1MRSA

Crystal structure of mycobacterium tuberculosis thymidylate kinase complexed with 5-ch2oh deoxyuridine monophosphate
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
208
structure length
208
Chain Sequence
b'MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDYLATE KINASE
publication title Enzymatic and structural analysis of inhibitors designed against Mycobacterium tuberculosis thymidylate kinase. New insights into the phosphoryl transfer mechanism.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 83
structure length 208
sequence length 208
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2002-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1mrsA00
4LPSA 3IBGA 3A4LA 2H7VA 4NCJA 4C7OA 4X8OA 5IRCD 5CIWA 3BH7A 4RFSA 2Z83A 2VTKA 2CMKA 1A2BA 4I1OA 5F2EA 4DB4A 1KAOA 4P3YA 1Z28A 2C5LA 3L0PA 4F4JA 1G18A 2BOVA 1Z6XA 1G21E 2C8VA 1AQYA 2IS1A 2YHSA 3U3MA 2JJ2D 3NBXX 1G19A 3AF0A 3GLGE 1GOTA 3GFPA 221PA 3TK1A 2PMDA 3C14C 3TAHA 3UMSA 1QG2A 4KYUA 4P4UA 1S2MA 2O8BA 4BLRA 1NKTA 4IOMA 2EU8A 3P26A 4DDWA 1G8GA 1Q1QA 2RGNC 1XEXA 1AZSC 3QVUA 1L4UA 4NCKA 2NIPA 1P2SA 4AI6A 5KPJA 4EPVA 1DEKA 2NG1A 4US1R 2GF9A 4ZDJA 3X1WA 3OEHA 3RS5A 4BFYA 4LJ9A 5JI3E 1XF9A 1EK0A 3RANA 1XMSA 2GEDA 1L4YA 2AK2A 2V8OA 4OI4A 2ATXA 3T06B 3AKEA 1TL7C 1WMSA 3CZPA 3EZ6A 3LBHA 4GZMA 4C30A 3CRRA 4U00A 1JXOA 2OILA 3LO5A 1NBMA 2MSDB 2RGEA 1P62B 2F43B 5CM8B 5EE5B 4HUTA 4LHVA 1H8HD 3X2SA 4KLNA 2XZPA 1P72A 4CVNA 3I8XA 2FWRA 2R8RA 3SHFA 1M7HA 1X8KA 5HPYB 2IK8A 3KJGA 4MRSA 5BWMA 5KDDA 4HSEA 3THXA 4W7SA 1S1MA 1K5DA 2BJVA 4YQFA 3KKNA 1IY1A 1E1QA 2GJ9A 1RVDA 3BFVA 1R0XA 2R6CA 3NC0C 2JLYA 5HKKA 1KO1A 1XJCA 1G5TA 1YKSA 4HAWA 1D2MA 5A4JA 3EPKA 2RHMA 4TSFD 1IM2A 1ZUHA 4AYXA 5K8IA 2VF7A 2G9NA 2JGNA 3TW4A 4V0ME 3TVTA 1KI6A 4CEJA 1OLOA 4FCWA 5D3MB 2V4ZA 1XWIA 2FEMA 4Y0VA 3DZDA 3U60B 1U99A 2VL7A 2G1KA 1G8YA 1GL6A 2PL3A 1OHHD 1G3QA 1VTKA 2RMKA 4RD3A 5EP1A 2IWRA 2XXAA 2QGZA 1EGAA 4M9QA 2P67A 2VEDA 2C03A 4CF7A 1XPUA 4BRWA 3ZJYA 5IK2A 4AYTA 1GNRA 5H70A 4A36A 1LF5A 2BMJA 4MGIR 4Q4JB 3FMFA 4YXWD 3GJ5A 5GVRA 2D2FA 3DO6A 4KFRA 3FFAA 4QBHA 5FR1A 4TYYA 1KI4A 4ZI3A 4YDHB 2CCGA 4TLAA 2QM8A 2GAOA 1KJYA 2E1RA 3KDSE 2WKRA 1A2KC 1G8FA 3PUZA 4PPGA 4IHQA 4G5QA 5L3QA 4JKIA 4KFUA 1LS6A 2QROA 2VH5R 2CLDX 4ZV4A 5FTLA 3ZVNA 3FOZA 3BWDD 2HYIC 3RC8A 5DYIA 2AFIE 4HLQB 4ITRC 2EVWX 4CDGA 3EZ2A 1CULC 2GXSA 2HCJB 4U7DA 3ADBA 4CEIA 2C9OA 1UADA 3DM5A 2OBLA 4CT4B 4BQSA 2FMXA 3KUDA 1G291 2JDIA 4QG7A 1E9AA 2NQ2C 3VHLB 1U8YA 3BERA 3DL0A 2YOFA 3MWJA 1KJZA 2ZSFA 4QHYA 1C4OA 2QTHA 3ND8A 3QKSA 4NMMA 2RB4A 5KSZA 1XEFA 2IA5A 2IYUA 4PHGA 1W36C 4M1YA 2CJWA 3NC1C 3VMFA 5KO2A 4OQMA 2E9SA 1J99A 2HXYA 2V6JA 1QRAA 2BCJQ 2PT7A 1YZGA 3OIVA 2AKAB 1SVIA 1EFRA 4AG5A 3RHFA 2ZAOA 2ZI3A 1DBSA 1U98A 1M2OB 3RABA 3RYTC 3X1YA 2V55B 1LB1B 3IDQA 1FMJA 1E1RD 1VCIA 3K0EA 4QGFA 2ZAMA 2ZE6A 4NHOA 1XZPA 2F6RA 1Q1BA 5J47A 2W0SA 3I5XA 4IDNA 4G3XA 1KNQA 1NJFA 3BORA 2RGAA 4ZDIA 2Z4RA 5FBWB 3VU9B 1M34E 2J0SA 5J4HA 3KJHA 4DEXA 2ANCA 3QXHA 4O25A 1ONBA 1RJ9A 4KXFB 1MO3A 4JLVA 1YVDA 2HEIA 3LW7A 1NMXA 3CNOA 5TXGA 4UJ5A 1S1CA 4JT4A 3NEJA 1YR6A 1Z6YA 5EXXA 1E0SA 1T0HB 1JR3D 2HDNB 4TT3D 5TV2A 3R8CA 1UFQA 4UJ3A 1N5LA 3P20A 4TL7A 3C8UA 4RY2A 5CLLA 2NOAA 1NSTA 3LH5A 2HJGA 4I4LA 4DEYA 4PC1A 4FWTA 1MO5A 1WF3A 4C3ZA 3GLIB 4JSYA 1F48A 3FDIA 4HZIA 5FBRB 2FFQA 2CCJA 4DDUA 2FV8A 3GCGA 1S0UA 1TU3A 3FB4A 1T4GA 4QBGB 5JWRA 2IYXA 5DI3B 3DM9B 1ODFA 3A4MA 4PC2A 5DH9A 2R44A 3B85A 4L9WA 4QGGA 1JEDA 3AB3A 4GDFA 4HAZA 1NVVR 2ECKA 1WBBA 1N6LA 5L3RA 3E70C 2CHVA 4Q18A 1XPRA 3QF4B 2NO0A 4PANA 2WJIA 2A30A 2FPLA 3AV0B 2G3YA 2QT1A 1PUJA 4FMDF 2A5FA 4AK9A 1XXHB 2KE5A 3RS4A 3VX3A 1VHTA 2IS4A 4LBYA 4X8MA 3ZZ0A 4B34A 4OI2A 1G3IA 2IC5A 5CJ2A 1K6MA 4HB2A 3K09A 2CE2X 2GA8A 1OB5A 1NIPA 3TSZA 1US8A 2PX0A 1E2KA 1P9NA 3T1TA 1G7TA 1MABB 5LPNA 2BBWA 1LY1A 4PSAA 3Q8XB 3RDPA 1T91A 1P6XA 1S8FA 2WMNB 2IXGA 3B2EA 5J4YA 4DT1A 2BVNA 4XWAA 2ZRIA 1E3MA 4PC7A 2ZU0C 4Q01A 4N0EA 2WJVA 2IS6A 4OKSA 4V02A 2IWHA 1Z63A 4A6PA 4Z1MD 2A2ZA 3SR0A 4DWJA 1GVNB 4OQFA 4TL6A 4Z54A 3U44B 1GNQA 1M7GA 2DYKA 1HEIA 1GTVA 3CF0A 1UKZA 2UZIR 3K70D 2LKDA 3SS8A 5KNDA 3T5DA 3D31A 2GJSA 1R0ZA 3QNUA 3V4FA 3AKCA 5FI1B 2QU8A 1G6HA 4NYMQ 2B8WA 2GXAA 5M04A 1XTSA 3D8BA 2ZRFA 3QKUA 3EPHA 1AQUA 1LNZA 1W0KD 2UVQA 3GJXC 2JLQA 2A5YB 3EPLA 1KOFA 4JS0A 3L0SA 5KPDA 5ELXA 1XD8A 4K8OA 4YONB 4F92B 1ETUA 3G5UA 4UNNA 5D3QA 4B6FA 4BWYA 4B3XA 3AVQA 5CB6A 2GETA 5AJVB 5JLJA 1G4AE 1L7VC 2XTZA 1EFTA 2WPDD 1W4CA 4FMDB 1TQ6A 1FX0A 3KFVA 5JEEA 1QF9A 3B1YA 5UKDA 1HE1C 1Y3AA 5AUQA 2V3CC 1AA9A 2B92A 3WYAA 4C2UA 2NMVA 2H5EA 2WOJA 1VYUA 3L43A 5AR1A 2REOA 1DOAA 4GPTA 2IUUA 3HJNA 2FF7A 1ZU4A 4Q1DA 1T3SA 1KK2A 1UAAA 2GCOB 3RAPR 1XD2B 4JJZA 2KBFA 3OEHD 4ESVA 1RPZA 3BS4A 4JMPA 2R6DA 1ZD9A 3LFUA 3K0FA 1BIFA 2EW1A 1PV4A 3KZ1E 2WOOA 4B74A 4DCVA 2CHGA 4LGMA 3QXSA 4Q21A 1LVGA 4YC7A 2C99A 2H17A 3HPQA 2G77B 4O2LA 3KTAA 3QBVA 4IFEA 3ZZTA 3WBJA 5FPKA 4V0OA 4L9SA 3SE0A 1ELOA 3KXKA 4DBLC 3JZAA 1NBMD 1CXZA 1T5LA 3EARA 2QPAA 3REGA 5JJIA 4KCGA 3BD9A 3T35A 4EFLA 5JI2E 2FNAA 1K5GA 2C77A 2FSIA 4AC9A 4BFXA 2JCSA 5EP4A 4MKIA 3W8RA 1R10A 3VFDA 4BRUA 2QMUA 2ZUBA 2ZITA 4HB0A 3B7GA 4TSFA 4CIDA 1FFHA 5JSZA 4LY6A 4TLBA 2IEYA 4N0DA 3LVRE 3PFIA 4URUR 3ZYCA 2QSZA 2CL0X 3VR4A 3F8TA 4M1WA 3LX8A 2YOGA 4B3GA 1YRAA 3I73A 3THWA 3TH5A 2J7PD 1UEJA 2JLVA 4Q1AA 5DSZA 2GILA 1II8A 5CYOA 4B2IA 4HAVA 4XH9B 2F1JA 4MQBA 1HYQA 4YXWA 2XGJA 1ZP6A 2D06A 2DCUA 5IK2D 5EUQB 3O8DA 3JVVA 5CITA 4MRRA 2ORVA 1G5RA 3CIOA 2ZE7A 1E0AA 5K8TA 4WZAE 1G3MA 4Q00A 1M6NA 3GP8A 4B32A 2ZI5A 3E2IA 4JT2A 4BZQA 1E4YA 4EJSA 1CR0A 1ZNXA 2YNMA 3EX7C 2CDNA 4A0RA 3WNBA 4DIEA 3LLUA 2C95A 1SXJB 2CL6X 3R7WB 2J1LA 1F2UB 1JJVA 1BH2A 3F5FA 2QP4A 4TQ9A 4DCUA 3TLXA 3TQFA 1Z2CA 1JQJC 4LJ5A 2ZJ8A 3TUIC 4D4JA 1XDBA 5KNCA 2IBMA 2VP6A 2ZREA 3ADDA 1SVOA 4JVLA 1RRCA 2QP3A 4A1FA 3ZQ6A 1DS6A 1Z08A 2ZEJA 3QJYA 1Z3IX 4CGZA 2IYTA 1VIYA 1ESMA 1BYUA 1Z6TA 2QMHA 1T0JB 2XZLA 4FN5A 1ZUNB 5CDFA 5C2JB 2I3BA 3GLHB 1KDRA 5AUOB 2EFGA 3AVXA 1FOEB 2XTMA 4LPKA 2VHTA 2ODWA 3FPAA 3OEED 2FGJA 2GRJA 4F4IA 2GF0A 4O3MA 5H8WA 3QKRB 3CRW1 4ARZA 2BV3A 3NH6A 2O8EA 3SC3A 4QBIA 4GI7A 2IEZA 4HB4A 4FI3C 1E2EA 1ZBDA 3HU1A 1X8JA 4Q1EA 1A82A 2YYZA 4B3DA 1HA3A 1OXSC 2JA1A 3CRQA 1GM5A 2VBCA 3GMTA 4JLAA 3NBYC 3CKLA 4L16A 4TZ0A 3B5JA 4XD7D 3N2EA 1TEVA 4TMWA 4OHVA 1U8AA 3FE2A 1W7AA 2ZVQX 1GL9B 4ZCIA 1E1RA 1N3BA 3ASZA 2QP9X 5L3SA 2C98A 4EPYA 1H65A 1W36B 1ZIPA 4B48A 5G53C 1IXSB 2HYDA 2ZRBA 4G0NA 4KSBA 3GLFB 3ONWA 1F2TA 121PA 4AYWA 4DUGD 2RGCA 3ZS9A 3A37A 1R0YA 3WMGA 5J5CA 4D4MA 5G41A 1IY2A 1P60A 3QG1A 4HDQB 1XFAA 1CLUA 4R2HA 3KQKA 1IN4A 1OFTA 2DFKB 3PUYA 2OEPA 1MRNA 4Q4HA 4ILEA 5BN3A 1X1SA 4QKQA 2H16A 3SFVA 3PEWA 4LV8B 4XSGA 1QG4A 4BLQA 3GD7A 1VYTA 1E9DA 3CUEF 3OF5A 4GOKA 3QOFA 4JLKA 1G8PA 4KI0A 3GLHE 2OFXA 5BXQC 4JL5A 5GJWC 1OE0A 4Q02A 4HATA 4CW7A 5EZ5A 3BIFA 4OBEA 1GL7A 1QZXA 1KYIA 3A8TA 4IVPA 1XD9A 2W2XA 1JAHA 2E87A 5FTNA 5K8LA 2PBRA 2VYFA 4NDZA 3B13B 4B43A 2C04A 1WDTA 3A58B 5DO9A 3T1QA 3WNDA 4DLWA 1OJLA 3A1TA 1AIPA 3QXCA 4K81B 1HV8A 2A5GA 4ZIRB 4M9ZA 3BFXA 3VKGA 2J45A 5F9FA 3TBKA 2Q9AA 3ZS8A 1D2NA 2Z5FA 4XWKA 4WZ6A 1NN1A 1UBCA 4FMBB 1YHNA 2R65A 5DGXA 4UXJA 1OF1A 5FUXA 1BS1A 1IJEA 1XRJA 2DB3A 2GK6A 3HR7A 2H57A 4MITA 4W5HA 4D0GA 4NKRA 3S1AB 3OHMA 3WBKA 1FZQA 2MMGA 3U7GA 3W5JA 4JBXA 3AP1A 4AY2A 1II9A 1OFIA 4GT1A 4EQ6B 3C5CA 4MYHA 3GJ4A 1NI3A 1VDZA 4A15A 5DHAA 4P0TA 1WQ1R 4OI1A 2D7CA 4PPQA 4POAA 3EIQA 3SHWA 3CONA 3C7KA 3IBYA 1YJ5A 2QZ4A 3HDTA 3HYTA 1VCOA 1CR2A 4DLVA 3GFTA 4IOKA 4JLBA 2HT1A 4X8LA 2CK3A 1NP6A 5DN6D 2J3EA 1KSJA 2ZQ5A 3BRWD 5KDLA 4OK5A 3ICQB 3U61B 1N2CE 5FBQB 1B23P 3Q72A 3V4RA 4GMDA 5KYKA 1C9KA 1MV5A 1QVRA 3AEZA 1Q3HA 2HUPA 3B60A 5AWFC 3B9QA 1OIWA 4V0LA 1LTQA 2IYSA 1E2LA 2FSGA 2RGDA 4TWZA 4ZI2A 2F43A 2F3RA 4DCNA 2ATVA 3QEOA 4Q9LA 3RWOA 2JAQA 4TN1A 2ZSDA 2YKGA 1W0KA 3JVUA 2OCYC 3NBZC 1HT2E 3GEEA 5GJVC 2BM1A 1WRBA 2FFBA 1DARA 4JBWA 2CXXA 3PEVA 1GKIA 2HCBA 3B1VA 4PC6A 2ONJA 1KMQA 4RCZA 4C4PA 1CS4C 1E2IA 2FFHA 4Q47A 2VP9A 3FMOB 4FD2A 3K0AB 5KSOA 2WPDA 3AVVA 1HUQA 1R8SA 3EPJA 5D3MA 1P5ZB 1PZNA 4QM7A 2FFAA 2YWFA 2DHRA 1GILA 2J0UB 2ZSAA 2AKYA 1JALA 2P6NA 2WSSA 1OH6A 1CRPA 3K8YA 1I4LD 4M1MA 2FG5A 4OHWA 1U8ZA 1TQ4A 2AFHE 1PJRA 2IUSA 2ZYWX 4Y0AA 2J87A 4D6PA 1J8MF 3F3YA 1W49A 5CM9C 4GSYA 2AD1A 2Z6VA 4D81A 4C0HA 2NGRA 3AGPA 3VR5A 4Q4JA 1EFCA 1XCPA 1EG7A 2WIBA 2OESA 4JLDA 4DLSA 2EFHB 1XCMA 3FMIA 3IPXA 2VQSA 4JL6A 4OJKA 4H9GA 1JR3E 4Q7KA 4A0HA 4NTZA 2I1QA 4H1VA 4HAYA 2YC4C 4A0FA 1DAFA 2JLXA 1Z47A 1RZ3A 1PLJA 3CWZA 2Q0HA 3IO3A 4RD4A 3WHKA 3AF1A 1T8TA 4S2EA 4BLOA 4M1TA 2WWWA 3EAQA 4DLXA 4MH0R 2ZJBA 4RZ2A 4ON9A 2AWOA 2ODEA 2V9PA 3CNNA 4LV6A 3FKQA 4JZKA 4HUQB 1CTQA 2O8DB 1S9DA 1QHGA 3W6OA 4Q9HA 3SJZA 2BMEA 5EE3A 1Z0IA 1CKEA 1G7SA 5EUMA 1E32A 2P65A 2Q9BA 3TJZA 2LWIA 4IDQA 1GKYA 4WOPA 5C18A 2GWHA 4MKFA 2WJYA 4G5SA 3U3KA 4LUCA 1E96A 3RRZA 1QHYA 3NBFA 621PA 2WMOB 3Q5EA 3IEVA 4ZDWA 3I8SA 2ZR0A 3UIEA 1GRRA 1ZNYA 3BB3A 3KQUA 3CO5A 1XTJA 1N0UA 2G88A 5FOXA 2A7QA 3KJIA 2J7PA 1Z22A 3VNVA 3NTUA 2C9YA 4D82A 3MWKA 4JBYA 4PAOA 5SZHB 2WWIA 3LV8A 1SHZA 2QAGC 4RFSB 3NEYA 1G41A 1EWQA 1OW3B 5HE9A 3CH4B 2GJAA 2WWFA 1AK2A 2BMDA 3W90A 2BM0A 1FPMA 1W47A 2QGNA 4YMTA 1ZINA 4OHYA 1SXJC 2W2VA 4FCTA 4KFSA 4PAQA 5TDHA 4QFMA 5FPYA 1P9RA 1OIXA 4B3CA 4WXRA 4ZDKA 3VX4A 4EAQA 1E2PA 1Z6AA 4MUAA 2GESA 1MO4A 1T5IA 2C96A 4KJZA 3B1ZA 4TTPA 2W6JD 1P7CA 2GCNA 3DOEA 2VP4A 3CR7A 2ERXA 1XMVA 1TX4B 1YR8A 2W2TA 1YZQA 2FPMA 4MYCA 2DFNA 2GJKA 3VU9A 3WMFA 1FUKA 4OQLA 3OIWA 4NH0A 4US0R 3VKHA 4H1UA 2WAYA 4PZYA 3ICEA 5B64A 4ERNA 3U6BA 4EPTA 2CHQA 2NZ8A 5AUNB 1IN8A 2ZROA 2DFLA 5FPTA 1KMHB 4IXNA 1TUEA 4E5UA 3TQCA 3D7MA 5GVSA 4DLZA 4I1VA 3NHBA 2RKOA 1YZKA 3OEEA 4RFVA 4V0NA 4F7WA 5EZ6B 4F91B 2QMOA 2JLZA 1CJTC 2KB0A 3GLIA 4TYNA 4D80A 2GK7A 1NLFA 821PA 5E4FA 2YZ2A 2RHDA 1KI1A 1G4UR 1GRNA 5BYKA 4B71A 1N0WA 2OBNA 5A5GA 4HAUA 4NL4H 4U5XA 2Z4SA 1CBUA 3RRMA 1SKYB 3RLFA 1ZC3A 2JEOA 3OE7A 4MGYR 4MGKR 3QXXA 3LDAA 1KJWA 5TB5A 2PMKA 3U5ZB 4XD7A 1Z07A 3QPUA 4BZPA 4KAXA 2O8CA 5G3YA 3DMNA 4MKGA 3MCAA 2ZYUX 2OLKA 1KK0A 3C41J 4NP6A 2C2HA 3IIJA 3QF4A 4CEJB 4KSCA 1MO6A 4C0KA 2IXEA 5JHGB 1DO2A 1G5PA 3L2OB 4G5OA 4DUGA 4JSTA 1P2TA 1YZLA 1VG1A 1XXHA 3UMRA 3AVTA 1E79D 3TUZC 2KBEA 1NVXQ 2X19A 4C0BA 2ZVPX 3QVVA 3E1SA 3QEJA 2DWQA 2Y8EA 2YINC 1LS1A 1A7JA 5J4LA 2XJ9A 4DRZA 3FHCB 4EPRA 4A6XA 1UPTA 2GZAA 1GITA 4C9BA 3ADCA 1JECA 1R4AA 3W9YA 4IEIA 4KV9A 5KTYA 1KTVA 2IUTA 5FH9A 4NYIQ 3PXGA 1AS2A 1NY6A 2VHJA 3C15C 4GP6A 2IS2A 1AN0A 3ZGXA 1NBME 4ACBA 2D62A 1XMIA 2YWGA 2B7CA 1GP2A 3THOA 3QKTA 4R2IA 2J59A 3E5HA 3I3SR 1IXZA 1N5KA 1OYWA 1VG9B 2WSMA 3ND9A 3VR2A 3X1ZA 4UNQA 4DDVA 1RC8A 3IUYA 4HYYA 2QQ0A 3B82A 1AKYA 4QC2A 5L3QB 1XJQA 3O8CA 1KHTA 2WTUA 1KNXA 2AXPA 1SKYE 4Z8XA 4BEBA 4WVFA 4WA7A 1II0A 4R7ZA 4TLEA 3U44A 3R9IA 3U6KA 1U81A 2CLCX 4NYMR 3TR5A 4ZPXA 4LC0A 1VMAA 3RS0A 4A8JA 2VO1A 1S9HA 4CEIB 4DSOA 1XNJA 4PZLA 1KAGA 4D0NA 3M4YA 4QHSA 4UNSA 1TAGA 3VQTA 2OLJA 1U0HC 2ERYA 3A1VA 2Z0MA 1XTRA 3PVSA 4LV5B 4Q9IA 4IEEA 2DBYA 5KNBA 3LAWA 2H18A 1DTSA 1KK1A 3QKSB 2A9KA 3MAAC 3F0TA 3I92A 1SVMA 1ZNZA 2HJVA 4A92A 1BMFD 1D6JA 4MDFA 2QM7A 5SZJA 1NIJA 3OAAD 4LBVA 1QHNA 2QL6A 3K0CC 3ZIAA 1Z6GA 2W58A 4OQXA 3B6EA 3EIEA 4W5WA 1KY3A 3BB1A 5FBLB 4ZO4A 2X8AA 2ZE8A 4PX9A 2AK3A 4M2LA 4DKXA 5DN6A 2JJ1D 3T1VA 2ZR9A 1G16A 1GAJA 5DISB 4URVR 2RAPA 2GCOA 2CK3D 2GEVA 2F9LA 2P0EA 4C2TA 2XAUA 1XD2A 3CX8A 4UXIA 2F1RA 5G3ZA 5HE8A 1FMLA 1KI8A 4BUJA 1DAKA 4JLMA 2RGNA 3CZQA 2ZI6A 4DC9A 3EASA 2XEXA 4JIMA 4LYJA 3HWSA 2VHUA 4OQNA 5JCZA 4YMWA 2EQBA 1I4DD 1JQLB 3IGFA 4C0SA 2IYLD 3SJBA 4ESHA 2CBZA 3BFKA 4LZZA 3W5IA 2P6UA 2OFOA 5H68A 2EWVA 1COWA 3UPUA 3ETLA 2VP2A 2FZLA 4S35A 3VTKA 2WKQA 2N42A 2F1HA 2PH1A 4TL9A 1MKYA 3GQBA 1VCNA 1DAMA 4IVRA 2OXCA 1Z0KA 3WXMA 1T3HA 2CVFA 1W46A 2PLFA 3AUXA 2AXNA 3ZVMA 2FZ4A 4TQUS 1RYHA 2FPKA 4M9XA 4HZUA 3SBDA 4Q7MB 2QBYA 4R71A 3WMEA 4C7OB 2WKPA 5F98A 4UXHA 4QGAA 2DY1A 3GEHA 5GJBA 5P21A 2JLUA 3LWNA 1Z0JA 2RGBA 2C78A 1Z06A 2Q3FA 1F6BA 1D9XA 2ZJOA 3NXSA 5TMPA 2WSSD 1G1MA 4ASUD 3LQRA 2GCPA 5JWOA 2Q3HA 2D7DA 3KKPA 3B78A 1FNMA 2ZRJA 4LHXA 3H84A 4V0KA 1A1VA 4PC3A 2GHIA 4ZCLA 4C0JA 4ZKEA 1E2DA 1ZM2A 2ZSEA 3CX6A 1RW4A 1AKEA 4DSTA 4F93B 3EC1A 3O8RA 3AVWA 4AKIA 2OHFA 1ANKA 1AM4D 3AM1A 4JYCA 4DVGA 3THYA 1MRSA 4IJMA 3ZD6A 1GRQA 4O0MA 5FBVB 1Q20A 2B7BA 2N46A 5FI0B 1KI7A 2J0QA 1SULA 4XOIA 2CNWD 5AJZA 1QHSA 3R7WA 1SXJA 1U94A 1NF3A 3LA6A 3U4QB 1GDDA 3NVAA 2EFCB 4X8HA 4QJ4A 4BFUA 2X1VA 4TTQA 2GBLC 3RRYA 4J0QA 4LHWA 3U3RA 5KUTA 2QN6A 1UF9A 4LWZA 4V03A 2O8FB 3MJRA 1E99A 3CPJB 2GVDC 3NG1A 5BN5A 4PSVA 1V43A 4M0LA 5B30A 3A36A 3TKLA 2NO1A 3PIRA 3G82C 2DWOA 4LCBA 4FMCF 2UZ3A 3ZDQA 2D3WA 1B0UA 1E0JA 4Q4AB 2R6FA 1X1RA 4EUNA 3DZ8A 4I81A 4EPXA 4IOLA 4YMSA 5LD2B 2QY9A 3WYGA 3NH9A 2WV9A 1MH1A 1E69A 3SJAA 4QJ3A 3LD9A 2YOHA 5B58C 2REXB 3QKRA 2O0HA 3AUYA 1OFUX 1PUIA 1NRJB 4PO9A 1U0LA 1W4AA 4ABYA 2FH5B 2XSZD 1KI9A 3A4NA 2ZANA 5E95A 3EZ7A 3I72A 4KLZA 3ZQJA 1LV7A 5KHOC 1NG1A 2PZFA 4LJ8A 1CR1A 1EFHA 1VIAA 3I32A 3KFXA 4RZXA 5DLQC 4DXAA 4UNRA 4RSGA 4XVQA 4TMKA 1Q21A 1VECA 2OFWA 2WM9B 4TMTA 2W6JA 1FX0B 2QAGB 3HU3A 3GLFA 2ZJAA 5AJYA 3I61A 1OPXA 2NZJA 2BBTA 1L8QA 4PO8A 5FUYA 5JHHB 2ORIA 3H2YA 4UNPA 2ZU6A 2GKSA 1U9IC 1OXXK 1VKJA 3L82B 1NVUQ 3AF2A 3RS2A 4KBGA 2A78A 4Q1FA 2QNRA 3AVPA 1Z0AA 4M8NE 4Q7JB 2ZRHA 2GVZC 4US2R 1G6OA 1RFLA 2VSXA 4QBFA 1Z2AA 4BPBA 2NPIA 5KU1A 2B21A 3DMDA 3FTQA 2CEAA 3SBEA 1ZM4A 1FL9A 4P33A 3R20A 2WWHA 1M74A 4PTLA 1Q1ZA 3DKVA 4GMXA 1CF4A 4DCTA 2DR3A 2QTVB 1FP6A 1G17A 2OG2A 2ZRCA 4PQYA 4FMCB 2GDJA 3PR1A 4OYHA 1ZC4A 4LHYA 1NL3A 3VNUA 1CJVC 4DSUA 1XP8A 1TQ2A 2G6BA 2OAP1 3R9WA 2XZOA 4EPWA 2BMFA 2G0NA 3AVUA 3SN6A 1JI0A 2ZJ2A 3BH0A 1G7RA 1NKSA 2RGGA 2AN9A 3OE7D 2F9MA 5JSZB 1Z29A 4FWIB 1EFUA 1XB2A 2XX3A 2ZR7A 2F3TA 4LYAA 2VP5A 1I2MA 5AK0A 2W0MA 4PHTA 1E79A 1EX7A 1IBRA 1KDTA 1P61B 4LJYA 4KITB 5G40A 3RRNA 4XSHA 1IXRC 2ZRKA 1W5TA 1E9RA 2IW3A 4G1UC 3SQXA 4D0LB 2VSOA 3H1TA 6Q21A 5EE1A 3M1IA 3R9XA 1Q44A 1II8B 2A5JA 3BXZA 4PPFA 4DIDA 2WWYA 1QBKC 5KSYA 5C4MA 1Z0FA 4LYFA 1OXUA 2IHBA 2ZI4A 3EC2A 4YMUA 3GLGA 1UKVY 1QVAA 2L0XA 4DHEA 2IYRA 4MRNA 4CEHB 3AF3A 4EJSB 4EFMA 1W5SA 5J40A 5TVKA 4QNMA 3AVYA 2X2EA 4FIDA 3HP1A 2QG6A 1KDOA 1BOFA 2V1XA 1Z5ZA 2J7KA 4Q7LA 5ANRB 5HR5A 2XJ4A 3I4LA 2VRWA 3FVQA 1SVLA 5JJKA 2PX3A 4Q1CA 3DOFA 1NN5A 3SDZA 3HU2A 3TSWA 3CR8A 3ZH9B 2EWWA 4EFNA 3NHAA 3U7HB 2XNDA 1E9SA 4Q03A 4RZ3A 4B3BA 1XTIA 4B76A 1ESNA 2HV8A 1GFIA 3GEIA 4TYPA 2SHKA 2P5SA 5HCIA 4JL8A 3SYLA 5HZHA 4LBWA 2FEOA 1X6VA 3CNLA 2A5DA 4QRHA 1W1WA 1UM8A 3MMPA 2ZE5A 4RZUA 2R2AA 1RIFA 3LRPA 5HCNA 4JVMA 3U3OA 2J41A 4NYJR 4TMXA 1XU4A 2QUZA 4II7A 1WCV1 2FSFA 2O8EB 4B2LA 2GXUA 1R6BX 3KKMA 2ZRLA 1BMFA 3Q9LA 5B2ZA 4QM6A 2AHOA 3QY0A 3T15A 3OAAA 4BFWA 1RRGA 2BCGY 5JZVA 5GADl 1XJ0A 3PJRA 2J0UA 4U02A 4V0MA 1G7CA 3VR3A 1R5OA 3KKOA 1WB9A 1KK3A 5FTJA 1KGDA 3Q7QA 4AURA 1G3RA 1IAQA 1E2JA 3QIAA 3ZIAD 4AKGA 2JJ1A 2ZRGA 1OT3A 3IILA 3SFZA 2HF9A 1YU9A 1F2TB 3KQHA 1O87A 2H8KA 1ZD1A 2ZYTX 1GNPA 4PQRA 3WRXC 1WBDA 5JEDA 1YZTA 1IHUA 2FN4A 4D4KA 4GNKA 4O2RA 1TTTA 3UK6A 1ZCBA 2PJZA 3W8NA 4CRWB 3OIUA 1UKEA 1CJKC 3AGQA 5FOTA 2HLDD 1NN3A 1XBTA 4MYUA 4G01B 2ZUCA 2FGKA 1OH8A 5CDFE 3K1JA 3H86A 2GJ8A 2QPOA 3QI2A 4JJKA 3NDPA 2OZEA 2Q21A 2REBA 3DEFA 5JCPA 1N0VC 1Q0UA 4HAXA 5IDVA 4HB3A 3BBPA 4G5RA 4HUQA 3KB2A 3QG5A 5F9HA 3PUVA 1COWD 3A1WA 3BC1A 3EA0A 2ZI7A 2PLRA 4N1AA 4G5GA 4L8GA 3VR1A 1VPLA 3QENA 1QHHB 3QXJA 1UDXA 5CLQA 5CB8A 1DVRA 1OKKA 1Q3TA 5B57C 3SQWA 1TEXA 2OV2A 5FL7D 4NCNA 5TY0A 4F4CA 5K8UA 3H0KA 2GZHA 4NONA 4AD8A 1XZQA 4KO8A 4BZXA 3NDBB 3NKVA 1RRFA 4BLTA 3FYHA 1MR3F 4M1OA 4NYJQ 1TADA 2Q6TA 2ZJZA 3CF6R 1XTKA 3CPEA 4GOJA 4RCYA 4LYHA 3T61A 1G64A 4LI0A 2CE7A 3AKYA 3REFA 3Q7PA 2G0TA 5JMTA 3DPUA 3K09C 4ASUA 4P31A 2ANBA 2GZDA 2QEQA 1W0JD 2FOLA 4NU0A 3ASYA 4AIIA 3RVBA 1ZM3A 4M22A 3ZD7A 4MA4A 2IL1A 1XTQA 1D8TA 4IW3B 5JECA 1G20E 3B8HA 1AJEA 1QHIA 3WNCA 1R5BA 1W4BA 3DVLA 5C46F 5JRJA 3MLEA 4B3FX 4UQOA 1BYIA 2BWJA 1DO0A 2JATA 2LCFA 3MGCA 4PR0A 4TMZA 2CNWA 3IQXA 4P4SB 2H1LA 1ZVQA 4WBSA 1PLLA 2R9VA 2ZJYA 1S3GA 1DG3A 2NO7A 2PT5A 1OH7A 1V5WA 1G8HA 1SXJD 2NTYC 2RCNA 4Q48A 4QL3A 521PA 4DLTA 3BB4A 4E07A 2W00A 3HYRA 3EZ9A 5LD2C 3WYFA 4MKHA 2AL7A 2GAAA 3KQLA 4I1SA 2XB4A 2V54A 5LB2A 1WA5A 4BGDA 2PJRA 3SOPA 1KMHA 2EYQA 5HZKA 1E9FA 1U9IA 4I1UA 3QE0A 2WJJA 4OL0A 2FJUA 1E2QA 1F60A 1J70A 3C16C 4JLPA 5JBQA 4JLNA 1ZMXA 5C4GB 5DNYB 2PEYA 3K70B 2O52A 3ZVRA 1LFDB 3RSLA 3K9NA 1ZIOA 3IHLA 2EYUA 1Z0DA 1OXVA 5IHPA 1TF2A 3FGNA 5FR2A 3IQWA 5CYPA 1E6CA 5EQTA 1G9XA 5FUWA 1JPNA 2Q3MA 3FWYA 1KKMA 2N1BA 2UKDA 2XSZA 1NVWQ 3DDCA 3FMPB 5FOWA 3I5YA 3PQCA 2WVJA 2HF8A 2AR7A 4Q66C 3R8FA 3TSOA 4PAMA 3BH6A 4M1SA 1NJGA 2JASA 4NPHA 1HT1E 3W3AA 1YR7A 3LLMA 4EKDA 4RD0A 4TQAA 5AUPB 4I99A 1K8RA 4NZYA 2QRZA 1P9WA 3CX7A 3FFBA 1NG9A 4IDHA 3LVQE 4KHZA 3N70A 3QPWA 1HE8B 3AP3A 3W3ZB 1W36D 4P32A 2OAQ1 1KO4A 4QHTA 1JB1A 1RKBA 3D6TB 3JZMA 4MRVA 2O8BB 1TU4A 1Q57A 5TARA 1N6NA 3AH8A 4B73A 1Y63A 2F1IA 1OIVA 4FCVA 4FW9A 4M4SA 3AKDA 1XEXB 4QGHA 4NYIR 3PCRB 2RGXA 2ZTSA 4NCHA 5LDDC 3NIBA 2ZRPA 1SVKA 3ECCA 4KODA 2NO6A 1RE0A 1ZD8A 1ZAKA 2QRNA 4Q19A 1VG0B 2ZRNA 1FP7A 3L0IB 4GRAA 2CLSA 3LQQA 3X1XA 1R2QA 2QMEA 1T9HA 2QT0A 3AP2A 3I1FA 3GJ8A 3UKDA 3GJ6A 4LJ4A 2GXQA 2MMCA 3MUFA 3T5GA 1KIMA 2ZS9A 3BJIC 4JKYA 4BFVA 1XPOA 1JBKA 1JNYA 4OK3A 4K46A 2BBSA 4L15A 3RWMB 1KO7A 4MDEA 4L5BA 4ZCMA 4HLUC 3THXB 1NN0A 1F3OA 1GWNA 5DI3A 2IYWA 3EA5A 2VHCA 1AS0A 2YC2C 3BOSA 3A6PC 1SHKA 2QE7D 4PHFA 4GZLA 1ZYUA 2OUKA 2JIZA 2AD5A 2YJTD 3L0OA 2J46A 4JYBA 1ZCAA 1JXMA 1KI6B 4LSGA 1DG1G 1UBEA 5EE9A 4XTCS 1JR6A 5A0FA 4E09A 5JRZA 2I1VB 3KB1A 4MGZR 2XXAB 2J5XA 3LBNA 5EE0A 1UBFA 1EESA 4A82A 1E9CA 3BE4A 1G3UA 5F3WB 3QPVA 4JLOA 5EP2A 2MSEB 2PCLA 4BFTA 4EJSC 2CL7X 4WIAA 2XITA 3N5CA 3IEUA 4LDJA 3OIYA 4YLGA 1MABA 5JWHA 3CW2A 2VHQA 3X1DA 3OFNA 1DAHA 4KBFA 5KOYA 3VR6A 3UG6A 1IJFA 4QJ5A 4B75A 3RSOA 2BKEA 2WZQA 3KKQA 3EG5A 1W2HA 2FDCA 1CJMA 4KFTA 1BO6A 2XOKD 1N6PA 1YE8A 2QORA 3HR8A 1HQCA 2WIAA 1R5NA 1YZUA 3IKJA 3L8YA 2ZI9A 3GJ3A 3OZXA 4BFSA 1OYYA 3SYNA 3EWSA 1SVSA 1X8LA 5JFGA 1DADA 5KSPA 2OT3B 4M21A 1CIPA 3AQ4A 2BBOA 1M1YE 3MFYA 4MRPA 2OSBA 2ZRDA 1D2EA 1ZNWA 4IRUB 4B6EA 2ZXUA 1HH4A 3A1SA 3B9PA 4CZ2A 2XNDD 2P2LA 3P1JA 4ZKDA 2AWNA 5EXTA 5E7MA 3UXMA 4CYMA 1AGPA 4TLCA 4PSKA 721PA 5CK5A 4PXAA 4DDTA 5DHFA 3W34A 4XVUA 5JS7A 3WY9A 3LBIA 3AVOA 3QQ5A 4QNRA 2BC9A 4RD1A 3GJ0A 3T1OA 1RRPA 2WWGA 3P27A 3UATA 3B1WA 5IF9A 2R62A 1SKQA 1KY2A 3CRMA 2IT1A 2OCBA 2W6ID 1JEEA 3PEUA 1N25A 3TMKA 3LXRA 3VHXA 3LXXA 1ZW6A 2CJWB 3V00A 2WICA 2KJQA 4E22A 2YWHA 2ZS7A 1R8QA 2K5UA 1UDWA 2O8CB 1DAEA 3IIKA 2XTNA 3FHTA 4HEJA 5SZKB 3M0EA 5AJXA 5LBIA 2EFDB 3SI7A 1A5TA 1KKLA 3VKWA 1TQDA 4RKEA 3QBTA 1TF7A 5DIFA 4DSNA 1N6OA 1T8UA 2ZETA 3MWYW 4Q9JA 4Q1BA 4Q9KA 2EFEB 1HQYE 1E0KA 1VG8A 1X3SA 2X77A 4JVSB 4TL8A 4TYWA 2OCPA 1F5NA 2R6GA 1HTWA 2PZGA 3U7FB 1AGRA 1W2GA 4MUBA 1IN6A 3EIHA 1XCGB 5IT5A 1E9BA 4TLDA 5E7JA 1BKDR 1NY5A 3ZLJA 1CR4A 4AKEA 1RJ9B 1E9EA 2A3RA 2HLDA 2VPPA 8OHMA 2ZS8A 4XVRA 4N3NA 1IN7A 2ASEA 2BEKA 1GSIA 3B1XA 3U4QA 3QUSA 2HT6A 4XWOA 2BEJA 5FOSA 1KDPA 2OO7A 2V7QD 4Q4LA 1ZRHA 4GL2A 3TAUA 4LRWA 1I2DA 1VCMA 2QTFA 3GLIE 4NCIA 3AF4A 2I4IA 3N2IA 2IYQA 4XIGS 1GZSA 2Q9CA 4JVNA 1E2FA 3FKSA 2ZM5A 4JLJA 2O8FA 3UWOA 4AWXA 1VHLA 1N6IA 2IYYA 3UANA 2NPFA 3DKPA 3GFOA 3FHOA 5JJLA 4Q4AA 3TE6A 1H8ED 5FL7A 4XJXA 1EWRA 3OESA 4B35A 3SYKA 1FNNA 1YZNA 2B8TA 1OKKD 4A8JB 2JLSA 2GNOA 3MSXA 1T6NA 1E2GA 3PG5A 4HDCA 2ZRMA 5H1YA 4OK6A 2DFTA 1P75A 1W0JA 4OJQA 2D74A 1XXHE 4DLRA 2GTPA 1OV4A 2FA9A 3DHWC 3A1UA 4QXAA 1R7RA 1FUUA 2ZJ5A 1NVVQ 1X86B 1IN5A 3WRYC 1LW7A 4DLYA 3ZZUA 3EW9A 2OXRA 3KL4A 5CJPA 2JJ2A 5E3HA 3WP1B 4PPNA 4TTRA 2B6HA 5GJCA 4A9AA 4XTRA 3QSYA 2QAGA 1IY0A 5E7IA 4A2PA 2OE2A 1ZM7A 4Z51A 1DE0A 1US8B 3ADKA 5EXSA 1NSFA 3CBQA 1VYVA 2ZPTX 1OSNA 1WXQA 5AJWA 3EWAA 1E4VA 1F2UA 4DJTA 3P32A 3TUJC 3T34A 3EZFA 4RVCA 4ACAA 4URZR 3QF7A 1DELA 2FE4A 1NLZA 2AX4A 3PITA 1R0WA 2OM2A 4DT1B 4DZZA 3K70C 1KZGB 4OI0A 2LKCA 4QOSA 5BN4A 1ZM9A 4DCSA 1SZPA 4RJLA 4M1KA 1U90A 1KSFX 4WW0A 2F7SA 4BFZA 4OHZA 3SJCA 2YWEA 1UBGA 3KXIA 1A4RA 2P3SA 4LJ6A 2CVHA 3GLHA 4AG6A 2ZUDA 2IYZA 1H8HA 1CU1A 5JS8A 1W48A 1KZ7B 4B2PA 2GEUA 2WBLC 3K9HA 1SGWA 1ZUIA 2Z43A 2ONKA 4KVGA 2IF2A 1TPZA 4FXPA 2BHRA 3KXLA 4TMVA 1EX6A 2VP0A 3KX2A 2QAJA 2KI5A 2IXFA 2OCAA 3NWJA 3VAAA 4D2IA 2BJWA 4Z8YA 4HI0E 4LK2A 1E1QD 3Q85A 4TYQA 1HURA 1IQPA 1N5IA 4IDOA 1P2VA 1N5JA 5HKKD 2VF8A 1T3LA 5FTMA 3GJ7A 4HZUB 1W44A 4C0AC 1KSGA 4LBZA 2J0VA 1S96A 4L4UA 4HLUA 4EDHA 3MG9A 2QBYB 1OHHA 3K53A 4F38A 5CIQA 2HXSA 1S4QA 3BK7A 2WJGA 3M6AA 2W83A 4LOAA 1W4RA 2R6AA 3MRSA 4EIWA 4HDOB 3O47A 4R9UC 2H92A 5SZIA 4A0GA 1HY3A 4B33A 1JJ7A 2G83A 4PFSA 1TF5A 3RNLA 3MJHA 4GBMA 3U3JA 2WHXA 1FTNA 4LHZA 1CRQA 4IKEA 2ODNA 4CEHA 1IOZA 3PENA 4PZZA 3THYB 4W9MC 4KU4A 3K0FB 4A2QA 1GUAA 1E98A 3P4YA 5J4VA 4GOXA 3SZRA 3KTAB 1FTSA 3CWQA 3Q5DA 4FINA 2G1JA 1XX6A 1DAIA 1XEWY 3U7EB 2WWXA 1JAIA 2MSCB 3CPHA 1XEWX 2QQEA 1AS3A 1MOZA 3TVDA 4ZIRA 4WAUA 4LX0A 4IOJA 3UWKA 5FTKA 3C5HA 3UMFA 3D3QA 2FX3A 1N6RA 1NNEA 1OB2A 2QENA 1XMJA 2BDTA 2C9CA 2QE7A 2FU5C 3TW8B 4YMVA 3TGPA 1Q12A 3LY5A 2PCJA 1QDEA 3ZVLA 5KDOA 1S3SA 3CLVA 2ZSBA 2XNSA 3U2QA 2ZIAA 4IVQA 3LW8A 5FPHA 4BLPA 2JIZD 3K9GA 3PV0A 1YQTA 1CJUC 2JDID 3S1AA 4YDSA 1P4SA 5HTKA 3THWB 1IONA 2TMKA 4EQ6A 1E94E 5FFMA 4HLCA 5FL3A 4LC1A 1U0JA 4OHXA 5LB4A 3W6NA 1PVOA 1P3JA 1Z8FA 1WE2A 3PUXA 2KWIA 3I62A 2X2FA 3BAFA 4DB2A 1M8PA 3K9LA 4TZ6A 4M9SA 1AZTA 1YRBA 4BEJA 4PQFA 1SQ5A 4URYR 4C0LA 3CM0A 4KVAA 1GG2A 1EFRD 3CB4A 3SEAA 4Q5IA 2IYVA 4MYTA 1M7BA 2O0JA 3IIMA 3OFND 1KSHA 3T12A 1SXJE 2FSHA 3EXAA 4P4TA 2DWPA 2VLIA 2XOKA 2V6IA 3IPYA 4IFBA 5C1BA 4AKHA 3Q3JB 3RS3A 3MWLA 3K0CA 5EJEA 2IX3A 1OXTA 3CH5A 1L2TA 4NBSA 2JLWA 4PO1A 1PLKA 3WP0A 4RKFA 3RC3A 5BYJA 1J90A 2XB2A 2IF0A 2NO9A 1J8YF 1ZU5A 5EXPA 4TT3A 1JR3A 4IXMA 2JLRA 1P2UA 2IHYA 1KO5A 1KI3A 2PZEA 2VA8A 1TMKA 1N6HA 5BW8A 5J4KA 4UKDA 1YR9A 4URWR 1JPJA 1EXMA 1D9ZA 1Q22A 3C4JA 4R98A 421PA 2P6RA 3BGWA 2F55A 3TNFA 3PEYA 4WZBE 2J9RA 1MT0A 1RYFA 3RS7A 5CK4A 3SNHA 4D25A 2W6IA 2WJHA 3SU8A 1N6KA 2RH5A 1QHHA 3W6PA 4ARZB 1WP9A 3K0AA 4URXR 3GPLA 1OH5A 3K0SA 4KYIB 4W5JA 2V1UA 4LJAA 3J81k 2ORWA 1GIAA 4RD6A 1NMYA 3UG7A 4BECA 4BE7B 2KSQA 5BQ5A 3GLFE 3TRFA 3PUWA 3LNCA 2ZYVX 1I4TD 3V9PA 1Q1EA 4BASA 1CP2A 1E2MA 3H4MA 4RD2A 2P5TB 5L3SB 1D5CA 5L8VA 2YVUA 3P4XA 1NMZA 2OBMA 3KQNA 2YV5A 1E2HA 2VSFA 2O0KA 1Z83A 1UEIA 2D4HA 3TIFA 1DAGA 3IHWA 5DE3A 1U2RA 5EP3A 4BLSA 3KJEA 3L8ZA 3MD0A 2ODBA 4Q4HB 1O3YA 2WAXA 3GLGB 4HLDA 4P4SA 2DPXA 1SVWA 1J7KA 1ZJ6A 3KUCA 3LX5A 1TUIA 4E03A 1J2JA 1UJ2A 3CRVA 3TR0A 2V7QA 2BKUA 4NE2A 5FPSA 1KI2A 1DPFA 3WHLA 1CEEA 1QHXA 2QI9C 1P73A 1FQKA 2BIFA 2ZRAA 1NLYA 1FQJA 4DLUA 1UKYA 5DI9A 5FUVA 2D2EA 3HPRA 2CCKA 4A8JC 4Z1MA 2O8DA 4D26A 4WXPA 4CT5A 4D4LA 3O8BA 1KO8A 4B44A 2JJ8A 1LF0A 4A2WA 3FKSD 5FOVA 4C0QC 1H8EA 1TNDA 2O5VA 4PHHA 5DYGA 1FW6A 5L3VA 4IDPA 4B47A 1C1YA 3CF2A 2PEZA 2GBLA 2QPTA 1GKUB 4GFDA 1E2NA 2QA5A 5FOUA 3G0HA 4M53A 4GP7A 4LJ7A 3IO5A 1OFHA 4A4DA 2VIIA 2QSYA
chains in the Genus database with same CATH superfamily
1JH9A 3A4LA 1ETHA 1ZISA 3DGFC 4YN3A 5IDQA 3T4UA 1CZKA 1WVMA 3A9UA 1TM5E 3BH7A 3IUPA 3CLKA 5G1OA 1DAOA 1JHAA 4KRYA 1GGMA 3BGDA 4I4TA 1KPHA 4I1OA 4KHPB 1EJ0A 2BFPA 2NUAA 4G09A 2VRNA 2TMGA 3OT4A 2BOVA 1Z6XA 5H9VA 3FNEA 1FTGA 1SD5A 2B98A 3GLGE 4HPXB 3BJZA 1WUJS 4IMPA 4RL4A 1GOTA 4WADA 3NTQA 5LQCA 2IVZA 3MRXA 1DLIA 3K9QO 3L79A 2G5GX 1X15A 3TK1A 3PDJA 4DLLA 2HIHA 1O4WA 1M6EX 3TAHA 4ZCRA 1QG2A 4UU8A 4KYUA 4BB5A 2IBTA 1EB9A 2AG8A 4P4UA 5IDWA 5I9LA 4BLRA 2GRUA 4IOMA 2C2MA 2EU8A 3WL7A 4DDWA 5DLPA 1CW2B 1KAQA 4TWJA 3ROTA 2NUTA 4RTLA 4DV5B 2NIPA 1L5HB 3EA4A 4IV0A 3FCSB 3WNQA 1LVUA 1XZGA 2QVBA 1BXGB 4QT4A 4HH4A 4US1R 3QMPA 4XGRA 3X1WA 3RC2A 4Z1OA 1Y4DE 1AGNA 5EUBA 2Y0PA 5JI3E 1GPWB 2UV8A 3F2VA 7YASA 1EK0A 1BX1A 2QUBA 1MX9A 2V8OA 2QQ5A 1D4FA 1ZCFA 3T06B 1H2AS 1VP9A 5TPWA 5IT0A 4GZMA 2VK4A 1X94A 1YSCA 3N8DA 4MW0A 1TJ4A 4C30A 5JXJA 1B4DA 2QQGA 4OYYA 4C2AA 2FR1A 4QZVA 5JY1A 1SCNE 2MSDB 3FIUA 2RGEA 3M6XA 5CM8B 4UDYX 1R8XA 1RBYA 4HUTA 2HX1A 2XZPA 3Q15C 2PNFA 4MS3A 4WKNA 4W9NA 2P27A 1SQ6A 2FWRA 2R8RA 1QV7A 2I87A 3ANNA 4G89A 1M7HA 1U11A 1X8KA 1NUHA 2ZB2A 4N3CA 1Z62A 4QO8A 2KM1A 5SY9A 3OJFA 2XRZA 3THXA 1S1MA 4NK5A 4B6GA 3PHLA 1LBSA 1GHTA 2ZB4A 4HAIA 4J7CA 3WNZA 2QXTA 4UE6A 1JKXA 4U8GA 1YJ8A 1G5TA 4BKUA 2G40A 1Q11A 2ZULA 1ODJA 1ADBA 3UJBA 3ZYZA 3EPKA 1J5EB 2GPAA 2A58A 2HPVA 4AYXA 3H2JA 3ZY4A 4V0ME 3TVTA 1KI6A 2X8JA 1A7UA 1J9GA 2AN1A 1IMOA 3PE6A 3U60B 2PUAA 1R74A 1G0NA 4NZZA 4AMGA 2C5GA 3ZWKA 1VTKA 2B78A 4DR6B 1Q7EA 2EKZA 3CW8X 5KNDH 1CUSA 2BGLA 1XA3A 2VUSA 1FRQA 1F7UA 2P67A 2G9UA 4XRGA 4Y6GB 4EW6A 4KWHA 2NU6A 3GNTA 7REQB 1EE1A 2P1DA 4EYSA 1I8TA 1YFJA 4LF7B 3MCVA 4AYTA 2B4QA 3ACCA 2JHCA 3INYA 4DA7A 4YB8A 3AQIA 3KWLA 2NLOA 4RY9A 3S7TA 3BN3A 4OH7A 1QTIA 2BMJA 2L17A 3FMFA 4YXWD 5GVRA 1OZAA 2Q2QA 4WK4B 2V9CA 1KFJB 4HNSA 1IMJA 2YFYA 3D64A 2PO7A 4LDQA 5FR1A 4AMUA 3UB2A 4B3MB 3LIIA 3Q12A 4PG8A 2G76A 4Z49A 3K9BA 3A3KA 1I24A 2VDWA 2ZIZA 3JQPA 2X5JO 4NZNA 3RK1A 2WKRA 3BRCA 3C4QA 1ZMOA 4LDAA 4MVJH 5LZ4A 3RUCA 4NXMB 4UTOA 3ZCUA 2AW5A 3TDMA 1YHZA 1IQUA 3S2YA 2W4MA 5DLDA 4BVAA 3P19A 1DC8A 4ZV4A 1BHJA 2A7XA 1J1ZA 2CXPA 3BWDD 1RP1A 2HYIC 3RC8A 5KYWA 3OPXA 1OV6A 1YGPA 4HKTA 3CUUA 4ITRC 2EVWX 4CDGA 1IVSA 1Z7BA 2WIDA 4JD5A 2JGKA 1TD9A 3PGMA 1CULC 4OQQA 4DG8A 2OLEA 2HCJB 4U7DA 5ICFA 2OWEA 3HJUA 3NJ8A 2D59A 4EITA 1T2DA 3RF6A 1T4DA 1YJQA 3OSZA 3SLKA 2AGVA 4BP1A 2OMKA 1TT7A 3P0HA 2ZBUA 3O4VA 3WQRA 4CT4B 4DIUA 2JIOA 2FMXA 3DVRX 4LDRA 1FNCA 1G291 2JDIA 2HQ1A 3KUDA 3OPVA 4AY6A 4S24A 2NQ2C 3BERA 3I2HA 3DL0A 4FQ5A 3ELYA 5EL0A 3U13A 3ND8A 2FPPA 4A5OA 1YC5A 4TRNA 4WESB 4ND1A 3QKWA 3WGYA 4PHGA 2CXTA 3T9BA 1KETA 3JQ9C 1A8HA 1DXQA 5MFPA 1EVZA 1J99A 1SNYA 1I1OA 2W6QA 2PT7A 3BTSA 4RTRA 3KBBA 2AQHA 1QYWA 2PSDA 3O5AA 4LHEA 3KZMA 4UE2A 5BO5A 4F8YA 1U98A 3RABA 5HIJA 1H2YA 1SIUA 4RLQA 5C31A 3C45A 3WKBA 1YI8A 1FMJA 4G23A 4G9BA 2ZAMA 2IXBA 1B8PA 3DV2A 4NHOA 1Q1BA 4ISCA 3E23A 5JAUA 1U9CA 2ZM6B 4IDNA 1KNQA 3BORA 4DIBA 6REQA 3DB2A 2RGAA 4CIBA 1YDMA 4YMIA 3W5UA 5IU6A 5FBWB 3DFUA 3KJHA 3G9ZA 3KR1A 3WWPA 3D2CA 2ANCA 3GPDG 4KXFB 5T4BA 3QX9A 3I4FA 5AK4A 2R6JA 3KTOA 5EUCA 3COPA 1W2WB 2DLNA 2FUCA 1NMXA 4MWZA 5HDBB 4BAGA 1JU4A 1JHUA 5ADWA 4X6UA 1T9GR 4HEA6 4JT4A 3O8NA 4Z9FA 4P83A 1YR6A 1M5RA 4YS6A 1E0SA 1JR3D 4OXXA 3R8CA 3RSFA 3SIRA 3N87A 4RY2A 3P20A 1Q6ZA 3C8UA 5CLLA 5IKEA 2I8CA 1ISGA 1B14A 5AQEA 1QG6A 1Y3CE 2HJGA 2NUPB 4O4HF 4M3NA 4P7GA 4FWTA 3I6BA 4MA0A 1MXHA 2ZWAA 4G1FA 4IZOA 5C8ZA 1F48A 1T8PA 2Q1XA 3ABRB 3FDIA 3I58A 3KT0A 2BHLA 2HLPA 1NQWA 2J3HA 4HZIA 3STUA 1KJ9A 1RYEA 3ZHSA 5I7SA 2H1OA 2NU9A 1EDBA 1VFNA 1ZESA 2FV8A 2ZT6A 1S0UA 1TU3A 3FB4A 3GCGA 4UBJA 5I4CA 5HQTA 4P81A 1VIVA 2IYXA 4BMVA 1ODFA 2V7EA 4CLRA 5LNK1 3LFHA 4JR2A 3NT5A 4BNVA 2ET6A 3WYNA 1AA6A 2OG1A 2Q7XA 3E05A 3PHBE 4KGVA 4XPIB 4WCFB 1LEHA 2CNLA 2DHCA 5EQFA 2BTOA 1NC1A 2O1EA 4HAZA 4DARA 4GDFA 3IUJA 3KPVA 4QYTA 1HZJA 1SRQA 2MJLA 3AXSA 3H6KA 4WN9A 5L3RA 4C7MA 2F3UA 2R4TA 3I6QA 3I0NA 4Q18A 4E4RA 3QF4B 1ISSA 1P2GA 3E7XA 3Q8LA 3VHQA 5I9IA 1Z6QA 1PW7A 3AEKB 3WJAA 1U1IA 1Z8DA 5DBOA 1PUJA 2Y9MB 2A9RA 4EY3A 4HFNA 2CDAA 2D5LA 4GF5A 4JX8A 4F21A 2PFSA 3P2IA 1VHTA 4K6GA 2IS4A 2OQIA 4YRZA 2ACKA 4NDNE 2XQKA 4OI2A 1J33A 1C50A 3HU5A 4CV3A 3R3VA 2ESRA 3AOGA 3WAJA 4BTLA 3IJRA 3HVJA 2YY5A 3G9UA 4RWZA 1J56A 1QTRA 2XOXA 4L2IA 4J94A 1P9NA 5IZ4A 3ZDZB 1MABB 3GJZA 4TYMA 4CNBA 2ES4A 4BUCA 3KUKA 4FKBA 5FRDA 1AX9A 2OV3A 4X91A 5DTRA 3Q8XB 4BO2A 4F06A 1MN6A 1ECCA 2Z2YA 4M88A 3K4PA 1BSVA 2J3JA 3NO4A 5LLSA 3TRHA 4DILA 1X1AA 2BI7A 4FFRA 3HRKA 4UOZA 4F72A 2XT6A 1DU4A 4FGZA 2DPGA 4QYIB 2HR1A 2BVNA 4XWAA 1BN7A 3KK0A 4EHAA 3WFJA 4IH4A 4Z86A 2WJVA 3I45A 3KPWA 4BZZA 2I6XA 1P18A 1TKCA 2MINA 3DTNA 4A6PA 1QSGA 5C1DA 2A2ZA 3SPXA 3G0BA 1LPMA 3GGGA 3SR0A 1GVNB 4Y98A 4JB2A 1WAMA 4TKZA 1SVUA 1IPHA 3ONNA 1TB4A 3GQVA 1D09A 3R5XA 1N32B 5ADHA 1VKRA 3UHOA 4QTUB 3CF0A 3KT6A 4J3FA 1E3WB 1V3UA 1U5BA 2R97A 3K70D 1GRVA 3O9ZA 4KQEA 3H2SA 2LKDA 3P0IA 4ZCTA 1JDBC 3M5WA 1G98A 3T7EA 3V4FA 3WDKA 5E1BA 1L7RA 4AKSA 2B8WA 2QSJA 2GXAA 1XTSA 4DDMA 4U7FA 3SR3A 4JA2A 3KOYA 1TCVA 3GZNA 4KB5A 5TQVA 3EPHA 1MOQA 2UVQA 3C74A 1GZ7A 3FLAA 1ZNQO 1PHRA 2XRFA 4P3PA 1X8XA 2JGLA 1ZN2A 2NYVA 3SNKA 3KLNA 4F92B 4CM5A 4F04A 4HXYA 4AFNA 4BWYA 2QUAA 2NU8B 5CB6A 4HDMB 2I91A 3NVDA 4HS9A 4LWQA 1EFTA 5AKYA 1DB3A 4FMDB 1BE6A 1O9HA 3DF7A 3N8GA 4PIVA 3T5MA 1GDHA 1BX3A 3HKBB 2ZBDA 4MPPA 5AUQA 4ZHSA 4E2YA 4KXWA 5GV7A 4O0LA 1PKEA 5AK5A 3TLJA 1K6EA 4H0NA 3UAXA 4ABTA 2OXIA 2PYIA 1FLDA 4PTYA 3X3HA 3R6WA 3FRIA 5K6RA 1ZH6A 3G02A 1DOAA 1Q84A 4JITA 4YJHA 4UPDA 4QFDA 1G63A 3DMTA 2HA2A 2Y77A 1T3SA 1CY7A 4Q1DA 2IW1A 2GCOB 3CVUA 4N7MA 2ABWA 4RM2A 5A03A 1ULUA 3EZYA 3UJ9A 4Q4DA 2FK7A 1XD2B 4JJZA 3VR5D 3BCUA 4ZAXA 2KBFA 3I9LA 1RPZA 1PBNA 3A0RB 3D6FA 3H6GA 3C6QA 1DTEA 4LDZA 4LGMA 4IXWA 2WQ7A 1OASA 1KMCA 1JGTA 4BMYA 1DEHA 5IYZA 4Y9SA 2C99A 4O2LA 4DWVA 1U1GA 3FCOA 3KTAA 3QBVA 4V3CA 4YRFA 2Y68A 3CINA 3ZZTA 4V0OA 3GYGA 2I5PO 3KXKA 1PAUA 2JARA 3REGA 3ZWVA 4NEGA 5JJIA 4KCGA 3UQYS 4IYJA 2WT4A 4MI3A 3O3CA 5KYXB 4URFA 5EP4A 3OZUA 3PVCA 4MKIA 2JBHA 1R10A 4LF8B 3IVGA 2ZUBA 2ZITA 4RZSA 1T8WA 4HB0A 3RSGA 3TW8A 1F38A 4OYRA 3H11B 1M8JA 3FFXA 4TSFA 1V6AA 1Z2NX 1UBKS 3FTCA 1FFHA 2VWHA 4LY6A 2IEYA 1CVRA 3WDLA 4YT5A 1EIWA 3LBAA 1OC2A 3H9CA 5ULLA 1I3CA 1RFGE 3LMKA 2A86A 4KOEC 3V7NA 2QSZA 4CMBA 1M54A 2CL0X 1HEYA 4RHXA 3F8TA 2UVPB 1K2VN 2BE9A 4PLCA 4ADSG 4EOGA 4KPUB 2PMWB 5ESDA 5ESRA 4MCJA 3ZHTA 1YRAA 3B3AA 4XYGA 2QTGA 5DSZA 3GD5A 1PWZA 2JFVA 5ILGA 1E9VA 1M5UA 2GILA 2L69A 1QYXA 2PY6A 4Q6WA 1AZLA 5CYOA 1JPVA 3OOSA 5AKLA 3RR2A 4GRDA 5HF6A 4MEJA 3R4CA 3VOTA 1JEJA 4DAOA 1SHTX 1CUUA 1R15A 4DMLA 2XNJA 2DCUA 5IK2D 4RF3A 3KQKA 2YWXA 5TC4A 5CA0B 4KH0A 5CFMA 4MRRA 1S3FA 5CITA 2ORVA 1G5RA 4H7FA 4JJIA 2QVGA 1E0AA 3KWMA 2JH3A 5LA6F 3GA7A 1C14A 3CJTA 1U3WA 4QUIA 4QOGA 5BWCA 1KRWA 1M6NA 2HPZA 1TIKA 2W37A 3EQ6A 3E2IA 4YH1A 5BUQA 1K7EB 1AKWA 1RHJA 1W6RA 2FMKA 3MWGA 4C7JA 4ZI7A 2YJ3A 3BTVA 4QJIA 2DC1A 1N5RA 1SXJB 3HJFA 2J1LA 3GU3A 4N7RA 1JJVA 1Y80A 2AA3A 2FOIA 3ICPA 3KHKA 3OTGA 4H15A 1IZ8A 2ISQA 2PPVA 2RHTA 1PT9A 2QL7A 4NU8X 4CMAA 4ZTBA 4DG9A 1CYDA 4GI1A 2IBMA 5F7OA 2ZREA 5JAPA 3JWGA 1VOTA 3OEWA 5CDTA 4E7PA 4HP8A 1RRCA 4A1FA 1DS6A 1Z08A 1UMCB 1MU0A 1ZOOA 3IV7A 4K9SA 3SIPA 4JGGA 4KEAA 4QU9A 4EO7A 1AXRA 1Z6TA 2QMHA 2X0RA 2XZLA 4BMZA 3V4VB 2X1MA 2GD0A 1UKAA 3L9XA 1J0CA 1NPDA 1K88A 4BGIA 3JD4A 4DGQA 5AUOB 3AVXA 2EGUA 1FOEB 4LPKA 4QUAA 4RTQA 1VLHA 3M4XA 1LU9A 5GY7A 1IJBA 2FW0A 2FGJA 1IXKA 3A14A 4X95A 3QX3A 3R8XA 2NU7B 4WZBB 4MDYA 5HFNA 3NH6A 3O93A 5HKBA 2O8EA 1UPXA 1Y82A 5FWYB 4FI3C 1WEHA 4YBZA 3AR4A 3PYXA 3E8XA 1ZBDA 1TCAA 1X8JA 1A82A 2WYUA 4B3DA 1HA3A 2JA1A 2VBCA 4B3JA 4CCWA 4L16A 1PS9A 2FTKE 4YO8A 1C3EA 1WMEA 2H4XA 3O75A 3Q4GA 3SEFA 3VC3A 4TZ0A 4OHVA 3VKFA 1EDDA 3BMOA 1LSOA 3KEMA 1XT6A 1NW8A 4ZCIA 3ZWPA 1I4OA 3TEMA 1WY7A 4LVCA 4Q24A 4EPYA 1H65A 1W36B 1N78A 1V9CA 2WTXA 3GLFB 1I5RA 5A1TA 3ONWA 1F2TA 1HRDA 2E85A 5GZ3A 4HADA 4YIHA 2ZATA 5DXJA 1UL1X 2BSAA 2OECA 2XMCA 1PR5A 2Q8PA 1N3IA 3QG1A 1CD5A 1CLUA 1JSZA 1V9SA 4R2HA 4RA9A 1OFTA 1OZGA 1OILA 2DFKB 2O3SA 1KE1A 4DMMA 2B69A 5BV8A 5BMOA 1H22A 2P11A 1MRNA 2IUFA 1H0KA 1SK9A 2P9ZA 4Q4HA 4WACA 4RC9A 3NFYA 2H16A 3CZCA 1MDFA 1D0VA 2VZ8A 4GXRA 2V7GA 4LV8B 4DNOA 3PEWA 2V5AA 3ISVA 3VU0A 4GOKA 3C3JA 1ODIA 3QOFA 4JLKA 2G9RA 4FZVA 2IXAA 5SYNA 4GMGA 1CFZA 3UMMA 4F1WA 1H2RS 4JYPA 2GPSA 3C4VA 1NU6A 5JDIA 2BSQA 4CU5A 3PJDA 4CW7A 2WKSA 5EZ5A 3BIFA 1P1RA 3EDMA 4OBEA 3EQ8A 1KYIA 3OQJA 4YAJA 3UK2A 2E87A 2PBRA 2GA9A 3BMQA 4OJTA 3C8DA 3H1BA 5EQDA 3GH3A 2HU8A 4C22A 2C04A 4XJTA 3LL4A 4FOTA 4JP1A 3DE4X 1WDTA 4M76B 3ZCRA 3WRWA 1PG2A 5DO9A 4AF7A 1BE0A 1WB6A 4P5EA 1AIPA 4KAAA 2HJSA 2A5GA 4M9ZA 4E5VA 3GRKA 3F9RA 3H8SA 3VKGA 4Q37A 4HNQA 2PKWA 3SM3A 4UZSA 2P0YA 2QGFA 4XJVA 5LKAA 3K4QA 3EFOB 4FFDA 4RJJA 3MRVA 1UBCA 4MDHA 1Q17A 4JUAA 4FMBB 1YHNA 1K3FA 4N5DA 1UWVA 2WJPA 1XVAA 5F52A 3B7WA 1K7YA 3UWMA 1BS1A 4UOQA 4ER3A 2MSWA 5KYYA 3HUFA 3AW9A 2X7XA 1XTVA 2ZCJA 1MVLA 2NXCA 2V7BA 4PGGA 4P7FA 4NKRA 2Z8YM 2IOFA 2OPBA 1ZD3A 5AKEA 2IPAB 2Z9BA 5KNBD 3C5CA 4MYHA 3K05A 3UHPA 5I3CA 2DLCX 1VDZA 4P0TA 3H5LA 1ZOLA 4BB6A 4BBZA 3V2HA 3TBHA 1HZZC 2D7CA 2RHOA 3L9WA 4PPQA 3HACA 3SK0A 2RBKA 5C8XA 1GAEO 1TMYA 3H5WA 4I4IA 3SHWA 1BWSA 2FP4B 2Y05A 3EBOA 4YV0A 5C1OA 2B5WA 4PRZA 1QE0A 3CONA 2WPNA 2X0FA 3IBYA 4RPCA 4DSZA 1WEKA 3W4IA 2QNIA 4Y3UA 5CVEA 4DLVA 1DQRA 4DQ0A 1L5HA 2HT1A 1BW9B 1QHFA 2G8NA 2CK3A 2X0KA 3O91A 1BXGA 3PE3A 4GZ5A 4PNPA 1PTJA 2AFHB 2CFIA 3KPJA 3BRWD 3JQFA 5IBPA 5HCUA 3IELA 3PFBA 3ICQB 4HXFB 4UCFA 2XB8A 2P9YA 5C51B 1RS0A 1N1GA 3BXPA 5FBQB 4GGOA 3IUMA 2AC7A 3UQZA 1I14A 2E37A 3OMWA 3V2GA 2HU5A 2I33A 1EBUA 1XAGA 3ISJA 3PQ8A 2YV3A 1C9KA 3DL2A 1COZA 2ZB8A 4LXTA 3WL8A 4WJLA 5AWFC 5TNXA 5LJIA 2R4QA 1OIWA 4N6NA 1CP3A 1W87A 3EDOA 4TWZA 2FXIA 3ZGNA 1Y48E 1NW6A 2OCKA 4FILA 2E4WA 3VR6H 4QX6A 4LK3A 1WXIA 2YWCA 4N01A 3PC3A 1DCMA 4QARA 5IFKA 2FR8A 2JVKA 2ZSDA 3Q9UA 4TN1A 2W5UA 5GJVC 3ZWWA 5C5CA 4H77A 2YCLA 4IQFA 1XTBA 1VQ1A 3THRA 2Q5EA 4JBWA 3VSBA 4IQ0A 2ODAA 4PC6A 4GPEA 1KMQA 2HPAA 3FF1A 1R6TA 2GHRA 1KYWA 4LTMA 2VRCD 3Q98A 5KNCA 1KP3A 2WPDA 1FYWA 1HUQA 1NZJA 1R8SA 4GKVA 1WSWA 4OD0A 3EPJA 3ABOB 3EIXA 2XYQA 2CJYA 4DQLA 3CN9A 3OA2A 4QM7A 1LV8A 2YWFA 1NQTA 1OBVA 2C20A 1T9KA 1T24A 3GO4A 5ITWA 2CY0A 3IMFA 2B2NA 4FB4A 3E9NA 1CRPA 1I4LD 3DCYA 3OX3A 1U8ZA 1DBVO 3L84A 7REQA 1DSSG 3FNRA 3WK6A 1ST2A 4WNYA 3GNSA 1EKXA 5LCXA 4AECA 5CM9C 4D81A 2NVUA 3IR6A 4C0HA 4R9VA 4RVOA 2NGRA 5E6RB 5KC8A 1JG4A 2ROQA 1MCZA 2OESA 2VNKA 2PG3A 3L07A 2VAVA 3FMIA 4K6KA 1JFRA 4JL6A 4Y9TA 3RYIB 4EYQA 1UBOS 1GQFA 4LJLA 4Q7KA 1LDNA 3HSKA 5FEUA 1M0EA 4A0FA 4HAYA 1I2BA 3BGVA 4G6ZA 4ENRA 1DAFA 1BFUA 2J6HA 3E3LA 1VA4A 1L4GA 3S6JA 3OZTA 1QCYA 4DIFA 4MP3A 3EXHB 3EN0A 5ALSA 3DV0B 4ZVTA 1YB1A 2P0AA 3WHKA 3ER9A 4BLOA 4D4GA 1RKQA 4BIIA 1GL3A 4M1TA 3RKUA 1S89A 2WWWA 3EPRA 2JB9A 3EH1A 2FPWA 1O97D 4J9UE 4RZ2A 3EMBA 2AWOA 2V9PA 3CNNA 4ON9A 3SDSA 5A3QA 4HNTA 3DBRB 3GGSA 3HYSA 2A0KA 2YN0A 3BXHA 1S9DA 1QHGA 2HSDA 2O8DB 4TPKA 3O3NB 4BUZA 5EUMA 1CKEA 1G7SA 1E32A 2P65A 3V1TC 3TJZA 5MN4A 1GKYA 1ACMA 4UOEA 4PFQA 4FFBB 2WJYA 2W9XA 3DDSA 4G5SA 5BR4A 1E96A 1ZD2P 1SBQA 1QHYA 3DZFA 5EIWA 621PA 3Q5EA 4L74A 2JCBA 1OPRA 2Z1MA 3K1YA 5ADUS 4BNTA 1Z4MA 3OIGA 1N0UA 3HQ4O 3RE1A 3I83A 2V96A 3GL9A 3O73A 3RVQA 1H2ZA 3VR4D 1RQ7A 4AUKA 4EA7A 3VNVA 2O57A 4F2DA 4WESA 3MT8A 1M1ZA 2I54A 3VPDA 4D82A 4ENTA 1DOHA 2CDBA 2H8GA 3HXTA 4RVDA 5J2UB 2RIPA 3LV8A 2AOXA 2QAGC 2C3UA 4RFSB 1G41A 2EJBA 1OW3B 5HE9A 2VAWA 3ET4A 5YASA 1Y9DA 1LLDA 3HV2A 2BMVA 2L82A 2W43A 4GD3Q 5BT9A 1IAVA 2DPMA 1W47A 4YMTA 2W2PA 3FWHA 3I6MA 4KFSA 1WCXA 1CHNA 1SAYA 4Z99A 3IPCA 4P3OA 3J7AC 3EOZA 1JSCA 4KTVE 2A4KA 3JSAA 2HDHA 5EPUA 3UXYA 4OOEA 2GESA 3OOJA 4TTPA 1UWKA 3ID6C 3LDFA 3O92A 4OPMA 2ZUEA 1TX4B 3CE6A 4YUZA 4RLHA 5DCLA 4MYCA 2DFNA 2XQFA 3WMFA 1GU1A 1U0FA 4IIGA 3IA7A 3V8QA 1FEZA 2R3SA 3X44A 4B85A 3EF3A 2OZKA 4YP0A 4PZYA 1E7QA 1WB5A 4C4YA 4QOFA 4JOBA 1M34B 2NZ8A 3BCSA 3FOBA 3IVAA 4J1TA 4X5OA 4KDEA 1DWQA 5ERYA 3COYA 1GV1A 1W1IA 2RG7A 4PZ0A 1M5TA 4BRSA 4E5UA 5EJ6A 3AU8A 4EENA 4DY6A 4Z2YA 3JR7A 5E9QA 2VBGA 4MYDA 4DLZA 3KU1A 4OUDA 5BSGA 2PYDA 3SXPA 4YALA 4E70A 1PWHA 3Q9NA 3FCAA 1U7ZA 4Y2YA 3LWBA 2M98A 1EWKA 3LPAA 4F91B 1BKYA 1IVNA 4CCSA 3CLSD 3TMYA 2PN1A 3M3DA 4DCPA 3DTVB 4D80A 1IZZA 1NW3A 3A6KA 2RHDA 4P1ZA 5LWHA 2C7QA 1GRNA 2F1OA 5C7IO 4B71A 2W11A 3H7AA 4U5XA 4MZDA 1Y7TA 2ATIA 3I05A 3ODGA 1X3LA 3NYWA 3ON5A 4QTZA 3GVHA 2OZLB 4D02A 2Z6QA 2PKCA 5CW2A 1UJ6A 1RAHA 4XPIA 1UWLA 2PMKA 4ID9A 4WCFA 1O03A 3GGJA 4BZPA 3EEBA 4MW6A 4MKGA 4RHTA 4RXMA 1G1AA 2W6CX 3QVWA 5ALKA 1KK0A 2C2HA 3IIJA 4MLPA 3QF4A 4ZYZA 1FFYA 1Y33E 4CEJB 4C0KA 4GX2A 1IBLB 3C97A 1J7JA 3EGIA 3BWMA 4ISBA 1HQDA 4JSTA 1DL5A 1P2TA 4DUGA 3MN1A 2G8LA 3AVTA 1E79D 1LWOA 4FCCA 4KE6A 3VYRB 1I6LA 2X19A 3IB3A 3M1YA 3TDKA 1J0EA 4B2YA 3HVKA 2V65A 4QDTA 3QEJA 4QODA 2Y8EA 4OFBA 4R1LA 4WA8A 3OVMA 1CQIA 1XI2A 2VG8A 4R1PA 1NVDA 2FN8A 4F5YA 4C6HA 1DWPA 2Q8NA 3FHCB 4QDOA 3QLVC 5ICCA 2PGXA 3LPNA 5BQPA 1R4AA 2WFMA 3FYUC 1UKCA 3W9YA 1RMQA 2FQ1A 1ISPA 2HGZA 1CUBA 3O8OB 4JELA 4BVBA 2IUTA 3EISA 5F35A 3VNBA 3ZVKA 2IH2A 4NYIQ 3EYAA 1IATA 4P8RA 4FXOA 3PXGA 5HVNA 4B3FX 1L7EA 4UHCA 3C15C 4GP6A 4D8VA 2IS2A 1LBEA 1O0CA 2AI2A 4AXBA 1QBGA 2B7CA 1CC1S 1GP2A 5I7OA 3QKTA 2J59A 2R5FA 2ZJ3A 5EVJA 1OYWA 1J8FA 1BEUB 2IEIA 3DCIA 4ND8A 4UNQA 1Z6PA 1RC8A 3IUYA 3QVMA 2VNHA 1QFMA 4BXOB 2UXDB 1AKYA 3G2QA 5EXEA 4AKTA 2R1ZA 1KHTA 2JC3A 3PD1A 4HEQA 2WTUA 5CVJA 1DC7A 2JBAB 4M1QA 1SKYE 2VZLA 2AYZA 4MI6A 4Z8XA 3TRKA 3AJ8A 4BEBA 2V3WA 5HQ3A 2GO7A 3B2NA 4H18A 4LMBA 3R76A 5JO0A 4EHKA 4BLUA 3G7NA 4NYMR 3N76A 2M6LA 4BX8A 1MB3A 3DWGA 3NZEA 2X0EA 1E3WA 1Z5PA 4QA9A 3U0VA 3HEMA 3PDIB 1C80A 1G5IA 1NFRA 3QFHA 5AD1A 2JG3A 3TLEA 2VO1A 1IBSA 1GD1O 2CZGA 3EGEA 2WTEA 3IESA 1XNJA 4G0XA 1KAGA 2XGMA 1FUYB 4QHSA 1BHQ1 2WTNA 5LXTF 2WSIA 2ERYA 1P91A 2PANA 3H5OA 4C4RA 3RIGA 3PVSA 1KZ6A 1XTRA 1Z39A 5G4KB 5ED0A 3ZI0A 5EWLB 5T7BA 4OYLA 3HHPA 3KR2A 2C2GA 2RSLA 3CX3A 3B3FA 3II6X 3GVCA 1B8VA 2BKLA 2H4ZA 3I30X 4F56A 1KK1A 2WK1A 3NHSA 1QNLA 2A9KA 6GPBA 3SCZA 5JC8A 2R7KA 2X3FA 3I92A 1E1LA 4UFNA 3GEPA 3SHTA 2EBWA 1IZ7A 3ECSA 4LRXA 4YGYA 1MAAA 4RULA 4PE5B 5SZJA 4QUBA 3JVIA 1YJBA 1E66A 1V3QE 1QHNA 1E61A 1K63A 3ZU6A 3NHUA 1Z6GA 2PUCA 1G9TA 2GK3A 4NX2A 2GPBA 3WMRA 3CV3A 1NOKA 3EIEA 1KY3A 1RCFA 4I5FA 3VR3D 3BGSA 2EDAA 5IBQA 3UUGA 2F1KA 4M2LA 5DN6A 4IMRA 2BEUB 2YFQA 2ZR9A 3T1VA 1V25A 1FDIA 3QLUC 1GAJA 5DISB 4H7DA 5EJMA 1I01A 4Y2JA 2RAPA 3OQPA 2GCOA 3JYNA 3VO1A 2YJNA 3MWFA 1ZWLA 2GEVA 2C4HA 1JZTA 4C2TA 2VPQA 1XD2A 1GQQA 1HOTA 1AH2A 1F6DA 4HRXA 2PS0A 4G97A 1KI8A 4JC4A 5AJUA 4CKYA 1MH9A 2R2GA 2ZBQA 3EOAI 4NOLA 4JLMA 3PWSA 2H65A 1Z4IA 2ZKIA 1W75A 3W2EA 4R9SA 1O6GA 3HWSA 2VHUA 4PZPA 5JCZA 2RH9B 2C7OA 2EQBA 3T7TA 2AB0A 3IGFA 4MV4A 4P92A 5FPPA 2IYLD 2JANA 4XQ0A 1BMTA 3CLRC 1Z75A 3TZEA 5KHLB 2GB4A 1YBAA 1SC3A 3OZRA 3W5IA 4PV7A 3V4ZA 2E82A 5IBRA 3FOAA 2KS6A 2I6FA 3T1NA 4EVIA 3HFSA 1VJDA 5EKTA 5KYXA 3UPUA 3DLTA 4NJMA 3SJUA 4EJFA 2FZLA 2VTBB 3GGCA 2F1HA 1P44A 4Q3BA 3VNQA 3I1JA 3D6MA 3U40A 3FCCA 2YS7A 1AQJA 2FZCA 4JI4B 2VDVE 1KORA 2EGGA 3KKEA 3H11A 5LIPA 2CVFA 3IEXA 4LIPD 1AK1A 2ASVA 1GTZA 2J3MA 2WNIA 3ZQ4A 1JYFA 2PLFA 3AUXA 2SKEA 2WM2A 3ZVMA 1KJ8A 4FDAA 1ZAYA 2FPKA 4M9XA 3ZCTA 3WICA 5JAMA 2H2FA 4GLLA 1BAPA 2NZ2A 4KXNA 3SD7A 5G0VA 3WMEA 2B0CA 2WUVA 4XWTA 3U3ZA 4R71A 2WKPA 4BBAA 4UXHA 4QGAA 3PKJA 1J1IA 4LMRA 3A1CA 4KPUA 5HG0A 3SSMA 3JYOA 2EXXA 1ILEA 3BWCA 3P8ZA 2Q3FA 1F6BA 2VRBA 2W4QA 4UHFA 1LWNA 1WP4A 1YB6A 2XZTA 3IYLW 3NXSA 1KQNA 3SKVA 1H5QA 2B4YA 1KDVA 5TMPA 3DUWA 3GDWA 5BUZA 2GCPA 3VYUB 4EI9A 4FB5A 2D7DA 4ZZIA 2IHZA 3QFRA 2CB9A 4E0BA 4LHXA 3H84A 5A4IS 1UC9A 3CH7A 3MHPA 1C1DB 2GHIA 4ZCLA 2GM4A 1E2DA 2UYQA 3SF8A 3CX6A 4PAWA 1QDUA 3EC1A 3IPRA 3KQSA 5ALNA 1DBWA 3AM1A 5ER9A 1NVGA 4JYCA 4XB2A 3QPDA 4DVGA 2I99A 1USWA 3GAZA 2B3TA 5FBVB 4O0MA 1Q20A 5FI0B 3HO1A 1DQPA 2GKGA 1JG1A 2CHUA 3TSAA 1DX4A 5FNZA 1D5WA 1NE7A 1SXJA 4C78A 1RAGA 3RGWS 4G0PA 4X8HA 5HIMA 2Z6UA 1BD3A 2QV0A 4JASB 4YRAA 3ENKA 3VYVA 1O2DA 1T0PA 2C3YA 5EWJB 4BFUA 1EVKA 2GBLC 3U3RA 1E62A 2N3ZA 4J0QA 5KUTA 4LWZA 1UMCA 2IV3A 5ARBA 3NKLA 1L8XA 3FOFC 3FWZA 1E99A 1SUIA 2WHEA 1V43A 4CETA 3LPMA 1PYOA 2NO1A 3GFVA 3F6PA 1SHUX 4Y7DA 1XYYA 5CR9A 2VCEA 3DW1X 1X1RA 1TO1E 4PLZA 4EUNA 3KL2A 3DZ8A 4I81A 1LK5A 2QN7A 5CB4F 5FAKA 4JQYA 4I55F 4WI1A 3TZLA 4BV9A 4KXYA 4EMSA 3PXUA 3NH9A 1K8YB 2QRHA 3SICE 3BREA 3WGKA 3G89A 1B1AA 1QHEA 1S8OA 3GBPA 4CKBB 4QJ3A 1AKMA 3LD9A 5B58C 1M2JA 4WZBA 3AUYA 1X7WA 1JA1A 2X6QA 2C59A 2BISA 3NASA 2WHYA 3QXGA 3NDJA 4ZCQA 1PK8A 1W4AA 1NM5A 3OD5A 5FWYA 5AVVA 2FH5B 2MDTA 4EVQA 3KP1A 1EZZA 4J2OA 3TNDA 4Z3OA 3LC2O 4TXMA 4KLZA 4X20A 3ZQJA 1KFKB 2C8KA 5FLEX 1CUYA 1NI4B 3CT6A 3VH1A 1CR1A 3E8MA 3I32A 1JRLA 3KFXA 4HF7A 4NBUA 1R37A 1ZY2A 4FBMA 4RSGA 4RZXA 2G17A 4EZBA 4TMKA 4EA6A 5LU8A 1VECA 2WM9B 3UK0A 3W3AD 1MG5A 3T7SA 2W6JA 3HU3A 4MR7B 4WNIA 3GLFA 1UIMA 3ED5A 5ALUA 1C3XA 2ZJAA 4MHTA 2G1PA 2NZJA 1N9ZA 4PO8A 4QD3A 5FUYA 2J6IA 3GRVA 1RAAA 5GINE 2GKSA 4JQOA 3HADA 4MW2A 5HJ2A 3VRHA 1ONPA 2IHVA 1NVUQ 4RSMA 3UXHA 2A78A 3GJSA 2PD3A 2VQ3A 3G23A 2C61A 3AVPA 3A9WA 1EMDA 1XRPA 3MMXA 3NHRA 3UMYA 2GVZC 2P6MA 5DTQA 3ROXA 2VSXA 1ULSA 2Z1NA 1IM8A 1IBCA 3O9MA 2PWPA 4OF4A 5IBCA 4BPBA 1IC6A 2HWYA 2PZ8A 3PQEA 2AI1A 5JJCA 3DMDA 3HR4A 1LH0A 4DVJA 2CEAA 4LE0A 2EZUA 2RI1A 2Q0QA 4O4JF 5TJ9A 5CFOA 2WWHA 4PTLA 3WZ2A 4TTTS 4BN5A 5CH5A 4HYQA 1OWLA 4GMXA 4O4LF 3G85A 3ROZA 1PZFA 4DCTA 2DR3A 2FUG1 1CF4A 1PFWA 2J08A 3IDSA 2E89A 3MLBA 3ZEAA 4IQ8A 1DV1A 4DYVA 4PQYA 5DBFA 4E5KA 2FWMX 1XU9A 3PDWA 2GDJA 4QQRA 3U39A 1RMYA 1XZDA 3G2PA 3WWEA 4BVFA 1ACLA 3ZJVA 1C9DB 1A9PA 3HLKA 1TA9A 1CJVC 1T4CB 4I9UA 5FI3A 1TQ2A 1GPJA 2G6BA 1UM9A 1D4ZA 3KKKA 4E32A 3M2TA 1BS2A 3FW1A 3UYKA 4EPWA 2GARA 4YAIA 2IHTA 5JH7F 3OLQA 1G7RA 1OBOA 3EFOA 2RGGA 2AN9A 3HS3A 3S40A