4Q1BA

Human dck c4s-s74e mutant in complex with udp and the inhibitor 7 {n-(2-(3-(4-(((4,6-diaminopyrimidin-2-yl)thio)methyl)-5-propylthiazol-2-yl)phenoxy)ethyl)methanesulfonamide}
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
241
structure length
229
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Deoxycytidine kinase
publication title Structure-guided development of deoxycytidine kinase inhibitors with nanomolar affinity and improved metabolic stability.
pubmed doi rcsb
source organism Homo sapiens
total genus 76
structure length 229
sequence length 241
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2014-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4q1bA00
1NKTA 3LY5A 1ESNA 3HU1A 5TXGA 3FMFA 2W2TA 1SXJC 1DAEA 2ZJOA 2O5VA 1US8A 2WWYA 2XOKD 3PEYA 4DSOA 1OIXA 4AG6A 1OYYA 1DAKA 1NJGA 1LTQA 1P6XA 3D31A 2IHYA 2ZR0A 5EP3A 3UMFA 1U8ZA 3B1VA 5FTKA 3BC1A 4UNSA 5E95A 2G9NA 4DIDA 1E6CA 2V4ZA 4BEBA 2GJAA 3B1YA 2VO1A 4NCJA 5KNDA 3KQHA 1BIFA 1R0WA 1HUQA 1JR6A 1W36C 1T5IA 3VQTA 3ZZ0A 3GLIE 3KXLA 4ZCLA 4RCZA 4A2QA 4BEJA 3GLGB 4NYMR 1IAQA 2ZVQX 4JS0A 5CM9C 1NJFA 4U7DA 2FN4A 1MRNA 1VPLA 3C16C 2J7KA 2OO7A 4B43A 4XOIA 2ZRCA 1SKYB 2FSHA 1XPRA 2ZI5A 4CEJB 1ZD9A 2VHJA 5DN6D 1FTNA 3B8HA 3KDSE 4D4JA 3THXA 2FE4A 3U7EB 2IS1A 1W48A 2VF8A 3CPEA 3UMSA 3GCGA 1YZQA 1DAFA 5G3ZA 4ZKDA 2P67A 3L0IB 3ZS8A 4JLKA 4G5GA 1FQKA 3FB4A 1B23P 3WHKA 1ZM2A 3C15C 3RHFA 2P6RA 1A5TA 4KAXA 2HLDD 3GLHE 1E1RA 1XXHB 1CLUA 5GJWC 4CT4B 4O2RA 4A4DA 1TADA 1IN7A 2OILA 4HB0A 2C98A 3PXGA 4GOXA 3ASZA 3K9GA 4DZZA 2JA1A 3BBPA 2FFHA 4PHFA 4TT3A 3R9XA 2C9CA 2ZJYA 2ZRNA 2A5YB 3IBYA 2JJ1D 4NYJR 3ZDQA 4GRAA 5K8UA 2VTKA 221PA 3QJYA 2WICA 2C2HA 1LS6A 3EZ7A 1I2DA 3ZYCA 3QSYA 2A5FA 2ONKA 1TEVA 4GT1A 4IEEA 1NP6A 3NVAA 4DDVA 1IN8A 4CVNA 4UQOA 2ZE7A 1NIJA 4JLJA 1JR3A 4L15A 1YJ5A 5AR1A 4LUCA 3UIEA 4HAUA 4KLNA 1KZGB 1ZMXA 2YOHA 2YOGA 1GVNB 2QMHA 2V1XA 3M4YA 4DDTA 1DG3A 1K5DA 5A5GA 3QPWA 1XJCA 1K8RA 2ECKA 1WRBA 5JSZB 1ZIOA 3QG5A 1TQ6A 4M1TA 3T1OA 2ZM5A 2F3TA 3EZFA 1R7RA 2PBRA 3P20A 1KI6B 2ORVA 1Z06A 1CR4A 1Z2CA 3KL4A 4D6PA 5KYKA 5EUQB 1Q57A 2GZDA 1AK2A 5IHPA 4PAQA 1EK0A 2P3SA 4RZUA 1UKZA 2CCGA 3IHWA 3NBXX 4RD4A 4D4KA 3AP2A 1ZCAA 4PC3A 2IW3A 3WYGA 2MMCA 1UM8A 2FFAA 4ON9A 4AKIA 3W3AA 2J7PA 2KB0A 3SQXA 4LC0A 1NL3A 2A5JA 2CL0X 1I4TD 1AGPA 2J0QA 4US2R 4LV6A 1XTJA 5B2ZA 5EUMA 3W8RA 2J0VA 4HZIA 2D06A 4IFBA 2P5SA 4DIEA 5EE0A 5JRJA 4TMTA 1OFIA 5CLQA 1MO5A 4OQNA 1CXZA 2ZJZA 1F5NA 4M1OA 5FL3A 3ZD6A 4CT5A 1T91A 5BXQC 5JLJA 1JJVA 3PV0A 1RPZA 2IHBA 4Q4LA 4JVMA 2L0XA 4MRPA 2VEDA 1UEJA 3GLGE 2W6JA 2DBYA 2ZYWX 3QXHA 3VR5A 4XTCS 5DH9A 1S2MA 3ZZTA 1EWRA 2R9VA 4MDEA 1ZNZA 4GMXA 1AS0A 3PJRA 4KYUA 1C1YA 1FNMA 1S9DA 3A4LA 3L0PA 3NHAA 5L3RA 3FHOA 3MMPA 3THYB 2ZS7A 1U8YA 4BLTA 2HDNB 2J0UA 4Q7LA 1E1RD 2GVDC 1ZM7A 3KUCA 1V5WA 4O25A 2XITA 4XJXA 3C7KA 2X1VA 3U3MA 1US8B 1XXHE 2BIFA 3K53A 4EQ6A 1D2EA 3CB4A 4EKDA 1UJ2A 3DKVA 3H84A 2MMGA 4II7A 4G3XA 1WQ1R 3DL0A 2NO6A 1OFHA 2ATVA 1GP2A 1NLZA 2W2VA 2OBMA 5DE3A 2IYUA 1VMAA 5F9FA 4CRWB 2WWGA 2VIIA 1R0ZA 1I4LD 1P2UA 2ASEA 2PX0A 3ASYA 3C41J 4QL3A 3BWDD 4XD7A 1UADA 1XPUA 1SVWA 3GP8A 1CS4C 3FGNA 2XXAA 1R10A 1JR3D 2AWNA 3U2QA 4I81A 4PZZA 5JWOA 2QP3A 3CRVA 4P4UA 1Z0FA 4JIMA 2C04A 4DJTA 5EXSA 4EJSC 3I8SA 1PV4A 2JLVA 3K0EA 1E2HA 4E07A 3K09C 1QVAA 2A3RA 1E94E 3TNFA 2OAP1 2R65A 2WZQA 3VFDA 2I1VB 3B1XA 4QBFA 3THXB 2IYSA 5JHGB 1YRAA 1NVWQ 3NHBA 4MRVA 3VMFA 1LB1B 2QMEA 3WBKA 1OFTA 2WMNB 2J59A 4BWYA 4LYJA 4IOKA 4B2IA 2HUPA 3L43A 2GF9A 3KXKA 1YE8A 2ZUDA 3RRMA 2B7CA 4Q01A 3RS4A 1VCOA 3GFTA 2C8VA 2Q9AA 2J7PD 2JAQA 4HAYA 2B7BA 4PXAA 3W6OA 4O0MA 1FL9A 1SXJA 2DR3A 4AKGA 2IS6A 2G0NA 4LYFA 1VCIA 1UBFA 2PMDA 1FMJA 2ZRAA 4Q1CA 4D81A 1UAAA 3MWYW 3ZQ6A 5CB8A 4RKFA 4EDHA 2BCJQ 2H5EA 1ZM9A 1F2TA 4WIAA 5JZVA 1KY3A 2VBCA 3X1YA 4PC6A 3D6TB 4TTQA 4HAZA 1P72A 2VF7A 3GLFA 3VR2A 1NY6A 2HYIC 2O8CA 1OB2A 2OV2A 2W6JD 3CLVA 4KODA 1GL9B 2H8KA 4X8MA 3C8UA 4D4MA 1FW6A 4OQXA 4WZAE 5FI1B 2Q3MA 4KXFB 3SJAA 3CIOA 1VHTA 5IK2A 4HDQB 1E9FA 2FWRA 3R7WA 4F4CA 3WHLA 4GFDA 3T35A 1S9HA 3R8FA 2GXUA 4IDOA 1XTRA 5HE8A 1A1VA 4HYYA 4B6EA 1CBUA 3ZVNA 3HR8A 4QBHA 4URUR 1KO5A 1XRJA 1KMQA 3DO6A 4G5SA 3B60A 3AV0B 4Q4HA 2NO1A 1OH6A 1R5OA 2AXPA 4Q00A 3Q3JB 1E99A 2C03A 3Q8XB 2V6JA 1VCNA 2G1JA 4F92B 3WNDA 2PLRA 4DXAA 3NXSA 3SQWA 1PJRA 2BEJA 2H17A 1KDPA 3BFXA 3AQ4A 3CZPA 2UVQA 5G53C 5IRCD 1KSHA 4IDHA 3LXXA 2IYLD 1KMHA 2RH5A 3FYHA 2GXQA 3AB3A 3FFAA 1A4RA 2QSZA 5F9HA 2ORWA 1E2LA 4XD7D 4KBGA 1Q3HA 4RCYA 1EFTA 4US1R 1U0JA 2YINC 5M04A 1ZU4A 1QF9A 3PR1A 1GWNA 3W5JA 5FPKA 2IEZA 1H8EA 2CK3A 1DO0A 4MA4A 4OBEA 1JPJA 3WRYC 4ZDIA 3RVBA 2GJ9A 3AP3A 1BMFA 4RSGA 1MO6A 1YZLA 1Y3AA 4IVRA 2QTVB 3BH0A 1NF3A 2TMKA 3GJ7A 4TMXA 4DEYA 4YMTA 4ZCMA 4PPFA 1RYFA 4L4UA 5C1BA 2NO7A 1E3MA 2UZ3A 2ZUCA 3R9IA 2EWWA 4Q4AA 3KJIA 3N2IA 1U99A 1Z0AA 2QPAA 3W3ZB 2J0UB 3NEYA 4WVFA 4XTRA 4MRRA 2F1RA 4PQFA 1N6KA 3RRYA 4OQLA 1TQDA 4AG5A 2KE5A 3I5XA 3PUVA 1RYHA 4W5HA 5DYIA 4HAWA 1KHTA 1OKKA 1SXJD 4EQ6B 3K9LA 1DE0A 1KDOA 4YDHB 2VH5R 4URZR 1DS6A 5BN3A 2OEPA 2WJGA 3HP1A 3SYNA 2PZFA 1XD2A 1KO8A 2XJ9A 1ZCBA 2IWRA 2QPOA 4RD2A 2GDJA 2BM1A 1Q20A 3DPUA 2QUZA 5HCNA 2XXAB 1SVKA 2YWFA 4RY2A 3O8CA 2A5GA 1SVSA 4C0SA 1TTTA 2VQSA 2ERYA 3NTUA 5KOYA 1N5IA 2IYTA 1JR3E 2QQEA 3OIWA 2AL7A 1GILA 1CRPA 4U5XA 2CLCX 1HT2E 4FN5A 4ZKEA 1VKJA 5IK2D 2C5LA 3EPHA 4WZBE 2N46A 4Z1MA 3ETLA 3DMNA 3Q7QA 5JEEA 4BPBA 4JJKA 4C0AC 5P21A 3EASA 1G9XA 1KO4A 2FPLA 3K0AA 3TUIC 3CW2A 3QE0A 2VHCA 3AGPA 2G83A 2ONJA 2ZIAA 1Q1EA 3IHLA 4ARZA 3PENA 2OSBA 5TVKA 1YR7A 121PA 5TDHA 4HZUA 3EG5A 3BIFA 3QPUA 3PITA 4XSHA 4I4LA 3LBHA 2BMJA 1KK3A 1KZ7B 4A8JA 3GJ6A 1T6NA 3SJCA 2FEMA 3LDAA 1SXJB 2W0SA 2JLZA 1KIMA 2D2FA 3VKHA 2WOOA 1VYVA 3CKLA 2P6NA 1QHXA 4DLXA 4RD1A 4JJZA 4TSFA 2KBFA 3TLXA 1JPNA 1F2TB 3K9NA 1ZAKA 3EIEA 2J87A 4C2TA 3AF3A 2RGDA 5FPTA 1WMSA 2D2EA 4G1UC 1N0UA 5FPHA 4TZ6A 1SGWA 2VSXA 3BB1A 4B48A 4LHYA 3UPUA 1AQYA 1KDTA 4BASA 1H8ED 2GEDA 1DADA 4TYPA 4Z54A 4HI0E 4M1WA 3MAAC 3GLFB 2CK3D 1QDEA 2O8CB 1G6HA 4HEJA 1M34E 3CF2A 3FKSA 2XB4A 2ZVPX 5JI3E 1TMKA 4A0GA 4ZCIA 1J8MF 3R7WB 3EIHA 3DOEA 2ZSAA 1YZUA 4XVRA 5FTLA 3TUZC 2DWQA 1M6NA 3GJ0A 4DLYA 5DI9A 2IX3A 2C95A 3B9QA 5EE3A 1NVVR 4M9ZA 4TL9A 4PHTA 3T5GA 3V9PA 4BLSA 3U5ZB 4Q4HB 4QM7A 3GPLA 2G0TA 1II8A 3VNUA 4GZMA 1KK2A 2FU5C 2OFOA 3A4NA 3I8XA 4Q03A 4P4TA 4CYMA 4W7SA 2YWGA 2BV3A 2Z6VA 2JEOA 4M1SA 2REXB 1M7BA 1OKKD 2IYXA 1MOZA 3GJ3A 1II0A 2BBSA 4JYCA 2Q6TA 4CF7A 4UNNA 4D0GA 3UK6A 3MCAA 1G7RA 2EFDB 4DVGA 5L3SA 1MO4A 5HKKA 5EZ5A 2ZAOA 4YQFA 1EWQA 1KMHB 1KK1A 4PAOA 1P3JA 1N0WA 1DAMA 3AVWA 4PFSA 2ZI9A 4B75A 5LD2B 2JGNA 1KKLA 4GMDA 1G3IA 4DC9A 1R6BX 5JMTA 2QGNA 2QNRA 2X2FA 4ACAA 2XZOA 3CRRA 2BJWA 2XTZA 5BW8A 5HCIA 1HV8A 2GJSA 4HUTA 2RGNA 4IJMA 1JNYA 5E7JA 1ONBA 2GZAA 4LDJA 3F8TA 3IPXA 4GP7A 4E09A 1KTVA 1NSFA 4KVGA 4PO8A 4GOKA 1KJYA 1S8FA 2KWIA 3H2YA 4I1VA 4OK6A 2IWHA 4A82A 2WTUA 1LV7A 1P61B 4P3YA 3P27A 5J4LA 2XJ4A 4NHOA 2A5DA 3K0CA 5DHAA 1GOTA 2R8RA 2OM2A 4IVQA 2VA8A 4HLUC 2J0SA 5KDDA 2JLXA 4Q4AB 3K9HA 4A0FA 3ZQJA 3T15A 2UZIR 3LX5A 4DDUA 2WAXA 4HDOB 1OIVA 1G8HA 5CK5A 2NIPA 2CMKA 3FPAA 4FMCF 3AP1A 4LCBA 4Q7MB 3RC3A 2K5UA 1AN0A 1YRBA 3OEED 4DDWA 4URVR 3TRFA 3CNNA 1N6RA 3WP1B 4KITB 1SHZA 2WPDA 4BRWA 1PZNA 2WIBA 5FBQB 4QJ3A 1XJQA 1X8JA 1Z47A 1KJWA 5FFMA 3W90A 4LV8B 1T0JB 1SXJE 5KSPA 4YC7A 5D3QA 2QM7A 5GJCA 1A82A 2A9KA 2J3EA 1LFDB 3AKCA 3GEEA 1XD2B 2RGEA 4TSFD 4DCVA 4X8LA 1UBGA 4CIDA 3G5UA 3N2EA 4KFRA 4JLNA 3RSOA 1E4YA 3GJXC 3HYRA 2F1IA 3PFIA 4KJZA 4KO8A 3V4FA 1R5BA 3CNOA 3J81k 2OCAA 4LJAA 3GLFE 3B85A 1TEXA 1XMJA 1Z28A 1YR9A 4IHQA 4JBWA 5KPJA 1J90A 3FKSD 2VRWA 4XH9B 4C0QC 1OH7A 2NZJA 4HLQB 2X2EA 3H1TA 2IYYA 5JWRA 2ZI3A 3QG1A 5HTKA 2D7CA 3SS8A 5K8LA 2ZYUX 5B64A 3NBFA 4OQFA 3K0AB 1JECA 3T12A 3B2EA 4NH0A 2LKCA 1J70A 5HE9A 4Q48A 4ARZB 3L0SA 2NZ8A 1GL7A 2X77A 3IEUA 5JRZA 3O8BA 4HZUB 1YU9A 3TAHA 3VKWA 3SC3A 2XGJA 2P5TB 5BN4A 1BS1A 4A8JB 3PVSA 2QTFA 1HTWA 2NG1A 1YZNA 4KBFA 4Q9JA 2AK3A 2GCPA 2QRNA 1G6OA 5HKKD 4LPKA 4US0R 4KFUA 2QE7A 2B6HA 3AH8A 4FWTA 4G01B 2OLJA 4RZ2A 3JVVA 4P32A 4G5OA 2D62A 5E7MA 1P7CA 2GBLC 4RKEA 2WM9B 1SVIA 3EZ2A 4BFZA 4C0JA 2XEXA 4BFTA 1GNPA 2ZE5A 1YQTA 1JB1A 2JLSA 2GTPA 4KHZA 1XCGB 4LHXA 1QHHA 1BO6A 2BHRA 1XTKA 2GAAA 3TSZA 1D5CA 1T8UA 3GJ5A 3PUYA 3U3JA 5JFGA 1AIPA 5KDOA 3NIBA 3KTAA 2VYFA 1WCV1 3LAWA 4GZLA 4LBVA 3X1WA 1FQJA 1T9HA 1DAHA 2WSSA 5IDVA 3LVRE 2BDTA 2YWHA 3OIUA 3QOFA 3CF6R 1II8B 5EZ6B 2WOJA 1QHIA 2GILA 3IBGA 4MYCA 5AWFC 3T1TA 1RC8A 3EZ9A 1COWA 3Q7PA 3ZD7A 5KO2A 1F3OA 1X3SA 2WPDD 2IS2A 4NMMA 2A30A 2G1KA 1PVOA 4RZXA 3A1VA 3DM9B 1UEIA 5EE9A 3CONA 2QTHA 5CIQA 3AUXA 5L3SB 3LW8A 1E0SA 1P9RA 3QNUA 3LX8A 3TSWA 3VR3A 4AYWA 1VIAA 1EX6A 1CIPA 2IYRA 4TWZA 3TR0A 3O47A 4F4JA 3OE7D 5J4YA 1DG1G 2QGZA 1U9IC 3RABA 1ZNXA 3NWJA 2C9YA 4NYIQ 4S35A 3VHXA 2CL7X 1X1RA 2Z43A 3BS4A 2JJ8A 2BC9A 2O8EA 1Q12A 1K6MA 2BKEA 2CVFA 4KLZA 1XPOA 1FMLA 3DM5A 3F5FA 1P9WA 1QG2A 2C78A 1FUKA 2VP5A 1JQJC 3SI7A 1J7KA 2NO0A 4I99A 5FOUA 1N6PA 4K81B 3MFYA 4MKFA 2DY1A 4UXJA 1TL7C 4HSEA 5JCPA 2IS4A 5FTNA 3NDBB 4UNQA 2Z83A 4TYYA 5JJKA 4BE7B 2YKGA 2QT0A 3SHFA 1HYQA 1N6OA 3AF2A 5E4FA 2O8DA 3NEJA 2WKPA 4JMPA 1Z0KA 5J47A 3E1SA 3EC1A 3KZ1E 4JLBA 1FP6A 2G77B 2FZLA 1W0JA 2OZEA 2ZSFA 3N70A 4HAVA 4RFVA 3SBEA 2CNWA 2XTMA 1GKUB 3D3QA 3I1FA 2CLSA 4PSVA 5DSZA 3T06B 2ZSEA 1E9RA 3ZS9A 4DSNA 5HR5A 1IY1A 3GJ4A 3LNCA 1XU4A 4K46A 4UNRA 1TU4A 4M2LA 1JJ7A 4TYWA 2QE7D 4Q1DA 1Z0IA 1NN0A 1FFHA 3I61A 2I3BA 1NMYA 2ZR7A 3KFVA 4PR0A 2BOVA 4FMBB 1E0JA 1NVUQ 4C30A 2F1HA 3WNBA 2R6CA 2E87A 4FCWA 3BAFA 1NIPA 3CO5A 2OCYC 1E4VA 3LBIA 3VR6A 3IKJA 4JLPA 5FOSA 4PZLA 1AQUA 4HLDA 4LSGA 4TYNA 2WSMA 2YV5A 4XWAA 4TTRA 5TY0A 1GTVA 2GWHA 3U3OA 1OV4A 4WAUA 3B1ZA 3T61A 2HCJB 5H8WA 3CX6A 4JVSB 1U90A 1ZYUA 4FWIB 5FTMA 4JVLA 4C2UA 2WSSD 2NTYC 3ZIAD 1AM4D 4FI3C 1TF5A 1XMIA 4R71A 2IYWA 5B30A 5KSOA 2FF7A 2CEAA 2VP2A 3KJHA 4GOJA 4TMWA 4MGKR 1RVDA 4MUBA 3CRW1 1OIWA 4ASUD 1COWD 2LWIA 3CR8A 4NE2A 3P32A 4HB4A 3AVPA 1VTKA 3D7MA 1U0LA 3DMDA 4DSTA 3AKDA 3K1JA 3OEHA 2R6FA 4ZDWA 5FPSA 4D26A 2QP4A 4WBSA 3B5JA 5FR1A 3GEIA 4AYXA 3AF1A 2BBWA 4PPQA 5EP2A 5LB2A 3SFZA 1IN5A 5CLLA 5L3VA 5HPYB 3P1JA 1CJVC 1W7AA 3I3SR 4D2IA 4AY2A 3L8ZA 2G88A 1K5GA 3LW7A 4BFYA 1G20E 4OJKA 3UWOA 1NN1A 3L82B 4WOPA 3OFND 2HV8A 1S1MA 2GESA 2RKOA 1GKYA 1QHHB 1XWIA 1XZPA 2JLQA 1EGAA 2XTNA 2Y8EA 1G18A 4H1UA 4N0DA 1E2MA 1G19A 3UATA 3KTAB 4MGYR 4WW0A 2FSFA 2PZGA 4LX0A 2RGGA 1XTIA 3I92A 1G64A 3EA0A 2GVZC 1D2NA 4IVPA 4PSAA 1F60A 4A2PA 1NNEA 4EPRA 1FPMA 1LNZA 4ESVA 3KB2A 2HXSA 1TF7A 2AXNA 4XVQA 5AUNB 3ONWA 3PEVA 4OL0A 1JEEA 3DKPA 4L5BA 5CJ2A 2ANBA 1N6IA 4A0HA 1W0JD 1IY0A 2CLDX 4LC1A 2CNWD 1N0VC 2J5XA 2ZSDA 3BH7A 5D3MA 5IT5A 1G3UA 4DSUA 2ZRPA 3TJZA 1SKQA 4QHYA 4YONB 2V6IA 3ZVMA 4R7ZA 2ZS8A 4V0OA 3TAUA 3A37A 1RRPA 1X86B 4FD2A 5H1YA 5C2JB 4LOAA 4IDNA 1DVRA 3CH4B 2NQ2C 1P9NA 1W0KA 4JLOA 4AK9A 5H70A 4BFWA 4FINA 4B71A 3RC8A 2FV8A 1IXRC 3Q5DA 2W6ID 1FTSA 1KI4A 1P73A 4B2LA 4S2EA 1F48A 3BK7A 5JS7A 3K0FA 4KYIB 2ZRMA 3PIRA 4IXNA 5DYGA 1JXOA 2QSYA 1T3SA 2ZU0C 4Q1BA 4QJ5A 5KSYA 1TAGA 4URYR 2R6AA 4DWJA 4MYTA 1IM2A 1W47A 4JLDA 2O8EB 2OFWA 3MWJA 5CYPA 3WMEA 1XTSA 3CRMA 4TN1A 4KI0A 1XMVA 4IRUB 2HJGA 4L9SA 4OHYA 4OHWA 1VYUA 3TSOA 2H1LA 4LBZA 3I62A 1QHYA 2FPKA 4B3GA 3UANA 1W46A 2YZ2A 2IYZA 3HYTA 3F3YA 1IONA 2OCPA 3W9YA 2V54A 3CX8A 2O8DB 2J46A 2QA5A 1UDXA 1CKEA 3EA5A 4QHTA 1D2MA 3S1AA 4GI7A 4EIWA 5EXTA 2XZLA 1HA3A 3UWKA 3MWKA 2QY9A 3LLMA 5ELXA 3U3KA 1IJFA 1N5JA 3GJ8A 1KNXA 4QOSA 2VL7A 1P2SA 2O0JA 3OEHD 1W2GA 2OT3B 3TVTA 3ZVLA 1X8LA 2OUKA 3KKOA 3AVTA 4F38A 2QAJA 4DCTA 4QBIA 3R8CA 1TX4B 5HZKA 1L8QA 1KSJA 1TPZA 2DYKA 3A1TA 2CCKA 2Q21A 4Q1EA 4AIIA 4CEHA 4PC1A 1Z8FA 3WXMA 4C0BA 5BWMA 2H18A 2BMDA 2CHQA 3BFVA 1U8AA 1CJKC 2QQ0A 4Q1AA 1ZBDA 3TUJC 2FGKA 4QBGB 4LBWA 3RNLA 1G21E 2F7SA 3IQWA 5H68A 4NYMQ 5FBLB 5JJLA 2IXGA 1OH8A 4MDFA 3FKQA 1KDRA 4X8OA 3THWA 5CM8B 4M0LA 3RS3A 3ZH9B 1IOZA 3QBTA 4OQMA 4Q19A 5CDFA 3Q5EA 1NVXQ 4DT1A 3EZ6A 4NCIA 3KQKA 3KKPA 4DLTA 1XCPA 1GNQA 3LLUA 3KFXA 3AF0A 4QGAA 5AJWA 4RFSA 1WE2A 1Q22A 2ODBA 2VSOA 4Q9LA 1E2GA 2O0HA 4B3FX 4E22A 4MRSA 1KY2A 5BYKA 2A7QA 2EFGA 3NC0C 1UFQA 4Q21A 1IHUA 1S3GA 1GRRA 1W0KD 2LCFA 2A78A 4DUGD 2RGXA 1F6BA 4QGHA 5SZJA 2ZJ2A 5DGXA 1X1SA 4NONA 2ATXA 1H65A 4V0LA 2WKRA 4NYJQ 1EX7A 1R4AA 4U02A 4J0QA 3IUYA 4WXPA 1MABA 2BVNA 2GETA 4V02A 1GRQA 2NPFA 4EFLA 1AKEA 3ICQB 1M7HA 2ZEJA 3RWMB 3VU9A 4U00A 2ZYTX 4YMUA 2IUUA 4FXPA 3P4YA 3KKMA 3WP0A 2PZEA 2JDIA 3B13B 2BM0A 1OT3A 2FA9A 3NH9A 4QXAA 1GDDA 4B3DA 1WB9A 4PAMA 3DVLA 3NBYC 2WJYA 3AVQA 5LB4A 4D0NA 1ZVQA 2AD1A 4KFTA 4TLBA 2IUSA 4E5UA 2RGBA 2AK2A 1AZTA 3MRSA 2ZJ5A 1GAJA 2ZANA 3AKYA 2IEYA 3QF7A 1W36D 3TW8B 3LQRA 3PEWA 3NBZC 2Z5FA 5D3MB 2FSGA 2J1LA 3FTQA 2FSIA 2ZRLA 1E2EA 1PLKA 1V43A 2EW1A 1QRAA 3MLEA 4XIGS 4BLOA 2D4HA 2ANCA 2EQBA 5EE5B 4LJ6A 4PPGA 1OPXA 2BWJA 5K8IA 1DAGA 3ND9A 2JLRA 4RVCA 4IW3B 3U7GA 3BXZA 4TL8A 1IN6A 2FG5A 3W6NA 3FOZA 5CITA 1X8KA 3K0FB 2QM8A 4PPNA 2PMKA 3FE2A 4L9WA 1I4DD 3OEEA 1G8FA 4P4SA 5E7IA 2VSFA 3W5IA 2EFHB 2ZXUA 1E0KA 3HJNA 4NYIR 4JVNA 3NG1A 3MGCA 5IF9A 1OXTA 1AA9A 3ZGXA 1YHNA 2PX3A 1P5ZB 3T5DA 1KI7A 4V0KA 3C4JA 1DO2A 1VECA 1RJ9A 2H57A 2I1QA 2I4IA 3AVOA 3UMRA 5AJXA 5FBVB 1G8GA 4CEIA 2DCUA 4UKDA 5G3YA 1NI3A 3IIJA 2N1BA 3BOSA 1ZUHA 1G5TA 2VP4A 2FFBA 3P26A 4MKGA 2W83A 1AS3A 1W36B 3S1AB 4PO1A 1L2TA 2OHFA 3W8NA 2ZRGA 2J41A 3U60B 1E9DA 4HLCA 1Q0UA 1RIFA 1Z5ZA 2RMKA 5BYJA 4B6FA 3BORA 3ADBA 2MSDB 3LXRA 4EJSA 3VKGA 3CR7A 1EESA 1CJUC 2XAUA 1M1YE 4LWZA 3K09A 3A1WA 4YLGA 3NH6A 4KU4A 2B21A 2GZHA 4DCNA 3U6BA 1FX0A 4PANA 5FH9A 2V7QA 2HT1A 3VNVA 4CEHB 5CYOA 1Z2AA 4C3ZA 5FOXA 5KNBA 2GJKA 4B34A 3LD9A 3CNLA 5FPYA 4CW7A 3JZMA 3RS5A 2EU8A 2HT6A 5DLQC 3TK1A 5KHOC 4Y0VA 1BH2A 2IK8A 3WYAA 2ZRFA 4Z8XA 2GXAA 4WA7A 2P2LA 5GJBA 2JDID 4LZZA 4ZIRA 2EWVA 5KSZA 1S3SA 3TW4A 3U7HB 3AVXA 3THWB 3H86A 1W4AA 5GJVC 2EFCB 4FMDB 2D7DA 5CIWA 5KUTA 3MJHA 1B0UA 4OYHA 4H1VA 1G7TA 5FL7D 2OG2A 4DT1B 2KBEA 5KNCA 4B32A 2G6BA 2RHMA 2ZS9A 3H4MA 4NP6A 4NDZA 4RFSB 5GADl 1XNJA 1N5KA 1MV5A 2ZJBA 4B33A 1ZJ6A 4LY6A 2XNDA 3SYLA 3KXIA 2MSCB 3CF0A 4DEXA 4NZYA 5KU1A 2OBLA 4B73A 1E2FA 1OLOA 2CE2X 1QHNA 3MG9A 3U44A 4D82A 4JT4A 3PUWA 4LYAA 1F2UA 4UXHA 2OE2A 3QQ5A 8OHMA 2P65A 4A15A 1NMZA 2YHSA 4BRUA 3FHCB 1E2JA 1P75A 4AD8A 1UBCA 2F1JA 3MSXA 1QZXA 1KSFX 3TKLA 1LF0A 2FFQA 4TL7A 3SFVA 1FZQA 3QKRA 4Y0AA 3UKDA 1UPTA 4XWKA 2W0MA 1M2OB 1MABB 4OHZA 4TMKA 4AKHA 2OESA 3AGQA 2PCJA 1G3MA 2ZETA 3VU9B 1YR6A 1JBKA 3ADKA 4OKSA 5TARA 2J9RA 2RB4A 2YC2C 1GRNA 2C99A 1DEKA 1P4SA 3KQUA 4DLZA 1I2MA 2ZITA 4LGMA 2BKUA 3SDZA 1TQ4A 4OHVA 1VG8A 3OE7A 4I1SA 2PT7A 3QXSA 1E9BA 3ECCA 3RDPA 2OCBA 3A8TA 1U81A 1J2JA 2QMOA 3U6KA 1UF9A 521PA 1IN4A 1KI8A 3SZRA 1Z3IX 2GJ8A 1G291 1UKVY 3FMPB 3IILA 5SZIA 3GFOA 5A4JA 1G7SA 5FOTA 2KSQA 2CL6X 3UXMA 3FFBA 5JECA 2YNMA 3TIFA 4QRHA 3SYKA 2E9SA 2R2AA 2WWIA 1YKSA 3MWLA 1G8YA 5JHHB 1Z6YA 2GEVA 3B78A 3EXAA 4HUQA 2V7QD 2DFKB 2WWXA 3PG5A 4HDCA 2V1UA 1KK0A 2JCSA 3M0EA 5AJYA 3G82C 6Q21A 2O8FA 3RS0A 1G4UR 3A1UA 1C4OA 2QI9C 3KJEA 3EPLA 1E96A 3CX7A 4P4SB 5GVRA 4WXRA 2QPTA 3IDQA 3OHMA 2JIZA 1GKIA 2JASA 2FZ4A 1E9CA 2O0KA 4JLMA 2V8OA 1XD8A 1Z6TA 1XF9A 1E1QD 2IUTA 2PEYA 4A9AA 1CRQA 4LPSA 1G4AE 3UG7A 4ZDKA 4MGZR 1R0XA 2NGRA 3GMTA 1RJ9B 4TLDA 1S1CA 4GL2A 5FOWA 1VIYA 3QI2A 5DISB 4BFUA 4CEIB 4C4PA 1II9A 3B6EA 2ODNA 4F7WA 1NY5A 2FDCA 5KTYA 3SEAA 5G41A 4EUNA 5CDFE 2X19A 1A2BA 5EE1A 1HT1E 2ZRHA 4FW9A 1SVMA 2H7VA 1M7GA 4HAXA 4YXWA 4C0LA 4JLAA 3X1ZA 1NG9A 3VR4A 1E9SA 4QGFA 1QBKC 3V00A 4C0KA 621PA 1M74A 2P6UA 5FTJA 1Q1BA 1W5SA 2XNDD 3AKEA 1KO1A 4A6PA 1E9EA 4M9SA 1S4QA 4EJSB 3K70C 1TUIA 3FMOB 1UKEA 1FNNA 2CDNA 1X6VA 2H16A 3FVQA 5EP1A 3TR5A 1XEXA 4FCVA 4UNPA 3ZIAA 1E2KA 4MGIR 4URWR 3QVVA 1FX0B 3CRQA 4UJ3A 1GNRA 3A1SA 5ANRB 4PHGA 2VP6A 1HURA 2IXEA 3O8DA 4KSBA 3THOA 3U4QA 1SQ5A 1XFAA 3QBVA 4C9BA 4NTZA 1KJZA 3DEFA 2GA8A 4Q7KA 1OW3B 4DKXA 2Q3FA 4ASUA 3KQLA 4Q7JB 3OAAA 1GG2A 1ZIPA 2QT1A 1W4BA 1SULA 4OI2A 3LWNA 3VHLB 5AUOB 1ZW6A 4W5JA 3I5YA 3WBJA 1G5PA 3U3RA 4ZIRB 1XBTA 2RAPA 4BZQA 4OHXA 2FJUA 2DB3A 4TLEA 3FWYA 4EFNA 2AX4A 2WJVA 3KUDA 1NLYA 2ZPTX 5JWHA 3BJIC 1LF5A 5J5CA 2GK6A 4B3XA 3WY9A 1S96A 4M8NE 3TH5A 2QN6A 4BECA 2R6GA 2VP0A 1ZNYA 2WAYA 2QL6A 3TE6A 2ZE8A 4JLVA 4B35A 4C0HA 4DBLC 3EPJA 1NBMA 2ZROA 3OFNA 3QENA 5C4GB 1O87A 2AR7A 4KSCA 4TMVA 3HDTA 3REGA 3PEUA 5LPNA 1IQPA 2YVUA 3I73A 3UG6A 3SJBA 5DNYB 4RD6A 2ZU6A 3CPJB 3QY0A 4DLVA 3U44B 1Z08A 3EWAA 4LI0A 1F2UB 2ZREA 3QKTA 4B44A 1ZM4A 4FIDA 3O8RA 2CCJA 4Q02A 4M1KA 1MO3A 2EFEB 2G3YA 1FUUA 4V0MA 3BB3A 4TLCA 3QKRB 3RYTC 1G5RA 1TUEA 1G8PA 2ODEA 2VPPA 1U98A 5AJVB 3TQFA 4DCUA 3B7GA 4MQBA 4ABYA 2JIZD 1QG4A 2QENA 5LD2C 2HYDA 4BZXA 3SU8A 1S0UA 1ANKA 1LY1A 2X8AA 3CM0A 3LH5A 4OI1A 2IYVA 2KJQA 1HY3A 3B1WA 2Z0MA 2VHTA 3VX4A 4Z8YA 2W6IA 2QMUA 4A6XA 4M53A 4BGDA 4RJLA 4AURA 2WMOB 2UKDA 3B9PA 4MRNA 5JBQA 1OB5A 2FNAA 4C7OA 4EPYA 4KVAA 1ZNWA 1E2QA 3KKNA 2GCOA 4A0RA 4KV9A 4TLAA 4LHVA 4YXWD 5EXXA 5F3WB 1NVVQ 2QAGC 2ZAMA 4TQUS 3AVVA 1FP7A 4O3MA 4I1OA 2ERXA 3A4MA 5FUXA 4IKEA 1BOFA 4KFSA 4HUQB 4CGZA 4CZ2A 4ZPXA 3D8BA 3QXXA 3DZDA 4HLUA 4NCNA 4P33A 3V4RA 2O8FB 1BKDR 5CJPA 2D74A 4RZ3A 1QHSA 3WMFA 3OAAD 2R44A 2FGJA 2W2XA 4EPWA 2F9MA 5LDDC 1Z6GA 2P0EA 3C5CA 5FUYA 4P31A 2WIAA 1IJEA 1HEIA 2NPIA 2DFTA 1TQ2A 2HXYA 1J99A 4G5RA 4OK3A 2Q3HA 4F4IA 3ADCA 1R8QA 1DARA 2GEUA 2VP9A 1J8YF 2V9PA 4JL8A 5FUWA 3EPKA 2QP9X 2WKQA 1VG9B 1YZTA 5DIFA 2Q9BA 2D3WA 4NU0A 4R2HA 3W34A 2ZJAA 1EG7A 4IDQA 4NCHA 3FDIA 4YDSA 5FUVA 1NBMD 4A36A 1XEWY 1SKYE 2RCNA 4ZDJA 2YC4C 1D8TA 1N6NA 3HWSA 5E3HA 1JQLB 1XD9A 4X8HA 4DB2A 1LVGA 1WF3A 3JVUA 2AKAB 1NSTA 2ZI7A 2DFLA 4LJ4A 4PHHA 1CF4A 1YR8A 3EARA 1JAIA 1GUAA 1XEXB 3CPHA 2HF8A 2OFXA 2WWHA 3QVUA 3EC2A 4XSGA 2ZTSA 4OI4A 3K8YA 4ACBA 2PEZA 1ELOA 1CR1A 4A8JC 4I1UA 1ZP6A 3CUEF 5JJIA 4AYTA 3ZVRA 3CH5A 3U4QB 2IA5A 4BFSA 4JBXA 5FBRB 1G7CA 2REOA 2CBZA 1E79A 1JI0A 2YOFA 4ZO4A 1VHLA 4TT3D 4ILEA 1P62B 4RD3A 1JALA 3TGPA 1KAOA 4Q4JA 4E03A 5DHFA 4JSYA 5KDLA 2ZR9A 2NMVA 3AM1A 3T1QA 4GSYA 2DWPA 2RHDA 2CE7A 5BQ5A 1Z29A 4Q47A 4A92A 3U61B 2KI5A 3QKSA 1BYIA 2WHXA 4DUGA 1WP9A 4DHEA 3K0SA 1ZM3A 1O3YA 4DLRA 2ZI6A 1GIAA 4MUAA 2PCLA 2GBLA 4G5QA 2WJIA 4V0NA 4DB4A 4CDGA 4M9XA 3BD9A 4A1FA 4AWXA 2XB2A 3AF4A 1ZD8A 3QKUA 4BQSA 5L8VA 1GL6A 2WJHA 1XCMA 1U0HC 1HQCA 2WJJA 3RAPR 3EAQA 2VHUA 4MYHA 1SVOA 3QIAA 1OFUX 3ICEA 4L8GA 1G17A 3PQCA 2H92A 4NBSA 1OE0A 5C18A 2F43A 3SR0A 4JL5A 2BBTA 1XMSA 3OESA 3T1VA 3IO3A 3EWSA 2GAOA 1XP8A 3KB1A 1NRJB 1AJEA 1AKYA 1HQYE 1NG1A 1L4UA 2GKSA 1SZPA 4IOLA 1PUIA 4YMWA 3LA6A 2JLUA 5CB6A 1L4YA 1ZC3A 4DLUA 1U2RA 1LW7A 1CR2A 2ZJ8A 3Q9LA 1N3BA 3WYFA 2FEOA 3RWOA 2O8BA 1XB2A 2RGNC 2F6RA 4Q9IA 3QEJA 1NMXA 3RS2A 3RLFA 2DPXA 2AN9A 2WV9A 4PSKA 2PH1A 4DLWA 4C7OB 1PUJA 3PUXA 421PA 1DAIA 2JATA 3LRPA 2EVWX 1VCMA 2ZSBA 1EFHA 3Q85A 3L8YA 1G41A 2R6DA 3LV8A 5JEDA 2GCOB 2BBOA 3HU3A 1U9IA 3E70C 2PT5A 2DWOA 4B47A 3K0CC 4TZ0A 821PA 4QC2A 3SNHA 1WDTA 2C96A 3EW9A 1E32A 2QROA 4MH0R 4NL4H 3GEHA 1OSNA 3BB4A 5EXPA 1EFCA 4QM6A 2AFIE 2PL3A 4V03A 4IFEA 2AD5A 2CHVA 1OXSC 1RRFA 1E69A 1TNDA 2BJVA 2CHGA 4NKRA 1YZKA 2JLWA 4AC9A 1KI3A 3IGFA 4D0LB 1KNQA 1N6HA 1KKMA 2Z4RA 5HZHA 2AWOA 1E79D 4IOJA 4GBMA 4EPTA 5TV2A 2RGAA 1E0AA 3C14C 3GD7A 4M4SA 2Q0HA 4ZV4A 3GQBA 4Q9KA 3I4LA 4G0NA 5L3QA 1Q3TA 3NC1C 1AS2A 5JI2E 2RGCA 1GFIA 2ZRKA 5DO9A 4PQRA 2F55A 4B74A 3HPRA 2JJ2A 2R62A 1Z83A 2B8TA 4M1YA 5FOVA 5SZHB 3H0KA 3ND8A 1YZGA 4LV5B 1N6LA 5J4VA 3KKQA 1CU1A 4R2IA 3SBDA 5AK0A 1G1MA 1ZRHA 1OHHA 3FMIA 3EX7C 1BYUA 4LRWA 3G0HA 3QF4A 1GSIA 4HATA 2FH5B 3QUSA 2DHRA 1NBME 2F3RA 3FHTA 1KI9A 1E2NA 2SHKA 4GNKA 5J4KA 1A2KC 1MRSA 1TF2A 4FCTA 5G40A 3F0TA 2FX3A 2HCBA 2QAGA 3A58B 3B82A 4BLPA 3VX3A 5SZKB 1XJ0A 1Q1ZA 3K70D 3GLIA 4NCKA 1JAHA 1E9AA 4QHSA 1RE0A 2BEKA 3WRXC 2QZ4A 3KX2A 4HB3A 2BCGY 1ZINA 3HU2A 4BZPA 2GF0A 1Z07A 4LHWA 5FL7A 2BMFA 3HR7A 1T3HA 2ZRJA 1N2CE 3L0OA 4V0ME 4B76A 3IEVA 3QXJA 2FOLA 1UBEA 2GRJA 4JL6A 4BUJA 2REBA 4LYHA 1KSGA 4BLQA 2XNSA 4Q4JB 5B57C 5AUQA 1E2DA 1EXMA 1Z0DA 3LO5A 4LJ5A 1N5LA 3ZZUA 3QKSB 4JSTA 3WMGA 2W00A 1CEEA 2YYZA 3GLHA 1YVDA 1Q1QA 2O52A 2FPMA 3RRZA 2IXFA 1D6JA 4N3NA 2Z4SA 3SE0A 3LVQE 1MH1A 2QBYA 4TL6A 3BRWD 1UKYA 3N5CA 2EYUA 4MYUA 4Q9HA 4EAQA 4ITRC 3PUZA 2JLYA 4MKIA 4M1MA 5LBIA 1N25A 2IBMA 2IT1A 3QXCA 4B3BA 1D9ZA 4FMCB 4QFMA 5C4MA 2GHIA 3WNCA 2NOAA 4MITA 3K70B 721PA 1CR0A 3CWQA 3IIKA 3OZXA 4LK2A 1RZ3A 1WA5A 5JCZA 4EPVA 1NN5A 1Q44A 2F43B 3KJGA 4R98A 3DZ8A 2WWWA 1U94A 4QGGA 4R9UC 3RS7A 3I32A 4B3CA 1OJLA 2PJZA 1UDWA 1KOFA 2V3CC 3SJZA 1EFRA 1E98A 2IC5A 3CWZA 4URXR 4GDFA 2V55B 5JS8A 4KCGA 4Q66C 2WBLC 1M8PA 1ODFA 4Q1FA 3TVDA 1JXMA 1MKYA 2AFHE 2CJWA 1ESMA 1Z6AA 4PX9A 4QJ4A 5KPDA 1R5NA 1W49A 1R2QA 1MT0A 4PC7A 5DI3A 4PO9A 5J40A 1R0YA 2BMEA 2ZRDA 2O8BB 2HF9A 2JJ2D 2MSEB 2QEQA 4JT2A 4LJYA 2XSZA 3NDPA 3VTKA 1W4CA 2QRZA 3QPVA 2ORIA 3P4XA 5AJZA 1DBSA 3E5HA 3VAAA 3REFA 1OHHD 3X2SA 3IO5A 4ESHA 2WWFA 1WBBA 1XZQA 1P2TA 4Q18A 1PLJA 3A36A 1BMFD 2XZPA 4LJ8A 3AVYA 4JKIA 5GVSA 4JBYA 3LQQA 2CXXA 4GPTA 4AI6A 5BN5A 3BGWA 3HPQA 3MJRA 4EFMA 2AKYA 2LKDA 2PLFA 1Y63A 1TU3A 3L2OB 3JZAA 1E1QA 5F2EA 5FI0B 1LS1A 3T34A 2B92A 2OAQ1 5F98A 1HE8B 3ZLJA 3GLGA 2W58A 1H8HA 4HB2A 1XX6A 1Q21A 1XEWX 2IL1A 1OF1A 3Q72A 2HEIA 4M21A 2Q9CA 3KQNA 4F93B 1KYIA 2C9OA 3VR1A 2OXCA 1WXQA 1FOEB 1IXSB 4JKYA 1T3LA 4CEJA 1IXZA 2GXSA 3AVUA 1VDZA 4UXIA 3BERA 1KAGA 1D9XA 2OXRA 4TYQA 5C46F 5L3QB 1T8TA 2HJVA 3CBQA 1JEDA 1NN3A 2F9LA 4IDPA 3X1DA 1DOAA 1RKBA 4NPHA 1VG1A 1GZSA 4QNRA 3EIQA 4JZKA 2EYQA 4POAA 1CULC 4RD0A 1QHGA 1C9KA 1XXHA 4OI0A 2WVJA 2GK7A 4W5WA 1W2HA 4BFXA 1Z22A 2XOKA 4TMZA 2C77A 4M22A 4QKQA 3U7FB 5CK4A 3W6PA 2XX3A 3E2IA 1OYWA 1DELA 1DPFA 3QF4B 4Z1MD 5EQTA 3RRNA 4DLSA 1DTSA 3M6AA 4QNMA 4TTPA 5J4HA 1W4RA 1VG0B 4AKEA 3SN6A 4D25A 2A2ZA 4PQYA 4PTLA 3X1XA 2QU8A 2YWEA 2CVHA 1P60A 4LJ7A 1CJTC 2QAGB 4OK5A 1PLLA 2ODWA 1IY2A 1CTQA 4P0TA 3TQCA 1VYTA 1KO7A 1OXVA 3GLIB 3RSLA 1Z63A 1XTQA 2ZUBA 2E1RA 2N42A 4EPXA 2IF0A 4O2LA 4D80A 4TQAA 5TMPA 1AZSC 1P2VA 1NKSA 4BFVA 2OBNA 3C5HA 2GNOA 1RRGA 3A6PC 4ZI2A 1EFRD 1GM5A 4JYBA 1T5LA 2VLIA 3DOFA 2ZE6A 1RW4A 4UJ5A 2ZI4A 2FMXA 3M1IA 3QEOA 2VHQA 1G3QA 4XVUA 5JSZA 2IYQA 5DN6A 1Z6XA 2ZQ5A 4PC2A 1T0HB 3GFPA 4IEIA 4IXMA 5A0FA 3RANA 3AEZA 1QVRA 1KI6A 4YMSA 3SHWA 2B8WA 1E2PA 1L7VC 2OLKA 1XDBA 5B58C 1CJMA 3OIVA 1XEFA 3IIMA 4M9QA 2XSZD 4IOMA 2AHOA 3GLHB 1ZU5A 3BE4A 5K8TA 4N1AA 1RFLA 5TB5A 5EP4A 4F91B 1G3RA 1ZD1A 2HLDA 2IF2A 3R9WA 1KI2A 4MKHA 4WZ6A 2QBYB 3MD0A 4B2PA 1A7JA 4YMVA 2YJTD 4H9GA 1KGDA 3LFUA 3R20A 1WBDA 3TBKA 3NKVA 4PZYA 4D4LA 2JJ1A 1GITA 3DDCA 1W5TA 1EFUA 1W1WA 3LBNA 3AUYA 4N0EA 1AGRA 1ZC4A 4LHZA 4K8OA 4XWOA 3TMKA 2QG6A 5AUPB 3PCRB 1RRCA 2NO9A 1SHKA 4A2WA 4Q5IA 1NLFA 2ZYVX 3OIYA 4QG7A 5EJEA 1HE1C 3MUFA 3ZJYA 1KI1A 2DFNA 2ZRIA 1G16A 5FBWB 4DRZA 1H8HD 2J45A 3CZQA 4GP6A 4ZI3A 1MR3F 4LBYA 4LJ9A 1OXUA 4TQ9A 2QORA 3IPYA 2GCNA 1CP2A 2ZRBA 1ZUNB 2PJRA 3DHWC 3ADDA 3BFKA 4DCSA 1SVLA 4ERNA 1ZUIA 1R8SA 4OJQA 3IQXA 3BH6A 4FMDF 3OF5A 4Z51A 1T4GA 5FR2A 3SOPA 4L16A 2CJWB 1OH5A 1ETUA 1HH4A 4BLRA 1IBRA 1Z0JA 5DI3B 5UKDA 1E2IA 3THYA 3I72A 1W44A 1OXXK 4W9MC
chains in the Genus database with same CATH superfamily
1NKTA 3LY5A 1ESNA 2RJOA 3RREA 1LDGA 2RSLA 2A4MA 3WWZA 1ND5A 4JEMA 2FE1A 4N41A 1HL7A 1CCWA 3NCTA 2O5VA 5BORA 3TDNA 2V7EA 2XOKD 3U0BA 4OQDA 4DSOA 1OIXA 2VPXA 5BRAA 1AOXA 1DAKA 2Y77A 1RAGA 1LTQA 3AFMA 2IHYA 3M3DA 5EP3A 3EXHB 1U8ZA 3B1VA 3BC1A 2CXQA 5E95A 1AKMA 2VPZA 1E6CA 2OC4A 1IZ8A 1GTG1 2PGIA 3AJ8A 2GJAA 4ZK6A 3U16A 4AO6A 3HXTA 1XE3A 1RJWA 1HUQA 1V2GA 3I04A 4E2FA 4E51A 4EI7A 4IS3A 4J2HA 2H7YA 5AW8A 1PNVA 1NXOA 1WEKA 1FLNA 2Q5CA 2Y1EA 3KXLA 4MGHA 3ZZ0A 4A2QA 3GLIE 4NU5A 4JS0A 3PC7A 3EZLA 3URMA 2IBTA 4R8MA 1WVGA 1R0LA 5AKKA 1VPLA 4AXBA 2PS0A 4B3JA 4XOIA 3UHAA 4C89A 2XXJA 3VAZA 3PQFA 3QWIA 5GIOE 4RIHA 1EGHA 2H54A 3ABRB 4R6WA 5DN6D 4Z4CA 1F0NA 1L7BA 3LUDA 3CPEA 1RYMA 3GCGA 4UNIA 3IJEB 3UMSA 5JCOA 5EIXA 3KUXA 3LSTA 3ZS8A 4Y1FA 4R1UA 1RQLA 2A9OA 2X41A 2B4TO 1X7YA 1B23P 3WHKA 4FGLA 1ZM2A 5KNDH 4J0HA 2BZSA 4CMKA 3ODPA 2P3OA 4QTUB 3WLAA 5EJ6A 3UJDA 3RHFA 4WLNA 3FPBA 1N8TA 4KAXA 1XTUA 1XXHB 3OM1A 3RFVA 4CT4B 3HXPA 4O2RA 3DVSX 1TADA 5FI5A 4DOMA 1XWFA 1Z4NA 4YR7A 5IVPA 1L5ZA 4LE1A 1CUJA 4YY3B 4LF7B 4TT3A 5BP7A 1U7UA 3HGMA 2Y0DA 4HFRA 4ZI7A 4D9CA 2ZJYA 3A9VA 4U9HS 5K0CA 5K8UA 2VTKA 1ZITA 1ZH6A 221PA 3I64A 3KKEA 2C2HA 2HAEA 4RLSA 4RF3A 1I2DA 3QSYA 3WGQA 1DV2A 2A5FA 2ONKA 3LMKA 4GT1A 4IEEA 3M6XA 1UQTA 1XHEA 5T7BA 4LQCA 5BWOA 4JLJA 1YJ5A 3HKEA 1OXKB 5B6PA 5D8DA 4CUKA 1FJHA 4P7GA 1SC3A 2HWYA 2XYPA 4F3KA 1XZFA 4L7VA 2IU0A 1DZ3A 1GZDA 5H83A 4YAIA 4NSNA 3ORSA 4HVCA 3VGPA 4K05A 4WZBA 4M8KA 3QPWA 2QYTA 3TM4A 1UPBA 3V8NA 2ECKA 1QRTA 5JXIA 3DAHA 4ZAWA 1XJ5A 3QVLA 1L9KA 1ZH0A 4D97A 2ZM5A 4BVHA 1M1UA 1KXZA 2ONYA 4MPTA 4UHJA 1KI6B 1UPUA 1Z06A 4X97A 5MN4A 1T9KA 3KL4A 5KYKA 5F4ZA 4EVRA 5LZ2A 2GZDA 1X94A 4DR5B 4Z53A 1HKUA 2HWWA 1KP3A 3I39X 1UKZA 3NBXX 3VBEA 1NNI1 1JDPA 1QTIA 3HXKA 4GR5A 3CZMA 4BEWA 3B9BA 2XUZA 5ED4A 3WYGA 3ZY4A 3O8QA 4C43A 2VJCA 3K6RA 3NWPA 3WC4A 4E2WA 3W3AA 5HQ3B 1LLDA 2VPQA 1W6RA 2A5JA 4U4AA 3M9XA 5IAEA 4K26A 3VOBA 4JB3A 2WB4A 3WK6A 5EWJA 4P5EA 2X8JB 4JUBA 5AHKA 5B2ZA 2LIVA 2YIVX 1W5AA 5ALKA 4HJXA 2PV0A 1UC8A 2HRBA 5BNWA 7YASA 1PJLA 2P5SA 2WEKA 1WVIA 3IUSA 3PJEA 4O3FA 4PYRA 4RJ2A 5P8WA 1P5HA 4BYMA 1OFIA 1VL8A 1MO5A 3R4VA 4I55B 4OQNA 3SE7A 1FS5A 4YCMA 2YBEA 3EA4A 1T91A 5DMHA 4JHXA 4AMUA 3JASB 3FWPA 3N8KA 5DCLA 5FIUA 1E5VA 1JJVA 3PV0A 4WLOA 1Y6RA 1RPZA 2VAWA 3ZI0A 5L3ZA 4JVMA 2L0XA 4BNHA 5A5DA 3D6MA 1AK1A 2L69A 2VEDA 4OYRA 1M34A 2ZM6B 4TVSA 4WZAB 2W6JA 1EGVB 3L0YA 3WGJA 2AQHA 2BFEA 3M4NA 2EKBA 3FDJA 1W25A 5FQNA 3Q11A 1S2MA 1U2QA 4W63A 4A0SA 2O9JA 4AZTA 1ZNZA 4GMXA 3UM9A 4I50F 1K0FA 3I3OA 4PAGA 4BY9E 1ZMOA 3WLRA 4UDXX 1C1YA 2NSJA 3KQWA 5TR9A 5EJ9A 1FNMA 1RQ2A 4JLWA 1M2JA 2B99A 4U3JA 3NTXA 3FHOA 2H0AA 3RQSA 3K2BA 1EAMA 1I3LA 1VDMA 1YJBA 2V4MA 2ZS7A 4LZWA 3L7CA 3GT3A 3HUTA 3QFCA 3GL9A 2QXTA 1HLPA 4NZZA 4Q7LA 4TTAA 4HEQA 4UDNA 3SZLA 1KDYA 1BQ3A 3NHMA 1ZM7A 1J2EA 3TLGB 5CVUA 3C7KA 3OA0A 4Y7DA 1GUBA 3OZWA 2BIFA 4R2XA 5DWQA 1AKTA 1S3IA 4X44A 1T3GA 4PRZA 1UJ2A 1JU9A 2DT5A 1PVDA 2LBPA 2BKXA 4G3XA 3DL0A 4G8JA 4I3GA 4MI6A 5DGDA 5G02A 4K1LA 4N0MA 1OFHA 5IBRA 1HYHA 2W2VA 3D7KA 4INAA 1FVFA 4P3XA 4XYMA 4E1VA 1VMAA 1R15A 4S12A 3V42A 2PYIA 4D9NA 1MQ9A 1R0ZA 4QAQA 1P2UA 2DBZA 5U9CA 3IR6A 4DC0A 1SA0B 4FLEA 1SVWA 1CS4C 3FGNA 4CV1A 1L7RA 4I5EA 4IOLA 1JFFB 3MAJA 5ARDA 4I81A 3NRBA 5LU9A 2H29A 2QP3A 3CRVA 1HKHA 1JLLB 3V4VB 1VLMA 2C04A 2IODA 4PZAA 1GPMA 4P2GA 3ZD9A 1XFDA 4OH1A 1PV4A 2DFPA 3K0EA 4TKUA 2YWJA 2EKLA 3K5PA 3OCYA 4AQ7A 3K09C 3R9KA 3FZNA 3MNFA 5KOHB 3BREA 2WWVD 1YCHA 2BFNA 4UHFA 1O4VA 4JMLA 4RK0A 3TNFA 3VFDA 2WZQA 5ICSA 2I1VB 3B1XA 2AG8A 3H2JA 4UBMA 3THXB 5JHGB 3ESYA 3NHBA 4I1PA 3GEGA 1EFVA 3L93A 2QMEA 4FN4A 1Z2PX 2O07A 4LRQA 4RK7A 2B4KA 3I45A 3VPAA 3DYVA 5JSFA 1UZNA 5I7OA 4BWYA 3ZY5A 3IAFA 2YZNA 2QLTA 3F5QA 1IWOA 3GYGA 5IDXA 3W5AA 2GF9A 3KXKA 3KQQA 1YE8A 4J0KA 3VC7A 5LZ4A 3RS4A 4YP5A 1Y6JA 2QD3A 4R2JA 1KQPA 2VDWA 3KS9A 4BVBA 2B7BA 3EPRA 3IYLW 3ZI4A 2P30A 3QXGA 4G0YA 2OMKA 4C29A 5DB4A 2G0NA 4ZTUB 4CLRB 2G17A 9GPBA 1UFKA 3HWWA 2PR7A 1U0FA 1E6LA 4QASA 2XF2A 5EJFA 3T52A 4M7OA 2BCJQ 3WLHA 3ZQ6A 4EDHA 5A0VA 3R7DA 2D2IA 5JZVA 3F71A 5KB3A 3R5KA 2PZKA 1NXQA 4CE6A 3D6TB 2E4XA 4MUIA 3BE5A 3ANLA 4BTEA 2DMRA 1D03A 3HA2A 3KJNA 1MC5A 4DR1B 1NI5A 2EARA 1A3CA 1P72A 4LOKA 2VF7A 2VWGA 3GLFA 1WSBA 1EMDA 5JCXA 4QELA 3UTDA 2HYIC 3EBOA 3OOJA 1GRCA 4CG1A 1GL9B 2H8KA 4HLNA 4RTPA 3PD0A 4AN1A 3DS8A 1E7QA 4INZA 3GGOA 3MJDA 3T3HA 4IGKA 3OCWA 2OK8A 1LPSA 1O57A 2D5BA 3D0RA 4FB5A 4I8DA 1FSPA 2DFDA 4GFDA 3G0BA 2GK4A 4K6GA 3VMMA 2GXUA 4K87A 2Q3CA 4H17A 1QIMA 4IDOA 5DNCA 5HE8A 1VM6A 1A1VA 1DINA 1POXA 5B3LA 3P5BA 2WIJA 4CQJA 1B7GO 4D41A 2VHXA 4R41A 2OXTA 4DMUB 2V7UA 4GGOA 1XRJA 5B7PA 1BDIA 3AV0B 3I9V1 1G9TA 2C3UA 1VGQA 5FBKA 4OXQA 1G2QA 3KT0A 1PJAA 1H0KA 2BZ1A 2FHSA 1EIWA 4J49A 1SD1A 4MO9A 4EMBA 3LS2A 1NBAA 2QY6A 4MQ6A 1WMEA 2PLRA 1GGVA 4WY8A 1CP3A 5FDFA 5LQUA 2O1SA 1EH5A 1W88A 1XZBA 2AOTB 1OI4A 1QR2A 1JTFA 1A04A 2H17A 3T1HB 2Y1DA 1PJSA 3NHZA 4WDQA 3LSYA 5G53C 1P1FA 4BC1A 5IRCD 2VFAA 3DWEX 3NDRA 4OYLA 4D44A 1GU0A 3FCUB 4BWVA 1UDBA 3HJFA 4EYSA 3M5WA 3NT5A 5KYWB 3WNVA 4X1IA 5B1HA 2OGZA 2HU7A 3DVRX 3WHPA 3BCHA 1E2LA 1FNBA 4XD7D 4KBGA 1Q3HA 3BSSA 1EFTA 2YINC 3D0QA 3HMQA 5M04A 1JEQB 1FP4B 3DAGA 3FF4A 3TFWA 3RRXA 1QYXA 3W5JA 2PR2A 5FPKA 4RAOA 3MJCA 3LT5A 4MA4A 1HNZB 4KE6A 4J7CA 3ZHBA 1NASA 3QFRA 2WY2D 3L8HA 2HCRA 5ALHA 4IVRA 1GNLA 1RAIA 1R9MA 3NWOA 3BH0A 5ENZA 4E7PA 1PP4A 2IGBA 2XADA 1NYQA 4CETA 3GJ7A 4QZVA 4ZCMA 3ZEIA 4B7XA 1M3SA 1BJRE 5LCXA 1IOWA 1UBHS 2AF4C 1F8YA 2ZUCA 3PL1A 3PXAA 2WHEA 3NRJA 4Q4AA 3OY7A 1DFGA 1CE8A 4ZVNA 3R9IA 3V7WA 5BV8A 2JD1A 1O08A 5JH7A 3GEDA 4P58A 1FP1D 4EGSA 2EV9A 3W3ZB 5KTMA 4KLAA 1O7JA 2G08A 1IHXA 1KR5A 4WVFA 3V1TC 1QGOA 1XAIA 2F1RA 3D5QA 4JX8A 3QFTA 1DX6A 3JQQA 3JD3A 4AG5A 4EENA 2KE5A 4OVKA 3I5XA 2H3EA 1RYHA 3PUVA 4W5HA 5I7EA 1P8AA 3AQIA 1OKKA 5DNUA 3K9LA 1Y80A 3FNIA 2OGUA 4HJRA 1UBNA 1F6DA 3FCXA 2P7HA 2XNCA 2VH5R 3K4HA 5EESA 4MW4A 3SKXA 3VSDA 4DXDA 5LOVF 3R5HA 3D8TA 5BN3A 1EE2A 2FEWB 3IB6A 3P9YA 4YP6A 2AKEA 2FPSA 1JFLA 2IWRA 3G2KA 1Y5NA 2G72A 3D6UA 1EFPB 2QPOA 4O4JA 3X3HA 2K87A 2G5TA 3ZE7A 1CUGA 2YXPX 3F4KA 3DPUA 3H9JA 3QVXA 5HCNA 1GPBA 1SVKA 2YWFA 4MW1A 5JY1A 3K9QO 5IH3A 1SVSA 4B6SA 2GDZA 1TTTA 2VQSA 3QLUC 1Z2OX 5IKEA 2OPBA 3JPWA 3VR2D 1R6DA 2ARKA 3M2TA 5IT9A 3I01M 3COPA 4LCEA 1CRPA 1WCWA 2JG3A 1LEHA 4PLCA 4P4GA 3C74A 1RCFA 3O3MB 3KO8A 4YAOA 5BUSA 4F46A 2XCTB 3MHTA 1PFGA 4NFYA 3H05A 3IUMA 1V11B 2N46A 1VSBA 3ZKAA 3CO0S 2IEAA 5AXCA 3H5AA 3Q7QA 2VATA 3PRKE 4C4TA 5JEEA 1CLEA 2FOXA 2R7LA 2VRCD 5LP6A 1KYVA 4LE2A 1BE6A 3NGMA 3PU6A 3EASA 4K3VA 3O4IA 2NYRA 2OG1A 3JQEA 3K0AA 2QXYA 2X42A 4NULA 3TUIC 3BGVA 3CW2A 4G26A 3BFPA 4EO4A 3IHLA 6REQB 3IERA 1YB7A 2ZBEA 3PITA 4L4ZA 2B25A 1UWKA 3F90A 3MRTA 1E8NA 1KZ7B 4NAHA 4PX5A 3GJ6A 3RYIA 1W29A 3GROA 4JSRA 3ZBQA 2HHJA 5CFPA 2D4AA 5JYEA 2O5CA 1SXJB 2JLZA 2ZJ0A 4OXYA 2IH4A 3VKHA 1ONPA 2XIQA 1X1DA 1B1AA 1K27A 1T9AA 2Y4NA 3CKLA 3PWKA 3VZPA 3QPCA 3OZTA 4RD1A 4JJZA 3B6IA 1PZEA 4BGVA 1JPNA 1F2TB 1GNTA 1C4WA 1TPYA 3EIEA 5FB3A 4DR3B 3IVXA 1GEGA 2D2EA 1N0UA 1PEDA 1P7YA 1UK7A 2GZRA 3BB1A 4PWYA 4TZ6A 3EQ2A 1N32B 4OM7A 2VCEA 5B4TA 2ZIVB 4BTVA 1AQYA 1KDTA 3DFUA 4BASA 2W70A 3LP6A 1ZI6A 4HI0E 1JKJB 3MAAC 4RTNA 2CK3D 2F2TA 3IT0A 3VOTA 2GNPA 1G6HA 2P9ZA 3FWNA 4ZQFA 3RUHA 2AE1A 1DTWB 1MF7A 2C2XA 3HKDA 3O2SB 4FFVA 4ND5A 5E8JA 4HP8A 3ZWQA 2YN2A 3BT7A 3EDQA 4KW7A 4A0GA 1EHIA 1J8MF 4ZCIA 5J59A 4CCAA 2ZSUA 3OUUA 5GV8A 3AEKA 5JHHB 4P5PA 3GJTA 1JILA 5FTLA 4G97A 4F5DA 3TUZC 3MK31 4OQQA 2Y0CA 3RKRA 1A8PA 2IZ1A 1M6NA 1B00A 2C95A 3W4JA 2CC2A 3KBOA 3KZKA 3JD1A 3HYCA 2JH8A 2QUAA 4Q4HB 4CF6A 2ZYDA 2CLEB 3U80A 4JUCA 1U63A 2OFOA 1V2HE 1EHYA 2ZWIA 4GPIB 4LE0A 4P4TA 4PGGA 5DK6A 5KWEA 2UZ1B 2REXB 4M6WB 1M7BA 2FZWA 1DC5A 1NP7A 3DO5A 2YFYA 1MJGM 1QIGA 2MINA 5KQPA 1CQZA 1II0A 2WF7A 3N75A 4GNRA 3KR1A 3EAGA 4HQ0A 4UNNA 4U2DA 1CVLA 2DWUA 1EFAA 1ZD5A 5L3SA 1U7ZA 5EZ5A 4KXUA 2ZAOA 3IEPA 3OT1B 3IQFA 4NBKA 1N0WA 4BVKA 1SB9A 4C6SA 1UWLA 2A14A 1U7TA 5LD2B 1OWMA 2Z8ZA 4ZJPA 1KKLA 2Y99A 3ROEA 1R6BX 2H00A 2BFCB 2O3SA 2QNRA 2FLWA 4O8CA 4YLEA 3IHTA 2BJWA 4CWAA 1V6SA 3H9BA 4WJZA 3V34A 4IWYA 1BFDA 2GJSA 5BW8A 1I94B 4HUTA 3VAYA 1ONBA 3AEUB 3AI2A 4LDJA 2DHDA 4E09A 5ELMA 3LIIA 1PS9A 1KEPA 3AM5A 3EEFA 4OMDA 3N0VA 3ME5A 4PO8A 4BOYA 2IRWA 5ALWA 3TPZA 1JU3A 4MS4A 5IHXA 2WTUA 1CB7A 3QVMA 4LZLA 1UC4B 4AMVA 4I46A 2HZBA 3EAFA 3LLSA 3P27A 5J4LA 1JSLA 1UOQA 4B5KA 1A5SB 1IH8A 1NURA 2CHEA 1ZJ4A 2W2PA 3E2MA 3DULA 4MXDA 4IVQA 2VA8A 1T1IA 4HLUC 4QO7A 4KL8S 4UUBA 4ZOLF 2J0SA 4F5WA 1JL3A 3ICWA 4UBIA 3LX5A 4NRDA 4QU5A 1L6RA 3NI2A 3K9WA 4CL0A 4LDNA 2NIPA 3FPAA 3K5WA 2AMVA 4FMCF 3WDSA 3JARB 3MAGA 1DQNA 3RC3A 2I2WA 3AKZA 1B6GA 2HCTA 3ACCA 3EMDA 1ZVKA 3OU6A 4FYIA 5AI6A 4DDWA 1KFEB 5HF8A 4NE9A 3CNNA 1VKNA 1XZCA 3KCQA 3TRFA 1SHZA 1PZNA 2FW7A 5FBQB 1XJQA 4YNBA 3DBLB 1X8JA 2P9BA 1KJWA 1B74A 1T0JB 3T9BA 1DEAA 1SOAA 3OP4A 5KSPA 1S8NA 1A82A 5IASA 3PIIA 4AJLA 1B2RA 3A26A 3FCCA 2BFDA 5GOZA 2RGEA 4E2ZA 3A28A 4TSFD 4X91A 1YBHA 5FNVF 1T25A 2WNHA 5HJ7A 2DFVA 5AYVA 4DTCA 2PBLA 5KX5A 1HORA 3G5UA 2G7ZA 3MZ0A 1V7ZA 3BIWA 3RSOA 3TRHA 1GPKA 3TTVA 3HBAA 3HYRA 3OPQA 2ISCA 3OTIA 2HHHB 1KMIY 3V4FA 3H6HA 1CY4A 1MCZA 3GGDA 4RDHA 2F8TA 3CVOA 1C1DA 2YFQA 5F51A 1YR9A 3K35A 3GLRA 4FFOA 3CZRA 1QJCA 1QIKA 3E61A 2Q7DA 4E5YA 3CMCO 1YIAA 1KH3A 2NZJA 2Y71A 3H1TA 2R1UA 4X95A 4IQ4A 3WRYA 1Z7BA 4KE8A 2PH3A 1DIHA 1GZ6A 1GPYA 1SC9A 2B4RO 2D7CA 5ALLA 3SS8A 1SXPA 4Z0TA 3U49A 5K8LA 4DBLE 4ARSA 5FRDA 3RFFA 3CBGA 4UM9B 3B2EA 3K8ZA 2LKCA 4NH0A 4BNUA 1ZVVA 3UAXA 3KXDA 4I08A 4KVFA 1YU9A 3ZOZA 1BA2A 4IDFA 1J4AA 3B20A 2VJYA 3OZ7A 5I9SA 5CPBA 3WRXA 5BN4A 4RQTA 3HDVA 1O94C 1HZZC 5D84A 3BCRA 1KYYA 4WY2A 1IUKA 4I4IA 4L4XA 5IUJC 1MDFA 2WR8A 4DZTA 3SVLA 2C9DA 2AK3A 2GCPA 2PVCA 5CURA 4S2UA 3QPAA 2CKMA 2R7KA 2I3GA 2TRSB 4OM8A 4OBWA 3AH8A 1ZD2P 1I9CA 3GRRA 3ZCSA 3DW3X 1YCGA 3N8HA 3JQAB 2PKYX 4P32A 4G5OA 3STYA 3RIGA 5ALQA 2WM9B 1IJBA 4J3FA 3D8NA 3I2HA 3GYBA 4MV6A 3G2MA 1SVIA 1QANA 5LB2A 3EOBI 4LCJA 1XK6A 5F9MA 3TDKA 1J8FA 1DKUA 4BFZA 4C0JA 2EEPA 1NX6A 4WVLA 1B15A 1GNPA 1AT1A 4HRYA 1YQTA 1WPQA 2QV0A 1ZMRA 4J4TA 4BMCA 5J63A 4E08A 4DMGA 2ADMA 2NZ2A 2UUPA 4LHXA 4X84A 4ZVRA 4BQIA 1XTKA 3Q1KA 2XMCA 1U2DA 5JFGA 5KDOA 2VUHB 2AN5A 3ZV7A 3KTAA 2VYFA 3KSDO 1WCV1 3GMDA 3L7IA 5DWVA 1E9VA 1DLIA 4LBVA 5J43A 1A8QA 4XAQA 3IV6A 5ALZA 1JKXA 3A6DA 1YL5A 3Q3CA 4Z0HO 3TRDA 1OD6A 3CXUA 2AEEA 2C8LA 4K9NA 3GF4A 1BNCA 4OHCA 4NOLA 3ZZNA 3OIUA 1SBTA 1X0VA 1II8B 5EZ6B 2WOJA 1I3MA 3SKYA 2GILA 1SKAA 5JD6A 1UXGA 1VJ1A 2QZPA 3E1KA 5LXTA 2PSEA 4DABA 2ISQA 1ONNA 1IEQA 2P2SA 2UYGA 3ZDXB 2GPSA 2WVHA 3EZ9A 1XT6A 3DP7A 4LRTB 2CDRA 3TQOA 4GOMD 4XM1A 1TZKA 4BMOB 4YUXA 5JO0A 2IS2A 3M4XA 1W1IA 2A9JA 4JU9A 4RZXA 4DLAA 4N9WA 2Q62A 2QU7A 3AG5A 3NXKA 1XV5A 3LW8A 1E0SA 3PZRA 4ZOBA 2PUCA 4FOSA 1YO6A 4BXOB 2ORED 3HKCA 3ANXA 3TR0A 1E63A 3O47A 1EXVA 3OE7D 3RF6A 3C7TA 3BA1A 5DWDA 4JUAA 2FAXA 3CCFA 1T36A 1DWOA 1ZNXA 3H11B 3O82A 4JDPA 5AKJA 1FFWA 2VH1A 3BS4A 1G20B 3CIFA 1RJGA 1EK2A 1J1ZA 1PZHA 3HNRA 1Q12A 1K6MA 2BKEA 2WHPA 1WJGA 1IUNA 1FMLA 1XPOA 1GGFA 4PWZA 1MOQA 1FUKA 4N0PA 4ZMBA 2XUPA 3ZCQA 1YFLA 1NQAO 1YOVA 2HIHA 4E15A 4QWMA 1Y5RA 2CBGA 4MI9A 3VZRA 1KQGA 3ZHXA 1TL7C 3LKVA 4HSEA 3K5IA 4JAVC 2Q7XA 5JCPA 5FTNA 5JADA 3SP1A 3PEFA 3PLAE 2XCSB 4IQ8A 4K03A 4BE7B 1D4AA 2E21A 2I76A 3SHFA 5AW7A 3M1AA 1PI3A 3AF2A 3EXIA 1JV2B 1A9ZA 3E1SA 3FPGA 3KZ1E 4QYTA 5ALPA 1FP6A 2GCIA 1W0JA 1Z68A 2ZSFA 2BL4A 4XRRA 2XTMA 1GKUB 4DLRA 3I6IA 2UVDA 3HWRA 5DSZA 4ZCTA 2CDAA 2ZXUA 3RYFB 3S28A 2KPOA 4LWOA 1FX1A 1XU4A 5DHQA 4RWEA 1EE1A 3MXOA 4BX9A 4UPDA 3UOGA 1DRKA 1YFKA 1JJ7A 3WXBA 4DV3B 4FYWA 5CX4A 3I6BA 1HG1A 1Z0IA 2IPXA 1PR5A 3SS7X 2VBFA 1EDBA 1NN0A 2IU3A 1FFHA 1YB1A 2I3BA 1QRRA 4L5CA 4PR0A 4CLHA 3MQFA 1FRQA 2F1HA 2R6CA 2ADOA 2E87A 4HBZA 2BF7A 1ZHFA 5C8ZA 1E6EA 3BAFA 1XNHA 5DEIA 3WYEA 5CNKA 3CO5A 1W30A 1IYZA 3GFQA 3LYHA 1RAFA 2VPYA 2FP4A 4JLPA 4LVOA 1H2BA 4MSUA 3REOA 5A4DA 5HXAA 1QC5B 3S1SA 4HADA 5THQA 1CUBA 3RQIA 2R60A 1EZ4A 4TTRA 4E0BA 5HK9A 1YBVA 3T61A 4AZSA 5JMWA 3ZHYA 1K6JA 2PXXA 4FJ1A 1UM9B 3SQDA 5B58T 3ZQKA 1CEQA 1MIOB 4X61A 1KEKA 4FWIB 2HSWA 1EIZA 3LUHA 2AB0A 4JVLA 5FTMA 4OU5A 2WSSD 5WRFA 2X2PA 1IPHA 5CLHA 4FQ7A 4HDNA 3W8FA 3ZIAD 2OCXA 4C01A 2DUJA 4DA6A 2C3OA 3H5LA 1T4CB 1MG5A 1Y1RA 3K9BA 1QPGA 3ET4A 3E3LA 1Q92A 3CEMA 1J2YA 4WXEA 3I9NA 2VP2A 4BO5A 1FP4A 4XIJA 4L02A 4EG4A 3JY6A 3KJHA 8ADHA 3LCMA 1PNTA 4MUBA 4HDKA 5BPFA 3CRW1 5KVSA 5MGNA 3GEPA 2PUVA 4QBKA 5AI0A 1COWD 4J4BA 4ZD6A 2GTHA 2G1PA 3RUCA 3MTBA 1RQPA 1C3EA 1VTKA 3D7MA 4ZU1X 3VR6H 1U0LA 1M1YA 3WQHA 1T5HX 1FK8A 2NXWA 1G4HA 3TGWA 3K1JA 1F2VA 3UW1A 5A2QA 5FI3A 3PC8A 3H9EO 2QNIA 3WGUA 5ADVA 4TTSA 3GEIA 4LNHA 4ZJZA 3AF1A 1Y9DA 4ZVMA 2E82A 6ADHA 3O5AA 5EP2A 1UXKA 3LCCA 3Q6MA 3N6XA 1XA3A 1E3WB 2I71A 4R3WA 1BRMA 1W7AA 1OI7A 3TPFA 4F71A 4IM7A 3VKVA 4KG7A 1PF7E 2Q4DA 1E20A 3L8ZA 2Y0PA 1S3FA 2ZLBA 2DY0A 1N7GA 2X5JO 1QONA 1FNCA 1O95A 3PUKA 1GUDA 1G21B 3OFND 4IO0A 2PS9A 4YJKA 1FFGA 1PU2A 3DBRA 2C4TA 2OAEA 4K8RB 5BVHB 1O96B 5HWSA 4B3MB 1LI5A 1XZPA 2D5CA 2XTNA 4H1UA 3TX2A 3UMCA 5MFZA 2I54A 2WFLA 1IQUA 3A10A 4AKSA 2PZGA 2I29A 2RGGA 3FPSA 3VZCA 3ZDBA 1EHCA 5H9WA 1MVNA 4E13A 1R9NA 2HMAA 5FTWA 4TLLB 3R5FA 4IBOA 5CT6A 3FLEA 4DBZA 1LNZA 1Y9JA 1X19A 3I9MA 4URHA 3GT4A 1TT5B 4X5OA 3PFGA 5AUNB 4TUYA 3PEVA 3C7AA 4HN9A 3WL4A 5BOSA 1T0BA 1TI7A 1I51A 2ACKA 4L5BA 4Q3CA 2ANBA 3ZN2A 2Y1OA 3QPDA 4QOHA 1MAUA 2QLFA 2W37A 2CNWD 2WD7A 2OVFA 3BH7A 5D3MA 3TOXA 2H11A 1L7PA 3NEPX 1YDMA 3JQ6A 3GT7A 1B8VA 5AK6A 3BGSA 2YYYA 1SKQA 5F7JA 1SHTX 2WJAA 1FSSA 1RRPA 3A37A 3H4TA 5C2JB 2QUJA 3C1UA 2NQ2C 1SOUA 1P9NA 1W0KA 4AK9A 5H70A 1CRWG 1T5OA 2FV8A 2W6ID 1FTSA 3Q5DA 5AIBA 4S2EA 4KUEA 1F48A 2IDMA 4KWHA 1QLWA 2OBYA 3AY7A 3BK7A 1FUIA 2D59A 4CMBA 3LPLA 3VTFA 3VYTB 3LRTA 2QXUA 3H4VA 4KYIB 5BUQA 5DYGA 4F8JA 1N7IA 2QSYA 6REQA 5JMTA 2PJDA 1Z38A 2EZ9A 3VHXB 2ZKIA 3BMXA 5LLSA 5KSYA 3QLJA 3KOUA 4EY5A 2R6AA 3ZV5A 5LQSA 3VR6D 3EFOB 2MTBA 3JZDA 5ALOA 4O2AA 3PA8A 3H9GA 4CIWA 1LVUA 2QJFA 4L6CA 3TTWA 5F76A 1XTSA 3RYHB 5FBZA 3WWCA 2P91A 2AH5A 3X2FA 1AMNA 2YICA 4HYEA 3WX0A 2HJGA 2GYWA 2VOEA 2X0RA 1OROA 2BGIA 4BU0A 1Y33E 2B37A 2BUAA 4JOSA 3WLQA 5HM6A 3B3JA 3P96A 1VI5A 1IRXA 5HZHA 4UHEA 1BEZA 1QHYA 2FPKA 1R66A 3N2GB 4B3GA 1AZLA 3UANA 3FJYA 4F3RA 1XO1A 4AY3A 3SD7A 1CYEA 5I7UA 2ZBGA 2DVMA 4CKEB 3WIDA 1T0UA 3CX8A 4I0WB 5LOVB 3E9YA 1EBBA 3U9LA 3LLCA 1LZKA 1V26A 3RTEA 1KXJA 1W52X 2Q4RA 2GOYA 1PGPA 5JDIA 1KQOA 2GN2A 3EVGA 2XVAA 1Y98A 1ZAYA 1KDVA 4KXYA 2JGDB 4U39A 5IWCA 4KJXA 1DCMA 3H1PA 2QY9A 1E8MA 3FDZA 3DAFA 4FFNA 3U3KA 1O6FA 1W19A 3GJ8A 3FJOA 2YZGA 2WKSA 4HQOA 4I36A 1KNXA 1M67A 2NU8B 3TD6A 1P2SA 1RWMA 1FLDA 1W2GA 2PRKA 3OEHD 3DP9A 3FDXA 3ZDCA 2VJMB 5AW3A 2OMEA 3ZE2B 2QAJA 4DCTA 1AXGA 2GLUA 1JW9B 3F9RA 1TX4B 2ZWAA 4BCCA 5CDHA 1L8QA 5YASA 1E62A 1QDLB 2VI5A 4Q1EA 5A7HA 4LF8B 5H3CA 4PC1A 3H3XA 5L4LA 4CEHA 4C0BA 1GCGA 4QNNA 7GPBA 1V8OA 1LV8A 3MTGA 4UREA 3RASA 2J5RA 4N5HX 3FFTA 3VDRA 4D42A 2NZYA 4TS4A 4YS6A 3TQSA 4EABA 4UU7A 5LQCA 1V9CA 3KJQA 4JBGA 3M6LA 2CBXA 4QBGB 2A92A 1OPRA 4GEKA 3DQZA 3CFYA 4GECA 5H68A 1QX4A 5BSFA 5FBLB 1JIUA 2FKNA 3AMVA 3WGHA 1PV2A 2IXGA 1AHNA 2QTMA 4ALJA 2DH5A 2ZBUA 1WXDA 2XMDA 5DKFA 4ZO7A 2QRHA 4QJIA 4ZT2A 5KJ1A 3FTNA 1A9TA 3THWA 1UJ5A 2JGMA 3W9SA 4YUVA 1GGNA 4WKOA 5KSWB 4Q19A 5CDFA 2VYQA 1THZA 2ZAIA 5LZ9A 3HEAA 2LIPA 4G4SP 3ZJ5A 3COWA 1AQLA 1HX7A 5ARBA 4X00A 4YP1A 3KKPA 3U4IA 5EHGA 1TCCA 4BVJA 3PNBA 3AEUA 1GNQA 3T7IA 3LC1O 5LBTA 4EY3A 5AJWA 4QREA 1NULA 2ODBA 1M8JA 1SUDA 1J21A 3Q2OA 3V8BA 1JMYA 3H0EA 2RHWA 4BKOA 1I2BA 4BMSA 4R6XA 1DMRA 3GFBA 2DOKA 3FLAA 2A7QA 1T9GS 4FGUA 1O94D 4U6NA 3HN7A 3QTTA 1QRSA 1S3GA 4G86A 4I3FA 4HX5A 1P4JA 2I1LA 3VPXA 2A78A 1EP3B 2RGXA 2AG0A 1F6BA 1XP5A 2GKOA 3LE8A 2RBEA 3KQTA 1LSSA 2O2JA 3ZJVA 1K9SA 1FYVA 1QE5A 3KU1A 4FYMA 4YCSA 5SV2A 4GYJA 4KMOA 4AJJA 4AJPA 2X14A 1YI0A 3HB4X 2Y1WA 5FYQA 1IBMB 3C3XA 1R4AA 1W85B 2BEWA 4B46A 4M36A 4WA8A 5BQFA 4I2VA 4V02A 4C7BA 2I2CA 4GR9A 3ZOKA 1I14A 4OXXA 1ZOPA 3L8FA 5C8YF 5DXJA 3RWMB 3TLZA 1H5QA 2IUUA 4BNDA 4HEA1 2R6HA 3ULKA 4F11A 3WP0A 2X0JA 2AZ4A 4E46A 2PZEA 4FX2A 5JAOA 2Q1WA 3N7UA 1OT3A 3D3WB 5AOBA 4Y8VA 5BSKA 3PDJA 1WB9A 3DVLA 5ENVA 2GN4A 4QATA 3UO8B 4KFTA 5KNLA 4RVOA 1FYEA 5AICA 3WLOA 3QFSA 3PYLA 5IM5A 4Q05A 4V1CI 1GVHA 2HOQA 2FWIA 3OMXA 5KVCA 2ZANA 3QIVA 3C1TA 4HZGA 3TW8B 3LQRA 5GM1A 2ILTA 5BV1A 1SU6A 4D6XA 3PEWA 2GGSA 5JV5A 2ECQA 2H4WA 3TZLA 1NUAA 1QRDA 2J1LA 1T6BY 3ELUA 1PLKA 2EW1A 5BMOA 1K3UB 8ATCA 2BT4A 2J3HA 3I0MA 2AFRA 4IY1A 2D4HA 2Q2VA 1TM5E 2W6ZA 2EQBA 1RTTA 4HGYA 4OB8A 3ZHOA 4B7AA 1YC2A 2DRIA 4HXFB 1OPXA 4PPGA 2LR0A 2BWJA 1SQFA 1GA4A 2O3TA 5CDTA 2C42A 4JI0B 3G0IA 4IW3B 1A7UA 4H3KB 4I9HA 2JEYA 2Q6IA 1U4SA 5JDCA 5GAJA 1FFAA 2QTAA 1XUOA 1ENZA 1XRLA 1QFMA 4ROSA 4WTOA 1CY2A 2PMKA 4ZICA 2QTRA 5ECWA 4ENQA 3E7XA 3R77A 1RLMA 4FYYA 4RTQA 1LBHA 2IIVA 3OZBA 3BBLA 4WLFA 1VSQA 2G4CA 4Z0PA 4EX7A 2EFHB 3RADC 3JXEA 3JD0A 3WQBA 4NYIR 1IZ9A 2Q5OA 4JVNA 4K40A 3IESA 3NG1A 5E9QA 3MGCA 5FAXA 4B3HA 1OXTA 1AA9A 4PG7A 5IF9A 4ZEOA 3L18A 2FW6A 1PFUA 2NXJA 4C5BA 1C8LA 2NP6A 4D79A 3DMPA 2AXQA 3OU2A 4GGMX 4DV0B 1KI7A 4L4RA 4PCAA 2IHUA 5ALMA 2I1QA 2H57A 3CC8A 1ZK3A 5FBVB 3L07A 5FA6A 1YQQA 3ENWA 5GPBA 3WLSA 1LLQA 3JYOA 1D5WA 4CEIA 5KOJA 1ZDMA 2GBFA 5G3YA 3EEIA 2OD2A 2H4XA 4A26A 3W5VA 3P26A 1ULBA 4NESA 1K0UA 3S1AB 3UKOA 5CYGA 1PWZA 3DQQA 1WB5A 2ERCA 5KAPA 5C51B 3B8EA 5JCOC 4H7DA 3ADBA 1F14A 2QVZX 4EJSA 4Q3EA 1E4EA 4JY7A 4N12A 4P98A 4FX5A 4LWZA 4YLGA 2R5FA 1CUDA 3A1WA 5LA6B 3IOYA 4TX1A 3NH6A 3PKIA 5I9TA 3V8PA 4EHLA 3A0RB 4M83A 3BCSA 1TLFA 2B21A 4DCNA 1PS8A 1J23A 1H4VB 3U6BA 3RG2A 5BRJA 4O6VA 3AJDA 2HT1A 1RAHA 2WSBA 3L0ZA 2G4VA 1SUBA 4JB8A 3V46A 4C3ZA 2GAJA 3DOUA 2RAFA 2HA6A 4PYKA 4F04A 2ALJA 2GJKA 3LD9A 3CNLA 2HA3A 4DM3A 1MHTA 1PT8A 4R2WA 4CNQA 1QTNA 2EU8A 3KEGA 3LC7O 3S7TA 4YUYA