5EUMA

1.8 angstrom crystal structure of atp-binding component of fused lipid transporter subunits of abc superfamily from haemophilus influenzae.
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
255
structure length
250
Chain Sequence
KDDGAYKAEPAKGELEFKNVSFAYQGEELALNNISFSVPAGKTVALVGRSGSGKSTIANLVTRFYDIEQGEILLDGVNIQDYRLSNLRENCAVVSQQVHLFNDTIANNIAYAAQDKYSREEIIAAAKAAYALEFIEKLPQGFDTVIGENGASLSGGQRQRLAIARALLRNSPVLILDEATTESERAIQSALEELKKDRTVVVIAHRLSTIENADEILVIDHGEIRERGNHKTLLEQNGAYKQLHSMQFTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title 1.8 Angstrom Crystal Structure of ATP-binding Component of Fused Lipid Transporter Subunits of ABC superfamily from Haemophilus influenzae.
rcsb
source organism Haemophilus influenzae pittii
molecule tags Hydrolase
molecule keywords Lipid A export ATP-binding/permease protein MsbA
total genus 84
structure length 250
sequence length 255
chains with identical sequence B
ec nomenclature ec 3.6.3.-:
pdb deposition date 2015-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5eumA00
2DFNA 2ZE6A 2ECKA 1U2RA 4LX0A 5JRZA 2RGAA 3DL0A 2KWIA 2VP6A 4V0NA 2VL7A 3AH8A 4AKEA 2QGZA 1G8GA 1JPJA 2PH1A 2AWOA 2JLYA 2NGRA 2HCJB 5BYKA 4ZDWA 2O8DB 1KI6A 2O5VA 4ERNA 1QZXA 5D3QA 1P75A 3AV0B 3RABA 2IEYA 1CULC 2QPAA 1W49A 2I4IA 3RRNA 1NKSA 4OHVA 4YONB 1R5OA 4JIMA 3U6BA 1TTTA 5CYPA 2HT6A 3ONWA 4LC0A 3OEEA 3TNFA 5JCPA 2IT1A 3PITA 1KNXA 3BB4A 4AG5A 2GXSA 4CT5A 1MH1A 1KI7A 4B33A 3C15C 3SJCA 4BEBA 4F92B 3SN6A 4DCSA 3Q7PA 3OAAD 4C0SA 1XTSA 3U61B 1NL3A 4W9MC 1SGWA 3IPYA 1U9IA 5FH9A 2ZETA 4FCVA 2QMEA 1B23P 2RGBA 1GWNA 3CRRA 1E9EA 4P3YA 1XXHA 4UNNA 5GJCA 2IEZA 4QL3A 5BN5A 3GLGE 3KQKA 3GEHA 1XDBA 4NU0A 2WJGA 2Y8EA 3NVAA 3KFVA 4OBEA 2JIZA 1IAQA 4Q1FA 5L3QA 4AYXA 3PUVA 3OFND 3SEAA 2FU5C 2PZFA 4DT1A 5GJWC 4DB2A 1T0HB 3A58B 3RLFA 3EPKA 4PZYA 3QXSA 3EAQA 4PSKA 4OHXA 4A2PA 1EFTA 1UBFA 4IEIA 4ON9A 3VNUA 3EZ7A 1ZP6A 2OBLA 4M9SA 1HT1E 4UNPA 3JVVA 4D80A 1KK1A 2CMKA 3E1SA 4KO8A 1CR0A 1N0VC 5KDOA 1T3HA 1FZQA 3O8CA 4KI0A 4RFSA 3LQQA 3AF4A 4WIAA 5EUQB 2A3RA 2GVDC 1AN0A 1FTSA 3AF1A 2EWVA 1W4AA 1E2LA 2IYUA 4IHQA 4HZIA 1Q1ZA 3T06B 3MWYW 3KKQA 3THOA 3KQLA 2N1BA 1TADA 1Y3AA 4C9BA 2ZUCA 3PUXA 2QL6A 1DPFA 2VP2A 1JECA 2ZI9A 2WBLC 4S2EA 3L0SA 2YV5A 4JL8A 2IUSA 1G4UR 3MAAC 2JDIA 2NG1A 4LJ5A 2CLCX 4YDHB 5KUTA 1E1RA 1U98A 2I1VB 1E4VA 1GFIA 5DYIA 4DXAA 4LDJA 5TY0A 1IONA 1FP6A 3AKEA 5JEDA 3FHTA 5E7IA 4Q7KA 3X2SA 4KJZA 2RHMA 4NYIR 1P6XA 2Q3MA 1DELA 3RRZA 3HR7A 3GLFE 4HB2A 1AZSC 2WSMA 1P2VA 4EUNA 3LW8A 3NC1C 4X8OA 1GL7A 1NN3A 4OL0A 1JAHA 5DI3A 1F2TA 3PFIA 3QPUA 5JI2E 1KKMA 1VTKA 1CU1A 2QM7A 1YZUA 2CK3A 4DDVA 2CNWD 1ZUIA 4KYIB 4XWAA 2DBYA 4OHYA 1R2QA 1CRPA 1RRPA 5AWFC 2A5GA 521PA 2OCAA 3IQWA 1H65A 3AM1A 2WV9A 3H86A 3WBKA 4M1TA 2REOA 2IXFA 2BMJA 1TAGA 4AC9A 4XSGA 1R8QA 4Q00A 1CF4A 3GP8A 4HB0A 5TV2A 3WYGA 1XMJA 3Q8XB 3V4RA 1HUQA 2RGCA 4FMDF 3NC0C 1NMXA 4R7ZA 2PEYA 2ZYVX 4K46A 3MFYA 3NBYC 4ZO4A 3FYHA 2FFHA 2FNAA 3FFAA 4PHFA 1EFRD 4GI7A 1BOFA 1TUEA 3K1JA 2IK8A 1QRAA 2ZE8A 2OCBA 5KTYA 1N5IA 2ZRLA 2FSFA 3P4XA 4QFMA 3VU9A 2WHXA 1E4YA 4QBFA 3OEED 1RIFA 3VX3A 1NVXQ 2QNRA 4HUTA 2O8CB 4DDWA 3A37A 3TAHA 3NG1A 3R20A 4EQ6A 2DWOA 4DDTA 4DHEA 2PBRA 4Q5IA 5C2JB 5E4FA 1E9AA 1VG1A 2WPDA 3K0AA 4HZUB 2ONJA 3RS0A 3U44A 2QI9C 2KBEA 4HB3A 3TE6A 4IDPA 2PMKA 3QXCA 4Q47A 4QNMA 4A9AA 1XTJA 5KOYA 5CIWA 3RS4A 3X1DA 1VKJA 1FPMA 4PXAA 4LGMA 5FBRB 3ZD6A 1N6RA 3BS4A 1KK2A 2CLDX 3CW2A 3LLUA 3PCRB 2GF9A 1T8UA 2VHUA 2ZSFA 3I8XA 4ASUD 1MOZA 4B3XA 1OW3B 1ZCBA 4A8JC 2FFAA 1ZBDA 3GJ5A 2WWYA 1T5LA 2R6AA 2EYUA 4DB4A 3MWLA 1Z5ZA 3I92A 1S96A 3EWSA 2XZPA 1NN5A 2V8OA 3CWQA 2J0UB 3BRWD 4GP6A 2D2FA 3K0FB 4PPQA 4OHZA 4KAXA 1JPNA 3AGQA 3QXXA 1S8FA 4Q4HA 2FSHA 1OYYA 4TYQA 5KNCA 2F1JA 4JBWA 3CPJB 5CITA 3LW7A 1RJ9B 4KLZA 4IVRA 4XVQA 1G4AE 2HLDA 4Z8YA 5TDHA 3ZH9B 4E5UA 5EXXA 4CEHB 1WE2A 4OQLA 3THYA 2YWEA 3C8UA 3BGWA 2QP3A 2R6CA 2Z4SA 4D0GA 1T4GA 5SZJA 2FSIA 1E0JA 3B1YA 5AUOB 3SFZA 1LV7A 1S9HA 1XEWY 2C77A 3DO6A 4BRWA 1U90A 2GJ9A 4PAQA 3ICQB 2FE4A 1QHHA 4B75A 1OKKD 4B44A 2OILA 3CPEA 3DHWC 5CIQA 5D3MA 3WNBA 2D62A 4HUQB 3P4YA 2ORVA 2WZQA 4QJ5A 2DYKA 2BVNA 4Q21A 2Q3HA 2C78A 2ZRNA 4DLSA 4JSYA 1G7TA 3LA6A 1U9IC 2XB4A 3LNCA 3THWB 1AJEA 2QN6A 2HUPA 2G9NA 5GVSA 2XOKD 5B57C 4I4LA 4H1VA 2DPXA 2VSOA 3QEJA 2QAJA 3ZS8A 2PZGA 3U3KA 1R0WA 3T1QA 3F8TA 4LJ4A 3RS5A 3IHLA 3PEUA 3SNHA 1OSNA 2FMXA 1DTSA 1P2TA 1ZD9A 2DWPA 4DIEA 1OT3A 2ZS9A 3AVTA 3W34A 4P4UA 3FDIA 3K9NA 3FHOA 5HCIA 3BB3A 4GOXA 4M0LA 1P3JA 2BV3A 4AURA 1OF1A 4HAXA 4L8GA 1KO5A 2E9SA 1UDWA 5F3WB 4UJ3A 1G3MA 3LRPA 1RPZA 2W6ID 3CF2A 4WXPA 1IY0A 4B76A 3PEWA 3THXB 2UVQA 4F4CA 3HP1A 3LAWA 1Q44A 2H92A 1G1MA 5FOSA 1ZMXA 3RAPR 3JZMA 1Z22A 4HUQA 1BYUA 4B71A 4GZLA 3DMNA 3U3RA 3WP0A 4JLMA 1FFHA 1KO4A 4JJKA 4ZCLA 3W6OA 2O52A 1YU9A 2YC4C 4RFSB 1CP2A 4A36A 4D81A 1MO6A 2QPOA 1MRSA 2OHFA 3BB1A 4D4KA 2QG6A 3QF7A 3B6EA 4ZI3A 4JLBA 4KSCA 2RAPA 2QBYB 4DCTA 2WOOA 3VAAA 2OFOA 1D9ZA 1FNNA 2DCUA 3NEYA 4WW0A 3WYAA 4BWYA 1EFRA 1ESMA 3FMFA 4X8LA 5FOXA 4EKDA 3UWOA 4HDQB 1HQCA 1T3LA 4QHTA 4Q4HB 2UZIR 1RKBA 1NN0A 2FPMA 4FMCB 3ZYCA 5IK2D 1K5GA 1XB2A 3X1ZA 2ZI5A 4NH0A 2KSQA 4DLWA 2VHTA 4MYCA 4E22A 3KZ1E 4HYYA 1XZPA 2KB0A 1XD2B 4F7WA 2LCFA 1OV4A 2VLIA 4D82A 1CEEA 3QKSA 3LWNA 4KCGA 5CB6A 1JALA 3NXSA 5DNYB 3AP2A 2Z83A 4L9SA 4O2LA 1E9FA 4GT1A 1T91A 2X19A 4B73A 5B64A 5J5CA 1SVWA 1YZNA 4JLDA 5CLQA 1W36D 1YKSA 2IYWA 4BPBA 3QPWA 1DAFA 3M1IA 3IDQA 1NN1A 3U4QB 2XZLA 2ZM5A 1UFQA 4DLXA 2WVJA 1N6IA 4XSHA 1KDRA 5FL7A 2GJSA 5JZVA 3ZDQA 1WB9A 3D7MA 3QPVA 5KSYA 2HXSA 3OEHD 1XNJA 3I61A 3TVDA 3U44B 1KO8A 1XMSA 2IS2A 2CHGA 1FX0A 1LF0A 1TF5A 4ABYA 1G6OA 4POAA 1XFAA 3RRMA 4B3CA 3VNVA 4N3NA 2OLJA 5C4MA 1JQLB 1ZRHA 2MSCB 3WRYC 2BJVA 3VR3A 2A78A 4KODA 4WZ6A 1L2TA 4CEIA 1ZCAA 4JBXA 4I1UA 1SXJB 3TW4A 3QF4B 1Q57A 1NMYA 1KAOA 5G40A 4C3ZA 4OK5A 1S1MA 1E79D 2G1KA 3GJ4A 1R0ZA 3QJYA 2ZS8A 1JI0A 4IDQA 1S3GA 2GTPA 4KFRA 5FBQB 3T61A 1OHHA 5L3SA 2K5UA 2ZXUA 3PUYA 5K8UA 4BASA 3KJEA 2BIFA 4I1SA 2HLDD 5C4GB 1LB1B 1P72A 3GLIA 2KBFA 1W48A 2PT7A 1P9RA 2BBOA 4R71A 2PCJA 5JHGB 4E09A 4JYBA 5KU1A 2O8EA 2A30A 1U8ZA 1D6JA 4LV5B 3DKPA 4TZ0A 4V0LA 4HEJA 3A4LA 3I5YA 2DFKB 4BFWA 1YR6A 2WJYA 4L16A 2PX0A 4DLUA 1KNQA 1VCOA 3LBNA 1NJFA 3B82A 2P0EA 2ZE7A 1X6VA 2O0KA 3GFTA 4QBGB 4IOMA 5HZKA 1VHLA 2ZSEA 4JMPA 5FOWA 2ANBA 4PHGA 2Q9BA 2V9PA 3PR1A 2XGJA 4Q4AB 2ASEA 2QP4A 2B21A 1FP7A 5DH9A 4ZDJA 5LB4A 2EYQA 2ZRKA 1VPLA 3SJBA 1HE1C 1JJ7A 3HYRA 1BIFA 2FGKA 3DVLA 1II8B 1Q12A 4ZDIA 1U94A 1JR3E 5DI3B 4QKQA 2VSFA 4BECA 3IKJA 1OB2A 2G77B 1YR7A 3B7GA 2QMHA 1HYQA 3K8YA 5GJVC 4ESVA 2O8EB 1WCV1 1OFHA 2BBWA 1DEKA 1NBME 2KE5A 3AVUA 4RZ3A 1JR3A 3WNCA 1ZU4A 1GNPA 4MKGA 2ZANA 5JS7A 1ZM3A 4Q7MB 1OXVA 3QUSA 3CNOA 1G64A 3A1SA 1YHNA 3ADKA 3E2IA 3ZGXA 3LBIA 2Z0MA 4WA7A 5FR2A 1W36B 1US8A 2GXAA 5CDFA 4TL6A 3GJ7A 5JSZB 2ERYA 1E2HA 1N0UA 4TT3A 3A6PC 3WY9A 4RKEA 1F48A 1UM8A 3WMEA 4UJ5A 4TL8A 3WRXC 1W47A 4GDFA 4P32A 4Q1CA 2ZTSA 4C7OB 4TSFA 3HR8A 1SXJA 4ZV4A 1QDEA 1Z29A 4DDUA 2W0MA 4TT3D 3REFA 2GK7A 4IDOA 4N0DA 4S35A 4CEJA 2ERXA 1KI4A 2I3BA 1P9NA 3H0KA 2BJWA 2XNSA 3BH0A 1A5TA 1KIMA 1OH8A 4DZZA 5TVKA 4B47A 4LC1A 5BN3A 1Z08A 2OUKA 3SU8A 2F3TA 1S0UA 1VYVA 3MD0A 3CNNA 3PIRA 2WWFA 2CJWB 2AXPA 4DCUA 5AR1A 4C0LA 1CR2A 4M2LA 2RGGA 1JBKA 1G41A 2UKDA 3KUCA 4TTQA 4R2HA 2C5LA 3QBTA 2BMDA 3W6PA 4WZBE 1VG8A 3AVOA 3N70A 4NKRA 4TTPA 5FTKA 3A4MA 2XTMA 1W0JA 1XF9A 2NO9A 3CLVA 3DZDA 1HH4A 3L0OA 1XXHB 3SOPA 3K70C 1XMVA 1BO6A 1W4RA 1I2DA 3GCGA 2YWFA 4RCZA 1LFDB 4FCTA 1X8JA 4ZDKA 1GUAA 4ACAA 5K8IA 2XZOA 3CH4B 3GLGB 3AKYA 4RD3A 1N5LA 2RCNA 5DHFA 5HCNA 5C1BA 4NYMR 4EJSB 1OIVA 2ATVA 2O8BB 2R6GA 2C95A 2QBYA 2G6BA 1GIAA 2QMUA 2ZSAA 4FIDA 4LV8B 4PPGA 2G0TA 3M0EA 2O0JA 1AS0A 2IX3A 1AK2A 2VPPA 4Z1MD 5SZHB 2VO1A 2G88A 4HAYA 4HDCA 3EASA 1ELOA 5FPTA 3SDZA 4PO1A 2ODNA 2OV2A 4D0LB 2GRJA 1Z0KA 4DCVA 1HQYE 1NP6A 3C16C 2GEDA 1CJUC 4CIDA 1P9WA 2QQEA 2GEUA 2P5SA 1MT0A 4II7A 1PV4A 2CL0X 4TL7A 4QHSA 1XTRA 2J5XA 1NVVQ 2F6RA 5JJLA 3RWMB 4Z1MA 3CB4A 3B1WA 1OKKA 3QE0A 3OHMA 3SQXA 4F93B 4NYJQ 1KMHB 3UWKA 1IQPA 1DAHA 1TQDA 2BKUA 5AJWA 4QBHA 5E7MA 2Z5FA 4TMTA 3QNUA 1RFLA 2WSSD 2WKPA 2XNDA 4M1MA 5KDLA 1JR6A 3GLHA 2QROA 4Q1DA 3V00A 3BBPA 1XRJA 2IXEA 2NPIA 2QQ0A 5JCZA 2FSGA 2NO7A 5G3YA 3MLEA 1M8PA 4OJKA 5SZIA 1KHTA 4BZPA 4ZIRA 1SXJC 221PA 4A2QA 4M1WA 3TRFA 4TLDA 4HATA 3KQUA 3TUIC 2FPLA 2WSSA 1Z0FA 1UDXA 2IHYA 2AX4A 4JLAA 5FOTA 3FKSD 2JLWA 2W2TA 1VYTA 3CONA 3VKGA 2FOLA 3LY5A 1KO7A 4A2WA 1CJKC 5EE0A 2C04A 3QVVA 1VCMA 1VCNA 5CK4A 2P67A 4LRWA 1VG9B 4I1OA 3ZQJA 2ATXA 2AK3A 3NHAA 2CL6X 4GMXA 3BOSA 1SHKA 4C4PA 4DLTA 4O3MA 2GILA 4G5GA 5L3VA 3DDCA 1S9DA 1DARA 2ODBA 4Q19A 3D6TB 3L0IB 2F9MA 1JR3D 2X2EA 4URWR 1SQ5A 3THYB 4QGGA 1YQTA 4OI1A 3K9HA 4G5QA 3D8BA 3MCAA 2CVFA 4QXAA 3ZJYA 1HT2E 5HZHA 4M9QA 2YWGA 1RJ9A 2NTYC 3M4YA 1IN8A 1Q1QA 2V7QA 2HXYA 2ZRIA 3KJIA 4TZ6A 1K8RA 2WJJA 2IXGA 1XD8A 3BIFA 3FFBA 1YZKA 2N46A 3LD9A 2D7DA 3A1TA 1E9DA 1C4OA 2H57A 2VP4A 1FOEB 5FTNA 1Y63A 1W5SA 1UKVY 3LVQE 1TQ2A 2XX3A 2ZIAA 1GNRA 3BE4A 4ILEA 421PA 4BLSA 4AKIA 1NIJA 1W0JD 4LBYA 1IJEA 4TQAA 1YR9A 4B6FA 2EFEB 3ECCA 2GZDA 4B48A 3BXZA 2ZRBA 3AKCA 2RH5A 3Q3JB 3ETLA 2JLXA 1MRNA 4GMDA 4JVNA 4GSYA 4RKFA 1DBSA 1XTIA 1Z3IX 1VYUA 2ANCA 3IBGA 5CLLA 2GBLC 3BH6A 4OK3A 3VFDA 2CXXA 2ZI3A 4TWZA 4NCIA 4YMVA 3K0AB 2GKSA 1E2QA 1YVDA 121PA 1EX7A 1M7GA 2OO7A 3GJ3A 1II9A 1E2FA 2RB4A 3K09A 1XPRA 4NBSA 1XX6A 4WAUA 1G3QA 1J7KA 2ZJZA 3QENA 2PCLA 3R9WA 1TF2A 4NYMQ 4B3GA 4Q02A 4M4SA 5HE8A 1SVOA 4BLOA 2FZ4A 1DO2A 1N25A 2H18A 1FMLA 4B3FX 1Z83A 1QHXA 2QE7D 2QTHA 3GJ8A 4KBFA 4F4IA 3W9YA 1IN6A 2AFHE 2ZU6A 5AUPB 2XJ4A 2GAOA 4B3BA 1CR1A 4YDSA 3LXXA 4G3XA 2QT1A 2BKEA 2C2HA 2FF7A 2IW3A 3UKDA 3Q5EA 3VHLB 1OXSC 2WJVA 2SHKA 1DAIA 2GVZC 4TQ9A 1VECA 1LS6A 3PXGA 4IXMA 3RANA 1AA9A 4JLJA 1XCMA 4HSEA 1SVLA 4KLNA 4TMXA 2WWIA 5TMPA 1BH2A 1WF3A 1U8AA 5FR1A 4JKYA 4JKIA 3GLIE 5JJIA 4P31A 5IDVA 2R6DA 3P20A 3ADDA 2E87A 5K8LA 2GCNA 1XP8A 3KB2A 4JJZA 4BFXA 4TLEA 3QQ5A 4MYHA 4Q1AA 3NIBA 2IS4A 4TLBA 5DO9A 1D5CA 2EVWX 1IXSB 3IO5A 3GQBA 1OPXA 2C9CA 2ZRAA 1YZGA 3FMOB 4LJ8A 1F6BA 1HA3A 3IIJA 1I2MA 2C9YA 3LFUA 2R44A 2J7PA 3K09C 1ZNWA 2A2ZA 3FE2A 5JBQA 5KSOA 1DADA 3QG1A 5CK5A 3VHXA 1FTNA 2XNDD 1E98A 4PTLA 1N6OA 1NBMA 1U8YA 1W2HA 4JVLA 3TBKA 3TMKA 2B8WA 2GJAA 4XWKA 1U0JA 2FWRA 1VIYA 2A5FA 2JDID 3X1YA 3OESA 3AVXA 1OXXK 5JWOA 2IYVA 2IYZA 5FBLB 2PLRA 1WA5A 4OK6A 2OLKA 6Q21A 5JMTA 1AGRA 2OM2A 3WXMA 4PO9A 2BM1A 2IHBA 5C18A 3SC3A 3DKVA 2FX3A 1IY2A 3A1WA 1XBTA 3HU1A 1G3IA 3U3MA 1D2MA 1KKLA 4ZKDA 2MSEB 2GETA 1W4BA 4PHTA 1D2NA 5KSZA 1YJ5A 1DAGA 1UBCA 1YRAA 1IOZA 3TK1A 2ZROA 1H8HD 2PX3A 4KVGA 4HDOB 5E7JA 2H17A 1KK0A 4RD6A 3B60A 4LWZA 3I62A 3CH5A 4AD8A 5LD2B 1JAIA 1Z07A 4DKXA 3TKLA 3G0HA 2IWRA 3FWYA 2J0QA 3HU2A 1R8SA 1NVVR 5EUMA 2QGNA 5H1YA 5DE3A 3K9GA 5E95A 1CJTC 5IT5A 4M1SA 4OJQA 3I1FA 3O47A 4IEEA 2BEKA 2V7QD 3WYFA 5EZ5A 3PEYA 1NJGA 3ZVRA 4AKGA 3I73A 3BFXA 2J45A 1OH7A 4M8NE 4M22A 3LLMA 4LUCA 5FBVB 4RZUA 3W8RA 2JCSA 3TGPA 2JATA 2ZRGA 4M21A 4QM7A 5LB2A 5J4LA 1HTWA 3K9LA 2DY1A 1GTVA 2JLSA 3AUYA 5KNBA 1S2MA 2PLFA 3PENA 2DR3A 3MUFA 3ZVNA 1ESNA 3ZVMA 2FGJA 2J0UA 4RD1A 5EQTA 2F55A 2QMOA 3KTAB 4A6XA 2QE7A 4D4JA 3IPXA 1R0XA 1KSJA 3IGFA 5GJBA 4TMVA 1KOFA 1WBDA 4BGDA 5KYKA 4PZZA 4A8JB 2WMNB 4LJYA 4IOKA 4QOSA 4MGIR 2R6FA 5GVRA 1X8KA 1XPOA 1MO5A 2VBCA 3IQXA 4QBIA 2N42A 5K8TA 1DAEA 3TQCA 1ZM7A 2H1LA 4BLRA 3GJXC 4NMMA 1P73A 3LO5A 2WPDD 1IHUA 3CM0A 1UKZA 1G5RA 1EWRA 2C9OA 2D74A 3KXIA 3N2EA 1FQKA 1LF5A 2PJRA 3V4FA 3B1VA 1S3SA 1G8HA 1E96A 1EFCA 4LYJA 3CX7A 1E9BA 5EZ6B 3UANA 1EWQA 1R4AA 1GL9B 1AQUA 1OIWA 4XTRA 4GOJA 4NPHA 3R7WB 2OBMA 4EPTA 4FWTA 2ZRHA 3WMGA 2WIBA 2ZAOA 4ASUA 1N6HA 1KMHA 4BLTA 3NH6A 1ZW6A 4G01B 2FH5B 1T8TA 3HPRA 4Q18A 4AWXA 1J8MF 4C0JA 4L4UA 4RCYA 2HYIC 4FCWA 3VKWA 2O8DA 1PUIA 2JJ2A 1Q1EA 4P4TA 1SULA 4JS0A 1XJ0A 2GNOA 1N6NA 1E2JA 3GJ6A 2ZJYA 5HKKD 2J46A 4QNRA 2UZ3A 2ZRDA 1TX4B 3TSOA 4R2IA 1N6PA 1G7CA 1OFTA 2CHQA 4JLKA 1X3SA 2BWJA 1NLFA 1NG1A 4LBZA 1OXTA 1XJCA 2LKCA 3ZIAD 2ZJ2A 1ZNXA 4GP7A 4IW3B 4XD7D 2YINC 1IN5A 4PC3A 3GPLA 2EFDB 1G3RA 3ICEA 3QXHA 1H8HA 2X77A 4V0MA 3ADCA 1G17A 4KSBA 1CBUA 1LY1A 4G5OA 4LSGA 3CZPA 4JLNA 4N1AA 4B6EA 4MRVA 2GHIA 5FBWB 5GADl 2W83A 4IDNA 3FVQA 2JLUA 4KXFB 2HJVA 4GZMA 3CUEF 5BWMA 4CVNA 1JNYA 4LJ9A 4W5HA 4UXJA 3VR6A 4RVCA 1UADA 2FPKA 3IEVA 3C7KA 4A92A 2ZAMA 5KHOC 3EW9A 2HCBA 4JL5A 3C41J 2WJIA 2OXCA 3RS2A 1HV8A 2JJ8A 1E6CA 3IILA 3ZVLA 2JLVA 5CM8B 3K70D 3SYKA 1KI8A 1E69A 1EFHA 2IL1A 2C98A 3LH5A 4DLYA 3ASZA 2PEZA 4BE7B 2NMVA 3W3AA 3EC2A 3W5JA 3RC8A 1EXMA 3A4NA 4KFUA 3FKQA 4MRNA 3RS7A 8OHMA 2FJUA 4OKSA 5FTLA 4DLRA 4PSAA 1T5IA 4DSNA 1L4UA 5AUQA 3EPJA 2GCOA 4HLQB 1JB1A 2NQ2C 1Z0DA 4HLUA 1T6NA 1XPUA 1G20E 4HLDA 4EPWA 4RY2A 2ZJ5A 4V03A 4I1VA 1FMJA 4ARZB 2YOFA 1US8B 4LV6A 1NY5A 1NVUQ 2PZEA 1T0JB 3KDSE 2AWNA 2ZU0C 4Q66C 3W5IA 3B1ZA 4JLOA 4MA4A 4GFDA 1SVIA 1TU4A 4JT2A 4EAQA 1T9HA 2VHJA 1SKQA 4TLAA 2VP9A 1UJ2A 2IF2A 1KY2A 2ZSDA 3MMPA 1Z63A 2P6UA 1SKYB 2QSYA 5FPHA 4QJ3A 1DO0A 1PLJA 2IC5A 2ZRPA 3QY0A 1MABB 3MWJA 2B8TA 5KNDA 4B2LA 2Z43A 3OE7D 4DT1B 3LV8A 1ZM4A 4Q1EA 4BRUA 2C96A 4O0MA 2OE2A 1EG7A 1ZINA 3E5HA 3S1AB 4TYNA 4PPFA 4A0HA 4JVSB 2R2AA 4IKEA 1W0KA 4G1UC 5FPKA 1E9RA 1NLZA 2WM9B 3GLHE 2V54A 3NBFA 4Q4AA 4A82A 2JA1A 3REGA 2V1UA 2ZREA 3OAAA 5EJEA 3VR1A 1E3MA 2MMCA 3U3JA 3HJNA 5AJZA 2R8RA 5G3ZA 2EQBA 4V0ME 2W00A 2CL7X 2IUUA 2J41A 5AJYA 3AP3A 1E2NA 2GDJA 1ZC4A 1Q20A 1QG4A 4IFEA 4QJ4A 5JRJA 1HY3A 1I4LD 3GD7A 3TJZA 2CE2X 1K6MA 4JSTA 4FI3C 3OF5A 4KV9A 2JASA 5EE9A 1P2SA 1DAKA 1G6HA 4A6PA 3T1OA 1AM4D 3GLIB 4URZR 3R8CA 4PFSA 3SR0A 2JJ2D 3CR8A 3JZAA 1QF9A 5DISB 2C03A 5L3SB 3GJ0A 2DB3A 2XTZA 3BFKA 4RSGA 2R65A 3ND9A 5EE3A 2BBTA 3ND8A 5FI0B 3EG5A 4RJLA 1W2GA 4P4SA 5HKKA 3KJGA 4NTZA 3LXRA 1XEXA 3W90A 1XEXB 5ANRB 2QT0A 1IXRC 2B6HA 1KI6B 2JLQA 3RSOA 3QOFA 4QG7A 4M53A 1M74A 1KDPA 3R7WA 2OCYC 4C2UA 1N6LA 4PQYA 5B2ZA 1WRBA 2A7QA 2V6JA 1M2OB 2RKOA 3DM9B 4UXIA 4ZCIA 4KU4A 1PZNA 2XXAA 3DMDA 2J9RA 5DYGA 3BFVA 3H2YA 1P7CA 3KKNA 1CIPA 4FD2A 1RVDA 1KI9A 4JBYA 1P5ZB 3EPLA 4B35A 1P2UA 2QPTA 1DAMA 4DJTA 4RD2A 4U5XA 4IOLA 1DG1G 4J0QA 2O8BA 1N0WA 5FOUA 4B74A 2OFXA 4TLCA 3BAFA 2C99A 1OXUA 1GAJA 4IDHA 2AN9A 1RRGA 1KO1A 4LPSA 5A4JA 3QKSB 4KHZA 5J4HA 4UNRA 1A2BA 3B8HA 4KBGA 3ZQ6A 1XJQA 5BW8A 5JWRA 2PJZA 1PUJA 2ODWA 3BK7A 5CB8A 1AQYA 2V4ZA 1A4RA 1OLOA 2V6IA 3QXJA 1G5PA 4GBMA 1QHIA 3U60B 3D31A 5JFGA 2RGNA 4R98A 1T3SA 3FMIA 5FTJA 1W46A 4TYPA 2QP9X 2W58A 2XOKA 3PEVA 2DHRA 1GRRA 1E1QD 2G3YA 5BQ5A 2D2EA 4NYIQ 1J2JA 4Q9JA 4C2TA 1MABA 3EZ9A 4UNSA 2VP0A 1WP9A 3VX4A 2D7CA 4Q9HA 2B92A 2IYSA 1QVRA 2HF9A 2PMDA 4LHVA 3QEOA 2WKRA 1GG2A 2BCGY 1JXOA 2ONKA 3OE7A 4IXNA 3DEFA 4I81A 1OE0A 5B58C 2REXB 4NZYA 3RNLA 5KPDA 4CEJB 5J47A 2B7CA 4QC2A 4LCBA 2ZR0A 5KO2A 4BFUA 1YE8A 2GA8A 3W8NA 3FMPB 3Q9LA 3NDBB 1HE8B 2V3CC 5IK2A 2ZYUX 3HYTA 4FMBB 4RFVA 3K70B 1NI3A 1W7AA 2VEDA 2CDNA 2EU8A 4GL2A 1SXJE 2F9LA 4ITRC 4PX9A 1KDOA 2OAP1 4Q4JB 1LNZA 3UIEA 1GRQA 1G8PA 3WHLA 1ZJ6A 5JI3E 4UXHA 3LX5A 1AKEA 1JEEA 2AL7A 3UMRA 1E0AA 1G5TA 4IVPA 3VR5A 4LJ7A 3VMFA 1L8QA 1Z0JA 1Q1BA 1DS6A 4Q4JA 1KAGA 2YOHA 4UNQA 2FV8A 3CKLA 1LS1A 2RMKA 4P33A 1CJMA 2QA5A 2H16A 3B85A 2YC2C 4NCJA 5CYOA 3IO3A 2VQSA 1II8A 4NDZA 2AXNA 4QGHA 3UMFA 4Y0AA 1VHTA 2YVUA 3X1WA 5M04A 1I4TD 1QHHB 4DCNA 4FW9A 3ASYA 4XOIA 1BKDR 4PPNA 1V43A 3RHFA 1IN7A 1V5WA 1NSTA 2ZYWX 1WQ1R 2MSDB 2FA9A 2QUZA 2GF0A 4FMDB 1Z6GA 4IJMA 1RYFA 3AB3A 2RGDA 2EFGA 3VR2A 3AEZA 4UQOA 4MKHA 4MDEA 4A1FA 2WIAA 4D0NA 5H70A 1SVMA 3EIHA 2F1RA 2VF7A 4XD7A 4YMWA 3VTKA 4F91B 2L0XA 2LWIA 4OQNA 1E2EA 4V0KA 621PA 2C8VA 3UATA 4AIIA 2ZR7A 3CRMA 1U0LA 4FWIB 4XWOA 1N6KA 1AIPA 3AVWA 5KPJA 2ZPTX 1CLUA 4EPRA 2NIPA 3CX8A 4ESHA 1ONBA 5AUNB 2NZ8A 1G8FA 3FGNA 3O8BA 1XTKA 4V0OA 3NDPA 2VF8A 1TEXA 3TIFA 2AFIE 2O8FB 1E9CA 3A1UA 3OIYA 2W2XA 4EFMA 2Q9CA 3QF4A 4CRWB 4PANA 3AVQA 2GBLA 5JEEA 4CEIB 1ZC3A 1ZNZA 1PLLA 5CJ2A 2VTKA 4L9WA 1G21E 2P65A 3QKTA 4DRZA 3F0TA 4LOAA 2KJQA 2EW1A 1ETUA 1FX0B 4A0RA 4MYTA 3U7EB 2XXAB 4E03A 2WWGA 4MRPA 1QHNA 4L5BA 3NTUA 2ZUBA 1MO3A 2ZS7A 4TL9A 3H4MA 1RRFA 2OEPA 2Q0HA 5FUXA 3FOZA 2YWHA 1E2GA 4C0AC 1XCPA 3U4QA 1FW6A 4PZLA 3UG7A 2QEQA 5F9FA 3AF0A 3ZS9A 5JWHA 3J81k 2YKGA 1COWD 4YMSA 2H8KA 4Q03A 1WMSA 1TU3A 4U7DA 4RD4A 2WKQA 4GOKA 2GJKA 1XD2A 1XEWX 3SFVA 3M6AA 5BN4A 4FXPA 2WJHA 3G82C 3PUWA 1COWA 2ZJOA 3F5FA 3T1VA 1JJVA 2VHQA 2WICA 3B13B 4TMZA 4US0R 4WZAE 3TW8B 4DBLC 2CEAA 1R7RA 2ZRFA 3B5JA 3BH7A 4V02A 4TYYA 4NONA 2Q21A 1Z6AA 1GP2A 2ZI7A 3KQHA 2CBZA 4OQXA 2NO0A 3SYNA 5J4VA 1UKYA 1Z06A 1TUIA 3GMTA 3MJRA 4C0QC 4C0HA 2P2LA 4NP6A 2Z4RA 2J0VA 2XITA 3MGCA 4HAVA 2ZEJA 4MH0R 3R9XA 3U7FB 3FPAA 2E1RA 3GFPA 3T12A 1NIPA 4ACBA 1H8EA 1IJFA 3KB1A 1F2TB 2FG5A 1U0HC 3B9PA 1K5DA 2Z6VA 5EP2A 2CE7A 2JLRA 4A15A 1G16A 1VIAA 3K0CC 2I1QA 1GRNA 1QBKC 1UPTA 5A5GA 4IOJA 4US2R 4Q9IA 2A9KA 3T35A 3UPUA 1D2EA 4RD0A 3I32A 2HJGA 4IFBA 2ZRCA 4D4MA 2EWWA 2P5TB 5E3HA 1U99A 3OIWA 2RHDA 4D2IA 1C9KA 2A5DA 1ZYUA 1UBEA 4M1KA 5HR5A 3GLHB 4NHOA 1VG0B 3FB4A 1Q3HA 4KVAA 3ZZUA 2HYDA 2LKDA 1UAAA 3LBHA 2CHVA 4G0NA 4U00A 1TL7C 1KI2A 1CS4C 1O87A 5FL7D 1IM2A 1KMQA 1NRJB 1ZAKA 3GEIA 4RZXA 4A0FA 2GCOB 1ZUHA 1Z2CA 2Q6TA 3W6NA 4AYWA 5EE5B 4B2PA 3L8YA 4HI0E 4ZKEA 5J4KA 4U02A 1Z47A 2G83A 2D4HA 3MSXA 3IBYA 2VHCA 4EFLA 1F5NA 2ZJBA 2QZ4A 2H7VA 3KXLA 4LI0A 4LBWA 3SQWA 1UEJA 3IIKA 1M34E 1JEDA 5DN6D 1E79A 1Z6XA 3RSLA 4AK9A 4B43A 4Z51A 3A8TA 1CKEA 3IEUA 3K53A 1X1RA 4LJ6A 4PR0A 4BLPA 3C4JA 4WOPA 2GK6A 2J0SA 3CBQA 2OZEA 1DE0A 1XU4A 1OHHD 1GL6A 4BUJA 3KXKA 1LW7A 4HAZA 1BMFD 3SJZA 5JECA 5L3QB 5KSPA 1FUKA 2BMFA 4YLGA 2HDNB 5KDDA 4DSUA 1QHYA 3UG6A 4QGFA 3SS8A 3EXAA 2RGXA 4CDGA 4TN1A 1IN4A 2AK2A 2AD1A 3QKRB 1KYIA 2CK3D 4JVMA 2VIIA 1NVWQ 4PAOA 2HT1A 4OI0A 5FOVA 1VMAA 1KI3A 1JQJC 1UEIA 4HLCA 2VH5R 4CGZA 5FI1B 3EPHA 2CCKA 2A5YB 4Q7JB 2ZVQX 2RGNC 1ZU5A 2CJWA 3PVSA 2ZE5A 5EXPA 4BFZA 4A0GA 1GKYA 4LYFA 4LY6A 5BXQC 3GFOA 1CRQA 4X8HA 4TMKA 3NEJA 2W6IA 1R10A 4HZUA 4BZQA 1GZSA 1LTQA 3QG5A 3QSYA 3WHKA 1UKEA 3K0CA 4YMUA 3WNDA 2F1IA 1NSFA 4C30A 2BM0A 4EQ6B 3IIMA 5TARA 3NBZC 1NF3A 4TTRA 3NKVA 4A4DA 1RYHA 1TQ4A 2IWHA 1P61B 3H1TA 4Q4LA 5JHHB 3OIUA 4BEJA 4EIWA 1Q0UA 4MKFA 3EZ2A 2HEIA 3CZQA 3I72A 3RRYA 3I5XA 4C7OA 3BERA 4P4SB 4QGAA 4FN5A 3PJRA 1RE0A 2FDCA 3L8ZA 3SE0A 3Q85A 3IUYA 5ELXA 4AY2A 1OB5A 1X8LA 3HDTA 3C5HA 3W3ZB 4HAWA 3BJIC 4OI4A 5FPYA 2GESA 3CO5A 3HU3A 3TH5A 1R5NA 1HURA 3AUXA 3PG5A 2W2VA 1RC8A 5HE9A 2OESA 3O8RA 2JJ1A 2YOGA 5IF9A 3MRSA 4EPXA 2BOVA 3H84A 1SVSA 4LHZA 2OXRA 1BYIA 2IYQA 5F2EA 2NO6A 3U6KA 1GM5A 3ZZTA 2JAQA 3HPQA 4PAMA 4TMWA 2ZVPX 4OI2A 2GXQA 1R0YA 5P21A 2VA8A 4MKIA 1I4DD 1N5JA 3B78A 1M7HA 3AKDA 1WXQA 1SHZA 4JZKA 3NBXX 2DFTA 4A8JA 3OIVA 1J99A 4O25A 3AQ4A 2IF0A 5JS8A 1NG9A 1TEVA 2CLSA 3P1JA 2ZYTX 4MYUA 2FN4A 5CM9C 3KTAA 3B1XA 3KUDA 3PQCA 3GLFA 2AHOA 4P0TA 2O0HA 1GOTA 4YMTA 2YZ2A 3OEHA 5A0FA 4R9UC 4O2RA 5JLJA 3DM5A 4URVR 5FL3A 4G5SA 2ZJAA 1C1YA 2QRZA 3LQRA 2IYYA 1GNQA 2NO1A 3L0PA 2XB2A 4GPTA 4NCHA 2FFQA 4ZIRB 3LX8A 5HTKA 2FZLA 5JJKA 1BMFA 2R62A 3GEEA 5DGXA 3VQTA 3VKHA 1OFIA 2OBNA 5CJPA 1G9XA 4D4LA 2XJ9A 2OT3B 4MITA 4PO8A 3EIQA 3EC1A 4PQFA 3P26A 2CVHA 5FUVA 5IHPA 2NZJA 1S4QA 4JYCA 3KL4A 4W7SA 3DOFA 4H9GA 2Q9AA 4DUGD 3C14C 2ODEA 5DN6A 2VRWA 3V9PA 4C0KA 4ZI2A 1YRBA 3CX6A 2YYZA 1GVNB 4ZCMA 4D26A 1YZQA 4LJAA 4L15A 3X1XA 1HEIA 2QRNA 3TR5A 3AF2A 1W1WA 4NCNA 5LDDC 4Q48A 3A36A 1XXHE 1DOAA 1M1YE 4LK2A 2J87A 2EFHB 3L2OB 1ZD1A 2NOAA 4X8MA 3WP1B 4H1UA 2GWHA 4HAUA 4Q7LA 4DC9A 4US1R 1AS2A 2HF8A 2VP5A 1RRCA 3SBEA 3RDPA 4KFTA 1NKTA 5J40A 4ZPXA 4XJXA 4XH9B 4PHHA 4B32A 3OZXA 5B30A 821PA 3I4LA 3EZFA 1EK0A 2O8FA 3NHBA 1YZTA 2OSBA 3QKUA 3GLGA 4M1OA 1KJWA 1XWIA 2ZR9A 2IYXA 3AGPA 1Z8FA 3DPUA 2XSZA 4MUBA 4DLZA 4QRHA 4QHYA 4NYJR 1GITA 2FFBA 2QTFA 2GJ8A 3Q7QA 4KFSA 3QKRA 1Z0AA 4CZ2A 2FEOA 2NPFA 1X86B 3AVPA 4MRRA 5EXSA 1RZ3A 3TVTA 5LD2C 5G41A 5AJXA 3TAUA 3HWSA 1Z2AA 1Z6YA 2PL3A 3NH9A 5SZKB 2ZUDA 4OQFA 1QHGA 3P32A 2DFLA 4URUR 2GEVA 3UXMA 4DSOA 1U81A 3CIOA 3SJAA 4YQFA 1A82A 2GZHA 4Z54A 1W36C 1GSIA 2WWHA 3FTQA 1G3UA 3NWJA 3D3QA 4LHXA 2RGEA 3N2IA 4KYUA 4TSFD 3EX7C 4MGKR 1D8TA 1KZ7B 4DLVA 4C0BA 2FEMA 2V1XA 1TQ6A 3E70C 2WOJA 4XIGS 4BFSA 1F60A 1GKUB 2OCPA 5EP1A 4G5RA 2BHRA 3SZRA 4F38A 4IVQA 2GAAA 5BYJA 3WMFA 4EDHA 3CRW1 2R9VA 1JXMA 3LVRE 3CF0A 1Q22A 721PA 3TUZC 3THXA 1NNEA 1WDTA 3ZLJA 1H8ED 2ZSBA 5L3RA 1GDDA 4PQRA 4Z8XA 2JJ1D 4Q9KA 1G7SA 5JSZA 5DI9A 2OFWA 1ZM2A 4I99A 4RZ2A 2IYRA 4DSTA 3MJHA 4WXRA 3T34A 4BFVA 3U7HB 1EX6A 2B7BA 3L82B 3TUJC 5DLQC 1J70A 2PT5A 5LPNA 1CR4A 4D6PA 2ZI6A 1F2UB 1KDTA 2TMKA 3THWA 4LHYA 4M9ZA 2IYLD 2WMOB 2ZRJA 4LZZA 4M1YA 1W0KD 2BMEA 1N5KA 2YJTD 3EIEA 3UK6A 2BBSA 2GZAA 1NMZA 3CF6R 4BLQA 3Q72A 1E0SA 3DOEA 5D3MB 1KSFX 4XTCS 1XCGB 5FFMA 1KGDA 3T1TA 4DIDA 5EP3A 1E2MA 4URYR 2QU8A 5DHAA 1ZNYA 3ZD7A 4EFNA 5CDFE 1E2PA 2IUTA 1AS3A 3CWZA 3KX2A 1SKYE 3QI2A 2J3EA 1DG3A 1CJVC 4Q9LA 1FL9A 3I3SR 3DZ8A 2XEXA 4CEHA 1A2KC 1GILA 1N2CE 1YZLA 3O8DA 4W5WA 2J7PD 3IHWA 4Y0VA 1DVRA 4N0EA 3K0EA 2ORWA 1VDZA 1UBGA 1R6BX 2ZQ5A 3N5CA 1D9XA 3ZIAA 3TR0A 1CTQA 5HPYB 4MGZR 3EARA 2QY9A 4NE2A 5IRCD 3P27A 2OAQ1 2CCGA 3R8FA 2WWWA 2XSZD 1OFUX 2VSXA 4YXWA 2OG2A 1E2DA 1IXZA 3EZ6A 3LDAA 3A1VA 4GRAA 3Q5DA 1YR8A 4CT4B 3KKPA 3EA5A 1OH6A 4JLPA 2GXUA 2HV8A 1G19A 2W6JA 1F3OA 2XTNA 2P6RA 2BDTA 3KFXA 3U7GA 2VYFA 2QAGA 2X1VA 4K81B 2ZITA 1W5TA 3QVUA 1Z28A 3CR7A 3R9IA 2AKYA 2DWQA 4M9XA 1NBMD 3G5UA 3U2QA 1AKYA 1KZGB 3UMSA 4FINA 1KK3A 4DEXA 4W5JA 2F43B 3AVVA 4JLVA 3RWOA 1E2IA 2YHSA 2JLZA 3RVBA 2G0NA 1FUUA 1O3YA 1RW4A 2F7SA 2J7KA 3EWAA 5G53C 3U5ZB 3VR4A 2O8CA 3SI7A 4MDFA 1G291 1KJYA 1XD9A 1ODFA 3K0SA 4MRSA 2ZRMA 3FHCB 3VU9B 2IS6A 1A7JA 1ZD8A 3BWDD 1G7RA 2REBA 1X1SA 4PC6A 1M7BA 3TLXA 2J59A 1P62B 4K8OA 3ADBA 1Z0IA 4EPYA 4CYMA 4TYWA 4LBVA 2CCJA 4OHWA 1G18A 4XVRA 3ZZ0A 2JEOA 4HLUC 2D3WA 3B9QA 1IBRA 4AKHA 2H5EA 1B0UA 1SXJD 1E1QA 1ANKA 2W0SA 1OH5A 5LBIA 3KKMA 4Q01A 1TMKA 3JVUA 3TQFA 2WWXA 3EA0A 5EE1A 1EFUA 4DWJA 1M6NA 1PJRA 4B2IA 5UKDA 3RYTC 4XVUA 3BD9A 3BC1A 5F9HA 2P6NA 4EJSA 2P3SA 2AKAB 2MMGA 5EXTA 1KSHA 1PVOA 1ZIOA 1II0A 3T15A 1E94E 1AZTA 1EGAA 2IYTA 1OYWA 5F98A 2F1HA 5H8WA 1N3BA 2AD5A 1W44A 4LYHA 4OQMA 2QORA 4AG6A 2WTUA 4PC7A 5EP4A 1FQJA 2AR7A 2D06A 3MWKA 4IRUB 5FUWA 1OIXA 2EFCB 4LHWA 3S1AA 1Q3TA 5DIFA 3QBVA 1E2KA 4QM6A 4D25A 5J4YA 1J8YF 5TB5A 2IS1A 4PC1A 2XAUA 3WBJA 1XMIA 1TF7A 2ZJ8A 5FUYA 2JGNA 1A1VA 4JT4A 3TSWA 1KY3A 1XZQA 3SHFA 3I8SA 2BEJA 5TXGA 2JIZD 4JL6A 4UKDA 4BQSA 2V55B 4DEYA 2F43A 3OFNA 2X2FA 1KI1A 3AVYA 1BS1A 2F3RA 3RS3A 1XEFA 2X8AA 5C46F 3C5CA 2IBMA 3KJHA 1QHSA 3TSZA 1P60A 2WAXA 3SYLA 4LYAA 4BFYA 1IY1A 1Q21A 4ARZA 5DSZA 4DVGA 4Q1BA 2J1LA 2A5JA 1E99A 3CRQA 2QAGB 4CW7A 1MO4A 1NY6A 4YXWD 3MG9A 4WVFA 1EESA 3CRVA 3KQNA 1AGPA 3QIAA 1Z6TA 4MQBA 5AK0A 1G8YA 4URXR 1KJZA 3PUZA 4PC2A 1TNDA 3AP1A 1R5BA 2QENA 1W4CA 4DUGA 1XTQA 4MGYR 3CPHA 1L4YA 1E9SA 5H68A 1PLKA 4E07A 4BFTA 3U3OA 4NCKA 4B34A 1NLYA 2QAGC 1QG2A 1MR3F 4MUAA 3L43A 3B2EA 2ZI4A 4EJSC 3SHWA 1SZPA 1KSGA 3PV0A 4NL4H 2G1JA 1SVKA 4AI6A 2GCPA 2BCJQ 1E1RD 4LPKA 1UF9A 5FPSA 1CXZA 1QVAA 3T5GA 1GKIA 1LVGA 1ZUNB 1FNMA 1S1CA 3BORA 1KTVA 1J90A 3RC3A 1OJLA 1ZVQA 4HB4A 3FKSA 4FMCF 3GLFB 3AF3A 3K0FA 2IA5A 5L8VA 4B3DA 4GNKA 2W6JD 1MKYA 2QTVB 1E0KA 3SBDA 2Q3FA 4TQUS 4EPVA 3T5DA 2KI5A 4AYTA 3KKOA 2BC9A 1VCIA 5AJVB 1E32A 1ZM9A 1L7VC 2CNWA 4WBSA 4CF7A 3F3YA 2YNMA 1ZIPA 1WBBA 1F2UA 1MV5A 4BZXA 2ORIA 1P4SA 4OYHA 4F4JA 4YC7A 1TPZA 2QM8A 4KITB 2QSZA 3CNLA 5FTMA 4PSVA 2WAYA
chains in the Genus database with same CATH superfamily
2ZE6A 1CY0A 3LCVB 2ZDGA 3WRVA 5LMUB 1OXKB 3EVDA 2JKVA 3LCMA 3AI7A 1U2RA 1YQDA 5ES3A 3ICWA 2XKAA 1VJGA 3Q4GA 4DNOA 1MTZA 2CBXA 3R3WA 4K6CA 3SEAA 3WGMA 2B8JA 3MK31 3FNEA 2XNJA 3PTZA 2JLYA 2NGRA 3W8EA 5HRCA 5BYKA 4KP7A 3REOA 1KI6A 3KEQA 3H5AA 4I4CA 2P4EA 4UMDA 2Y0DA 2DBZA 1ENZA 2X8LA 1P75A 2GT1A 2X4DA 4EI7A 3K35A 3N0XA 4INJA 3ONVA 4QDZA 1CULC 4HY3A 2O2JA 4H1TA 3I5MA 2QPAA 2WU0A 4HDMA 5IS2A 2VDNB 3B1KA 1NKSA 1FS5A 4M6WB 3BQMB 1LW6E 1MQSA 3QOYA 1R5OA 8LDHA 3H5RA 4HP8A 5TQ2B 4ZRMA 1EDOA 1WETA 2BSXA 4MKRA 3DKKA 1KVSA 5CDYA 1O5IA 2HT6A 3ONWA 2LNDA 4QXQA 3CA8A 3TNFA 1BJRE 4NK5A 4BLVA 2G9ZA 3INTA 1KNXA 2VOJA 3OJLA 2FLWA 3QVOA 4YYZA 1YZFA 4YMLA 3EYAA 2FZ5A 4I6GA 1Z4MA 2AIRA 4AG5A 1C4XA 1MH1A 4CM8B 1KI7A 3TOZA 4KR0A 3OMXA 3SJCA 3RIMA 2PT9A 3CMMA 1MTOA 3SN6A 4ER5A 3U16A 1BE0A 5BMVB 3ZJTA 3OAAD 4FOPA 1MHPA 4C0SA 2X0NA 4I4TB 3IE0A 4E3WA 4COKA 1EIWA 4W9MC 2H5LA 1DX6A 3IPYA 1Y8RB 4Y1EA 3U17A 3EDCA 1B23P 3HN2A 1GWNA 3JYLA 5E6UB 4OSEA 3BD8A 1IEWA 2BUCA 4X62B 4D8YA 2IEZA 4QL3A 3RFFA 5JVDF 2M98A 3TEMA 4AUEA 1RWMA 1K7EB 5DTEA 2WJGA 2NZVG 2GEJA 1MZVA 1MAAA 1JIKA 1XVAA 2VDWA 1SD1A 2VSNA 3WGLA 1F0YA 4RFLA 2QZ9A 3ANYB 1FFDA 4HDRB 4RESA 5KOJA 5L3QA 2JBWA 4JDPA 3SHOA 2C5FA 1P39A 1T0HB 4HX9A 3T54A 4ALLA 1V48A 4UEOA 5JNTA 3WDKA 1WU8A 4UBLA 2F4VB 1J1IA 4PSKA 4Q1VA 2B30A 2Q5HA 4BE9A 5CBKA 4ON9A 4LZLA 1YR1A 1ZP6A 2WFZA 5ELMA 1Z82A 1DDGA 4UQPA 1Z13A 2AQKA 3DXYA 1KJIA 2GFHA 1QTRA 3V1LA 5BR8B 2CMKA 4KO8A 5JXIA 5KDOA 2IUEA 1FZQA 5MHTA 3SQMA 1SXHA 4KI0A 1PGPA 1QONA 3P2MA 3ROKA 2P9QA 3AF4A 4WIAA 2A3RA 1XA0A 2GVDC 2VQEB 5K2OA 4BQEA 1SIWA 4MP3A 3IUMA 1QYIA 2X0JA 4P38A 1ZWKA 3R5XA 4HZIA 5HP4A 2IOQA 3VXKA 5KVAA 2SBTA 3T06B 3KKQA 5EFOA 5I7OA 2Q7OE 1XI2A 2XQGA 3C4QA 4LFBB 2RARA 4L78A 4C9BA 3RASA 3IA2A 4DYDA 4W63A 2R2GA 2WTNA 1EUCA 4IDFA 5AK6A 4QUIA 4EMTA 5KWVA 5GINE 2JDIA 3ON5A 2CLCX 4UMVA 3S4YA 5KUTA 1KZ1A 1IEXA 1Z4PX 2DPLA 2I1VB 1E4VA 1CUDA 2QG9A 5D5QA 4DXAA 5JROA 3A3OA 1JHDA 1NOJA 1C9DB 2C2ZA 2A4MA 2G5TA 2BHTA 2YN4A 3ANMA 3AKEA 5LZ8A 5AIBA 2FE1A 5E7IA 4MXDA 5K6AA 3EGXA 4KJZA 4NYIR 5IC6A 2QTAA 3RUCA 4XSVA 2IHNA 4FOLA 2IIVA 5LIRA 3IDAA 3MJFA 5DIZA 1XMOB 3A1EA 3E18A 4JJFA 4H2DA 2VDRB 2WM2A 3UB2A 2HJ9A 1D09A 1PJBA 4NAHA 4U2BA 3I23A 4PBSA 4ZU1X 1JE0A 5AXAA 3EXG2 1KKMA 5JI2E 1JIJA 4J7UA 3AF5A 2PSFA 2DPYA 3L7JA 4OH7A 4B3TB 5EHIA 3ZHBA 3ABZA 4JK3A 4D3XA 3HMQA 2CNWD 3Q9UA 4KYIB 3M34A 2PDAA 3I76A 3IP8A 4R9NA 4AFNA 1U28A 1ICIA 2F2TA 3OPMA 2Q6IA 2W6QA 2OCAA 1H65A 2VLBA 3H86A 4JEHA 4XIYA 1HDIA 3AR8A 4N8EA 1TAGA 3AINA 1J0BA 1NF9A 3I9OA 4IIDA 5FKJA 1THTA 1CUBA 4Q00A 1CUVA 1X1TA 1A9ZA 1XMJA 3V4RA 1PL0A 1SFRA 4ZOBA 4K5QA 5G4KB 1M2FA 3PKJA 4AY2A 1YBHA 1JDNA 2XWSA 2CJPA 1I1NA 2QYTA 3HDQA 3IV7A 1ESEA 3FSGD 4UVHA 2ZYVX 1E3EA 2J3QA 3FNIA 1KC3A 5DCWA 4E5SA 3MFYA 4MW4A 4AJIA 4HV4A 3DAPA 3ROFA 3W4KA 4HWRA 3KTOA 4WCFC 5I9NA 5HHTA 2HREA 1NI5A 1PJTA 9ATCA 2BI8A 3HRKA 1R0KA 1ZK3A 4BJHB 2BFFB 3K1JA 2QIPA 3KAPA 1P4JA 2QZJA 4TTTS 3DZIA 4X7RA 3OG9A 1I4WA 2WVGA 3VJLA 4BLUA 4QFMA 3VU9A 4F6LA 4IQ8A 2ZTMA 5DHPA 5T57A 1ZJWA 1RIFA 1BCRB 3OCJA 3RSZA 3DO5A 3JYNA 2QNRA 2ID9A 4HUTA 3VKVA 1HBJA 5DCLA 3QPDA 3NG1A 4R0MA 3C87A 1Y7HA 1A95A 2CEKA 4DPMA 3AU9A 3FWKA 4JCCA 3R3YA 3WAJA 2PBRA 3FRJA 4NV3A 3DAOA 4NMLA 1E9AA 1RMYA 2VTBB 2ONZA 1ZR2A 2PJDA 1CZUA 3FZNA 1Z6PA 4ZO7A 2XVMA 4I50A 4IDPA 5HGXA 4IIJF 2JFXA 4Q47A 4WKOA 2Z6AA 1GU0A 5HCUA 4MDHA 3BSSA 5CIWA 1RXVA 2WJWA 1T3ZA 1G20B 1Y7PA 5L7YA 4U2FA 3O91A 1A9PA 2PZBA 3E27A 4GYYA 3ZD6A 1HX7A 4YI3A 1I9CA 5JMOA 3S2GA 5L6LB 4S1NA 1VE7A 3PCRB 1JIQA 2FQYA 2GF9A 1T8UA 3S5JA 2ZSFA 3TMYA 4RW0A 1ZJ5A 1AK1A 2PNFA 1HNZB 3E4DA 1H0KA 1K6IA 3KJNA 3GJ5A 3N75A 1T5LA 1O2DA 3DUFA 3ZK9A 3DLHA 1I8TA 2HA3A 1IATA 2I03A 4UUPA 1N2CB 5HQ3B 3D6NB 1YJ8A 3WG9A 1NN5A 4PPQA 2J0UB 2H3EA 5ALGA 1H23A 2CLFB 3GIDA 3K0FB 4JYZA 1QVWA 1AURA 1JPNA 3HDJA 3AGQA 3OEYA 1S8FA 2BELA 3BTUA 3QXXA 1OYYA 2QN1A 2F1JA 2ZUTA 3CPJB 3V7NA 4KLZA 5I5EA 5ALLA 3TO5A 2HSZA 2HLDA 2C61A 4TTSA 4Z8YA 3CUYA 1WE2A 3UT0A 1GFWA 3WAGA 2H4FA 1QIJA 3V46A 3BGWA 1Z26A 3ZHCA 2ATEA 1PQUA 1SEPA 2NADA 2QD2A 4H3KB 4CE6A 4HJRA 3RAFC 1E0JA 4KUEA 1FU7A 1UP4A 1C7FA 1S9HA 1M72A 2PZ8A 3KS9A 3ICQB 3KOMA 2JKYA 4YJFA 1QHHA 5ITVA 4WKGA 4LJKA 4B87A 4LF8B 3TXXA 1N8SA 2BI4A 2YJZA 4B44A 5KMGB 1HT0A 2D62A 2O2CA 3WNBA 4BDSA 2BP7B 2PZMA 2XLCA 4QJ5A 3DAYA 5H3CA 2DYKA 3URKA 2FRVA 4Q21A 5JLAA 1CUJA 1VRCA 2XBUA 4IDAA 4IHJF 4EB0A 2J3HA 4NFSA 3UHOA 4X7MA 1G7TA 2MOKA 3LA6A 2QXTA 2XB4A 3THWB 2QN6A 5B57C 4ZI5A 5JZMA 2NUPB 4H1VA 4QU5A 4GM4A 5KAPA 1KMCA 3RS5A 3L8DA 1Q7EA 1L4GA 2X9GA 3PEUA 3AIMA 3R0QA 5EZYB 2WV7A 2PWAA 2B7LA 1G8AA 1OT3A 1O54A 3W34A 4GPIB 4P4UA 1A7AA 2QRVB 2ICAA 2I78A 3F4KA 2PSJA 4ZAXA 1LDNA 4TV8F 2HU2A 1GY8A 5F5XA 5I01A 1JKJA 2E9SA 5ED0A 5HA5A 5JCJA 5HRAA 2UXDB 1G3MA 1W93A 3DE6X 3DTVB 3LRPA 1RPZA 1YB5A 2QYHA 3DXXA 3THXB 4NHEA 4QJBA 2C8JA 3R77A 2Q07A 3LAWA 3N9IA 4O08A 1N0IA 2FPIB 1Y8QA 4W5OA 3V4SA 4C7BA 3E84A 1U2DC 3COZA 1U9YA 1W75A 4HUQA 2F3QA 5KCMA 3AHHA 4GZLA 1PS9A 5ITSA 2PMFA 4MLPA 5DKFA 3U3RA 1KO4A 4JJKA 4K9OA 4ZCLA 3R6TA 4H7FA 1G6KA 2YC4C 3L7MA 1CP2A 4RFSB 1JSXA 5JRDS 4A36A 1IY9A 2O07A 2OHFA 4XQGA 3QELB 3SP1A 5H3LA 4FT2A 4X93A 1JKFA 1P2BA 4L5IA 5BRNA 2BUAA 5GZ6A 4QEZA 4DSAA 1N5MA 4K2AA 4D9JA 4Y2XA 3QJ5A 1C3LA 2NWQA 3C6BA 3GXBA 4IP0A 3B36A 2VAWA 1TZ2A 2QMQA 1RXCA 3WYAA 4AQYB 1YIOA 4F9TA 1EFRA 5FOXA 3HVUA 4M0UA 5AHOA 5AKJA 2Q5QA 4CBVA 2I1LA 1HQCA 1T3LA 4ZAZA 2UZIR 3NM6B 5DBHX 4X71A 5GP1A 3ZNOA 5KNDH 2XE4A 5CCXA 2VHVA 5IK2D 4MQEA 1K5GA 3L4BC 4DLWA 2NYUA 4E22A 5A6VA 2BZ1A 1AQIA 1C30A 3E3NA 3GFQA 5C8ZA 5F52A 5B7QA 4C4YA 3OJ0A 2LCFA 5K0SA 3KFLA 1N3YA 4E30A 1Y8RA 3E48A 4H7KA 5ICGA 1CEEA 1UMCB 3ITEA 3CRNA 2Z83A 1ML4A 3HN7A 4O2LA 1E9FA 2VR1A 1D2CA 1T91A 1ES9A 5WRFA 4B73A 5B64A 5CLQA 1PL6A 1MC4A 3GRVA 4OXXA 3QPWA 4BPBA 1DAFA 2RHBA 3IDQA 3NPAA 3PJGA 3WIDA 1YB7A 5T6MA 3DLCA 3DGFC 2VDOB 1TEHA 3QEKA 1MZPA 2CJFA 1N6IA 5F7JA 1MVLA 1AGXA 4U0JA 1RBYA 5JZVA 3AZPA 2Q3CA 3ZDQA 1AF7A 3QPVA 3ST7A 2HXSA 3U44B 3LBYA 4DAEA 4WKCA 2WUFA 2CHGA 1RLOA 4KPGA 3ZJ5A 1G6OA 2L82A 4DJ5X 4DM7A 1XFAA 4L8WB 1CZNA 4OKIA 4YUAA 5HF5A 5KINB 3IUNA 5JSUA 1L4MA 3VR3A 4KODA 3A9WA 1QFMA 1VB3A 4EUKA 1EFAA 4I1UA 3AIKA 1DC7A 2OB2A 1NMQA 3QF4B 4RV4A 2B4QA 2CFIA 4KAJA 4OK5A 5DNEA 3VVMA 1C2TA 3BRSA 1NX6A 2FAXA 3R3HA 1IPFA 1BROA 1CUFA 4N5IX 3G9ZA 4BB0A 5M29A 2RE8A 3HZHA 2OFFA 1ZR4A 5D2CA 3HA7A 1P31A 2XZLA 3OETA 4JX8A 3MCUA 4ZJYA 3FCCA 3VR3D 1KETA 1OHHA 2K5UA 3ZQUA 5L3SA 1FRVA 3LQ2A 6REQB 2BIFA 3LSTA 4AN0A 4R3WA 4GBJA 1NU8A 4RLFA 5CT9A 4KRFA 2FR8C 2FMIA 1QH0A 4J49A 4TZKA 4ZVVA 2ZJ0A 1TVMA 2PZKA 2CXHA 4GPBA 3NO4A 2R7MA 4R71A 1I1OA 2QVZX 4KIWA 4U8HA 5L3ZA 3R0XA 4IZOA 5K3EA 4XYEA 1PF7E 5A7HA 2PWBA 1MC5A 4GI2A 1T2CA 3B1FA 4O4IA 3H9UA 1UPCA 1N34B 1DKMA 1YR6A 3BM5A 5INTA 5CHYA 3J81A 3B82A 3S2UA 2H2GA 4TVKA 1UBHS 1Z18A 2F17A 2Q5EA 3WWDA 4IOMA 3RBZA 1S2NA 2R5WA 3AUAA 3KEMA 4JMPA 3VDXA 1D7OA 1NBOA 2G7MC 2Q9BA 4H7JA 5AVOA 3VDNB 4D41A 4FR0A 5FADA 3BJEA 2QP4A 2B21A 1FP7A 3OKCA 5DH9A 1FDWA 2QD1A 3TTUA 4BTVA 5D6OA 1P8JA 3GGGA 4CKCB 3G2KA 3HYRA 4MEJA 4RCVA 3UAWA 1U94A 2ZB7A 2IDMA 4QKQA 4BECA 2IYNA 2ZB4A 2EXXA 2Q4RA 2QN8A 3G2QA 4KXVA 3CUSA 3B7GA 3IQDB 4JT9A 1BX0A 2O8EB 3MS4A 2I9KA 3KQSA 2ZAYA 2BBWA 3D5EA 4PBTA 1SXPA 3K92A 4YNBA 5ALDA 1E4OA 5DYTA 2FK7A 4RZ3A 1GGMA 1JR3A 1UZMA 5HF8A 4MKGA 4ALIA 4YUXA 1ZM3A 4NFHA 2G4CA 2ACVA 1I4EB 2XIJA 2L42A 1OXVA 4H16A 3EF1A 4Q7MB 2P2SA 2Y1CA 3A1SA 3AW9A 3A6KA 3HKDB 3N3BC 3ADKA 3E2IA 3KWLA 3QM1A 4U2EA 4WA7A 1W36B 1X7GA 1B93A 1MD9A 1RC0A 1RVV1 1GAQA 2HDOA 1XKTA 1E1KA 2YRWA 3L6BA 3LBAA 3N2GA 5IULC 4CTKA 2AKEA 2P4QA 4PCUA 3RTDA 3OTQA 1JHRA 3R0ZA 4EMUA 2FQWA 1LQUA 4TL8A 3ITNA 4HH1A 4J1TC 3GK3A 4ZU3A 1UK7A 3WO1A 4J0DA 1SXJA 3K2BA 4L2IB 3O9MA 1AU9A 1NF2A 4OM8A 1QDEA 3AR7A 4NLLA 1V3VA 4D45A 2GFIA 1SHTX 1V8ZA 2EEPA 5K09A 1VJCA 1DJLA 1Z62A 1OI7A 1UDBA 2W0MA 4IDDA 3REFA 1K6EA 3KQTA 1EQ2A 1KAMA 3LO8A 3AETB 3I0NA 1LI5A 5D84A 1EHCA 3L8MA 4B7ZA 3BH0A 2GYUA 3DW1X 1ID8A 1NPTO 1QIIA 4X6XA 5H16A 4D4HA 1GUZA 1Y8ZA 4FVTA 1W29A 2F3TA 2OXIA 1T8WA 1GQRA 3ZGVA 1N9GB 1ADYA 3F90A 3CNNA 3WLJA 1MAUA 4CMEA 1JBKA 5T5QA 3Q10A 3JQ8A 2AC7A 4R2HA 1YVRA 4TTJA 1K97A 2BMDA 3IEKA 2BGRA 1XHLA 1VG8A 1YE5A 4ND3A 4NKRA 2OOSA 3KEOA 7ABPA 2C7GA 2PVPA 1J33A 1SHJA 5FTKA 3A4MA 3P0RA 5C8XA 2B5VA 2XTMA 4XCXA 4FJ1A 1W0JA 4AB1A 1XF9A 4F04A 4KWIA 3I53A 1O96B 1XMPA 2OGUA 4DDKA 2EZ4A 1PAUA 3GAMA 4TL6A 1EWTA 1HL7A 2NYRA 1MBZA 1J4AA 2P9YA 1XCLA 1GV0A 3E22A 3KOXA 4EHAA 2O8NA 1GNTA 3K70C 1XMVA 4F9EA 3JZIA 4E5VA 5DTQA 1NZDA 2XVAA 5BSHA 3K6SB 2ZBGA 2QT9A 1FSSA 4ZDKA 1GUAA 3UA4A 4ACAA 4D79A 4COOA 2QLFA 2I4TA 3AIIA 2ADOA 3QVWA 4S1PA 4NYMR 2ATVA 4LKOA 3RKRA 1WD5A 1GIAA 4FIDA 1P0FA 5AIAA 2YZNA 3CEJA 2MYNA 1AS0A 5DTMA 1Y9DA 4PAGA 1AK2A 4PVDA 4Z99A 2IX3A 1B6GA 2I2XB 3NHRA 5AOCA 2SICE 5SZHB 3LX4A 5DWVA 3RTBA 1NONA 1NKVA 3NIGB 3P9IA 3QTBA 1E89A 2R1VB 4O8CA 3RJ5A 3Q0IA 2OV2A 1L3CA 3LHFA 3T7KA 4DCVA 4QLBA 4JHLA 4D99A 1CJUC 3P94A 3OZRA 4JOBA 4YJKA 1V8DA 5EPEA 3DHEA 1JVBA 4QXRA 4OFZA 3VTFA 4C0XA 4EWLA 4P92A 1X1DA 1TZJA 1YQQA 1PT5A 4JITA 3O3CA 4PXSA 5AVZA 2QZZA 2C2YA 2R6HA 1Q16A 3GYBA 4PLVA 1OKKA 4Q3LA 1Z74A 5AM3A 4YCLA 3PI6A 3OTIA 2E5WA 1O1YA 5H82A 5E7MA 2BKUA 5LLSA 3RUFA 4TKUB 1NXVA 4EEKA 1JWLA 3IT0A 3QNUA 3PKZA 3ABQB 4FUQA 3GLHA 1DKNA 4GGPA 5CR9A 3RYIA 3V00A 1REQB 1XRJA 4JJGA 2IXEA 5JCZA 4OUKX 1SBTA 3HM9A 2FSGA 1SBIA 3A9TA 1CC1S 1LC3A 1V7PC 3K05A 4H6VA 4PZDA 5DGIA 1M8PA 3W78A 1ESDA 4HF7A 1TYBE 2IJGX 4Z0PA 4BZPA 1SXJC 2C7RA 3BQNB 3GDOA 3CE9A 4KUHA 1XC7A 4K6FA 4HH0A 4NNOA 1W25A 1Z9BA 3PRKE 4WZZA 1G9TA 3FKSD 3RO7A 3MOSA 1VYTA 2JI7A 1QLWA 4PZCA 4PONA 1OUMA 1SNYA 1YQ9A 2UZ1B 4UVEA 1KO7A 2OV1A 3CEAA 4HZGA 4MS4A 3VYSB 1CJKC 3EGCA 1WUKS 5KCZA 2V45A 5B1HA 4OREX 2D5IA 4XUEA 1VCMA 4YRJA 2O59A 1RXWA 1T4CB 1YBVA 4LY0A 1YZVA 1T36B 4WNAB 3D3NA 3ZQJA 4O29A 4YRGA 2VUTA 4L28A 4EJ6A 2ATXA 3HUTA 5FJJA 3DKIA 3BOSA 3L07A 4C4PA 1M0TA 5K0JA 2GILA 4KJXA 2FW0A 1N1EA 2EZ9A 5CJJA 4CV3A 3D7NA 3EEBA 1DARA 2GX6A 3FUTA 3CEMA 3HCBA 2HLPA 3D6TB 3I01A 3L0IB 4OFXA 3BJZA 3X1MA 2X2EA 4TM7A 3V8QA 3DWGA 3F9CA 4M3NA 3AC0A 3FDFA 3TRHA 4QGGA 3E82A 1ZUNA 4OI1A 1E6UA 3AONB 3TQQA 4QXAA 2CVFA 2VQ3A 4XM1A 2AJTA 4M9QA 4JOQA 1RJ9A 5JC8A 4GP9A 3TW8A 1LWNA 2HXYA 2XYVA 2PH3A 2WJJA 2Z8ZA 3LXUX 1BCSB 3I6QA 1XD8A 3BIFA 4KXQA 5B6JA 5IKPA 1ODTC 2XDYA 5IYZB 4OGGA 3C3BA 3LD9A 5BO5A 4A03A 1ETHA 1QJCA 1R18A 1Y63A 1W5SA 4E12A 1UKVY 4LQDA 2ZIAA 3BE4A 4MCJA 1V6SA 2YV2A 3QEMA 4BLSA 4GI5A 1LI4A 4CI9A 4TQAA 1YR9A 2W71A 3SC4A 4Y2HA 4PNPA 3TQSA 2LGJA 1RJFA 2QTMA 4YBRA 2ZRBA 5AKLA 5AT1A 3Q3JB 3ETLA 4OF4A 2XV1A 2GD6A 1UDAA 1JHZA 1M5TA 5KQRA 4GC5A 4E2WA 1OZ0A 3ZTYA 1TVKB 1SUAA 4AKSA 3IBGA 3DBHA 4N3CA 4XLLA 3Q7EA 1ORDA 3O90A 4GI3A 3JCZA 1H2YA 3DS8A 4QIHA 1U8FO 3R7DA 2CXXA 1WUHS 3D2AA 2BGLA 1T5HX 4TWZA 1E1CB 3HP7A 2PBZA 4NCIA 1QFYA 4YJHB 2VTBA 5FUQA 4UM9D 3RAEC 1E2QA 1LFAA 1EX7A 4N7MA 5B3LA 2RB4A 1A9TA 3B7WA 1RHQA 4KLCA 2JH9A 1G3QA 2GM3A 5KYXA 3UOGA 1SKMA 5KYUA 4QUKA 3WKDA 5KTPA 2AR0A 3M2PA 4HS4A 3HHPA 4NYMQ 2C29D 2YJ5A 1HGXA 5E1OA 4BLOA 1V45E 4MWTA 3QBJA 4EDFA 1DO2A 1MHTA 1NVGA 1FMLA 2GRUA 1Z83A 2QE7D 4NK4A 4F1KA 4NBTA 6GPBA 2YBEA 1A8QA 1IN6A 1DINA 1FQWA 2HDWA 1OFGA 2ZU6A 3WGHA 1USVA 2X76A 3PQ7A 2VYNA 4IIHA 5CLGA 2BKEA 3I9MA 3VHLB 3Q5EA 4XQEA 5I6DA 5TPZD 1U3GA 2Y66A 3HCEA 3ML1A 1Z39A 3EPRA 5BSTA 2BTQB 4H18A 4J29A 4UOQA 2WNHA 1LZKA 4I5IA 3NDIA 2WIFA 1XCMA 5DWQA 3OPYB 1J09A 2CXPA 4R31A 2YV4A 3TL3A 1DOHA 5EJ7A 5GIOE 1BZYA 2HMVA 2WWIA 4FDMA 3TTSA 5FR1A 3H2ZA 4JKYA 2X0DA 2IZ5A 4LMAA 2E87A 4HGRA 1H85A 4B4WA 1GCOA 5J4KA 3LGSA 4PYKA 5A9TA 4DCGA 3U48A 1D5CA 1PYDA 4R6XA 5ALEA 1TDJA 1XNGA 1RLMA 2VNSA 3GQBA 4K9RA 3SYTA 3O82A 1YZGA 3FMOB 4MLZA 4N9WA 3UCFA 1I2MA 2O4CA 3UK0A 1TJ3A 2B4AA 3UFBA 1YCHA 4F84A 1DADA 1WXHA 1R5JA 1GNVA 2H6EA 3KWMA 3K94A 1Y4UA 1FTNA 3LYUA 4XASA 1JQDA 2CGEA 1U8YA 1W2HA 1T9AA 2BFBB 2P2ZA 5KWSA 2XB8A 2VYQA 3FZQA 1NV9A 4JC8A 2GJAA 3TINA 3LSYA 1D3AA 1M2VB 3F7MA 5K03A 2A5FA 2JDID 5A0VA 1ZIDA 1C8LA 1YDWA 2H4XA 3DTVA 4KUGA 2DBRA 3JYHA 4EF5A 4X20B 4OK6A 3HY6A 5JXGA 4BJ1A 4LGCA 1S3FA 5KYXB 1AGRA 3DAGA 3U4QA 3H3JA 3GRAA 2BM1A 1A77A 1FLNA 1O0CA 1N77A 3TBFA 3MJSA 5C9ZA 3SC3A 4AJHA 2R66A 4OQQA 1R6VA 1RYMA 4KXYA 5KSZA 1F7VA 3OZSA 1YJ5A 3A6ZA 1TW3A 3LOUA 1UBCA 4ML3A 2I3GA 3GJSA 2ZROA 4ZZ0A 1TK2A 2AQIA 3UO8B 4DMFA 4HQ0A 2AQHA 4C1BA 1DUIA 3O3OB 4RD6A 1EKXA 1X77A 4LWZA 2NV2B 3WLNA 4TS3A 1U0BB 3OHSX 4AD8A 3ZE7A 1W76A 3T1NA 3TKLA 3PPYA 4NDNE 4WOKA 3K9GA 4MPRA 1XTBA 2YFYA 2GEKA 2QLNA 1I80A 3I1FA 4FS8A 1KARA 3GZNA 1ISRA 4IEEA 3LQ1A 3P96A 2BFMA 1J56A 1W0CA 3ZVRA 3EH1A 4IF6A 3BFXA 2P7HA 3HYLA 4MUKA 2J45A 3G2MA 1Z7BA 4M22A 1OH7A 3LLMA 4D3DA 4CMIB 3K9WA 1NXOA 4UOEA 5KJEA 1S7CA 1NBEA 1DZIA 5CDSA 2QW8A 5AK5A 4BV2A 5DXFA 4KGVA 4MVJH 2XUZA 3VMMA 4B85A 4DIUA 3SM9A 2JLSA 2ORYA 1G5QA 4IMPA 5KNBA 1CG6A 1QPZA 1EGHA 2IHUA 1MP0A 4IIEA 4RDCA 3OQPA 3EIWA 3MUFA 3U13A 4RD1A 5E9JA 2PJUA 4RVGA 4MPJA 4EYGA 4IUDS 3ESYA 4HPWA 2J9ZB 3IPXA 4FFBA 3C4VA 3M81A 4IL5A 4ZYVA 3KU1A 4JGBA 1AE1A 2V6GA 4B4KA 2VRCD 3VGJA 3GLUA 1T4CA 5JXWA 3EXEB 1FUYB 3BXPA 3IQEA 2QL5A 1X8KA 2C3UA 2F48A 1J9ZA 1RU3A 4KI7A 5A1JA 2V7VA 2XRYA 2UZ1A 4C4XA 3E0QA 4YLYA 5CVDA 4ZQBA 1X13A 3G7NA 4BLRA 4YIHA 4QPDA 3W9UA 1WD7A 1RXEA 1QK5A 2AYYA 2VRCA 1G5RA 3O21A 3U9SA 3A14A 5CXUA 3KXIA 1E61A 2OQRA 3V4FA 4S0ZA 1S8OA 1GT6A 1RYZA 4NBWA 1Q92A 3B1VA 1S3SA 5E8RA 1E96A 2PUAA 2IVFA 4JQSA 3KT6A 3EWIA 5A6SB 2QVCA 1AQUA 3LLVA 2OO3A 2OBMA 3ZOKA 5HZGA 5C8VA 5IKMA 5G0TA 5JAZA 3WMGA 2JLCA 3R0VA 1N6HA 2WR8A 3NH6A 4G01B 5DLDA 1L5VA 5KWJA 1I7DA 4HTFB 1HEYA 1MGOA 3S5UA 4UU7A 2HK8A 4FCWA 4ZO9A 3VKWA 5B1DA 1TK9A 4WDRA 5HJEA 4W99A 5CMLA 4EBFA 1XJ5A 2O06A 3NWEA 1TI7A 4HRYA 1H1LB 3KAJA 3GI1A 4FFLA 4JS0A 4R69A 3W4JA 1C3EA 1W8DA 2GN2A 3B3FA 3MTJA 2C7PA 4H7PA 4POOA 1ND6A 4AY6A 2W90A 1SH7A 5LQCA 4N7JA 2IP4A 1W88A 2J46A 4J16C 2UZ3A 4QNRA 3GF4A 4AUNA 1YGPA 4HNVA 1Q0HA 1N6PA 4BX9A 1OFTA 2CHQA 5KNCH 1IHPA 3QY9A 3BF8A 4F8YA 4X7BA 2W43A 4LBZA 1PS0A 3D6JA 1Z0SA 3WL3A 4RK7A 3F47A 4K9SA 4OP2A 4NPAA 4MV3A 2YINC 1EX9A 4NXMB 4BB9A 2PMEA 3GRPA 2EFDB 3NX4A 4I55A 4OGLA 3I2FA 3QXHA 1K4KA 2WQ6A 2HQ1A 1T25A 1E66A 3OJOA 3Q2KA 3OBIA 3C43A 3QMMA 4PGHA 5AO9A 4UPEA 4C76A 1XAGA 2Q9UA 3NLLA 4B6EA 5K0LA 2HNBA 1FSZA 3BICA 1DIGA 2M9MA 4IDNA 2ETXA 3QUAA 2AFVA 4B17A 4CFSA 4J2HA 3CUEF 4LZPA 3OLCX 4OFWA 2W4IA 5BWMA 1TM1E 2OZLA 3G7UA 4LJ9A 5HWSA 5C53B 3PE4A 3VR6A 2IDKA 2WUWE 2QUAA 5AW3A 4MR7B 2YASA 1X9HA 2QSJA 3C7KA 4A92A 4RELA 2AC4A 4TZ0A 4UFPA 2WFMA 1A27A 3EW9A 2IELA 4D5GA 4JL5A 4BYMA 3RC9A 3WGNA 1ACLA 3UN1A 2WJIA 1B1CA 1BN6A 2OXCA 2WYWA 2XYHA 5AI6A 4YQEA 3RS2A 3TLMA 2VWHA 3PC3A 4PG8A 4X1KB 3ZVLA 3DF9A 6NULA 2XADA 4UTRA 1WHSB 2I7VA 2AI1A 1HDXA 3H5IA 3OIGA 5BYBA 2IL1A 1NM5C 2ZBQA 2C98A 3LH5A 3MTAA 4ZXFA 1JXQA 3W3AA 2M1ZA 3RC8A 1VLZA 2ZTLA 3A4NA 2BT4A 4RDHA 3ZDAA 4XA8A 4UC0A 2FJUA 3OZCA 4G0QA 4OKSA 1HKHA 4ZC1A 3FNFA 1PV1A 3K2IA 4YO7A 3W0LB 4RZHA 5AUQA 4BMPB 5BSKA 1QO9A 3OT1A 1WV1A 1NQVA 3BE6A 1Z0DA 4AMYA 4OTZA 4AJ9A 1XPUA 1G20E 4ZYUA 2R97A 1QO0A 3N2GB 1BXRB 2H2FA 5IXJA 2WEKA 2Z1NA 1US8B 5HF6A 5ER9A 5T4FA 1NVUQ 1W6UA 4L4XA 3KDSE 1U8CB 3SBOA 1GR1A 3IMCA 2FKAA 4Q66C 3WLPA 3B1ZA 4F11A 4FWBA 1WZEA 4JT2A 2EKLA 2EGUA 2ZCVA 3F8WA 4OX9B 3IODA 3KU4A 3VH1A 1SKQA 4TLAA 3TOSA 3NM4A 4KMSA 3KDAA 4AKTA 1QO0D 3O8OB 3JD3A 1Z63A 4PU0A 3P2YA 2PRIA 2VJNA 1MQAA 4O4IF 4QODA 4JLSA 1UOPA 3F6CA 1LBIA 3RJ9A 1MABB 5KNDA 2B8TA 4DY4A 4JI7B 4LDPA 4Z5XA 4HGQA 2VDKB 4DTCA 2ID7A 2QMYA 2B69A 1FMCA 3P9KA 3N2YA 1KZHA 2AS0A 2QRGA 4Q1EA 4RTSA 2OE2A 3T3DA 2ZWAA 4TYNA 3E8XA 1DP4A 5FPKA 4G1UC 2PUVA 1OA0A 3W1VA 2WM9B 3FPFA 4CMHA 2GA9A 2V54A 2O9JA 3NBFA 4WLEA 4CLOB 2JA1A 4ZHQB 5KNDD 3CU5A 4LA4A 2MT9A 3A11A 3ZWVA 2Q1TA 1WXDA 1VDMA 4RV5A 3RFCA 2AV6A 3A6DA 3HJNA 5CX4A 2R8RA 1TCCA 2CL7X 1FCJA 3GN1A 4Y6GB 5BR1A 2JL1A 1GPDG 2GDJA 3MINB 2G80A 3ZE0B 1AO3A 2YHAA 4IFEA 1KQNA 2CNDA 1HY3A 1I4LD 3GD7A 3IOBA 2CE2X 2POCA 3IR5A 3TJZA 4XFJA 1KKUA 2CLHB 4FI3C 2JC3A 4R1LA 2OC4A 1XHEA 1LGYA 4WCVA 1C7IA 4GOLD 5BV7A 1YMVA 2RJOA 1CVRA 4ETMA 2Q0XA 5CX1B 1JE1A 4F3KA 2DTXA 1IHOA 2IZOA 5LR6A 2VK8A 3R8CA 1GGKA 2H29A 3SR0A 5K3BA 3BMOB 2C03A 1P1HA 3JPWA 3P5BA 5L3SB 4MQ4A 4KKXB 4JR1A 2H7CA 4QQKA 4K26A 1G0NA 2R65A 3B6KA 2QW1A 3ND8A 5L3QB 3G9XA 1QIMA 3D6MA 1W2GA 2ZIZA 3G0GA 2WAAA 4RJLA 4RTMA 3W90A 4OJNA 4OAQA 1HOTA 5B1EA 1XLUA 2JLQA 3FLMA 3D8RA 1JHPA 3NU1A 3QOFA 2WT9A 1IDOA 4M53A 1M74A 4BGUA 2FR1A 4TX1A 4RADA 2P9CA 3EXHC 1NNLA 2X6QA 2A7QA 1O9HA 2V6JA 4ZOLA 1RPJA 2WUVA 1WNTA 2A86A 2R84A 1X92A 3B48A 5IH7A 4UXIA 4KU4A 3M33A 3F78A 3DMDA 2XXAA 4UEJA 4X1IB 4UBNA 1U1CA 4EG4A 5CPBA 1Y3HA 3DMTA 3LKVA 2NZWA 3CX4A 1Z4OA 3OKFA 1Q0TA 2QJOA 4E7OA 1GAXA 4JBYA 3EPLA 3NHPA 2IODA 4DXHA 4L6IA 1F3LA 1EB8A 4RD2A 2CB0A 4U5XA 4I0WB 1ECBA 3DE1X 1QO7A 4XJSA 5FQOA 5LUAA 2BR3A 1FFCA 4TLCA 3JD4A 1VKRA 1RR6A 1OXUA 1GAJA 3OCUA 3G85A 4XEUA 1RRGA 1VL2A 4I5DA 1SY7A 4MJXA 1T2NA 3AK4A 4MDYA 1D1SA 1PRYA 1XZIA 4GHWA 4PG4A 5TT1A 2VWPA 4GMHA 5EY5B 3TRIA 3U0BA 1BHQ1 3FNGA 2IXAA 1XJQA 2RHLA 2WYHA 3I12A 2BN4A 2JB9A 3BK7A 3ZE8A 5CB8A 2G36A 1AN9A 2V4ZA 1OLOA 3QXJA 1OFVA 3U26A 1S2LA 1PR2A 2B9VA 3U60B 3D31A 2VNAA 5F5NA 4R98A 1MOQA 2JVKA 4IIFA 5FTJA 2XA1A 1X7XA 2ZQZA 2PV0A 1VHDA 1IG3A 1I2AA 1VIVA 2XOKA 4TYPA 5SV2A 2DHRA 4RMGA 2D1QA 3OU2A 4ZYTA 4YCSA 2D2EA 3P0HA 2XB6A 1Z34A 2OO5C 5CW2A 1T0BA 5KAMA 3OOSA 2EWMA 2QJFA 2BRUA 2EEZA 4UHJA 2WDZA 2ZVDA 4NZNA 4B8WA 2XKKA 3WGUA 1GSHA 1DO8A 1YBFA 4JLWA 2IH4A 1ODSA 2O3UA 4OIFA 2ONKA 4QDKA 1GPAA 4EY4A 4FN4A 1N8NA 3X1JA 3RIYA 5DTJA 3DOIA 3L7BA 3OE7A 3DEFA 3H7IA 4WINA 2GM5A 1EAMA 1EWKA 3ZLVA 4X61A 3WSTA 3RNLA 4D92A 5KPDA 3MN1A 4MA5A 5J47A 2CD7A 1HNWB 1JG3A 4BFUA 2BFNA 3CJQA 3FMPB 2IU4A 1CY8A 3HDGA 1LPNA 3Q9LA 5TGTA 4AP5A 3ESZA 5BPHA 2LP4Y 4L2IA 5I3ZA 1SUEA 3E5RA 3V2HA 1NI3A 2AJ8A 2I4LA 1BQ3A 1W7AA 2AW5A 4MRAA 4JC0A 3ZK7A 2CDNA 2EU8A 5DM60 4KNYA 1JKJB 1GADO 2IBSA 3ELDA 1KDOA 2OAP1 2OHVA 3M89A 2Z5GA 3D8UA 1ACJA 2AXEA 3ZI0A 4F97A