5EUMA

1.8 angstrom crystal structure of atp-binding component of fused lipid transporter subunits of abc superfamily from haemophilus influenzae.
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
255
structure length
250
Chain Sequence
KDDGAYKAEPAKGELEFKNVSFAYQGEELALNNISFSVPAGKTVALVGRSGSGKSTIANLVTRFYDIEQGEILLDGVNIQDYRLSNLRENCAVVSQQVHLFNDTIANNIAYAAQDKYSREEIIAAAKAAYALEFIEKLPQGFDTVIGENGASLSGGQRQRLAIARALLRNSPVLILDEATTESERAIQSALEELKKDRTVVVIAHRLSTIENADEILVIDHGEIRERGNHKTLLEQNGAYKQLHSMQFTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title 1.8 Angstrom Crystal Structure of ATP-binding Component of Fused Lipid Transporter Subunits of ABC superfamily from Haemophilus influenzae.
rcsb
source organism Haemophilus influenzae pittii
molecule tags Hydrolase
molecule keywords Lipid A export ATP-binding/permease protein MsbA
total genus 84
structure length 250
sequence length 255
chains with identical sequence B
ec nomenclature ec 3.6.3.-:
pdb deposition date 2015-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5eumA00
1XPRA 1CS4C 2WOJA 3EX7C 2W6ID 3QUSA 3WHKA 4OJKA 1A7JA 3EZ6A 3B1YA 4A2PA 4PC3A 3WYFA 3VR5A 821PA 4Q18A 4XVRA 5KOYA 2WWIA 4AD8A 1V5WA 3AH8A 5JJKA 1CP2A 1GKYA 3FTQA 2BMEA 3DM9B 4HDCA 3GLFB 1T3LA 1WRBA 2NO0A 1T9HA 3ZLJA 1F2TA 3CZQA 1TTTA 4HAXA 2XNDA 1E1RD 2NGRA 5C2JB 3KXKA 3GFOA 4MGIR 2D2FA 3L0OA 2Y8EA 1IJEA 1KO4A 5CJ2A 3TBKA 1CTQA 2WWFA 4RD3A 2CHVA 2YWFA 4C0LA 1FNNA 3A1TA 1VTKA 2IYVA 1E0JA 1KO8A 2NO6A 2FSHA 2ZJ8A 4NCKA 4RSGA 5EE3A 5EQTA 4JLOA 5EUMA 1T4GA 4AC9A 2IS4A 1VYVA 3LXRA 1PUIA 1W2HA 1E2MA 2ATVA 2FJUA 2PX0A 4C3ZA 2QORA 2XNSA 2G0NA 4B43A 1OXUA 2OFOA 2P6UA 1F48A 1AS2A 3BB4A 3BERA 2AKYA 2ZEJA 4YLGA 5SZHB 1YZKA 4LX0A 1P9WA 1R5NA 5L3RA 4XWKA 1EX7A 1R0WA 2BBWA 2VBCA 3AQ4A 3NKVA 4LBZA 4LYFA 1QHHA 1T0HB 1G16A 4URUR 2ZVQX 1ZIPA 5FBLB 1TU3A 2XB4A 2X77A 3K9GA 4NU0A 2OE2A 2XNDD 4DLYA 4KV9A 2NPFA 5JBQA 3A36A 5KNBA 1W4AA 3WNCA 3ADBA 1JR6A 2DFNA 4RCZA 2D7CA 3BC1A 4RZ3A 2G0TA 1XCPA 2GHIA 4E03A 3BBPA 1S96A 2QG6A 2FGKA 2JJ8A 2OAQ1 4MA4A 4ABYA 2ERXA 2Q9CA 4D0GA 1ZD8A 4DKXA 4AKGA 3SYKA 3VKGA 4OBEA 4MRVA 5KHOC 3Q7PA 1IN7A 1JQJC 2VH5R 3PUWA 3GLGB 4LJYA 4HB4A 2A78A 3QSYA 4ITRC 1WXQA 4IFBA 4WVFA 3T5GA 1SZPA 4Q1AA 221PA 4YXWA 1KY3A 4RY2A 2GVZC 3Q5DA 1CEEA 2JIZD 4MGZR 3QXXA 4HAWA 2GA8A 3RSLA 1ZP6A 4EAQA 4TYQA 4Z8YA 5IK2A 2MSEB 3GEEA 5DH9A 1ZM4A 1DEKA 2NO9A 1XBTA 1E94E 2GJSA 2IYZA 5FUWA 1XD8A 3SJZA 2OFXA 4PTLA 2XITA 4C0BA 2UVQA 3DMNA 4Z51A 2W6IA 4TL6A 1GNPA 5C1BA 5HPYB 1P4SA 1YHNA 1GZSA 3D8BA 4XH9B 1FPMA 1EFTA 1FQJA 3L0IB 4G5QA 3JZMA 5AJVB 4QBHA 2G9NA 2CBZA 4DCTA 3WP0A 3T12A 1LTQA 2HLDA 3AB3A 4O3MA 3NVAA 5HE9A 1LS6A 1KJWA 2NMVA 2REOA 4PQRA 2IX3A 2EFCB 4TQAA 3B1ZA 4TLAA 4KO8A 1ZNZA 2ZAMA 4JKIA 4QXAA 2FPMA 1E2NA 4PO9A 4B76A 2EVWX 3K0SA 4JYBA 1E2QA 2EYQA 4IVQA 3NC1C 4Y0AA 1T3HA 5G53C 4UQOA 1F5NA 3C5HA 1D9XA 1GIAA 1OLOA 2O52A 2WWYA 1TF5A 2QUZA 1IONA 1OH5A 2ZTSA 1ZM2A 3KDSE 1Q1EA 3PJRA 3PEWA 3GJ8A 2FEOA 3KFXA 4UXHA 1H65A 3KXLA 2H7VA 1A1VA 2ERYA 1I2DA 1E9CA 2AK2A 2I1QA 5A5GA 2VHQA 4PHHA 5DISB 3N2EA 3HWSA 1DADA 1U94A 2RHMA 2PJRA 1ZAKA 3QF7A 2ZE5A 1RRPA 1D6JA 1CBUA 2P6NA 4QFMA 4WBSA 1KMHA 5DE3A 2R8RA 1N2CE 2UZ3A 2QSYA 4IOJA 3ZIAA 1AJEA 4EPYA 1FFHA 4Q1FA 2WJGA 2BV3A 4I81A 5DI3B 4R7ZA 5L3VA 4A8JA 2NZ8A 3IHWA 2FFHA 4LDJA 2JLVA 1P73A 2CJWB 4F92B 3A1SA 1NVXQ 5SZIA 5FPSA 1Q3HA 2QAGA 3KZ1E 2BDTA 4ZDWA 1P6XA 4NH0A 3RDPA 4EDHA 4QNMA 4GZMA 2EW1A 4JLNA 3EZ9A 4H1VA 4UNNA 3RRNA 2C9OA 5JZVA 3DPUA 4W9MC 3EPJA 2GILA 1W44A 1D9ZA 4XSGA 2GK7A 2QSZA 4V0ME 3T1OA 2WWXA 4HZUA 2QGZA 3F3YA 1SVOA 3QXCA 2DPXA 2X8AA 4M4SA 4B73A 4LHYA 1K5GA 3T15A 2OXRA 5J4YA 3O47A 3H4MA 1E79A 4X8OA 2ZRFA 5L3SA 3DKVA 2BCGY 2DCUA 4UXJA 3U2QA 4ERNA 1W48A 4Q00A 2IF0A 4D0LB 4CT5A 1Z08A 5J4VA 4R2HA 3O8RA 4Q7JB 2PEYA 5JHGB 3IO3A 4A8JC 2FG5A 1NVVR 2GWHA 4FXPA 4JVLA 4LHZA 4YMUA 1GUAA 3QKRA 4M9XA 4QM6A 1H8EA 3ZZUA 1KSJA 2BVNA 2HCJB 4PXAA 2C9YA 2RGNA 3GLHB 3WYGA 1KYIA 3BOSA 4DSUA 3C5CA 4FW9A 4NPHA 5EXSA 4PSAA 1HQCA 1M1YE 4QJ3A 2RGXA 3K0FB 4LYHA 2L0XA 3ADCA 1R8QA 1GITA 3I5XA 1P2VA 1SVMA 3IDQA 5AJWA 1XXHA 3LY5A 4A0RA 1IXZA 1OKKA 4MKIA 5JHHB 3VTKA 4KSBA 4CEHA 5DYGA 3LVRE 2ZJBA 2P65A 3P20A 1JAIA 2ZRPA 4UNQA 2KJQA 1C1YA 2O8FA 4MUBA 1X3SA 4XWAA 4C0AC 3R7WA 1WMSA 1Z06A 2CCJA 1OXSC 3L8ZA 3QF4A 4I1VA 3BGWA 2YOFA 4LC0A 3E2IA 3W9YA 4TQ9A 3UKDA 2FX3A 3K8YA 1VG8A 1XD2A 4O2LA 4BFYA 3HDTA 4R98A 4CEIA 4OQFA 1DS6A 4YDHB 2J9RA 4QG7A 3KKMA 3V4FA 3FKSD 4TL9A 4QGAA 5B58C 2VHCA 3CF2A 3KQNA 1WCV1 4S2EA 4TMTA 5FL3A 1GRQA 2DR3A 2MMCA 4HEJA 1W0JA 2FSGA 4X8LA 3T5DA 3LAWA 2WMNB 2PX3A 4DUGD 4OHYA 2W58A 4JBWA 1PLKA 1TPZA 2ZRJA 4A82A 4TZ6A 2Z4SA 1P5ZB 1OFUX 5GVRA 2QENA 3UIEA 4URZR 1G6OA 2WJJA 2JJ1D 4GOKA 4IOKA 2QGNA 1VG9B 1DVRA 4US0R 1I2MA 1XJQA 4XIGS 1VHLA 1T0JB 3TJZA 2RGGA 3QENA 5L3QA 3KQLA 4D6PA 2A3RA 1W4BA 4B48A 3U5ZB 2IW3A 4FWIB 3MWLA 4EPWA 1HT2E 3NBXX 4JL8A 4EJSB 2XB2A 3L8YA 4D25A 1II0A 1ZCBA 4BZQA 1PZNA 1ZM9A 2WJYA 4Q7MB 5CLQA 5GVSA 2QTFA 4A2WA 3OIYA 2HV8A 1OH7A 2PZEA 3RC8A 4Q7LA 4O0MA 1UJ2A 1UBFA 4Q9JA 4BFUA 4EKDA 1XFAA 3B8HA 3PCRB 1Y3AA 2LKCA 2OLJA 1OFIA 1Q21A 3GJ5A 1QHIA 1XZPA 1AKYA 2WWGA 4I4LA 1ZU5A 2H1LA 4W5HA 2R6FA 4XWOA 1XB2A 1TUEA 5D3MA 6Q21A 3OZXA 3P4XA 4IJMA 4JVNA 1E6CA 1ZU4A 1JPNA 2HLDD 2QTVB 3B6EA 5EZ6B 3R9WA 3AVTA 3U4QB 4Q1CA 1DTSA 1Z3IX 3ND8A 3CKLA 1G3IA 4PC7A 3VMFA 2ONKA 3THYA 1E2LA 1UBGA 4TL7A 5CB8A 2XX3A 1XMIA 1FW6A 4MITA 1ZD1A 1KTVA 4K8OA 2DBYA 1QF9A 1KJZA 3ADDA 2F1IA 3EA5A 4DJTA 4QJ4A 4B3XA 2XJ9A 4JLVA 2HF9A 2A9KA 3F0TA 3VR3A 4WXPA 5EP1A 5DHAA 1OKKD 2OEPA 2CXXA 1Z6AA 2KSQA 3RRMA 1BMFD 1G3RA 4B44A 3THYB 1S1CA 2YOHA 4JYCA 1XPUA 1M2OB 3FVQA 1F60A 1OT3A 3B13B 3IILA 3Q85A 2GRJA 2CE7A 3DM5A 3FB4A 3U4QA 1HQYE 3Q7QA 1W0JD 1XP8A 1S3GA 1N3BA 3VR2A 1ZNYA 1ZJ6A 1XPOA 3LFUA 4FMBB 4L16A 4M1WA 1ZM3A 4ZI3A 3ZYCA 1VIYA 4N0EA 4HLCA 5B57C 4ZDJA 3LVQE 1S8FA 5JI3E 1KDRA 4BPBA 4DB2A 2RAPA 1LF5A 2HT6A 4JLPA 4V0LA 5CJPA 4ARZA 4TSFA 4KFRA 4GDFA 5JFGA 1VCNA 1DAHA 3LA6A 4FCVA 4HLQB 2JLUA 1HEIA 4XTRA 2ZPTX 1N25A 4EQ6A 3I61A 5TVKA 3X1XA 1XEWY 1J90A 1ZC3A 2O5VA 1DAIA 2H8KA 4LYJA 4EJSA 2Q0HA 3GJXC 4DIEA 1FL9A 1JPJA 2JGNA 2OG2A 4FMCB 4I1OA 4B3DA 4ZDIA 4URXR 4XJXA 1N6KA 3PUVA 2BBTA 4KJZA 2WICA 2E9SA 4IHQA 1SQ5A 2ZJAA 1X8LA 1WDTA 5LPNA 2XOKD 4TYYA 2FF7A 3UMRA 4HB0A 3K70B 1HV8A 1U98A 1G64A 5DI9A 2O0KA 4A92A 4D4JA 2FEMA 2C99A 3RS0A 5KNDA 1H8HA 2VSOA 4BLPA 1BS1A 4IDNA 2E87A 4BFZA 3QVVA 4FWTA 2J0SA 4KCGA 4DSNA 3ICEA 3TVDA 2WMOB 3OEHA 4FMCF 3CRQA 1Z47A 4JSTA 3AUYA 3TH5A 4M9SA 2WKRA 4EPTA 2QRZA 3NG1A 1TADA 1XEXA 2QBYB 3I1FA 1KSHA 4LJ5A 5F3WB 1UDXA 1CXZA 3QXSA 3ZVRA 4DDTA 1PV4A 3ZVNA 1G8GA 4Q19A 1OH6A 1S4QA 2JLRA 2FH5B 2OCAA 3NIBA 4MYHA 4D0NA 2P2LA 3QQ5A 5G3ZA 4N0DA 2XOKA 2CEAA 1MKYA 2OBMA 3GLHE 3VX4A 2QRNA 3IEUA 1TMKA 2IBMA 2O0HA 3CPJB 4HLUA 2HT1A 1CJUC 2H5EA 3ASYA 2VA8A 5DN6A 2ZRDA 3A58B 2YVUA 3U3JA 4CEHB 2F7SA 3MWKA 1RPZA 5CYOA 4B2LA 4KXFB 2ZI9A 2GEUA 1ZINA 3I8SA 4M21A 4N1AA 4C0HA 2YHSA 1TL7C 1LB1B 4TYWA 4DDUA 2GXAA 2V3CC 3SBDA 2CLSA 3K0FA 5JSZB 1UKZA 2F3TA 2ZRGA 1EESA 3BD9A 3GEHA 1LNZA 4DCNA 4AYWA 3OIUA 1OHHD 1DPFA 2F3RA 1ZUHA 1HYQA 4B75A 2VP6A 3M0EA 3QKRB 5KSPA 4A1FA 1W36C 4LRWA 3J81k 1T6NA 1FNMA 2N1BA 1DELA 1OB5A 1R8SA 3U60B 2HDNB 3LH5A 2C96A 4I1UA 1E2EA 4G0NA 1Z63A 3AVYA 1SHZA 1E1QD 1KI7A 1N6RA 2IYRA 2Z6VA 1KHTA 3K9NA 3KJIA 4RCYA 3HU2A 4MGKR 1D2NA 1N6NA 2HXSA 2R6AA 4DCUA 2ZREA 1U2RA 1Z0IA 4NYIQ 5TB5A 4GRAA 5KUTA 3MWYW 3KUCA 1UAAA 1EG7A 3OFND 4HZUB 3WRYC 4ZIRB 3ZVLA 1NJFA 4JMPA 4C30A 3EZFA 4DLXA 2ZJ5A 1OXXK 2AFIE 3HU3A 4WZ6A 1E9BA 1IHUA 2ZR0A 5FOTA 1MRNA 1ZIOA 1FTNA 2DWOA 2FV8A 4XVQA 2CMKA 3RSOA 5JCZA 4V0KA 1EFCA 1R5OA 4RVCA 2FOLA 1U0HC 1TF7A 3E70C 5G40A 2FNAA 4YMWA 1LW7A 1GNRA 2GJ9A 4A8JB 1FQKA 1XJCA 2P0EA 3K0EA 3QG5A 1E2IA 3GJ4A 1N0VC 2ODBA 4URWR 5DI3A 4WXRA 4EFLA 4QHYA 1KSFX 4BASA 3NEYA 4KLNA 3SC3A 3RWMB 3UWKA 3AKCA 1IXSB 3OIVA 2ZYTX 1FP6A 1RW4A 1Q12A 3PR1A 3BB1A 4PSVA 3RS2A 5TDHA 1UKVY 1KO5A 2H57A 2BJVA 2NO7A 1NLYA 1LV7A 2HF8A 3I73A 1X1RA 2ZS8A 1RZ3A 2VQSA 5FPKA 3SOPA 3SQXA 1KY2A 1KZ7B 1XDBA 4QBGB 3RHFA 2XZLA 3FHCB 4BLSA 5JEEA 1NMZA 2GCOB 1JXOA 3ZDQA 2WSSA 3IIJA 1G7TA 5P21A 2ZJ2A 1E2GA 2CCGA 4JIMA 3CPHA 4G5GA 4E22A 3F5FA 4FCTA 3BE4A 3O8CA 1Z8FA 1NP6A 2N42A 4BFSA 1E9SA 5BYKA 1WF3A 4A4DA 1QRAA 4QL3A 2F6RA 1N5IA 3O8DA 5ELXA 1ZCAA 2A5JA 2WAYA 1ZC4A 4DCSA 1XXHE 3WXMA 3U3MA 4JLJA 4W5JA 4DSTA 4IDHA 2C2HA 2ZITA 2QMEA 4EUNA 2GCOA 2NTYC 3GFTA 5CLLA 1Z2AA 5FR2A 1RFLA 3KKPA 5TV2A 4ZKEA 1N6IA 1UBCA 4RD4A 5GJBA 2RGCA 1A82A 4KHZA 1Z6GA 1HE8B 1TUIA 2ZRCA 1DOAA 1JJVA 3PXGA 3K9LA 4AYXA 3TIFA 1IJFA 2ORIA 1P2TA 3SNHA 3DOFA 4Q4LA 1U9IC 3I8XA 4G1UC 1SVLA 2EWWA 2R2AA 1U0LA 2V8OA 3P1JA 4PPQA 4Q9IA 721PA 4AK9A 5FL7A 3NBFA 1COWD 4EFMA 2ZRIA 1UDWA 2AD1A 2B7CA 2GCPA 3LDAA 4JLBA 5J5CA 1CJTC 5J4HA 3G0HA 4BRWA 4TSFD 3B7GA 3VHXA 2EQBA 4ZCIA 3FKQA 5JLJA 5DIFA 5CDFA 1CJVC 2D2EA 4V0MA 1ZVQA 4HUQB 3QXHA 3B78A 2PBRA 4MRRA 2FDCA 1F3OA 4ZDKA 2ZSAA 5E7MA 1I4TD 1Q22A 1CRQA 3DZ8A 3ICQB 2FFQA 1TU4A 4MGYR 3WBKA 4BUJA 2QM8A 4NZYA 4GP7A 1YR6A 4PPGA 2GAOA 1OSNA 2CE2X 3SJAA 5LDDC 3RABA 3ECCA 4B3FX 4TLCA 5KDLA 3CUEF 1P60A 1Z6XA 1L2TA 2XSZA 2IUUA 3IBGA 1EX6A 3FGNA 1R5BA 5AWFC 2ZRMA 3DVLA 4JLDA 1KNXA 4X8HA 4DHEA 2AWOA 2R6GA 3ASZA 3M6AA 1CJKC 2YWGA 2EWVA 1UEIA 2J87A 3EZ7A 4NDZA 2FFBA 4V0OA 4MKGA 3WMGA 4A0HA 1QHHB 1VMAA 3TQCA 2G3YA 3VNUA 3K09C 4TQUS 4Q02A 1P9NA 3RANA 2ZXUA 3ZZ0A 4DVGA 2OAP1 1JR3E 3AEZA 3KQHA 4IVPA 1KAOA 2H17A 4CVNA 1U90A 5HKKA 4MKFA 1GL7A 1FOEB 2UZIR 3EPHA 2XGJA 3BAFA 1XCGB 2H16A 1NI3A 1WQ1R 3AKDA 2JIZA 2EFGA 5JSZA 3KJGA 4DSOA 2IEYA 5LD2B 3B9QA 1G1MA 5FOSA 2IXEA 4E09A 3M1IA 1GVNB 4EPRA 3F8TA 3FWYA 3RLFA 2ATXA 1LF0A 3V4RA 3B1VA 4OYHA 3RS7A 4FIDA 2XTZA 1E2FA 2CHGA 4MRPA 3RNLA 2C03A 3BRWD 1YKSA 2KBFA 3T1TA 2D3WA 1ZD9A 3MRSA 3SDZA 2EFEB 3QPUA 3IEVA 4NMMA 2V6JA 3CNNA 1BO6A 2ZYWX 2QMUA 5GADl 1L7VC 2ODEA 4NYJR 1U8AA 2ORVA 4DZZA 4GL2A 1KGDA 4HSEA 1RE0A 2C5LA 3VU9B 2C9CA 4XD7D 4JKYA 2GBLA 2OBLA 3GJ7A 4HI0E 4ZIRA 5JRZA 2WVJA 3NWJA 1E4VA 4L8GA 5JJLA 4NCHA 5TY0A 1Z0AA 3L43A 1W36B 4C0JA 2YWHA 4MYTA 2MSDB 4OHWA 1FX0B 3FPAA 4D4MA 3TK1A 1CLUA 1XEXB 1IN5A 4BFVA 5FBWB 3JVVA 3FMOB 1AS3A 3QKSB 4LOAA 3JVUA 4RFSA 2OT3B 3TW8B 3CLVA 2Z43A 4TMWA 1L4YA 2OCBA 3U3RA 1ZBDA 2BOVA 1R0YA 3CWZA 4R71A 2IA5A 3BK7A 1NN0A 2RGNC 3RWOA 1E2HA 4NCNA 5KDOA 3BB3A 1N5KA 4XTCS 1M6NA 2QL6A 1MABB 2C8VA 4TTPA 5DNYB 1CR2A 1X8KA 1YVDA 2VHUA 2X19A 1E2JA 2ZJOA 2BIFA 3CNOA 4NKRA 4CT4B 2BBOA 4H1UA 3LWNA 4KFSA 1MO6A 5SZKB 2WJHA 1VCOA 4Q9HA 4ZI2A 1W5SA 2VEDA 3CRRA 3W6PA 3TKLA 1H8ED 2FE4A 2GKSA 1G7SA 1KI1A 3H2YA 1XEFA 2WPDD 1AIPA 3QBVA 3KX2A 3PFIA 3KJEA 1TQ6A 2TMKA 3THOA 1UPTA 4M1YA 3HJNA 4Q9KA 4F93B 2QAJA 4DDWA 2QPTA 3THXB 3N2IA 1E69A 1HT1E 2XTNA 1UM8A 2ZR9A 2ZUBA 3LNCA 2C98A 2VP9A 4WOPA 1G4AE 1A2BA 4LI0A 4NCIA 1LVGA 2E1RA 3WRXC 3KB2A 2B8TA 4O2RA 3AKYA 1YR7A 3ZS8A 3UANA 3U7HB 1S9DA 1ANKA 2A30A 5TMPA 1F6BA 1X1SA 1M7GA 3GCGA 2OZEA 4AURA 5BN3A 5FTNA 4HATA 2QN6A 5J4KA 3THWB 3AKEA 2D06A 3AVPA 1OF1A 1W7AA 1O87A 4OK5A 1SXJB 2CL7X 5EXPA 5H8WA 1UKYA 2QBYA 1KK0A 4KI0A 4XOIA 3KUDA 4PHTA 3KKQA 4TYNA 4PAMA 1CU1A 1II9A 4LJ7A 3RYTC 3TW4A 1S1MA 3CB4A 3EG5A 1G7RA 1Z0FA 5JECA 1E4YA 3GQBA 1SXJE 2WAXA 4PC1A 1XTSA 2G1JA 1CKEA 1OYYA 2ASEA 1JXMA 1K5DA 2OILA 4LHVA 2RMKA 4Q03A 2ECKA 2QE7D 1N6PA 3PUZA 1IY1A 5FOUA 1Q1ZA 4JBXA 4TT3A 1KK3A 2XXAA 2HJGA 4Z1MA 1T5IA 3SR0A 1BMFA 1YR9A 1JR3D 2ZANA 2PEZA 2ORWA 4G5SA 4LJ4A 3LO5A 1E9FA 1KDTA 1OPXA 4TWZA 5CIWA 4DWJA 3GPLA 2O8EA 4WA7A 2FFAA 1CR1A 4B2IA 3GLGE 4C9BA 3CW2A 4G5RA 2RH5A 4NONA 4M1TA 5J4LA 4DEYA 2V4ZA 5AUOB 2QP4A 4KYIB 4P3YA 4NBSA 5D3MB 4EQ6B 3SFVA 3VR6A 4BFWA 1XTRA 3I4LA 4JLKA 3MCAA 1COWA 2YNMA 2Q6TA 3D6TB 1IN6A 3FMFA 2W2XA 4BEJA 3AP2A 1N6LA 2GXSA 5CB6A 4B71A 3C4JA 2VF8A 5AJZA 2C04A 1IY2A 4ON9A 3GJ0A 3BJIC 3BWDD 1W47A 3EC1A 4A0FA 2V9PA 3SFZA 4CF7A 2F55A 5SZJA 2J7PA 2RCNA 4MRNA 3B5JA 4Q5IA 3EA0A 4MH0R 4UJ3A 5H70A 1GDDA 2O8EB 1GP2A 2F1HA 5LBIA 1VDZA 1ZNWA 5JS8A 4CYMA 2G83A 5K8LA 1W0KA 2ODNA 3QPWA 1XMSA 1MO5A 1HH4A 3NDPA 3OIWA 1NSFA 4HAVA 4A6XA 2XXAB 2XSZD 4IFEA 3SN6A 2J45A 1R0XA 4M0LA 4TMKA 4KFTA 2AK3A 4US2R 4IW3B 3H1TA 3WP1B 5GJCA 1X6VA 4ASUA 4Q7KA 3AP1A 3RS4A 3TSWA 1ZRHA 3QVUA 3QE0A 1ZUIA 3QOFA 4AYTA 4LHWA 4C4PA 2YINC 3DL0A 4HAUA 1SXJC 4PANA 2HXYA 1T5LA 2QT1A 1Z6YA 4PZYA 5C18A 5EXXA 2FZ4A 3EPKA 5FPYA 4PC2A 2ZE7A 3ZQJA 1GKUB 2XTMA 2JJ2D 2AX4A 2P5TB 4HYYA 4OK3A 1KI8A 2N46A 3WBJA 4EIWA 1SKYB 2RHDA 2BC9A 2ZE8A 4IOMA 3FE2A 5B30A 4B34A 1W0KD 4IOLA 5IT5A 3RC3A 4FMDB 3DOEA 3BXZA 3AM1A 5BYJA 4YDSA 3X1WA 3UMFA 4DEXA 1KKMA 2X2FA 2ZRNA 1E79D 3IGFA 1MO4A 4AG5A 4GMDA 1JR3A 1OFTA 4M8NE 1HY3A 2DFKB 3SZRA 3L0SA 4OHZA 2ZRHA 3UWOA 3ZGXA 4ASUD 2ZRKA 3THXA 2QM7A 3LBNA 4RFVA 4BLRA 5AR1A 5EJEA 2LCFA 4TZ0A 3ZH9B 1OV4A 3R9IA 1YJ5A 1P62B 3B2EA 1G5RA 2NO1A 4LWZA 1FP7A 3D31A 3BH6A 4UJ5A 2GTPA 2CDNA 2GEDA 3LX8A 1FUKA 5JI2E 4LV5B 1E99A 1VHTA 1G3QA 2SHKA 2PMKA 5JWRA 2VLIA 2OBNA 4POAA 3KKOA 1WBDA 1WBBA 1MH1A 2A5GA 2J5XA 3GLHA 1JEEA 3CIOA 4IDOA 1NMXA 5EP4A 4L9WA 3T1QA 1E3MA 4JT4A 1R10A 4B35A 3U61B 5IDVA 3B85A 5CIQA 4R9UC 5H68A 5F98A 4GPTA 2JCSA 1G18A 1PUJA 4RFSB 1KJYA 1XX6A 5FI0B 2VYFA 3QKSA 1DAKA 4D2IA 4JZKA 3TUJC 3UK6A 4P4UA 2B92A 3W3ZB 1VCMA 2V1UA 5FUVA 4TYPA 3SI7A 4CEIB 1XD2B 2I1VB 2FPLA 1NBMD 4PSKA 3UPUA 4PPNA 3MJHA 3ADKA 3D7MA 4U02A 3QF4B 1SKYE 3E5HA 3E1SA 1G3UA 3VU9A 2QAGC 2QTHA 3GEIA 3R7WB 4URYR 4QGFA 3GD7A 2QPOA 5HR5A 5DO9A 5FL7D 2O8FB 1XNJA 1KIMA 4M2LA 4A9AA 5D3QA 5F9FA 2QAGB 2W83A 2BMDA 5KSZA 1BKDR 3FOZA 1R6BX 2CJWA 1XJ0A 1E96A 1W46A 5E4FA 4FD2A 5F9HA 3QY0A 3B1WA 2Z4RA 2IYWA 3P26A 1XCMA 1TX4B 2GNOA 5IHPA 4D4LA 1ODFA 2VPPA 5CK4A 5BWMA 5EP3A 4DLWA 3MAAC 3S1AA 5H1YA 3R8CA 4PZZA 2X2EA 3TMKA 3DO6A 2IUSA 2UKDA 4UNRA 3LRPA 4B6FA 4PO8A 1A4RA 1R2QA 4QBFA 1D5CA 2VSXA 2MMGA 4EPVA 3LQRA 4DCVA 3SE0A 1U9IA 2DFLA 4GBMA 5BN4A 1NN1A 1HUQA 4I1SA 3PG5A 4K46A 1QHNA 2G6BA 4LJAA 4MDFA 1EK0A 3TRFA 2IUTA 4H9GA 1OE0A 3ZIAD 4OK6A 5IF9A 4B3CA 2NZJA 5AJXA 1L8QA 4FN5A 1G41A 1RJ9B 1VKJA 2VIIA 2YZ2A 4HDQB 4OHVA 3W6NA 5L3SB 2QQ0A 1P72A 4LK2A 2AXPA 3OESA 2GCNA 1YQTA 3RS3A 4U7DA 3CWQA 1G20E 2AFHE 1S9HA 3VAAA 4NYJQ 1PLJA 1UBEA 3G82C 1JI0A 3EXAA 2AWNA 1KI3A 1NLFA 4W7SA 2VTKA 5HCIA 4LHXA 3LXXA 3PEYA 2PLFA 4LYAA 5FR1A 5KO2A 5FUXA 4KBGA 4HUQA 3L82B 2D4HA 1YZLA 2V7QD 2HYIC 2EU8A 4M1SA 5F2EA 2RGDA 1VG0B 2IF2A 4M1KA 4NL4H 3EZ2A 3K70D 2KBEA 3I92A 4P4TA 4M9QA 2BEKA 2WZQA 2BEJA 2P67A 2QU8A 4PZLA 5FTKA 1KMHB 2VHTA 4QRHA 2Q3FA 1QVRA 2OSBA 1GSIA 2F9MA 4IVRA 1M74A 5M04A 1XZQA 4DRZA 1ESNA 3KB1A 5J47A 3KQKA 3C7KA 3GFPA 3T35A 4C0KA 3PEUA 3CRVA 2JJ2A 2O0JA 5KPDA 3R20A 3ZD6A 1XF9A 3QBTA 2WOOA 3GLGA 2C77A 5FPHA 4HB2A 4CRWB 3C16C 3CF0A 4L9SA 3AVUA 2R9VA 2XZPA 4OHXA 2RB4A 2ZYVX 1YZUA 4ESVA 3BFKA 4MUAA 4X8MA 3WHLA 1CR0A 2JJ1A 3NBZC 1YE8A 2AHOA 3HR7A 1VYUA 2IC5A 3BFXA 4KYUA 3H86A 3EPLA 2QNRA 4Q48A 1KO1A 3ONWA 3W8RA 4E5UA 1D2EA 5TXGA 4F4JA 2D7DA 4RZUA 2P5SA 1IBRA 2YKGA 5EP2A 3TQFA 2FA9A 2GESA 2J3EA 5K8IA 4K81B 1W49A 1MR3F 4HB3A 1S3SA 2DWPA 4PR0A 3DEFA 4M22A 3I5YA 5KPJA 4HAYA 2JASA 2JLQA 2REXB 4NYMR 3TE6A 4CDGA 3WMEA 2ZRLA 2AL7A 2PZFA 4YMVA 3LBHA 4RD2A 2QQEA 2ZQ5A 4HAZA 1E9DA 3PEVA 2B7BA 2JDIA 2V1XA 1J7KA 2OCYC 4A36A 2QEQA 3LX5A 2ZRAA 4LPSA 5A4JA 1NVVQ 4RKEA 3IQXA 1XMJA 3EIHA 3JZAA 1N5JA 5HKKD 1V43A 4NE2A 1RYHA 2NPIA 3HU1A 2G1KA 2WV9A 4DLSA 1NNEA 5CITA 2JLYA 5FOXA 4P0TA 5KU1A 3QJYA 1W2GA 5C46F 1G5PA 5EE5B 5FFMA 2Z83A 2OO7A 3K0CA 4OQNA 1WP9A 3A4NA 1N0UA 3HP1A 5FTMA 1ESMA 5HTKA 1N6HA 1M7HA 2VP0A 4F38A 1G6HA 3DKPA 3FMIA 3LBIA 5HCNA 1AZTA 4JL5A 3CH5A 1G8PA 4Z54A 2ZYUX 3CNLA 1F2TB 2CLCX 5JRJA 3GLFA 3K70C 4GNKA 2NG1A 4TMXA 4HLDA 5A0FA 3OF5A 2V54A 3IHLA 4M9ZA 1JNYA 2XEXA 3OHMA 2AD5A 3CH4B 2G88A 4MKHA 2DHRA 2D74A 3N5CA 1NMYA 4GOJA 4KVAA 2GJ8A 4EFNA 4OI2A 3EAQA 4PQYA 5JMTA 3X2SA 3CONA 1DAEA 2WSSD 1PLLA 4AIIA 4B32A 2YWEA 5BXQC 3OE7D 1EFUA 1NG1A 5DSZA 2IEZA 2IYXA 1JALA 3IPYA 5FI1B 1AGPA 2GXUA 1QHXA 5EE0A 1ZUNB 4KITB 2CVFA 3MFYA 3RRZA 3PIRA 1M34E 4XSHA 3TLXA 2GZDA 5BQ5A 4B33A 4W5WA 1T8TA 5FUYA 3N70A 3W8NA 2ZROA 1VIAA 1CRPA 1IQPA 2IYTA 2P3SA 5AUQA 2ZM5A 5EZ5A 2F43A 2QY9A 3UG6A 3ZZTA 1JB1A 2FSIA 5FBQB 3FDIA 3BIFA 2KI5A 2YV5A 2IWRA 3UXMA 2AR7A 2J0UA 3WYAA 4ZV4A 2GJKA 2WWHA 3B82A 5HZHA 3AF1A 1G7CA 4GFDA 4TMVA 2KE5A 4P31A 4B2PA 4RD1A 5E95A 1NF3A 2FSFA 4BEBA 1WA5A 1UEJA 2ANBA 4M1OA 3Q9LA 3ZS9A 4YXWD 1OHHA 1Z83A 4B6EA 1E2DA 5E7IA 3KL4A 3X1YA 1VCIA 2RGAA 3U6BA 2YJTD 1HE1C 3KKNA 2ZI7A 1ZW6A 3AF3A 3NTUA 3LW7A 3OEEA 4F91B 1DG3A 1IAQA 2ZSFA 1CJMA 1XEWX 4J0QA 5CM9C 2WWWA 5GJVC 4JT2A 1GM5A 1M8PA 1YZGA 2QMHA 3W5IA 3AVVA 2CNWA 4TLEA 3AV0B 3NC0C 4QM7A 3RRYA 3KTAB 1NSTA 1IN8A 1GL6A 4NTZA 1SHKA 1YZQA 4F4CA 4ZO4A 5LB2A 3K0CC 1E9EA 5AUPB 4OQLA 3FFAA 2KB0A 2IL1A 4AY2A 4FCWA 3IO5A 2ZSBA 2GXQA 1AKEA 2R6CA 2GETA 4Q1DA 1PJRA 3NHAA 1OIWA 4QJ5A 1NY5A 4UKDA 1W5TA 1G17A 3EARA 2A7QA 1DE0A 4LUCA 1CR4A 4A0GA 2FGJA 3SQWA 4DIDA 1EWRA 2W2TA 3AGQA 3GLIA 3EIEA 2ZSDA 4Q4JA 2OXCA 4G5OA 5E7JA 5LD2C 1JECA 1XTJA 2CLDX 4BFTA 4TLBA 5L8VA 1NVWQ 5EE9A 4LBYA 2A2ZA 2JAQA 3GLIB 2OUKA 4Z1MD 3WY9A 2JEOA 5DHFA 3B60A 3U6KA 1SULA 1BIFA 3RVBA 4HLUC 1GWNA 2ZR7A 3VX3A 5FH9A 1U8ZA 5B2ZA 4KVGA 5FOWA 3IBYA 121PA 4QC2A 4UNSA 3AVXA 4L15A 4KODA 1QHGA 4GI7A 2HEIA 3C41J 1K6MA 1LY1A 2J59A 3BH0A 4Z8XA 3R8FA 3C14C 1GL9B 1UKEA 4IXNA 4KU4A 2O8BA 5FOVA 1BOFA 1L4UA 4M53A 1JEDA 3WNBA 4DT1A 1O3YA 2CL0X 4LGMA 2BWJA 4TTRA 1EWQA 4P33A 4GSYA 2EYUA 2Q21A 4ARZB 5JS7A 2WPDA 1TQ4A 3WNDA 1KAGA 1G9XA 3IKJA 3KTAA 1UADA 4JVMA 1U0JA 3MSXA 2PLRA 3CRW1 1N6OA 2VO1A 3CM0A 4GZLA 4RKFA 3LLMA 1ETUA 1OYWA 1Q1QA 1I4LD 3EIQA 3TGPA 1XTKA 3MGCA 2WJIA 3HYRA 4KAXA 4QOSA 3UG7A 4BGDA 2A5DA 2NOAA 2AN9A 5AK0A 2HUPA 4FI3C 4DLTA 3Q5EA 2QT0A 2EFHB 2ZRBA 1NKTA 1RIFA 2IYYA 3L2OB 3QXJA 2OESA 2IK8A 4EJSC 2Q3HA 4AWXA 4U5XA 4G01B 4URVR 4ZCMA 2J0UB 3QEOA 3TUZC 1PVOA 3W34A 1QG2A 1VECA 1OXVA 5KDDA 2QA5A 3EASA 4LJ6A 5DYIA 4V02A 1YRBA 1NRJB 3CBQA 5JWHA 1GRRA 2DWQA 1G8YA 3M4YA 1RRGA 4MYUA 2FN4A 1WE2A 1E9RA 1F2UA 5BN5A 2BMFA 2GZHA 2GAAA 2IXGA 2B21A 2R65A 3DMDA 3DDCA 3GJ6A 2CVHA 1G3MA 2ZU6A 3A4LA 2ZI6A 1RRCA 2BM1A 1SGWA 2C95A 2CNWD 1IOZA 1J99A 3LW8A 4GOXA 2ZAOA 1GKIA 5JJIA 1XRJA 1VPLA 1YRAA 5KNCA 3NDBB 3IIKA 4WZBE 3U7GA 1Z5ZA 2WIAA 2PT7A 2PL3A 2GF0A 3I72A 3FKSA 3REGA 3BFVA 2NIPA 3ZD7A 3CRMA 3D3QA 5JWOA 5IK2D 4MQBA 2V55B 2WKPA 1Q0UA 2J0QA 1NL3A 2IYUA 4RZ2A 2FWRA 5HZKA 1Z28A 3X1DA 4BQSA 1E1QA 1W4CA 5C4MA 5K8UA 1G8FA 3RAPR 4LPKA 3VR4A 1EFRD 4Q01A 5FTJA 2IYSA 4Q1BA 3TR5A 1J2JA 2ZI5A 4QGGA 4RD6A 4IDPA 4PHFA 1ZNXA 3KFVA 3GLFE 5L3QB 4CEJA 2Q9AA 3TAHA 1MOZA 3SHFA 3SEAA 4DDVA 1W1WA 4P4SA 3V00A 1US8A 1QVAA 1Y63A 2ZS9A 1JBKA 1NIPA 5FPTA 2XAUA 4R2IA 4RJLA 2DB3A 2WIBA 5J40A 4Q66C 3A1VA 1K8RA 4JJZA 3MLEA 4Y0VA 2GZAA 3T34A 4IRUB 4ZKDA 3U7EB 4ACBA 3DZDA 3Q72A 5KTYA 1A5TA 2FZLA 4C7OA 3NBYC 4AKHA 1XU4A 1M7BA 1P9RA 2ZETA 1AM4D 3AVOA 4LV6A 3W5JA 3FFBA 3L0PA 4FINA 2J1LA 4QHTA 1U8YA 4TL8A 3MD0A 1J8YF 1C9KA 3CX8A 2CHQA 4ILEA 4Q4AA 2JLXA 2REBA 4BLQA 2BHRA 3PUXA 3NH6A 4LJ9A 4KSCA 3LV8A 1W36D 2F1RA 2WBLC 3EWAA 1CIPA 1Z0KA 1BH2A 1YU9A 4Q9LA 3T06B 4BE7B 1ZMXA 5GJWC 1BYIA 4PO1A 1DAGA 1G21E 2OM2A 4QBIA 3FHTA 3CPEA 4D82A 1E0KA 3TVTA 2K5UA 4L4UA 2IWHA 1DAFA 3H0KA 3B1XA 1KNQA 1NJGA 5K8TA 4IEIA 3AUXA 4GT1A 4UNPA 5AUNB 1TQ2A 4QKQA 1X8JA 2R44A 1XXHB 4V03A 1T8UA 4OKSA 2WM9B 1TNDA 3A1UA 3KQUA 1YR8A 1SKQA 2IHYA 3K53A 2ZS7A 3U7FB 2W0SA 4PQFA 1TF2A 1S0UA 3GP8A 1SVWA 1IM2A 4IKEA 4JS0A 2Z0MA 4YC7A 4L5BA 2I3BA 3U44B 3SYLA 4B74A 3AGPA 4FMDF 1E0SA 1UF9A 3QIAA 1E98A 4RD0A 1Q44A 2C78A 2O8DA 3CR7A 1Z0JA 1TAGA 5LB4A 1T3SA 1KI9A 2VP2A 1KKLA 2H18A 4B3BA 3OE7A 4JL6A 4TTQA 3MWJA 1Q1BA 2VP5A 2ZJYA 1KMQA 3ZVMA 1MRSA 3A8TA 1LS1A 5JEDA 4G3XA 1Z29A 3AVQA 1RJ9A 1Z2CA 3C8UA 4B3GA 2Z5FA 4UXIA 2ANCA 2VL7A 4A2QA 2WKQA 3CO5A 4YONB 4DUGA 4DLUA 4MDEA 4YMSA 2OV2A 2ZU0C 1XD9A 2JLWA 2F9LA 3QKUA 2O8CA 1GFIA 2GK6A 2OHFA 1P7CA 1QHYA 3UMSA 2I4IA 4ZPXA 1MO3A 2CL6X 2YYZA 4BRUA 4Q4HB 1N0WA 2OFWA 2PMDA 1KI6B 4OL0A 4DC9A 1J8MF 1C4OA 1QG4A 4F4IA 4GP6A 4RZXA 4WAUA 3U44A 2V7QA 3BORA 1Z6TA 521PA 3S1AB 4JVSB 3K0AB 1AGRA 3VKHA 1GILA 2IT1A 5CM8B 3EWSA 3K0AA 4CW7A 4NCJA 421PA 3CX7A 3IIMA 3OEED 3IPXA 3K09A 2J41A 3OFNA 4QHSA 1R0ZA 5FBRB 4ZCLA 4BLOA 1TEXA 1LFDB 1Q57A 4OQMA 4BZPA 3GLIE 1EXMA 1KI6A 1OXTA 2QI9C 4C2UA 1GRNA 4ACAA 4Q4HA 2PJZA 1FUUA 1ELOA 3X1ZA 2VSFA 1NN5A 2FPKA 1RVDA 4BECA 2BCJQ 2OLKA 2XJ4A 3SYNA 1NG9A 2O8CB 1DG1G 1XTQA 5ANRB 4D81A 1T91A 1RKBA 1KDPA 1B23P 4N3NA 4O25A 1KI4A 3H84A 1AZSC 1NN3A 1FTSA 1GOTA 1IXRC 4LZZA 5DGXA 3A1WA 4AKIA 1OJLA 4LCBA 2QP3A 2ZIAA 3TNFA 1SVIA 3AF0A 3R9XA 3VKWA 1YZNA 4WW0A 4C7OB 1FMLA 2Q9BA 3VR1A 2ZSEA 4U00A 3BH7A 3W3AA 3Q3JB 3NXSA 2PH1A 4Q47A 1RYFA 2HJVA 4D80A 2JATA 4HDOB 2O8DB 2FMXA 1VG1A 5EXTA 4D4KA 3PV0A 3SHWA 4LBWA 3CF6R 2W2VA 4LC1A 2G77B 1HURA 3SS8A 1NVUQ 4P32A 1Q3TA 5KSOA 4JLAA 2J7KA 3O8BA 4NYIR 1GNQA 5FTLA 4LSGA 3OAAA 4BZXA 1OIXA 4CEJB 2YOGA 1HTWA 2VHJA 4NP6A 2HYDA 3UATA 2P6RA 1AK2A 2VF7A 3KJHA 1B0UA 5DLQC 2BKUA 3QEJA 1ZM7A 2YC2C 1G291 3C15C 3TSOA 3CR8A 1U99A 1EFHA 1KK1A 2FU5C 4KBFA 4PHGA 1JQLB 2XZOA 4D26A 5E3HA 2R6DA 1QZXA 3REFA 1SXJD 1P75A 1GTVA 4C0QC 2W00A 2CK3A 5EE1A 4B47A 1ZYUA 2RKOA 5KSYA 1A2KC 2BM0A 2ONJA 1WB9A 3PENA 3LQQA 4WIAA 2W6JD 2WHXA 2ZE6A 3ND9A 1KSGA 3QI2A 3Q8XB 4Q4AB 3PUYA 3PITA 4TMZA 1J70A 3MUFA 5JCPA 1AS0A 1GG2A 4NYMQ 5EUQB 2IYLD 1TQDA 2GF9A 2GJAA 4A6PA 4BWYA 1KK2A 3HR8A 5AJYA 2X1VA 1OIVA 3V9PA 2B6HA 4QNRA 3VQTA 1NKSA 4CZ2A 3NEJA 2J7PD 1GAJA 3U3KA 4HZIA 2BJWA 1P2UA 3TSZA 3A37A 1NY6A 1YZTA 2BMJA 1R7RA 4BLTA 2DY1A 5CDFE 4PAQA 5G3YA 1US8B 2CCKA 4P4SB 3K1JA 2CK3D 4CGZA 4IXMA 1D2MA 1I4DD 1OH8A 4M1MA 1JAHA 2W6JA 4LY6A 2AXNA 3ETLA 2GVDC 2R62A 3IQWA 1EGAA 2F1JA 3T61A 2JLSA 5FBVB 3I62A 4JJKA 4Q21A 1E32A 5BW8A 1DBSA 2B8WA 2RGEA 3ZJYA 3HPQA 3MG9A 3MJRA 3IUYA 3SJBA 3KXIA 1QDEA 2V6IA 1DO0A 1XWIA 4OJQA 3TAUA 4DXAA 2QMOA 1N5LA 4E07A 4DB4A 4HUTA 1QBKC 2A5YB 4S35A 1KZGB 2ZUDA 2JLZA 2RGBA 2WTUA 2QPAA 2ZVPX 1DO2A 2QZ4A 1AN0A 3AVWA 5DN6D 3P32A 1DARA 1OFHA 4DT1B 2KWIA 4A15A 2O8BB 3AF4A 3OAAD 1EFRA 2IS1A 4LV8B 3GJ3A 1G4UR 1TEVA 2JA1A 4PX9A 4LBVA 3I3SR 4GMXA 4MYCA 2ZUCA 3HYTA 3MMPA 2J0VA 2ZI3A 3RS5A 4AG6A 3QG1A 4DLVA 1IN4A 5IRCD 1AQUA 1CULC 5G41A 1QHSA 4US1R 5CK5A 5KYKA 1E2PA 1KI2A 1F2UB 1Q20A 2D62A 3WMFA 4Q1EA 4TLDA 1P61B 2PCLA 2BBSA 4QGHA 4WZAE 1AQYA 1KDOA 2W0MA 4EPXA 2GBLC 2J46A 3EW9A 5HE8A 4DLRA 3GMTA 3SJCA 3U3OA 4F7WA 2IXFA 2LKDA 5B64A 4JLMA 3BS4A 4LJ8A 1ONBA 4JSYA 3T1VA 3W6OA 1UFQA 2EFDB 4NHOA 1E1RA 1E9AA 3EC2A 5C4GB 2GDJA 2PCJA 3P4YA 1E2KA 2DYKA 1G8HA 4OI4A 3VNVA 4YMTA 2MSCB 1SVSA 1FZQA 3B9PA 4TN1A 1SXJA 1XTIA 1Z0DA 1AA9A 2WSMA 3DHWC 3CX6A 1Z22A 4PFSA 1S2MA 3NHBA 1MV5A 3THWA 1II8B 1R4AA 2BKEA 2DFTA 3TUIC 1OB2A 3P27A 5UKDA 1G5TA 5CYPA 2VP4A 1FMJA 1SVKA 2H92A 4I99A 2VRWA 1VYTA 3A6PC 2OCPA 4PC6A 3FMPB 3NH9A 3FYHA 1W4RA 3FHOA 3AF2A 4XVUA 3W90A 2IHBA 2ODWA 2WJVA 2ZJZA 4II7A 1DAMA 1U81A 2QE7A 2YC4C 8OHMA 1II8A 1MT0A 1HA3A 4OI1A 4C2TA 4TT3D 3SBEA 2HCBA 2A5FA 2GEVA 3QNUA 1NLZA 4BFXA 4YQFA 1P3JA 1CF4A 1P2SA 3VHLB 2QP9X 4ESHA 5TARA 4AKEA 4IDQA 3CZPA 4PPFA 4C0SA 4OQXA 4CIDA 2Q3MA 1NBMA 4DLZA 4DBLC 1X86B 1IY0A 1NBME 3VFDA 1RC8A 1MABA 3G5UA 3LD9A 3PVSA 1E0AA 2F43B 1KO7A 2PT5A 2IS6A 1Z07A 2IS2A 3A4MA 4Q4JB 2QROA 1RRFA 1H8HD 3I32A 2AKAB 4KFUA 3AP3A 1XMVA 3ZQ6A 1JJ7A 2ZI4A 1G19A 1D8TA 4AI6A 1KOFA 4IEEA 2LWIA 3SU8A 1OW3B 2NQ2C 3OEHD 3HPRA 3QKTA 4KLZA 4MRSA 4OI0A 3PQCA 4XD7A 2JDID 3LLUA 4V0NA 3QPVA 1FX0A 2IYQA 3K9HA 4JBYA 2PZGA 4PAOA 621PA 3TR0A 1BYUA 1NIJA
chains in the Genus database with same CATH superfamily
1JT9A 2WMYA 1EIZA 1U4SA 4QEZA 5BWCA 1JDUA 1RD4A 3EZGA 1IK6A 4GR4A 1D03A 3KCQA 5LYJB 3WYFA 5JNRA 2I66A 4MRAA 1VA4A 4KEAA 1U0RA 2WWIA 3RO7A 4N5IX 4N48A 3NMUF 1F9AA 2BMEA 3DM9B 1XVAA 2B36A 5BT9A 4UHDA 2NO0A 3ZXYA 3CF4A 4JHLA 3GLFB 2PX4A 1F2TA 1YDMA 3CZQA 5KTRA 3CZ9A 3NHMA 4ZXFA 2NGRA 4L95C 3EMVA 3L0OA 3HFSA 1IJEA 3LF1A 1B26A 4IGAA 4M88A 4WACA 3TBKA 3ZY6A 4AMUA 4G5FA 1RZRD 4C0LA 3ECAA 3U4GA 4HMQA 4CKBB 3QLJA 1DV2A 1TZKA 5EUMA 1X7GA 2IS4A 3MHTA 1XRMA 3HU5A 4GUDA 3VO2A 1SIWA 4H6WA 2FJUA 3OZGA 1C2YA 4DQUA 2IUFA 4GMFA 2QORA 4TV9F 3UNXA 3KSUA 4YCLA 3VPBA 1YZ3A 1Q2XA 3WB2A 5LMCA 4E15A 5HWSA 2ZEJA 4M0KA 1YZKA 1FRVA 4JZYA 3D8TA 4XWKA 3DYIA 4OHUA 2XLCA 3IP8A 3IQDB 2VBCA 2NZVG 4MQUA 4LYFA 1ITZA 1WD7A 1T0HB 1C80A 1WVMA 5KREA 2CVOA 3PQFA 1TU3A 2PM8A 2X77A 3IAS6 5FT9A 3LSYA 1T8RA 4ESEA 5HUQA 2XUIA 1KORA 3WNCA 1JR6A 2DFNA 3TD9A 4GYJA 2WB2A 2D7CA 3TRJA 3CSDA 4DYVA 1QV6A 3JV7A 2X0KA 2GHIA 2OV6A 3ABRB 3RK1A 2Q5OA 1ZH8A 3Q2KA 3UYLA 3BD8A 4JB3A 2RFLA 4O59O 3GELA 2VYCA 1L5QA 1AU9A 3H9GA 4PSDA 4OIFA 1NASA 2ERXA 2Q9CA 1L8XA 3G5LA 4NWIA 3RVDA 2JIBA 3SY8A 3SYKA 3UVEA 5HZMA 3W1WA 4MSUA 3RAJA 2QN7A 3ENNA 3PUWA 4GICA 3NW9A 2LVBA 3ESRA 2R0QC 4LJYA 2ODPA 3J81A 4WVFA 2O4CA 4Q1AA 3SLKA 3HB5X 3HKEB 4CM4A 4FILA 1KY3A 3DAPA 4V39A 1Y81A 2GVZC 3Q5DA 3C3XA 2EQ5A 2JIZD 2LW7A 1E1DA 2YW2A 3QXXA 3JZDA 4HNQA 4MGZR 4OUDA 1JZQA 4CM6A 3GDOA 2FJ0A 2ZATA 2B5WA 2MSEB 1NSYA 1TQ8A 1VJTA 2GZMA 2AYZA 2IX9A 2JEYA 3FDFA 4Q6BA 5A3JA 2NO9A 1D1TA 1NR7A 4BIIA 3FAZA 4HNSA 3EDCA 3IMEA 3WWEA 5K9ZA 3DMNA 2W6IA 2ZT5A 4UZEA 5HPYB 1QQBA 1P4SA 4XH9B 1FPMA 2R5NA 3WB0A 1N8TA 4G5QA 1SHTX 4QBHA 1RYZA 4DR1B 1IE3A 4DCTA 1ZL0A 2Z9CA 4NBNA 4QYIB 3T12A 2RHLA 2HLDA 3GUHA 4YIKA 4PTZA 2Y0EA 3PS9A 1MJGM 2SICE 4AZ3A 1QQ6A 3EVFA 5F21A 3KPUA 2HTFA 2EFCB 4CF6A 2KPOA 5AI4A 4JUCA 1T2AA 1ZNZA 2FPMA 1Z62A 3PX2A 5A5FA 4PO9A 3K0SA 2LCQA 2LDXA 1WS6A 1A77A 4IVQA 2XEDA 2EXXA 3C1OA 1RPAA 3MCWA 4RIHA 1F5NA 1AV6A 2CNBA 3LCCA 5M04A 1GIAA 1O4WA 1LV8A 1RWKA 2VPTA 3ILHA 4GI2A 2ZTSA 3KDSE 4NNPA 4R8MA 1RAEA 4W7HA 1YB4A 3D1LA 4RM2A 2V3WA 2FEOA 4Q0MA 4RPJA 2JGKA 2VRBA 1FJ2A 2YS7A 3I28A 1ECPA 3ZJUA 4RJIA 4K3UA 3P2IA 1ECFA 4UXHA 4Q3NA 5J59A 2CW5A 5E1MA 2C82A 1W2WB 3LI2A 4JD5A 1YB2A 1OT5A 2CF5A 3IOCA 3L05A 4BNLA 4HQFA 1L4EA 3NRJA 3LPAA 2NU7B 4MAAA 4RIIA 5DISB 4CHTA 5BV7A 1DADA 4LNHA 2IH5A 4OFWA 3QF7A 5DGIA 2PJRA 1YHYA 4ER3A 4IO0A 4ZI7B 3PNMA 4BU0A 3OLVA 4ARIA 4JUAA 4BB0A 1D6JA 1CBUA 4WBSA 5IMBA 4D97A 3KKZA 3VYVA 1KMHA 3MXTA 5DE3A 5E7QA 3IJEB 4KWHA 4HYQA 3RVLA 4C4YA 5AIBA 2HA0A 3OIFA 3Q41A 4HH3C 3WLJA 1E5VA 1WHTA 4EGQA 2AUTA 4EPYA 5EJFA 3DNPA 4I81A 2NYUA 2IE0A 2EBFX 5ECGC 1MVNA 1ULBA 2LDBA 3AHHA 5COBA 5TEVA 1T2UA 1EJ0A 4LDJA 5L3VA 2FFHA 4Z4EA 1QOQB 2CJWB 2WF8A 3NT4A 2WG0A 1BD3A 1NVXQ 1UBLS 2YYSA 3LGXA 4MAMA 3FRJA 5FPSA 3FD8A 5EQDA 5IYZA 4UTZA 3G3EA 2GZ2A 2R60A 5JZVA 3EZ9A 4YV1A 4W9MC 3D4BA 3EPJA 1MMFB 1VP3A 2PGNA 2Q3EA 4MGHA 1DT3A 2HV9A 1CUWA 2I2CA 2IGTA 1YS4A 2QXTA 2RKBA 2X41A 3TJRA 5AD1A 5JYEA 4FU0A 4L4RA 1B8VA 1L5FA 2F3SA 4HZUA 5D01A 3M8KA 3OY7A 5DW0A 3RW9A 2K2QB 1SVOA 3PQ8A 2DPXA 4M4SA 2GPYA 3ZEAA 3GCDA 3WX0A 2GN4A 1U7OA 1CQJA 1XLTC 1E6WA 4WEQA 1OYVA 4X8OA 3ZWBA 5LQNA 4AF8A 2BCGY 4XEHA 4K05A 1YE5A 1W48A 4Q00A 2JCXA 4EI2A 4F9TA 1KYVA 3KSDO 1BROA 3RIXA 4DMUB 3FVRA 3PDJA 4R2JA 2FRDC 1E0DA 2FG5A 1NVVR 1QWOA 4LHZA 5IJZA 3VU3A 4C7MA 3O0TA 3I9V1 4M9XA 1XQYA 5C3UA 1P1HA 4EG8A 1HNNA 3UKOA 4AY4A 2XD4A 2H7YA 2HA3A 2JIQA 4RZHA 4PXAA 2E37A 1V8BA 2QV0A 2EKPA 3JRNA 2CNDA 5IAEA 1FVHA 1GPWB 2BZ1A 3A9RA 3B1KA 2PV7A 4IH1A 3EXHC 3PNYA 4PSAA 5DT9A 4QJ3A 3E58A 3HEBA 4E2FA 3DV0A 2V6GA 1PG2A 1H6DA 4YO8A 4M99A 1SVMA 4LCEA 5JRDS 1ZIXA 5AJWA 1H22A 3LY5A 3FZQA 1O95A 5ALPA 3T1NA 4BP8A 2ZBDA 1OKKA 2PU5A 3SXUB 5JHHB 1HM5A 3BSYA 4ZQBA 5C80A 1DBIA 3VTKA 2EW2A 2HU2A 4Z3OA 1ZSYA 3IV7A 6AT1A 2PXCA 1FXWA 2CLMB 2I6XA 3E18A 3LVRE 1E64A 1RKVA 4KO3S 1DIRA 4ZCSA 3WLTA 2B5VA 3ZWVA 5CX1B 4WKBA 2ZRPA 1VI5A 1L9XA 1OASA 4IZOA 4DIOA 5DMHA 2O8FA 1Z5OA 3ZEIA 1G98A 3NANA 4C0AC 3R7WA 2YWRA 1Z06A 4Z7OB 1QGYA 3DLHA 2CCJA 1Q7BA 5K0NA 4G8BA 1TCVA 2F2TA 3NM4A 3BGWA 3AR8A 3O8NA 4LC0A 3RC2A 2GVNA 4EFKA 3AK4A 2HHAA 2Y27A 4LGVA 3COPA 1TRHA 1VG8A 1W4LA 1QIHA 1XD2A 2OL4A 3E2PA 1I1NA 2FMHA 2X0DA 1KMCA 1DS6A 4OQFA 3O74A 4YDHB 3TQTA 3NALA 3NM5A 2XMRA 2XY4A 5E1BA 5HEKA 1TKBA 5B58C 5F35A 1E3WB 2VHCA 3CF2A 2LIVA 3ONEA 2NQ8A 4FGWA 4AKTA 5GWXA 4ALJA 3QNMA 1H3FA 1GRQA 2MMCA 3KYIB 1FUEA 3R7BA 3GDWA 1KWGA 4X8LA 4HX2A 3LAWA 2AG6A 3KZCA 4RH1A 3FN4A 5IZCC 5C52B 3CVVA 3SIWA 2ZG6A 4DB2A 4MPTA 1TZ2A 3WG9A 1O57A 5IKOA 4LF6B 4BN0A 4TZ6A 3M3HA 1DBVO 1G9TA 1Z7BA 2QVZX 2RJ3A 4ZJYA 5GVRA 2GPAA 4URZR 4WVLA 1DMSA 1PJLA 1X80B 1SJ9A 1QDLB 3TDKA 2JCGA 2RH4A 3RSFA 3T3GA 5LJIA 1VG9B 3FXAA 1QX4A 4WX2B 1VLLA 4BGIA 1X13A 4XIGS 1EK1A 1VHLA 1EB9A 2RGGA 3KQLA 4IIJA 4D6XA 4L5IA 1RQ2A 1R6TA 2QTMA 3F6PA 3REOA 4RH3A 1XL0A 4JL8A 2PXAA 4MWOA 5EIBC 2ZYRA 1II0A 4EJSB 1ZCBA 2YY7A 4N0MA 1ZM9A 3KV1A 4LXTA 4E5VA 4Q7MB 2Z2XA 4K2HA 3DE7X 1ZWLA 3ESZA 4A2WA 4MQEA 1TM1E 2BONA 3PIDA 4GBGA 4YPVA 4LDNA 3NIWA 2I3AA 2X14A 1VZ3A 3PCRB 1IL0A 1ZIYA 1Y1KE 1N3IA 1Q21A 4GKKB 3A27A 5DGTA 2XCSB 2GFIA 2WWGA 1ZU5A 2PPLA 1OGIA 4I4LA 4IIEA 4O5OA 5ENVA 5ARDA 4D92A 3IAXA 3DFFA 4FOSA 5ALIA 4PN3A 3I6QA 5KVSA 2ATEA 3E53A 2RAVA 3G8DA 1LQUA 1ZU4A 2HLDD 1Z8NA 1MEJA 3AESA 4PZDA 3G5AA 4GGMX 3U4QB 2B82A 2V5UA 4HVCA 4I9FA 4Y9UA 1RMQA 4MUIA 3R3UA 4WCFA 1ZGJA 3SQOA 2J3MA 1M2FA 1G3IA 4DADA 3WL7A 1ECGA 4C6HA 2SNIE 2XIJA 1CY2A 1P0FA 5DNEA 4X95A 2AMLA 3R7LA 1ZCJA 5CB8A 2GTHA 1SRRA 4HUJA 1XMIA 2NVUA 3WVNA 3ZE2B 4MITA 3PTAA 1P6UA 3D9QX 4DSAA 1ONOA 4DTCA 5IANA 4UTNA 3OKFA 2DBYA 1QF9A 2QDKA 2HTEA 4N8SA 3FFWA 3NHFA 1IVSA 2F1IA 1O54A 1QGZA 4RKRA 1K68A 5EMNA 2WTAA 4CIVA 4PCUA 3I3OA 5IJAA 1W25A 3F0TA 1SOVA 3MW8A 1M1XB 5JQGB 5DHAA 1OKKD 4HDNB 1OREA 3DUFA 3EVBA 3UYKA 1UXJA 4MHTA 4LZAA 1W35A 3I76A 1AKNA 1PBTA 2O5CA 1C2TA 4OA8A 1GD1O 1NUSA 2HJRA 3GVXA 2J9ZB 1X7ZA 3LP8A 2C4HA 3RYCB 3IILA 3Q85A 3INRA 2GRJA 1C3OB 3D3EA 5DK6A 1NJ1A 2C5GA 4NU6A 2ODAA 3BMNA 3LHIA 1W0JD 1XAIA 1XP8A 2QZZA 3MWDB 3EDRA 3QJGA 4OFBA 5C7YA 4B85A 1ZNYA 4J0EA 3DC7A 3DTVD 2XBUA 5HQ3B 4ZVPA 4CKCA 1XPOA 1ZK0A 1JYEA 2IGBA 4KHPB 5JASA 2CXPA 2ZSHA 4FDMA 3ZWOA 3A1NA 5LQSA 2CMGA 2IZ0A 1S8FA 4KN5A 2SCUB 3FZNA 4JLPA 3ZDZB 5BSUA 4HGQA 4LVOA 3EF1A 3C6XA 1BXRA 1L4LA 1GNTA 2CMHA 2AF4C 3HL0A 3DV2A 4K6HA 1J5XA 4Y3UA 2NTNA 4YREA 1N2XA 1PEDA 3CU5A 3LA6A 1O0BA 2A6PA 1V7CA 1EK5A 2ZPTX 4R1MA 4YRQA 5TVKA 4Z6KA 1X14A 1XEWY 4IRXA 1Z4NA 1GA1A 2R00C 3HO8A 3U7RA 4XI9A 3EG9B 1BOOA 1Z0SA 2UDPA 1I51A 1T1JA 2X1HA 2JGNA 2CVZA 3QPDA 4I1OA 5K3SA 3FUXA 4WFQA 4DIEA 1JBEA 4ZDIA 4EJ2A 5JXHA 4JNCA 3KYDA 3B36A 3PB3A 4IO1A 4W5TA 1Y8AA 3PUVA 5LLDA 1O03A 3A6GA 3OBIA 3LKDA 4IHQA 2FZ5A 2BLNA 1X8LA 1XRQA 5LPNA 4EM6A 2HHJA 4V3BA 4YAWA 3WGHA 4TYYA 4MUXA 1WXGA 1KETA 1LA2A 4O4LA 4BP9A 3EQ9A 1QP8A 2HJWA 3BAZA 4ITVA 1HV8A 3R09A 2W4QA 3R3WA 4DXDA 4X7PA 3EGXB 2JFQA 2O0KA 4A92A 4GC5A 3PLRA 3RBXA 4J0FA 4BLPA 4IDNA 4CHGA 2E87A 4ZGGA 3ZDXB 3CNBA 4NABA 3ED5A 1PQUA 3FNHA 3FTPA 4V3CA 2EJVA 2V65A 3HXLA 4W1SA 5H3CA 4B45A 1IXYA 2OK8A 3BMOA 3TVDA 2WMOB 4REMA 2G9UA 5C37A 4P9NA 3OEHA 4FMCF 4I50F 3CRQA 3FZYA 2ZJFA 1JU3A 3AUYA 1VHDA 3TH5A 3EEQA 1ZR4A 4EPTA 2KS6A 3G2IA 1TADA 2COUA 2FEPA 2QLJA 3G6KA 4TWJA 3E9NA 4Z3DA 3VZQA 1TYAE 1KSHA 2G76A 2E55A 3DMGA 1P4AA 3ZCXA 4KIFA 2E0IA 3IODA 3TRKA 2ZWMA 4Y8VA 4MKXA 2NYRA 5AVJA 1X19A 4UDNA 3ZVNA 1G8GA 4Q19A 2ZSUA 3A9SA 2JLRA 4N18A 2B6NA 2FH5B 2H48A 2OCAA 3EXIA 3NIBA 3OZEA 3PWSA 4PCAA 3REQB 2P2LA 4CLRA 3P71T 2IXDA 4L3VA 3KZMA 4CLHA 4DIMA 4F5YA 1JP7A 1YVEI 2GD1O 3LVBA 4IDFA 1FRNA 5HJ7A 2M32A 3BXEA 4QOFA 3OPVA 2H52A 2G82A 5HF5A 5A0VA 2QRNA 3IEUA 1TMKA 1JE0A 3N2YA 3GJZA 4BCDA 2FQXA 5K4AA 3VPFA 4ENSA 1P8JA 4HLUA 3FPFA 3GEBA 4RZIA 4RTNA 2O5EA 2ZRDA 3LUBA 1YJBA 4KE6A 4DMGA 1ACJA 3IURA 1O5IA 1FDTA 5CYOA 2ZI9A 4HTFB 1ZINA 1CUCA 3I6YA 5G1PA 1N7JA 2F1OA 2JW5A 3TDNA 3LDHA 5C81A 1U63A 3ILVA 5KMGB 1P29A 5C8ZA 2GXAA 2V3CC 4LDRA 3QPCA 2CLSA 3HJFA 3D4LA 2H9YA 3ES9A 3HADA 1UDRA 3V4PB 1B3BA 2XT6A 1P45A 2GNPA 2ZVJA 4U2EA 4Q82A 4BVAA 4I66A 4REOA 4QXMA 4B7CA 3BD9A 2UYQA 4DCNA 4AYWA 4EB6A 5FJJA 5L6MB 1XU9A 3HB7A 4DCCA 3JRXA 1JKJB 3HA2A 1YDGA 3LHKA 3M0EA 3PQ6A 4K9NA 4D5EA 3NTLA 5K3EA 1T6NA 1Z4KA 4DNPA 4DR3B 2AW5A 2N1BA 1R8SA 3SVLA 2COKA 4QDTA 1MDFA 3OF3A 5BVHB 1AUVA 4R6XA 3N0TA 3IP6A 3PFWO 1H0HA 3H05A 5TPWB 1TKAA 1KI7A 4MLCA 4CLOB 1ZGGA 1FYDA 4BNDA 3BL8A 3E3MA 5AFSA 3KJIA 2EFYA 2HLPA 2AHRA 3JAKA 4RCYA 4W5QA 3HU2A 3ZPXA 5BYAA 1JDVA 1N6NA 2R6AA 4ML3A 4BY9E 3G2KA 3ROZA 2OGSA 4OMCA 1U2RA 2CXQA 3G2OA 4NYIQ 3N76A 3O3NB 3ZY5A 3KUCA 4RHTA 1YRHA 3HUTA 3COVA 2H0QA 3OFND 5DP1A 3TM4A 3WRYC 1X2EA 2B4TO 4QUBA 3MTQA 3ZVLA 1GG8A 2JVKA 5FLXA 4RH0A 3H2KA 3CKKA 2ZJ5A 2AFIE 2V7UA 3HU3A 3LUHA 3PDHA 1XJ5A 4WZ6A 3RYFA 3I5MA 1NW5A 2OWDA 1QMGA 1IU9A 1XVVA 1E1LA 3DTTA 4QPNA 2Z57A 4XVQA 3WHIA 4PZ9A 3CV3A 1HDOA 2QIPA 5JCZA 1R5OA 4DM7A 5G40A 1JKMA 5ISMA 2FNAA 4DNQA 4GOMD 1AQLA 2FP4B 4MGEA 2GJ9A 4ZAWA 2OZKA 3QG5A 1XJCA 4A8JB 5JTUA 2I9KA 4URWR 1IZ9A 2ODBA 1ABEA 2PWBA 4WXRA 1JWLA 3OKCA 1QIJA 3NEPX 4QHYA 3TMKA 2IHKA 4TVKA 4CDRA 4J1QA 4BO7A 1JQKA 4OHBA 1RW4A 1B0PA 1EM8A 2BJVA 2NO7A 1NLYA 3I73A 3IUQA 5NULA 4JASB 4O02B 2ZS8A 2HNKA 3TBFA 4YRGA 3LYAA 1RZ3A 2FEKA 3SOPA 4D0RA 1ZGZA 3T1TA 3HO6A 1J7JA 2AH5A 2XZLA 3JR3A 5JEEA 1NMZA 2YCLA 3ZDQA 2ZXFA 2ZGVA 2WHYA 4AX8A 4LFCB 4B17A 5DM4A 4JIMA 4QDOA 3FLMA 4JDPA 5JIBA 1AMOA 3OPYB 3DNMA 3BE4A 1R0RE 3O8CA 2VTBB 1Z8FA 1NP6A 1E9SA 4IIYA 3U39A 3RRZA 3V6LA 3TZCA 3L49A 1QRAA 4L5JA 4P08A 1C30A 1N5IA 1CHNA 2O3SA 1DSSG 1ZCAA 1JLLA 2I7TA 1JLRA 3HLTA 1DUSA 1XXHE 3H2SA 4DCSA 3WGZA 4EW3A 4ZK2A 2X3FA 3OPYA 3H7AA 4JLJA 3ANTA 4DSTA 4H18A 4IY1A 2ZITA 2OCIA 1R15A 4DV7B 4KFCA 3NBAA 4TPKA 3TZLA 1RFLA 1MAAA 3L06A 3KKPA 4NDNE 1SQ6A 1E1YA 1D2RA 2RGCA 5LA6F 1Z6GA 3STUA 5MN6A 2ZRCA 5A4AA 7MHTA 2WZDA 3ABIA 3E05A 3OTWA 4MR9B 3V4SA 4AYXA 4CQJA 5CFZA 4JYAB 4G1VA 3TIFA 4P7FA 4G24A 3SNHA 3ORFA 2B37A 4I9GA 3NEAA 3P1JA 4UBIA 1XO1A 1PFYA 3JQ9A 721PA 1SD2A 3ST7A 1W6UA 1X8XA 2XWJI 4GYYA 1GNLA 2NZWA 1WUTA 2ZRIA 4TLLB 2B7CA 3FGOA 2Q27A 1WCIA 1Y6JA 1RJDA 2DSTA 4ERXA 4NCBA 4GKJB 5ES4B 2R8OA 3G2NA 4F97A 5CVDA 5CBKA 4ARVA 5H82A 3CUWA 3KHUA 5DIFA 3O8LA 3G79A 4YJGA 5CT8A 5CDFA 1NFQA 1ZVQA 2DQSA 4HUQB 4YR7A 1B0AA 2C5AA 4FFVA 5JD6A 5IWAB 4FB5A 2FDCA 4H3KB 3MUOA 3QRWA 5BYBA 3O83A 1B00A 1WO8A 5DB4A 5I7HA 4XM2A 3AETB 3KG2A 1UBUS 3QFFA 4R9VA 5T3UA 3IRUA 4MGYR 3WBKA 3OJFA 2PKEA 5T5QA 5JMWA 3WGJA 2NAFA 4GP7A 2IDJA 2GAOA 4NESA 1OSNA 1Y6GA 3D4PA 3PCXA 1XELA 1M2VB 4M8LA 3GP5A 1ZHOA 1P60A 4ZGBA 5DP2A 2YZKA 2IUUA 1EHIA 5FFFA 3RFTA 1SUWA 3IBGA 1R1DA 2QW8A 2O06A 4ZXPA 2GAIA 4D56A 2PQ2A 3NDJA 4JLDA 5D8DA 1KNXA 3BMCB 4DQ0A 4F5WA 1YS2X 2J9FB 1UK9A 2J87A 3EZ7A 4Z99A 5EIOA 4BHTA 4NDZA 3MN1A 2FFBA 3AL3A 3LOPA 1QHHB 2CFOA 1ZQ9A 3BPSA 3BILA 4QBTA 2LR0A 5AKGA 3ZCVA 1P9NA 1ZD2P 4LE0A 4DVGA 5EWJA 3RUDA 3R7NA 3GG9A 3KKLA 3OP1A 4EDFA 5AW0A 5B3JA 2HA5A 3GVHA 3GZ4A 4UU7A 4ZHQA 1PNTA 5SY4A 2WQZA 4QTYA 4HQKA 3UHAA 2IFTA 1GQQA 2R48A 2VJLA 3BAFA 4MDYA 5T6BA 5B7PA 1NI3A 1WPXA 1J2UA 4MJLA 3S2IA 3AKDA 1SU4A 3IBTA 4N6GA 5ICFA 2EFGA 5JSZA 3EMDA 2YASA 3KJGA 3N2KB 1H2AS 4DOMA 5LD2B 4AX4A 4E09A 4EPRA 3CGWA 3F8TA 2QMYA 3M1YA 5DEIA 1JKFA 2DF8A 3R6GA 4NE9A 4WKOA 4YA6A 4YACA 1A8IA 3O8OB 3KVVA 5FWYA 3VMMA 4FNAA 4L27A 5EKSA 1E2FA 1F8GA 2CHGA 4JCOA 2C03A 1E62A 3BRWD 2KBFA 5EY5B 2BGKA 4J4HA 5SYNA 3WQRA 4BUCA 2CNKA 3HR4A 3MRSA 5SYAA 3ZHQA 4KMRA 3PFNA 3ZGVA 1HK7A 2YDXA 5GADl 2HQRA 1VL0A 3LFHA 3SM3A 2ODEA 3NVMB 4J94A 4ZQGA 4GL2A 3VI4B 1CYEA 1GEGA 3CZ4A 3G9XA 4R2LA 4HSEA 2CWWA 4C4TA 4R5MA 1P4HA 4KVZA 4WBXC 3CRNA 5ENDA 4YCMA 4XD7D 4JKYA 2GBLA 4DW8A 1WHSA 3GJ7A 4ZIRA 3AEKB 2DH5A 3D3WB 4L8GA 4NDAA 4EI8A 2Q4BA 3A4IA 3KO8A 4KNYA 5JJLA 3L43A 3QU4A 4EYQA 2R4QA 2YWHA 4DVJA 1X9GA 5MHTA 4DXHA 4L5AA 1SUBA 3NNNA 3H42B 1M8FA 4D4MA 4MW0A 1QDUA 1G4HA 1QGAA 1NF2A 4BFVA 2CKMA 4BVKA 3HFRA 1FFAA 2WK1A 2RSLA 3JVUA 2VVTA 2CLHB 3KV3O 4Y2SA 3C6KA 4X1YA 4B5LA 3ER8A 3ROEA 4ALIA 3CLVA 4Y98A 4KQEA 4TMWA 3D1VA 3OOSA 4ALMA 4EHKA 2BOVA 3CWZA 1FYXA 3MTAA 4BJ1A 4R71A 5JMOA 1JTEA 2IA5A 1NN0A 1PFUA 1E2HA 3V2HA 3HRKA 1QO7A 1QHFA 5ALZA 2JIMA 4K1LA 4P0QB 2DQKA 1M6NA 1WKVA 4AZTA 4RTMA 4NCAA 4CMEA 4AN4A 2X19A 5CRIA 1SKUA 1PU2A 2JJMA 2BUCA 4O4IB 4LXIA 1DJLA 1Y3FE 3M7IA 4FZ5A 4ZI2A 2H1IA 1IM8A 1YQXA 3W6PA 1NX9A 2QRKA 1U5BA 1YOVB 2GKSA 3KYDB 4FCCA 1G7SA 1KI1A 1J9ZA 3CO0S 3WK5A 1R6VA 1T2DA 2XUJA 3M82A 9ATCA 2HW8A 3QBVA 3KX2A 4D98A 3PFIA 5JAZA 3OJWA 1PO7A 1TQ6A 2TMKA 1Y34E 3ZK7A 1UPTA 1INLA 1H0RA 3G8AA 3MMZA 2OWEA 3G0IA 4K0RA 4OOEA 3T0IA 3ZJ5A 2Z3WA 2PBLA 4P3KA 5E4JA 4F93B 2QPTA 2X9LA 3N2IA 3LT0A 1NR5A 2ZUBA 2HH9A 3EUWA 1RDFA 4YT5A 4RPCA 5ALDA 1N5RA 2J85A 4HV4A 1LVGA 3WRXC 4AT1A 3PXEA 9LDTA 3ZS8A 4QDJA 4ALLA 1NBOA 3WGUA 1JDTA 1A8UA 1DDGA 4EB3A 2D1QA 1ZI9A 2OZEA 4RIFA 4AN0A 1L7PA 1BWQA 2W11A 2JJQA 2Z04A 2GO1A 2WT8A 5K3CA 5K6AC 1ORDA 4XJSA 1BQ3A 3AOEC 5LXTB 3AKEA 5DK4A 2D06A 3BQMB 3VC2A 3ZYZA 5F5XA 2VUTA 1SXJB 4X93A 2J6CA 3O1HB 4ZWNA 3VC3A 5A2GA 2YYYA 2OHHA 5H8WA 2PGOA 5I48A 4PRKA 1XN1A 1ZS9A 3F9CA 3PQ4A 4XOIA 3OZVA 3KUDA 4PHTA 5BW5A 3HCRA 2WTMA 3A6DA 3QKWA 3S1SA 3WA7A 2C42A 3F74A 3HCBA 4PAMA 1CU1A 1PZFA 4GE0A 1Y1QA 4LJ7A 4QVGA 2D2XA 3RYTC 5SY9A 3NGXA 2YIDA 1S1MA 5DHTA 3EG5A 3FYUA 1C0IA 1J07A 4MVYA 2XADA 1E4YA 3U4AA 1T5BA 3GQBA 3UXHA 4IIFA 4ME6A 5L9AA 3FOBA 1QIKA 2G1JA 1CKEA 2WKSA 1COZA 3MOSA 4LHVA 1Z2EA 1K5DA 4Q03A 4QT4A 8LDHA 2FETA 3KB8A 4TWIA 5IEBA 5K5EA 3N3BC 1HE3A 4JP1A 2WSYB 3KL2A 4PRYA 3M34A 1N6PA 1QVVA 2GN1A 3CUVA 3PUZA 2PL1A 4NFHA 1D4ZA 5FOUA 1Z36A 1W5EA 4EG5A 1KK3A 1XE3A 3SQLA 1BMFA 1RHUA 3LE8A 2Y6UA 4RF3A 5K45A 5JR3A 5AVZA 1UPFA 2ZANA 3EQ2A 3UUGA 4RKYA 5E0KB 1JFFA 1ODKA 4BEVA 2P2SA 2O8EA 1KDTA 4RY9A 2FHPA 4FGZA 5CIWA 1E61A 3EHEA 4WA7A 1CETA 1G2QA 2X4GA 1CR1A 3I6MA 4IIVA 4B2IA 4YH1A 3ELDA 2RH5A 5FOQA 4WZZA 3I5AA 3VYWA 4DEYA 1SOUA 4GVXA 3NKFA 5AUOB 2UUCB 5TX7A 4CQNA 2GZ3A 1NV9A 2QUJA 1BRMA 2FWMX 1U7WA 1HBJA 2HHCA 3AUAA 3KYJB 3AHGA 4I9HA 5CP8A 4OJMX 5DNCA 4ZYWA 2YNMA 4M0EA 1IN6A 1I9GA 3TFWA 4JGGA 1P74A 3A6ZA 4F5ZA 4KC0A 4HDAA 2NUAB 2RHRA 3O95A 2GXSA 3BA6A 3FTFA 1UBTS 2QRVA 3G2QA 2VF8A 4UE3S 3H5IA 1EWTA 1TJ4A 4JITA 1R16A 2BN4A 4ALKA 4ZRDA 4DQXA 3M4NA 4ISCA 1T8PA 4EG0A 3ZZMA 2AOTA 4UTVA 1U3UA 5TEWA 4FQ5A 5BORA 2ZB2A 3DFMA 3TTVA 5SZJA 4MRNA 2O2SA 3MBOA 2OZVA 2WRZA 1GRVA 4UJ3A 4ZMSA 2JI9A 3RTGA 1EZZA 1NI4B 1PJQA 2PR2A 1GPLA 1NZJA 1VPDA 3FWZA 3LCMA 4MS1B 4KRXA 1VDZA 1A5AB 1G0NA 4BMZA 1RZUA 1P0PA 2FMKA 3H16A 3QVJA 4J2TA 1W0KA 4ZO8A 3U7JA 3WISA 1PGJA 1XMSA 2YV4A 4RTRA 4DMMA 1HH4A 2DQYA 2GK3A 5DCWA 5AHXA 4EKGA 3SN6A 2PQ6A 3CVWA 4TMKA 4KFTA 4MKZA 4N9QA 5CFMA 3SMQA 1ZSVA 3H1TA 3PHHA 2Y66A 3AB7A 5E2AA 3WP1B 1KQGA 2FUG1 4IIDA 1PSWA 2FY8A 3HBAA 5FNVB 1VJ0A 3LXMA 4F60A 1MG5A 3B12A 4IYRA 4KWIA 4U8GA 3RS4A 5F78A 3H2ZA 4D46A 1ZRHA 5DV9A 4EABA 3M6VA 3MC1A 1XQXA 1A7KA 3QOFA 2QLFA 4YALA 2R5FA 1SXJC 4Q9AA 4C21A 2GK4A 2QT1A 2X5JO 4P84A 3RFXA 1EXDA 1WEHA 1KC1A 4HFNA 1YFLA 5EXXA 4BLWA 2AFHA 4FJ2A 3BKWA 1E59A 2DR0A 1IJKA 4K9QA 1RPZA 1GKUB 1Y7TA 1QC5B 3KQWA 4OK3A 4XGIA 5C8YA 5IKMA 3QVXA 4EIWA 3HB4X 4ENWA 1IQUA 5AI0A 2V3VA 3HBFA 1RMTA 4WKGA 4BQPA 4DBVO 3EYAA 4QYTA 1U3CA 3RC3A 2VQ3A 1OXBB 2C61A 2QR2A 3AM1A 2XMQA 1U2PA 3QVKA 1M34B 4YDSA 5DKFA 4IQGA 1DEHA 4XEUA 3KOXA 2WAMA 3ILSA 3IGFA 5KB3A 2OVFA 4GMDA 1JR3A 2WTNA 1EU1A 2B3TA 3L0SA 4OHZA 3UJNA 2ZRKA 2QM7A 1UXHA 1K5HA 2B99A 2AI2A 1AGYA 3AMVA 3PHLA 4BLRA 3DMPA 4Z9YA 3ZGYA 1M83A 2ZIEA 5THXA 1WU7A 4IH9A 2D00A 1C7JA 3QNWA 1QGDA 3B2EA 2H1WA 2NO1A 1YOBA 2ZWVA 4LK3A 3PQ7A 5DM0A 3NYIA 2GEDA 3RPEA 3K72B 2PMWB 4LV5B 5TS2A 1BVUA 4MJ3A 2SHKA 2PMKA 5EIAA 3LP6A 4CL0A 4E94A 5KQGA 2VLIA 1GVHA 3M5DA 1UFRA 4HX9A 4ZREA 3KKOA 2UUBB 2QVXX 5K03A 5AK6A 2ZT6A 2BGGA 4JJ8A 2ZYAA 3CSUA 5C1IA 1JEEA 2QIOA 1NMXA 3WV5A 4EHHA 3AIKA 3HCFA 4YAKA 1E3MA 4DNXA 2YHAA 4PGFA 5DULA 2BKAA 2O0MA 3B85A 5JAPA 2VFAA 3RRFA 2C1XA 4J16A 1OC2A 5H68A 5F98A 3IX7A 3ZLUA 4CGYA 3GC6A 1GGKA 4E3WA 3FCOA 1N1DA 2DHCA 4QFCA 3W2HA 3ZJTA 1G18A 2FPPA 4L5YA 4QOEA 1KJYA 1XX6A 3KQOA 4P7GA 2VYFA 4TKUA 5CVTA 5C8VA 3AHEA 4BO6A 3W3ZB 4FI3F 3NFYA 3SI7A 5KTTA 1V4NA 4NJOA 1QG6A 1RHKA 4CL8A 4YT4A 1PR3A 3RR2A 1C9JA 2B83A 2O1EA 3DDSA 3MJHA 3WLEA 4UOZA 2IH4A 1XQ6A 4JQZA 1Y6QA 3FNIA 4JUFA 5JAQA 1G3UA 2Q5EA 2QAGC 3Q8WA 4M9UA 4E5SA 1DX4A 4GYWA 2FN7A 3NZEA 2NQTA 4URYR 1L3BA 3B89A 3O84A 4L6AA 5FL7D 1XNJA 2CLEB 4L51A 1FC0A 1KIMA 4J29A 3BM5A 4UZFA 1N3YA 1B42A 3N74A 3OU2A 5BUSA 1P7ZA 1NE7A 1UJNA 2JVIA 2Q49A 2W83A 1V39A 3R5FA 1T34A 2BMDA 2XGMA 3GLKA 2H65A 2ZYGA 2ZK7A 3TRIA 2FWNA 1XJ0A 3JVEA 3MM4A 3N1UA 4FD2A 1XDZA 1LBSA 2PWAA 3AINA 5IAGA 2NSHA 2IYWA 2Z4RA 3P26A 4XM0A 2VJCA 5HS6A 5HFNA 1QFJA 3V42A 4D4LA 3D4NA 1P1JA 4BZWA 1RKUA 5AM4A 5F51A 1E1CA 4J3JA 5BWMA 4UM9D 2Q3JA 4KGVA 1JIUA 3IULA 2AMYA 5FO0A 2X2EA 2EBHX 2PWPA 3I37X 3HGMA 4G0YA 3R8CA 1C3XA 3DO6A 3OBBA 4QBKA 1JA9A 4YDRA 1TT7A 2ZWIA 3LRPA 4HDSB 4ZHSA 1GGJA 1XQVA 1A4RA 1L4NA 2BHSA 4KR0A 1WY7A 3UICA 3ZWCA 1J2RA 2MMGA 3DOIA 1UPBA 3ZJVA 3LQRA 3NTOA 2AG8A 3LHFA 5EWJB 3ZE6A 1HUQA 1Q0RA 3WK4A 4ZT7A 5B1IA 2ZT8A 3G13A 1B4DA 5F5NA 3IOYA 1AK9A 2BHLA 3WO0A 3ZIAD 3MBIA 3H5AA 2I6GA 4OK6A 1FTWA 3RUPA 5IF9A 1CX9B 1P1IA 2Q7XA 3WYNA 2PZLA 3BMCA 1M1NA 1VKJA 4D8TA 1YFZA 4M54A 3ZIUA 4CR7A 3JQ8B 3WL4A 4F8JA 1P72A 1RCUA 3C3YA 5LZ9A 4MLZA 3WL5A 3JQ7B 5IFKA 5HG0A 4X97A 3VR3D 2BGWA 3E81A 4LDZA 2HRBA 1L6RA 2DQ4A 2HY7A 3M6UA 3E7WA 2NVBA 2AFHE 4EH1A 4MAFA 2QHXA 5AW8A 4OXYA 4AJKA 2DPYA 3EXAA 1NP3A 4IJWA 2X7XA 2DBZA 4QTZA 1SH7A 3DCIA 2B7LA 3AEQB 1NLFA 3Q9UA 3AETA 3OC0A 4F84A 5HZGA 1JQBA 3PPWA 1WZCA 4AZ3B 2MR5A 4PG6A 3OMWA 3ZG6A 3BA1A 4R7TA 2AW3A 4CMAA 1RQRA 4LYAA 3LYHA 2TRSB 5FR1A 4NQRA 4CF4A 1KVQA 3V48A 2VZ0A 4P54A 2YXEA 2Z09A 3CVOA 3FRIA 5ALRA 4TXMA 2HYIC 4M1SA 5F2EA 2RGDA 4M1KA 4PCLA 1WCIB 1CY7A 3H7IA 3NQ41 3K70D 1XR3A 1JDNA 1YACA 2WZQA 2P67A 5FTKA 1ECLA 2VHTA 2PYDA 2Q3FA 2OYCA 2F9MA 1GSIA 5ARBA 2GAJA 1C3EA 3K6JA