G8HA 4F2HA 3DOHA 2AZDA 1R66A 3UC5A 2ZZNA 3RARA 3WQRA 4JL5A 1R3UA 5FUBA 5CYFA 4LDAA 5DU2A 3TSWA 1V39A 4E7PA 2KE5A 3M4YA 2J3MA 3AV0B 4X60A 4Y2TA 3HZRA 2JFPA 4V3CA 3ELYA 5KHOC 3OMLA 1K06A 3FI0A 1NURA 1JKIA 2GO7A 1MAAA 1XMXA 1GRCA 3AVQA 4YREA 5TEWA 4R5HA 4OQZA 3D7MA 1LF0A 5MN4A 2FVXA 1SFRA 5EKXA 1DELA 4YNBA 4P84A 1UBTS 2FTKE 1K8ZB 4F1JA 4BO5A 2L18A 3NHMA 4JGIA 4XB1A 1GHTA 5DBFA 3GRFA 2VDQB 2NU7B 2KBFA 2X8AA 4R8RA 1DRJA 3CSDA 4G8CA 1WMBA 4IF6A 3SOPA 2AMLA 3EDOA 4IO1A 3U0VA 4D4HA 3OPYA 1GP2A 1PO7A 3UQYS 3P2YA 1EG7A 4N76A 2FR8A 5DJ5A 3NS7A 3QW2A 5E3IA 5EESA 4EG4A 3JD2A 4DTIA 2P0YA 1KAEA 3O6VA 1CQIA 2W2VA 3TOVA 2XB6A 1AKUA 1EGAA 4LOAA 1PDVA 2QUJA 3QTBA 4UD6A 8OHMA 3T4XA 4KV7A 1DBRA 2C5BA 1MRSA 2K7ZA 5H5JA 4DG8A 1WZIA 5C8YF 4W1RA 1D4ZA 1YDMA 4BBZA 4F9FA 3OIUA 3BTVA 5ITWA 3Q2KA 5KCZA 1V47A 2I6SA 1K5PA 3ZQJA 3N86A 4G5QA 1KIMA 3I64A 1T36B 3IR5A 2QN6A 3PPVA 2I2FA 4O3FA 1O97C 4Z99A 4C2TA 1Y9AA 1HC7A 4LCJA 4W5TA 3VI4B 3Q8LA 4NCNA 1HOTA 1JFTA 3FNIA 1TYDE 3DDOA 5TX7A 3R7WB 4P35A 1E79D 1F2TA 2F3SA 3DPSA 3VR5D 1ZC4A 3JZAA 3V8MA 1EM8A 3I2GA 2H4ZA 3ZWVA 2I3GA 4YQYA 3X1ZA 1NQWA 2R25B 4A91A 3GIWA 3F98A 4HH1A 2CFSA 4HUJA 2HA6A 1P7PA 5EIBC 3WL8A 3BRQA 2AEFA 3LLUA 4EUEA 1QUEA 5IM5A 1GU7A 1P61B 2IYFA 3TO5A 4EYKA 2OOSA 1Y33E 1JQ5A 5HJ2A 3N87A 1IULA 5JJCA 3FKSA 3LSTA 4ZHQA 4LBWA 2QTRA 4K0RA 1ZHOA 4G9GA 2F1HA 5EYPA 3V55A 1D1SA 2WIAA 1NHGA 3ZQ6A 1NP3A 3CRW1 4K8RB 2PU7A 3O3NB 2LWIA 1EA7A 2XQFA 4F97A 3A1TA 1DAIA 1U80A 3R9XB 5AOCA 3G49A 3IHKA 3QVGA 2YFKA 1WHSA 3QMVA 3RK0A 4BEVA 4C20A 5BVHB 1DC3A 3LLCA 4GXRA 4C0BA 2FLVA 5CH3A 1S4MA 2OYRA 1L2TA 5DHRA 3MSXA 2NU6B 1CIVA 4INZA 5F77A 2WINI 1OCEA 4ABTA 4KYTA 3WKBA 4YV7A 5ALJA 4IP0A 3DVAB 2CC2A 1JE1A 3A6PC 1ACMA 1JHMA 4LWQA 5GIPE 3PLRA 2HSJA 2HYDA 2YWRA 4G1VA 4LVUA 2C94A 3SX0A 4N41A 1A77A 1NBME 1SUFA 3QXCA 4TTIA 1BU5A 2VNKA 4KCGA 3NLLA 8GPBA 3ONFA 4ITUA 1IC6A 4YRCA 4MEJA 1CLEA 1VL1A 4X1KB 4LIPD 1J42A 1OIWA 4XCVA 4MQLA 2R87A 1T13A 4P3XA 4QD3A 3TVTA 4K1LA 4DMHA 2P9FA 3I62A 4E6EA 1IYZA 4R9RA 1DV2A 5BR8B 2J5BA 3NM4A 3Q40A 1HNZB 1GA1A 2MCFA 1ICEA 3C16C 5A71A 3VR4H 4BQPA 2B36A 5TMDA 5JNLA 4LN1A 4D57A 1RAGA 4M89A 1JIVA 1E2GA 3R0ZA 5AXAA 1H1LA 1JI3A 1I4EB 2BCEA 1DAOA 3RWBA 3B6ZA 3A1NA 3BH7A 3B6EA 3E82A 3GWGA 2GR9A 2PQ0A 3SVZA 1KJNA 2AR0A 3PFIA 4CQLA 3WJ1A 4F5DA 3ECAA 1UPCA 5CIYA 4PG8A 3R6WA 2CCJA 1U65A 3TQOA 5LZ9A 3NC4A 5AK6A 2NUAB 3P9YA 4FYWA 1QHIA 4FHFA 3Q10A 1KL7A 5AKGA 1RNLA 2YMMA 2OESA 4B4WA 3VPSA 4LS3A 5FAXA 4DLYA 4DLSA 2ZQYA 1E6MA 3HUUA 4H31A 3RJZA 3ZE8A 3IOBA 1A9OA 2C2BA 3BQNB 3EDRA 4P08A 4ZQEA 2J5QA 2CF6A 1YDHA 1Q77A 1YJ5A 1PJTA 3S4YA 3VU0A 1XRRA 3PEUA 4DR1B 1MNAA 1OU0A 2BKAA 2MT9A 3DAHA 3GPIA 3IP3A 4PRZA 3PFKA 3WLEA 1YRHA 3DFZA 4R8MA 1Z2EA 3TINA 2ANBA 1E32A 1CUDA 2VLBA 4PZDA 3ZXIA 2GHTA 5CT5A 4YMSA 2FKAA 2VJPA 1QLWA 2E2WA 1ZGHA 3F90A 2BSQA 2X9LA 3MJHA 3LBAA 4D3YA 4JLPA 3QPDA 2H1HA 3L43A 3W8FA 5A0VA 3HP4A 3PNLA 5TE9A 5EA2A 1J8VA 1RHKA 1Z07A 2AN9A 4KE8A 1SGWA 3IC5A 4K7JA 4R0VA 3PI6A 4TMZA 3AZQA 3ZV7A 1SVNA 5EWMB 3OA0A 1ODLA 3ETEA 1NI3A 1V4NA 4U5XA 3SAJA 1SUBA 2W2TA 2WD7A 3KPYA 4B8YA 1Z4KA 2RHGB 4PF1A 1TCVA 1DKPA 3A2NA 4EHNA 5TSDA 4MKZA 1NG1A 5A3SA 3D5QA 3DBVO 3MIIA 1S89A 3CE6A 1WX1A 2W58A 2WWRA 1GPKA 3WL3A 2PWYA 4MARA 2AZXA 1QO9A 4U7WA 2QJFA 4Y98A 3DH0A 5J4YA 2O3SA 5KOJA 4KR2A 3FKQA 1R0BA 2Q6VA 3ZI4A 4RF2A 3BFVA 1VG1A 4MVCA 4O4HB 5KX5A 1RWMA 1H8EA 5G0SA 4B9EA 5DLEA 4AQ7A 4V0KA 2QP3A 1B8UA 1JEOA 1TMGE 2FYTA 1WUTA 1H2HA 4TSFA 1NQXA 4DPLA 2J0EA 4LCBA 5U4QA 1Q0TA 1XRLA 3VR4A 1VE3A 1WCV1 4F5WA 1KHTA 1ZXXA 3D2CA 3E2PA 3P5BA 5LQCA 2P3SA 1E3TA 5M04A 2IF2A 2FFQA 2XADA 4U9UA 1PX2A 1TQ4A 3HUTA 2I8LA 1R8QA 3P0RA 3TSAA 2MYTA 3OIDA 4MPPA 1KETA 1JQBA 3RNLA 4ZVUA 4HEA1 1QO0D 2VP3A 1KH2A 1ZRNA 4DABA 2I22A 2D7DA 4LYGA 3HJAA 2GGSA 4Q16A 4HAWA 4TXMA 2BR4A 4DIEA 2I1VB 3H9BA 5F23A 2CFOA 1N5DA 5JLAA 5BSVA 1KDVA 4BJHB 3V8RA 2CBZA 1Q3HA 1ZW6A 4HYYA 1PV1A 2NACA 5EFOA 4D9KA 3OM9A 4EHAA 2UVPA 2ZUEA 4UEWA 2N1BA 2H0AA 4BLWA 3BICA 1WUHS 1ESDA 4EEXA 3SQNA 2N46A 3F6PA 2HQSA 4QFCA 3QQPA 1O3YA 4UE6A 5LXTB 1FRVA 5KVQA 4HR7A 1R6TA 1QE5A 4RY2A 4G85A 2HADA 1BDBA 4LE2A 1J97A 1TI7A 1E96A 1BQ3A 3DVQX 1DPGA 3KE8A 1LA2A 1R64A 3UY4A 4ARZB 1W85B 2OHOA 4YUVA 3TEFA 4YI5A 4JI3B 5KTMA 3C7DB 3H6HA 1RFGE 2NQTA 3GFGA 3NCHA 4PCUA 4UMEA 1B73A 3QU5A 1Q1QA 1XEWY 4UVHA 4HT3B 3PRHA 2TMGA 5AI4A 4RD0A 6AT1A 2BHNA 3BTSA 4NV3A 5ENDA 3LP8A 2P40A 1U8XX 5EMLA 3U17A 3FPHA 4XX1A 3W9BA 3B8EA 3EULA 2O0KA 4RWZA 3LPMA 4N12A 1VE5A 3KVOA 1GQRA 3ZI7A 5DCUA 5LPNA 1RYHA 2Q8NA 3DMYA 1SHLA 2EWVA 1GQQA 1T0UA 2YBDA 4HDSB 1RWWA 2A84A 4NRDA 4B8ZA 2JD2A 4LV8B 1GRRA 4MAMA 1VKOA 2AG8A 4LW8A 2AXPA 2ZIEA 5E7JA 4FMBB 4NAVA 3K9NA 1MQ8B 1P77A 2PSEA 1YD7A 2CXTA 2HT6A 5A7GA 5IT9A 1UZNA 3WNVA 1UDCA 2R11A 1G20B 4LXXA 1SRRA 2O05A 4N3AA 3OZXA 4XSGA 1CR6A 1E0JA 1JHQA 2DECA 2E4UA 3HB4X 1XZBA 3HBJA 4UEOA 1SUSA 3L7LA 5T57A 1A4RA 2L0XA 5IYZF 9MHTA 1AQLA 1MIOA 3MTDA 2K4MA 4W9RA 1P45A 1VHLA 5BN3B 2VF5X 4TS4A 1WV1A 1HNNA 2Q5JA 3I9V1 4TSFD 1AHIA 3ORYA 1CFZA 2G8LA 5G40A 4ECEA 1YJCA 1GAXA 1GADO 2IEDA 1H8ED 2HKIA 4OJQA 5JAQA 3RT9A 3QVLA 1T1JA 2JAOA 4DE5A 2X2EA 1YTLA 2FDXA 1RT9A 1QB8A 2J3HA 1NX9A 1FFHA 5J4HA 1CQWA 3RG2A 4EG1A 1QE3A 2IGTA 2QUAA 3MWFA 3SC6A 1I2DA 1EGHA 3ZR4B 4DV0B 1EK6A 4TL7A 1W0KD 3FRJA 4OUDA 3H6KA 1N2JA 4DJAA 4UBOA 4C03A 2WHEA 2EGGA 1MU0A 1CJKC 3KZXA 3OPVA 4WKBA 1LB1B 4EVSA 4FINA 4XQGA 5K4GA 5LQJA 4NXNB 1T8TA 4BP9A 2RARA 2PGLA 3H2SA 4XM1A 4KHPB 9LDTA 2J0QA 4NESA 1JSRA 2E1PA 3CKYA 5C8VA 4ND5A 2ZE7A 3TVDA 3PNBA 1F9AA 1ZK2A 1H0RA 3DKVA 2HA2A 4RGQA 3GY0A 1I6KA 4HGYA 3MGCA 1YE8A 4HZUA 1FTQA 4BO6A 5JZ9A 2ZJ5A 1O96A 1TZ2A 2X42A 3DXXA 4UZFA 4BXOB 1DCTA 3N5KA 3JQBA 4IVPA 4A7PA 1VTKA 1CR2A 1C30A 1W49A 1KDOA 5K20A 3E3LA 3ND5A 3BK2A 2GF0A 3EPHA 2R1VB 4XSVA 1A7KA 1WCWA 1EAMA 1MOQA 2CMFA 3H3JA 4G5RA 2IGBA 3RJMA 5F3RA 3DVSX 1Z0JA 2OORC 4NMLA 1IHYA 4C4XA 1M74A 4LHZA 4Y2XA 1FDVA 2AK3A 2XNJA 1J2TA 1CJMA 4QYXA 4RJTA 1JKMA 4Y9RA 4BKOA 4EHBA 5GTDA 2D8MA 1W46A 4QOHA 2YRFA 1JYSA 1U0EA 4XSHA 1GUYA 2QL7A 2QQGA 2JCGA 2B3DA 3QF7A 3DE1X 4GD3Q 3N58A 1SNYA 1GFWA 2C3PA 1M0SA 1HRKA 1NW6A 1SUDA 2C3MA 2JFUA 1N8NA 3GLHB 5D3ZA 1I6LA 1S2GA 1PZXA 1A7UA 1A9PA 1TMYA 2E4ZA 3CVJA 1XCLA 2PEZA 2REQA 4JROA 4OHZA 3RWOA 1UK9A 2C29D 5I8ZA 1NMQA 4PX3A 2EFGA 4Z9XA 3CMCO 2PR2A 3UJDA 4RENA 2BVNA 5JALA 3JATB 1M6EX 2NXWA 3PHBE 5ES3A 4BWVA 8MHTA 1XZMA 2IUFA 4IGFA 4QDXA 3WLRA 5AVZA 4IIJA 4RJLA 4TLLB 3ZS9A 4B6JA 2VXOA 4WPGA 2P4QA 5LZ7A 1E6KA 3FTCA 2HXGA 4K0KB 3UTCA 2UVQA 1R2QA 4EMBA 1C1HA 2WOOA 1WXWA 4PV7A 2BPOA 2OUKA 1ILEA 5CT8A 5LZ8A 3FF4A 4A8TA 3K6SA 4G56A 3UUGA 1RYDA 2ZB8A 3F96A 3IEUA 5AW0A 5JD4A 2RJOA 4FFWA 5A7FA 3U7GA 4LTDA 2X9QA 4R51A 1SAYA 4UDYX 1L4NA 4PGFA 4FYHA 1I4DD 3RC1A 1PF7E 2WF9A 1K27A 3H16A 4X1IA 4MLCA 2WTAA 3A31A 1EKXA 2NXEA 3HKEA 5LQUA 5IRCD 3WK8A 3L0BA 5EHZA 3EK2A 2R8PA 4AVYA 3WI7A 2Q3MA 1EX9A 4S1VA 4XARA 4JYZA 1L4YA 2JNWA 4CL3A 1U4NA 3CB2A 4W5HA 1PFQA 1ZLYA 5EEGA 3SYNA 1CF2O 2W2OA 1BJRE 3RG8A 4C88A 1OAOA 3ICWA 4I9NA 4PZAA 4PXSA 1XNQB 1FP4A 1YRWA 2ZYGA 3IMGA 4MUXA 4U9HS 3C3AA 1R74A 1OWMA 2FE4A 4RZUA 3IPLA 2OSBA 1LC0A 1Z6YA 3GN1A 3G2NA 4WOJA 4G25A 3HDVA 3L7IA 2RH5A 2C31A 3CHYA 4QODA 3MRVA 1KVRA 2YYSA 3TCKA 2ZTLA 4MQMA 2XT0A 4B47A 2PXAA 3JPYA 3ZD6A 3NKLA 4D3ZA 1VMDA 2X4GA 1USWA 4MWEA 2QYTA 5E1OA 3ACDA 3A4YA 2NU8B 4AS2A 1D09A 3ZWBA 4ZVOA 1Y8QA 3CN7A 4IMIB 5EINA 2HW8A 1ILWA 1PL6A 4DG9A 3OQJA 1XTUA 2W4QA 1Z88A 2EG9A 3G7UA 3JALA 4QBIA 1PZFA 4MB0A 4RYLA 4WCFB 3HFGA 2WI8A 3OP1A 1DTWB 3IE0A 2JEZA 5EE3A 4KXFB 3KCQA 1QDEA 3PGXA 4BQNA 5C8DA 3QG5A 1JAHA 4KW7A 4M0LA 4YC7A 4DSNA 4JR0A 2UUBB 3KXIA 3OBIA 5ESWA 3T7KA 2HDWA 3GFBA 5J2TB 2O59A 5E38A 3FJOA 1U7DA 4XFKA 1VIDA 2JFGA 2J5KA 3CCBA 3L02A 1ZW1A 4DMGA 4OMDA 3D2LA 3K0FA 2IV2X 2EERA 2OZKA 4B2PA 2WQ7A 1XDGA 4YCSA 5IVKA 2PGJA 1Y3CE 4ZV4A 1NU6A 5IKOA 1WLYA 4CG2A 4HH3C 2P79A 1P1RA 1CY8A 5IK2A 4QQKA 2QHXA 2V5UA 3I6MA 2QAGC 1YB5A 3B51X 3K32A 5C8ZA 5CFPA 1K75A 3IUQA 3O3OB 2EW8A 5B58T 1EFRD 3N2GA 4GZLA 4JOCA 4KG7A 5IXSA 4Z1MD 5B57C 2J7KA 3FCSB 3A6FA 2OYSA 2IZ6A 1V5IA 4KRGA 3W4KA 5C5EA 4U8GA 1IXRC 1WPGA 2C5EA 2ZGVA 4JAVC 3ZHXA 1K7SN 2W2XA 1GPDG 3BD9A 3KXDA 3OE7A 3VDQA 1H2AS 3W6ZA 1MJHA 2R2AA 4HLUC 1M8JA 2ASVA 3OZTA 2LXNA 5A4FS 3CUUA 5JS7A 1P9LA 2PZBA 3MQFA 3PWTA 4F6LA 3T7DA 1QK5A 5FI1B 5JAUA 2DBYA 4XDHA 5CMLA 4AWBA 1NUHA 2ILVA 5ELLA 5PGMA 4ALNA 4MVJI 3VJKA 2WWVD 3U4MA 1SBZA 4DCMA 4UAJA 1V7CA 4AJHA 2UV8A 1D9ZA 1FP4B 2J9GA 2Z2ZA 4TM7A 1KI6A 5F52A 1DGQA 4D98A 2HIHA 4CR6A 4EATA 4XRGA 3HO1A 1I0IA 4GX0A 4PLFA 3A9WA 3EXFA 3OU2A 2P6NA 3FTNA 3D3WA 4Y9DA 3RUAA 4DV6B 4MPTA 2WMNB 3E9NA 2OLKA 1DHRA 5IKMA 4GMFA 5CGZA 5DYYA 1N75A 1UKZA 1UQRA 2MDTA 4HNGA 3AFHA 4L73A 3RADC 2JHCA 3ET5A 4KSBA 4R81A 1IOLA 5HDQA 2IS4A 1UMBB 2WA1A 3SSNA 1A9TA 2YWFA 1ZX1A 4MK4A 5C5DA 3PDJA 1DINA 4RZ3A 5AW6A 3VHXA 3W5JA 2RCYA 3L8GA 1RI1A 1XDZA 3NJ8A 2VQSA 1DG9A 1TT5A 4PGAA 2BF7A 4NENB 2HGSA 4DHWA 3WNDA 3WBFA 5JRJA 1ODJA 4N8DA 1OAAA 5EXTA 4NECA 3I1YA 4DQVA 5C5IA 1P18A 1VJ1A 1Z6QA 1SR8A 2JFOA 4X44A 5DGCA 2PG3A 3OJOA 4GPZA 2HL6A 5CCXA 3QU2A 4UDXX 4X7MA 2OA0A 3FOFC 2WRZA 2NVBA 3EA0A 5JMTA 1O6GA 2JCSA 1B43A 2IRWA 1S2IA 2I4IA 2YNMD 1JU4A 3HDQA 4UNRA 3N8GA 4OHPA 1UK6A 2DZDA 5ARDA 3ZV6A 3E5NA 5E8JA 1O95A 3GGGA 4XDZA 2FW1A 1GGKA 4L0DA 3HVUA 4YTEA 1HDGO 3SPXA 1DVRA 5HJ5A 1Z8DA 1XVIA 3QBJA 2ZU6A 4I6JA 1PJQA 3HYLA 2R5FA 4LYEA 1DG3A 2ZRKA 4A6XA 4A8JA 3URMA 5HRUA 5IULC 2PLRA 1PD0A 3NUQA 3MT8A 4HNAB 5LCXA 3V7UA 4C5AA 4XWAA 1RZRD 3CLUC 1KI8A 5G1PA 3MT9A 4HDMB 1TCBA 1ZKDA 1XP8A 3EXIB 3I12A 1RWPA 4NF2A 5DASA 3VH3A 4B73A 5CG2A 4PEVA 4AYWA 1U2RA 1INLA 2HPAA 3L0IB 1EB9A 1WP9A 4K46A 2NPFA 4IJ5A 1JEDA 4U2DA 4B7AA 2WSSA 3QEAZ 1FFCA 5H3HA 3RVDA 4R2XA 1BA3A 2X15A 5FA5A 4B3MB 1RKBA 3PEEA 1JDVA 1X1CA 2JIZA 2QMHA 3LOPA 3ZDQA 4RFLA 1TKCA 3L7KA 1SKAA 1SXIA 3FR7A 2DCUA 2WB4A 2XAUA 3RLFA 1UQUA 3LY8A 4W7SA 1UK8A 3OLZA 3NHLA 3Q9NA 2NSHA 1CP2A 3G8AA 2JD1A 3DYBA 4QEZA 3NBZC 4DDHA 1V2HE 1DC6A 4DJJA 4CMIA 3HKCB 2ZRAA 2A2ZA 2D2VA 2ZIUB 1RXYA 3VPCA 1M8GA 3R0JA 5D6OA 4NU6A 4DAOA 3VR6H 5CDFA 2OMKA 3ZXXA 1C7ZA 1AVTA 3DDZX 5FLYA 4EHIA 2P69A 4B3TB 4Q3AA 3T7AA 3PA8A 1AXEA 2XKJE 3AFMA 3HA3A 4Y6QA 1U8EA 1W0JA 4KQFA 1D2MA 4CKXA 2R60A 2FEOA 4KK3A 1JHVA 1IK6A 5TVKA 1YCHA 2C3YA 3VVBA 1UC8A 3OZCA 5L4SA 1W48A 5DHPA 4MHOA 1KY3A 1OYVA 4E4YA 1M73E 3EG9B 3KELA 3VPAA 6Q21A 2M9MA 3ZE9A 2FG5A 1L7AA 4KSCA 4AMBA 5HHTA 2GD6A 3P4XA 3RD5A 1UJMA 3I42A 2PRIA 1CRPA 5LBUA 2WJIA 4KGZA 2GPYA 3GLKA 1BHO1 3HL4A 5ILQA 3TTWA 4O5AA 2O48X 1PP4A 1KJJA 4RPLA 3JYLA 2CDBA 5A4JA 2P1ZA 5KJ6A 4RTNA 5AI0A 1VLLA 1SUEA 2Z4TA 3A70A 4LZOA 4PLYA 4HZGA 2IITA 2BFEA 4IZIA 1EDBA 1KPIA 4HDOB 4TRMA 5EPEA 5G0WA 5K01A 5FBWB 2PLAA 4FWTA 1NONA 3I1FA 4WXYB 4QGHA 4YWHA 3W04A 2C4WA 2PO7A 4F5YA 4MWSA 5A5EA 4Y7CA 1G7RA 1HI9A 1RLJA 3DFMA 1KO4A 4S04A 5J5AA 4LQDA 3IVCA 5DGXA 1AV7A 4FFVA 4YGXB 2X0NA 2PBFA 5KNBA 3U0BA 2Q3EA 3ENQA 2FGJA 2AVNA 1P0PA 4FZ3A 4UARA 2O3QA 3WNZA 1JEYA 4NY1A 1EVYA 1VMKA 5DOVA 1JEQB 3NEYA 1ONOA 3DLPX 2A7XA 2Y92A 4RNDB 5LM3A 1LV8A 1TKBA 4OYRA 2YJ5A 4NG4A 3ZOZA 4RJJA 3QVWA 3VH2A 2ZJ1A 2WT9A 2XPCA 4XVRA 2HA0A 5CNJA 4PR3A 1WXHA 5D85A 1VI5A 4N5HX 2C2ZA 1GYRA 2ZBRA 3WKAA 1WIWA 3SKXA 1AKVA 1EVEA 3L7DA 1PUXA 3O3MB 3PGA1 1O87A 2R47A 3I0MA 4MUNA 4NOJA 4QDOA 3B1KA 5IU6A 4D0SA 5KNCD 3S1SA 1L5NA 1BXZA 1Y8ZA 1AN0A 2VTDA 3RSCA 5KVVA 1L9XA 2ZLBA 1I3CA 1TYCA 5TXGA 3GN2A 3OZ7A 3ROEA 2J87A 1HDCA 1X92A 2YINC 3LRPA 4O2AF 5DTMA 3ZLVA 1VP9A 2XNDA 1MNQA 2Q1TA 3O0TA 3SQWA 3E70C 5I48A 1K3UB 2C7BA 2WIJA 1BS1A 3CF6R 3JCZA 4FFDA 4CMKA 2WT8A 4DA8A 4E88A 1JV2B 1L7OA 3E4DA 4JLVA 2ZT6A 1ISPA 1AF7A 4FTWA 4RTMA 3H1TA 3HKDA 2G83A 4CMGA 5AUPB 2RD2A 2DPYA 2Z1MA 1XX6A 3PDCA 5A62A 5CXXA 4AN4A 1IPHA 1XJ5A 1H2YA 1WXDA 2LRHA 1GSIA 3OI7A 2HWUA 2W2PA 1G5TA 3HJRA 3OZWA 2QQEA 3WSVA 1FRZA 1N9GA 2OTCA 3PC4A 1U63A 1GQOA 5T41A 2O2EA 4HLCA 5B1SA 3L4SO 1V16A 2BFOA 1Y6FA 1YQ9A 1D3AA 1MO4A 4O4HA 5KX5B 3NXKA 1EK0A 5CAEB 2DE0X 4JSYA 5JZMA 4XWYA 2WAYA 3PFNA 4QXMA 2ZB2A 1EGQA 2CNKA 1NMYA 2K5UA 4JZKA 2VLIA 3D02A 3P19A 3TZ6A 5HK9A 1LRJA 4KUEA 4I6GA 1RWQA 4JODA 2P67A 2REBA 4NBTA 5KPDA 2AYYA 3FWPA 5B55A 5L4NA 3I6YA 3EFBA 1G5RA 3U81A 3AK4A 4KITB 4HI0E 5EMMA 5LNK1 3QX3A 3I1JA 4HAYA 5CURA 4MIOA 1TO6A 2ZR7A 4R1TA 1ZVQA 5LMZA 2OZLA 3E9ZA 1WJGA 5TMEA 3N9IA 4A8HA 1XNGA 2YIVX 2R5WA 4BFUA 5IH7A 2X5NA 1LTQA 1JECA 2ZBGA 4M36A 3A7DA 3EVDA 3AR4A 4F93B 1RAHA 3HYTA 3LCJA 1VLJA 4LOHA 3TRFA 5I9LA 1QZ3A 4DDWA 5JNWA 3KR1A 1UT8A 2H5EA 1NVEA 2GZAA 4EKEA 9GPBA 3KAPA 4BNUA 3RRYA 5CUQA 1A0OA 2CYAA 3TL3A 1UINA 5ALVA 3OU6A 1QGZA 2WUEA 3ELWA 3IBSA 4O4LB 1D5CA 3P52A 3DDNA 4WXHA 2WJZB 4MUJA 1UP7A 4KWEA 1FMCA 1QQTA 2A35A 4GR5A 1ZVKA 4CT0A 3PNMA 2UZAA 2H0RA 3BREA 4EJ0A 2NUPA 1UAYA 1HSOA 2FLKA 5GVRA 3D64A 4L2IA 2X41A 4DIOA 2W11A 4Z2AA 4MRNA 5IUNC 2H4XA 4G0QA 2OWEA 4YAGA 5ITVA 3SY8A 1CUZA 1OJ7A 1V9CA 3KYJB 4QE3A 3I1IA 2EJUA 1HPLA 5EGSA 1JR4A 2QPTA 5K09A 3WLMA 4CIWA 3TOXA 3R3UA 3GU3A 3E9QA 3NVAA 5ESDA 3PUWA 4ZO9A 1N9GB 3SKVA 5ECYA 2HHHB 2P2ZA 3LT5A 4G0OA 3QTTA 4BN0A 4KR6A 2NTJA 121PA 2TMKA 1J06A 2A9JA 2I4OA 1P2VA 4LKOA 2YV3A 3Q7PA 4MQ4A 3THXA 1Y1QA 4DLRA 3TGLA 1Y7HA 5LQRA 3PPYA 5HKKD 3K4PA 4GEKA 5HQ3A 5SZHB 3HKDB 1HBJA 1KK3A 1X87A 4PR0A 2QA5A 1GWNA 3WLOA 3B8HA 5A2GA 3E5RA 3A2KA 4G4JA 3DZDA 1J0EA 1WPQA 1E4VA 3GRRA 5JFTA 1A98A 2OQRA 3KALA 2ORYA 3VBCA 3PE3A 1TM2A 1NVTA 2WIKA 3H0CA 2CFCA 3ROXA 1NFFA 4LF6B 1SU4A 1OA0A 3M6MD 4JA0A 4WHMA 4Z7JA 4KWTA 2QTTA 1XWWA 3MRXA 3A9RA 3DVLA 4M8LA 1KFEB 4RESA 3CVYA 2GAFA