1BVYF

Complex of the heme and fmn-binding domains of the cytochrome p450(bm-3)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
152
structure length
152
Chain Sequence
NTPLLVLYGSNMGTAEGTARDLADIAMSKGFAPQVATLDSHAGNLPREGAVLIVTASYNGHPPDNAKQFVDWLDQASADEVKGVRYSVFGCGDKNWATTYQKVPAFIDETLAAKGAENIADRGEADASDDFEGTYEEWREHMWSDVAAYFNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a cytochrome P450-redox partner electron-transfer complex.
pubmed doi rcsb
source organism Bacillus megaterium
molecule tags Oxidoreductase
molecule keywords PROTEIN (CYTOCHROME P450 BM-3)
total genus 46
structure length 152
sequence length 152
ec nomenclature ec 1.14.14.1: Unspecific monooxygenase.
pdb deposition date 1998-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1bvyF00
1FVXA 3OX1A 5LJIA 1YOBA 5A4KA 5LLDA 2QX8A 4DILA 2MT9A 4BMOB 4ZVMA 4CF6A 2KLBA 1DX9A 1QR2A 1OBVA 5F51A 4OXXA 3ESZA 3N3AC 3JSXA 2V9CA 5F4BA 2X2OA 1V4BA 3D7NA 3F2VA 4GR9A 4H6PA 1AKRA 4YAWA 1FX1A 1CZRA 4C0XA 3B6IA 4NULA 4N82A 4QODA 2XODA 4LTDA 5EA2A 1YRHA 1FLAA 2WC1A 3NHKA 3KAQA 3LCMA 3NFRA 1GG5A 3O73A 1J9ZA 3F6RA 3K20A 4Y7CA 1CZNA 1VMEA 1WSBA 3ES9A 2Z9DA 1SG0A 3NLLA 4N65A 3OVMA 4R81A 5LBTA 2XOEA 5JROA 1ZX1A 4H2DA 5FA6A 1AKUA 2KQUA 2MOKA 2QMYA 1YCFA 1AZLA 2W5UA 3SVLA 1JA1A 1D04A 1C7EA 3QFRA 1FLVA 4FGLA 2MWMA 3GFQA 4PTZA 1J9EA 4NLLA 1J9GA 3L9WA 4ESEA 3GFSA 2FVXA 5FX2A 1AKVA 5EAIA 4LA4A 5EMNA 1OBOA 4FX2A 3N39C 4ZVKA 4N9QA 3FX2A 1RLIA 3NHRA 3OWHA 3W77A 3ZHOA 3KLBA 5LBUA 5TGZA 1AKWA 3OJWA 3HA2A 3U7RA 4Y9RA 2QWXA 2X2PA 4DIKA 4QOGA 3OWXA 1FUEA 4FGKA 2R97A 2M6SA 3F6SA 2OYSA 2AMJA 4BMPB 1H66A 2QMZA 4Y9UA 1ZWLA 3B6KA 4C14A 3EYWA 1QHEA 3P0RA 1T5BA 2V5VA 3L9XA 3U7IA 3NHJA 2QR2A 3W7AA 4QOJA 1E5DA 2BN4A 2BMVA 1CZLA 2BPOA 1H69A 3FNIA 1SQSA 1AKTA 1QBGA 2FZ5A 3ESYA 2HPVA 3B6MA 1NNI1 3OX2A 4J8PA 2FDXA 4YALA 1AHNA 1RTTA 2Q62A 4YAOA 5NULA 3NHUA 1AKQA 4QOHA 4YQEA 1AMOA 3NHLA 2FOXA 2MTBA 1D03A 2B3DA 1QRDA 4ZVLA 1FLNA 4LTNA 2ARKA 4CETA 5LJLA 3FVWA 1KBOA 4XDHA 2BF4A 3NHYA 1CZUA 1YCGA 1KBQA 2OHHA 3B6JA 4DY4A 2HNAA 3TZBA 3HLYA 3QE2A 1D4AA 1JA0A 5F12A 1BVYF 1YCHA 1RLJA 2M6RA 1FTGA 1XI2A 3EDOA 4D02A 1FLDA 3KEGA 2GSWA 2Q9UA 2HNBA 4LAFA 4YAFA 3W79A 3R6WA 6NULA 2V5UA 4LTMA 4QOIA 4C0WA 1OFVA 3NHPA 4XDGA 2FCRA 3NHFA 4U7GA 2FX2A 4C76A 1ZWKA 4F8YA 4ICIA 1XT6A 3OX3A 5B3LA 1XYVA 3K1YA 2OHJA 2FZVA 3QFCA 1AG9A 3ESXA 1C7FA 2QX6A 2RG1A 3HR4A 5ULLA 4QOFA 4U7HA 3FW1A 1X77A 1T0IA 2OHIA 3NHSA 5FUQA 4HEQA 2F1OA 3OJXA 5LVAA 1CZHA 3NHWA 5B3KA 2Z9BA 2R96A 5BUCA 4YAUA 2QX9A 2BZSA 3KAPA 3O2NA 3F90A 2Z98A 3TEMA 5LMCA 1I1OA 1F4PA 4HS4A 3S2YA 1B1CA 4GQIA 4GI5A 1CZOA 2N1MA 1YDGA 1XYYA 3UXEA 3G5MA 2D5IA 4ZVNA 4QOEA 2FAXA 1RCFA 2Z9CA 1TLLA 1DXQA 2A5LA 2QX4A 2ZKIA 3LT5A 4FGJA 3TE7A 4U7FA 3UXHA 3FJOA 3GFRA 2FLVA 3W78A 1CZKA 1YKGA 4PU0A 4S24A 1TIKA 3N3BC 5NLLA 4PTYA 3RPEA 1BU5A 1DXOA 1WSWA 4M0CA 3GAMA 1J8QA
chains in the Genus database with same CATH superfamily
1T0UA 1J00A 1VHTA 1ZL2A 4R5HA 1XR3A 3W1VA 3JTMA 4NH0A 5DX8A 1I3CA 5JS2A 1U0OC 2B83A 2I8CA 1Q5PA 2WFLA 4I50B 4K9RA 4J7XA 4GMXA 2HLHA 3CE9A 3CW9A 3PFIA 2VVTA 2NIPA 3C4VA 2YZMA 3SZ3A 4CGYA 5JASA 2PKWA 2R65A 3TB4A 4KXFB 3O1IC 4TWAA 4ERXA 3E15A 1U5BB 5CNKA 1ZAKA 5BW8A 4YROA 3LCUA 4OHYA 1YB1A 2W6JD 4N0MA 1CQXA 4MHSA 4OX9B 2ZWVA 4R2KA 1U4OA 2XMGA 5FWDA 3KQHA 3E7PA 1TKCA 2GEDA 2HTEA 4XVCA 3O4RA 1R9GA 3FHTA 4P5EA 3KXIA 2V3VA 3BMNA 2XX3A 2JI8A 3AL2A 4PLHA 2AJTA 1R9MA 4MQUA 1JA1A 2V3WA 4FXOA 4PTZA 2B6NA 2Z2IA 4GNKA 1W88A 2DKOA 3PDHA 4QA9A 3E9CA 3Q7RA 2O8EA 5JALA 5FWYB 3TAHA 3I2KA 5HZGA 4RDXA 4U1RA 4NPAA 5FUXA 1ZRNA 3IDOA 3C97A 5IW8A 4I1VA 2C5BA 2H9YA 3TIXB 4X6XA 2JHAA 4XWWA 4PYIA 4XQCA 1P61B 2WVHA 2ZIEA 3H2HA 3FIUA 5CMLA 4CLHA 5I9LA 4MRVA 3OETA 1UIRA 2ZYIA 1WBJB 5DGTA 4BQPA 4R16A 1HXHA 4Q3BA 2JJ2A 1I8TA 1I13A 1QHFA 1YCDA 3B7PA 4KIFA 4CCWA 2F3UA 5DNDA 4MA0A 3EAQA 1VB5A 3OX2A 5LUAA 1QSGA 3DT9A 1VYVA 4FMCF 4A8PA 2C4HA 3U13A 4KZKA 3M2TA 3HG7A 4QOHA 4CM5A 4Z51A 3IXMA 2WWTA 2FFHA 2AS0A 2BOVA 5KHLB 1XMPA 4EO7A 1MO5A 4LHSA 1JLSA 4US0R 3EC2A 4ZQCB 2J0QA 3LF2A 5TS2A 1NY6A 3KKEA 1U1IA 4JC4A 4PZDA 5D84A 2ESRA 2V0CA 1A9QA 1JIUA 4ZEOA 4RK6A 5I5GA 5L3SA 2BFAA 2FZLA 2JEOA 2WMOB 3FPCA 1CDDA 1QRRA 3H1EA 3R6WA 2LTAA 5GGYA 3SIRA 1U3UA 3CGWA 3MWKA 3TK1A 4HNRA 3WYEA 5ICMA 1NXVA 4E33A 3JPYA 3I9JA 2Y0PA 3TTXA 4EVQA 2E4VA 3CWZA 4M0DA 2QE6A 1Q14A 4WCFA 1G3IA 1K8ZB 2OV6A 3ITEA 4WTOA 2H11A 1YBMA 3EIEA 4JI0B 2SKDA 3M9XA 3OZBA 1GWNA 1KAMA 1E2FA 1JQKA 1N5IA 1D0VA 1DUVG 1WUIS 1KYQA 5J9FA 1SUIA 1ILEA 3MPUA 5FTJA 4AKHA 5IDYA 2E5FA 2XDAA 4OU5A 2R4TA 1ZITA 5ESXA 4BPRA 1QV7A 4HNAB 4DS3A 4ETNA 3M4YA 3OO1A 1DC4A 2HQOA 3QEJA 4WY8A 3T0GA 1M2GA 2WTUA 4ROSA 3NM5A 1OF1A 4YRPA 4CKYA 3FNBA 5HTOA 3CO0S 1D2RA 4GRDA 4IUYA 3NJ8A 2PZMA 1NVAA 1IEQA 3DCNA 4FYKA 1BMFD 4K03A 4NBKA 4BFYA 1T4GA 2WIDA 3W8NA 1CRLA 4S24A 1CU1A 3K1AA 4WCFB 4CPDA 4DB2A 3G89A 3WRYC 5EJEA 1DXOA 1T1SA 3WWEA 3M9LA 1PG2A 1Q0QA 1P7PA 2QP3A 2W71A 3ZGOA 4HB3A 1OBHA 2MT9A 3PE4A 4HUQA 1OXMA 1DDOA 1PJAA 5LP6A 1B3BA 4AJPA 4KR7A 2YOFA 3COJA 4LQ4A 4X1KB 1HTTA 2NYUA 2IXDA 4V0RA 4WJKB 3CS3A 5EPEA 1QHIA 3ZGNA 4C4YA 1E2LA 1E89A 4EHAA 5IHXA 1K0FA 2FUNB 2G80A 2ZT6A 4LJSA 1U31A 5K7SA 1SA0B 3A9RA 3F6CA 2O2JA 4O2RA 1W93A 3AEQA 4KQXA 1FDVA 3PWSA 2PYDA 5EYPA 4PCUA 3ONDA 2O8DA 4YS6A 4G41A 1U2DC 3S40A 1DCKA 3V4OA 1E2BA 3Q1KA 2O8CA 2P0YA 2QT1A 4HFNA 4IVPA 4XM1A 4GH5A 4US2R 1KKUA 2I03A 4FHGA 3UYLA 3W9BA 2CLFB 3MGAA 5TS3A 1S2MA 1GPKA 1ZVJA 4URXR 1E2HA 1ETUA 3THWB 4PYJA 1RWXA 1PKXA 2YWEA 3NHRA 4M8NE 5CLLA 4CT4B 5EFOA 5IK2A 1NBAA 1U94A 4ZZIA 2GBFA 4JXXA 2G76A 4Y67A 3OQNA 1BJKA 2IWRA 4QU8A 2JIPA 3OUTA 1GG9A 5DHQA 3V1LA 4ZQGA 4M60A 5EXSA 3UO8B 2C0CA 3NHJA 4RZXA 4UREA 1XEFA 2VZ8A 3FOEC 4M0LA 4XPZA 3P9NA 3QXJA 4G4IA 1QYCA 3ZKWA 4H0NA 3QE3A 4A6XA 2WYHA 1G8HA 2BM9A 4BFCA 5JXHA 3WAGA 3T35A 2CV0A 2QZ9A 5ER6A 3GLGE 3PDWA 3JVIA 5FLKA 1QO9A 4Z86A 4QPJC 4R9VA 1XKLA 4XOUA 4EECA 4K9QA 2XB8A 4RORA 1G5IA 3NHYA 4LQLA 4OMUA 1HT3A 3J80A 1Y8CA 3D3EA 2FRXA 4C88A 4RTPA 3ESCA 4ZZ1A 4KE9A 2J5BA 3VZCA 4L7QA 2GBIA 2OE2A 1G5FA 4R8LA 2QW8A 4P4NA 4R8RA 4S12A 3CVXA 3LBYA 4UDXX 1EX6A 2AQKA 4AZ0A 1JU3A 3DFUA 3RS4A 2B35A 5EVJA 3ESXA 3H11B 2ZYRA 4EUNA 3MCUA 4Y1FA 2NNWB 3G2KA 4BVFA 1S3FA 2P9GA 1Y3AA 5F2EA 5CD9A 2C1ZA 3QH4A 1Z5UA 2ZE5A 1G4HA 4DCJA 4UHCA 1FQWA 2Z98A 1KGSA 1XHEA 3BWVA 5I3ZA 1QM5A 1AKMA 5FA5A 4GI5A 4R2MA 3TSOA 5BSVA 4J1NA 4FC6A 2POQX 1X2EA 3TAUA 1OASA 3G2IA 1AMNA 2YXBA 4QO7A 1YT5A 2NYAA 2G9ZA 2HA4A 2LVBA 5CYOA 5DNAA 1L7BA 1G3QA 2X8BA 5ALIA 5HRUA 4AKGA 4IHJF 3IDSA 4JY7A 3PNPA 3RTEA 1DC5A 1PF7E 3QSGA 4KMOA 2WJVA 1Z2CA 3DW3X 5HX7A 1A7JA 3ZHXA 3UK7A 4Q7KA 3TI7A 9LDTA 1ZN7A 3C98A 3IPYA 1CS0A 1F0NA 3D3NA 2VPQA 4H7JA 5JAZA 2JG3A 3A4IA 1TW3A 3I8OA 2BGIA 1SQ5A 3F9RA 2RH5A 3GLIA 5JTTA 5IUJC 1H8HD 4LRYA 1KZ7B 4NZNA 4NK5A 3UUGA 4W5NA 3N58A 1J7KA 1PLLA 4JWKA 3BL5A 4LXHA 1E2MA 1NZFA 4TZKA 1L7RA 2WAMA 4ZMBA 1E1LA 2RGUA 2GEVA 1ISIA 3K05A 5BN1A 5C8XA 5ELXA 4JVOA 5F7XA 1CZNA 2IZ5A 1PT8A 3WGNA 2AN1A 3SYTA 3PEWA 1W9HA 1Y98A 3HWSA 3I9V6 4KPUB 1S2NA 2VH1A 4TQAA 4A2PA 2G5GX 1CWUA 2PO7A 4KXUA 2JH8A 2CBGA 5TDHA 3NVKI 4BGUA 1PUJA 2N3ZA 5KDLA 3QBEA 4XLLA 4WUVA 4QYIA 1YE8A 4GDMA 1RKBA 2HO5A 2XMSA 4L07A 4R9NA 3TMAA 2DCUA 4D25A 2X8LA 5LU9A 3WJ7A 1WSAA 3SMVA 2OM6A 3NBQA 1HEIA 1TGYA 4FTWA 1GCGA 1O77A 3KSMA 4JUIA 4PRLA 1SVWA 4EF6A 1B43A 4HDSA 4DCPA 3UPUA 2WY2D 5B64A 5E4JA 4BKMA 5JXWA 2OESA 2PZLA 4YRZA 3A26A 3I5MA 3MTIA 4Z9AA 4BN4A 1X13A 5F2OA 4BRZA 2HX1A 4HGNA 1RXWA 4LF6B 1GPAA 1Z0SA 2EFYA 13PKA 2L17A 3V80A 3F71A 3UTDA 2Z57A 4EDFA 3A6PC 2K4MA 3A9SA 4U2BA 2EXXA 2O8FB 5CDFA 2FOLA 3CVOA 3JQ8A 5EPOA 3U3ZA 3HB9A 4E03A 4QLAA 2J6BA 1CT9A 4ECEA 1YRQA 4UBLA 4JVLA 4K28A 4Q9LA 3BAFA 1SM4A 4C6SA 3EODA 4DXAA 2FUG6 2LDXA 4J2OA 3C43A 2D0OB 4DSUA 1RYYA 3S5JA 2R8OA 4ETWA 5C1IA 5LJLA 2NVOA 3G8DA 3R0VA 4R8MA 4KOAA 3RWOA 4CQLA 1MZPA 5KYYA 3R9IA 1UBJS 1GAEO 3HLYA 3NMUF 5CVUA 2K7ZA 3UUEA 2QN9A 3KJZA 1KF0A 3H1FA 4JS0A 1ICIA 3K6SA 1DAGA 2PFKA 3SHVA 4H7DA 5AH0A 1NVEA 3AJAA 4YT4A 4J1TC 1SU8A 2BP7A 2Y4OA 4IJMA 1FFBA 2CL0X 3H9GA 2W8ZA 4K7JA 2ZR0A 5SZIA 1AQLA 1P2UA 3N75A 4KLCA 4EKEA 1TT5A 5DGXA 3ZH2A 4EFDA 2ANCA 4HB0A 3NP7A 1K5DA 2O0KA 2R1TA 4HX5A 2W9XA 1NUQA 2P8JA 3SCZA 3T9FA 2ZIXB 3BXOA 2RIPA 4G0MA 2PWAA 5DNCA 4ZQEA 4TLLB 1O8BA 2H5EA 4TXHA 2AHOA 4BOYA 3JATA 3ZQKA 3VZRA 4DOMA 4EUHA 5CB4F 1V37A 2IXEA 4I5GA 5FL7D 2W2VA 4C08A 5JT1A 1RM3A 4FE4A 4D0GA 1DBSA 1BWQA 3SC2B 5H70A 5A2GA 3KB1A 2ENUA 2V8OA 2FSUA 4B5KA 3LT5A 3NNSA 2WJJA 3TLGA 3P0IA 4TMVA 1XLWA 3AY6A 3IP7A 1T1IA 3F5DA 3UHJA 1Y8AA 5DPMA 1I0IA 3AF2A 2RGDA 5AI4A 1ONOA 1Y8RA 3NU1A 3REFA 3VZQA 2WJ4A 4G36A 2EHDA 5FYQA 1OZFA 3KCNA 3ZKAA 3IUQA 5A7FA 1ZJJA 2P6UA 3D8HA 3PNKA 2GASA 4J3JA 2BZGA 1U4NA 5FUWA 3Q3EA 3LW7A 3AUJB 2OQVA 2E49A 3AESB 1YQUA 3GUUA 5J2UF 2PV7A 1MQ8B 1T9GS 2VP0A 3NX4A 1M1YA 2EYQA 4GZLA 2IEDA 4M55A 2I3ZA 3DCYA 3ABIA 2GHTA 1DKRA 2FPPA 3QMMA 4I14A 4UUOA 5BQ3A 1KS9A 3ES9A 1T2FA 4JBYA 4EEXA 2BUAA 3WZMA 1T15A 2ZJYA 4HADA 2HIGA 3QVGB 2UUOA 3HKCB 5K3CA 4CF3A 2QG9A 2VNSA 1LKZA 1VYUA 5CVEA 2I80A 1MC1A 1NQTA 2WYUA 5TSDA 1MEOA 4L0QA 3RFXA 3WGGA 3WYDA 4DADA 3ZGYA 1JEQA 2YN0A 1R3UA 2GETA 2XB6A 1JBQA 2VZEA 4BVBA 4H1WA 4PX5A 5CT8A 4HZIA 4Z9YA 3AKCA 1JFFA 1TECE 3E0QA 3FX2A 1OZGA 4RVCA 1XTBA 2UXCB 1PG5A 4G9GA 5ITZB 1PNRA 1O5OA 1E9BA 2R44A 5D7BA 2ZSIA 2ZZKA 1W94A 3B12A 4LPSA 1IIRA 3P94A 4FBMA 3ZY5A 1OTXA 2JRCA 1WMEA 3HJHA 1K2WA 4OQEA 4RUKA 2ZTHA 3WVNA 4N7MA 4WFJA 5CCEA 4UMEA 3JWIA 4WBNF 3LBAA 1WE2A 3TS1A 1UMDB 4DA0A 1RC8A 3M2PA 2V7QD 1XMJA 1MUUA 2NXWA 3M0EA 3RVMA 2VDMB 3F3SA 3TB6A 5DEIA 2XI4A 1QGOA 3L8DA 3O3NB 1JLLB 3OFND 4HQOA 4YQEA 3S7TA 3ZBQA 4BAUA 5JNVA 4LS3A 5CA1B 2HK6A 3IXQA 4LTNA 1VJGA 2H1HA 4K6KA 4NYIQ 3QPCA 1ZC3A 4LBVA 2WIBA 3CXRA 1LGYA 2P11A 4LXYA 1CUHA 3EUFA 4R0VA 3KSBC 3ZE1B 2E37A 3QHQA 1BVYF 2OV1A 4GOOD 4D02A 2DWQA 2PH5A 4M0KA 2JHGA 2NV2B 4WY5A 2JFFA 1KI8A 5LUBA 5JVDF 4B3TB 1EFVA 3F3YA 1OFIA 4JBNA 1ZNYA 1ZGCA 2A14A 2X9GA 2E7ZA 2AXEA 3EFOA 3NYIA 4TTQA 2XBLA 1TRKA 2Q4EA 2YDYA 2BMDA 1QR6A 4DCTA 4MS4A 4YB8A 1E0JA 2FWPA 3GFOA 4XUCA 5GM2A 2O3JA 1M66A 1MKYA 5JXJA 3SNHA 2ONZA 4P3KA 1EVKA 1ZVVA 2J4CA 3ECSA 4MV7A 4BNWA 3TLMA 3GLRA 3O9VA 2PN1A 2V7WA 5FUQA 2RB4A 1VMIA 5BRJA 1F2UB 1F6BA 2TMDA 1Y8QA 2ZS9A 3V7UA 1D3AA 1IDOA 1YJXA 2AEFA 3KYCA 2ZDQA 3MHTA 1JR2A 2ATIA 2GRUA 1Y8QB 1MQ9A 3DCIA 2Q0SA 3FXAA 3KXPA 2DX7A 2JFZA 3AZQA 4KEAA 1PQWA 1ABFA 2NYRA 2O1SA 1I0LA 4E5DA 4YDSA 1JHVA 1RBMA 2VUIB 1VMKA 1GL7A 3REOA 1PIWA 5B4TA 4IJKA 1TLLA 3RU2A 3OT1A 1XZQA 4LW8A 3ICEA 3BB3A 3L41A 4RMGA 3TGPA 5CH8A 3VSDA 3IVGA 4S0ZA 3OJFA 1OAOC 4I4NA 1L9KA 3CZPA 3T41A 2FR0A 2FXIA 2HL6A 3HBNA 2PVPA 1U98A 3NIFB 3PUXA 4IIJB 4DAOA 4B48A 3H19A 5LM3A 1ZOPA 1TFUA 4BNNA 4MKZA 2ZTUA 2PUAA 2Q6VA 1FUUA 2WT9A 2HB6A 3JRWA 3L0YA 4I1OA 4U7TB 1O94D 4UULA 4E2WA 4EARA 5H82A 3U19A 2HF8A 3EPLA 4ES6A 2QQGA 3ZWVA 4C5CA 3DBRB 4X6LA 3E1GA 4P3PA 1DIOB 2V45A 4JEIA 1U7OA 3P5SA 3Q9SA 4MRMB 3NNNA 2Z9DA 2R1VA 3N8IA 4FW9A 4UPDA 2FFAA 2VP9A 3U3KA 2P9EA 4IIDA 4QGAA 3WQHA 1P72A 3JD2A 2OAEA 2FHPA 4IKEA 1F8GA 2IU4A 3S3TA 2Y1WA 2W2KA 3A6ZA 4X44A 4YUXA 1C7EA 2NUAA 4UHKA 4J6FA 3WTBA 1UXHA 4RYLA 1XD9A 2X7HA 4DSZA 1T5DX 1R15A 4HP8A 4I6JA 3SR4A 2CFTA 3PGKA 5FO0A 1QGED 3CB2A 4LJRA 3S70A 5GJWC 4P0QB 3PKZA 3TZCA 2GMWA 4V0MA 5BW6B 2H2FA 3KLBA 4QUKA 1EVZA 4W7HA 3VU9B 2QIPA 4I4TF 3ZJ4A 4UQOA 4V0LA 4W5OA 3SU8A 3VDQA 3UKDA 1S1CA 4WNAA 5JCPA 3NTXA 1NOJA 2R7AA 3V46A 2IX3A 1PW5A 3DDUA 3UH0A 4CM8A 1USGA 2DUUA 5AUNB 2VK2A 1IZYA 5A03A 4J8PA 1Z4NA 1HEUA 1K4KA 1VL0A 1VZ3A 5DCLA 4JFAA 1O89A 5KO2A 3VPGA 2DVMA 3E0XA 3N2KB 2FYTA 5C7IO 2PX8A 1YNOA 1JEYB 5HKKD 4WQMA 4ZEVA 1AUXA 1XQ6A 1LLFA 2D0DA 3HDGA 4K9PA 4IHJB 4DV0B 4XB6B 4WKOA 1PNQA 1P2DA 1K3TA 3ET4A 5CB6A 5KNDH 3SKYA 4M87A 4D9GA 4AY4A 3L04A 5D00A 4X65B 2QR3A 2AF3C 3OPYB 3E9MA 2E82A 3ZY2A 1FNMA 3Q87B 3I62A 2WILA 1DWOA 4D7AA 4KTTE 3TZLA 1SIOA 1LVUA 2AUMA 4YT8A 4RHTA 4BZPA 2IV7A 3GH3A 4UHEA 3OCVA 3TJZA 3UCXA 3VPSA 3THXB 4LJ5A 2C8VA 4MICA 5FFMA 5CDUA 4BB5A 2WV7A 4P3XA 2Q6IA 2XOKA 5L3VA 1H3EA 2ETVA 3IQEA 2D0IA 4FIDA 4R54A 5J2UB 4AN1A 3NW9A 2A7QA 1ND6A 1G8FA 2ODAA 3LC7O 3FJ1A 1ISSA 4V38A 3KQVA 4GGPA 1TIPA 1PL6A 3O2QB 3QPDA 4G0OA 4IDNA 4MVJF 4C4OA 1C9MA 2Q3FA 4IDBA 4Z0TA 5ALYA 3TIGA 3UXEA 3BD9A 2JFNA 3FHCB 1BGWA 3I92A 1EXMA 1UEXC 4W99A 4CR6A 5DX0A 3TE7A 2FFBA 2AQIA 2R47A 4QVKA 3PICA 4UXIA 5KQGA 3TDKA 2BHTA 5AXDA 3ZS8A 3PD0A 4B2YA 1QAOA 2DJ5A 2LPMA 1KPGA 4MR8B 1NVGA 1Z3IX 4OFWA 2XWPA 2NX2A 4X6YA 1DAMA 5GZ6A 4J1TA 5JAMA 2OG1A 1YC5A 5JI3E 4O0MA 3L79A 1OBVA 1JNXX 1YBAA 2ZCUA 5EOVA 1JQDA 4CEIA 1MFPA 2W6IA 1KO1A 1WVGA 3GRVA 3JSXA 4FOLA 4BFXA 5FR1A 3E9YA 3M6LA 1ZOLA 3H4IA 3AWDA 4R31A 4HNVA 1SK9A 4O2AB 3RUIA 4J07A 3U6KA 2VUUA 3G17A 2XHEA 3DBHA 3IKJA 2WTMA 1AURA 1GG5A 4IDQA 4GOKA 1RZVA 1GCAA 4IFIA 3L02A 1P0CA 1RYMA 5LBTA 1JEEA 5A6VA 4ZXPA 1X42A 1ZCJA 4JB3A 4NJMA 4O2LA 4BJ6A 1DUSA 2XDQA 4M22A 3HYTA 4ZI5A 2BGRA 5KTMA 4KK3A 4WNYA 1D04A 2YC2C 5ADWA 1YJAA 3DXZA 4MV3A 1DP4A 3RVOA 1JAZA 1VJ5A 4LZWA 1GITA 5KX5B 3GR6A 1TCUA 4U6SA 2DHQA 4YV0A 4WA8A 1YA8A 3GPCA 3OG9A 4RIGA 5FOVA 1E4OA 1VHDA 1VKJA 3ILHA 3EG9A 5ES3A 5FBWB 3LXMA 1NZDA 1KU6A 3ICVA 3QFTA 4A2CA 3BMQA 1TO1E 2PGXA 4FFVA 2NVBA 2W6ZA 4BAGA 5LXTB 1LBSA 4G1BA 2H2WA 2EP5A 1T9KA 3D1VA 4NV1A 4YP9A 2ISCA 2CUNA 3KR9A 5EJIA 2OBYA 2V03A 5EIBD 1ISFA 2UZAA 4AG6A 4FB4A 3JALB 5SYAA 3W2EA 4LHEA 3W0LB 1EWQA 1K8XB 3D2LA 3G13A 4ZDWA 5ABPA 3NWJA 1K7EB 2WF7A 4OJKA 4JXKA 1FU8A 2XUGA 4KBYA 1RQPA 1MB2A 1NLZA 3LQYA 4IG4A 4CFYA 4EW2A 1SXHA 1A77A 1EDBA 3IR5A 2MCFA 2AOWA 4GX5A 1JQJC 1TEVA 4DV2B 2IXGA 1W35A 1X7WB 4R1TA 1E0DA 2ZTMA 4RD4A 6Q21A 4EG7A 1LV8A 3GUCA 3GZNA 1UZLA 4EA6A 3NUGA 1TW2A 3HB4X 3AERA 1E77A 2DMRA 3JQBA 2PU7A 4NOLA 4G07A 3P2JA 3R0QA 4RPJA 5G0SA 4A6DA 1DRVA 2Z2XA 3R9KA 4EJSB 4JASB 5D87A 5BW5A 1VI6A 3WP0A 2D00A 2ZXUA 3KJFA 3MPOA 1B73A 1I2ZA 2ZRQA 2OHJA 1XVTA 3AYZB 4TOIA 1JA9A 5DVZA 5FPYA 3H2GA 3AR4A 3HUFA 4YBZA 5REQB 5C18A 2PUCA 2ZYTX 5E9WA 5AUQA 5DI3A 1S3IA 2F1OA 3BFXA 4D4HA 2FEKA 2GRJA 3SQMA 3F74A 1XCJA 3CNBA 3DW1X 1FYFA 2EDCA 2WG0A 1T4MA 1BSVA 4PSVA 4PVCA 4X95A 1KVRA 3TFQA 4XGQA 3VR1A 2CFRA 2WP8J 3RQSA 1W0KD 4IO0A 4F93B 3L4JA 3HJFA 3TG2A 1JT2A 3OE7D 2NT3A 3ZV5A 3IL2A 2D0PB 2IUEA 3QVSA 4JUCA 1AO3A 2H06A 3AFIA 1JXAA 4HRYA 4OVKA 5AVUA 1V5EA 1W9MA 2BSXA 3K2QA 5ECYA 2BR4A 2QMUA 3IQWA 4TUYF 4BNUA 1E66A 4REOA 3SLKA 3U6BA 4F2DA 4FDUA 1HFKA 1DE0A 2DCMA 3MT7A 1Q22A 4Q7LA 1I1QB 3JYPA 2F00A 1G98A 1XZFA 5C0OE 4ZYUA 1C1XB 2GPSA 5A9SB 1F3LA 5KJFA 4EP1A 3ZBPA 3VYVA 1WMAA 3IDQA 3WQRA 4YR7A 3WGIA 1A88A 4FFBA 2FW7A 1DRWA 4JZKA 4LNUA 3URMA 1I7NA 5F9HA 1Z83A 4EHNA 4ZCIA 2BM8A 4FI3C 1J8YF 1I6MA 2P1RA 1NQWA 4QUHA 1QX4A 4UDOA 4BBZA 2ZSKA 3HLTA 4QFMA 3TR5A 3CUYA 3GLGB 3B53X 1GUYA 3OHMA 2F59A 1BO6A 2CD9A 2A1TS 4GOMD 4KQCA 4V02A 4PZAA 4KREA 4AN0A 1E1YA 4K5QA 4UEQA 3TECE 2IXTA 2ZU0C 4GEGA 2C7PA 2C1EA 2HMWA 3COPA 2B30A 1FLVA 4E14A 3A4MA 3GFQA 3PRKE 3PHGA 2HRCA 4Z7QB 4S0XA 4FFRA 5MGBA 3LD9A 3EUEA 2DQKA 2Q7DA 3NVMB 4M1QA 2XIJA 1H05A 1Y1KE 2RGEA 4OP2A 3U61B 3BF7A 3ZWYA 4BGDA 4UBJA 4QJ3A 3W2IA 2AKYA 4I19A 4DDWA 3LT2A 1JMVA 2OBFA 1MX5A 4JT4A 2HBRA 3D2BA 1COZA 3DOUA 4LJ8A 1PVVA 5LYJF 1QQAA 1ENPA 2QORA 1BCRB 3MJHA 3D4LA 1VZ2A 2GH1A 2C7GA 3EZ7A 2OG2A 4OAQA 1C7IA 1JSXA 3DBLB 3C5VA 1RAIA 2WSIA 1NUHA 2I22A 1U3CA 3CUKA 2JDIA 3DC2A 3DPIA 3FDZA 3FZEA 3NEJA 5ALPA 1UXGA 1Z6XA 4UAUA 5KKAA 2R7LA 1HUQA 1KI6A 3FCCA 1E3SA 4GICA 2UXBB 2YQZA 2GFQA 2IYNA 1C1HA 1J8DA 3VC2A 1E63A 2PMFA 3IC5A 4JLJA 4RLHA 4BLQA 1PEDA 4JWTA 8ABPA 1BDIA 4B7AA 1JQEA 1UC4B 1XLTC 3RUPA 2EERA 1YBFA 3E9RA 2EKPA 1U8FO 2R6R1 2QTAA 1UF9A 3N1UA 4GXTA 3M3DA 5CDYA 3S1LA 4G86A 3QE2A 4OSPA 2J5QA 3IFSA 2GYYA 3O4IA 4ESOA 3IYLW 5JRZA 1FTGA 1FUIA 1MORA 1WABA 2JGIA 3I34X 2I9KA 1VE6A 4MK4A 3SXUA 1OILA 4AO7A 2XRYA 3RT9A 1PQPA 4DMLA 4EK9A 1WV1A 2QL6A 4GLFA 4ZT4A 4EJ2A 5TJ9A 2GCGA 1N2IA 1B23P 2BM1A 3QLJA 5TGTA 3VVMA 3AF0A 3NWOA 3IMEA 4EGQA 1CNEA 2YW2A 2WPDD 4C9BA 4LMPA 4OG2A 1USVA 1XZEA 3MGGA 4DL9A 2DPMA 1CUIA 2UYGA 2HR1A 1RPJA 2PTHA 2C2KA 4X9XA 3GPLA 1K27A 1QIEA 1DFHA 5JCZA 1ACLA 1QP8A 3K2IA 1QHGA 4GW3A 3TEJA 1V4NA 4X63A 3M6VA 5ICSA 2GPTA 1Z45A 3TW4A 2EX4A 1FOEB 1LRJA 1P81A 1QHHA 3FGZA 3KNZA 4UUNA 4IAOA 5T67A 5AM1A 3V7FA 1II8B 4L8WB 4TXLA 2X0FA 5LQAA 4CL3A 1X1QA 3H9EO 4FK8A 3ICQB 1H23A 2E87A 2VDKB 3DEFA 4KXLA 3NKFA 4CFZA 4CVNA 3SEAA 1WSWA 1WO8A 4EF5A 4MS4B 3GHHA 4RKRA 3IP1A 4BNYA 1N2CE 3M1IA 5ECDA 4Y6GB 1FSSA 2PKQP 4HWGA 4F9FA 2GSDA 5B7GA 2A8YA 4KX3A 3KAKA 4QT4A 1G3RA 5DHAA 1GUBA 1XRJA 2H1WA 5HYVA 3U60B 4AO6A 4RFLA 1YRWA 3V8QA 4TWJA 2X15A 3FMFA 5I7AA 1JDNA 4XJXA 4DLKA 5ICGA 1XTSA 3FKQA 2HK8A 1FTSA 3GDOA 3JQ7A 1UK6A 2AZDA 4IF6A 1SKMA 1WVMA 4LC9A 4MQ5A 4CQMD 2ZK7A 4RA6A 4D9MA 1U3TA 4DA4A 1I7LA 4MXDA 4BU1A 4BNGA 4Q05A 4B83A 4PFSA 1Y81A 2PIDA 1QVRA 3FDZB 4ZK6A 2FE4A 5E6SA 1XF1A 1W5TA 3WLFA 1CIJA 2B82A 3KWFA 2HF9A 3WKDA 1J24A 1DXHA 1PEYA 1CJVC 2YVUA 3E2MA 4OA5A 4UKDA 4MKHA 2WU4A 3WDSA 4KWHA 1ZN9A 5F73A 2X5JO 1UT8A 4N0DA 5HF8A 4L6CA 3F6YA 1A2QA 5E0OA 2FKNA 1PEAA 3QKSB 1I4WA 1XRRA 2WQ7A 2FP3A 5FEMA 1XAGA 1Y5RA 1BZYA 1ZNWA 2B1QA 3DKPA 4RTQA 1Z63A 5IT4A 2VA8A 4NMXB 4D4LA 5JDCC 1MTOA 2QNIA 4O3FA 3WNBA 4EHDA 2O7VA 1ECJA 2F64A 2P2LA 3BL8A 1JI3A 2YIMA 2HPVA 4TYNA 1XP5A 4HEJA 1MPTA 3H8SA 4RJIA 2P9TA 2RHLA 5CXXA 3S7ZA 1J2EA 2QSYA 3RRNA 3VNSA 4CETA 3RC9A 3NB0A 3IPRA 4FYWA 1KEUA 2VRCD 5ECWA 3J81A 1L4MA 1TAGA 1A9XA 3WQSB 4RA9A 4F97A 2YHBA 1HE4A 3P27A 1XWFA 1L5ZA 5DI9A 3DVAB 1ACJA 1YZLA 5EMJA 4YV2A 1R10A 1NT2A 1QLWA 1CUBA 3AYXB 3KYJB 3PVSA 4FNMA 4GLOA 5E38A 5TR9A 3MWGA 4NATA 5TPZD 3GLHB 4BMVA 4W5QA 4C76A 2H1IA 1Q11A 1RDFA 1GTZA 2QJFA 3CYFA 5DJ5A 1E9SA 1RJFA 2GNAA 1M7GA 3K9LA 4RGYA 2YIVX 1X1EA 1CY0A 4Y0NA 1FJXA 1G8MA 2IUUA 4PHTA 3EF1A 2IDJA 1W2GA 1THZA 3FTCA 2R6HA 1GNTA 4J0EA 5DU2A 4NNOA 2FEPA 2QZ4A 2JVKA 2RHGB 5HBRA 2CEKA 2HEIA 1J0XO 1TUBA 3CZ4A 2Q5QA 3E03A 3IILA 3UNXA 3NC1C 4HLQB 3ZI4A 2XCUA 2QYSA 2ZIXA 5JE8A 3DZFA 4MCJA 3UMGA 1UP4A 3DOIA 5IVIA 4UM9D 3AKYA 3WGLA 4GGOA 4LJ4A 3AHIA 5BV8A 3WMXA 1VCMA 4JQCA 8ADHA 5INTA 3U3XA 5IP5A 3BWCA 3BDIA 1OREA 1AK1A 1TZJA 5IMSA 4QFBA 2QXTA 3ZWMA 3TVYA 4TQGA 5DBFA 3HO6A 2ZUBA 2YICA 1EGHA 1X14A 1OXBB 5K0NA 1DHTA 2ZAGA 3LUPA 3NPAA 3BERA 3LCVB 2OXIA 2NPIA 1FMCA 3I76A 3KUXA 2V9ZA 1YJ5A 3FE2A 3EVAA 5KDOA 3OJ0A 5IT0A 2WUDA 4ZQHA 5KYYB 3EGWA 1P4GA 3I9KA 2BJHA 4XD7A 4FVTA 1GYQA 5ALLA 3IE2A 3L7MA 2J4FA 4FYHA 1EVIA 3RYHB 3IQXA 1NN5A 2BLLA 3J7AC 1EVQA 1KK2A 2P27A 1BGVA 2PRSA 3NYWA 3QKSA 4GIBA 4XVHA 2F1KA 4V39A 3RD5A 3GDFA 3OSUA 3CUEF 1NHGA 4WXYB 3BF8A 2GT1A 1P73A 1N9KA 1TQ8A 1DQRA 1VIAA 3KJQA 1ESMA 2G17A 4RFSA 4XZ3A 3GA5A 3MB8A 1KYWA 1O0SA 2BGWA 1OUMA 5BURA 4Q48A 2FEAA 2NUAB 2FF5A 1F0KA 2W2PA 5K0ZA 3QUBA 3UOWA 4DMCA 5IUNC 5JZSA 1NQOA 4EW1A 2FX3A 1F8FA 4U2GA 1VBMA 3FKSD 3GEEA 1YU6A 4ENPA 1ZVKA 1KMCA 3VU1A 1UC8A 2P4QA 3FFAA 2R1VB 4QHYA 1U9IA 1VM6A 3U31A 5H4GA 4DM4A 4MWSA 2AV6A 5DOVA 4P7FA 4DB4A 1ZD2P 4JI3B 1GKKA 3C3MA 5FL7A 4TVSA 2W2OA 5BSUA 3CPEA 4M0PA 1AVTA 3RKSA 4EG0A 1P2VA 2V6FA 4B1FA 1FW8A 1DZ3A 4QQFA 4JBXA 1S8NA 1MIOA 1T9DA 4MQLA 1UK9A 2YVAA 2XSZD 1MT3A 4W82A 2DPXA 2VHYA 3ESYA 4TV9A 3RGGA 1VPVA 4A91A 4BEVA 3HDVA 3FPKA 3H4TA 4IJ6A 1SQ0A 1U8XX 3OZEA 4ND5A 3RVJA 3A70A 2C9BA 1JZSA 4CIDA 4H4EA 4D3XA 2ZJOA 1XFAA 4UNQA 3KDSE 4MPDA 2NU8B 1R0SA 3R41A 2YWDA 3O2JA 3TTSA 1WHSB 3D8UA 4IQGA 2NU8A 1HL3A 4DUYB 1L7DA 2WP0A 4RE6A 4DR7B 2VJNA 3LVRE 1AB5A 4X1IA 2PBFA 1I2DA 1X8KA 4K86A 5IAKA 1EKXA 4Z7OB 1XNHA 1U5BA 1ZFNA 5F1KA 1FMFA 1VDMA 2OBXA 1R8SA 1S1MA 2ZYWX 2VNHA 4PLCA 3ZQJA 3Q2OA 3LBFA 3KQKA 4ZCMA 4H1UA 4M2LA 4YWHA 3IAAA 3FTEA 1T2AA 4IDEA 1F17A 4DCNA 2AD1A 4R68A 1V3QE 4X8OA 5FIUA 4TV9F 1DIBA 3ZLVA 3DLHA 2XE4A 4IHQA 1SIUA 2IUSA 3F49S 1P17A 3BH0A 4O4LB 3U4GA 2IPXA 4J0IA 4DM3A 5BUCA 4O2BA 4P3OA 3IS3A 2EBHX 2QAGC 3GK3A 4HL6A 4RIEA 1DI0A 2H4XA 2RHCA 4N3GA 5J63A 3S2YA 3E82A 5CYFA 3V4RA 3RFVA 4GQIA 4WESA 1V96A 3V1MA 4A03A 1R0RE 4JLAA 5A3VA 3FNQA 4IEEA 4FMPA 2Z9CA 4UE2A 3T06B 3WICA 1KWKA 2J59A 4TN1A 2UYYA 3BMOA 5DRTA 4DLLA 4OQYA 3B20A 2OQIA 2GJSA 3EDYA 2BEJA 2IU0A 1Q0RA 3I1FA 2HHCA 3VC3A 3HO1A 1MJHA 3BIWA 2RAPA 3HKBA 3T7CA 1W0JA 4IV5A 1Z2PX 3W3ZB 3WB0A 1CXZA 4NJEB 2O1XA 1NYTA 4DCSA 1BMTA 3K9HA 4TLMB 1E79A 4UNNA 1TKBA 2VCYA 3GRUA 5T4FA 1YHYA 3U9TA 3VGJA 3F8TA 4G8CA 1NBOA 3DVRX 2GGSA 1EEHA 2NQTA 2W48A 4IFBA 1W52X 3L0SA 5JCJA 5EZYF 2RGNA 1RXVA 4RIHA 3TE6A 3NC4A 4LXQA 5FD8A 4AP6A 5GADl 1M6EX 1WSBA 4WSOA 1K08A 1GA6A 2OO5C 2UUPA 3ND5A 3EZYA 2D06A 4AXBA 3FB1A 1RJGA 1UBNA 1JXQA 2XXBA 1EFRD 1Y8RB 4HYQA 1U2ZA 1ADBA 3NANA 3BD6A 5AVOA 1E8DA 4NG4A 3K53A 4RZSA 5CFRA 2ZJ6A 4YJFA 1FE8A 2GYWA 2I2AA 1J1ZA 4CUJA 2WVAA 5DCUA 1BE0A 1IONA 4WFKA 1EG2A 3N2IA 3WV5A 2ZYVX 4CHTA 1S8AA 2HK7A 2A5GA 5ALTA 1ZW6A 3RIYA 1UBCA 3JQFC 4A5OA 1CQJA 2O7RA 3NASA 2QVLA 1FB5A 2B7LA 2JJYA 2OCYC 3DTVB 1DG1G 3OZCA 4RF2A 4C3UA 4D6YA 4ZGWA 5JFGA 2QP9X 4NENA 2E4XA 1YR2A 4P4LA 4ZDJA 3NRBA 1AF7A 4IIXA 1OWLA 4U7HA 2J09A 4JYZA 3DVAA 3QNUA 5LMCA 3L4KA 2F9LA 5KWEA 4RGVA 3QBVA 4ZT5A 3SZMA 5AVQA 3I4FA 5ARDA 2B21A 5AJTA 4MVWA 2E21A 4ZOLB 2IH2A 1ECBA 5KSPA 1IBLB 1Y1PA 2LUOA 5AHWA 4GMHA 3UAXA 1JHDA 2JA2A 4UU1A 4X84A 2CW5A 2BEUA 3HCWA 1A97A 2X0JA 3WNZA 1BOOA 4L9SA 1C80A 2H4YA 4TT3A 3FYCA 3AHHA 3FPJA 4DLBA 4PSAA 3QW2A 4KIWA 2ZUDA 3EOZA 1NJ1A 1K06A 1WOYA 2AC7A 1Y7HA 5A1TA 5B55A 5C1PA 5KTSA 2CV2A 3PJDA 2XMDA 4E1AA 2YMQA 5CG2A 4YP7A 4ZVVA 1PJ8A 4TSFD 3MJSA 2OKGA 1N0VC 2DBQA 1PR1A 2PYIA 3IB6A 2I3GA 1ZH0A 1WXGA 4NF2A 1FFGA 1MOPA 2YJ6A 4B6SA 4BIIA 5JCJD 4B4VA 1XD2A 2IYYA 1YF3A 1I0ZA 1QDLB 5AFSA 5MN5A 4MVJE 2EBWA 3CTPA 2BHRA 2NO7A 2IPNA 1PCXA 2BMEA 1CLEA 3MLEA 1SGWA 4E2YA 1J42A 5F4ZA 3WLEA 3CEJA 2PRZA 1IXYA 1CUAA 3FPGA 3H2BA 4K6GA 3PFBA 2ZE6A 4REQA 3JTEA 4TX1A 3WLPA 2DY1A 4FINA 5DHRA 5C5CA 5IAOA 2VPWA 4PU0A 4BWYA 3LXRA 4QVIA 3D3QA 1L7AA 1NQVA 3DBOB 1NVKA 3GAMA 3SG0A 4JJGA 2VT6A 3QJGA 3KEQA 4P84A 1RR6A 4JSTA 4MYTA 4LOHA 3UXMA 1PT9A 1VPDA 1HT0A 3E5RA 4BMDA 2P9BA 4L74A 4NBSA 3RC8A 1B6TA 3GV0A 4E2XA 1KY3A 4ZOLA 1FS4A 1PP4A 4RETA 1V4BA 1L4NA 2IU3A 4YI5A 4ZAVA 1GNSA 3QEMA 5G0VA 4JX8A 5LZ8A 3RFTA 4YYEA 3JQAD 2FXVA 1WD7A 1FNBA 1U0GA 2PKCA 2G8NA 2XDWA 3FPLA 2Z8YA 4G4SO 2PM8A 3KLPX 4MQFA 2IYAA 3NBFA 4WEQA 3LA6A 3LDGA 4ALIA 2EQ5A 4CF5A 3EXAA 3KLNA 3O93A 2GCIA 2QT9A 5JIBA 2C03A 5SYNA 4YC7A 1MVNA 4NONA 1US8B 1ZUIA 1ZI6A 4JK3A 2ZUTA 2RBEA 4F71A 1ZOSA 5CPBA 1SELA 3VJLA 3VDNB 4M0EA 2JKYA 1YE5A 1K7FB 2X76A 1A4XA 5I5EA 1MNQA 1E64A 2IIQA 3ANMA 5JU6A 4QUEA 1IZ7A 5A3JA 3T7SA 3B1ZA 4XCVA 3TLKA 3DBHB 3OF3A 4HQRA 4F7DA 2OP0A 1V7QA 3W1WA 4LC1A 4TXNA 3ZLBA 5JNTA 5KS2A 1JMKC 3H2IA 3IEPA 1TTHA 1IJFA 3IVXA 3LH5A 1VSBA 4YRLA 2GPAA 2LXNA 2JGDA 1SURA 1IRXA 1U0FA 3P9CA 4WN9A 3EGCA 2FPXA 3AO0B 4FMDB 4HRVA 2YYZA 1KAOA 3HN6A 3KSZO 3R5XA 3ZVNA 3OCJA 5DYGA 1UANA 2GHIA 621PA 1VMAA 3B8EA 4R1UA 5H0IA 1D2MA 4LYYA 1A1VA 3AUTA 4WLVA 4WACA 4INPA 3C48A 4BNLA 5EP4A 1XDZA 1H2AS 2PJRA 5J4HA 1GDHA 2C04A 3HCNA 4LHWA 2IEZA 1I5EA 2BSAA 3LKBA 4LOAA 4ETIA 3W3AA 4J0FA 1A69A 3D0QA 4K6HA 5HE8A 4FHDA 1LPNA 4WZBE 4I3HA 2ZRBA 3ZCTA 1QPZA 1KI6B 1YFZA 3AY0A 3E53A 4OD0A 4RHYA 3WR5A 2Z1MA 1EZ4A 2V5UA 3SLRA 4C2TA 3MWJA 4M9CA 3EEFA 1ZINA 3UWPA 1OT3A 1CQZA 1LX7A 1ZONA 2J3JA 2VPPA 3G85A 4DUPA 3Q8LA 4HDRA 3E3MA 3HBLA 4BQNA 1TQ6A 1WZEA 2XMQA 5CFPA 3W3AD 3L8FA 2OD7A 3HCPA 1TA0A 3EWNA 4JXZA 4YAIA 3LVFO 5I8ZA 2BD0A 3MMXA 3K30A 5J2TA 3HMKA 5KVSA 2YNMC 4LYHA 5JBQA 2BI7A 2K2QB 4TMXA 1B41A 1E3WB 1LB1B 2WBLC 3AWIA 3GJZA 3G5MA 3G2OA 1XZAA 2H8KA 3P9XA 4ZALA 4F04A 4QUJA 1G8JA 5FPKA 2PPVA 3DJFA 1IK6A 4U7FA 2FV8A 5K6RA 3MWEA 1XA3A 3DZCA 2AJLI 2C77A 1E62A 1KFBB 5AM3A 1GGVA 1T3TA 1EAMA 2JW5A 3HDYA 1J6UA 2WLSA 5EJ8A 3C8ZA 4E09A 5HQTA 3K70C 4AJEA 5EVCA 3ZV3A 3LSTA 1Y3DE 5J2TF 1NR5A 3LVQE 3UMRA 1MB0A 1B42A 1KMHB 5E7MA 5ALVA 5CFZA 8AT1A 1Z37A 1FRFS 4PN3A 1CY1A 3AVUA 2OV8A 4EQ6A 4M8IA 3RAPR 1O8CA 5FNVA 1C50A 2GX6A 2NW6A 2WM2A 1JQ3A 4HAWA 4M1ZA 5HS6A 2AXQA 4R8VA 4EKDA 1A82A 2E89A 3NT2A 5COQA 4DSNA 2HI0A 1HPLA 1K98A 4OHOA 5CK4A 4ESVA 5C53B 4TKVA 3I6MA 2B92A 3QHAA 3MOGA 4YRCA 2W43A 3TPZA 2AD5A 5E1OA 1O6BA 4EI7A 2WTBA 1BH6A 1R7RA 4DMGA 2JLCA 1QP0A 3D3JA 3VJMA 4AX4A 2VBCA 3ILSA 1FA9A 2Z08A 5LZ7A 5KYKA 3HGMA 4D46A 5KSZA 3A36A 2G09A 5BMVA 1YL7A 4WN3A 3PQ7A 4OJTA 5H83A 1E1MA 4AZWA 4UXJA 1NXOA 1Z6QA 3JYOA 3GDHA 2IYXA 3HVKA 4PIPA 2MYPA 1T8UA 2PX6A 2GF2A 4HFMA 5BMVB 3RB8A 1KA9H 3PIRA 1FIUA 1H6AA 4H60A 3RGWS 5JEDA 9ATCA 1N6IA 1X87A 4H4CA 2YQ4A 4DLTA 1Q17A 3LUBA 3T95A 3MRXA 1KFEB 2VF4X 3HA7A 2JANA 2ROQA 2ZCVA 4XR9A 3VKHA 2OO7A 1XBTA 3DE6X 3HA3A 4HDKA 1UAGA 3HZHA 4QOJA 2GEFA 4WJLA 1BEUB 1JXOA 1J0EA 3RHSA 4DLYA 2QJWA 3UB2A 5HIJA 3M33A 2HA2A 2W83A 1P0MA 2V58A 3WK4A 4BO4A 2NO6A 2WKQA 4C7OB 2X9QA 3GLUA 4NARA 3VR2D 1CPYA 2XYHA 3AU9A 4O63O 3TI9A 1M2OA 3FWNA 1H2FA 3KKZA 3WB9A 1QZ3A 2WYWA 5K3OA 2D1SA 2F90A 4KYUA 1FTYA 2ZIUB 5B4VA 1YXMA 3P2YA 3VHXA 1E3IA 4WLOA 3ZJVA 5BSGA 5FLXA 2B8EA 3T7AA 1CS0B 4PZCA 4P35A 4RF4A 4B4DA 4ML3A 1DBIA 1G42A 3KEGA 1Y0BA 4N7JA 4C3OB 4PSDA 2FG7C 1PQYA 4LY3A 5CAEA 2WYIA 3VGPA 2YNMA 1SXJB 3QKRB 1ORWA 1R9JA 1M6NA 1OHHD 2Q6OA 2D3TA 2P35A 1CUXA 5FV4A 1MDFA 1E9EA 3NHAA 1Q74A 2Z6QA 2O23A 3WHIA 2QX6A 2ZB4A 1O6ZA 3QXSA 4EATA 3WG9A 4PQYA 4WRRA 2ZAIA 5HF9A 4LOKA 4YUYA 1I36A 4K9MA 4MPPA 1JKFA 3CA8A 1PEKE 3Q7IA 1C29B 3IUJA 1Z39A 3Q2KA 4Q3EA 1AUPA 3X2FA 3O8DA 3CN9A 4YPVA 4Q3NA 5C37A 5EJ4A 2JGRA 3G5AA 4Q7EA 4YRGA 4PFQA 5CH3A 3STYA 4P9NA 5JNUA 1VHQA 3TJMA 5C8YA 1RRKA 1IZ9A 3KQMA 3UWOA 3JPWA 1ZK2A 4MVJM 3HVJA 5G4KA 4LY9A 4GSYA 3SZOA 3K15A 2ZJ7A 2IK8A 3Q3CA 1P0QA 1Z5ZA 2AVNA 3DC7A 4AKSA 1T5LA 4WGFA 1RZ3A 5TMBA 3L92A 4YP5A 5KMGB 1EP9A 1FVHA 2X19A 2IDKA 5A4DA 1QWOA 4I81A 3OZDA 3V1YA 3ZU4A 4QU5A 1GXSA 2G5PA 1VPLA 1ZW1A 4URZR 1ADFA 2ATVA 5FORA 4M37A 5HUHA 2PH1A 1HDGO 2ZR8A 4L3VA 1IH8A 3PUWA 1YS7A 4B6EA 1FXUA 2Z95A 5EKXA 3SDZA 2QD5A 1PLKA 1WW2A 2GUWA 2WPDA 2X5KO 5FA6A 3RS5A 2QUJA 1OD6A 3O73A 3F4KA 4PQFA 1CRPA 1JU9A 2POCA 3OECA 3BCHA 2BAGA 4QUAA 1GPNA 1OT5A 3OAAD 5DBHX 1LLUA 2XUDA 1E61A 1E5TA 3MMZA 5E2BA 4AROA 4C6TB 4OM8A 1N2HA 3N07A 3DMPA 5AJUA 2IGTA 2X1LA 3R7WB 4X90A 5EP3A 3TRFA 5F33A 4ZHQB 2Y68A 4C0QC 4BV9A 4EMBA 1NJSA 3LUHA 4EYQA 2ADFA 3IXLA 4RDHA 1QPBA 1H94A 5BYBA 1J5EB 5GGXA 2HFKA 3OLVA 3DFZA 3SYNA 2CHFA 4UNSA 5G53C 3ZHTA 2CWDA 1F20A 3DFIA 1WCIB 4WBSA 3Q7SA 4CM3A 5AW0A 16PKA 4WJZA 3MJRA 4IEIA 3BXHA 4ZI7A 1JLKA 1YQEA 4AIRA 1O9BA 2WHXA 3U5ZB 2QRGA 2TRSB 4PHGA 3KK0A 2J33A 4H3SA 3MM4A 4MIEA 2CYCA 4CKWB 3BWEA 3DE1X 1EFUA 3B2QA 1Z82A 2ZG6A 3SVZA 1U8AA 1K6IA 1CP3A 3E7DA 4QDJA 4YVFA 3HB1A 1H69A 4EGJA 4K46A 5I47A 4LF8B 3DDZX 1O54A 2B0JA 2IEIA 1E7RA 2FPSA 1IBCA 2FMKA 1E32A 1SRRA 2QY6A 2OAQ1 4L4RA 2G40A 3W5BA 3TIVA 4AMVA 3UQYS 4EO9A 4Z7JA 5DYWA 4HX2A 3GEPA 3B2EA 1QIKA 3HRKA 3OE4A 3KKLA 1BVRA 4KGDA 4WK4B 3EBLA 4W63A 3HY3A 4E1VA 2EJUA 2C5EA 3EY4A 1LNZA 2NZXA 4WUTA 2R7NA 2R6AA 3GJXC 2NSHA 4YCJA 1K8RA 1M83A 2O0LA 2OXFA 3KELA 4MRNA 5DSTA 4DE5A 5LQCA 9MHTA 1Z8DA 2XT6A 1XQYA 3DR5A 1TEZA 4LOJA 4EBFA 1ZY2A 4CQMA 2HC9A 4UU8A 1YQDA 1E5XA 3N76A 1RSZA 4F8JA 3G88A 3DEKA 5IAGA 2FZKA 4RE5A 3UMMA 2JLAA 2QI9F 2L2QA 2Y76A 3UAZA 2GZ2A 5IDXA 2YHSA 4TVOA 1ZIXA 1U1EA 4LRTB 5B3KA 2PL5A 5B4UA 2X4DA 4D9FA 3AI3A 1NW5A 2QQ0A 4X8MA 3KEOA 5EQFA 2HJ9A 2AX4A 3BILA 1UODA 1PVDA 3I0NA 2NZUG 4JIGA 4WGGA 1WMBA 2FW8A 1P2BA 5E6SB 2RBKA 5TEWA 3FVTA 3ZY4A 2EG9A 4LZJA 4UOEA 2WLTA 3ZCVA 2CYBA 1MV8A 5KTOA 4PLFA 3E6AA 3QYFA 5IBPA 2LCQA 1CZKA 2PMKA 1RHKA 4KXYA 3HKEB 4HR7A 2PSDA 4IKOA 1N8KA 1ODIA 2ZTSA 4M38A 1EXNA 2UZ1B 4BCBA 1KYZA 1JFTA 3A9UA 2NV0A 3BICA 4MJ7A 3I5YA 3A1FA 4JQSA 5AW6A 4KSCA 4CF6A 3TMKA 4F96A 3RVQA 2HRQA 4OFBA 2HCFA 3ROPA 3SX2A 3JZMA 1H3NA 3KKOA 3HCAA 4P54A 1SOMA 3AZPA 3KEMA 2OCXA 4WKNA 1HOXA 3LFHA 2C2HA 4QYXA 4LDNA 4I5FA 1FY2A 1GZ4A 3STXA 4DIDA 1TMYA 3C6MA 1FNSA 3IJEB 3M81A 4MCHA 4ZYLA 5KNBH 1ML3A 5BSTA 1Q0ZA 4WD3A 2YJZA 4F91B 3ONEA 2Q5CA 3E58A 4P0TA 4COKA 2LE0A 1JI0A 5T8KC 3EOBI 2YV1A 3G8BA 2WJGA 4RM3A 3ESBA 2ZGVA 3FJYA 4O33A 1PJZA 1IUPA 1DJLA 4P81A 5LMUB 3HYLA 5K3FB 2FWRA 2OCLA 4TKLA 5CA1F 4GF5A 1H8ED 2OWEA 1Z2NX 1L3IA 2G5TA 3AIOA 4ESEA 2VUSA 5HILA 4R3WA 2PXAA 2EF1A 1IWOA 1N5KA 2FDRA 4AJ9A 5AW1A 5EPUA 2GZDA 4HTAA 2YBEA 4JLSA 3AOEC 2OKCA 2DECA 3H6KA 5CURA 5BYJA 1R4NB 4CFSA 4YR9A 3QPAA 3W6PA 3X1ZA 3V33A 3ZHZA 1TJNA 4EGFA 3QVMA 1CR6A 3PJGA 3OWXA 3Q88A 5TIIA 1XZMA 3C7DB 4EPRA 4O4HA 1B8UA 4RPGA 1NSTA 3ICWA 5KKCA 4Q9JA 3A32A 5J43A 1HMYA 1JWLA 4DSOA 1SC6A 1D2EA 3B6EA 3KTDA 5LWQA 1HX7A 4WXEA 1WNTA 5AQ1A 3B78A 3ER6A 1Y5IA 4PZUA 1A8HA 1E2GA 4MVJP 4C0KA 3PEVA 3C3PA 3QG5A 2XYPA 1GKYA 4HGOA 6GPBA 1M2NA 1V5IA 1XK6A 2GJ9A 4AFNA 5JS7A 5CA1A 2X7JA 2V6MA 4UD2A 2N42A 3UJ8A 2Y4NA 3NDBB 2FEMA 3BG5A 3GY0A 1ORDA 3TZBA 3AEUA 1GNQA 3PFHA 3LLUA 2WINI 3IBSA 3IUEA 1SUCA 2BFDB 4Y0AA 1ZAYA 3VZPA 1G8PA 1UP7A 5I7VA 2H6EA 1OLXB 3E23A 5C1DA 1S3SA 1VIYA 5IJZA 2SHKA 2ZRLA 2IOFA 3O0DA 5AXCA 1R6XA 3TD6A 5FB3A 4AMYA 3QEOA 3UEOA 2YHIB 4PYQA 6REQA 4O4IA 4W7IA 2M98A 4U2FA 4R2LA 1ZCAA 3QLVC 3KAPA 5ERGB 1XC7A 4NQZA 2HRZA 4HAYA 4IL5A 5JS1A 4HS4A 2UYOA 4UFOA 3F46A 4XIJA 3IJ5A 5DOZA 1NJFA 3IA2A 1TTPB 5B37A 1E1DA 1K5GA 1CJSA 1KZ9A 1VFNA 1N5OX 1ZRMA 1IMJA 2ZRIA 3I72A 4H27A 4MUKA 3ZTTA 1EX9A 3GPBA 1T8PA 2Q27A 1LPSA 2BCGY 4JI7B 4IXTA 2OFPA 2CK3D 1F1BA 1GRQA 4WZAA 2OFWA 3VYSB 1XUOA 2WTXA 2PX3A 1ATIA 2YHAA 2Y9MB 1PO7A 1BU5A 2WWGA 3HVIA 1Q95A 3SP1A 2QEQA 1HTBA 2X0IA 5IK2D 2RI0A 4QYWA 5EG5A 3T3OA 2P0EA 3OKFA 2HCBA 4AQ7A 4RHXA 3H0CA 3KXKA 4OKIA 3COWA 3FUXA 3QFSA 3VSCA 2G36A 1EPUA 3RS0A 4ENVA 4QLBA 1JKIA 1NMQA 2V6JA 4J75A 3DOOA 1OPXA 4QFCA 5T4BA 3WHKA 4MEJA 3A6HA 3CVUA 2VTEA 3OM9A 3FWPA 3ZH9B 5BSEA 1QFMA 4IGIA 4P36A 3L6UA 4Y2GA 3VC7A 2IH4A 2WQZA 2KS6A 2WIAA 3NOQA 3AL3A 4TV9B 1NNUA 1JB9A 4QPNA 1ES9A 4JKOA 2G77B 4KMSA 1AGYA 3NFRA 1X2BA 2PUDA 5ALDA 1Z68A 2NP7A 3HL4A 4YJ2F 2XD9A 4ARBA 4YJKA 1Z33A 3BEDA 2Q49A 3HP1A 4G1VA 5BSRA 2VYND 4MUAA 2C7QA 1I80A 1NATA 5A0VA 3EXHB 1ABEA 3RRBA 4CU5A 4OP3A 5KOHA 3BB4A 1N1GA 3LYHA 3GMTA 4RDCA 4BWVA 1X7HA 3PJEA 4XVUA 5FDFA 1XPOA 3CRVA 2P30A 3OTOB 2JBHA 4EHBA 3SWWA 4AY3A 2ZRNA 3D4IA 1ZJYA 1EVLA 1X1SA 2JEYA 2NSJA 4N9QA 1P29A 3EQ7A 1E92A 5F3WB 3DWEX 1KO8A 2NVUA 3V4SA 4G5HA 3AG6A 1XD2B 2G71A 1RFLA 3LE8A 5EHQA 3FMVA 1JHOA 1GZDA 2PG3A 1P4RA 3NGMA 2VAPA 3FOWA 3PF8A 4O5OA 3KYDB 4RK7A 4R41A 5ADHA 1M0EA 2CXSA 1MCZA 4RNCA 3HJBA 4NCAA 2ZRPA 1DNPA 1KJ9A 4N3BA 4BRUA 2JHCA 3IODA 3RVDA 1NBME 2XSZA 2D5LA 2CYAA 2PGDA 2CBZA 3NHUA 3ZHRA 1WXDA 3VTZA 4FLEA 3KB8A 3I32A 4RJKA 2P2CA 1HRDA 4DUGD 2QA5A 1Z0DA 2IYOA 3D0OA 3BWMA 1KDTA 3DNFA 1D2NA 1GGEA 2QMEA 4D3YA 2R5FA 3L7YA 4JOCA 4YJGB 5FWAA 3WA7A 1BX1A 4J4BA 2O5VA 4YJHB 1ORIA 3IAM6 2PT6A 4DCVA 1HBJA 2RHJA 1YZ3A 3PG5A 2GPWA 5EKDA 4BDSA 2ZETA 1VE5A 4HNAA 5AW5A 3WBKA 5KYNA 4PS0A 4RHFA 4TSKA 3P9SA 1QGDA 1UJNA 1YR9A 3V1UA 2R6ZA 4F5DA 2P9JA 1SKAA 3CSDA 4J1SA 4IMIB 1P5ZB 2OOSA 3MGKA 1O9GA 2R62A 4DBLE 4E3ZA 1WF3A 1ZC4A 2FPIA 2XE8A 3BQNB 3TGWA 3IOBA 5C80A 2ZRFA 3FG9A 4I1UA 3MCAA 5JAIA 3DDOA 3VR3D 2RHDA 5KKNB 3H5OA 3TQRA 3WMFA 5K5EA 1A76A 1EX7A 1QH1A 3KKMA 4WLUA 4IXMA 5HP4A 4LV6A 5JAUA 2H5JA 4D4MA 1RYEA 2B4YA 3OA2A 1RWQA 4AKTA 1GPMA 4CG3A 4J3NA 4WV3A 2JH3A 3CF4A 3R8XA 1NUAA 3TRKA 4AF7A 2OECA 1VP9A 3JYLA 3VVCA 4P98A 1U9ZA 4JLKA 3IIEA 1KH2A 2G07A 4L8LA 3TZHA 1QAQA 2XVMA 4Q9IA 4BLPA 2M9MA 4RTNA 1LI4A 1FP2A 4JSYA 3RIXA 4EQZA 1BVHA 3FVQA 2I3DA 2JGNA 3S6JA 5KNCA 4FSDA 5LNK1 2QTMA 2W6NA 1QIHA 3LCJA 2DKNA 3IVRA 4ZT6A 2X5OA 3DSRA 4U02A 3UZUA 5F51A 3PQ2A 3RKUA 4QKQA 1G8YA 5HRAA 2C7OA 1UBSB 4MI9A 3SGLA 1E7WA 2Z5FA 1RWVA 1LDBA 3A3YA 2Y1CA 4B6PA 1GT6A 3ZWDA 2OGWA 3RANA 4EOGA 2PZGA 3LGSA 1BQEA 1ZM4A 2G70A 2H4ZA 2XZLA 4AP5A 3QX9A 1V6SA 1Y6QA 1PJTA 4NS1A 3ZCXA 3KETA 4BYMA 1ZESA 3M6IA 1DEAA 4IMPA 3VPFA 1NV9A 2A4MA 1Z8HA 1G16A 1ZX1A 2J3EA 2XUAA 3PHBE 4JDUA 3RTBA 3PDJA 4HQFA 4GBJA 4F3KA 2F67A 3H4MA 4J0QA 4CCYA 1A7UA 5K4GA 4PPGA 2A5FA 1SZPA 4ZC8A 5IC5A 1GPYA 2C29D 2ZW9A 4RXUA 4CLOB 1VSQA 1ODJA 2IRWA 5K8TA 5C8ZA 2IZ0A 1CUUA 5EESA 2B9EA 3MQFA 5KYXB 2I3AA 1KIFA 2JGDB 3PPVA 2RAUA 4FX2A 3HCFA 3NH6A 4O2BB 3F8SA 4DYVA 2XYVA 5JFOA 3UJHA 2I67A 5D86A 2ID8A 3PUIA 3THXA 1MJNA 4FJ2A 4IWXA 5D5HA 3FCUB 5ES4B 1K3FA 1YOVB 1S7CA 1SK8A 2BW0A 1H2HA 1YJBA 1K8QA 3KJGA 5BNTA 3FRIA 1Q1EA 1VLZA 5H68A 4F06A 3EHEA 3RVSA 4GXRA 4W5WA 2FWNA 1A9PA 2ERXA 4O5AA 4UTOA 4UVIA 2WE7A 4FSXA 3P5BA 4DILA 2PJZA 3C7CB 1U2GA 1TCCA 2Z2JA 3FYUB 3K6JA 3OZWA 5H80A 1NQUA 2OOKA 3VR4H 3QWIA 1Z35A 3O91A 1ILWA 2G5CA 4LUCA 1G9SA 1U6JA 4YMHA 5C2JB 3W4JA 4QO8A 2RGNC 2HDOA 2HFJA 4PNZA 2IYWA 3OIWA 2GERA 2W4MA 4RZIA 4DMKA 3QTLA 3N87A 3DMGA 3IR7A 3H9QA 3WLLA 3PSHA 3GLSA 5F12A 3WYFA 3ABOB 3HEMA 5DK4A 1PWEA 2LKCA 3I37X 1U28C 1Z6TA 3OQPA 4GGMX 1NLMA 1K1EA 1U7DA 5ERYA 4WMLA 2EFGA 4Q4HA 3HZRA 2A7XA 1QIDA 2GBPA 3GVCA 4EY7A 1LWOA 4M1WA 1JAIA 2JPDA 4G0QA 1QS0B 2OORA 3BDAA 5EWLB 4AY2A 4D0RA 4IIVA 4B9AA 1QG0A 1LJLA 3BFPA 4HYEA 1TT7A 4P4UA 1N6LA 4EI2A 4K88A 2AR9A 4F38A 2XZDA 2Z9BA 3NS7A 1B6SA 5A4JA 3O38A 3CO5A 1QF9A 2ZYGA 2FEXA 4AG3A 2FJ0A 5ALHA 1AF4A 1JJFA 3BZBA 2ZT7A 3WYAA 3L7DA 3OMWA 5ILOA 4I9HA 2ENWA 5T7BA 1S02A 4BJ3A 4CIVA 2TMKA 1NN3A 1PK7A 4MW2A 5A4FS 1JBKA 2IP4A 1YL5A 2VHWA 3L4BC 4FLFA 4H7IA 4NJOA 4XASA 1Z0AA 3NQ41 1GTVA 1RYZA 1SCDA 3O9ZA 1GPBA 4ZQBA 2LCFA 5JRJA 4JI8B 2WJYA 4UTXA 1GVNB 1ETHA 1Z0KA 2JAWA 3C3WA 3PGLA 4JA0A 1U8YA 1KSGA 1QGYA 4YT5A 1L8OA 2CNWD 1U2RA 2NTJA 3QEKA 4GLJA 4MUMA 4UBNA 4TGLA 1WA5A 3WGKA 5ARCA 5A3RA 2D1FA 3CEPB 4WVLA 4E30A 5K6AC 2GPBA 3P45A 2GN8A 3MAAC 4ZOAA 2AT1A 1H65A 3RRZA 4ALLA 4RULA 1L8QA 1ZGHA 2ZT8A 3CRRA 1YL6A 4GPEA 1F7VA 4MVJH 3AUFA 3H6GA 4FNOA 4PBSA 4EX6A 3WFZA 4C4AA 1CUWA 3DAFA 3I3OA 1DIGA 4PGMA 5FNVB 5K4HA 2BI4A 3ASZA 3U7GA 4I8IA 2AN9A 1V1RB 2CLDX 3C6YA 2HPZA 4HXFB 4UD6A 3VJRA 4WINA 4YRRA 3CJTA 1D4FA 4V2IA 3PJFA 1SEPA 4OBXA 3VYRB 3VNUA 2GCOA 5JY6A 4EGCB 5IM5A 3OPMA 1Z74A 4IOKA 1Y1TA 1N32B 4BTEA 2A0XA 4HEHA 4YLGA 1UKCA 4Q4AA 5DT2A 3WS7A 5JTUA 2FZWA 1OXKB 4OLJA 2HQBA 3G0HA 4MYRA 5JSZB 3I9OA 4WXPA 1DBQA 5DH9A 1LPPA 4JCCA 3OOEA 5ADVA 1G9XA 1X94A 3U3RA 3VUFA 3QU9A 4JITA 2IKQA 2FWBA 5I8WA 1TI7A 2QPLA 4ZI7B 2F3SA 5JARA 4I08A 2XBUA 3DQQA 3IULA 4XPIB 1TM3E 3DR3A 3L7OA 1XJCA 2O20A 3FCSB 2SKCA 3WLJA 3GMSA 2G0AA 4RSHA 4CV2A 4YJDA 4EYOA 1XLVA 2QLMA 2ZTVA 4UCQA 4TKUB 1EE1A 2XQFA 1HZZC 1BQ3A 3K9WA 2PX2A 3QZUA 3HJRA 3A3NA 1ZJZA 1UM9B 3JVEA 1KJZA 4HN2A 3IV6A 3FYSA 3HSKA 3M6UA 4ZAFA 4RSRA 1Z4OA 1XTKA 4IMJB 4EH1A 4PQRA 3TAXA 1T0JB 1GP2A 4HMPA 3EVGA 3W2HA 3UF0A 4YMGA 4ZICA 1YCGA 5HOEA 1IVNA 1S4MA 3HJCA 3P2EA 5HJ2A 1U8TA 4ENRA 4RQTA 3D81A 4O8ZA 1D2GA 1RLJA 2A67A 2O8NA 4BNKA 2PS1A 4RANA 4OQDA 3AY3A 3C7AA 4XGRA 3WLSA 3A1DA 5AHXA 2D5CA 1G8GA 3M6FA 4HWKA 4QIHA 3T3PB 3KLMX 3N8GA 1CSEE 1C0LA 1E2QA 5DBOA 2XIQA 3RSOA 5LZ4A 3ILXA 2FPUA 1GTG1 3PUHA 1SKBA 4OX9Y 1ISRA 3BHNA 4C20A 3V1TC 2PEZA 1W4BA 4BKPA 2YOGA 1UKEA 1W29A 3EFEA 2EKDA 4RF5A 4BP9A 3A6GA 4Q0MA 1GEEA 4IQ4A 2W90A 5JV5A 3ZPXA 4AO8A 2DBRA 3CT6A 1DQSA 1OXXK 2O4CA 1ZNZA 1B1CA 1GU1A 2QJOA 3DAOA 4KI7A 3LHIA 4BL5A 3MTBA 3DD1A 1GL6A 4HX9A 3DNMA 3ND7A 3S99A 2C98A 2DFDA 3IAUA 4U2EA 4WDQA 3S8EA 1Z88A 4QOEA 1BFKA 3FTNA 1G63A 1RAHA 3QK7A 3RUAA 4B4WA 2IP2A 3UM9A 2IS6A 1HA3A 2FLVA 1QFYA 4US1R 1NRJB 1FXWF 1J70A 1PV2A 4LKRA 1UKAA 3ITDA 1MQAA 3TLAA 2C4NA 5ESRA 4JI1B 4DLWA 4INAA 3KQLA 1EDEA 2PQ6A 3MCTA 1CQPA 1G8KA 2IHVA 2QUZA 2AMLA 3CLTC 2OYRA 3JQ7B 1AQYA 3LJKA 4L0DA 1R74A 4UQPA 4NBLA 2PD3A 5HKLA 3IKTA 1MA0A 4PG6A 3WXBA 4CMIB 3FUTA 3ZV6A 3RSCA 5D6NA 3PUZA 5KMGA 1IEWA 4NYMR 3TLEA 3C3EA 2XF2A 5IT5A 2QTCA 3RLFA 3EC1A 4C0XA 1COWA 3D4PA 2Q5LA 3AUKA 3MQ2A 4QEZA 3SSAA 4AWXA 1XWWA 3IAEA 2RCNA 3FPSA 2VPYA 5TE9A 2FSVC 1AGPA 2R8BA 3U7RA 2ZJ2A 1EFLA 4GRAA 4RJLA 5CW1A 5IJWA 2V55B 4OKNA 3ZD6A 1TEXA 3ODGA 4HCJA 4JLUA 4MWBA 1ZS9A 1C3OB 1UBMS 2DQ4A 1CEYA 3BSFA 1W5FA 2XUOA 4KR0A 2XMPA 1LDNA 2QTRA 3SC4A 3VV2A 1F8UA 4FU0A 1ZHFA 1ZHOA 1DLJA 4WERA 3B38A 2PXCA 3R3XA 1V7PC 4P31A 5B1DA 2IUTA 3UBMA 3GROA 2GD6A 3V8VA 1DAEA 2XCQA 3BRQA 1JDBC 2YCLA 3A9CA 1NU8A 1I32A 5KU7A 1FF9A 3UMBA 1ORHA 4Z0PA 3V7NA 4MCAA 3AG5A 5BRAA 4DUGA 4C21A 3GGJA 4OQZA 3KC2A 4N6OA 3AR8A 1C2YA 1CR4A 3EEIA 1AN9A 1RI3A 4PWYA 4Z7NB 1FMLA 5HQ3A 3LPDA 1H66A 4XOIA 3EOAI 5HSGA 2V65A 5DNWA 2UVQA 1BA2A 3I6ZA 4OQXA 4F0JA 4YO7A 4BO6A 1SHZA 1XA4A 2O2DA 3BGOS 4J0HA 3SYMA 3SQXA 1OX6A 4KFUA 3L7KA 3RRXA 1D4OA 1XTUA 3VH4A 5BNZA 2XRZA 3C0KA 3A7EA 3NC0C 4QYMA 1X39A 3IQZA 3GLIB 2CE2X 1I01A 2W6CX 3K0CA 5JD3A 5H16A 3GEGA 5LYYA 1AY0A 1CY7A 2R0QC 2YZ7A 3EEBA 1KO4A 1UOPA 2BFBB 2HZBA 4DJEC 2WF6A 5HXAA 1VHLA 3OQVA 4PAWA 4BEWA 1D2HA 1ZG3A 3EDOA 4J9UE 1FLDA 2Q2NA 5D1HA 2ZRMA 3DLBA 1NFQA 1U3GA 1RC1A 2A9QA 4QOIA 1NM5A 2IEAA 2WNSA 4HDKB 4CDMA 2ZWOA 1F2TA 1T5SA 2QL5A 1TZ2A 3TD2A 4BV8A 1V11A 1Z73A 2ATXA 2RKWA 2B5VA 2Q1SA 3CB4A 3T4UA 4Z2YA 1BMDA 4BKQA 2VHUA 3REQA 1S0UA 4AN4A 3BE5A 4QREA 1OI3A 5LOVA 4PLPA 1CYEA 1CZHA 2GTIA 2IOHA 4PAGA 2G4LA 2G6BA 4ND4A 1I51A 1V26A 1R8QA 3C5WP 3R3HA 3TSCA 2YC4C 3H86A 4ND2A 3PUKA 4RXTA 1NP7A 2HWUA 3VPAA 5G02A 3SR3A 3IMCA 1GNLA 2O6LA 5SICE 4KWEA 3BFKA 4LXIA 2UYHA 3CNQS 3OPQA 4C07A 1DTEA 2IC5A 4FYPA 3IALA 5JAOA 4FKBA 1VKHA 5LMZA 4IV8A 3KXDA 1IJKA 4P7KA 3K71B 1R0XA 2PL3A 4MWOA 1C9NA 2VT2A 4UAVA 2NSYA 4ZYTA 1KRXA 1Y34E 2XDYA 5EHIA 1R88A 5CCBA 3IEMA 1U7PA 5H3LA 2WDPA 4BLOA 1FU7A 4N3CA 4RM2A 3T7IA 2ZRCA 4EYSA 4C0SA 4Z4QA 2FP4A 4RKQA 2MU1A 4JOSA 2V4UA 2GB4A 3X1YA 1U0RA 2ZWPA 3HEBA 1F7UA 4LHVA 2PX4A 2CE7A 3P0FA 5L4NA 1TPZA 3R40A 5GJBA 2WF5A 3I23A 3KR0A 3GJ0A 5SYMA 2CNBA 4KN5A 1JWBB 3OTWA 1RRFA 2Q8NA 7REQA 1YKSA 1L9XA 3V7WA 1D6SA 5DZSA 2PRJA 3C3KA 4EI8A 3PCXA 3QQ5A 4JEUA 1AXEA 4FSHA 3G2QA 3WO0A 2VYCA 3H42B 2MOKA 5E2IA 4PCAA 3FSJX 4OJNA 2PQ0A 2DYKA 3L49A 1U8UA 4H3HB 1A8PA 2AGVA 1D1QA 2JZNA 4YI3A 1DV2A 1X6VA 3PR3A 1Q6YA 3ZWWA 5BWOA 2J0EA 2JCSA 5FFFA 1TKAA 1YONA 1NMYA 1YMQA 1GV0A 2B61A 5J3JA 5E95A 1QCYA 1FUYB 1WUJS 3E7WA 2A1UB 1P4AA 3IIJA 1K5PA 3N70A 3PQ5A 4RLFA 4RVHA 2AG8A 4UTPA 5JADA 5K0BA 2DM6A 3I4LA 1P18A 4AMUA 2OFFA 4LJAA 2GBLC 4Q9HA 1M33A 3H87A 4H15A 5EP2A 4ZVPA 5CFNA 2Z2ZA 2AI2A 4C6RA 4RMIA 2MIIA 4I0WB 1E60A 3QVJA 4JT9A 4EA9A 2XZPA 2FUG1 2FU5C 1EXWA 3GJ3A 2H3EA 4LVCA 3R0IA 3VZBA 2E2WA 1T1JA 1AHNA 1BH2A 3BH7A 1GZ3A 4UUPA 3MC1A 5DEOA 5PGMA 3UVEA 5HKAA 5L3RA 2CFIA 1P91A 1ZOOA 3IHLA 5F78A 1JIKA 3AR5A 4H35A 1Z4QA 4ZHQF 3I9V1 4EPYA 3JVDA 2B8NA 4EL0A 1N75A 1JFSA 1ANKA 3HUEA 4JROA 2WK1A 1UT6A 4KQWA 3MJTA 2O5EA 5THXA 1H8EA 2YWCA 2NYVA 2Q9UA 2FW9A 2YMLA 4I1PA 4D8TA 3ROQA 1Q0HA 1Z56C 4U2DA 4N76A 2PZEA 1UCFA 1FRQA 3CRNA 2VQEB 3DVLA 3I9LA 1BWRA 2Q5IA 1F5NA 4PXAA 1W76A 2J6CA 2BGMA 3MTQA 4XWGA 1CP2A 1PLJA 3VO8A 4QOFA 4DDHA 1X70A 3ONWA 3CZQA 4PAOA 5L7TA 2RC5A 3ZYCA 4ZDIA 2PANA 4I3FA 1UAYA 3SVTA 3NHWA 1N1MA 1SIWA 1UQTA 3EEYA 1LK7A 2YWJA 3ETHA 4ND8B 5EIAA 2NUTB 2QQ5A 3NAQA 4Q19A 2NU9A 1QYRA 1P75A 3W2GA 1BE1A 2CKDA 4PX2A 2XMRA 1JDPA 1C0IA 1MVOA 1RZRA 1EWTA 4TLCA 3UB4A 1HFEL 1DARA 3TQFA 1C8LA 4R7GA 3JYHA 3OPXA 2QX4A 3WE7A 1E18A 3L1IA 3NO4A 3WMRA 3FR7A 4F4JA 1GPLA 1EH5A 4GU5A 3W78A 1DOZA 1OYWA 2GKOA 1F51E 2TYSB 2OR3A 1G6Q1 2JVIA 2QGFA 2VT3A 4R2HA 1AOXA 4XFDA 1C3VA 5ENVA 1B93A 3ZGXA 3ULKA 3SQOA 3GD7A 4EFMA 2QX8A 5B6PA 4TQ9A 2WG1A 3E9EA 4JLWA 3RV3A 3RYCA 4BMOB 4PLGA 1FFCA 2RK3A 3VH3A 2HSJA 2F48A 3GLTA 1SXIA 4H6XA 1P77A 5F5LA 1KARA 5A1JA 4GR9A 4IIBA 4N3NA 2P9FA 4OATA 4MRPA 1KVSA 3HJUA 3G1UA 2PLNA 3M4NA 4NOKA 5JMTA 1ZDMA 1JQ5A 2PT7A 1TLFA 5AK4A 2DFNA 3GA0A 3ZI0A 3VKVA 4W5HA 1UK8A 3KE8A 4B82A 3LOPA 5I7RA 1NXQA 3HKEA 3IP6A 4BNDA 2ZE8A 2H51A 1WKVA 1IAQA 4PEVA 4JB2A 4E4YA 5GJVC 1T1RA 3IPXA 5KJ1A 3A3PA 4DR5B 2QX7A 1SOAA 1CNFA 1PR4A 4BN0A 1FDWA 1PZXA 3FWZA 4W8GA 4RTKA 1QORA 5KOJA 1GLNA 3MN1A 3PXBA 3PDIB 3FH0A 2FN9A 2I1VB 2PV0A 4P92A 1FDTA 2PY6A 1K3UB 2W6JA 3A1VA 3KQPA 2OD9A 3QMWA 4EW3A 1I94B 1EJ6A 1KO7A 5JH7F 3INGA 5IH3A 1KYXA 3S8MA 1KI2A 1UBUS 1BE8A 2DHDA 2P9YA 3KKNA 4XSGA 1Y42X 3IVMA 1Z5VA 4GZ5A 4NEHB 2DBYA 4AECA 1JJAA 1Z2AA 3KS9A 2BEUB 4YJFB 1NUUA 3GLFA 3DYIA 4O1MA 2FDXA 1RTTA 3I1IA 1Q50A 1CJUC 1TEHA 2A30A 1M1ZA 2J5KA 2VDQB 1EINA 4YMTA 4JV5B 3A1EA 3A3OA 4WFQA 3EYAA 3QENA 3R09A 3DONA 1WUYA 5KPJA 4C87A 3KE9A 3U1BA 5ALRA 3BWBA 4NENB 3C6BA 5HK9A 3I73A 4EMSA 1QKKA 4OFZA 3QOFA 1E6LA 1TL7C 1YI1A 3MVEA 1WEHA 1X7XB 3JZFA 4P2GA 5BUSA 4ZJUA 2QMQA 4FQ7A 3IP5A 1RIFA 4FEYA 3QBTA 4Y1GA 3OTGA 4YV7A 3P9RA 3TIIA 1MENA 1NQ5A 1Q7GA 2NTEA 5AVVA 4Q3LA 1NAIA 1LJ8A 1YULA 3NIGB 5M2QA 3LQFA 4LBYA 3VNBA 1B74A 3FR8A 1KGDA 3I9MA 1ZK4A 1KBZA 3U4QB 3EG5A 1ESDA 2Q3DA 3IA7A 2VJPA 4J0CA 4BKRA 4MI1A 2EZUA 4L6AA 3UANA 1MEJA 1M10A 1EJBA 1NDUA 2I6QA 3ONVA 2PZBA 3OOHA 4IEFB 3V00A 3VU9A 2P41A 3ZE7A 1WQ4A 1NVDA 1W88B 1YZGA 2Q6LA 1Z28A 2D7JA 2R5NA 2Q45A 3GLQA 2IYVA 2GN1A 2Q2OA 3AF1A 2PS0A 1VIVA 3LL4A 4OXYA 3LRPA 3H3JA 2NADA 2Q5OA 3DS8A 4G1MB 3PRYA 4AK9A 4EFNA 5GZ3A 1ISHA 1COWD 4G24A 1Z13A 3BXEA 2C95A 1YK0A 3RPEA 4F4DA 1DX4A 1VKZA 4B6GA 2HYIC 2PL9A 3HGTA 3ZD8A 2H08A 3Q4GA 4ZTBA 2NTNA 3O1JC 3TNYA 4HNUA 4XX0A 3THYB 3L5OA 1Z4KA 4CR7A 2KX7A 1C4KA 1JPVA 2VXYA 4HGZA 4EYGA 3H9JA 4BLRA 1QTNA 4XJVA 3S2GA 2FE1A 2IYEA 5DNYB 1WCWA 1OI2A 3OIFA 2HN9A 2XQIA 1ZSNA 2P5UA 3KJNA 1FJ2A 2DFKB 3R6GA 4P5PA 4P4TA 4FE3A 4K9SA 2YJGA 3AVVA 1P4HA 2UVPB 1Y8ZA 2IYSA 4DPMA 3ROGA 1PT6A 2JLYA 4GL2A 2ZJFA 2I7XA 3AETA 3EBOA 4ARUA 5K51A 3I09A 5A3SA 3RU7A 1ZA2A 2Z8XA 2DPLA 4ZVQA 4OCZA 1KAQA 2O05A 4BKUA 4N39A 5BVHB 5DN6D 1QUFA 3PL5A 4HTFB 4JGIA 1LK0A 5JJ5A 1GAJA 3KOWA