3DKRA

Snapshots of esterase d from lactobacillus rhamnosus: insights into a rotation driven catalytic mechanism
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
241
structure length
241
Chain Sequence
FRKPQPFEYEGTDTGVVLLHAYTGSPNDMNFMARALQRSGYGVYVPLFSGHGTVEPLDILTKGNPDIWWAESSAAVAHMTAKYAKVFVFGLSLGGIFAMKALETLPGITAGGVFSSPILPGKHHLVPGFLKYAEYMNRLAGKSDESTQILAYLPGQLAAIDQFATTVAADLNLVKQPTFIGQAGQDELVDGRLAYQLRDALINAARVDFHWYDDAKHVITVNSAHHALEEDVIAFMQQENE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase D
publication title Crystal structure of esterase D from lactobacillus rhamnosus
rcsb
source organism Lactobacillus rhamnosus
molecule tags Hydrolase
total genus 87
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2008-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3dkrA00
4NS4A 1TCAA 2V9ZA 5C8VA 1F6WA 1CPYA 4MYSA 2WILA 4FNGA 1AKNA 2XUIA 5HF9A 4B9EA 3PDCA 2C7BA 4WFKA 4G4GA 5CW2A 1MAHA 4L3WA 5DYTA 3Q0TA 1XLUA 3CCBA 2PSDA 4U2FA 4INZA 1DINA 4QLOA 1IZ8A 2ZVDA 3C5WP 1JI3A 1CEXA 1DT5A 5BOVA 2XQIA 3STYA 3LLCA 4J0JA 3R3UA 1M33A 4OU4A 4RE5A 4PNZA 3EQ7A 3D5EA 1KU6A 2HHAA 5LP1A 1YB6A 2BGRA 5HF8A 3WL8A 1E5TA 2B9VA 4W1SA 4B80A 3WKEA 3F96A 1AGYA 3CXUA 2CB9A 2PX6A 3FYUC 1VA5A 2PSFA 4LXGA 4QWMA 3ILSA 2GBFA 2FJPA 1SFRA 3CN7A 2BUBA 4KAFA 1BCRA 1IUOA 5D6OA 4MEAA 4PSCA 3A6ZA 3KWJA 4DYHA 4XX1A 1CQZA 1MU0A 3QMWA 2XUJA 4H7JA 1J1IA 5FXMA 1CLEA 4Y2SA 2XE4A 3T4UA 3FYUB 1UKBA 4YX9A 3BE8A 1AC5A 5ALYA 3WJ2A 1CUFA 3A2LA 3RLIA 1E66A 1TQHA 1QOZA 4K6GA 3WA6A 5ALSA 3VISA 3TEJA 5I9IA 2XUKA 3I2HA 2C58A 1ZI9A 5ALNA 1IZ7A 3MUNA 2OGTA 2B4KA 1JU3A 3V1MA 5JD4A 2WG1A 5LKRA 5AI0A 4UBLA 1TAHA 2XQFA 3AUKA 4A23A 2BFNA 2JGKA 2BCEA 4U2CA 5ALXA 1SCQA 1BE0A 3ZI7A 4FLMA 4CI9A 5AIBA 1CUHA 4MQMA 3S8YA 3KSRA 3F9CA 1CFJA 1CRLA 2J4FA 4UHDA 4KE6A 3F8SA 4H7EA 3RK4A 3HXKA 1XZMA 4AB1A 4BYMA 1BEZA 2IX9A 3I6MA 3GBSA 4J0GA 1E8DA 3A70A 4BZWA 3H19A 3C87A 4BP8A 1VE7A 1XRLA 5IVDA 4NVRA 3STTA 2R11A 2Z3ZA 4V2IA 3F97A 4DTCA 4HAIA 1JJIA 4J0HA 2OGZA 1ORWA 4J0IA 4G4JA 3PE6A 5HZGA 3DQZA 4UHHA 2WIDA 4CG2A 1HBJA 1QIEA 2XQJA 2RI6A 4OD0A 5IVKA 3G0DA 3QVMA 4DNQA 1PJAA 3G9ZA 5AO9A 1HQDA 2WJ6A 1GXSA 5HFAA 5AKIA 1XKLA 3X3HA 4NMWA 1LPSA 2WG0A 2CEKA 3O9VA 1EB8A 4M0EA 1WCYA 3O0DA 1E8MA 1JT2A 5K3AA 1Y7HA 4QWWA 5JAOA 1FFAA 4UFNA 2ZSHA 3DL7A 4AO8A 1C7JA 3IUMA 4W1RA 1QIFA 2IITA 3HRHA 1CR6A 1TKRA 2YXPX 4GHWA 2VT6A 3FCXA 2RIPA 1EX9A 1NU6A 5CH8A 3OURA 4FMPA 4P93A 3G0BA 3LIPA 3IDAA 1CIJA 4O08A 5LZ7A 3KOOA 4QZVA 3GROA 3O4HA 4AZ3A 5KWJA 1N5RA 3AJAA 3WMRA 4ZXFA 4Y9SA 5HCUA 5JD6A 1F8UA 1EI9A 1DTEA 1GT6A 2AJ8A 5K3FA 2WTNA 5AM2A 1OCEA 1R50A 2WUDA 5AM4A 3G9XA 3ICWA 2HU8A 4PF1A 1VOTA 4UBKA 2O2IA 1QE3A 4MXDA 1DWOA 6YASA 1ZJ5A 2RHTA 4HRXA 1TCBA 4EHBA 2HM7A 4E46A 1QTIA 3MVEA 3OC0A 4U2BA 5LKAA 2QKYA 1XRPA 4UBMA 1XZGA 3UUEA 2GBGA 2AJBA 5SYNA 1XLWA 2XUQA 1OILA 4Y2TA 5JARA 1XZCA 1A88A 5JZ9A 4BP9A 1VJ5A 2BAGA 1TK3A 1CUCA 4FWBA 4H7KA 1QO9A 3IVMA 2PPLA 1WPXA 1EA5A 3OG9A 2WIJA 2P8SA 4GW3A 2ZJ6A 1UZAA 2JGEA 3ZV7A 3AZOA 4HS9A 2DQYA 4K5QA 4QDOA 2QZPA 1EDBA 5JADA 4W1QA 2O2HA 4PSDA 1C7IA 1VA4A 3TGLA 1CVLA 4H0CA 1MN6A 1LGYA 3D4LA 1H2YA 4W9RA 1ZD4A 4DMHA 4Z49A 3AILA 1ZIXA 1F0NA 4ZGBA 2GBIA 3JWEA 4IO0A 2J4CA 1ZGBA 2CMFA 1MNQA 5AP9A 5HKAA 3WK6A 2ES4A 3D3NA 1VZ2A 3DYIA 4MEBA 1G66A 3WJ1A 3AZQA 2NW6A 2XDWA 1JU4A 4ROTA 3C70A 4DSAA 4N8EA 2OAGA 4HRYA 5AKYA 2JGMA 1R9MA 1N8SA 3I2IA 1UOPA 1WHTA 2FJ0A 5ISMA 1QIHA 3AIKA 3NWOA 4DLNA 5ALDA 5EIHA 4DNFA 2EEPA 3I2GA 4FBLA 2JEYA 4J0CA 5K3FB 3DJYA 4UHEA 3WWOA 5D3ZA 3F67A 2C5FA 5AI8A 3KDAA 4A16A 1XZBA 4N8SA 3WK7A 1WB5A 4EY7A 2OG1A 3WI7A 4JYMA 5DWDA 1B41A 3PFBA 4ARBA 1ZJ4A 1E8NA 4C6HA 3QITA 2XMRA 4X93A 5A7FA 3R3VA 2ACEA 4MWTA 3WIOA 2VSQA 1P0PA 2WSLA 1CUYA 4OB6A 4WFIA 1LPBB 2HA2A 2WUGA 4OB7A 1EK1A 1WB4A 2G63A 2WUEA 2QR5A 4CCYA 4OYLA 3HLKA 3G9TA 3I1IA 4U2GA 1MNAA 2O7RA 2QUBA 2BGNA 5AKXA 1IVYA 1USWA 1XRNA 1K5PA 1VZ3A 2C0PA 1FJ2A 3BDVA 4B6GA 4Y2XA 7YASA 1DX6A 2ACKA 2DFPA 5A71A 1SCIA 2WUFA 1Q83A 1GPNA 4Q82A 2WQZA 1N5MA 3M81A 4AN1A 4K6KA 3R3ZA 4FHZA 2HA7A 2XMZA 5JAUA 2JEZA 5EIEA 2C0QA 4IHAA 1E3QA 4GBGA 1CUSA 4H7DA 4QDTA 5C7YA 4GXNA 4AXBA 4AMYA 1WOMA 1MO2A 2GYWA 4C88A 1XZJA 1CUDA 5CBKA 2VEOA 2OCLA 4G9GA 1CQWA 5CT5A 1WB6A 1CUZA 1JJFA 3ESCA 5AKLA 4UHCA 3E3AA 3NUZA 4FTWA 2EDCA 5HK9A 3DOHA 1ACJA 2FX5A 5AK3A 4FNMA 3HABA 2HA5A 5EHQA 3DKKA 2XMDA 3D2AA 1LPPA 2O7VA 2W22A 3R40A 5FKJA 4FOLA 1GPLA 1JFRA 5ALGA 4RNCA 4BC0A 4U2EA 3R0VA 4KE9A 4UBOA 5CURA 4C4ZA 5AK4A 5E4JA 1Y7IA 3LCRA 5JZBA 5HF5A 1MPXA 4OSEA 5ALIA 3GELA 4CCYB 4EA6A 2CKMA 4BAZA 5ALLA 1XRRA 2YASA 1O6FA 4XIIA 1EB9A 5CH5A 5AOCA 1ISPA 1ZD5A 2W6CX 2WIFA 2XUDA 2HA0A 3AIMA 2LIPA 2WHPB 2WLSA 1U8EA 5A6VA 3WK5A 3G8YA 5AKEA 4LXHA 4EBBA 4FFVA 2HU7A 3IB3A 4JYPA 5E4TA 3C8HA 2HL6A 5C8XA 3WK9A 2QOEA 4BE9A 5DYWA 1XZAA 4G9EA 1ZGCA 2HU5A 4UFPA 1QLWA 3OPMA 3YASA 3WL6A 4OB8A 4X00A 1G42A 3F98A 4BTVA 3O95A 4QLAA 4X97A 3VKFA 3LS2A 3D2CA 3VJLA 3VJKA 1ZIYA 3BIXA 1LBSA 3FLEA 4AO6A 3HJUA 4FFWA 1EH5A 2C5GA 1FFBA 1LLFA 4RPCA 3B12A 4HVTA 2AJLI 4G1FA 4F21A 1TRHA 3KXPA 3H17A 2RGUA 2HFJA 3DEAA 1QIDA 4KRYA 5KBYA 4I4CA 5EIAA 4KYVA 1R9NA 4GLBA 3QMMA 2Q0XA 1GZ7A 1QONA 4KAAA 1SC9A 2GYUA 4Q3OA 4K6HA 5E2IA 5HFNA 3H04A 2YH2A 4H7IA 3I6ZA 5AOAA 5IVHA 3V1LA 1LPNA 3ESDA 2WHQA 2WIGA 5CT4A 1XZDA 3RM3A 5AM0A 1RWQA 3CN9A 2XUHA 5AKZA 1EVQA 3C8DA 2Z8XA 3Q8WA 2XUOA 4HXFB 3G0CA 3G9UA 3W05A 4G5XA 3L1HA 3HACA 4JNCA 5C81A 4DMFA 4X6YA 5HF6A 3UUFA 1S8OA 2XMCA 1EINA 2XUGA 2PSHA 3NOXA 4S0XA 4BB0A 1XZFA 2HDWA 2WG2A 2H7XA 1QIIA 5DNVA 3DYVA 4LYEA 4UUQA 3O4IA 1OXMA 3A2NA 1NX9A 2ZSIA 1X2EA 3TRDA 3BDIA 5JYCA 2ZYRA 1ZICA 1Z68A 1GGVA 2XQKA 2V96A 2B20A 4J0KA 1LPOA 2I03A 1U65A 4P92A 3QPAA 3C45A 4CIBA 1L7QA 2HRRA 4TVKA 1EDDA 4Q1VA 5JALA 2Y6UA 3H2GA 1L7RA 1NU8A 1DT3A 4KRXA 3VVMA 2G5PA 4MWSA 5DTJA 2UZ0A 1CUBA 2HADA 4X91A 4HZGA 3W2TA 5AKJA 3A2MA 5YASA 1YAJA 2JBWA 2QRUA 2VATA 5JZSA 5KREA 2VJAA 1FFDA 5CXXA 4I19A 1N1MA 4JH0A 3AINA 5ALJA 3STUA 1DWQA 2JGLA 4P9NA 4B83A 1W6RA 2X5XA 4U2DA 2WFZA 4EZIA 2V97A 3GZJA 4WY5A 2QT9A 4B0PA 4G8DA 4HXGA 5ALUA 3ICVA 5FP0A 1BU8A 2GBCA 1BS9A 3R41A 5FPPA 2OGSA 4W63A 2AJDA 4CG1A 4CFSA 2ORYA 5HK8A 5AK6A 5LIPA 1P0QA 4X6XA 2GZRA 3E1GA 4JEIA 3WYDA 2I3ZA 4BTLA 3AIOA 2RONA 2X8BA 1D07A 1XROA 2JF0A 4TGLA 2EDAA 3PF9A 1XRMA 4BRSA 1UK7A 4L0CA 2X76A 5AM1A 4M0FA 4CG3A 3B5EA 4F5ZA 3BF7A 1DQYA 3DNMA 2ROQA 4Y2RA 3WWPA 5DNUA 3FWHA 3E0XA 3VDXA 5AHXA 1A8SA 4RGYA 3OTQA 4B81A 3FAKA 5IH7A 1QIKA 2WFMA 1HKHA 1BEEA 4EY6A 4MQLA 4PQEA 3PICA 5AK5A 1EXWA 5JD5A 2H1IA 1EK2A 4JUIA 3VVLA 2DR0A 4KE7A 4E14A 1QFSA 1XQYA 4H18A 5T4HA 3K2IA 1CUIA 2FUKA 1BCSA 3C6BA 3PFCA 1XZIA 3STWA 3TJMA 3R3XA 4H77A 4RE6A 3HEAA 4X92A 2DHEA 5ALPA 1HLGA 1G5FA 2XB6A 2VF2A 5ALTA 1CV2A 1ZI8A 2VJCA 4X85A 5LLSA 4B82A 1K6EA 3C5VA 5DTIA 3WA7A 1ODSA 5ALZA 3KD2A 1QZ3A 2DQZA 1BN6A 2PL5A 1E89A 5HKBA 5ALKA 4E15A 1QO7A 3DKRA 2JGJA 5K3EA 4QDZA 1GQSA 3WZLA 3GA7A 2K2QB 3W04A 3W9UA 1R88A 1IUPA 4WFJA 3W06A 2OPHA 2HA4A 2O2GA 1C4XA 3W9BA 1YCDA 3V1NA 1A7UA 4ZV9A 1WM1A 3IBTA 5CT6A 4C87A 1J06A 2WM2A 4WDRA 4Y2QA 2D0DA 2XMQA 2XQGA 4OPMA 5I8PA 3GUUA 5ALQA 1TIBA 2DCMA 1BRTA 2PKYX 1X2BA 2XUPA 2OQVA 2ZJ7A 1MTZA 3ESBA 2Y2VA 4X95A 2RHWA 1X70A 4Y2UA 3WKCA 5AI5A 5K3CA 3H0CA 4AQDA 3DDUA 4ETWA 1QFMA 4DMCA 2PBLA 5CTAA 1MX9A 4UHBA 1R1DA 5IKXA 5A62A 4UHFA 4ARAA 4QE3A 1LNSA 3AFIA 4GI1A 2OQIA 1MX5A 4E11A 4GDMA 4QA9A 2Z3WA 3O4JA 5AM5A 4DGQA 1EVEA 3R3WA 3ZPXA 5AI4A 4BAGA 4OUKX 3ZLTA 1KEZA 1BN7A 3I6YA 4X71A 4BCBA 3SX4A 1CUXA 5ALRA 1DX4A 4FKBA 2I3DA 4BE4A 4B7ZA 1EHYA 3QBJA 5T4BA 3I28A 5AKHA 1Q0ZA 4BBZA 3N2ZB 3O4GA 4LHEA 3PUIA 3QPDA 2PVSA 2OCGA 1Q0RA 5C8ZA 2CJPA 2YYSA 4G8CA 1FFCA 4LYDA 4EY5A 3IIIA 4FLFA 5DNWA 1ODCA 5FUMA 4KAJA 1FSSA 2AJCA 2QM0A 5EHXA 3SWWA 5FV4A 3C43A 3DCNA 2HA6A 3FNBA 4BC1A 2PU5A 1LPAB 4AO7A 2BKLA 1QTRA 2JGIA 3STXA 4BVLA 4FBMA 3WKBA 4UBNA 3JW8A 3D0KA 1W52X 2VQ6A 4YPVA 2BUAA 3BXPA 5EFZA 1P0IA 2C4HA 1PFQA 4UPDA 2QUAA 3G7NA 1HPLA 3LIIA 3WYNA 3WK4A 4AN0A 4A5SA 1UT6A 3ZLUA 4X90A 3C6XA 4KACA 1JMYA 1W75A 2QS9A 2WU3A 1DU4A 4DNOA 2Z5GA 3DS8A 2J3DA 3JYHA 4N8DA 5BWCA 3C6ZA 1GKKA 2DSNA 4Y2JA 4H7HA 3P2MA 5FPQA 4KEAA 3ESAA 4Y2YA 3HZOA 1VKHA 2WIKA 1H2WA 3V48A 4LIPD 4L9AA 1UK8A 1YSCA 1ZOIA 4DMKA 2WU4A 1AQLA 1CUVA 4Q34A 1R3DA 4BDTA 3D2BA 3FLAA 4BVJA 3IULA 3GFFA 1MAAA 1IMJA 1LPMA 5LYYA 3FVRA 3D7RA 2VT7A 2OAEA 3L1JA 4OCZA 5I7UA 1ETHA 3EF3A 1EDEA 2HIHA 4F0JA 2WJ4A 2XI4A 4XVCA 4WJLA 2XUFA 3R3YA 3IUNA 4YK7A 3C6YA 2VA9A 2QJRA 2XUAA 1UWCA 1VLQA 2ZYSA 3WWCA 1H2ZA 1YAHA 3WIBA 2QTBA 4B85A 3H18A 4LKOA 4Q05A 5K3DA 4GECA 4PSUA 5CH3A 5AKGA 4QNNA 4J0DA 3WWEA 1LZKA 4IH9A 5FRDA 2BUCA 2G4LA 2WHRA 4UFOA 3EIOA 1ZI6A 1J07A 4L72A 4J03A 4Q3LA 1W4LA 4MYDA 2QXTA 1YA4A 2Y6VA 4EUSA 1U4NA 5D7BA 5EHZA 1HL7A 5KWIA 3FVTA 1Q84A 5K3BA 4CIAA 3D59A 3S2ZA 4C4YA 5ALVA 1CUGA 1XZLA 5JANA 4Y7DA 2HA3A 3FSGA 5BWBA 3M3DA 1CUUA 2ZJFA 4CCWA 5H3HA 4EB0A 4NZZA 3E4DA 3VXKA 5JAPA 5AM3A 1ORVA 1GQRA 1W76A 4B9AA 3FBWA 4BDSA 2E3JA 2IIVA 4UBJA 4ZWNA 1TCCA 3PI6A 3OOSA 4QEKA 4G4IA 4C4XA 4BRZA 3KWFA 5JASA 2R8BA 4AMZA 2WTMA 5EHNA 3V9AA 1LZLA 4G8BA 1K4YA 5LZ5A 5BV7A 5FDFA 4F60A 3PF8A 2OCIA 2HRQA 2Z8ZA 5JAHA 3ED1A 2PU7A 4IQ4A 5CMLA 1XQWA 4X6UA 3FOBA 4BATA 4FLEA 4J3JA 4P08A 3I2JA 1B6GA 3NGMA 4H7FA 1UXOA 2VAVA 2PUJA 3IUJA 5CT9A 4BAUA 2V98A 3EQ9A 2JIDA 1WHSA 1ZD2P 5JIBA 5HQ3A 2GYVA 3QH4A 3V1KA 4DM7A 5ALMA 2ZYHA 3G02A 4LXIA 3K6KA 1RP1A 4PV7A 2ZYIA 4DNPA 3G0IA 3H2HA 4GEGA 3WLAA 3BJMA 4N5HX 3SK0A 2PSJA 3T52A 3DL4A 3H2IA 3WL7A 1XLVA 2XLCA 3I1YA 1K8QA 1AZWA 2H7CA 1FFEA 4DIUA 1XQVA 1QJ4A 1ZD3A 3M82A 1A8QA 2H7YA 4I3FA 4M0MA 3I2KA 2OCKA 2VAXA 4GWLA 5FOQA 2Y1KA 3O9MA 2XT0A 1U2EA 2PSEA 2VJDA 4BCCA 4AX4A 4WDQA 2BJHA 2Y2UA 2D5LA 2ECFA 3BJRA 3OM8A 3WWDA 5LZ8A 3WZMA 4H35A 3FLBA 3ZWQA 5F4ZA 1UKCA 4IH1A 2CZQA 3BF8A 1ODTC 4FDMA 1UKAA 3U0VA 3MUOA 1AUOA 2OLEA 3WQHA 2DHDA 5DJ5A 1XQXA 4OU5A 1XRQA 2HFKA 3G0GA 5AH0A 3H2KA 3WK8A 4UBIA 1PV1A 1YR2A 5DLPA 1J2EA 2CBGA 5CT8A 1DWPA 1T2NA 5D3KA 5AIAA 4B84A 5J3JA 3DOIA 1VXRA 4QDXA 1DQZA 2RAUA 3BIWA 4AZ0A 3SC2A 5A7HA 4C01A 4K2AA 1H23A 3HC7A 3HYSA 1HDEA 1XKTA 5AKKA 1QIMA 3BWXA 1CUAA 1YB7A 2CUTA 4ZV7A 2XLBA 2XMGA 3QYJA 1LBTA 5LZ9A 1G4HA 1P0MA 2GZSA 4ZRDA 3ANTA 1RYYA 1QIGA 5HQ3B 1SOMA 1YS1X 5CXUA 3U1TA 1MT3A 1QGED 4KR0A 4IH4A 1GPKA 3N0TA 1MX1A 5A7GA 4C89A 3FCYA 2QMQA 4B0OA 5DYYA 1UOQA 1JKMA 2WJ3A 1VE6A 3EBLA 4KE8A 3FSGD 1A8UA 5ALWA 3EQ8A 1H22A 4Q3KA 4J7AA 3IA2A 1H2XA 4EY4A 3ANSA 4MJ3A 3VJMA 2XMBA 2G5TA 3H2JA 4BVKA 4WY8A 3DD5A 1THTA 3CCCA 4X94A 3DLTA 4X3CA 2WKWA 3IURA 5ESRA 3BL8A 5SYMA 1MJ5A 2WFLA 3LP5A 5AI9A 5AI6A 2PM8A 5ALFA 2B61A 1WPRA 3IUQA 4XWGA 1QIJA 3H1AA 1IUNA 3B3QA 3K9BA 1AX9A 5E4YA 1I6WA 5LZ4A 3I2FA 3RARA 2QJWA 5IVIA 2QVBA 3L1IA 1JMKC 4TPKA 5ALHA 5LZ2A 5FLKA 3ZLVA 1T4MA 1UFOA 5ALOA 4ITVA 5T4FA 1CUEA 3WL5A 3PUHA 3HSSA 5EGNA 1UK6A 2I78A 1O6GA 2H9YA 4Y2VA 4OYYA 5AICA 1XFDA 1R4ZA 2VJBA 4BCDA 3QPCA 4ZREA 2WHPA 1YS2X 4QDUA 2QXUA 2XMSA 4XJVA 1ACLA 5AJHA 4DSZA 3QZUA 4HTAA 3QM1A 1VXOA 1CUWA 1UK9A 1Y37A 4ZI5A 2VTVA 3FYTA 5JATA 5A2GA 1AURA 3WKDA 2J3QA 4KJXA 1YA8A 3UMJA 1THGA 4BZZA 1XZKA 1UOOA 2PUHA 4N5IX 4X7BA 4HXEB 1CUJA 4YASA 2AXEA 4W1PA 3M83A 5EI5A 2DHCA 3FYUA 3MGAA 1YASA 3WKAA 4D9JA 5CRIA 2ONCA 2JGFA 1XZHA 1BROA 1KU0A 3H1BA 2OXEA 5AOBA 4WCVA 5K5EA 3HI4A 5ALEA 1GKLA 4EY8A 2WFLB 5T4EA 3AZPA 1JJBA 4PW0A 1L7AA 3RKSA 1F0PA 1AMNA 1K63A 1XZEA 3STVA 3QMVA 1W1IA 1SCKA 4PO3X 4Y2PA
chains in the Genus database with same CATH superfamily
4PZAA 3THRA 4NS4A 1JG4A 16PKA 1V5FA 2IRWA 3THWB 2PA3A 1XJ0A 2PGAA 3UK2A 5AUPB 2QVXX 4UW9A 1E9BA 4EARA 2G76A 4ZMSA 5DM70 1FXWF 3VSDA 3V4RA 1MH1A 1SXGA 3Q6MA 1Z36A 4B9EA 1ZSVA 3C4VA 5THXA 3CT4A 1OPRA 1WW2A 2E5FA 2FPOA 3CRNA 3KXLA 5LMCA 4A8PA 4DT1B 5DYTA 3UNXA 1Y3BE 1HE4A 2LRHA 5EMJA 1XA0A 3Q0TA 1JXMA 1AA6A 5F7ZA 2F4NA 3D2LA 2O5VA 4QPPA 4HCJA 4TTTS 2PUDA 3JR7A 3CCBA 5KB3A 4D25A 1I51A 1F6DA 2PSDA 2CLIB 3QIVA 4QNRA 2X0DA 1K3FA 1LTKA 2VNHA 2VP0A 1JG6A 1ZUNB 1DINA 3KFLA 4YLEA 1YF3A 4R54A 4ACBA 4EKGA 2DFDA 2A9QA 1RC1A 3ABRB 1JI3A 2DJ5A 1L1QA 1ZOPA 3EW7A 1P2VA 1X0XA 4BLSA 1ZKDA 4X7MA 2MSKA 3STYA 3LLCA 3FDXA 2GR9A 4J94A 1KPHA 4ZPXA 4RL4A 4PNZA 3AR7A 3KUXA 3RDPA 3VU0A 4CKBA 4JI4B 1XA4A 1DQRA 4J1SA 2ZUEA 4TTAA 1Q21A 3DXFA 3L9XA 3MGGA 1OIWA 4KL8S 1JT9A 2CBXA 3B78A 2OCDA 2CB0A 2QYHA 1SG0A 4NV3A 3ZYCA 2Q6VA 2AV6A 1LDBA 1HDOA 3BH6A 3CVJA 3DXZA 2X8JA 4I2VA 5LP1A 1YB6A 5FO1A 2BGKA 3LO8A 1OYWA 1GRVA 5AT1A 2C8LA 5BOSB 2ENWA 5FWAA 4BNHA 5CB4F 4I81A 5HZHA 4GNRA 4F46A 1HO3A 4KVAA 4MKIA 4YPFA 5JYBA 5L3RA 2VP9A 4RADA 1ZAKA 2GERA 1NKSA 3AF1A 5FBQB 3HV0A 4EW1A 4RA9B 3W1EA 4JODA 4P3PA 4G09A 5JZMA 1AGYA 1BHQ1 3E9EA 4WZ6A 5J40A 1RLJA 4AJEA 1OU4A 2JBAB 3KR1A 1TT7A 4E03A 1J8FA 2PX6A 4DC0A 2VDWA 3HCNA 3ZQ6A 3V7NA 4K9RA 1K98A 3EXHA 3KTOA 1H9BA 1F2DA 1Z8FA 2P78A 3CJRA 3DOUA 2VDOB 3IQGX 2DR3A 4REQA 4JEUA 5J43A 3FPJA 2RGWA 4WADA 2EJVA 5FBZA 4KAFA 5EKTA 4ARZB 1WSAA 3BIOA 2IKSA 2DFTA 4UASA 3CIOA 4CM3A 2J0EA 3EN0A 4IDOA 4M54A 2NSHA 3W5AA 2AC4A 4MEAA 5JSQA 1WZCA 1MOPA 1XTVA 3CWCA 3PGMA 4BJ5A 1T2EA 3LXXA 3KWJA 4RYLA 1U2GA 1PR9A 5FNVB 2WJJA 4UXJA 3TW4A 1FXSA 1UZNA 3PDJA 4F7DA 4C20A 1XYGA 1MU0A 1I4TD 4H16A 3ZXUB 1V16A 3FTQA 2AG0A 1J39A 3NP9A 4EITA 1AU9A 3RVOA 5BV0A 3QELB 1XPJA 3OIVA 4Q1BA 3W6UA 1JKJA 4Y2SA 2HZBA 3F6BX 4MUNA 3FYUB 1UKBA 2BY4A 2VDKB 4ZA2A 1C1XB 2ZU0C 4YX9A 3M1AA 1QAMA 2C2YA 3BE8A 1IC6A 3FCSB 3L5OA 4GXTA 4KG7A 3UGQA 3WLRA 4MDHA 1PLKA 4HR7A 4JBHA 3IALA 2QIPA 1NZJA 1E1NA 2YJ5A 5HBRA 4M49A 3EXG2 4ZYZA 1D0SA 4WA7A 5CFPA 3KB8A 1XTUA 4PPFA 3U80A 4DREA 1QOZA 2Q9BA 3CWZA 4GBED 2YWCA 4K6GA 3WA6A 4M7RA 3NAZA 5ALSA 4IGKA 3AVWA 5KMGB 1Z82A 4JU8A 4LHWA 1XX6A 4FC6A 3GIWA 4QBHA 5C9ZA 3AHHA 4RVNA 3AF5A 2CXSA 2I6TA 3DJFA 3ESYA 2BGGA 2G4CA 1R27A 1EFDN 2OGTA 4GM0A 2NZ8A 4PYQA 1Y6ZA 4YJ3B 4PN7A 1A2OA 2ZIWB 3JD1A 1GAQA 4ND6A 4EEXA 2UUBB 1WZ2A 1E77A 2M32A 3QVOA 4MR9B 3BPSA 3LW7A 1DI0A 4MI9A 3L4SO 2WG1A 1ZNYA 3OT5A 4R1UA 3IJPA 4BGVA 4UTVA 5AI0A 2AF3C 1TAHA 2OO7A 3RT7A 2XQFA 3AUKA 1KI2A 1T6ZA 2W90A 3GOHA 4HHEA 1P4GA 4YAWA 5JMPA 1J9GA 5TPZA 4MPDA 1GDTA 3KFVA 3TYXA 4LQCA 1AKTA 3S4YA 3GJTA 1BVUA 2WWVD 3T35A 1EESA 4PVDA 4R3WA 4C4RA 1JR2A 4G5QA 1QVRA 1BE0A 3Q3GE 2ZGVA 3H4MA 1VHJA 2BFFA 2WSBA 4AKSA 3TPFA 4BEVA 3QEOA 3JV7A 3SXUA 4CI9A 1RYMA 3MHPA 3FD8A 3M4ZA 4KYUA 5EWLA 3ECAA 3IFSA 4N9WA 4BMNA 4MQMA 5EYPA 4JI8B 3AFOA 5ICGA 3C1AA 2V6MA 2HQRA 2QDKA 4PYNA 3QE3A 1RQPA 3A1TA 2FRDC 1CRLA 3AP2A 2A59A 2J4FA 3BKXA 2YCBA 3OLCX 4UHDA 4KE6A 2Z4RA 4H7EA 3KPYA 4HYQA 2QRJA 3TKAA 5GONF 1L1RA 1SULA 2O1WA 2QUIA 1NW4A 1V35A 3RK4A 5E1MA 2GSWA 1I0LA 4AB1A 2Y27A 3WZ2A 3DF9A 1JHPA 5TQ2B 4B79A 1BEZA 1T1RA 4BYMA 3I6MA 2J9RA 2C9CA 4P3NA 2W2TA 1EBUA 1AKWA 1U5AA 3FFXA 4AF6A 5IT5A 4XCVA 1T5DX 1E8DA 1WY7A 4CKBB 4DC1A 3JWIA 3A70A 3K96A 3NONA 1BQEA 3KSBC 2FZWA 1YOBA 2IQ5A 3C87A 4DPLA 1P29A 4HB2A 2ZE7A 4NONA 3TSAA 1NR5A 2FJUA 1N8KA 3CPSA 2JJMA 4BNVA 3O3CA 4ZAFA 2D3TA 3F97A 2N3ZA 4V2IA 5E6RA 4EYOA 4KQMA 5FEUA 5JBIA 2OOSA 2YOHA 3KKZA 1DDIA 2X8JB 4K8OA 1KY4A 1ORWA 3E70C 2OBBA 5IDVA 3UTCA 3QUQA 1ECCA 3M3PA 4Q3AA 5DDIP 3E58A 2RB4A 2CLLB 2EZTA 4U9UA 1V5EA 2QAGC 5CW1A 1TC1A 2VH2A 3IS3A 5D3MA 3DQZA 4RH1A 4R68A 5KQPA 2CUKA 5EE0A 2PJUA 5FLXA 1WSWA 1BG6A 4U7PB 3WHPA 1QIEA 4M86A 4AS1A 3U3JA 2VDWB 4LG1A 2HPZA 3EXHB 5E2BA 4REQB 4CL8A 3ZVLA 4ACAA 1UBSB 5ES4B 2ECQA 2XXAB 2O0HA 3NHRA 2AR7A 2JRLA 3NXKA 3QVMA 4POAA 4DNQA 4E4RA 1QQ6A 2X9LA 4FVTA 5IX8A 1X7XA 4R71A 1HQDA 1B0PA 2WJ6A 1U0RA 3QPUA 1GXSA 1KVSA 1N2SA 2I1QA 4I4LA 4IKPA 5IW8A 1V37A 4DYDA 4NBLA 1K7YA 1Z5OA 1UAGA 1UJNA 1CD5A 3HU1A 3RUDA 3WE7A 2ZROA 2BN4A 3KUDA 1M3SA 2XE7A 3K8QA 3NEYA 1XMIA 3DO8A 4MVJG 4XB6B 4E2WA 2HXSA 1VRVA 2WG0A 2AQKA 3L8DA 8AT1A 3C1UA 1NVFA 1A8HA 3O9VA 4LN1A 3ZR4B 3LQ1A 1VCOA 3GAMA 4GGOA 4M0EA 5HIMA 4KLRA 1JPUA 1E8MA 1JT2A 3U6BA 5K3AA 5JI3E 2JHAA 2VYCA 4HAYA 1NMYA 2YZ2A 4RUKA 3E1SA 3GDOA 3MCAA 1TQ6A 3IUMA 2H4WA 3KXKA 5KUTA 4LFAB 3AH8A 3G88A 4OIMA 1P5RA 2IITA 3HB9A 3MC1A 1PTJC 4ZCSA 1KSGA 3HR7A 1NUQA 3VKWA 1YJQA 3HRHA 1PUXA 4YRSA 4B40A 2CHVA 1I2AA 1Z5WA 1JG3A 4JMPA 3FCXA 1RPJA 1JG1A 5IN4A 3DEZA 1YQQA 1JLHA 2EKPA 1NU6A 4L50A 2X5JO 3CEMA 1M2EA 2IXAA 4P93A 2BTQA 1N9GB 1EG7A 4JI5B 3UJ8A 3NT4A 2HAEA 2OUIA 2VFAA 3GQVA 4RJKA 5BSTA 2QM7A 1JEOA 4TXLA 2WWWA 1BZYA 3IDAA 2IUFA 5IEBA 4EM6A 3D1VA 4CKZA 3ULKA 5BVHA 4YEDA 3D8NA 3AYXB 5CTJA 3CNHA 5DLYA 4O08A 2QT0A 3R20A 4HAWA 4RPIA 3ONDA 1FDUA 1G2QA 1JQDA 1L7EA 4IXDA 1YB1A 1VBKA 4TZTA 3T9CA 3V8EA 2R8RA 4WHMA 3ZX4A 1VECA 2DP4E 1J0BA 3DAHA 2ZBQA 1WV1A 3DTVA 3L3BA 3O2SB 4XGQA 3RVPA 4DUYB 5DLQC 2IPMA 4ZN6A 3HYLA 3R5FA 4CM7A 4Y9SA 4NCAA 5HCUA 3RUPA 1PVOA 4TMKA 2QX6A 1P9NA 4RD2A 3SS9X 1S2DA 4GR4A 1HSZA 4F4JA 1EI9A 1DTEA 5C7IO 4JC0A 4ZCQA 3MN1A 4X8OA 4WBNB 4K6FA 5K3FA 4KQKA 2HPVA 2WTNA 3OICA 3VTZA 4XIYA 2C4MA 1OCEA 1T5BA 3TOXA 3ICWA 1A9XA 5ILGA 4B3CA 1SQ0A 4HPWA 4WGGA 2PKQP 4UKDA 5F7OA 4JJEA 1N9KA 1VFNA 1VOTA 1AQYA 1FK8A 4MVJI 1OWPA 3ZY5A 4DLAA 3TH5A 1DKLA 2FN7A 4QUJA 2X41A 5IK2D 4G89A 2EERA 4LOIA 4LY6A 2OA0A 1OZ0A 3E7FA 3NIGB 3BTSA 1NQUA 5TV2A 5C53B 3G6WA 5J2UF 1GAXA 6YASA 3RHTA 3LC0A 4GLJA 4IS2A 4OHPA 5K8JB 1ZJ5A 5E6RB 4Q66C 1LU9A 4M21A 3HHPA 4YMIA 2F4VB 3TDNA 4X9XA 2GZHA 3EFEA 1AUVA 5E1DA 4EHBA 5BYKA 1MB0A 3G2OA 2DWOA 2NVOA 5CFZA 2XJ4A 1B14A 5LQAA 1T9DA 1DBPA 4YA6A 1W29A 2IZOA 4G0UA 1YE8A 4UBMA 3RE1A 1PNQA 4EGAA 3UK1A 1KI7A 2AJBA 5K6AC 1JWAB 1IY2A 5K0CA 3UJPA 1N3YA 5E3IA 2ONJA 3GG2A 4Y2TA 5JARA 3R6WA 4P0PB 1A88A 2GEUA 3CLUD 1X3SA 2V6BA 2XA2A 5JZ9A 1ZMOA 2HMUA 5BW5A 2BAGA 4LDQA 1M6WA 5ENZA 1GR1A 4JY7A 1QO9A 4G25A 3VFDA 2PPLA 3O21A 3SKXA 1Z29A 3OG9A 1X7XB 4JVMA 2ZU6A 4II3A 4FNAA 2WVAA 4XARA 5D00A 2IEDA 1B93A 1GXSB 1J70A 2BP7A 2YZGA 3N76A 1DDOA 1J6UA 5EZQA 2PT5A 5LQDA 2XADA 4Z8XA 3ZV7A 4A0FA 4AJJA 1WMBA 3L1UA 3I4LA 1OZFA 4K5QA 3C1OA 4WNCA 1QX3A 4BFSA 1CVRA 5D51S 4Q4HB 2V58A 4CF3A 2D1QA 2HWXA 3N6VA 2QR2A 1J5XA 1K9SA 1U9IA 4BJ1A 4N12A 3LT2A 5BNWA 2PUVA 3EGVA 1HETA 4W1QA 5A3JA 1RDFA 2O2HA 3FYSA 3VKUA 3I9V1 4PSDA 3EXAA 1NVDA 3U4DA 1EBFA 1F20A 4XH9B 2R97A 4CF7A 1RSZA 2IXFA 4H0CA 2FV8A 1MN6A 2OCYC 2OFWA 1RWOA 1VI6A 2L18A 1WP4A 1H2YA 3ILYA 5KVAA 4ZC8A 4ES6A 1ULTA 3HKEA 4EB6B 3QWFA 2RC5A 3VKVA 4QL3A 3AILA 4ZEXA 4TRRA 1EVKA 3CLTC 3RG2A 2FFRA 3CBQA 5DGXA 3BXZA 2PWZA 3LDHA 5CFRA 4FWTA 3TJZA 4U5XA 4IO0A 4WXPA 3VH4A 4QX6A 3ZE7A 2E2WA 3LUBA 4F9TA 3K0CC 1I1OA 5AP9A 5TPWA 4XPIA 4QBTA 3WK6A 1NRJB 2VQEB 3SAJA 2BTQB 4EG1A 2ES4A 4C3UA 3RSLA 2Y0CA 4N54A 1GU1A 1YB4A 4XCXA 5JOQA 1VZ2A 3DYIA 2Q3FA 3WL4A 1SCDA 5GPBA 1Y4UA 3WJ1A 4RFSA 3ROQA 3ENWA 4DQDA 1VGRA 1CZOA 4XQCA 1XVAA 2IP4A 4O8ZA 1I4LD 2VTDA 2KQUA 4N8EA 4Q9JA 2FPSA 5M34A 1E4EB 1UKEA 1P6XA 5J58A 3AEQA 2PNFA 4LWQA 4ZZ1A 3DTVB 5AVOA 4OLJA 5DHUA 5A06A 2JGMA 1R9MA 3I2IA 4H6WA 5SY9A 4K9SA 1Z4NA 1QYWA 5CNKA 1TCVA 4WNAA 1QIHA 4D7AA 5ISMA 1NONA 5JQGA 4YDSA 3LWNA 2ZSAA 1M9NA 3P9YA 4PPQA 3AIKA 5JZVA 1PWHA 3VAYA 5TIIA 3NNNA 4BGIA 3UYLA 2C95A 2R65A 1F14A 1LF0A 3I09A 4WXMA 1UM9A 1V5GA 1VMAA 4CWAA 4GP7A 3TQIA 2QEQA 3AJ8A 3D8HA 5LOVF 3L0OA 2EFDB 3I2GA 4FBLA 1Z22A 4OHVA 5K3FB 3CU5A 3T7DA 5IYZA 5JC1A 1KFBB 2IZZA 1M1UA 2XOKA 3ZJVA 4HDNA 2KBEA 4BBPA 2XNKA 1JF8A 3B82A 3F67A 1KYVA 1R0LA 1XC7A 3NHYA 1Q1NA 1TKBA 3CX4A 5K0FA 3VZCA 4OLBA 1BS1A 4TTJA 3IDQA 3E3NA 2HX1A 3HR8A 1FPMA 1XZBA 3ZKAA 4W8OA 4EA8A 1C9MA 1WB5A 1RQ2A 1U3TA 2KLHA 1TM3E 2ZBUA 4RZ2A 3WI7A 4JYMA 3BWVA 4PZCA 2P75A 2Q99A 4RIIA 2BI7A 4KLAA 2D74A 4XJTA 5DWDA 2OL4A 3OOWA 5BN3A 4ARBA 2G04A 1BSVA 2G70A 5EMMA 4YDQA 2KLBA 2C78A 3DBLA 3DDWA 4FCCA 1RXSA 1B8VA 1OGIA 4XTRA 1RRGA 3CNLA 3NMUF 2X19A 2OOKA 5LPNA 3HXMA 1C1YA 4EUFA 3ADOA 4X93A 5DGIA 1E2QA 2FRXA 2IS2A 3DCJA 2DBZA 4LEIA 3IOMA 4B09A 1FMCA 2JFHA 2VYVD 3LY9A 3R3VA 2I7DA 1H6CA 2R7AA 3LQ2A 4OM7A 2CV0A 5BQFA 3L8FA 1XCPA 1H9CA 1P0PA 1L0BA 1E59A 1RS0A 3TGPA 2Q9CA 3KKQA 4AJLA 4E12A 2HQ1A 4AZ0B 2Z5LA 4R69A 4OB6A 2CSXA 5DULA 2B36A 4WFIA 3CRVA 3U39A 3ZNNA 4CG0A 5DHQA 2HA2A 1P1JA 2QI9F 1EK1A 3EVGA 3FW1A 4I55F 1IH8A 2ANCA 2H11A 2WMOB 3CPHA 4YXFA 4LRXA 2HLPA 2JFQA 4X84A 5B58C 1WMDA 2QJOA 3G9TA 2ZRQA 3HLKA 3I1IA 3KHTA 4TQAA 4HT3B 4U2GA 1VLVA 1O1YA 2DSTA 3G49A 3OCXA 5KQSA 4HSEA 4K0RA 4RTKA 3NR2A 1W59A 2XSZD 1SKMA 2JRCA 2BGNA 2QAIA 1QH8A 1PLLA 1SUWA 1L6RA 2DBRA 2FMFA 3HRKA 4K40A 3VTFA 2FLWA 1ZGZA 3VA7A 5DGDA 2Y93A 1X7YA 3JXEA 2ZREA 1B0ZA 3UHPA 1R2QA 4PZEA 1KIMA 1GPYA 2D1RA 1T26A 4KBGA 1XRNA 4XIGS 1OWMA 1N0VC 1QOQB 1V7PC 4DADA 3KZNA 2BISA 4IZ6A 3VPAA 1T8PA 3HKEB 4M9ZA 2XVYA 4BWGA 4L9SA 2HPAA 1E1CA 7YASA 1NJ1A 4O59O 1QP8A 3QEAZ 1NUPA 1SCIA 2WUFA 2GBLA 2QY9A 1C80A 2Q2NA 3VZBA 3ZBPA 4ND5A 3QU4A 3RU2A 3EAQA 4NYMR 5L45A 4YRTA 1X74A 2V7GA 1NDHA 3B51X 3M81A 5CX1A 3V6LA 3VPBA 3DGEC 4BO3A 3SYMA 1PZGA 2A14A 4B6RA 5LB4A 3JQGB 1YZLA 3TZEA 3UT0A 2CVZA 4JVOA 4CIWA 3R3ZA 3ONNA 1VJDA 2HA7A 3BWCA 1QB7A 2AZ4A 2XMZA 2GXQA 2ODAA 2WPNA 3KX2A 5DXJA 3ZJTA 4RFSB 1MV8A 2YY6A 2NTVA 4IHAA 1M6NA 5SICE 3NYRA 1BKYA 1GR0A 3GEPA 4GBGA 3PPYA 3ZWWA 3VC1A 2II6A 4UZEA 3W4IA 3OESA 1CUSA 2GCIA 3FPEA 4H7DA 1COWA 4TM7A 1UUFA 2ETXA 1Z4MA 3AEQB 3AEYA 4NECA 5K51A 4DQUA 3H42B 3LZDA 2FGJA 3E18A 1AT1A 1VL8A 2ATVA 3RWMB 2JCSA 4FMDB 3B1VA 1RFGE 1V7CA 1SPXA 1HDGO 1YC2A 4WNAB 3ZDAA 3MWYW 4IYJA 1MO2A 3SOPA 4BBAA 4QDJA 2H4YA 1I3LA 1GILA 2Y1CA 1V26A 3DWFA 1KKMA 2AC2A 4D4LA 4DZRA 4DDUA 5H02A 3FN4A 1VKRA 1OPXA 2AKYA 3QI2A 1N4DA 5G0UA 2VEOA 3KLOA 3DOFA 2J8ZA 2PGDA 3R7DA 2P2YA 3HM9A 5IYZB 2Y1WA 1WBJB 1X38A 4G9GA 1EUQA 2O5EA 4MUBA 1CQWA 1ZEMA 3FR8A 4QHSA 3UJ9A 3HH8A 1D2NA 1GGFA 1SUSA 1WJGA 1BA3A 3VYTB 1W47A 1IZ9A 5JS7A 1AH2A 1XZ8A 2C4VA 2R62A 4IWYA 4BFZA 4PX3A 4CDRA 1OI2A 1WTAA 3E3AA 3O8DA 3U3MA 1R5JA 3N75A 4YCAA 1CZUA 4YRIA 4N6NA 3SYNA 4XSGA 2VDUE 2I7XA 2JD0A 4YUXA 4Z7QB 3OEEA 5AK3A 4DKXA 2LCFA 3FZNA 3TMYA 2IWRA 5CA1A 1WSDA 3I3OA 3RTGA 3HABA 4EG8A 2HA5A 4QPZA 4A82A 1QFJA 5M04A 4HLCA 3BH7A 3CS3A 1C9NA 2H85A 2CMKA 2O7VA 2ZG6A 1OKKA 2O8NA 3DZDA 4WCDA 1AKMA 2OFPA 4XYLA 4EJSB 5EE3A 1ESCA 4ND8B 3R40A 3BERA 3KJQA 3AFNA 3QYFA 4QREA 1FDOA 3WMFA 3X1XA 3E5RA 5T5QA 3WGLA 4PHTA 1EE2A 4Q1FA 5FKJA 4A9AA 4J43A 4HPXB 2X5OA 1IM5A 4E1AA 5ALGA 3VVCA 2BEUA 5F2OA 5HJ2A 3F7OA 3PFKA 4C4ZA 1SCAA 3EQ2A 3S99A 4QODA 5BN4A 4E5MA 3IAFA 5AK4A 2QJFA 1XTQA 3IP6A 1L7DA 3KQYA 1ZH2A 1C7EA 2OYCA 3SVZA 3A9TA 4L8VA 4WLNA 4RK7A 5BNFA 1DAPA 3T5AA 1WSBA 1RTKA 1VTKA 1Z56C 5FADA 1WU7A 3LGXA 4P7BA 2QE7A 1O9BA 4TSRA 1MPXA 3EGEA 3OZSA 3IHWA 3ITKA 4Q4AA 4XDHA 3W6ZA 3EY4A 4KK4A 1ZA1A 1F38A 5AWFC 1CVIA 3D1LA 2C1EA 1MQSA 4BAZA 1XRRA 3LYLA 3OSUA 1U31A 1O6FA 2O6HA 3EZ7A 4XIIA 1VJGA 1ISPA 1GL7A 1Q17A 1WZUA 4XUGB 1FS5A 2IPNA 4QTXA 2WIFA 4HX5A 4NCBA 4ROSA 1HGXA 4HQNA 4YUZA 4ZV4A 1JQKA 3LCJA 3AIMA 4H3KB 3RIMA 3WB2A 3O4RA 5I7AA 1RPAA 4PX2A 2W6PA 3AOEC 5TMBA 3GRZA 1O95D 3WYGA 4TSFD 3H97A 4HVAA 3SJCA 3SP1A 4PWZA 4A8JA 1NMSA 1PTKA 2P6MA 1RYBA 1E1CB 4AJ4A 3WK5A 3JZIA 1VGQA 4PNEA 1AY0A 3I23A 2WD7B 2VJNA 1OB5A 2A9JA 1EFLA 2BEWA 2JGAA 3DLIA 4QOEA 4EBBA 4FFVA 1KOJA 1J2RA 1Q19A 1YR6A 3IB3A 4WD3A 2GWHA 4HH0A 5DCWA 5HUHA 5C46F 3LFHA 1NL3A 4H60A 4JYPA 5E4TA 4LY0A 3QKIA 3TRHA 2ZRDA 2Z57A 2VJKA 3MPOA 1GY8A 1GTVA 5DRTA 2YVKA 2VNIA 3UAYA 2QOEA 4K3UA 2GCPA 3PRYA 3OJLA 4PYRA 5DYWA 5T6BA 3SLKA 2G83A 2ZOSA 4EO4A 3LUGA 3FB4A 4G9EA 5I3ZA 4Q1CA 4TMXA 1UWLA 5LSAA 4UFPA 3AF6A 1OXTA 3PE3A 3QHQA 5EHGA 5ICEA 4TOIA 1XLTC 3AF3A 1LJUA 3DE2X 1JW9B 3HZZA 3GJ7A 5JY1A 1M7BA 1YFZA 1KDZA 4R2JA 5I7OA 3VKHA 1FLNA 4X00A 2JLZA 2AXQA 1KOGA 3F98A 4D0SA 4BTVA 2YC4C 1KRXA 2A5FA 2NZXA 1R6BX 4RD0A 3WQRA 2UXDB 4PO1A 1XDDA 3LS2A 3ZZTA 4AC9A 5SV2A 1Z45A 2E4YA 2NSYA 3P96A 3RIHA 4DV0B 3ICPA 1WW3A 4BLWA 1G38A 1KEKA 2IGBA 3PYLA 1T1JA 4K9NA 4JK3A 1BKSB 1J0DA 4Z4IA 3D2CA 2BR3A 3A10A 3VJLA 4B73A 1LDYA 4A8JB 3EGOA 2WSSA 1UCFA 3VJKA 4CLDA 4CIXA 3GU3A 5HKKD 1JFVA 2LR0A 3HDHA 1JH9A 4R9SA 1PWZA 1R4MB 3I9LA 2C4KA 4F97A 2KE5A 5JO9A 3AJEA 4Y0VA 3E9DA 4CM4B 2J33A 1HQCA 4P33A 1WQ3A 3PSHA 1FFBA 2IA5A 2IDMA 4UU0A 3O0TA 3MJEA 4RPCA 3SS8A 8MHTA 3B12A 5JCJD 4MV4A 1D8AA 5TNXA 4WN3A 2A9VA 1G9SA 1YK0A 5GOTA 1T36B 3OHSX 4EO9A 1W25A 3I9MA 4P98A 2HMSA 3H17A 1EMDA 4BJ3A 5LDGA 2VNJA 1UMKA 2VTBB 4ZTBA 5KBYA 3P5SA 2GD2A 2IDKA 2PZFA 2CL6X 1U9ZA 4KIFA 3VDMA 2GZDA 4YQFA 1KZ9A 1OLXA 2P9YA 3LK7A 1MX3A 1RJDA 3B6MA 5IM4A 2Q0QA 2QYTA 2BEUB 3AI7A 5IRCD 2AEFA 1IEVA 3KIPA 4D9MA 3QMMA 5IT4A 2WYOA 3P9NA 4B44A 5HQTA 1FMLA 2XT9A 4YMSA 4LGCA 4YUVA 4HDSA 1DCKA 2NIPA 4WNYA 1D4AA 4XEUA 1SC9A 4JDUA 3O2QB 5KTYA 3DDSA 4OP2A 2R47A 2ZQZA 1R0RE 1RJGA 3G68A 1PEDA 3ZGYA 2CJYA 1TU4A 1HYHA 3AF2A 2MJLA 4ZVMA 2GGSA 3X0DA 4CEHB 3VHQA 2GSDA 5IVHA 1E3TA 3GHHA 3QKTA 3DFMA 3ZV4A 3GEGA 1HDXA 3R5JA 2IYLD 1QU3A 2SECE 1NPYA 2YWJA 1DUVG 1J1UA 4RELA 1RWQA 2AOTA 2F8MA 4RVHA 2FP4A 5AKZA 4RVDA 1JJAA 4R31A 2CW5A 3C8DA 1B8UA 2VDJA 2Z8XA 4RH3A 3GT0A 3BB1A 6ABPA 2Y76A 1DC3A 1KO4A 1ZVKA 4PG6A 1B1CA 1PJ8A 3JS5A 3KTDA 4UDXX 3ZS9A 5JRJA 1N32B 4NI5A 5FLEX 2C3MA 4GEKA 1GEGA 2CJWA 5EL0A 3R7LA 3GDHA 3PNPA 3UAGA 4HPJB 1YOVB 3RTEA 1U98A 4UZSA 3L1HA 3Q2OA 1QQTA 4B3HA 1EWKA 2AFVA 4JBLA 3N7UA 4JNCA 1NM5A 4DMFA 2JZCA 2BEWB 4AY3A 2C57A 5DK4A 2NXCA 5CLJA 5AVWA 3A26A 1Q95A 4YHBA 2A35A 3UUFA 3NZEA 2WJGA 4KPGA 2L17A 2JJ1D 2X1LA 4L73A 3VYRB 1SU6A 4NICA 3EWAA 2WU8A 2EC5A 2H1CA 1EFKA 1OT5A 4R83A 3NOXA 4RESA 3P9QA 1DPFA 4WX2B 2OAP1 1NN0A 4JKOA 1UADA 4XD7A 4ITUA 4XWTA 5G3YA 2H7XA 1QIIA 2P9FA 1T3HA 4FGWA 1NI3A 3CM0A 1GARA 1I6MA 1NVKA 4EHNA 1T0UA 1WCWA 2EV9A 2G40A 2JKZA 1VKJA 1Z2CA 3BHNA 2XWJI 3A2NA 4UUQA 1P5JA 2EBHX 2DFVA 1SBTA 2QAJA 3IV7A 4F86A 1YACA 2HD4A 2WWRA 1W5SA 3TRDA 1BJTA 4OQNA 4HI0E 3K8OE 3PQ2A 4LECA 1RMQA 4KN9S 1BMFA 2ZYRA 1KK0A 3IX7A 3EMVA 1WQ4A 1GAJA 3B5JA 4K8RB 2WTAA 1KJWA 4YUAA 1TO6A 1Q14A 5BV2P 4HXYA 4EA7A 4GDFA 3GRAA 2BRUC 1AS3A 1TF2A 1G7CA 1LPOA 2I03A 2O2JA 2ZRNA 4HEJA 5KNDH 4JI0B 4R4JA 3RIGA 3KDPA 5EY5B 5HM6A 5DNDA 1W4ZA 3KB1A 1UBMS 5FHRA 3DMGA 5AVYA 2Y6UA 3H2GA 2C9ZA 3VVMA 1AV7A 2R0QC 3HJFA 1G8KA 3FPLA 1VL1A 2AE1A 5FOUA 5GJVC 3AM1A 1X94A 4GKKB 4R7ZA 3GX1A 4YCNA 3ES9A 3R4VA 5B7GA 1M5RA 2YV1A 3IVAA 1CUBA 4L0MA 1B2LA 4X91A 2HHHB 1OXUA 1U0OC 4HZGA 5EZYF 1E6MA 3WAKA 4EHIA 3MT0A 2GEFA 3H5VA 1XNRB 2Z9BA 1E6CA 4G65A 1SXJB 1E6UA 5K3SA 1T2VA 5A4IS 4M89A 1URPA 2HT1A 3GGCA 2L2QA 4FXPA 3BJIC 4KWEA 4Z0HO 1XZNA 2HK8A 4NOKA 2YIJA 4Z0PA 5KREA 1ZNZA 4CLHA 2ZS9A 2OBLA 1GG2A 2W6IA 3LBNA 3RVJA 2ZM5A 3QTTA 1QRAA 1N1MA 4F84A 3MWKA 3S1AB 5IWAB 3D9QX 3U7HB 3ADDA 3V7UA 3W3AD 5ALJA 2IU4A 1E6KA 3BRCA 1QK4A 1FYFA 1SPBS 3GT7A 3IBFA 5HUJA 2W9XA 2VDPB 5F78A 4EHJA 4B4VA 4N65A 5TQ0A 3CGGA 4EZIA 2V97A 2GYYA 3LP8A 4ZAYA 3OCCA 3DZGA 1XAGA 3GZJA 3GD5A 4R9NA 4P86A 4R6WA 2JHGA 2FSUA 3PP8A 4BMXA 1CZLA 1UZUA 4HXGA 1OLXB 5LLSA 3IEIA 4ZOBA 5KQGA 4ZDIA 1JZTA 1W93A 1QH1A 1V41E 2QROA 4FS3A 1QP0A 1E3LA 5ALUA 2CUNA 2HCTA 3OPNA 5FP0A 4HRVA 2GBCA 3F6RA 3IR5A 2EFCB 4HDSB 3QLUC 1Q7BA 1XNQB 4V24A 2YDYA 3L92A 4WOJA 3SXJA 1J09A 3M2PA 3ND9A 3R6TA 4CNQA 4O5AA 1VE3A 1VP9A 2O19A 5LIPA 5AK6A 3LZCA 1VPTA 1TJ4A 4Z8YA 1A4RA 4AUKA 1G7RA 4XUCA 4IDEA 4JEIA 4TMZA 2O5CA 3QEMA 5FTLA 2GEDA 4RW0A 3QVKA 3PNOA 2PD6A 4ILKA 1LS6A 1LWNA 1HY3A 1RLOA 4KXNA 4PC3A 3TBKA 1V9CA 4QBIA 3W9YA 4E22A 4ZICA 1G2PA 2GRJA 1XOIA 3EIWA 3HCRA 2W00A 4N1AA 1EFPA 3U40A 1J2JA 4DL9A 2FP4B 3LDUA 4A0HA 1E61A 1WQ1R 2JF0A 2YJ4A 5KI6A 4TGLA 4MMYB 2I4NA 4LMRA 4F2WA 4BNFA 2R1TA 2PRIA 2CKDA 4RZUA 2P62A 5E0OA 4BRSA 4CJXA 3CPEA 5E9QA 1UK7A 3C24A 2I1VB 2JVJA 5K8TA 1K9VF 2X76A 1G19A 4TKZA 5L9AA 4B3TB 2QYOA 4I1PA 1N5DA 4CG3A 1V8FA 1ZVMA 3BF7A 3PQFA 2M6KA 3UOWA 4AS3A 1A4XA 1K6IA 4PG8A 4GI7A 5KNDA 2ROQA 3WWPA 1BWPA 4EA9A 3ZVNA 4MEJA 1GPJA 3MAAC 3T6KA 5F52A 1E2PA 1MV5A 3FWHA 3THSA 4CPDA 4YRCA 4QVIA 3ZE2B 3PL5A 4F45A 4Z99A 1YJ5A 1W9MA 1A96A 4MP6A 3VDXA 1U7UA 4L4XA 4R7GA 3U31A 1A8SA 1VSQA 4RGYA 3I4FA 3QKSA 4ZEVA 1TMGE 1QIKA 2WJIA 3MWDA 3AV3A 1YZYA 3IKLA 4MLPA 4CMKA 5CDSA 4H6PA 2YYYA 4B7XA 2WJHA 3K72B 4PPGA 3GLFA 4EY6A 5IXJA 1AN9A 4E5VA 4P4NA 4MQLA 1MEJA 3KSAC 3Q8KA 2VHCA 4AW9A 4AJ1A 1EXWA 5FD8A 4DM3A 3WRXA 2IYVA 1ZS9A 1FFHA 1HRKA 1W44A 4GU5A 1BYUA 4JC4A 5IK2A 3U1BA 1UEXC 3FDZA 4KE7A 1OOEA 1QFSA 3BUSA 5JDIA 3JALB 1E4VA 2CVOA 5NLLA 1B8PA 3JYOA 1PKEA 3OM0A 3K2IA 4CT0A 1NBEA 2G3YA 4ZGGA 4O0LA 1ORHA 3STWA 2ZAYA 3KJIA 2W6JD 1GP2A 4Y9RA 1RI3A 4DB2A 4XFKA 5FCDA 3DB2A 4XJXA 2RGEA 3O73A 1GLGA 4H4CA 3ZD9A 2B21A 2VK2A 3RV4A 3NC0C 4UM5A 1PL0A 5ALPA 3TF5A 2VZ9A 1G5FA 3K9LA 2XB6A 4CR6A 4D4GA 4I5DA 2GTPA 1GGEA 4TL7A 5ALTA 4YMUA 4MVJD 2FG7C 3GGPA 1CV2A 2EFGA 3LUDA 3LMKA 3T7EA 2B7CA 4B4DA 3L8YA 1G8AA 3Q9UA 3LKBA 1K5HA 1U94A 4X85A 2EJCA 2JIOA 2GKGA 1EDZA 1Z4OA 1PG5A 3P2JA 4MRNA 5CFLA 1KPIA 3AUSA 4V39A 5BUCA 4TWJA 4WEOA 1SBYA 2AEEA 1MC4A 1MMFB 3KOWA 3W7VA 3RJMA 4OI4A 4Q03A 5C4IA 1GTSA 4RDCA 4B6JA 4B74A 2IELA 3MRSA 4TT3D 5DK6A 3L7AA 4KXXA 1T1SA 1NBAA 2FFAA 3A25A 1MEEA 1P1BA 1NW9B 2BE7A 3LLVA 1IOLA 3KD2A 1R0CA 3PT5A 4J0FA 4MW4A 1QZ3A 2D2VA 2TMDA 2I6UA 1EUDA 3E7WA 4ZT4A 1RWWA 3I42A 3UJ3X 2PAFA 1I7SB 3DTTA 5JNTA 1JYSA 4XOIA 4JP8A 2UKDA 5LC1A 4PINA 2ZI3A 4CNBA 4I4TB 4J6FA 5K8IA 3ZHSA 5C35A 3SFZA 4UU8A 2JGJA 2IK8A 3LM8A 4G0PA 4Q19A 2D5CA 2B5OA 2XTMA 5K3EA 3PD0A 3ZU4A 3A1FA 3HL4A 2BHNA 5LYJA 1LBHA 3WZLA 2CLOB 3GA7A 5LLTA 3C3PA 2WHXA 3G17A 4IHJB 4DBZA 1Q16A 2W42A 1QDUA 5GJCA 1QGYA 2FGKA 3IAUA 5FX2A 3VUEA 1RNLA 3TCKA 1F6BA 3UMYA 3W04A 10MHA 1SKBA 2PH5A 2PKXA 3VPGA 2DMRA 2XZTA 4G23A 3W06A 5FLYA 1C4XA 1O57A 1P18A 3P4XA 1GCUA 1SEVA 1SOWA 2IYOA 5LA6A 1A7UA 4NU5A 3UJCA 1U80A 1AKYA 1DBRA 1N7GA 1W0KA 3QEMB 5SZKB 3V8BA 1W4AA 4PWYA 2M2IA 4LTNA 2P27A 3OCJA 5E9JA 1W0JA 4YP1A 1GRNA 1MXHA 3IBTA 2X14A 2NO4A 5KNBH 4DR2B 4JQOA 1I7DA 1YU9A 4JVLA 1E62A 4D9GA 4MDEA 1P62B 4WDRA 2EIHA 5A6SB 1EFPB 1UBUS 3NT5A 1QUFA 4QGAA 4Y2QA 3TS1A 2O54A 4YNBA 1NJ5A 1WXIA 2C5HA 1M0WA 1TJ5A 4UUNA 2HKIA 3RVMA 2R1TB 4RETA 2QSUA 3MM4A 5HRCA 5J4HA 1XE3A 3VOBA 5DLEA 1LI4A 1THMA 3IB6A 4RM3A 4H17A 1XJCA 4M0DA 4M1EA 3WDMA 4EFDA 1TIBA 1C9EA 1ADBA 1ZISA 2ESRA 3QGMA 4IXWA 1ZM2A 4K87A 5HIIA 3U49A 4AIIA 4B45A 3PD7A 1N1EA 1X2BA 2JASA 2BFPA 1DELA 2J3LA 3ZBTA 2ZJ7A 6REQA 2PUGA 3PA8A 1TW2A 1OGJA 2GUWA 3E23A 4OHMA 1UINA 4MGEA 1DSSG 2Y2VA 4HMPA 2OXTA 3JQ8A 4C4PA 1KZ7B 3DM5A 1X70A 4GL4A 3VPDA 3EZ9A 2I4RA 1EWYA 3H0CA 4WGFA 4B2LA 3H5WA 3LECA 3ZDCA 2TS1A 2PFKA 3DDUA 1G21A 3MWDB 1NV8A 5ED0A 1R00A 1L8LA 3TQOA 4AJ2A 1HK7A 4ETWA 4YJ2A 1S9DA 3E22A 4IFBA 3I8SA 3GLFB 3CY6A 1MX9A 1TI7A 2O20A 2VIIA 2ZBEA 3DZIA 3F7TA 3PKJA 4OL9A 4UHBA 4WLFA 1BJRE 2B99A 1R1DA 2YHSA 4NULA 4BECA 1U1CA 2GCGA 2QTVA 1Y81A 3OO1A 4UHFA 1RYEA 1L5VA 3A1VA 4D8XA 2VDRB 1X92A 1XYVA 4DFDA 3FDZB 3D6FA 3AFIA 4MITA 1ZN2A 2JAPA 2HGSA 2VYQA 3KKNA 4ENPA 1M2GA 1U5CA 3IAM1 3BMNA 4P7FA 3FM9A 2JC3A 3RO7A 5C52B 2Z3WA 4C0XA 1C2YA 4CT5A 4TV8F 1Z5GA 1SBHA 1U7XA 1W49A 3LHFA 3EEBA 4DGQA 4QAJA 1O95C 3TNDA 5AW1A 4LJ7A 2R25B 5G0SA 4BAGA 1XU7A 2JW5A 4BX0A 3ZLTA 1GUAA 2HPHA 5G1PA 5KYWB 4YAUA 3VU1A 1ETUA 2A57A 3AJRA 3SX4A 1UL1X 3WMGA 4DARA 2OZEA 3R6DA 1NGSA 2AZTA 3ETJA 4FMCF 4E32A 1YHNA 1KR5A 5BYJA 4BKMA 1ZRHA 2EEZA 3K32A 4JELA 3V4ZA 3HXQA 1C3VA 3ETHA 1ARZA 1BE1A 1T3SA 5EIFA 5A0FA 1ORTA 1M2WA 1GNRA 3C3MA 5KHAA 4NZOA 5E9AA 2JLVA 2NOAA 1V45E 1N92A 3H0EA 4QULA 4O0MA 2FSFA 3S81A 5C1PA 1I7NA 3QBJA 4BNZA 1S96A 5BYAA 5LXTA 1Z07A 1NUHA 3DKIA 1EUDB 5JSKA 1M7HA 2NUAB 4LHEA 5KNBA 3PUIA 3ZGZA 2F2TA 4Z9YA 1L5WA 1YRAA 2FQ1A 2PVSA 4KXUA 2OCGA 3W7BA 3ZW7A 4HH3C 2I2WA 3J81A 4ZXFA 5JAZA 4HQOA 1S02A 1GPMA 4BWFB 2ZRLA 3A6LA 4PG4A 2WTUA 3IR7A 1EIZA 3D8TA 1EBBA 1T5OA 1KAHA 3UQZA 4D3ZA 2LCQA 4L5JA 2ZJYA 1EQUA 2XF8A 3WFJA 5K6RA 1JECA 2ZJBA 4P5EA 3VNQA 5JSZA 4F9FA 1FFCA 2YY7A 1PS8A 3PITA 3ZWOA 4G0WA 4G84A 5FWNA 3LXRA 4TXJA 5B36A 1P39A 1QFYA 2DUMA 4G01B 3TZLA 1G6OA 1F60A 2G9QA 3RS8A 3EPJA 4NU0A 3GZNA 4RK6A 4PIVA 1QHEA 3LUJA 4XVQA 1OXKB 1XCBA 1C3LA 1X7ZB 2JLCA 6PFKA 3V4LA 2O57A 4DLUA 1QFZA 2M6SA 3B38A 5LA6B 2G0AA 3SLGA 5BRJA 5HDBB 1L5GB 1JFLA 4RHCA 2E5LB 3GB9A 1SEPA 1QG2A 1NN5A 2VP6A 1J0XO 2X58A 1NJ2A 4MO2A 4PHHA 1E2HA 2PE5A 3VR6D 1B4DA 1Z0JA 4BC1A 5BPFA 2PU5A 1I5OA 1LPAB 2Z58A 3J7TA 3SI7A 1JE1A 3CLKA 2O05A 4WV3A 1IJKA 1QTRA 2Z04A 1JDBC 2DWUA 2VKTA 2ZULA 3BWYA 3GRVA 4YVFA 2J3EA 2XCRB 3ZS8A 1R64A 5KTRA 5L51A 1BTOA 1M7GA 3EHEA 4RF3A 2DUJA 4XYBA 2NZVG 2RAFA 2C99A 3BG5A 1ZMTA 4FBMA 5DI3A 5CLGA 4UBNA 1ZLXA 2FQQA 3TIIA 3TQQA 3U1VA 1GZUA 5JNWA 3F71A 3LD9A 4HGQA 5E7IA 4MW0A 5CCEA 1W52X 4TYNA 1FMFA 3INGA 4XVHA 1IY9A 3EASA 5DHPA 4URXR 3OU2A 4LYAA 3BGVA 4BPBA 3O1HB 3T12A 1NTRA 1HDIA 3V7FA 2RSLA 4NMMA 1YV9A 1PZNA 2WKQA 3B13B 3USZA 2G1JA 3N2NA 1GO2A 3AFHA 3K8ZA 4K1LA 3UO8B 5GZ6A 2QUAA 3EDMA 5HPYB 1CYEA 2D1SA 1H0SA 1G21B 4YJ2B 1ONBA 1HPLA 2H4ZA 1HYBA 2IC5A 5CD1A 4UVHA 4YAOA 2D5AA 2ADMA 1KJYA 2OHHA 1HT3A 3MT7A 3WK4A 3WYNA 3OFKA 4EFKA 5IS2A 1RWPA 2RGAA 4OMCA 2C4TA 4FZ3A 4IWNA 1YCGA 5A0TA 1OBFO 2O1SA 1T2CA 2QTVB 3DB1A 3S70A 4F5WA 3N87A 1VL5A 1KHTA 1MLDA 1P6QA 1XEXB 2NSJA 2WSMA 3NOQA 4PANA 2YJ6A 3AL2A 2IOHA 3ZHXA 4AY4A 4BMSA 2GK6A 5JECA 1DU4A 3R7FA 1D9XA 3BMNB 3TL3A 3LPLA 3PUZA 2J3DA 4OI0A 3P0IA 1UMCA 1BGWA 2VK1A 3HBLA 3H11A 4N8DA 2PEYA 4DZTA 4L3OA 1QV9A 2DSNA 2WUVA 4ESVA 2CDCA 4AAYA 1ISSA 3TW0A 5K0TA 2Q6LA 4LGMA 4MQEA 4Q16A 3OO0A 5JTTA 2AD5A 2E21A 4DY4A 5JEDA 4DA4A 3ESAA 4BLVA 1OAKA 3WAJA 1QCYA 5K20A 3LL7A 3RBXA 1PO7A 2R9VA 2WIKA 4QJIA 2A92A 1T13A 2NZYA 2J46A 1IEXA 3FJ1A 5L95A 4MMZB 2ICAA 1NRXA 3QLVC 1MABA 4M7OA 4RD4A 4HLDA 5A4FS 1DJPA 1MQ9A 4Q02A 5F64A 1X6VA 1ZOIA 3DBHB 3NHSA 3O3NB 4H31A 4BNUA 3KC2A 2ZBDA 1XWFA 4F2DA 1AQLA 1CUVA 1QRRA 2YMMA 3OJCA 4EY3A 2ZR7A 3AX6A 1CP3A 2CXOA 3PYXA 1C1DA 4HQKA 2ZIVB 4NG4A 2Q4RA 4XFJA 3RSFA 3WSVA 2IUUA 3ZXXA 1R9GA 4DILA 4ZYXA 2FRDA 1KIFA 1EPUA 2FW0A 2O0MA 2ZB2A 3WMEA 3IUBA 3FLAA 2F8LA 1EG2A 5IN5A 5LXTB 5AW9A 3WHKA 2Q4BA 4EJ6A 2ZXFA 3IP1A 2XYPA 3KYCB 4DSTA 1Y5NA 1YDEA 3R4CA 3HNRA 2FMHA 4C3OB 3MG9A 5K0SA 3UA4A 1KAMA 5F1YA 3ANXA 3PXBA 1DKRA 3GO4A 2C4WA 2EHDA 2R6DA 1YK1A 3D7RA 3AHFA 3LPMA 4UDNA 3B3GA 1KRWA 1JIJA 4OCZA 1N6PA 1YZQA 5I7UA 4AJOA 4HFNA 4RDHA 4WXEA 1WUKS 1NYRA 5JSZB 3ILVA 4TQGA 4V0LA 1KKLA 2WJ4A 4XVUA 2C29D 5TB5A 1YQUA 2H1FA 1HEYA 2PRSA 2I71A 1QGAA 3PCXA 4DMLA 3R3YA 4DV6B 1FRFS 1BDBA 3BMOA 3CRW1 3GZNB 2EJUA 2H4HA 2WE8A 3QUTA 4HGOA 1KVRA 1PSDA 4M1QA 4MV8A 5FO0A 3ZHRA 2QAGA 1UWCA 3DW1X 3WWCA 3SYLA 1TVKA 3TTTA 2Q4TA 5D84A 1NG1A 3QBTA 4IMIB 4REOA 3B1WA 5DISB 4RVGA 4Z4CA 3VDNB 3QWAA 4Q05A 4CKXA 1SC4A 3DKPA 1D4FA 3FMPB 5KYYB 3DC7A 4XQEA 4GECA 4UJ5A 4PSUA 3OH8A 1FIUA 4L08A 3CG0A 4KIGA 2QLMA 4CLOB 4DLXA 4EUEA 1YB2A 2CMHA 2DLNA 5LQUA 1R15A 2NXNA 4X20B 1KERA 5E3JA 4B3FX 1UBJS 2DWPA 1M6VA 4TLEA 5HJEA 5EIBD 3CO0S 2EX4A 5DI3B 4L8FA 2N42A 3K0SA 5FRDA 2BSAA 1SZDA 2PMCA 4YUWA 2Z2JA 3VPHA 2WHRA 4JCOA 3N0WA 2QPLA 1G5HA 4OMUA 3EDQA 1TAGA 3LTNC 1PEYA 3A28A 3M8KA 2QW0X 4F93B 4GQIA 3R2JA 1OHHD 2DXIA 2V8BA 4Q9KA 2H63A 4D6XA 2AK3A 3GLHB 4TS3A 1SVKA 5BWNA 1B1AA 3H9EO 2FDCA 1D6NA 1G5TA 1W4LA 3DMFA 3LGAA 1N2JA 3QY9A 1UIRA 2IYZA 4WMLA 3SHQA 2HXGA 5KPJA 1YA4A 1DHRA 1H6AA 1L7NA 3K5WA 1G2OA 1SY7A 1PL6A 3FVTA 3H2SA 4HB3A 1OWLA 1PTJA 1ESZA 3BREA 2XCSB 1M75A 2XZDA 3KYJB 4US0R 5ERGB 1NZFA 4DC9A 4ZVUA 1USVA 5AQ1A 1I7QB 2PUAA 2A5JA 1U1IA 4C4YA 4D92A 1O6CA 2I80A 1KZ1A 1UC5B 1Y9JA 3IHTA 5FT9A 4YB8A 4P54A 3G3EA 4QBGB 1FPQA 1ECLA 3WLEA 2NNLD 3UMSA 2HA3A 5GJWC 1Z8NA 4G0ZA 1G4UR 1UMCB 3MOIA 4IIJA 4CEJB 4EGCB 3H11B 3WNQA 2HLHA 5BWBA 4B2IA 2N0SA 3PXCX 4FE4A 1P5FA 4UEOA 5K2MA 1FP4B 5FQOA 4CCWA 5H3HA 5TMEA 3PXDA 3R5TA 4EB0A 1MO4A 4OFWA 3HM2A 1TQ8A 1HEUA 3MFQA 5AM3A 5EUCA 5JAPA 3EZLA 2XYGA 1GQRA 4RPLA 4RXTA 4WKCA 3OZXA 1JH8A 4NFLA 3TLCA 2P90A 2QRNA 4QU8A 2I2XB 4RO0A 3HVJA 3H5LA 1GNLA 1FMJA 1IZ0A 3RNOA 4DBLC 2I99A 5D5HA 1T24A 3TN7A 2QZ4A 3FHOA 1BA2A 4C4XA 2PGIA 3C3WA 3MCZA 4DQVA 3RG8A 4BNXA 2BH2A 2B8NA 2ZBRA 2MOKA 4UDYX 5BVGA 5JRDS 1JB1A 4LJSA 5G3ZA 4F4HA 1QHIA 2IUEA 4US2R 4CVNA 4NESA 2WTMA 2HCJB 3ZHZA 3JQPA 1K8RA 1Q1AA 4Q15A 3V9AA 4CCSA 3LOPA 1FUIA 2HTFA 2XAUA 1LF5A 2L42A 2O2DA 2BI4A 4OMFG 3NS7A 3VSEA 3CRZA 3RF6A 1KXJA 1L5RA 3U3OA 2FLVA 5BV7A 3UWSA 4JI7B 4F60A 3PF8A 3OP1A 4CF4A 2GVDC 4ZYVA 1FS4A 4U8GA 1WPGA 2OCIA 3IP5A 3JQEA 4DVGA 2W2OA 3ZJ5A 1HTWA 4D3DA 3EXFA 3L7BA 3UT5B 1L4HA 1KRHA 1POXA 4MUXA 1U3VA 3OE7D 5FNVF 2ZDGA 1FFXA 1OFUA 1SXQA 1VJCA 2VUIB 1SO8A 2B4QA 4DKJA 3AF4A 5E38A 3OZAA 3SZOA 3OLWA 5KOHA 1CZKA 3M5CA 4XWYA 3H87A 3MPUA 1Y6GA 1WMAA 3NTXA 4J3JA 3VHXA 1XPOA 2PUCA 4P08A 4CHTA 5G4KB 1IBRA 3VNRA 1PGNA 1ISFA 1GZ6A 3NGMA 4H7FA 2OD9A 2QAGB 1RAEA 1UXOA 1BVRA 2VAVA 3ZIUA 5ITSA 1TVKB 5CT9A 4ASUD 4ARSA 5K6AA 3T3NA 4S12A 2F8SA 1QWSA 5T8KC 2PWAA 5F4BA 5IFLA 1WHSA 1T35A 2JK1A 2CK3D 1U11A 1XNJA 2AKEA 2GYVA 3GNLA 4QKQA 3V1KA 4DM7A 1F7UA 2TRSB 3D3KA 2N46A 3UV6A 2A0XA 2M1ZA 2VS1A 4IBOA 4DXHA 4K0KB 5F3DA 4CEIA 5ERYA 5IASA 3CVUA 1DVRA 3JQ9C 2C7QA 3GLFE 1A71A 2ZYIA 1M6VB 3AUAA 4D80A 5ICSA 1JDSA 2UYHA 3NQ41 5FL7A 4C0JA 5DF1A 4BYGA 1KYIA 3DDZX 2X3FA 4ZVTA 3BRSA 4YRZA 3P9RA 4RQTA 3D64A 3HDVA 1ZKMA 1ZJZA 1YDHA 4F3KA 4AULA 4JQCA 1RC0A 4KV9A 4YS6A 1JR6A 3KZ1E 1G3QA 3ZWYA 4B32A 1IY8A 2M98A 2GAJA 5K9ZA 4MVYA 1MC5A 1XLVA 1PJ4A 2OTCA 2BGWA 1XCLA 4MWGA 1XQVA 4L8LA 2O4CA 4JVNA 3GEIA 2PZJA 3GFRA 1GLVA 2PX2A 3HWRA 3IPRA 5KTSA 3BFVA 1Z2NX 3WSWA 4CDMA 2OCKA 1NQXA 2VAXA 3SEAA 9ABPA 3E53A 3PB3A 3WFIA 3JQAA 4E08A 4OHRA 2HN9A 2K4MA 2VBGA 1CXZA 1K08A 1FP6A 3IEPA 3HJBA 4HMOA 5D7NA 3C5HA 3K0CA 4MHSA 2VJDA 3F2IA 3L4EA 4Z9XA 4JBWA 3ZW9A 4GMGA 2VUHB 5BSWA 4BCCA 2C54A 4AX4A 3FUXA 4QRDA 2BJHA 3U4CA 4BQPA 4E1VA 3M70A 3A06A 1KE2A 2ECFA 1EFRA 3FZEA 2EJBA 4JFAA 3OM8A 2JFZA 1TZMA 1RRMA 2R86A 2XCQA 5AVXA 1XV5A 4HAXA 3HB4X 3ICOA 3FJYA 3FSJX 3DXYA 5GAJA 1JR3A 3FLBA 1X3LA 4TYPA 3OD1A 4URWR 3IXLA 3EYAA 1DJNA 3B2NA 1JHAA 3ETCA 2PLNA 2C20A 3WLNA 2OV6A 1A1VA 4JWTA 1U7HA 3N6RA 2H1OA 3WQHA 4O4JB 1X77A 1DQPA 4NMXB 4YCJA 3TI9A 3ZZUA 1W2GA 2QXYA 5TMPA 4IVPA 1HSOA 2BR5A 2W2LD 2WSIA 1OWNA 1XQXA 2P9TA 1YJ8A 3HO8A 3VYWA 1GPAA 1XRQA 4YRLA 2A3RA 3QE9Y 2W2QA 1R9JA 2J48A 2JIZD 1DTWB 3CNOA 4WLUA 5CM2Z 2CDNA 3PVCA 1HE5A 2GEVA 1YR2A 1LK5A 2Z98A 4JWKA 3TNLA 5DLPA 1J2EA 2CBGA 4I46A 2OENG 4X1YB 3H5IA 5CT8A 1OTXA 4D79A 5J47A 5GM2A 2PQ0A 2J6IA 4RKYA 2FWIA 2YXLA 5AIAA 3ZGOA 1X1EA 3KAKA 5DYIA 3BZUA 3DOIA 1VXRA 2CJFA 4KSBA 2RJOA 3H5NA 1KH1A 3CSDA 1G9XA 4QDXA 3VSBA 1RLMA 3EXFB 1EX6A 3HFJA 3SHWA 4F2PA 2DG2A 3AUYA 4UTRA 2VRCD 4H2DA 1H23A 1E20A 1Q91A 3OPYI 4J90A 3C7AA 2GJ9A 4D02A 3QRWA 3K2QA 1Z6XA 1F4VA 1XKTA 2WEKA 4PFSA 3W5HA 3WTCA 4P35A 4BX8A 4QICA 3KAJA 3FRJA 3VHXB 5GJBA 2MDTA 1OI3A 2QSJA 2HJHA 3V46A 1NYQA 2XX3A 2P0EA 1YB7A 3CA8A 2PCLA 2PRYA 4H59A 4HDRB 3TJRA 1ZMXA 5EUMA 3Q1LA 5B4UA 4AI6A 2C9BA 1LBTA 3ELDA 3QYJA 1G4HA 1P0MA 3UAOA 2W37A 4MUMA 5DM60 4ETIA 1WHSB 1NAIA 1K06A 1OT3A 1ABEA 1TZCA 3WLTA 4QG3A 4DA7A 1IBKB 3ZX5A 3TQSA 1SBQA 1M0TA 3HJTA 3ZU6A 1G21E 2OHIA 1U1DA 2WM3A 1XCOA 3TLZA 1GQQA 2OMEA 2TSYB 4HDMA 4IYRA 3ND7A 4OKNA 4CEIB 4PYMA 5DO9A 1TAUA 4IH4A 1GPKA 1O94C 3FSEA 1A1SA 2OE2A 3N0TA 4GF5A 5GV8A 1W35A 721PA 2PVCA 3UOAB 3UMBA 2ZUDA 2DY0A 3EMKA 5A7GA 3P45A 3S28A 2Y9MB 3UENA 3C0KA 3LBYA 4KQ2A 1TUBA 1ZONA 2AZDA 1N0WA 4B0OA 4IDFA 4BMZA 5BWOA 5M2QA 2QMEA 3ORYA 2A5LA 4CM9A 2R48A 2CWWA 3FNFA 4U0JA 1UOQA 5LBUA 4FHEA 3RAPR 2WJ3A 1RVV1 4IUBS 4DIEA 1TKAA 4MRRA 4ZDKA 2WTEA 5H70A 4ZVKA 4EGQA 2V45A 1AF4A 2IKQA 4PN3A 1AVTA 4D6YA 4N82A 1X1AA 1EJ0A 3P0RA 4MB2A 3UMFA 3T3GA 4Q3KA 1L5NA 1NPDA 4ZPJA 1VPLA 1NOKA 3FDIA 1CP2A 5DEOA 3T5BA 1KEWA 1CDDA 2YV4A 2UDPA 1FQWA 5CG2A 1XKQA 4TWIA 2CXUA 5K3OA 5FBKA 3F4LA 5F3RA 4UARA 1ZJ6A 1I1NA 2V54A 4AMBA 3W9SA 3L0BA 1Y5LA 3GL9A 3VJMA 3WRWA 1WCXA 3A4MA 1NF8A 2VJOA 3SIWA 2FEWB 1FDVA 2XWPA 1EUZA 2CF5A 7MDHA 5KTPA 4JOCA 1YR3A 1Q0LA 2DT8A 3CRMA 4RZQA 3ZIAD 5HHTA 1CW2B 1E7SA 3HLYA 4ZO7A 3LO5A 5CEFA 3URMA 1ISJA 1E1QD 1T8YA 2HK7A 2WIBA 4XWOA 3A58B 5DN6D 3KQKA 1ZD1A 1UJBA 4ZIRA 1DFGA 3ZE1B 3U62A 4X3CA 1ECJA 2UYGA 5A05A 2CNLA 3D4OA 3BL8A 4JLUA 5IP5A 3F3SA 4V3CA 4Z1MD 5L3QA 1B6TA 1GUYA 2BF4A 2ZTLA 2J30A 4NH4A 1KDYA 3WG9A 2VP4A 3UAWA 1G98A 3OJEA 2I5PO 1XZPA 3BDAA 1CDZA 1E96A 4NQRA 2H59A 4L0DA 1Z2OX 3HI6A 3DC2A 2Q8NA 3JQ6A 3PPIA 4MW2A 1JVSA 5MDHA 1FDTA 1TC2A 5KQLA 1Y3DE 5EKDA 1FOEB 1X1RA 1TD1A 2J5XA 1RWNA 1UBEA 3PFGA 4P58A 4INAA 2UVPB 3F5DA 3WLLA 2ZUTA 1Y3CE 1IUNA 1C1HA 4GPIB 4LUCA 3DZBA 3IQFA 3K9BA 5C32A 3IQHX 1JS1X 1FTSA 2EATA 2CFOA 4Y1GA 4ZTZB 3KZXA 2UU9B 3K0HA 3PV0A 4MI6A 3G5AA 4HAOA 3V1TC 2BW0A 4BQFA 1J49A 1NNLA 1NXPA 1QRDA 1GYPA 3PHBE 4O4IA 4UXIA 4D8UA 2YHUA 3IXQA 2NU9A 3KEQA 2QVBA 5FBRB 4F56A 1PE0A 3RHFA 5IARA 3H1TA 1RRFA 5AHOA 2Q5EA 3RF7A 3H1FA 3V8VA 2XYRA 3KP1A 2VUUA 2FZLA 2Q5QA 1DXOA 4TPKA 5ALHA 3CCFA 4RPHA 3QXSA 4WINA 3ZLVA 1B16A 4LDNA 4XGNA 5ALOA 3ZK7A 2E6UX 4ZMBA 1YA6A 5F9HA 4EB8A 1P74A 1XSEA 4KXFB 4GOND 3WVNA 2OMKA 5AVQA 3KQNA 2YTZA 2VP2A 1CS4C 1V7QA 1CUEA 3I4CA 1DX9A 3PUHA 4ZCLA 2OYSA 3DF7A 1CF4A 4IIGA 4PHFA 3OZBA 1FUEA 4E94A 3MCVA 1GZ3A 3JX9A 3M49A 4Y2VA 3G23A 3RS9A 1CNEA 3GLHE 1J23A 5ARBA 3DFIA 4GKBA 1ATIA 4EAAA 1TYAE 1ONNA 2VJBA 3DUFA 4UUMA 2VAPA 5KWEA 2AEJA 2KYRA 3M1LA 3C39A 2HY7A 3CIFA 2ON6A 2DPXA 5DTEA 3SX0A 5LIRA 2QXUA 3ZHYA 4A6XA 4XJVA 1E7YA 4W5TA 1ZH0A 1BW9A 2C9DA 1FFWA 2DETA 2IBTA 4CMIA 2AYZA 3GJ4A 4HX9A 1TUBB 3JAWA 1P2BA 5F33A 1T1IA 4G67A 3ZVMA 2CYBA 2J3KA 2QMUA 2ZR0A 3O2JA 1LLCA 1SIBE 1UJCA 1ZOSA 5L3SA 4DR7B 1WLSA 1XPUA 4FHFA 4C2TA 1QTQA 4WZBB 1QCCA 5JNSA 1AURA 1ZRSA 2B3DA 2JLAA 2H0RA 2XD9A 3HBNA 4EHKA 1R66A 2HMWA 1ANKA 3E7XA 2YWFA 1U3UA 3NG1A 2J3QA 2EARA 2XWQA 2NO0A 5F76A 5IU6A 5HYVA 1RD4A 1PR3A</