3DKRA

Snapshots of esterase d from lactobacillus rhamnosus: insights into a rotation driven catalytic mechanism
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
241
structure length
241
Chain Sequence
FRKPQPFEYEGTDTGVVLLHAYTGSPNDMNFMARALQRSGYGVYVPLFSGHGTVEPLDILTKGNPDIWWAESSAAVAHMTAKYAKVFVFGLSLGGIFAMKALETLPGITAGGVFSSPILPGKHHLVPGFLKYAEYMNRLAGKSDESTQILAYLPGQLAAIDQFATTVAADLNLVKQPTFIGQAGQDELVDGRLAYQLRDALINAARVDFHWYDDAKHVITVNSAHHALEEDVIAFMQQENE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Esterase D
publication title Crystal structure of esterase D from lactobacillus rhamnosus
rcsb
source organism Lactobacillus rhamnosus
total genus 87
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2008-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3dkrA00
2OCLA 2Q0XA 3ED1A 2OG1A 4KACA 3F96A 5CMLA 1HPLA 4PQEA 2R11A 3WL6A 5DYYA 1E8DA 1GPKA 4KEAA 5JYCA 4H7DA 3GA7A 4JNCA 3R41A 4AXBA 1U4NA 2X5XA 4OB7A 4Y2QA 1PV1A 5CURA 5AOCA 4EY5A 5HF6A 3SK0A 3MVEA 2XI4A 4BVLA 3D59A 4JEIA 4EY8A 5KWIA 3A2MA 5JAPA 1XQWA 3I6ZA 4HAIA 2B9VA 1XQXA 1CIJA 2BGNA 1NU6A 4B0PA 3NGMA 4OD0A 1MU0A 2V9ZA 2WJ6A 3WL5A 1J07A 1LPAB 4AX4A 3I2IA 1AUOA 5HFNA 1K63A 4LXGA 1EB9A 1JJFA 3C8HA 3BDVA 5K3FB 1QIHA 4FFWA 3AIMA 1CUIA 1CUCA 5LP1A 3QH4A 1RP1A 2Z3WA 3ESCA 4QDOA 5AKEA 3L1HA 2WUFA 3FWHA 2GBCA 1NU8A 3PICA 2AJLI 3ILSA 1VJ5A 1XZHA 1EVEA 2O2HA 4MWSA 4H0CA 3FSGA 1YB7A 2XMGA 1VOTA 3KXPA 4B85A 5JADA 4BAGA 4RE6A 2GZSA 5ALFA 2Z5GA 2FUKA 5DTJA 3KSRA 3G9XA 3WIOA 2CMFA 1QE3A 5SYNA 2DQZA 3BXPA 1XKLA 1KU6A 5HKAA 4D9JA 1DINA 1DQYA 4AO6A 4PO3X 3PI6A 3OURA 2UZ0A 3H2KA 5ALLA 2PU7A 2B4KA 1GZ7A 3WK4A 1OXMA 5FRDA 1CR6A 2CEKA 1GQRA 1YAJA 4G4JA 3PFCA 4BC1A 2HHAA 4ITVA 4OPMA 1JU4A 1X70A 2JBWA 5A7GA 2WHPB 4MJ3A 3FBWA 4N8DA 4S0XA 1Y7HA 2R8BA 3I2KA 1CUGA 3O4IA 2GBIA 3C87A 1XZLA 1BEEA 1XZDA 3Q0TA 4TPKA 4H7FA 5ALKA 4J7AA 1O6GA 4BCDA 2XUJA 1D07A 2NW6A 4Q3LA 1CPYA 4H7IA 2ROQA 3E4DA 2JGMA 5SYMA 3WMRA 4INZA 2HFKA 1XZIA 3QPDA 5LKAA 2XUQA 3STYA 4DGQA 1FFDA 3QPCA 3OOSA 2AJ8A 1AX9A 4K6KA 4QNNA 3FYUB 4BYMA 1LZKA 4W9RA 1MX5A 5AI5A 2ONCA 3EF3A 4PSCA 4Q3OA 5LIPA 5AIAA 4ZI5A 4Q34A 5BOVA 4OB6A 4B80A 5IKXA 5LZ9A 5EFZA 3PF8A 4U2DA 3KOOA 1Q84A 3R3XA 5K3AA 1H22A 1YS1X 3W9BA 1Y7IA 1EDBA 3S2ZA 1FSSA 3K9BA 2RHTA 1XLUA 1XZMA 1VE7A 1ZGBA 2WFLA 3FVRA 4UBLA 4A23A 1N8SA 1ZOIA 2VJCA 1UK8A 4OSEA 4BDSA 1CVLA 3F9CA 3G0GA 1WB4A 5IVHA 4ARBA 4X90A 3O4JA 3O0DA 4W1RA 1WOMA 1UKBA 5D3ZA 1M33A 1P0MA 5LYYA 3HLKA 5YASA 3DYIA 4KE8A 2PSJA 5FP0A 1BN6A 1R9MA 1E66A 4H7KA 1MX1A 1W76A 1SC9A 2WIDA 3C6XA 2I03A 5AM5A 4CI9A 3E3AA 3F67A 2XQKA 4Q1VA 3G0CA 3WYNA 5FPQA 5IVIA 5HQ3A 5E4JA 1EA5A 2CUTA 2VATA 1MJ5A 3GBSA 4AN0A 5ALHA 5HCUA 3W04A 2ZYHA 5FV4A 3BJRA 4EB0A 5JZSA 4ZWNA 5LZ8A 4DIUA 1CRLA 4K6HA 5JZ9A 3HYSA 5AP9A 2GBFA 4X71A 1SOMA 3A6ZA 2Y1KA 4JH0A 4DYHA 1IMJA 4UBJA 5AI0A 1G42A 4P9NA 2C7BA 4GBGA 2J3QA 4JYMA 4KE9A 5ALRA 3AZOA 4H7HA 3BWXA 4QEKA 3WZMA 4DSZA 5A7HA 4C4XA 2ZJ6A 3V48A 4JYPA 2DQYA 1DWPA 1XQVA 2AJDA 1L7RA 1GPLA 2WKWA 1MN6A 5ALXA 3STTA 1ZD4A 5ALNA 4AZ3A 4UBIA 5KBYA 2WFZA 3I2HA 1L7QA 3FLAA 1E89A 1SFRA 3I6YA 3R3UA 1UOQA 3UUFA 1DWQA 4F21A 3HACA 4JUIA 4CCYB 3R3WA 1ZD3A 1WPRA 2J4FA 2ZVDA 3U0VA 5KWJA 5DYTA 3MGAA 1B6GA 2W6CX 5HF9A 1A8SA 1JU3A 2RIPA 2WFLB 5C8ZA 3O95A 1YAHA 4TVKA 3DL7A 2XUGA 2XQIA 3E1GA 1IVYA 3H2JA 1N5MA 3B3QA 1VA5A 2HIHA 4RE5A 2C5GA 1ZI6A 5AKLA 2HA5A 3RKSA 3OTQA 4ZRDA 1USWA 4QLOA 4QLAA 2D5LA 2XB6A 5JIBA 1AKNA 2QRUA 1W6RA 2VAVA 1H2YA 3D0KA 5CT5A 3W06A 4X91A 1R1DA 3A2NA 1VKHA 2XE4A 4UFNA 5ALVA 4N5IX 2DSNA 3WKCA 1N1MA 1ZD5A 1ACJA 5AICA 4B81A 4CG1A 4ETWA 3STUA 4H35A 1TCCA 1HKHA 2PSFA 4K2AA 4C87A 2WHRA 3PF9A 2V96A 4QE3A 4DNQA 3D2AA 2PX6A 2YASA 2H1IA 4B82A 2RHWA 3HSSA 1CUXA 4G8BA 4I4CA 2RI6A 3BL8A 4BZZA 4QDZA 4OU4A 4CFSA 1MTZA 4GXNA 2X8BA 5FUMA 5FPPA 3BJMA 5BWCA 3K2IA 3I1IA 4F0JA 2JEYA 4L0CA 4GDMA 2JIDA 1JFRA 4FNMA 5F4ZA 1AMNA 4QWMA 1EK2A 2QVBA 2JGKA 4E11A 1LGYA 3CN7A 1DWOA 2ZJ7A 3TGLA 2RGUA 4L3WA 2HU7A 3R40A 4DNPA 1GKKA 5EHXA 5EIAA 3FOBA 4Y2JA 1IZ8A 5JASA 1XFDA 4RPCA 1VA4A 1N5RA 4GW3A 2HA4A 2WQZA 2OGSA 4EBBA 1DT3A 2WIFA 2ZSIA 1YA4A 1EHYA 1MX9A 5AM2A 4FBMA 2PSEA 3L1JA 2O2GA 3CCCA 3ZI7A 3GFFA 1ZI9A 4W1PA 4A16A 1T2NA 2XMRA 1TRHA 4BZWA 1E8NA 4FWBA 5CH8A 3YASA 4GWLA 4UBOA 3V1KA 3CXUA 1CUAA 5I8PA 4NVRA 3WLAA 1AZWA 1P0QA 1TCAA 5K3EA 1QIJA 5AO9A 2C4HA 1ODSA 4FNGA 2EDCA 4EY6A 5K3DA 1WHTA 4NZZA 1MAHA 2WG2A 4E14A 3ZLVA 4YK7A 3D4LA 4IO0A 3H1AA 3RM3A 2DHCA 3JWEA 4UFOA 1W4LA 4OYLA 3U1TA 1XZCA 1C7JA 4C89A 3CCBA 1LZLA 4ZGBA 4W63A 4FKBA 2WUGA 1QLWA 3N0TA 1U2EA 4IHAA 3E0XA 1YA8A 1JMYA 2VJDA 1BCRA 1OCEA 3OPMA 2QOEA 5EIEA 5T4HA 4C4YA 4I3FA 1G5FA 3DKKA 3Q8WA 4Y2VA 4HXGA 3LIIA 2BGRA 4X6YA 3WJ2A 4PSUA 2FJPA 1UKAA 4LYEA 2QXTA 1CUVA 2QM0A 5HZGA 1KEZA 1QIGA 1MAAA 3FNBA 3OC0A 2VF2A 1XZGA 3TRDA 2HDWA 2AJBA 2OAEA 2GYVA 4AO7A 5HK9A 3EQ9A 3WKEA 1EK1A 4G8CA 1XZBA 5JZBA 4EA6A 3DNMA 1VE6A 4CIBA 2OQVA 2W22A 4HZGA 4WDRA 2PU5A 1ORWA 3DDUA 4QZVA 3D5EA 3GELA 3M82A 2G5TA 5AH0A 2FX5A 3WI7A 2YH2A 5ALDA 4PV7A 1G4HA 3FYUC 2OCGA 5AKXA 2B20A 1FFCA 2VQ6A 3G9TA 5ALEA 5JANA 1ZJ5A 1CUBA 3LS2A 2RONA 4Y2XA 4GECA 1J06A 1JT2A 5AI8A 5T4EA 1G66A 4B0OA 2WSLA 5HF5A 1CUFA 4MWTA 3PE6A 3ZV7A 3JYHA 5AI6A 1EI9A 3WWPA 3I2GA 3M81A 2VT7A 3QMMA 3G8YA 1UK6A 4WFIA 4KRXA 5JD5A 4BVKA 1CUEA 2WU4A 2OXEA 5AKGA 3AZQA 2DR0A 4DTCA 5ALUA 2HFJA 3G0DA 5FLKA 5A7FA 5ALQA 5LZ7A 3C8DA 1JI3A 2EEPA 4Y2SA 1A8QA 4G9EA 4X7BA 4ZREA 5AM3A 4KAAA 1HQDA 3W9UA 1EDDA 5EHNA 3G0IA 4AZ0A 4RGYA 1K8QA 5AOBA 4BB0A 4U2GA 1JJBA 2JGIA 4QDTA 4G4GA 1XRLA 2QXUA 1WM1A 3VKFA 2GYWA 3G9ZA 4MYDA 1E8MA 1ZJ4A 2QMQA 2JEZA 4U2CA 4XVCA 1UK7A 3GUUA 4TGLA 1GT6A 3WL7A 2WIJA 1XKTA 2I78A 4FLEA 5C8VA 2I3DA 1VZ2A 1LLFA 3IUJA 2HADA 5LZ5A 5ALYA 4K6GA 4G8DA 3SX4A 3N2ZB 3T4UA 2WIGA 3OM8A 4P92A 2CB9A 3BIWA 1EB8A 2CJPA 5D6OA 1MNQA 1CV2A 4X6UA 5DTIA 5D7BA 3EBLA 4BDTA 3VJMA 1CUZA 4KRYA 4P08A 1CUUA 1P0IA 5HKBA 3S8YA 3D3NA 4UHFA 4CIAA 3HXKA 2XT0A 2XUHA 1XRRA 2PPLA 1Q0ZA 3MUNA 4KAFA 2WUEA 3B5EA 3DQZA 4BC0A 3LCRA 3FVTA 5AKZA 3D2BA 1U65A 1LPSA 4MQMA 1QGED 3BIXA 3UMJA 2HA6A 4DLNA 5DYWA 1YASA 2ZSHA 1QTRA 4UBNA 4WY8A 3R3YA 1XROA 1AQLA 5EHZA 3STWA 3DCNA 2YYSA 5H3HA 1TAHA 2HL6A 1TIBA 3K6KA 2XMSA 2D0DA 2V97A 3VVMA 4E46A 1LBTA 1MNAA 1HBJA 4LIPD 2BCEA 1WB5A 1FFBA 1EINA 1DU4A 2HRQA 5DJ5A 2ACEA 2PKYX 2Y2VA 1PJAA 1ORVA 2Y6UA 1A8UA 2J4CA 1EXWA 5FKJA 1BEZA 4G1FA 3V1LA 5AKJA 3V1MA 1DX6A 2G5PA 5JALA 5ESRA 2CKMA 3IVMA 4BAUA 1UOOA 1XZJA 1ZGCA 2IITA 3BF8A 5D3KA 4J0DA 4PNZA 5ALWA 3WKDA 4U2FA 1Q0RA 4I19A 3ESDA 4Y2YA 1QFMA 3WKAA 3GZJA 3AFIA 3I6MA 5K3CA 2QT9A 3LIPA 2PL5A 4ZV9A 3QMWA 3VISA 3WK8A 4HRYA 2DCMA 3FSGD 2BUCA 5HFAA 3FLBA 1XRQA 4DSAA 2OQIA 1THGA 2QJWA 4KE6A 3FLEA 2CZQA 4N5HX 4WJLA 1C4XA 2DHDA 3O4GA 1LPPA 4G5XA 1QZ3A 3EQ8A 1QFSA 3WQHA 2XLCA 7YASA 5CXUA 2JGEA 5AM1A 3PUHA 4BBZA 4DM7A 2BJHA 1LNSA 2XUPA 1FFEA 3D7RA 3IUNA 3AIKA 4BATA 2PVSA 3QZUA 5JATA 5DNVA 1TCBA 5A6VA 4B9AA 4J0KA 1MO2A 4FTWA 3PFBA 1BS9A 3MUOA 1CQWA 1ACLA 1A88A 4V2IA 5ALSA 4BCCA 2GZRA 2C0QA 3O4HA 1HDEA 1Y37A 5AKYA 2XMQA 4BTVA 1XRMA 1QIIA 4HTAA 4EY7A 2WG1A 3QYJA 4X00A 2WU3A 4C01A 4KYVA 4YX9A 2XQFA 4YPVA 3WA7A 1ODTC 1ZIXA 5ALJA 5LKRA 2Z3ZA 1ODCA 3R3ZA 2QR5A 2Y2UA 3WK6A 3C5VA 3G7NA 4AQDA 4C6HA 1CUSA 2QUBA 5HQ3B 1O6FA 3G0BA 1X2EA 3WJ1A 1W52X 4MQLA 3IIIA 1AGYA 4B6GA 2X76A 3OG9A 4FLFA 2WIKA 4UHEA 3VDXA 5K3FA 4UHDA 3ICVA 1TKRA 4IH4A 1R9NA 2JGLA 1WHSA 4N8EA 5ALTA 2CBGA 3A2LA 1CUWA 1I6WA 4LXIA 1IUNA 4UUQA 4J0CA 3QM1A 4AMZA 5BWBA 1OILA 5E4YA 1UZAA 2K2QB 3GROA 2ZYSA 1QIKA 5DNUA 1T4MA 3G02A 1WB6A 5AI9A 4AN1A 4M0FA 3VJLA 3WZLA 4XWGA 3WK9A 1UXOA 4NMWA 1XZFA 3DJYA 4WCVA 2XMZA 4W1QA 5EGNA 2WM2A 3H19A 3AINA 5T4BA 3H2GA 5I9IA 2G63A 3H1BA 3WYDA 4ZXFA 5HK8A 3QITA 4Q05A 1XRNA 1FJ2A 3M83A 1QTIA 2VTVA 4NS4A 1BE0A 3PUIA 4ZV7A 5AM4A 4Q3KA 2QKYA 5CXXA 5C7YA 2VJAA 1YR2A 5AKKA 3R0VA 2WHPA 5C81A 2JF0A 3DKRA 4DMFA 1FFAA 4G4IA 1HLGA 1DTEA 1XZKA 1RYYA 3RLIA 1XLWA 1CQZA 2H7CA 2DHEA 4XJVA 3NUZA 2YXPX 2OCIA 3T52A 3TEJA 3H17A 2E3JA 3L1IA 1ZD2P 2XUAA 5A2GA 4QA9A 2C5FA 4HXEB 5IVKA 1BU8A 3I1YA 3M3DA 2WUDA 2BAGA 4KJXA 1YCDA 2IX9A 3FYTA 1L7AA 1U8EA 3KWFA 5LZ4A 5HF8A 4EUSA 3KWJA 4B9EA 2PUJA 5EHQA 3V9AA 1QJ4A 4J0JA 2XUDA 4QDUA 1SCKA 1CLEA 4BP9A 1MPXA 4BTLA 5ISMA 3FYUA 5AJHA 4LYDA 4WY5A 2OAGA 4X97A 5IH7A 2O2IA 3NOXA 5CH5A 1ZICA 4L72A 3H2IA 4UHBA 3SWWA 2HA2A 1K4YA 3C45A 1ISPA 4GI1A 5JAOA 3C6YA 3WL8A 3IB3A 5AK4A 2VSQA 1IZ7A 1B41A 4MYSA 4C4ZA 5JD4A 3C6ZA 1E5TA 3BE8A 5AHXA 2VA9A 4BAZA 5FXMA 1X2BA 4OB8A 1TQHA 2VT6A 4KAJA 3AILA 3DOHA 1F6WA 2WJ4A 4J0GA 3WWDA 2XMDA 3HRHA 3H0CA 4M0EA 2ACKA 3ZPXA 4BE9A 2V98A 3JW8A 1QIMA 4FBLA 4PSDA 2HA0A 4OU5A 1UOPA 5AKHA 4MXDA 4EZIA 4RNCA 1J1IA 4BVJA 4IH1A 3IUMA 4CCWA 4HS9A 1UFOA 1E3QA 3SC2A 4Z49A 1R3DA 2XDWA 2WTMA 3ESAA 3STVA 2OGTA 1UK9A 2Z8ZA 4X95A 2HM7A 4E15A 5A71A 2HRRA 4Y2UA 4EY4A 3ZLUA 1SCIA 1XLVA 3QMVA 4HRXA 5ALIA 2XUFA 1XRPA 4WFJA 1AC5A 4U2EA 2PSDA 3A70A 2WILA 3LP5A 4UFPA 4Y7DA 4Y2PA 1AURA 4QWWA 5ALZA 4K5QA 2ECFA 1A7UA 2JGJA 3CN9A 5AI4A 1XZEA 1XZAA 3F98A 3STXA 2BUAA 4FLMA 1BRTA 5CT6A 2Y6VA 4Q82A 1MT3A 3UUEA 3WK5A 2XMBA 4BP8A 4M0MA 2XUIA 3O9MA 3DYVA 3HEAA 2O7RA 3DEAA 4X3CA 1YS2X 3QVMA 1GXSA 4WDQA 1HL7A 3H04A 5EI5A 3DL4A 5AIBA 1THTA 2J3DA 4UBKA 5AK6A 2ZJFA 5JAUA 4OYYA 1JJIA 4WFKA 2XLBA 1GKLA 1K6EA 1PFQA 1R4ZA 1H23A 1QIFA 4N8SA 3FCYA 4YASA 3IA2A 3KDAA 5K5EA 2C58A 4UPDA 1F0PA 3H18A 3WWOA 2PM8A 4FOLA 3W2TA 5LZ2A 1CUDA 3I2JA 3BDIA 2G4LA 4L9AA 5JAHA 3DD5A 3ANTA 4DMHA 4CCYA 1VLQA 1SCQA 1VXOA 3HJUA 3AUKA 2GYUA 2EDAA 3NWOA 1ZI8A 1CUHA 1GPNA 4W1SA 5DNWA 3LLCA 3AJAA 4BRSA 5EIHA 3D2CA 1WPXA 1DQZA 4P93A 3F97A 5AKIA 5ALOA 1BN7A 5J3JA 4H77A 4XX1A 3C5WP 2XQGA 2GBGA 4X85A 2VJBA 4BCBA 3TJMA 5DLPA 1W1IA 5JARA 3H2HA 2WFMA 4G9GA 3ICWA 3C43A 5FOQA 1F8UA 5CBKA 1QO7A 3DLTA 4B84A 4OUKX 3R3VA 4EHBA 3EQ7A 4LHEA 3BF7A 2ES4A 4Y9SA 2B61A 2HU8A 5BV7A 4KE7A 2ZYRA 3RK4A 4MEAA 2BKLA 4IH9A 2IIVA 4DNOA 1ETHA 3DOIA 2AXEA 1H2XA 1WCYA 2QZPA 2XQJA 4O08A 2WLSA 1NX9A 3HABA 4HXFB 3FAKA 2BUBA 2HA3A 4C88A 2OPHA 1Q83A 3IBTA 2PSHA 3VJKA 3IUQA 5DWDA 4MEBA 2H7XA 4CG2A 3C70A 1LBSA 2P8SA 3WA6A 1EX9A 4LXHA 2WG0A 3IDAA 5I7UA 1KU0A 6YASA 1S8OA 2VEOA 3QPAA 4PF1A 3ZLTA 2WTNA 3W05A 4FDMA 2H9YA 3VVLA 4X92A 2QJRA 4H7EA 2QTBA 1ZIYA 1QONA 1CFJA 3AZPA 4F5ZA 5AOAA 5CT9A 3HI4A 2C0PA 4FFVA 1QIEA 1BROA 1UWCA 1CUJA 1EDEA 3QBJA 1XQYA 3WWCA 4AMYA 4BRZA 4XIIA 5K3BA 4B83A 1UKCA 1YB6A 4Y2RA 5A62A 4UBMA 3RARA 4GLBA 4J0IA 5E2IA 5ALGA 5CW2A 4BE4A 4FMPA 4UHCA 5T4FA 1EVQA 1GQSA 4X94A 4UHHA 2PBLA 1H2ZA 3FCXA 4J0HA 5FDFA 3WK7A 4U2BA 3KD2A 3F8SA 1CUYA 2BFNA 1JKMA 2OLEA 1H2WA 1LPBB 4AO8A 3DS8A 5CT4A 4PW0A 2DFPA 1W75A 3WWEA 5CRIA 2VAXA 4J03A 2H7YA 1DX4A 4B7ZA 2QUAA 4X93A 4AB1A 4CG3A 3G9UA 4X6XA 1EH5A 4QDXA 1P0PA 5C8XA 2LIPA 3ANSA 5IVDA 2I3ZA 5AM0A 4GEGA 5JD6A 5LLSA 5CH3A 4F60A 2XUOA 2OCKA 1R50A 3I2FA 5ALMA 2FJ0A 4GHWA 3X3HA 1IUPA 2ZYIA 5KREA 4H7JA 1J2EA 2Z8XA 4ROTA 2HU5A 2AJCA 4IQ4A 1Z68A 2XUKA 3EIOA 2PUHA 1UT6A 1TK3A 2WJ3A 3ESBA 1BCSA 4A5SA 1VZ3A 2ORYA 2O7VA 1VXRA 5AK5A 1CEXA 5CTAA 5E4TA 5ALPA 1DT5A 2HA7A 4LKOA 3ZWQA 4DNFA 3B12A 3AIOA 1QIDA 1IUOA 3IULA 1YSCA 3V1NA 1RWQA 3PDCA 1R88A 3P2MA 1LPOA 1QOZA 4DMKA 1GGVA 4ARAA 3VXKA 3C6BA 1C7IA 4OCZA 1QO9A 2WHQA 4J3JA 2JGFA 1LPMA 3IURA 1LPNA 2XMCA 3O9VA 2QS9A 4FHZA 1JMKC 3I28A 3HZOA 1K5PA 5AK3A 3WIBA 4HVTA 4KR0A 2OGZA 3HC7A 4DMCA 5CT8A 2RAUA 1F0NA 4Y2TA 3WKBA 4H18A
chains in the Genus database with same CATH superfamily
1XOIA 4BLTA 2PKQO 5E3JA 3PGLA 4KACA 1AN0A 4INPA 1Y6FA 3JSXA 5CMLA 1HPLA 1WDKA 1V16B 3QLUA 4I81A 2R7KA 4DSUA 3RVRA 3OC6A 5AW6A 5HSGA 4WRRA 4P4UA 3BB4A 3QUQA 2X1MA 1JJAA 2VQFB 4GSKA 3EDOA 1AMUA 2YJ5A 4NECA 2WWHA 1BW9A 4YEDA 1ZOSA 2CVZA 2JI4A 3GA7A 4XGKA 3AEQB 5K4GA 4AXBA 1U4NA 2OOSA 4NE9A 3HO6A 1XWFA 2ICAA 3AVOA 4OB7A 2NUPA 2GBPA 3FCOA 2J7PA 2ZEJA 3E35A 5CURA 5AOCA 1TAGA 1HQKA 3SK0A 1PV4A 2L0XA 1U9CA 2OZKA 3TMKA 6CHYA 1RXUA 1SEVA 2CK3A 3X44A 4US2R 3G2MA 1FXUA 3B85A 1RQXA 2W2KA 3FKQA 4NEGA 5JCPA 2NTYC 4PFJA 4PRLA 1OJ7A 5KWIA 3RTCA 5L7TA 4S1OA 1HF3A 5A3RA 2I2CA 1B8UA 2LWIA 3OX2A 2E85A 4ZD6A 2QUKA 1DXOA 4FZ3A 3B1VA 4JBIA 1MJFA 4MIKA 4FXOA 4UNRA 2ZWOA 2ODQA 3FI9A 3C24A 2RGNC 1XQXA 2R3SA 2IIBA 4ND2A 1PVDA 4L4YA 1GNLA 5KSZA 1CIJA 2VP6A 2X7XA 1L7NA 1HZJA 1N3YA 2BGNA 3E81A 4IGFA 1LBIA 4MV6A 1LDYA 1GPH1 4OD0A 5KSPA 3FOWA 3MTEA 5MGBA 1T5DX 2V9ZA 2WJ6A 1W5AA 4WNAA 4ZQIA 1Y33E 1TYEB 4CFYA 3ZN2A 3ASVA 5B7NA 3IAEA 2R7LA 3UJ6A 1CTQA 3TNLA 1LPAB 4MUEA 1QRDA 4EKNB 3KOYA 3QJGA 5C4IA 4X61A 3GLKA 3HBAA 2BFMA 1HI9A 1PZFA 4BP1A 1C0KA 5DOVA 3FGNA 4X84A 3NALA 4I0WB 3CUWA 1IVSA 1Q0UA 4O4LA 2PUVA 2ONYA 4HLDA 1G19A 3QSYA 1IG3A 3PEEA 2D3WA 1VSQA 1K3TA 5KX5A 1H8HD 1P1JA 1SK9A 1FYXA 4WZBE 1HTWA 1R37A 1HM5A 3FPKA 3BDVA 1N2CA 3NP9A 4ZVVA 2GPSA 3C2QA 1GCOA 3ORHA 4K9LA 4R84A 4G1MB 5DGTA 3HCDA 4FFWA 4C2BA 3GMIA 5HUHA 2PEYA 4A0QA 1WHSB 4D42A 5BQXA 4Z4FA 1HDOA 4A8TA 2IXGA 2BISA 4CODB 1CUCA 1JLRA 2V5UA 4OQ4A 5DYGA 5K8IA 3GGPA 2CGEA 2H18A 3GGDA 4B17A 3ZJUA 1Z2CA 2NNLD 3PEVA 2H8KA 4G5FA 1ICIA 4CQJA 2G83A 2Z3WA 1AM4D 3KUCA 3OZ7A 3IQWA 3PPYA 7REQA 2Q62A 1S1CA 4QDOA 4EHLA 3LQ2A 4MVJM 3L1HA 4A1FA 4CUJA 2FPPB 5ADVA 1IEXA 3OPXA 3OLXA 3TQFA 5ARDA 4EATA 1RLTA 1Z4OA 1GNSA 3CRW1 3FWHA 2YIMA 3FFXA 4L0DA 1C7FA 1KBOA 1NU8A 5DDIP 5JI3E 2KE5A 3PICA 1PHPA 4HEA1 5AXCA 4LF6B 2YBDA 5J4LA 3ITDA 1D03A 3UBMA 1XZHA 4YA6A 5ICCA 1NW5A 2O2HA 4MYRA 5EHGA 1FRVA 3NP7A 4LVNA 5IU6A 3MCAA 2AG6A 2I4TA 4NF2A 1H3EA 5FYQA 1ZN9A 5IULC 2JHPA 5JADA 1ADYA 1R0RE 2ZR8A 3BWBA 3U7EB 3RT9A 3LZCA 3ZCQA 2Y71A 5AW7A 2M6RA 5HRAA 2R8YA 1MKYA 3E48A 3P5SA 3TVYA 3WIOA 2CMFA 2H9AA 2GARA 3CLSC 3WIDA 2YV2A 4D82A 5SYNA 3TXAA 3EW7A 4PTYA 2FUCA 3K8YA 2ZJZA 2OBYA 3W78A 3VOAA 1HT1E 3RUAA 1SUSA 4FJ1A 5TV2A 2CMKA 3UA4A 3AX6A 4AO6A 3QBVA 3K1AA 1QRUA 3A3YA 3VMFA 6REQA 4G2NA 3HG7A 1MAVA 3LT2A 1YL6A 2G4CA 2UZ0A 2WD9A 3H2KA 4RBNA 1FYVA 4UUBA 4YP6A 3TL2A 4ALNA 4EO9A 2PU7A 1WZEA 5HX7A 2C2YA 5B2FA 5GWXA 4F96A 4U7PB 4PQGA 2B4KA 2W43A 1UJ6A 2B8WA 3K2QA 2HC9A 3DTNA 3Q2KA 2X6QA 1DKOA 4LVCA 4OAQA 3B1YA 4GE3A 4HJXA 3A8TA 1L7DA 1EBBA 4YACA 3GVXA 4C0HA 1SG9A 4UCWA 1H4SA 2X58A 1J8MF 5FWAA 3PFCA 1ANKA 4C6RA 4D1YA 1AKYA 1GP2A 2A2ZA 1AN9A 1OU4A 4ENTA 1P4RA 4C7OB 1DC3A 1X70A 2JBWA 5A7GA 4IMIB 4GM1A 1VC2A 1EVIA 1VBNA 2YZGA 3FBWA 3TGWA 4PYNA 4S0XA 2GZDA 4BGVA 3WFIA 2P9TA 3OICA 3Q9NA 3MPOA 1GTRA 3A6LA 1UL1X 2OCBA 3RSHA 3MXOA 4DJJA 1RM5A 4FMDB 5PNTA 4W8GA 3CG4A 4G2TA 4JCCA 4K9OA 4QC2A 4QJ5A 3N7UA 1IONA 2EX4A 1IL0A 1XZDA 4F93B 4QOHA 1M73E 2C83A 5TJ9A 4E32A 3NVKI 1ORTA 5FA5A 4E30A 5KOIA 1EU1A 2VHEA 1OZGA 3DCYA 1XJ0A 2NW6A 2B83A 5JYDA 2ZBGA 1LV8A 3LC7O 4JEHA 2AX4A 4Q3LA 3LBYA 3SM9A 4M55A 3DUFA 1WR8A 4IM7A 1T3GA 1CW2B 1G0NA 1S89A 1IBRA 1OBVA 2PUDA 1I3MA 2AKAB 3OZEA 2YYYA 4EW6A 1SZDA 3FGOA 1M2OA 4MVJP 2HUNA 1ZHHA 2JA2A 2XYRA 3OAAA 4ZZ0A 5JCOC 3H0KA 4NCBA 2BP7A 3E4DA 4LF7B 1N2OA 2IYWA 4IHQA 3ZE8A 1G7SA 1JDBB 1ZRNA 3N6RA 1RDFA 2PZMA 2VRWA 1Z25A 2HFKA 4CM5A 2HTFA 3BEOA 1M1YE 1WXIA 1XZIA 3QPDA 3VPCA 2I80A 2I71A 4ER0A 4EZBA 5HM6A 5KSYA 1U1IA 3AL0C 1M2KA 2PD6A 4IWNA 1GGKA 4LWPA 1JKXA 4CV0A 3A27A 4CXMA 1FFDA 2OGUA 3OOSA 2JIZA 1SGWA 3H1TA 4ZYVA 3WE7A 1B00A 5JXIA 1OHHA 2QLBA 2IU3A 3FYUB 5C1BA 3OEWA 2DPGA 4KO8A 3FFBA 3VO2A 4W9RA 3KVVA 1FMCA 1Q20A 2XF2A 3INRA 2WOOA 1NBHA 3B70A 2QSYA 3QU4A 2ONCA 3D8UA 5EZ5A 5LFAA 3U26A 1CF2O 2TMYA 2IYFA 3KAQA 1FQKA 1H4VB 3PWSA 4ZI5A 1NTOA 1Q21A 4OB6A 1DX9A 5BOVA 3UJ7A 4K6OA 3DW3X 4B80A 4RKFA 5LZ9A 5IKXA 1VYUA 3FMGA 1NMYA 3KOOA 3NI2A 2ATEA 2N1BA 2QZSA 2VVTA 2GAFA 4W5NA 3Q2OA 2QR3A 1YS1X 1YS4A 3W9BA 4EPXA 4P38A 3RPEA 1EHCA 2EYQA 3D81A 1T3ZA 2Y93A 5F7XA 1P1HA 2BI4A 3GR6A 1DAPA 4ABTA 1JLLA 4GMGA 3ER8A 1KO5A 4C7XA 1SHJA 2RHTA 1FSFA 2FXIA 1XLUA 3GJ7A 2FPMA 3A9RA 4Q7JB 5SY6A 4PR0A 1W6UA 3B7PA 3MQFA 4AP5A 3GFPA 2P9EA 2X8JA 3ROZA 4UULA 3NASA 4OQEA 1XL1A 2J9YB 4EQ6B 1N8SA 3KB6A 5DHPA 5EUMA 4OP1A 3F9CA 4TWAA 4ZQBA 1QGUA 1KEEA 1AT1A 1H9BA 2K7FA 1FMTA 5K3SA 4XB1A 4B43A 4JB8A 2B92A 4NTZA 4D02A 4PC6A 1CZLA 1OBHA 1QHIA 1IWBB 1R8QA 5BW5A 4YQFA 5HIKA 5D3ZA 1ZHFA 4HX9A 2YV1A 2NO5A 4RA9A 3OZIA 4BLQA 1OMOA 4BQQA 7MDHA 3EXAA 1V95A 5TR9A 4DIMA 4YCJA 1JR3A 4G5RA 5CVEA 4LPSA 1AKTA 1SBTA 1Y9EA 1A2OA 4QSHA 4KE8A 3AYXB 4EGQA 1B1CA 2PSJA 2X8WA 2GHQA 3FUWA 2ZUSA 2XNKA 2PPVA 2J4DA 1QRAA 3MLBA 1LLCA 3EC1A 3M6LA 4RHTA 1E66A 1L6RA 1UBSB 4YAIA 3FR8A 5IXYA 1LJ8A 3B3GA 1KQ3A 2IY7A 3LW8A 3V34A 3B1WA 3SG0A 2CVOA 4ER3A 3T7TA 3G2QA 1N5DA 4CKCB 2OB2A 4URHA 1KSHA 4IS3A 3SNKA 1A9TA 1U8ZA 4JBGA 5JVDA 1ZNWA 1N9GB 13PKA 1FU4A 1VYVA 2QG4A 5KPDA 3JVIA 3V2HA 2DFVA 4CI9A 3RSGA 5CBPB 1N2BA 2XQKA 2ETVA 3DOEA 3NKFA 3Q5EA 1OGJA 2EZ9A 5IVIA 1DEAA 3BA1A 1SXJA 3BXGA 3IMEA 5LQSA 1RADA 5G0WA 3SIPA 2PBRA 1SOUA 1NBWB 4IMJB 1EA5A 4NHOA 2NU7A 4WCFB 4R98A 3ZR4B 4A9AA 3AF4A 3E61A 1RXCA 4DADA 4NH4A 4LDNA 1FBNA 2X3UA 1QDEA 1ZLYA 5EKXA 5TMBA 1IY9A 3ZV3A 5ALHA 3LXXA 1R6TA 5JO9A 3ES9A 3E9RA 3CEPB 3IR5A 5CM8B 3ROQA 3W04A 4A7PA 5JS8A 3E9ZA 3SGLA 1XD2A 5K6AA 5DX1A 3OIWA 5BVHB 2GHRA 4ZWNA 1CX9B 2HT6A 3AU8A 5H83A 1X7WA 2JATA 1CJCA 1GL6A 2PX4A 1CRLA 2HAEA 4PX3A 5LZ8A 3RFUA 4DIUA 4K6HA 3QEBZ 4Q21A 2AFIA 3AL3A 4EABA 5C7LO 1FDIA 3IJRA 2QW8A 4YJFA 3OLWA 3HYSA 4E5KA 2NMVA 1DRJA 1CDZA 1P39A 2R66A 3H13A 4JQYA 3GJ8A 4EFKA 3JQ9C 2GAJA 5AP9A 2FZ4A 2I6TA 4CKBA 4MS4B 3FRIA 1JZQA 3A6ZA 5BMVA 1RLOA 2PL9A 4I55A 3SY8A 3W1EA 4ZMSA 1NV8A 2I6GA 4IJWA 3H3XA 1R00A 2V8OA 1Y80A 3LQRA 3RWMB 2HNKA 1SVIA 3HJAA 4DCVA 2ESRA 2VPTA 3KJGA 2NUTA 4MGEA 4TX1A 2E82A 2YZ7A 4KUHA 1BQEA 1YS9A 4IUCS 2RK3A 2RE8A 5BSVA 1OAAA 1D9ZA 2PRKA 3AZOA 2F9LA 3CXRA 3KZNA 3A04A 1EFPA 5IUKC 1TVKA 4OHPA 1N7JA 3KEQA 4INAA 1I33A 2IXAA 4FZRA 1SD1A 5EFOA 5IBQA 4F4UA 4UTNA 5BN5B 3TEFA 3EB9A 2XA2A 1YWGO 1P9RA 2DQYA 2WZQA 2GPAA 1XQVA 3AU9A 4OM7A 3SEFA 5CVTA 4O1MA 2FW9A 1ZIPA 2F43A 2X9NA 2YHIA 1F7UA 2Y0PA 4WOJA 3H2SA 1QFZA 3MWEB 4G0PA 4MARA 1KAMA 5ESDA 4AWAA 2B99A 3BXOA 5GVRA 1GPLA 2NXEA 1HXHA 3OE4A 3OLYA 2X4LA 3LBNA 1D1SA 1P2BA 4ETNA 2OM2A 2JLWA 2G1JA 3DAHA 4DC1A 4LYFA 5EUQB 1BHSA 4GFDA 4H17A 3UCEA 3STTA 1ZD4A 5AW5A 4ARVA 4JJFA 3EGDA 3MMSA 4Q39A 2BY4A 4YCMA 2WFZA 3I2HA 3VAAA 4HB4A 3I4LA 3OQ1A 4OKIA 5FUXA 3I05A 2GRAA 1S9HA 1YZHA 3HUUA 4XOUA 1SBIA 1CS0B 1SFRA 1TJNA 2G28A 2X6TA 3MRXA 3QA9A 3R3UA 2JNWA 2R86A 1OROA 3O2SB 2PSSA 4TUYF 3UUFA 4RZUA 3VGPA 1BNCA 4UM7A 1ZD3A 4PYQA 1NG1A 4F84A 3EIQA 3CRMA 2ZVDA 3U0VA 3L8FA 4GM0A 2BT4A 1C4KA 1B6GA 3W2GA 3HJGA 3PLNA 4MA5A 2IHNA 1A8SA 2RIPA 1UM8A 2WFLB 3K1TA 1Z06A 1A27A 3O95A 3F5MA 4UKDA 1S0UA 1BHJA 1ITZA 2FWPA 4I2NA 5FUYA 5EVCA 1IDN1 3CMCO 1ZM2A 4TVKA 3ZH9B 1U0SY 1W46A 2W2TA 1NKTA 1FNCA 2BTQA 5CNJA 3H2JA 4CMAA 4NCIA 1VA5A 3LF2A 5JQGA 3VPXA 4DR3B 2HIHA 1NN5A 4IP0A 2ZRMA 5EZYF 2PX8A 4QM6A 3H4TA 2C5GA 3DHNA 1ZI6A 1ZGJA 3EA0A 1ZJJA 1BYIA 1D8TA 3NVDA 2JLVA 5IC6A 3GJRA 3KQKA 1XDSA 3TAXA 3PLAE 2PT9A 3FPAA 5BUSA 2BZ1A 3DYBA 3ZBQA 1F3LA 4B75A 4AJIA 1RYBA 1QC5B 2NGRA 3KQTA 2PZKA 3LQ4A 4QLAA 1NF9A 4DCGA 4L4SA 5AD1A 3CR8A 1I7NA 1Q7TA 1URPA 3WBKA 1AKNA 3ZUGA 4Q16A 1U3DA 2FN3A 3JQ7B 4LJLA 2GEDA 5J4KA 2BBWA 1L3CA 4M60A 2WU8A 1H2YA 2EBFX 4I3GA 4NYIR 3R44A 2Q5HA 3D3JA 3Q6MA 4XSVA 2FSUA 4P98A 2VRBA 4RVNA 3W6OA 4EG7A 2ON6A 2Z1MA 2Y9MB 3OE1A 4B45A 2Y1EA 3L84A 5DISB 3PBKA 1FL9A 4IV5A 3RTAA 3KKZA 3W5AA 4UFNA 3E23A 3CGGA 2C9OA 1GJRA 1H66A 3C1OA 5HMLA 1G21B 1PL0A 2C7OA 5B4UA 1WVMA 2DSNA 3WKCA 3U6KA 4AJOA 1ACJA 3MTDA 2IP1A 3FHJA 1UP4A 4JBYA 2VDMB 1XMIA 3MWLA 3TB4A 5JNTA 2R6JA 3U4AA 5JZMA 2H0AA 3ZQ4A 3AHCA 4ETWA 3T61A 3GLHE 1A7KA 3IMCA 3MWDA 4NZOA 2PZEA 5IAKA 3STUA 4DLKA 2WQ7A 4MWOA 2H63A 2GAOA 1J8YF 3TPZA 4NJMA 3HB5X 4TKUA 4RESA 5FI5A 2QROA 3AG6A 3N87A 3TNDA 4BO7A 1O0SA 1YJCA 4R2HA 1Z0KA 1YR9A 2L18A 1E3WA 2MSEB 3ZTTA 3D2AA 3RHFA 4FMDF 3WRXC 4DNQA 3GAFA 5I4IA 5BWOA 3U7GA 1P3Y1 3U1VA 4TTSA 5EG5A 1SXHA 3E22B 5KWVA 2DBZA 3T95A 1U02A 5JYEA 2EJCA 3PDIB 5JJIA 1T2UA 2C3OA 2EZTA 3BREA 5JDIA 1CUXA 1OX4A 4Z7NB 1XALA 4DCPA 3WGGA 3BL8A 4BZZA 1RTKA 1TM7E 2QNIA 2YYAA 1YVPA 2ZIWB 2FH5B 2ZVJA 4IILA 5F12A 2CXOA 5TEWA 2VWQA 5E6RB 2W48A 4BN0A 4OHBA 1MTZA 1KE1A 4EWLA 2BJWA 3N0XA 1EGHA 2XR1A 3HU3A 2ZE6A 1U31A 3VQTA 4D4MA 4N1AA 5J59A 5FPPA 1DDIA 3HS3A 3K35A 4WK6A 3TQCA 2P75A 1M6EX 3CEJA 2CV1A 3DFMA 1EDOA 1XN4A 1ZUHA 2QU8A 4KRFA 1SVOA 4PCVA 5FNVA 3O93A 3GJ0A 3F6YA 2ZJ3A 5CCXA 1T4BA 1TM4E 3C3DA 3T1HB 4UQOA 4C0AC 1PDVA 3GFQA 4L0CA 4E5YA 1RZUA 1XMPA 3L4KA 1V41E 2AC7A 5F4ZA 2BH2A 4PPGA 2OXIA 3H9CA 4PX5A 2NZJA 4KDFA 4RXUA 2V7GA 4IJVA 2JGKA 3G9QA 2A9JA 3KB1A 4E11A 4ZHSA 1HT3A 4YMSA 1SB9A 2I6FA 3QU2A 4AAYA 4WHMA 2VNIA 4FGSA 2HU7A 4L3WA 4D57A 3FKSD 1GKKA 1MB0A 4I1SA 3JVUA 1T6BY 3M6AA 3PPVA 4TV9B 2IPLA 2QPAA 4LZPA 3R0ZA 5ERYA 3LLSA 4LX0A 4PQFA 3DEHA 4ZHQB 3ZBTA 1NYRA 1Z5VA 1IK6A 1EFVB 2HA4A 2ABWA 1XDWA 3HDVA 1U94A 2OGSA 2V9PA 4RX1A 1JNYA 5I8ZA 1ULSA 1NSTA 1OGIA 1I3CA 1VJ1A 3RUEA 1MX9A 1N7GA 5D51S 1KI6B 2CJWA 3D4NA 4DV2B 3F47A 3FSJX 4OAPA 2FG7C 4GSYA 3V8BA 2O2GA 4G24A 5HIIA 3ZI7A 3N8KA 5F1YA 5IJ0A 3E84A 4UHJA 2H2FA 2CF6A 1UC8A 1PTJC 1QPGA 4W1PA 4A16A 4DBLE 3OIVA 4RVFA 4G85A 1T2NA 4BZWA 1X7XB 1N1EA 5IC4A 1AKQA 1IHOA 3ENKA 3L7AA 4IIBA 4QBTA 5BUQA 4V0RA 1E2MA 4PZPA 1Y0BA 2PZJA 4AZ3B 2DETA 2RAPA 1FJXA 4FDLA 2YHUA 5JZVA 3MJVA 3DEFA 5CCEA 3CXUA 1E59A 2V03A 2JVKA 3B2QA 5AJWA 2ZPAA 3ZWOA 1DIHA 2OZLA 4KNWA 3RROA 1JYSA 4MGHA 5KKAA 3VYWA 1RJ9A 2VPQA 1LJUA 5B55A 4YFVA 1T3LA 3EXHA 3VTAA 2P1RA 3CB2A 3RS3A 4CN9A 4HWKA 1TCAA 3BQ9A 1QIJA 1PWEA 4WQMA 4Y2HA 3WGMA 2PZBA 2PUGA 1LI5A 2EDCA 3A4TA 4MGZR 3SS7X 4EJ0A 1E6EA 2YWFA 3PD7A 1RAFA 3AY6A 3LK6A 2UUCB 1DNPA 4F3TA 1MAHA 2CZCA 2BEKA 2TSYB 4RAOA 2EVWX 3VDNB 3ZGXA 4H1UA 2PJDA 5IDVA 4IO0A 3RQSA 3V2IA 3FF1A 4C4TA 4Q6BA 3KQNA 4MQBA 3S2IA 1M72A 2YUIA 2QN8A 3NCHA 1AU9A 2NTVA 3P19A 3LGSA 2X42A 3MINA 4G5SA 2YZNA 3EUEA 3DFUA 3F4KA 4OHKA 1QM5A 3BDAA 3FKJA 2OBFA 3B9PA 5KYWB 4ZGBA 4W63A 3WB0A 4UM8B 3LRPA 4GBED 3D7MA 3IHWA 4Q4JA 5FYDA 3NHSA 1BHO1 3RRJA 4BWFB 3H5IA 1NN1A 2HREA 2WUGA 1H8EA 3O84A 3AB8A 2J6CA 1U2EA 4P3OA 5AVKA 3JYOA 3Q8KA 3K31A 2XXJA 2YC2C 3LZDA 1DMRA 3E0XA 3I5UA 2I67A 4LOIA 1OXXK 3OQMA 1C1DA 1X77A 3KJQA 4OH1A 3VTZA 1T0JB 2HV8A 2IYPA 5EIEA 3ADKA 3JZDA 3B3JA 1TAQA 1X7ZB 2BOVA 3IL2A 2HZBA 1AKWA 4F9GA 2XYQA 3BWDD 1XZNA 1G5FA 1L8OA 1PYOA 2PR2A 3U5ZB 2R8OA 2AOVA 5CXSA 2GZ1A 2JFHA 4XE5A 4M99A 4G26A 2HPHA 3AGPA 4Z1OA 1U9ZA 2FETA 2Z2ZA 1YTLA 3R5TA 1MX3A 4JI1B 3V6MA 4HXGA 3LIIA 3RRZA 3NUGA 2H29A 3VNQA 4Z53A 3RV3A 1G5QA 4W5WA 4X6YA 4X20B 3LP8A 2DR2A 4MI9A 5EYPB 1N9KA 3KPUA 2B3DA 3MAAC 3D8BA 4PGAA 3HKBB 3M2PA 3K4HA 5FV7A 5J58A 4CPDA 3BSYA 4R2LA 4XUEA 3RVJA 1EBFA 3PQDA 2OK8A 4LYEA 1CUVA 2QNRA 3AF1A 3QLUC 4AC9A 2BDUA 3IQFA 3MMZA 4IHJA 2BSQA 1G9XA 1KEZA 1SUFA 1QIGA 2QE7A 4K3UA 1DBPA 3WNVA 1UPUA 4E2WA 1MAAA 3FNBA 1G20B 3VI3B 1M0EA 3TRDA 3CHYA 3TZHA 2HDWA 4EITA 1E2UA 2QDXA 1ZVJA 2E9SA 2AJBA 2OAEA 2FPKA 1RKUA 1T9ZA 2QLLA 4MGKR 4YT8A 3MJSA 1PZNA 2IHKA 3DSRA 3KHUA 4BVGA 2XEDA 2OUIA 3CFYA 3UF0A 5FJJA 1T5IA 1U3VA 2XRFA 3PC7A 2PGAA 2JGRA 3NS7A 2QN1A 4G67A 2GDJA 4U8GA 4HFMA 2PMEA 3DNMA 1FP4A 4OFXA 1YZNA 3EFEA 1SNYA 3IRVA 1JFFB 2QTWB 3A7EA 1KP9A 1X15A 3II6X 3MFQA 4QPNA 1ODIA 2OD2A 3KB2A 3PDHA 1E63A 1SCAA 2W22A 5BVGA 1IZ0A 3A6GA 1XJQA 5B6JA 1ORWA 1V8PA 2Q99A 2XNCA 3SR3A 1QG0A 3WGZA 2QSZA 3GELA 4QZVA 5EJ8A 3M82A 2DAPA 4FT4A 1E92A 2VJQA 1POWA 1WD7A 3CVYA 1VLHA 2GPBA 5F51A 2QQ0A 3P9RA 4PV7A 5T6MA 1ZGGA 4E3ZA 2GRUA 3G9TA 1HO3A 4BEWA 1UP7A 4RQTA 1RE0A 3D31A 3F1LA 2DEUA 4I50F 1MJHA 4N54A 4RZQA 3TNYA 4Y2XA 3KJFA 4GECA 2IIPA 4LF4B 2R87A 4CF4A 2GGSA 1JT2A 3O1HB 1SHLA 2F1OA 5JBQA 4NYMQ 2J46A 3OP4A 1VB5A 1WXGA 2G1UA 4B0OA 5BWMA 2ATXA 2WSLA 3ESZA 3NBAA 3Q72A 5JXHA 2AXNA 3AWIA 1AQNA 2MHCA 3EVEA 1T3TA 1NM5A 1O95D 4HOYA 4DA6A 3F6SA 3M9WA 3PE6A 4E3WA 3ZV7A 2VK1A 2II6A 1ISFA 3JYHA 4L08A 2FKAA 3W8DA 4KODA 4F1KA 1C0PA 1EUDA 1PT6A 3OIFA 3PQ7A 3OQ6A 4JENA 4PZLA 5AXDA 3T0GA 1X86B 1LVUA 1VGVA 1H2RS 2P79A 5LP6F 3LLUA 4UMVA 3NH6A 4PAGA 3GEHA 1VPVA 1ZSVA 3C74A 3RV4A 3CNLA 4KRXA 4YPFA 2I3GA 4GZMA 3AONB 3VPFA 3M1YA 2B94A 4RZIA 3GXOA 3O73A 5JD5A 1Y1KE 5BSKA 2ZE7A 3SE0A 5AKGA 5JCJD 1N78A 3EJWA 3AZQA 1T0HB 2WFAA 4ZKEA 4US1R 1RT9A 4HMOA 5E9AA 3EWIA 3HA2A 3C6QA 2R7AA 4GMXA 5LDHA 3C8ZA 3TSOA 1V35A 2BI8A 2PEZA 3IP5A 1TK9A 5FLKA 3R7FA 1Y7LA 1NWCA 2FRVA 2LDXA 3H9GA 5TPWB 4B2PA 5JJKA 5A7FA 5JJCA 1WHTB 4F5WA 5LZ7A 1TJ3A 1YUNA 1JI3A 4KLRA 1NFRA 1W4AA 2AB0A 4QYTA 1U0JA 4B4DA 2RJ3A 4BGEA 1Z17A 2O7QA 4RK4A 3ZZ0A 5IYZA 5K0SA 3SVTA 2Z04A 1A8QA 5EJ2A 5CDUA 1M7HA 2P65A 3T5TA 3GJZA 1R0SA 1DL5A 2M6SA 4ZREA 1LA2A 2ZYAA 3G6WA 1T8PA 3KIPA 4NZMA 5CJ2A 1ZS9A 3B1XA 1GYPA 1SRRA 3LOPA 3HMKA 4CTMA 3VU8A 2WT9A 4R8LA 4MRRA 3PNYA 4YAEA 5AOBA 2H92A 3PHGA 4F91B 1B23P 1N3BA 3UEOA 1USUA 1RIFA 1SCJA 1XNJA 3FZNA 3BGIA 1OASA 1RBZA 2QXUA 4JVMA 3AW9A 3C14C 3VKFA 2GYWA 4WA8A 3PJRA 4JR0A 4BLOA 1KI9A 2P2SA 3ADPA 5CK5A 1HURA 3ZVNA 3IR7A 4N39A 3LDAA 2QMQA 3B6IA 1X42A 3R5KA 3QTTA 2JEZA 1PJCA 2X0NA 1AE1A 1NI4B 2RHCA 5A0FA 2GJAA 5K3OA 1IM5A 5CUQA 2I2XB 1IH8A 4KK3A 3RAJA 4WY2A 5EQJB 4B35A 4TYWA 4KHZA 4XDYA 3OT1A 3P4YA 3BB3A 1IC6A 1NMQA 2WE8A 1Y8QA 2X9GA 4RJ2A 4YJ3A 1N9ZA 2JAOA 1VKNA 3A1EA 3DDWA 3KQQA 3WWYA 4YY3B 4KC0A 4IX1A 4RV9A 4TMYA 3TR0A 2ZI3A 4AROA 1D4ZA 1Q5PA 2OORA 3KJZA 4TTPA 4J0EA 5TQVA 4GPZA 3NBYC 4N9WA 4L3VA 5FLEX 2E37A 1QTQA 1YQWA 3NOOA 4BNNA 5D5HA 2W70A 5FX2A 5C8VA 4HGRA 3ZUPA 1LLFA 5KCZA 1PX0A 2RKOA 5ESWA 1RMQA 1I4TD 1WDWB 3VZBA 4BS9A 3DBHA 5AVXA 4CMKA 3ECAA 1W9HA 4K6GA 2ZRFA 3JD3A 2V4MA 3DQPA 3I9LA 4G8DA 4IJKA 1V39A 4V02A 5C2JB 1H05A 4NFHA 2QRVB 3D5TA 1Y98A 1UODA 4CEIA 1QSGA 1B43A 3H3JA 4Q3DA 3IEXA 2FOXA 3T7IA 16PKA 2ZKIA 3E15A 3AR5A 4HDNA 4QPPA 5L9AA 1QQAA 1NVTA 2XPCA 3KYCB 2G8NA 1UMBB 3U2QA 2XVMA 1P61B 5FPTA 5TS2A 3KUXA 5D6OA 2W2VA 4OL9A 4UQLA 2BKVA 1XTUA 2OO3A 2V9CA 3BXFA 1CKEA 2IELA 5JI2E 5KU7A 4X6UA 3EBLA 3JPWA 1RXIA 4ENWA 1NBOA 2YNMC 4KRYA 3TXYA 1YBHA 3HCCA 3PENA 3COZA 1P0IA 2NU9A 4EW1A 2DYKA 2FWMX 5KNDA 5TS3A 1RHMA 1ZP6A 5EWMA 3U16A 2HTEA 1XMOB 4YP0A 3BRSA 1K7EB 1Y9AA 1NSYA 5HJEA 2OTCA 3S8YA 1ZCJA 2RCNA 4MOWA 1UDAA 5B1HA 4S04A 3GCGA 1MDBA 3UMRA 2IYYA 1ZR4A 4HGOA 5IBRA 4Q24A 2C5AA 2XUHA 3AQ4A 1T5TA 3JQEA 3FKSA 4KTVE 2PPLA 4NMLA 3S29A 3MUNA 5EKSA 5LXTB 4F5DA 1R16A 2WUEA 2ZGVA 3TZCA 4C1BA 3DQZA 3NJRA 2C97A 1VHLA 1W35A 2AH5A 1NXQA 1TU0A 3LCRA 1PR2A 5AKZA 3EGOA 5EQTA 5G3ZA 5B58T 2O57A 4KXWA 4U5QA 2UYOA 1RBQA 2GM3A 5BW4A 4G4SP 4MQMA 4ZI3A 4KVZA 3BIXA 2HA6A 2ZW9A 4IIJF 3VR6H 2A8YA 1NG9A 3EC7A 1YASA 4CM9A 2ZSHA 4K05A 3A31A 2XWJI 4HPWA 3WYCA 1XROA 1YZFA 2O0HA 2Z0MA 4FHDA 4GSLA 3ROMA 1ZLXA 3STWA 3C4VA 3DGFC 5IK2D 3TZBA 4C2UA 3M89A 4AU1A 2FWAA 3BWVA 4J43A 1TAHA 5AVRA 5HOQA 1YS6A 1U5AA 2OZEA 3UOGA 2E21A 2GCNA 2PUWA 3K6KA 4CF5A 3CZRA 3DF7A 2XMSA 3AM5A 1MPTA 5JH7F 2N42A 5LMUB 1MRSA 2V7WA 3ZLBA 5JJ5A 1QHYA 3AUXA 1RKBA 2I2FA 4DHWA 1H0HA 1VB3A 3P1JA 1B6RA 1KRWA 2D0DA 3Q12A 4E46A 4P36A 5JJBA 4KBGA 3AEKB 1JQDA 1RJEA 1J20A 4A6XA 2BMDA 1AQUA 3SICE 1HBJA 1TO1E 3AUUA 5H82A 4DA0A 2BCEA 3PHHA 2HSEA 4I4TF 1FFBA 2I55A 3ZWPA 2H48A 4OH7A 4LSGA 1LI7A 1UWLA 2IEZA 3JVVA 4XH9B 2PKYX 3FD8A 3HXLA 2QUZA 3INTA 4HGZA 1JN0A 1EJ2A 1QU2A 1FMFA 4AICA 2R0QC 1HZZA 2G25A 5KTKA 1PG2A 1RMTA 2HHCA 3OM1A 2UYQA 3W6UA 4LZNA 1IB0A 3DDZX 1T1EA 4OY3A 5LYJA 2L2QA 2FW6A 4LDQA 5FOSA 3ZQKA 1HFJA 3DMTA 4J16C 4U5XA 2AWNA 1DBIA 5FIUA 4A82A 4QFBA 5JG7A 1U5BB 1P7WA 2G5PA 2UYGA 5DIZA 3CONA 3L05A 4GH5A 5ESRA 5F7ZA 3V8RA 4BAUA 1GQOA 4MVJD 1QLJA 4DW8A 4IIXA 4KGVA 4B74A 3SBOA 3WGIA 4KFUA 5KB3A 1IZYA 5DIFA 3VKUA 1DQRA 2FWNA 5I7AA 1DVRA 5BN4B 2DM6A 1IBMB 2DFTA 3ZHQA 3I8SA 2Y1WA 4CWAA 1F2VA 4MKRA 1IBSA 1KYVA 4R0VA 5D3KA 4EB6B 2IH2A 3RVSA 4QUDA 1PGJA 4HNAA 2AHOA 2UVPB 1Z08A 3PWZA 4M6WA 3H5VA 4AJNA 1K08A 1GUDA 2H1LA 4NZNA 4G65A 4HLQB 2FPUA 1HRKA 2JH8A 1E3EA 1Z0AA 2W6QA 3T3OA 4U2FA 1SU4A 1HDYA 1JLSA 1YQUA 1Q0RA 2JJ2D 2QTRA 2R1VA 4I19A 4KQEA 3ESDA 5KI6A 3X0DA 4CMBA 1U0RA 4Z51A 1WW8A 3ET4A 4G84A 3SQDA 3WKAA 2Z5FA 3GZJA 2CUZA 2XA1A 1TZ2A 4IR7A 1MABB 3I6MA 5K3CA 4BNIA 4UZFA 3FOAA 3P96A 4KMRA 4KL8S 2OCXA 5L3QA 5CB8A 3R9XA 3W0LB 3RE1A 1WEHA 3GUYA 1KMCA 3RRFA 3V80A 3VISA 3HB7A 4DLAA 3C7AA 4HRYA 2I8CA 2OO5A 3HZZA 4V39A 1JAIA 5KDLA 1BXZA 4NQRA 1MEOA 3CF6R 4JBHA 1Y4UA 4DSAA 1BD4A 2OQIA 4KE6A 2QZ9A 3FLEA 4N5HX 1SCUB 1PIWA 3FRJA 4W5HA 4B6OA 4WJLA 1XVTA 4JFRA 1C4XA 1OBFO 2DHDA 2RK6A 5K6AC 3ONNA 4G5XA 3QKUA 5A06A 3GLRA 4H1WA 1OAKA 1QFSA 3DBRA 3U3XA 1FTGA 3WQHA 4W5TA 3UY4A 4MQ5A 4PLPA 1IBLB 2NO7A 2MDTA 3EEFA 3RWBA 3VAZA 3M4XA 2OK7A 4HYTA 4DM7A 2BJHA 2RGCA 1DARA 1PFKA 3P5BA 2XUPA 4GOJA 1T1JA 5FFNA 3JD4A 2RH8A 4II2A 4OJMX 5HA5A 3T3NA 2JD1A 1I7DA 2Q7XA 3L0OA 1C7EA 3D7RA 5EE1A 4ZVNA 4REOA 4RTQA 4ISBA 2C82A 2OZPA 1Q2XA 3IUNA 4EUKA 3C3KA 3KEOA 4BATA 2O4UX 5BQOA 2NPFA 4EH1A 3ADDA 2AL7A 3IERA 3NRJA 2CVHA 2FR0A 2XD9A 4L16A 4P31A 1TCBA 3OQHA 5G2OA 5JATA 3ZVMA 1MUUA 1EE9A 2F7SA 5CX1A 4B9AA 4FIZA 1JDTA 1I6MA 4ZCLA 1MO2A 3GEDA 3E7FA 1QF7A 3R7WA 3VR6D 3WC4A 3LRTA 4BO5A 1IPHA 1JIQA 4DA9A 1T9BA 1BS9A 2ID9A 4TRRA 5F7JA 2VDKB 4RK0A 1USGA 4NKRA 4RFSB 1L5SA 1T9AA 4CUKA 5HM8A 1RYEA 1BWRA 3IMFA 1CQWA 1SN7A 4M1WA 4R2XA 5BQFA 1NGSA 3BICA 2CXUA 1DDGA 4RQBA 5ALSA 2P3QA 4JVSB 2RBKA 4BCCA 2GPNA 3OT4A 4MI3A 3H11A 4PN3A 3SJBA 1IJFA 2GZRA 2HXYA 3CNHA 1HDEA 3IXLA 3O4HA 5AKYA 5I7RA 1KZYC 3OMXA 3A58B 3G23A 2D5AA 4MPJA 5FR1A 4RQUA 4ZVUA 1RPAA 1SWVA 5AW0A 2PE5A 2WA1A 1P9NA 1HTBA 3DBIA 4U9HS 3CUEF 1A2KC 3ZU6A 4B7XA 2YZKA 3VFDA 2FZKA 3FCEA 4G0YA 2Y1DA 4P7BA 5M7EA 6NULA 3IS3A 1WKCA 3R4CA 5AVOA 4GKKB 2XQFA 6PFKA 5C8YB 3BE5A 2D62A 2J67A 1U4SA 3X1JA 4TSFA 4L5JA 2CN1A 1PEAA 3DV9A 2AS0A 2W0SA 3H8SA 3ILHA 2QPLA 1N3LA 4W99A 1ZIXA 4M7WA 3WA7A 1XPOA 3D3KA 3OLVA 5ALJA 4K6CA 3MUEA 1JWLA 1P7ZA 3A6JA 4FE7A 1QUFA 3BXEA 2Z3ZA 1LW6E 1RKXA 1JPVA 3MOSA 2VJYA 3GGGA 1SVMA 3B2NA 4LA4A 4ONEA 3WK6A 1Q7BA 2C3UA 5J1SB 2OHJA 2VJLA 3RS5A 2B1IA 5L4LA 2BHRA 2IGBA 1CUSA 3G5AA 2O54A 1O97C 2QUBA 4TMKA 4GMKA 5HQ3B 2I33A 2ZREA 1LSJA 1O6FA 1F3OA 3L4EA 1PI3A 2JZCA 3G8AA 4Z8YA 4YRJA 1WL8A 3D3WB 3BERA 1DWUA 4ZZIA 1UPFA 1W52X 4LYHA 4PAMA 3ELYA 4X1YB 4JR2A 3WJ1A 1GDTA 3DM9B 1J00A 4LXQA 2Q1WA 3PT5A 3VU1A 3WLJA 3SC6A 4MYHA 5CTJA 3WAKA 2HIAA 2CLIB 1G3MA 3OG9A 5LMCA 3DD1A 2CXSA 1F17A 3PNKA 1ZJYA 1I5RA 1CIPA 3MGCA 3MRTA 1M6YA 3AESB 1R4NB 1JG7A 1G6KA 3Q0EA 4FUQA 1A76A 4FYXA 3ICVA 4MP6A 1GA4A 3RYFA 1UKZA 4D9KA 5LDDC 2VYVD 1H5UA 2BEUB 4FFBA 1YJQA 2H11A 4KFSA 2PIDA 3F9IA 1EFRD 1ODJA 4IJQA 4YAWA 2VPPA 3IJPA 2WR8A 3QKSB 1V8DA 2CHFA 3K09A 4R51A 4XXHA 4Y6QA 1HDXA 3CRRA 3FWNA 3QU9A 4O8CA 3WFJA 2V3CC 3N6XA 4UAVA 3FFWA 4JX8A 1GY8A 4W8OA 4FXPA 1NUUA 1OX6A 3D3QA 5EERA 3VHRA 3VHXB 1CUWA 2JFFA 4FGZA 1E7RA 1QQTA 4I5DA 1I13A 4JLDA 2QL9A 4HYEA 3U80A 1WPQA 3ZNQA 2O14A 4LXIA 4A0HA 3C5EA 1QR2A 2WVJA 2YN0A 2W6PA 3KLBA 2WWGA 3L0CA 4LDAA 4UVGA 1FPMA 3TSAA 4DDMA 2CLEB 4YQEA 1IUNA 1MF7A 2G09A 2OAP1 2VDJA 3ORSA 3AIIA 1H93A 3NYRA 3HP4A 3QM1A 2HUPA 2FZLA 2O1XA 1TIPA 1N6OA 3K5WA 1PR0A 1YQQA 1X7HA 2F55A 3Q2IA 4NZ9A 1V26A 1M3SA 5TGDA 2POQX 4MR9B 2BFEA 2ENWA 4MRPA 2DT8A 1RQ2A 3K70C 3G2JA 2Q6VA 2BEVA 4Q03A 4KGXA 1JDVA 4Z54A 3G02A 4IOJA 5AI9A 4L1KA 2IYAA 3FPBA 4AWXA 5IPFA 4KSYA 4M0FA 3VJLA 2ZTMA 2FE4A 5DEOA 3FVQA 3GEIA 2YTZA 2ZSAA 4RD0A 3O8CA 3BBLA 4TS4A 1P2UA 2ZJ0A 4D41A 4AI6A 4NDNE 3GWZA 4F1JA 2XITA 1PU2A 2GI4A 3AB3A 1A3CA 3AINA 4IIGA 5EHIA 5T4BA 4BFTA 5A9SB 1JYFA 3PC2A 2G63A 1XIVA 3JARB 4GPBA 4RV5A 4DLPA 4RQAA 2XSZD 4ZOLB 3BMCA 1EUZA 5HK8A 1GFSA 3MJEA 2QMZA 3LQQA 3IOEA 3M83A 5KSOA 5GADl 5KNCD 4ZT4A 1QTIA 4X62B 1EIWA 4Z7JA 4NS4A 1QB8A 4RDHA 1BE0A 1OKKA 3ACCA 1JEQB 5DFAA 2HK7A 3TPCA 4JYAB 1DTWB 5LWQA 4CFZA 4OQLA 2RG7A 2F8TA 4XGQA 3GAMA 1WIWA 1J39A 2GM5A 2I7XA 4II3A 3LI2A 4NU8X 5HCNA 1G60A 4EJSB 2FQ1A 4HD8A 5C7YA 1YR2A 5KQLA 2ZJ1A 1GPYA 4F3RA 1TA0A 1YE3A 4C6TA 1COWA 1IATA 2R5WA 2GCGA 1TF5A 1AH2A 3N76A 3BWEA 2WHPA 2X8AA 4H6PA 3FOZA 2BFFB 4HQFA 4YJHB 2W6JD 4JLMA 5DLDA 1YI8A 2FVYA 3DKRA 3U62A 4A0GA 4ERXA 4QXRA 1KJWA 5F1KA 5HKKD 1U8TA 3Q7QA 3RUIA 3DO6A 3OZBA 1HLGA 2IXFA 4X5OA 4EGAA 3HXOA 4CHTA 1DTEA 2QTVB 2FFQA 3COVA 3P4XA 3ANLA 1RZVA 3ULKA 1G5RA 1GGHA 1N0IA 2YINC 3JQQA 5LXTF 5BYKA 1U6IA 4N49A 1NVBA 3WLHA 1XLWA 4WN3A 1YV9A 4NAVA 4O2AB 4P8RA 5MGNA 1JWBB 1Y3CE 4YALA 3D8NA 2Y27A 2DHEA 2ILVA 1U8XX 4FMBB 1BEUB 2YXPX 3T52A 2DXIA 4PAQA 1ZD2P 4B8WA 3P0IA 3AHJA 3EVFA 4BZPA 4OBWA 5E9QA 2C5FA 2OO7A 3J80A 3RAFC 1BXRA 2PO5A 4WADA 5EWJA 2ZT8A 3ADOA 2GILA 3TINA 1FUEA 3GRCA 3NHYA 3SOZA 1Q14A 4ZYXA 3I1YA 4EEZA 1T9DA 1OA0A 4ZVLA 3ZY2A 4E70A 2R1TB 4RGVA 2HCTA 4EHAA 3BJZA 2VTDA 3JQAB 2RFLA 4KJXA 1YCDA 4E5NA 4YT5A 1N5KA 1GDHA 2H5IA 2NTEA 3KRTA 2O0LA 4PLGA 4RHUA 3H3FA 4DEYA 1U8EA 521PA 4WKOA 1OTHA 4OI2A 3UFBA 1OC4A 1RRKA 1ZK1A 2E4UA 2XAUA 3BEDA 2JLRA 4KXFB 5FOXA 3LDGA 2YOFA 4YMWA 5EHQA 3TS1A 2CL5A 1QJ4A 2K87A 5LUAA 3E9NA 1EP3B 2Z1NA 3OOEA 2IHZA 3IMKA 4O59O 1UQRA 2VXCA 1IY8A 4QDUA 3R74A 2WJJA 1F6DA 2Y8EA 3DOFA 3GJXC 4JJGA 3F73A 1MPXA 2FW7A 4OQNA 3GVPA 4LCBA 4IV0A 4YRQA 1YJ5A 5U4QA 3NBQA 4L8VA 1I1NA 4U9IS 5EP4A 4QEZA 3RAGA 1CHDA 5HGXA 1X8KA 4P54A 3ZWYA 1T8UA 2QNBA 5BSGA 4NJEA 2IEDA 2O2IA 3PYMA 4X97A 4F86A 1Q0TA 4J1TC 4FYKA 3W1VA 4UJ3A 5KNLA 2R7MA 4OL0A 3H2IA 1K4YA 1L8QA 3C45A 4ANFA 1YGPA 3FLMA 3SZGA 4JFAA 4AZVA 4R9NA 3E05A 1PR3A 5AUQA 3GC6A 3UHPA 1YJAA 3LQYA 4A2CA 3WL8A 1F20A 1ORHA 5FTWA 2ACVA 5D87A 4YJGB 5LOVB 3WNQA 3DTYA 3L79A 3VC2A 5BNTA 2XVAA 2IWHA 5AK4A 4FCTA 4MVJA 3TD2A 2G6TA 2VSQA 1ORRA 3BMOA 3GRUA 3PU6A 3PUZA 4D99A 2WJHA 3LFHA 1G5TA 1Q1QA 1U04A 2R6CA 4JDUA 4BX0A 7AT1A 2C9CA 2XCUA 2ZJ8A 2BGLA 1G21E 3G2OA 3QI2A 4FR0A 4FYVA 4JLUA 2I5PO 1E5TA 2ZBDA 4C6SA 2JAUA 2VF7A 3U19A 5CAEA 3RF6A 1VG0B 4BAZA 1X2BA 1KVQA 2A59A 1CEQA 2JLBA 2CYBA 3C5CA 4U2KA 1V7CA 2VT6A 2FJUA 4DLLA 2ZXFA 3DOHA 3E7WA 3LV8A 1E9SA 4G0WA 2AUNA 2E2WA 1L1EA 5T6BA 3KVNA 5D01A 1TCVA 3EN0A 1I32A 3ISTA 2ZP1A 5BV2P 2KW5A 2WJ4A 2D0PB 2QPOA 3NONA 1LK7A 1FLDA 3NHZA 3GLHA 2O8DB 1BX3A 2VK8A 2R47A 1F48A 3CC8A 4ND7A 1J4AA 4R2IA 1FDTA 2ACKA 4BHTA 4BE9A 1HC7A 3JW8A 4NPAA 4FFNA 2XXAB 1R4MA 4M8IA 4BNDB 5E6UA 4BNZA 4CL3A 4RY0A 1J24A 2X9QA 4FBLA 4RF4A 1XHLA 1YF3A 4OQMA 4ND5A 1KO4A 2GKSA 2C2MA 3BD7A 2JBHA 4YBZA 5KMGA 4OU5A 4KO1S 4YUXA 2NPIA 2GR9A 4FYJA 4ZAYA 3RYTC 4Q4DA 1TVCA 3M5CA 4R1PA 1F2TA 3HDGA 3SKXA 3IE2A 3AEZA 4FPXA 5KTTA 5LIRA 3LHSA 4RNCA 4RTSA 3ZDDA 2G3YA 2WW8A 1LTHR 2H1FA 3IUMA 1YACA 2HD4A 2QTNA 4HS9A 1DJMA 4ZRMA 2H2IA 2QD2A 1WSAA 1BQ4A 1F1JA 1LSUA 2JAHA 3SC2A 3JATA 4Z49A 5BR7A 2J3JA 4RZ3A 4UEJA 1HUQA 5HKLA 1TKCA 2RKWA 4PGMA 4YYEA 5KNDH 3Q8MA 1DO8A 4DJAA 3JQAD 4PO1A 3I30X 1EZ1A 1AQIA 3ZJVA 2OGTA 1YK1A 4N76A 3ISVA 221PA 2A58A 3OECA 4LAFA 1NN3A 1XX6A 3PC6A 4RLFA 4F7DA 4MR7A 1HTTA 1I4WA 2Z8ZA 1KHHA 3ZKWB 1U0OC 4E6PA 4E15A 4QGBA 5A71A 4EY4A 1COZA 1I5OA 5HJ7A 1MZPA 3ZLUA 2BD0A 5TARA 3QMVA 3ZGVA 2JHFA 1JNXX 3QUCA 1XFAA 1II8B 1XRPA 4WFJA 1Z4LA 3RIYA 1V1MB 2O2CA 2YWBA 3N58A 4Z86A 2QQEA 1FX0A 5F52A 2PSDA 4OK6A 3RSCA 4XYLA 3LP5A 3RBXA 2JI9A 1THZA 1W0CA 1KY2A 2J9FA 4DPKA 4Y7DA 1NMEA 4AY6A 3OU7A 1AURA 5JO0A 2OWEA 2VHJA 4YJ2B 4JJ7A 4D4HA 4DYVA 4O4JB 1WSBA 3HDHA 3G5UA 4IMPA 2REBA 3SQMA 1XTSA 3S7TA 4B7AA 2XCRB 2XRYA 4DV7B 4DA7A 2W8BB 2YWDA 2XRMA 3OFKA 4UASA 2JGJA 2JJ1D 5AXAA 3ICOA 3TL6A 4D3SA 3MT8A 2HBRA 1P2FA 1VBKA 5KCMA 1KF0A 1ECJA 3SSMA 2EFCB 3F98A 2VDVE 1WP9A 2A57A 4QPCA 2BUAA 2VPZA 3HBLA 1R0ZA 2WKRA 3H1EA 3KNZA 4UOEA 1BRTA 4W7SA 3UFXB 4H6XA 2YHAA 4QPDA 4Q3AA 4A4DA 1NYQA 3TL3A 4KITB 3ZNOA 3UUEA 3WK5A 2XMBA 4G5YA 4TKVB 4L85A 4YRKA 1A04A 5K2MA 4AJ4A 1P7CA 3E3NA 4CTNA 1NM5C 4B3HA 2DQSA 3PR1A 1K6MA 3BYZA 3IV9A 2Q1TA 4G0XA 3ZJ5A 5B57C 3CCFA 4HDKB 3O9MA 2DY1A 2DP4E 3DYVA 5FQNA 2OR3A 1D0IA 1PSZA 1M2GA 1TOAA 1RI3A 3A6PC 2QN3A 1DAGA 3VR5A 4FKMA 3R8XA 2HF2A 2EKPA 3QIAA 1L5HA 1G7RA 2OBLA 3D3EA 3EE6A 4MV7A 1MTOA 1GZ3A 4OLJA 2PL1A 2W6OA 2XKBA 4R05A 2XTMA 1U2GC 3KZ1E 4MWZA 1I51A 3VU3A 2HWXA 2HRCA 3L4JA 2QBYB 5HE8A 3WP0A 5TNXA 3WLOA 3ZEIA 3V3TA 2B4QA 2L17A 2X19A 5JAUA 5EMLA 3K72B 1T0UA 2VBCA 5LWHA 1DKPA 4WVFA 1GCIA 1N2IA 4D9EA 5I4BA 4CVNA 3M4JA 4A2WA 2IH4A 2O8EB 2WF6A 2Q6IA 4ZVSA 1R4ZA 2L42A 3ZGLA 3RFFA 4DRZA 4N8SA 5FFFA 3PZRA 2NSLA 4YASA 3L9WA 3NRBA 2C59A 4YDQA 2A5LA 3HY6A 1RYZA 3MSCA 2H0QA 1E58A 1F0PA 2ASEA 2IZ6A 3H18A 4RANA 2CDNA 2GASA 2OHIA 4FOLA 4P4GA 3S8MA 2HB6A 2ISSD 4DMUB 4DA4A 3JVEA 5FWXB 3T3EA 4D8VA 1X7YB 4LGCA 1KDRA 4UVHA 2ZI4A 3R3SA 2W37A 1KGDA 1I3OA 1PLLA 1NVXQ 2OZVA 3U3JA 4F6RA 3QVJA 4L76A 4XW2A 4L9AA 3W7BA 3DD5A 1CQIB 3QXCA 3A9TA 3ONEA 3ECCA 1MCZA 2NU8B 4DMHA 4EA7A 1O8CA 1G3UA 3M1AA 5EJ6A 1LQTA 1QYIA 2MU1A 1SCQA 2M1ZA 1XEAA 3DWGA 1WPGA 1WOYA 1PSDA 3NTUA 3EBOA 2OCPA 2RIRA 3LY5A 4FR5A 2WNSA 3HJUA 4ZI7F 4MA4A 3FTFA 1SA0A 1PRYA 4NBRA 3W3AH 4DUGA 2DLNA 3QVSA 1DCTA 2GYUA 1H9CA 4R5HA 2FG5A 2Y1CA 2EDAA 4KUEA 1C2YA 1ESMA 1ZI8A 2JIBA 4OGKA 4D9GA 5DNWA 3LLCA 3U7JA 1UJBA 4B3BA 4JIMA 1LVGA 3LYHA 2VHQA 4PCUA 4B3XA 2DX7A 3QFFA 3GEMA 3UMFA 3Q5GA 5K09A 3CVXA 3OQPA 1T8TA 3DE3X 3HCBA 2W90A 5FCDA 2WRZA 1S2LA 4B3SB 1W4RA 2N3ZA 3BE4A 3NM6B 3DAYA 4L15A 4C14A 2ORVA 3V4LA 5ALOA 4I1RA 5DTQA 3U61B 1J0BA 2JCYA 1MEJA 3U17A 1G20E 4BQSA 2Y0EA 4LQCA 1JG1A 2A1UA 2C0CA 2GBGA 2W83A 3HGTA 4FCWA 2VK4A 2VJBA 3GUVA 1ZUIA 2LP4Y 4L8FA 4MKIA 3ENQA 4FFDA 5DLPA 4A8JB 4CM1A 1XNRB 4FE3A 3A1DA 3KKPA 2WFMA 2D5BA 3CPHA 3HR8A 3R5SA 3OQJA 3C43A 4I1PA 1L4MA 1X80A 4UU8A 4DMGA 2O8FA 1PVVA 2ZRQA 5B58C 4NCKA 3KSAC 3E9MA 5CBKA 4AS3A 3TVDA 3BFPA 2HHLA 3NVAA 4B84A 4TSRA 3W3ZB 4MROA 3T0IA 5F9MA 3P9XA 3EQ7A 2JFUA 3TO5A 1W88A 2JKVA 2QB5A 3GB9A 4JP2A 3W7AA 1T8RA 1VHTA 1VJCA 1VCOA 2PKEA 3IYLW 3DOCA 1WAMA 4QOFA 4FEEA 1KR5A 3M5WA 5A5FA 1CLUA 5ICFA 2K7ZA 3RSFA 4KE7A 5AHOA 1UBFA 5JSQA 1NNI1 2FEXA 1KTIA 1GFWA 2VI5A 4UHKA 1TYCA 4QRHA 3DAFA 2BKLA 5AJXA 2YWXA 2JIRA 3OQNA 1IN1A 2J6BA 2ANBA 1H1TA 2GN8A 1XQ1A 3MFYA 2IIVA 4HH0A 3R7SA 5EXPA 4DNOA 1NASA 3L7KA 2OHGA 5CDHA 5BN3A 3OZFA 4FUTA 3U0BA 1A95A 1JV2B 3EY9A 1O77A 4JBXA 1WCYA 4RIFA 2AUMA 1NVVQ 1UJ4A 2GM4A 2J9XB 2WLSA 1EUCB 1FTQA 1J56A 1XEWX 1JILA 3GEGA 3CISA 3GN1A 3HABA 3RFCA 3E3MA 2R8XA 4HDMA 3A1UA 3TMAA 5KJCA 1NIPA 3OSUA 4RK5A 3K7EA 4JC8A 3SQXA 4ER5A 4FMCB 4RZ2A 3UJAA 3HCAA 1VP3A 1ISMA 1LTQA 3CLUD 3GHYA 4Y9RA 3QEOA 3TSWA 1CBUA 3VJKA 421PA 5J2UB 3ORQA 3WYAA 3COSA 3THWB 3LO8A 3PCTA 4B6JA 4MEBA 4DREA 1U8FO 2C4NA 4KZPA 4BU1A 4EG6A 2P2LA 4AY5A 3U39A 2D6FA 2AR0A 4JI6B 1MB4A 2PRJA 2VP0A 3NEAA 1IEVA 5JAMA 2BFBA 1CU1A 1W49A 4BO8A 1M1UA 1RPTA 3WA6A 4FD2A 2G5CA 1QCCA 3R23A 4CE6A 4L8LA 4YV1A 1KU0A 1B0ZA 2FK7A 4V0SA 3DUWA 2QV0A 4PHHA 5J4VA 3TM5A 2PWPA 2FOIA 2NUAA 4V38A 4GMDA 3ZXXA 2XDYA 3CYFA 2CLFB 4F72A 2Q0HA 2EFEB 4GMFA 3RIMA 2YUTA 4K28A 4UNPA 5AQ1A 2XY4A 3MWYW 1QP0A 3U3OA 4HL6A 3UZUA 2WTNA 4MPTA 4Z4QA 4AY4A 121PA 1GG2A 5IWAB 4JL6A 1MJGM 1E0SA 2C88A 1OV6A 3DZHA 3PQ4A 2VDWB 1DPFA 5LD2B 3UWOA 1V96A 3MB8A 1PSWA 2FMUA 1IXKA 4G1CA 4KH0A 4ZCTA 3LD9A 3OTWA 2VTBB 2O8BB 1TUBA 1N34B 3GLGB 2HX1A 1WP4A 1ZIYA 2HLNA 2WABA 1RQPA 3KXKA 3AEUB 1AKRA 1ZK3A 2R8RA 4P2GA 4W9NA 2JA1A 2VSFA 4IVNA 4YIKA 1MHPA 2H2WA 2W0MA 3K94A 3M4YA 3PXGA 2AMYA 3EMVA 1DJQA 3MCVA 3VUEA 3ZQUA 4BASA 4CF6A 4URXR 3DE4X 4LQDA 2ZU6A 1NNLA 1EM8A 5AOAA 1H85A 4FKZA 2D1SA 4X65B 4ES6A 3DMTC 4G0OA 2FDXA 2Z30A 3KT0A 1CUJA 4GKJB 1C0EA 1ECCA 3L3BA 2X1VA 4AMYA 1GSHA 3QNMA 4ZT7A 3ZHZA 4JLJA 4TS3A 5K3BA 1ZAYA 3HKDA 4Y2RA 5A62A 5LL6P 1JG3A 5ECWA 3G8CA 2XB2A 1V11B 2ECOA 4K26A 3IP7A 2PGNA 5ALGA 1GL3A 4W5JA 4ARZA 3T34A 3GGCA 4BNXA 1RPZA 2IEIA 3AR3A 1GQSA 4YDRA 5T4FA 4DJEC 1M0SA 1IZZA 3F46A 3JR7A 4MUXA 1LBQA 4QRIA 2PBLA 4UEWA 4CTOA 5FDFA 3EZYA 4MB6A 4UTVA 4U2BA 5C4GB 1R5JA 4EGSA 1LW7A 1YZQA 5SV2A 4WEQA 4XWOA 4I66A 2VZ0A 2B30A 4M0CA 3AKCA 2NXWA 1J22A 1JKMA 3IKTA 1PF7E 1L7VC 1RVV1 2PAAA 3CA8A 5FF9A 2MYTA 2NACA 3L8YA 3WV5A 1GA1A 3AJDA 5H59A 4R5MA 3NHWA 1WZNA 5DP1A 5K4AA 3GFVA 1TO6A 3W1WA 3O31A 4TYMA 5L51A 2GN4A 3ER6A 2BELA 1YONA 2H4FA 1UZNA 2Y67A 3V4SA 3A1TA 2OO5C 2XKJE 3KLMX 1MB3A 2WT8A 2F9MA 4HATA 1GSOA 1KH3A 4PW0A 2J9ZB 2DFPA 1J2UA 2OB1A 2IZ1A 3R2JA 3VX3A 1Q1BA 3KQSA 4HNUA 4FNAA 2QL6A 1BX1A 3D4BA 3AUYA 1TZJA 3ZK7A 1P8JA 3NOVA 3DOOA 3FH0A 4Z3KA 1SPBS 2RGRA 1X9GA 1TMKA 2G9RA 3QGMA 3VTKA 2VWHA 3OX1A 4PNHA 4JI3B 3ENVA 5KTMA 3ERCA 3Q7TA 3RNOA 3EPHA 3IAFA 4ZQEA 5EJ5A 3R6WA 4UCFA 2I34A 2CHGA 1EWTA 2PFSA 4D0SA 2JFWA 1I2AA 4QDXA 1L5RA 4DOMA 2DF8A 1F4LA 3I52A 4ATNA 1TU4A 1ZONA 3SDZA 1PW5A 2VAWA 1WXWA 3SXUB 1V3QE 2GO7A 5G1PA 3WBJA 2X77A 1JR6A 1FFHA 3AFNA 3GCDA 2JDID 2LIPA 2Y0BA 3ANSA 1UBLS 3N7TA 4XQ0A 2I3ZA 5JEDA 4OXXA 5H68A 1QZZA 1MH9A 4M8KA 5H9WA 5CH3A 3CNEA 3HWSA 3EFOB 3KCQA 4JBNA 1R50A 4ZVTA 4TOIA 4O4JF 1NQWA 3AY0A 2FJ0A 3CVOA 1PNVA 2I54A 2VAPA 1NULA 3L6RA 4WZAB 2AG5A 2OMKA 3QG5A 2ZB4A 1EESA 3HN7A 2QP9X 3LG2A 4JT8A 3FROA 4FB4A 3DKIA 4KDCA 1KQOA 1GL9B 1X13A 4H7JA 2W6ZA 1ENOA 1SKYB 3HRKA 1DXQA 2WWWA 4F6LA 5M29A 4ZO8A 3VNVA 1WKVA 3A1WA 3LUGA 1ZVVA 3NOQA 3QLVA 1D2AA 2IPNA 2GNOA 4AQYB 2H6EA 1KH1A 4TUYA 3S5JA 4DMMA 4CQLB 4ESVA 2HWYA 5BT8A 1U2QA 1UT6A 1MC1A 1XTIA 1IAQA 2OFOA 3V8EA 3ZDRA 4D9IA 5JFGA 4EI7A 2O0KA 1A4IA 3IOBA 2ADMA 4MDEA 3X1YA 4X7MA 1BCSA 4LCEA 5EIBC 5ARBA 1Z39A 3OE7A 4L0MA 3N2GB 3HUEA 1VZ3A 4DV5B 2G17A 3C15C 1Z0DA 2O7VA 4JBWA 5AK5A 2POCA 1JKFA 2XWSA 5E4TA 3FZEA 3SMVA 4CG0A 5D85A 5BYBA 5FBWB 2DPXA 1SVUA 4UMEA 4LKOA 4QECA 2OD7A 2QU7A 5B3LA 3FDXA 3NG1A 1IYZA 2X4IA 5D7NA 1FNDA 4X54A 1IUOA 5LCXA 4TWJA 2AG0A 3REFA 3T7AA 3AI2A 5EZYA 3E53A 3G49A 3IULA 4COKA 2G80A 5INTA 1YSCA 3V1NA 3N28A </