1BVYF

Complex of the heme and fmn-binding domains of the cytochrome p450(bm-3)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
152
structure length
152
Chain Sequence
NTPLLVLYGSNMGTAEGTARDLADIAMSKGFAPQVATLDSHAGNLPREGAVLIVTASYNGHPPDNAKQFVDWLDQASADEVKGVRYSVFGCGDKNWATTYQKVPAFIDETLAAKGAENIADRGEADASDDFEGTYEEWREHMWSDVAAYFNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a cytochrome P450-redox partner electron-transfer complex.
pubmed doi rcsb
source organism Bacillus megaterium
molecule tags Oxidoreductase
molecule keywords PROTEIN (CYTOCHROME P450 BM-3)
total genus 46
structure length 152
sequence length 152
ec nomenclature ec 1.14.14.1: Unspecific monooxygenase.
pdb deposition date 1998-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1bvyF00
1QHEA 1RCFA 2Q9UA 1ZWLA 2W5UA 2HNBA 3KAPA 4YAFA 1H69A 2RG1A 4YQEA 4ZVLA 1CZNA 1TIKA 3OWHA 1JA1A 1T0IA 1TLLA 1QRDA 1WSWA 3EYWA 4U7FA 4C0XA 3NHWA 2OHHA 4PTZA 2KQUA 2GSWA 4DILA 1FTGA 2OYSA 1J8QA 2Z9DA 1OBVA 2B3DA 2FVXA 4ZVMA 3UXEA 1QR2A 2FZ5A 3FNIA 4YALA 4U7HA 1VMEA 4M0CA 4F8YA 5BUCA 1FLDA 5LVAA 2HNAA 2KLBA 2MT9A 3ESYA 5FA6A 3SVLA 3NLLA 1J9GA 2QX4A 1ZX1A 5LJLA 1CZUA 3F6SA 2FDXA 2R96A 2Z9CA 3RPEA 4ESEA 2QWXA 4C14A 1OFVA 2QX8A 2HPVA 3F2VA 3GAMA 4QOFA 1SQSA 3G5MA 1F4PA 1FLAA 3NHKA 1D03A 4ICIA 4J8PA 1FLNA 3D7NA 4PTYA 3TEMA 1SG0A 2BZSA 5FX2A 5JROA 1XI2A 4C76A 2D5IA 4QOGA 1AMOA 2V5VA 2MWMA 3K20A 2M6SA 3NHRA 3EDOA 4FGKA 1KBOA 1DXQA 3FX2A 1CZHA 1GG5A 3W7AA 2AMJA 2Z98A 2FZVA 4HS4A 1YDGA 3N3AC 1D4AA 2MTBA 4ZVNA 3ZHOA 2WC1A 1RLJA 2R97A 3QFRA 3QFCA 5FUQA 1AHNA 3O73A 1YKGA 4BMPB 5F12A 2QR2A 3NHUA 3ESZA 5A4KA 1T5BA 3OX1A 4Y7CA 3KLBA 2V5UA 1YRHA 4QOIA 1OBOA 1X77A 1XYVA 2X2PA 3N39C 5NLLA 3B6JA 2FOXA 1C7FA 5B3LA 1DX9A 3LCMA 4XDGA 1AKQA 5ULLA 3U7IA 1JA0A 3W78A 3NHFA 3HLYA 1J9EA 3OX2A 1ZWKA 1XYYA 4GI5A 3LT5A 3OWXA 1RTTA 3P0RA 4S24A 3FVWA 4Y9RA 1CZLA 3R6WA 2ZKIA 4FX2A 3B6IA 4QOHA 4QODA 3NHLA 2QMYA 2N1MA 4LTNA 4DY4A 3W77A 1B1CA 1I1OA 1BVYF 4FGJA 4C0WA 1D04A 2FCRA 4N9QA 4CF6A 3OX3A 4D02A 1AKUA 3FJOA 3FW1A 1CZKA 4NULA 4Y9UA 5EMNA 5LLDA 2XODA 3HA2A 3NHJA 4LAFA 4R81A 3OVMA 2F1OA 3W79A 2Z9BA 2A5LA 1DXOA 1J9ZA 3NHSA 3TE7A 2XOEA 2Q62A 4NLLA 4ZVKA 3KEGA 1C7EA 4QOJA 5LBUA 5LMCA 1YCHA 1KBQA 2BMVA 3ES9A 1YCFA 1E5DA 1XT6A 2BPOA 4LA4A 2V9CA 1NNI1 4BMOB 3B6KA 4H6PA 3NFRA 6NULA 1YOBA 2X2OA 1YCGA 3GFSA 1V4BA 4QOEA 5B3KA 4YAUA 1WSBA 2ARKA 2QX6A 3K1YA 1AZLA 1CZOA 4YAWA 4U7GA 5EA2A 5F51A 3QE2A 3TZBA 3F90A 5TGZA 4DIKA 5LJIA 1FLVA 4PU0A 4FGLA 1AKWA 1CZRA 3GFQA 5F4BA 1AKVA 2FAXA 3JSXA 4H2DA 4XDHA 5NULA 1QBGA 4N65A 3F6RA 4LTMA 5EAIA 4GQIA 4YAOA 4CETA 1RLIA 2OHJA 1AG9A 2QMZA 3N3BC 3NHYA 2BN4A 3L9XA 2BF4A 3NHPA 5LBTA 3OJXA 3U7RA 4GR9A 1FX1A 2M6RA 1AKTA 2QX9A 2MOKA 3L9WA 1FVXA 3ESXA 3HR4A 1H66A 3KAQA 4HEQA 2OHIA 3S2YA 2FLVA 3UXHA 1FUEA 3B6MA 4LTDA 4N82A 4OXXA 3OJWA 1AKRA 3O2NA 2FX2A 3GFRA 1BU5A
chains in the Genus database with same CATH superfamily
3OBIA 1KQPA 4L75A 3W0LB 1P39A 2GM9A 4F2GA 4DV0B 3PQCA 5DEOA 3ZY2A 1R8YA 2JD0A 3E82A 4KITB 2AXQA 1SIWA 5C8VA 3R7DA 3OU6A 4FGWA 4P4SB 2BFBB 2ZRPA 2AOWA 2IDKA 1IQ0A 1XA3A 3B51X 2R79A 1WCYA 2VNSA 3IIKA 4Z1MA 1KAQA 4L0CA 2RGNA 2CJPA 5GONF 3AIOA 3EQ7A 4R1SA 3I9OA 3UFXA 1QPBA 4E2FA 1EGHA 4FFBA 4HNSA 3EPHA 1GGVA 1ZRSA 1KAOA 2FEMA 4L7VA 5FWDA 2FSGA 2DQ4A 2QMOA 3F5FA 1NJ2A 2OGTA 1SCUA 3CR7A 1Z73A 3L06A 4ND1A 2NQ2C 4O5AA 1L5YA 3BQNB 3OLQA 5KJCA 2EWWA 4L9RA 1A4UA 3QVXA 2RHLA 2YXNA 5BNTA 2FPGB 1R8SA 3D1JA 1XNQB 1RDFA 1FDVA 5HWSA 1NQVA 3DCIA 3NBFA 3RC1A 1KBOA 1DWOA 5EIHA 3BK1A 2PL1A 4ZVNA 2FZVA 2C7BA 3WGNA 1KYZA 3CRZA 5FR1A 3A4IA 4PN3A 5IH3A 1DEOA 1GNQA 1M8FA 2DPMA 4MJXA 1KORA 4MW9A 2PCLA 5CH5A 2OZVA 2Q50A 4LYDA 4MGKR 3L6DA 1E4EB 1E9CA 2GCIA 4O5OA 4NR0A 1J99A 4NQRA 5D85A 3DAHA 4F3RA 1JYSA 3M3DA 2PFSA 1TYBE 4ZQIA 2G08A 3ZQJA 4FYKA 3K0FB 1JQDA 4KODA 2DR3A 5CTJA 2NT3A 3C3AA 5IAEA 1S8NA 2AHRA 3DE7X 3LWZA 3TO5A 1NMYA 3PQDA 4FOLA 3Q2OA 1RKQA 5KAPA 2FHSA 4BQOA 3GFBA 4PSAA 1JG2A 5DW3A 2OZLB 1CZLA 1J2EA 1NVUQ 4RAQA 1XD9A 4JB3A 4JT8A 3BKXA 1KE2A 4DIEA 4EG0A 2TMGA 4A8JC 1JG4A 3A6LA 2BLLA 2GLTA 1G2OA 2WNHA 3C8DA 3E61A 1IY0A 2CYBA 1MIOB 5SZIA 2XCTB 3PGLA 1JR3A 1DI0A 3VR5A 3DZJA 1C0LA 1JFLA 1EVEA 4MDYA 4W1SA 5AJVB 5EQJB 3ZIUA 4RF4A 3DMNA 4FUQA 2WHEA 4EF4A 4W5QA 3WWCA 3DOOA 4EGCB 8MHTA 5JS2A 1RKVA 4L9SA 3PLNA 3R3UA 3SYNA 4K6FA 4J3JA 2Y9MB 3DFUA 4O25A 4EPVA 1E5DA 2AA3A 4YCBA 1QTIA 2GHTA 3MJHA 5IC5A 3R7NA 4F2PA 1TFUA 4S0ZA 3FROA 3VYTB 4JZKA 1Z2CA 1QONA 5B64A 3WOHA 3CVVA 2OCGA 3AP2A 4NMMA 5YASA 1IL0A 1MEEA 1W36C 1VPDA 5BVHA 3ANYB 1SRQA 5AVOA 1KU6A 3QA9A 1G8PA 2J0UA 3T3IA 3PDJA 4LC1A 3UPDA 5CA1A 1Z29A 4ZZ0A 4J0KA 1SVLA 5L95A 3DVLA 4J1NA 5KYUA 2ZU6A 4F4UA 1SD1A 4YLYA 3NANA 4CKWA 4MGYR 1BJKA 3NG1A 2X9QA 4DA9A 2GZ2A 1RBMA 3FUUA 3K2EA 3O2SB 1C4KA 4OH1A 1I10A 4OPMA 2X0DA 2QX9A 3LSTA 2G4LA 1HE1C 2KSQA 4NAUA 4TSKA 4UUQA 2QSJA 3I0ZA 4MS4A 1L3BA 4PSCA 1ZD9A 1BCSA 2GYYA 2WOJA 4TLLB 1Y98A 4NESA 3KB1A 4R7GA 3S81A 3TVDA 1VRWA 1Y82A 1IIRA 2JLBA 3BH6A 2EL7A 4JMLA 4XVQA 4YO7A 5FOVA 3DW1X 4BVEA 1K6XA 4DLSA 3EEYA 4PC2A 5L7WA 2FN3A 4JXZA 2HSGA 3B12A 3KP1A 5B6IA 1ZXLA 5H82A 5BOSA 2GTHA 4YPOA 2WR8A 3DW3X 4N49A 1AB5A 1YIOA 1ZEMA 2GQ0A 2GPAA 4HLCA 4NDZA 4DNPA 1Q15A 3CF4A 3OZCA 5E7QA 2QTVA 3ZK8A 1WOYA 1CNMA 2BFFA 1KE1A 1CY2A 5EXXA 5E6RA 4M88A 2I87A 1E9SA 4MP8A 1B4DA 2W6ID 1JHUA 3B2EA 2XCUA 2CKMA 4LRYA 4KXFB 2W48A 1J2UA 2B69A 3PXDA 5F1OA 1ZMRA 3IHTA 3VYUB 4C3ZA 5BP7A 4TXNA 4NMHA 4C6HA 3JALB 1IZ0A 3QNWA 3WAKA 4CCYA 5LR6A 4DUYB 1Q22A 2VHUA 2BSAA 3HQ4O 3RJMA 4O6VA 5CNIA 3THXA 1QB8A 3O03A 3PHIA 4KBFA 5DCYA 2FSUA 1YQGA 4J3FA 2GK6A 2WF8A 3FVTA 3WYEA 4DF3A 1IEQA 3LBHA 4PAMA 4DYHA 2XTMA 1KDPA 2O1SA 2EKDA 4JQYA 3DTVD 2FKNA 4IINA 5E9QA 3TQHA 1RXWA 3IKLA 5AHKA 5KWEA 1RHMA 1WHTA 2H4JA 4QEKA 3EXEB 4QBTA 1U99A 5BVHB 1QJCA 3MSXA 3CUEF 3CNBA 1SXJC 1OLSA 3HM2A 4HDOB 4EYOA 3TW8A 3ZYZA 1AGPA 1XLVA 4C5BA 3FMVA 1TQ6A 3PSAA 3RWMB 4BNUA 1FUUA 4KQGA 3GEIA 4OVKA 1N1EA 1HURA 1GT6A 4BB5A 3LUFA 1K6EA 2WKQA 4DEXA 1VE1A 2P3OA 1NASA 5AFSA 3G0OA 2VH1A 5TT1A 4DJDC 5KU7A 1Q19A 1P62B 2F1HA 3P52A 4NCHA 2DY1A 2ZULA 4CR7A 4NXMB 1BKDR 3V6MA 5H3LA 4DM3A 3SIRA 3FCYA 3C3PA 1W7AA 2WSLA 2IXDA 2VUSA 3M6FA 4W8OA 4YWHA 3QQPA 5DWDA 3DWEX 5FLYA 3SHQA 2UZ4A 3A6KA 5FB3A 2PVSA 5GJWC 5DRYA 4N0EA 5IM4A 1YJ5A 1GTRA 4PQYA 3RS0A 1F7UA 3BMOB 2VF8A 1SJ9A 1O95C 1P5JA 1OREA 1BEZA 2OC9A 2J7PA 5BURA 2WU8A 2HRCA 4BB0A 4G1UC 4K9LA 3OH8A 5TDHA 2W8BB 2VWHA 1RMTA 2IOQA 2PT7A 3UCFA 2Y4OA 2JEZA 4ADSG 1VG8A 4I55B 1RZVA 3U0BA 4AZVA 1F7VA 2WD9A 1KJYA 1P91A 2X58A 4HQ6A 4RK4A 4ZAXA 1JDBC 5AJYA 3TQSA 2QRKA 1G55A 1LTKA 1XTSA 2JPDA 2WP8J 1UP6A 3ABRB 3GEHA 4MGEA 4YRRA 2LTAA 5AUOB 3K9CA 3DO6A 1IOZA 2QPLA 4JASB 5DI9A 5TQ0B 4MKFA 4JIMA 3FNRA 1NU6A 1KEPA 1UC9A 1HC7A 2H0RA 1W8DA 3OZSA 3VTZA 3IEVA 4E5YA 4E33A 2PZMA 1Z6XA 3FPBA 1QLWA 5JCJD 3W5CA 1NKSA 2PSEA 3UJ9A 3IAFA 4OBEA 4RD1A 1CF4A 1GAEO 2C5HA 4ZIRB 4P4UA 4G26A 4DRXB 4IMRA 5IZ4A 2IV2X 1I3MA 4XA8A 2G63A 4EKEA 2G82A 3IAAA 2Q3HA 4KGDA 5FTMA 3DZKA 2OK8A 3Q7QA 2OVFA 2B2NA 1ZCAA 1XGKA 1TVCA 2H54A 5B4UA 1PWYE 1TTHA 1FBNA 2AC2A 3EWNA 3RLFA 3LUPA 3ZWXA 3EA5A 4ARCA 4K6KA 1I2BA 3AEKB 2Y1KA 4H59A 4E5PA 2OXTA 2PSDA 3MOSA 3TE6A 1QQ7A 4ALIA 1A5TA 4Q0MA 1PFVA 3BORA 1M2OA 3O8OA 1KR2A 4BE4A 2V6IA 1CD5A 1AF7A 3RF6A 1TZJA 4ML3A 1VMDA 2PPVA 4L5YA 1ZN9A 4LUCA 1US8A 3EEBA 3HSYA 5IX8A 4QELA 1WM1A 1WS6A 1P1JA 4P86A 4HV4A 3FDFA 3AC0A 4TS3A 2DCUA 4X3CA 5COAA 4KI0A 1N2EA 2M1ZA 1E66A 2O2DA 3LC0A 3TKYA 5KYTA 2V5AA 4E4YA 3M34A 2RJNA 2G9ZA 1Q7TA 2J6HA 3O4JA 1NW8A 1YNOA 4KO3S 1W59A 1T29A 3DKKA 5K0BA 1YE8A 1EWQA 4ZOLB 1F51E 1CY0A 1VYHA 5FWNA 4RTMA 2FR8C 5A4KA 1PTJC 3PUVA 2RGDA 2DOKA 3CW9A 3K09C 3QW4B 4KMRA 5LA6B 1PVOA 2OCKA 2RSLA 1WEKA 5JBQA 3HHEA 1W581 1DX9A 3KLMX 2VUIB 5HA5A 3RYIB 1E8DA 1KSFX 1HPLA 4BUJA 1WCWA 3OKPA 2FCAA 3IKTA 2VBIA 1S3IA 2CNLA 3QE4A 1WMFA 3U5TA 2QUBA 1Q0PA 2DPGA 4H7PA 2OORC 4MVJG 1Z62A 4QPCA 4S3MA 2HXYA 2ONKA 3C7KA 3D8NA 3NDRA 5K0JA 4Q48A 2BONA 5ES4B 4GU5A 3FUXA 3I64A 3ECCA 4YRNA 3CNOA 4LOHA 2A8YA 5I5EA 4OHYA 4E21A 5ILQA 3KAKA 2HDHA 4B87A 1QE0A 2X41A 4D9HA 2ZIWB 2B35A 2EF0A 3FB4A 3EVGA 3RVBA 1MTOA 3PKJA 4HH3C 1CJTC 1EIZA 2CXPA 2HDOA 3ONWA 4KWEA 4UTRA 1NAHA 2GCPA 1J7JA 2HU7A 7MDHA 4MR9A 4C7OB 2F4VB 1YR7A 4R1QA 1R6VA 3OZUA 3VDMA 4JJ6A 5J5AA 4UPVA 2GVZC 3N74A 1PV1A 1E64A 2YMPA 1D8TA 3KRTA 1NVBA 221PA 1LX6A 2A84A 1B6GA 1GTL1 2Z3VA 1M67A 4KZPA 4HAWA 4IMJB 3COYA 3TOSA 3UWSA 4N65A 2OHGA 2RI0A 4LOAA 3RRFA 4COKA 1P6XA 3ITEA 3TSYA 2O5CA 2JCGA 1R4MB 2OGUA 3DFZA 1JSLA 2CYAA 1KU0A 3W8NA 4B6FA 3L9XA 1XVUA 3QVOA 2FWPA 3VR6D 1XZMA 2NSDA 4ZVRA 1O54A 2GLUA 4YROA 4FFDA 1M2NA 2J5RA 3I6YA 4WT7A 1CRWG 3GHYA 3UMSA 1BS1A 1PJRA 3C5EA 2EEZA 5CFMA 4RY8A 4CCYB 2CFRA 4ZJYA 5DMXA 2GHIA 4HADA 3LQ2A 4R9RA 1TK2A 3I73A 1RWBA 2X7JA 1YE5A 3DDCA 2M98A 1RI4A 4NMXB 1M72A 2P2CA 3GEBA 3I1JA 4LXHA 1ZM3A 3SQMA 4IIJA 5AQ1A 3P0IA 5LA6A 1FU7A 4Y6PA 1JQ5A 2JHGA 4OJQA 4I4CA 3E53A 1Z2OX 4GECA 1VFPA 4IXWA 5FV4A 3U2QA 6ADHA 4IFBA 2D06A 4LZLA 5AMXA 2PRJA 2GNOA 4M7WA 3EDYA 4OATA 1PS0A 2Z95A 3G13A 4YXWA 3W5BA 3G2MA 4ID9A 4OOFA 1JYEA 3M6UA 4Q4HA 3CT4A 3WMFA 2VBCA 3AVWA 4PZPA 3B5EA 5DYIA 3WO0A 4RPJA 1MU0A 1ZOPA 3AHDA 4X6LA 3EF0A 2MHCA 2C3MA 2HV9A 2PTHA 1RYEA 1YBAA 3IKJA 3P9XA 3N6XA 3BTVA 3LPLA 3F8SA 2FA9A 3K5IA 4K9PA 4R68A 1XZKA 1Z5GA 2VDWB 5LLSA 1SBYA 3QWHA 4UBNA 3H9UA 4WZBE 5C4GB 2DWUA 4EF5A 1I0ZA 1EUQA 5T6BA 1E6LA 1J5PA 2AUTA 1JQEA 5GJCA 1TJNA 3HXKA 3MIIA 5D8DA 2DGDA 2UVDA 1G8YA 5FV7A 2VXCA 2GT1A 4OLFA 3ONEA 4X7MA 2Q5EA 5KHOC 2D1RA 3NHFA 1C80A 3WRYA 2H2GA 4ARZA 5JCOC 3FOAA 3QSYA 1UMDA 3WLKX 4DLBA 1Z5WA 3Q1KA 3INRA 3GFVA 1YE3A 4M98A 2OT3B 4DTIA 2BKVA 1B1CA 1P2TA 1JR3E 3IR7A 2WJPA 3O8NA 5EGNA 4CF6A 5CITA 4YX9A 4AQ7A 1MX9A 2FQWA 1CR6A 2F9LA 1L7BA 3BZWA 3H0EA 2R1VA 4RO0A 3EXHB 4REMA 2GVNA 3PFBA 2Z9BA 4NMWA 2KBEA 4JWKA 3ZWYA 4E22A 4Z9XA 4EELA 3KPYA 1OR8A 1U7WA 1BN7A 1HA3A 3R0VA 2B1QA 2QN2A 3KT3A 1WW8A 4TZ0A 3LZDA 1GA6A 4HJXA 4BLTA 5ALJA 3CPEA 1REQA 3A0UA 3CNLA 3AM5A 4ZYTA 1GZSA 3LUAA 4YCSA 1U63A 3FG9A 2HF8A 5AQEA 3B1KA 4HLUA 5FA5A 2QG9A 2FXVA 1U80A 1BXRB 1QRUA 1M2EA 1E69A 1EH5A 1TI7A 2ZJ4A 3R6DA 4O2AA 3JSXA 2HHAA 3R5FA 4HX5A 2IXAA 3AKCA 4GC9A 2XLBA 1CVIA 3B3AA 2XT0A 3DH0A 1C8LA 3QYFA 3R5JA 5JDCC 4ENPA 5I4BA 1JB9A 3WIUA 3CVXA 3EGDB 5JY1A 1YK0A 5FPQA 1OIVA 1UWLA 2JK0A 4O2BF 3P0HA 4XGRA 1FQWA 1VGQA 1TAUA 4HGZA 3HS3A 4LRXA 4RJJA 2WWTA 3GZ4A 3JQ9C 1QH1B 3JXEA 3NB0A 3FHOA 4YN3A 3RM3A 2F3QA 4E09A 5SYMA 3ASVA 3DTTA 4BNDA 2O8BA 3FJ1A 1EDBA 2Z6VA 4RJKA 1OYVA 2C8JA 4E03A 2ZI6A 1TADA 1RM4A 3KPUA 4YHBA 4KE9A 4JU9A 3A1VA 1TYCA 2XRYA 2QUKA 4N3AA 3I04M 2IXTA 3LWNA 3UATA 4N0QA 4C7OA 3CEAA 3IH5A 4UCXA 2C95A 5AJHA 4B6QA 1MXHA 3FYUB 1WXEA 3JRWA 3QKTA 4XD7A 3F4LA 1GPMA 1V8ZA 4GMHA 4PG6A 1GTMA 5DK4A 4O8CA 5LSAA 3MWKA 4RV4A 3BTOA 3L1HA 2LCFA 2P79A 1EJ2A 3IOCA 2PEZA 3GA7A 2E4UA 4RGQA 5FHRA 4PYRA 4C03A 4N40A 1UANA 2Y1EA 1KZGB 3R0ZA 3W1VA 4A3SA 3KZVA 4B4VA 1YAHA 4F84A 1U4OA 1VKRA 4MI3A 2Q0QA 3LFTA 4P2BA 3NIBA 5E7IA 2AUNA 3D7NA 3CEHA 3JALA 1I3OA 2AMYA 4J9VA 2I99A 1CUJA 3H0CA 1XVIA 2RGXA 4RA6A 1RRVA 3BILA 4X1IA 4YYEA 1JKMA 3HYSA 3B2NA 5E95A 3WS7A 1UKYA 2HSZA 3IIEA 2MYPA 2ZE7A 5T4BA 3OLYA 1G6HA 1CUHA 3HFGA 5AVQA 1FZTA 2CJWA 3AUJB 4XSVA 5M04A 3V7YA 2XZOA 4TXMA 1VJRA 3BCSA 1U8AA 1DBRA 1GPUA 1IN5A 2WNIA 2B92A 2XQKA 3J81A 4FUTA 4CMKA 1QGOA 3ODPA 4KXQA 1TLFA 4AS3A 5BWCA 4MUMA 2J31A 5JNRA 2VRNA 3OLZA 1FMFA 2CJWB 3ZWAA 4FIZA 1ACJA 3SFZA 3ETNA 2VAXA 3CVWA 3AUXA 4LPSA 4BVHA 3NIGB 2DTDA 1GILA 2HF9A 2IPAB 2YOGA 1P4JA 5KMGB 4JROA 2ZBVA 2IDMA 2ZJZA 2C5LA 3F3MA 4M0MA 4N9QA 5JO0A 1KO1A 3HFRA 5EJGA 3FUCA 5CXXA 4CIYA 2WT9A 5TQ2B 1VLVA 1B76A 2FWIA 1XTTA 5E6UA 4XUEA 5JOQA 3CUWA 3IUYA 1RABA 1X87A 2DE0X 2B4RO 2UYOA 1ADBA 3BTSA 4M37A 3GFFA 2HQOA 2XAUA 2C97A 2YMQA 3G5UA 5KNCH 3GLGA 1M5RA 1DWUA 4QFDA 4C08A 2NTYC 4X90A 1Z74A 5AHOA 3WO1A 1I6KA 1NIJA 4G01B 2IH5A 1E5VA 3N0VA 4CL2A 5J4KA 3DZCA 3ETCA 2XOXA 3P2JA 1U6KA 4CM4A 3LC7O 2HA4A 3PJGA 1WXHA 4DSTA 2NTNA 2JLAA 4ZVSA 10MHA 1EMDA 4MRPA 4KR6A 4C7XA 4Y2JA 4HLQB 2RHWA 2XMQA 3EH1A 3P9CA 5KNDA 1OB2A 1U8UA 2PBFA 3DEAA 3CCBA 1KQOA 5EN4A 1U0EA 2GYVA 4R2WA 2Q1SA 3KDAA 2QQGA 3QRWA 4NZZA 3RJTA 4DY6A 2G28A 4M38A 4CEJB 2GEVA 2MIIA 4HWSA 1WZIA 2VDVE 5I7OA 1X9IA 1NURA 2FHPA 3FIJA 1LNZA 5CR9A 3E48A 1KSJA 5ALLA 1KWGA 2ZVPX 5BSRA 3HR4A 4RCYA 4QGFA 3RKUA 5EINA 3AF4A 5IFLA 1JEYA 2YC4C 1E62A 5LP6B 4GPBA 2PQ2A 9MHTA 5DW0A 3QHQA 1PG0A 1PNQA 1R9GA 1YB1A 4BFXA 4ZYVA 5BN1A 2IJGX 2CNWD 1DV2A 1HXHA 2C4VA 1YASA 4MUYA 3MSCA 3QLUC 3RUHA 5CA1F 5BOVA 5BVGB 4CKCB 1G291 1NOJA 4BX9A 1RHJA 2YIDA 1J8QA 3L0IB 2FR1A 4O4HA 3BX1A 1Y89A 5JYDA 2OBNA 1ZIOA 1LX7A 4UDXX 1QNFA 4CTKA 3SWWA 1UPUA 4P82A 4H6VA 4HMQA 4ZOAA 2W4QA 2E2WA 1C4OA 2VYNA 4BRZA 4D99A 1ESMA 4G1BA 5K8LA 1H6BA 3SBOA 1ULZA 4UVGA 5B1DA 1VLJA 3CPSA 1D2RA 4A8JB 1TEZA 4PGAA 2P9HA 4EMUA 5EMMA 1BSVA 1WLSA 4C1BA 4WESB 3T5DA 1FW8A 3QXXA 1O4WA 3RJZA 1L7OA 5AW6A 5F7OA 3IMEA 2JI8A 5INTA 1XI2A 3H9BA 4TZ6A 3M5CA 3CFYA 2NO4A 5GVSA 5G2OA 3JQ7A 4M8NE 3KQLA 1ZL2A 3RBXA 4DHWA 1JAIA 4QGSA 4E31A 4KYUA 2CD7A 2HWYA 2V03A 1I6WA 5A3RA 2ZSBA 1UEIA 5KDOA 1QS0A 3CLUD 4MYUA 2FDCA 2RKBA 4D6YA 4I5IA 3OOJA 2B8WA 3WFIA 2CMHA 3C4VA 4E12A 1GPH1 3ED1A 1MF7A 4FYWA 3MEQA 1M1YA 3STVA 4DC9A 2AW3A 4M1ZA 3N8KA 3E2IA 5CRIA 3KK0A 1ZFNA 3GZNB 4JVMA 3WK8A 1Z4MA 2Y71A 2H7VA 1GDHA 3AHFA 3RQIA 3RFVA 1B26A 5DBOA 4LHWA 4RVHA 1YZFA 1XRPA 2RK6A 4KXLA 2A0KA 1WF3A 4DQVA 5JSHA 3MRVA 4EDHA 2X0JA 4WVFA 3JD4A 1E6UA 3AJAA 3H84A 4KRYA 5B53A 4F9FA 4JITA 5A7FA 1K89A 3QU2A 4KIFA 5TPZA 1CTQA 1LFAA 2OHXA 4M9CA 1PNTA 2IGTA 1K68A 3ZDXB 3RK0A 1TT7A 2E4AA 2Q4OA 3GDWA 4UU1A 3BMQB 2HRZA 1WKCA 4HB2A 3H17A 4PANA 4XKJA 5T3YA 1SKAA 3HXOA 5CDTA 2GBLA 3GT3A 1LI7A 2P62A 2V7XA 2WZBA 3SHOA 4RZXA 3EC2A 5AT1A 2PYZA 3F1KA 3O92A 2PD4A 5KSYA 1Q2XA 2A57A 4NZYA 1I94B 1EQUA 1L4MA 4FB5A 3H1AA 3N86A 2BGWA 1U7PA 3GLVA 1YIDA 4KQ1A 4F5WA 1P5HA 3FXAA 3WK6A 4YCLA 4MVJH 1U7UA 2PGNA 3GZJA 4HY3A 1TZKA 5KNBH 2PCJA 1Q7BA 4OLJA 1V9LA 1QBGA 2A30A 4AX4A 3N2YA 4R8SA 3T3HA 2CYCA 3AGPA 1E2JA 3MCTA 5EE5B 1XC7A 3IAHA 3S99A 3LPCA 4CKWB 4I6GA 2G1AA 4Y1EA 3T7AA 3LCUA 4B7CA 4BNFA 2I29A 1I1QB 5IBPA 4M7RA 1E9FA 1FVXA 1SM4A 1Z6ZA 2EP8A 4PPQA 1W1UA 2GTIA 3LX4A 4DPLA 1U5BA 3PYMA 3UXEA 2C0CA 1MPXA 1V6CA 2J9FB 2G09A 4UAVA 2ZZMA 1HWYA 1K9SA 1IZ7A 1SHTX 2QT1A 4KLZA 4W1QA 2Z6UA 3LK6A 2YW9A 2B1JA 3X2EA 3GLGB 3ZEIA 2ONCA 5U9CA 2HA2A 1LDMA 2JGFA 3MGAA 5AWFC 1USKA 1T4MA 5JTTA 3OIVA 4QDOA 3RSLA 1RRFA 1Y4DE 3PCRB 1CE8A 1G4HA 4IQFA 5HCNA 4CODB 1KH1A 3C3EA 1M33A 2JIPA 3ADOA 3RG8A 3RO7A 4A5SA 4TYMA 4O1IA 3CNQS 5D86A 2I66A 1OGYA 4QDUA 3HDQA 3A2LA 3S5JA 2GF9A 3EVZA 4FNAA 3WQQA 1HL3A 3I0NA 4BRSA 4F86A 3M5PA 2FP4B 1DHRA 4L4SA 1RM0A 2BR4A 2VFAA 4AO6A 5L4LA 4R0NA 3A6ZA 4KSBA 4IGKA 4IH1A 2R7LA 3VR5H 1M76A 1TCAA 3FWKA 3I28A 3LXXA 4KIGA 1XL1A 3LTEA 4RTQA 1NBOA 3FSGA 3KYCA 4RY9A 3QZUA 1L7NA 2AZTA 2HN9A 2VJLA 1O9BA 1JECA 2FE4A 4YONB 1XN4A 4AZ3A 5A4JA 1O97D 4OF4A 2WSBA 1QDUA 3MRXA 4IWYA 3U3XA 4C4ZA 5MF6A 2V97A 4OU4A 1EB9A 1Y4UA 2Z4RA 3M70A 4MW1A 5MHTA 5JJKA 3I9NA 3KR9A 1QFXA 3GCWA 2XHEA 4ZDIA 4QUJA 1OAAA 4J4TA 1LLDA 3LU1A 5KC9A 5JV5A 1DOHA 3G2PA 3PXBA 2CJXA 1P1FA 2UV8A 2RB5A 3PLRA 4Y9TA 2C0PA 3U7IA 1F2DA 4AM8A 4N7RA 4RQBA 2GPJA 3OTWA 1ZWKA 1B8NA 1ZVMA 2FF5A 4P98A 3BFVA 4WZ6A 2PUAA 2GVDC 3MMSA 4H9GA 4J75A 3L8HA 5AXCA 3PWSA 3GF4A 3NORA 1VCHA 1OX5A 3DOFA 3KIPA 2H3HA 3A7DA 3C8HA 5C8YF 3O8QB 2ZRKA 5ILGA 1TVKA 3G9XA 1WUTA 3OVMA 3BB1A 3IGFA 2Z58A 1YF3A 5BN3B 3VKHA 1W47A 4Z6KA 2D4HA 4Z7OB 3N2IA 4ZO8A 4OXRA 2NZYA 3DF9A 1RBYA 3NM6B 4RA9A 4YIKA 2BFBA 3X3HA 2WLSA 1OWOA 5IH7A 2OXRA 4RE5A 1ODTC 1LPPA 3T61A 3HJGA 3JWIA 5M2QA 3HR7A 3E8MA 3K1YA 4MMYB 4O0LA 4RIEA 3VFDA 3AV0B 1A04A 4AFNA 3NP9A 3GT0A 1JKJA 1G5QA 2QW8A 1LBHA 3W3AA 1NF8A 3GY0A 4N7JA 4UBMA 2QVXX 2J3EA 3LGAA 1FCJA 2A9JA 1K75A 2QYTA 2ZJ2A 1VE5A 3WWDA 5AM2A 3KQQA 2C3PA 3G2NA 3NJ8A 3WYGA 2AJLI 4BVJA 2N75A 3VPAA 4JJ4A 1C41A 1T2AA 2OR3A 3NTLA 3KQUA 2G76A 1WABA 3CVYA 4B6OA 1USVA 1NZFA 3MUFA 2PWPA 5AM0A 2J6IA 2L2QA 1TMYA 3UEOA 1EE2A 4AKHA 1D9ZA 4O63O 4CKEA 5KVAA 1KP9A 1NPYA 3DDZX 3ZWNA 2PGLA 3D8RA 1O6ZA 1U7ZA 4TMTA 4TKLA 1ESEA 5HNKA 3M6XA 4R2LA 2P35A 1V0JA 6REQA 3KOMA 4HAIA 5EI5A 1QU3A 1DDIA 4PYJA 4RJ2A 4B75A 1LEHA 1JIKA 1OAOA 2O1WA 2HQBA 4CCWA 3PEVA 2WPDD 3QX7A 1IAQA 4FN4A 2JGRA 2HGZA 1Y1TA 3LE8A 2X5XA 3LC1O 2D7JA 2QRVB 3ENWA 2I2FA 1XQ6A 2ZSKA 3AFIA 4L8YA 2J4CA 4M0FA 5AK6A 4DR3B 4TYYA 4I55A 1VHDA 1ZH6A 3CUYA 1HG0A 3ZLBA 1AQLA 1NUQA 2QQEA 5LJLA 5A0VA 3L84A 1N3LA 3QNUA 1OX6A 1IUPA 1P72A 3DQZA 1D5CA 4MZXA 4RORA 4Q7LA 1UBSB 4HNAB 3VZBA 1CUCA 1SFRA 2PX5A 4EI8A 3AQ4A 1V2GA 3L79A 1NYQA 3K20A 1Q0ZA 1XMOB 3VHLB 5LBIA 3I1FA 3W1EA 3O6VA 1DXQA 3MCWA 4HDNA 3OOWA 4WSOA 4E70A 4CGZA 2IZOA 2CV1A 1OJ7A 3FKSA 4AULA 3L0CA 1ZIXA 4MCHA 3UCXA 1TF2A 1IN1A 3DS8A 1ZY2A 3OKCA 3VZSA 1B8VA 3PWZA 3JVEA 2D3WA 2W2VA 1ICEA 1PFKA 1T8RA 3ONNA 3HKDA 1T25A 4U5QA 4BNJA 2LUOA 5IHPA 4PXYA 2A5YB 4H7EA 2D0PB 4LE2A 4NICA 2DVMA 4IIUA 1JU4A 2D0OB 3AZPA 3VU9B 2UYHA 2O3QA 4C9BA 3CY6A 3P9ZA 5E3HA 3PNOA 4KLAA 1J9EA 3G9UA 4BKQA 4KQFA 1PRYA 4OA8A 3PB3A 2LV8A 4YP5A 2PSHA 1JN0A 3ZDRA 1HDYA 1KFCB 1L8XA 2EZ4A 1KO7A 1DUSA 4ONEA 1PJAA 1DC4A 3CCCA 2QSYA 3JAKB 3D0OA 4MKRA 2VP0A 3ID6C 3QBTA 4Y0NA 5ERYA 4XUCA 5CVTA 5FEUA 2XZLA 4H7KA 2P3QA 1F0NA 3PUIA 3R40A 3B5JA 4DLTA 2GKSA 1C9DB 3R7WB 1NIPA 3NX4A 4QRIA 4CIWA 2X9GA 5KQMA 3EHDA 4I1VA 1RQPA 3UFBA 5IVHA 4NBVA 4XM0A 4P3OA 4JI6B 3T9BA 1LV7A 3KYDB 1FMCA 3CKMA 1H2ZA 4QTYA 2ZDGA 4ANFA 4B32A 1L7AA 4PZYA 1AUOA 4EB3A 1RHRA 1Y1SA 2C2YA 5D5HA 3T95A 2HWWA 4YMWA 3I6IA 2DFVA 1J5EB 3QI2A 3RYCB 3LVBA 3A3YA 4W7IA 5D6OA 3QKRA 1ZK1A 3LX6A 3C6ZA 4Y1RA 1M2HA 1OHHD 3FTPA 3RT9A 3MUNA 2ZJ8A 1P75A 1WD5A 2AI1A 3ZTWA 4CLRB 1CRQA 4HRXA 2GRUA 4Y9SA 5CM2Z 1V7CA 3E7XA 1Z12A 3PA8A 4QVKA 2YUTA 1JSRA 1NF9A 5FL7A 5I51A 1MDFA 3BB4A 3AV3A 3OEHD 3QKUA 3WGKA 3TDNA 2UAGA 4LTDA 3RU9A 3VDXA 3DHYA 5CBKA 1V26A 1Z16A 1GFZA 1L6RA 1HF3A 1XXHA 2A0FA 4E3ZA 1M8GA 1VI2A 1I2CA 2DRIA 3AEQB 1Z5UA 4OMUA 2YIVX 4E94A 5L3QA 3I6BA 2PQMA 1XPUA 1PZHA 1WL8A 2A3NA 1M0EA 4BN0A 4KJZA 1D2EA 1NDUA 3W2EA 5HS6A 1MOQA 1JJVA 1LI5A 5CBPA 1BMFD 5HX7A 1PL8A 1A9XA 3AVVA 3EGCA 4LWZA 1C7QA 4WOCA 2E5LB 2ZI4A 2B83A 3RYFA 3CEJA 3L93A 3Q41A 3ZD6A 4RTPA 5AVZA 5DULA 3PYXA 4UVIA 1BFUA 1RFGE 3AB3A 1XTJA 1FSPA 3V1TC 3H5AA 5SZHB 2NSHA 4MB6A 2FMIA 4HZUA 4O4LB 2CE2X 2IQ5A 4KB5A 4B3JA 1C9NA 4JUIA 4CUJA 4EMTA 1OWPA 1PN3A 2GUGA 3KQYA 1ZZEA 1B6TA 4IJUA 4QPZA 3P20A 1G8SA 3A2NA 2XTJA 2DKOA 1YZYA 1L3IA 1XF1A 1ZU4A 3F78A 3GRPA 4RVGA 1JNXX 4XYGA 1V8BA 1L5LA 1SU6A 3L5OA 1S2MA 3AUUA 4WKBA 4C6TB 1CP3A 1Z4PX 4IUYA 1QIJA 3IE0A 1MJGM 2BP7A 2HI0A 4QJIA 1JU3A 1WPRA 3O95A 4NV3A 5LKAA 4GH5A 3JASB 3CF2A 3I3SR 1WP4A 3NTXA 4X8OA 6REQB 1A98A 4JYCA 2VA8A 3W6NA 3STUA 3RKSA 3K3PA 2O8EB 4ZAWA 3R20A 1NT4A 1JJIA 1HNNA 1QZXA 4WHMA 5BXYA 4JVNA 2YV2A 4ZMBA 1Z5NA 3WA6A 1ZJYA 1OFGA 2B5WA 5EMKA 2FPRA 4KJXA 3HSSA 4GBED 4HDQB 1SOVA 3LCMA 2YTZA 3R24A 2G9NA 2BGGA 3O75A 1SBCA 3ZE7A 3A6HA 1ZHFA 1II0A 2GM3A 4L3WA 1QTRA 2GEDA 1Q74A 2VQDA 1E6KA 4LJLA 4NJEB 4P7FA 2QV7A 1EUZA 1UBGA 3AF1A 3DPSA 3R6TA 2AFIE 5DYTA 4QNRA 3MLBA 4MDHA 3ORRA 1IBKB 3UK7A 8OHMA 4U63A 4MHOA 1B43A 4WBNF 1GGHA 4M1KA 4B80A 1YZTA 1PD0A 1RYDA 2R8BA 1G3QA 1GYRA 5LZ2A 4QX6A 1IAVA 3M5DA 4BO5A 4CF7A 3AZQA 5L9AA 1JNYA 1ZI8A 2IU0A 2FSPA 1L4HA 1T5LA 2PJZA 5F64A 4AG6A 1VYVA 1VJCA 1KJWA 3GJ0A 3BBPA 4AKGA 3IYLW 1F5SA 3ZOZA 4A73A 5CURA 4WPGA 2FSHA 4B35A 3QV1A 1U8XX 1L2TA 1BDJA 1P7PA 4GOOD 2PQ0A 4FFBB 4BUZA 4EYQA 4JFRA 4LFBB 1S0UA 4HMOA 4NX2A 4QTUB 1Q1AA 3PICA 2PJDA 3ZTYA 3S8EA 3QUBA 1N2BA 4CETA 1U2GA 1YH3A 3NU1A 1XA0A 2ZVJA 3KOOA 4ZI7B 1L5VA 3WZ2A 4FFRA 1HL7A 4KHZA 2VP6A 4BBPA 1N33B 2JW5A 2WWIA 3L6RA 4K9DA 1SZPA 1R1DA 1KPIA 2OHOA 5ICMA 3WLRA 3KL4A 5I45A 1RAIA 1V3UA 4GQAA 2W11A 3DAOA 1ZOSA 3H11B 1KDOA 5CDUA 1T91A 2WM2A 1KVTA 4B6PA 5IC4A 4BN5A 2BZ1A 1XZHA 3D2LA 4NU0A 4PYKA 1SR8A 5BNIA 2VJAA 2Q9BA 4GSKA 3OIFA 5AXBA 2OXIA 1ZOOA 3GLUA 3ILSA 1A88A 2WJ6A 4K3VA 4Q1DA 1YBVA 3EPPA 3E70C 3ICEA 1ZI9A 1ZA1A 1XLTC 1MB2A 4P7JA 3RI3A 3RK4A 2IUUA 3CEPB 4XTRA 5DXJA 3U4AA 1AUVA 3KBOA 3TTUA 4DLLA 2XCOA 2R1TA 1GGKA 3U7FB 4DFDA 3GPLA 2BLNA 5KDDA 3GLGE 2N47A 4FDLA 5BWMA 3SZMA 4DGQA 2R96A 4FOSA 3NIDB 3TLYA 2FYTA 2B1IA 1Y4ZA 3JQ8B 1DAOA 4FWBA 4DLZA 3ZX4A 5EIXA 1GA1A 3RBVA 3AYZB 1DVRA 3TPCA 1DAMA 4LDZA 5G1PA 4TWRA 3NTUA 1U4NA 1MO2A 4CMEA 1FFXA 4F96A 3KWFA 1SQ5A 3LYLA 4LCBA 5BMVF 3PVSA 5K3AA 3REFA 2AMJA 2V4ZA 3RUFA 4PCVA 3K8QA 3CLKA 1E5QA 1ENPA 1QCYA 5KX5B 5ALPA 9LDTA 2BM8A 4PSUA 3RRJA 4EYEA 4NS1A 3B20A 4M36A 2BFMA 4PLVA 4DRXA 1XZDA 2W58A 1ZJ4A 4DEYA 1UMKA 5T4FA 3TM5A 5HKKA 3BVPA 3WTBA 3J80A 3IQXA 3CUVA 1N2SA 2O5RA 5EHIA 1YRWA 2EWMA 1A5BB 3I34X 2OSVA 5EKXA 2JZNA 3CBGA 4RPKA 2E0IA 4Q1EA 1KFBB 1JQ3A 2I65A 2YHBA 4AYTA 3QKIA 3M1IA 1JTVA 1EQ2A 3MQ4A 4HRVA 4A0SA 3UAZA 1HT1E 3VTAA 4D8YA 3IJRA 4R2IA 5EJ5A 3JPYA 2MINA 4N9WA 1R12A 2GK7A 2COUA 5DN6D 5REQA 4NH4A 5LPNA 1SXPA 3AI3A 1CBUA 3OX3A 4N5LA 2JLXA 2O20A 2ZXFA 1KI7A 2GN6A 3EPRA 1PS8A 1JWBB 3B13B 3ZDQA 2ZE8A 3IBTA 2AFHE 2P65A 3O4HA 3ZY6A 3E9YA 2XUHA 1MUUA 2NV6A 4G0XA 2VAPA 2VTVA 3I2FA 2AQKA 3P9KA 2JF0A 3BSYA 5DV9A 4YJ3F 3DE4X 4GLJA 2H2AA 3ZH9B 4A10A 1R5JA 1XCOA 3KVNA 1IOLA 4OQYA 2BAGA 2WABA 3RUDA 3PFWO 3CH4B 1ZOIA 3HA5A 1FXWF 3ZK9A 2ERYA 1SZDA 2OUIA 4KR3A 2W83A 1NDQA 1RYBA 1KNQA 1EEXB 2YDYA 1TW3A 2VXYA 3KQWA 3QQ5A 2IF0A 4HUJA 4JX9A 1U2ZA 4DLUA 4US0R 1S2GA 4EG3A 3N8GA 4K9OA 4AJNA 4LTMA 3NNDA 3SHTA 4CTOA 3AESA 1ZU5A 2F4NA 3H2ZA 1T10A 4KQ6A 2SBTA 1XU7A 2FSIA 2XUQA 4L28A 3U7RA 4BBAA 2QM0A 4KXXA 1TMKA 4UASA 5A1JA 3LCVB 5D87A 3SKVA 4BYMA 2RGCA 1C9KA 2Y93A 2TMKA 1ZBQA 3G8YA 3ND7A 5DEIA 5FTLA 5CLIA 4ZCTA 1K8ZB 4HFJA 4TQAA 2EYUA 3MA0A 2WYVA 3FY4A 3BWBA 1QG4A 2I3BA 1RLMA 1VXRA 3FDJA 3CZCA 3KVOA 3ME5A 2QXUA 1RIFA 3GXOA 3EXFA 1S9HA 3N58A 3NNSA 4HB3A 3NCHA 4HNUA 1RIIA 2DR0A 3ZZTA 5AVSA 1L1EA 4N48A 4EYKA 4V02A 2FG5A 3KUCA 4EY6A 5C5CA 1T8PA 1N6OA 4XIIA 2OO3A 8GPBA 2ZXEA 1B41A 4M0LA 3JAWA 2YN4A 1SUAA 4YHHB 3ZWOA 1NMQA 1SXIA 3ISTA 1R88A 3WLHA 1Z6QA 3LFUA 1H2YA 1IXRC 4OQ4A 4ARAA 5I48A 3DR3A 2WVAA 3KKKA 1TA4A 5DCUA 4TZTA 3T9AA 4Z4EA 3DCNA 2ZBEA 1HO3A 3D0RA 3KJQA 4HDKA 2P68A 3CO0S 2FU5C 2PWBA 2RHCA 2ZI9A 3H19A 4LDNA 4V3CA 1C1XB 2J45A 5K2MA 4OBXA 3S4YA 3RVKA 3D0KA 4MICA 4U7DA 4V2IA 4O1HA 4BQPA 1FTYA 4YGXB 3KUUA 2Z2KA 1XDZA 4I9HA 3RQSA 1W48A 1TCUA 1X7WA 2QLJA 3PK0A 2OLJA 2PRIA 3EIQA 4FMBB 4X7PA 5EWMB 5B1HA 4RE6A 5K0TA 1BYIA 6AT1A 3QW2A 2NNLD 4GS5A 4HS9A 5HKKD 5KWIA 2O14A 3U81A 3WBBA 5HP4A 5HOQA 2B4KA 2N9UA 3M6WA 3WISA 1HOTA 2ZAMA 2XYQA 2G9VA 3KTFA 4IQGA 3RIGA 3WL8A 3B8EA 2V8BA 1PTKA 1JLHA 1MZPA 1Y3IA 3DFIA 3GRZA 5EP3A 1AKQA 2EFEB 1G5HA 1U2DC 2XQVA 3IVXA 3GI1A 4GKBA 3K0EA 5L7TA 4NYMQ 3LDFA 3WIVA 2VYVA 4BNYA 4D44A 1XB2A 2G1UA 2DMRA 2UZ0A 3A2MA 4X66B 2NTVA 3FA2A 1CUIA 1DPFA 4ON9A 4E2YA 2YY7A 4DWWA 1X1SA 2HBRA 1KC3A 2J0UB 3RAJA 2DLCX 2JFGA 1J97A 4Q3AA 1N78A 4FNOA 3KFXA 4JUFA 2X13A 5EYPB 5LZ7A 5KYUB 1KMMA 4RF5A 3S8YA 3O38A 1AMNA 4RULA 2QQFA 3V2HA 4K6CA 1H3EA 2BMWA 2ZYTX 2XYVA 2NU8B 4OP1A 2YWJA 1VZ3A 1W46A 3WL6A 4JXXA 1EP2B 1ZC4A 1M7GA 4PXSA 4QQ8A 1LSJA 1K4YA 4HXGA 1LBIA 4F5ZA 3UOWA 1V1JA 1RLOA 3EUFA 3QOWA 4H6PA 1O3YA 2OB2A 5TQ2A 3STWA 4B3HA 2IYEA 2PGJA 2C54A 1W73A 5KHLB 1TTQB 2QKYA 4EFDA 2HRRA 5ALHA 3NRCA 2E55A 2LGJA 1NVVR 4MCAA 1AZLA 2P9ZA 4BNIA 3AVQA 1G8MA 1SUFA 1X94A 1ZK4A 2E18A 3E18A 3T1QA 3C6BA 4AI6A 1S2NA 4IDQA 1BQ4A 4ZOCA 4ZVVA 4BYGA 4DCVA 4Z0TA 5AI5A 3TL6A 4DV5B 4IGAA 4RMGA 4LSMA 1IUOA 1DAHA 4FYVA 1EFVA 4GFDA 1EHIA 4WLFA 5H4GA 2GWHA 1TMOA 8AT1A 2ZCJA 2R1ZA 3R2JA 2W2LD 3GC6A 1T4DA 1ZHHA 4J7UA 1SELA 1LSUA 4R01A 3WK7A 1PG5A 3K0AB 3NWPA 9GPBA 4Z3OA 2X5NA 2JLRA 3ESXA 3K0FA 4PFKA 1WDKA 5EWMA 3S2YA 2YMMA 4I2VA 1FTNA 2OB1A 3B3FA 1B0UA 2C31A 2K4MA 4GI3A 3RG2A 4X8LA 4HXFB 5C7IO 1UJ6A 1TYDE 3LBYA 2GZMA 3OG9A 2PUCA 2D0DA 4I3GA 5EVJA 5JNWA 5I4IA 1D4OA 1E2GA 4UBOA 3R8FA 1Z2EA 1IWOA 2G8LA 5ADUS 3SX4A 3UENA 3ZNNA 1F4VA 4ZPJA 3RW9A 5KOJA 3VOBA 5FUWA 3HCBA 1OUMA 2A4KA 1IHYA 2GXSA 3D6VA 4MYSA 4LBZA 3FOCA 4RDCA 1OBVA 1UCFA 3Q7IA 2MJLA 1QWSA 3Q3EA 5FFNA 1VGRA 2O8CB 3PGVA 3AVOA 5FLXA 4JI0B 1WU7A 1SCUB 1UBHS 4HFRA 3PX7A 4TKVA 2MDTA 2Q45A 3WNZA 1EKXA 1AT1A 1FSGA 1PWEA 2NSYA 1IQPA 1HQDA 3ROMA 4QIHA 3T7RA 3TVTA 1P19A 1AGXA 2FOIA 4B17A 2FP4A 2IEIA 3KTDA 4BBJA 2LIVA 1KY5A 3V55A 4K5QA 4EI2A 3HUFA 4NJOA 3OPXA 3EX7C 4DR5B 1Z0ZA 3GBSA 3TLCA 3VISA 1NHGA 2OLKA 2DBVO 3QMWA 2B2XA 2X6QA 3IPLA 2GBFA 2V3WA 4OQQA 2WB2A 2R97A 3C1AA 4MPTA 1RPZA 1Z7YA 3A9RA 4ZN6A 1QHIA 2R2AA 3A0RB 3CVJA 1K1EA 4M1EA 1XJQA 4W8GA 1C0EA 1IONA 1RU3A 2H11A 3NXSA 4QSHA 2ZYHA 3WMWA 2CNOA 1K5GA 1GCGA 3D81A 3M1YA 2Q3JA 2G80A 3IRVA 4BNTA 1B2LA 3B9BA 3T6KA 2QTBA 2LD4A 1YKSA 4CV1A 1O6GA 3M5WA 5AW1A 1E2HA 1XXHE 1G1AA 3T5PA 4C7VA 2H4HA 3NDIA 4DNFA 2HW8A 4WGFA 3IBCA 3R7LA 3SVZA 2O9JA 3G1UA 4JBXA 1CETA 1ECGA 3RWOA 3U3KA 2VXBA 4BZZA 1EX7A 4U7PB 1XCGB 3N70A 3KOYA 4FHFA 2FWMX 4UQLA 4B3SB 1YK1A 1BX3A 4C4TA 5FULA 4MB0A 5DM0A 5A3QA 3KKNA 4H7HA 4B6EA 2O3TA 4NG5A 1JAXA 4UEWA 1RRMA 1ZRMA 4OKNA 4A8HA 5JD6A 4KFCA 3DEJA 3THOA 2I4LA 5TJHA 1OHHA 2NXJA 3C5CA 4JCCA 4UBKA 1WDLA 2XDAA 4EA6A 5KX5A 2CDRA 4LJ5A 5ECYA 3TZBA 4P4GA 2QU8A 4IVPA 4BTLA 5DYWA 4BRWA 1FY2A 3WJ1A 1X86B 2Z6AA 1XDUA 4PVCA 2N3ZA 4YREA 3RGWS 4DVGA 1WSDA 1GV1A 2OHJA 4WLVA 3UMCA 2CDBA 4KXWA 2J09A 1MC4A 1XHFA 4ILEA 4LKOA 4OMFG 3VR2D 2TECE 2CXXA 4E46A 2GXAA 1AJEA 4ID3A 1UXKA 3H5IA 3DZIA 4QEDA 3HJUA 1X42A 3AY7A 5FKJA 1TU3A 3EIXA 3QF4A 3ZDBA 5JAQA 1CY8A 2PX2A 2D2IA 1RAFA 2ZWOA 3KAPA 2Q9UA 2OOKA 5C8ZA 4JFAA 4R98A 2I2BA 3IEMA 1TU4A 5E6SB 5JZMA 2LIPA 1PSDA 3DMHA 1GUBA 2POQX 1SIUA 1Z4NA 3HUDA 3OBBA 5GJVC 1H93A 2PIAA 3G02A 2AE1A 5JNLA 1CQIA 3HZHA 1QP4A 1XQWA 4MGZR 4HDSB 2FEWB 5DKFA 1UAGA 4DQKA 4XRGA 3BKWA 4U7HA 3TF5A 2Q3FA 3QVLA 3L4EA 2JLUA 1HNWB 3ESYA 4Q02A 5IEJA 3QX3A 1M10A 4LMPA 1GG8A 2O5EA 1KDRA 1UMBA 2XDWA 4WOPA 2PGAA 2VO1A 2HX1A 3H5WA 3KEQA 4GMXA 1Z6PA 5EJ2A 5K8TA 5IKOA 1Q83A 4LSGA 1EK2A 1CFJA 1GU7A 1SQSA 2D1SA 3O1JC 3OPYI 3OX4A 3QYAA 1U4SA 4OQZA 4UFNA 5DX0A 1NF3A 2WMOB 3LSYA 3MQ2A 2J8ZA 2WA2A 5ED4A 1EGMB 3SZLA 3U7EB 3E15A 3THXB 2ZWAA 4ZU6X 2ZUVA 3JD2A 2E5FA 2IVZA 3VHXB 5KREA 2WWVD 4HYQA 4W5TA 1GITA 1DBQA 2CZQA 4JGIA 2DHQA 3FPCA 2PZBA 1ARZA 2JVJA 2D2EA 2WM9B 4OUDA 4TV9B 1IHOA 1YDHA 5SYAA 5GADl 2UXBB 4IXMA 1JWLA 4H77A 4RETA 2I7DA 2PZ8A 2INGX 1JEQB 4F6RB 2OO5A 3P32A 1JDVA 1D1SA 1UT8A 3ITDA 3NYRA 2J3HA 2QL5A 4LN1A 1QZTA 4RTKA 4DLKA 4RHUA 1ONSA 2PPLA 4P5PA 3K32A 2HCTA 1UC4B 4LY3A 3ROPA 1RZUA 2Q1YA 2R11A 3I5UA 4MV8A 3IIIA 2IYWA 1U2SA 4AUKA 3ELWA 3RRYA 4I8DA 1F0PA 2EGUA 4ROTA 3ETHA 4MP3A 3ADKA 3H13A 1Z28A 5DGIA 3VAAA 3R5HA 2HGSA 3DMTA 5DNWA 1SCBA 4FHEA 1CUFA 1YUBA 2EV9A 2GMWA 1U3CA 2ZQZA 5CXUA 4KMMA 1QUFA 5J23A 4PLYA 3MB8A 5DBIA 2HU2A 1VYUA 3CF0A 1U1GA 2ZBUA 3UPTA 3LF1A 5JDIC 1YOBA 4LPKA 5LIRA 2JLSA 1X8LA 5JBIA 4JY7A 2Q0XA 5A2GA 1GZDA 4KQHA 3UA3A 1XIVA 1BVUA 4D9JA 2C5BA 1ZGBA 1VMAA 5I7SA 7REQB 2BJHA 3GB9A 5B3JC 2CLKB 2PKRA 2QW0X 2YNMA 2CNBA 5CLGA 1WAMA 3W9YA 4TMFA 2EERA 2PMKA 1U2PA 2VJDA 4AICA 5IS2A 3PUHA 2PAAA 3FNFA 2YZNA 4LXUA 4B6SA 3VHXA 4Z9FA 4DLVA 4YIHA 3SS7X 2YYSA 4HVTA 2Z04A 3E1KA 4ESHA 4OM8A 4IVNA 4R83A 3BZUA 3O4IA 3M4JA 3NBQA 1Z34A 4YS6A 1ADFA 3CNHA 3PC8C 4YDHB 1CY4A 2Q3EA 4EJ6A 3WNVA 5H80A 4MV3A 3CRVA 4UTZA 1NBAA 3CZQA 1ZUWA 3IXQA 1V4VA 3PNYA 4FI3F 2YQZA 4UMEA 1Q7RA 2XTZA 3IVRA 4Q82A 3TXAA 1N92A 4FMDB 2IHNA 2VKQA 1CVLA 3Q1LA 4Y2HA 1RPNA 3QTLA 4EKIA 3ZZNA 2WFZA 3WRWA 3LIIA 5L3VA 2RHJA 1UAAA 1WMEA 1NJ8A 1DKLA 2XYHA 4IS2A 2R5NA 1UKBA 3NLLA 4W6ZA 2FX5A 2PMBA 4KPGA 1M2OB 2X4GA 3HCNA 3O8OB 5EERA 3RUCA 4NOKA 4X0EA 1TMGE 1VPLA 2GD2A 1W2HA 2OUKA 3AF5A 4R41A 3CTMA 4UUMA 1JQBA 2QLMA 4E15A 2BTEA 2Q3MA 3ORSA 3M81A 3AETA 1PQ4A 2MU1A 4I6JA 3PCTA 2E3JA 3HXQA 2Z0MA 3MJVA 1SCIA 5CGQB 3IE1A 3N2KA 3ZIDA 5F1KA 1NFQA 1L8OA 3L82B 3A11A 2Q4DA 3ER6A 4TUYF 2FW1A 5U1PA 4R31A 4G2NA 4EW2A 1CNFA 3H8VA 4MTLA 3IVMA 3O73A 1UEXC 4I36A 4M7OA 3BHNA 3I6QA 4PFJA 4QOSA 4YA6A 2VJBA 4OI1A 5EOVA 4D9NA 1YRAA 3LBNA 1LDNA 2AKYA 3L1IA 1Y48E 3MWEB 3F5SA 4MHTA 2ZM5A 4PPYA 4N8SA 2QLLA 4B1FA 1HE5A 2PKQP 1FDOA 2Z5FA 2ZYIA 4TWAA 1E1CA 2BI8A 2X8AA 4M9SA 4PHFA 4OHUA 4RSRA 5JQGB 1M3SA 3CNEA 1J5XA 4UNSA 3IESA 1SHKA 3ZGLA 1R15A 5JADA 2C88A 3K96A 1CC1S 1W88B 1RZRD 4I46A 2WUFA 4ND4A 5KWSA 2XB6A 4LVCA 4URWR 4PCUA 4FXOA 4EEXA 5I9SA 3BXZA 4G37A 1A76A 1SAYA 1ST2A 4OTZA 1UBCA 3W5SA 4YMSA 2OAQ1 4FFWA 1D5WA 3F6YA 2VSQA 3AUTA 4ZYYA 1UR5A 3WWPA 4MIEA 5JAMA 3UJCA 1H2RS 1TNDA 2W2TA 1MW8X 3JARB 3FLAA 5DLDA 5TRTA 4Q47A 1NVGA 5G02A 2TMYA 1PR3A 3KEFA 1B42A 2WAYA 1P9WA 2JD1A 4WXEA 2H63A 4EQZA 3CKKA 1FW6A 1AA9A 1JDUA 4DMGA 2ZPAA 1A2QA 1K9VF 3K9LA 3LBAA 3LLMA 1EPUA 3M4YA 2F1JA 4UHCA 3QXGA 1XEFA 4IDFA 3GFTA 4QO7A 4W5HA 3TXYA 4HZGA 4MUXA 5K0FA 2HZBA 2MINB 1NR5A 1YO6A 4OH7A 3D2CA 3M9LA 3IMGA 3AR8A 2YINC 3ACDA 2IZ5A 5F35A 5CD9A 2C77A 4B3DA 2VNAA 1G64A 1QHNA 2VT7A 4OP2A 3K70D 1IQUA 4V0LA 4RK5A 1QIGA 4G4JA 3WADA 2J33A 3LO8A 2A86A 2DBQA 4ZANA 1Z08A 4CUZA 3QXSA 2JHPA 5CUQA 1ILEA 3G0HA 4HDRA 4QSMA 4ASUD 2PH7A 3ZCRA 3P2MA 4E51A 1FNBA 3GLIA 3O2NA 1Y5LA 2PLWA 3CVUA 1ZQ9A 1QQAA 1P33A 2MSEB 5SV2A 2QX7A 3P9IA 1XRJA 4RTOA 1TAQA 1DBSA 1H05A 3ZU5A 2OQVA 1OU4A 1MABA 1F1BA 2O06A 2BC9A 3HC7A 2YBDA 1TPYA 2H7CA 3RFFA 4UU0A 1V7PC 3MUEA 1DG3A 5LNK6 1O87A 3JD0A 3KR1A 5FUBA 4B71A 3ZDAA 1XRQA 4BFLA 4RTSA 1PZFA 1N77A 3AB7A 1GO2A 3HB9A 5HGJA 3ZLVA 4TTTS 3OU2A 4ZPXA 3I01A 4X6XA 3U9LA 1WMDA 3PEUA 4CMIB 1R10A 4C1NA 2EU8A 2Q8NA 2VPIA 4RIIA 1YFJA 2O3SA 3ZJTA 4YJGA 4FILA 5DGXA 4HEHA 5L7YA 4LF9B 3ORYA 5E7JA 1E7RA 1T13A 2YDXA 4H3VA 2OXCA 1HUQA 2OWEA 4F46A 3ZWPA 3BD7A 3NP7A 1OVGA 2NACA 3OJOA 1MJNA 3WNBA 4BLWA 3LECA 1QE5A 3KUKA 4QBFA 4HUTA 2EJVA 1BCRA 1CY6A 1NOKA 5HILA 5BSKA 2QENA 3C45A 4E7OA 2HCFA 3RIEA 3BIXA 2PD3A 1M8JA 1C7FA 2C9CA 3PQ5A 3IQDB 4G36A 3D5TA 2I55A 4YJDA 1YQTA 2XD9A 5DXFA 4V0RA 4BMXA 5HDQA 2X1MA 4K28A 1T1EA 3GJZA 2O59A 4DIDA 2H3EA 1RTTA 4IL5A 1U6JA 2EDCA 4OK3A 1P2UA 2JL1A 3AOEA 3HL4A 2JGAA 4GBJA 2WV7A 3G89A 3DC2A 4XEHA 3TZEA 4CT5A 2NU6A 5KZMB 2ICAA 3PEYA 1SEVA 3A9VA 2WHRA 3LHFA 4OSOA 4UTVA 4ZO4A 3QVKA 5D00A 3TPZA 4D0SA 1KQGA 2XCRB 3AVTA 4G0VA 3CJQA 1N25A 4UTPA 4MVWA 4UM5A 4E14A 3RH0A 2FMXA 4BJ5A 3DUFA 1R0YA 1UC8A 1VI6A 3ZHZA 4DM4A 1CQXA 2DECA 1IRIA 1EX9A 1QRRA 2V4MA 5C53B 3GGSA 3CNNA 3OLVA 3TUJC 4MDFA 2JJ1A 1THMA 4GYYA 4N39A 4WNAB 2A7QA 4P84A 1NX6A 1QK4A 2QTHA 2G0TA 3JZMA 4R8KA 1Y5MA 1CDOA 2ECQA 3D7MA 2QE7D 3QP9A 1WZEA 7REQA 5I01A 4KKXB 4DMUB 5BPHA 2J7KA 3CGGA 2VP3A 1PLKA 2O52A 2O8DA 4HX9A 3GAFA 1WE2A 4KRGA 3TZKA 3UFXB 4EL0A 4LDPA 1BGVA 1RKBA 4CCSA 4CI0B 5HYVA 5GJBA 3TIVA 4LMBA 5FQNA 3B7WA 3JR7A 4BGIA 4BEBA 4F06A 3GPBA 4MIOA 5C7LO 3NKFA 3DF7A 3FMGA 1TUEA 3QVTA 4XPZA 5AIAA 5G3ZA 3ANXA 4BO9A 4MQ6A 3BXGA 4HR7A 1YS1X 1KZ1A 2NT4A 2A88A 2R8XA 4MWGA 4EI9A 4KPUA 1HI9A 3EVDA 4YLGA 2XE4A 3WWZA 2PHZA 4Y3UA 1QH8A 2VJMA 3IOYA 4JD5A 4KW7A 3SQLA 2HFJA 1B0ZA 1Z4OA 5LC1A 5E0KB 3U7QB 3T06B 3E9ZA 3HABA 3PZBA 1GZUA 4GP7A 4WZBB 4ZAZA 4EFNA 4Q7QA 4ZTBA 3VVLA 3SOZA 1BDIA 4KHPB 4OU5A 1NWHA 4LRQA 3GXBA 1COZA 3OO1A 2Z1NA 3BA1A 5MFZA 4EITA 4J7AA 1P0PA 3CSUA 2R6ZA 3EISA 4YJHA 4MV4A 3ANMA 1C7RA 2FXIA 3BL6A 4J0JA 1QMPA 4PEVA 4K7JA 2DWOA 2EKBA 1VSBA 1QIDA 1GGJA 4RCVA 4RY2A 5JJBA 4UKDA 5I7WA 2J3QA 4J43A 1J9GA 1Q7CA 1QYWA 4OXNA 5BWBA 4NBUA 5JS7A 5K6RA 5KDLA 5BV8A 5P21A 4S04A 1ACMA 3RPEA 4JLAA 4DCNA 3HB5X 5GINE 2CJFA 4LI0A 2OG2A 4LJ7A 3U61B 3O1HB 1P9LA 2O8FA 3DP7A 3VU8A 4D8TA 1IVNA 5JDIA 3AEZA 4WV3A 3ERCA 4RM2A 1MRZA 1RXYA 2QSUA 3KSDO 4KDFA 3TL3A 4HG2A 1T26A 3HVJA 4RK0A 2IV3A 3ZHSA 3HVRA 3MLAA 4GVLA 3OUUA 1TO2E 1QX3A 4B7UA 3DSRA 3LGSA 3AX6A 1U8ZA 4C4SA 2X3FA 2O8FB 5HM8A 4FFVA 1XZNA 4G0QA 3QFRA 4Z4QA 3N6RA 1SHJA 1UJ2A 1O96A 3BTUA 4O2RA 3KVRA 2PZKA 1S3GA 3OPQA 4DYDA 1KY4A 1IPHA 1TUIA 3QWIA 2I76A 1QIIA 1KF0A 3LLVA 1GPLA 1KRHA 1VJGA 2B82A 3IDZA 2R25B 3BWVA 2OPHA 4DLNA 2P9CA 4QLAA 2BMEA 4H4EA 4DCPA 4ZAYA 4GI2A 2V3CC 1T4BA 2I3DA 2PUWA 4MV5A 1UDAA 2GZDA 2OPBA 4HB4A 1DBWA 16PKA 1I30A 3W2IA 4U2FA 2FQQA 2Q46A 2Q5FA 1E0KA 2VHEA 2WWHA 3R09A 4ZT5A 3W77A 3QJ5A 4ZI5A 4ALLA 4F3CA 9ATCA 3IPYA 3QGMA 2R6CA 3EXAA 3H3JA 4J6FA 4OJTA 1XK6A 2KE5A 1VP9A 4IUCS 5JLAA 3SD7A 3WMGA 1QH8B 4EG6A 4E5MA 2BCJQ 1ESZA 4M8LA 3I9LA 2H4WA 3FDIA 1XZEA 1RT9A 3R3ZA 4DR6B 1BVHA 2ACVA 3G0CA 1Y4SA 3BRWD 2HQ1A 3JQAA 3KJZA 4ITUA 4P1ZA 1XZPA 2PANA 1YQ9A 2QK4A 3UGJA 2JLYA 1HDCA 4HK4A 4GG1A 3SSOA 3FJYA 3KZXA 3SC6A 5KTRA 4RZQA 3AHHA 1LC0A 3B82A 4HYEA 1YBHA 4QDKA 4UD2A 3UC5A 3ZY5A 3ZV7A 4ETMA 4B3TB 1XPJA 4M76B 4BVLA 5BORA 3F67A 2XUKA 4G84A 3DEFA 1KJQA 4UE6A 3N53A 1A9ZA 5K4GA 2RK3A 2R2GA 1H2XA 1HNXB 4X3OA 1JQAA 1NBME 2LDXA 2Q6IA 3K9WA 5L4SA 2NSLA 3FYTA 4UE2A 2HMTA 3STHA 3UJBA 1WVIA 3ZU2A 1UBKS 2YZ2A 5ALQA 3GELA 5HKOA 1XJ5A 2OCBA 3R9KA 3BS4A 2A7XA 2X8WA 1IWBB 2YWBA 4NAVA 5JU6A 2AK2A 1FFAA 2X1VA 4LNUA 4TOIA 1D2HA 5LBTA 2HYDA 1J06A 1BMDA 4I9NA 4M53A 5K2OA 3ER9A 4LF6B 5A0TA 4A1FA 3JVUA 4LWOA 4WK6A 2FX2A 2ZYSA 3IELA 5HCUA 1T8YA 2A2ZA 4KVFA 5ALVA 5EE9A 2FEXA 1FNSA 2AE2A 2XMPA 4B48A 1RQNA 3FHLA 3PNVA 5BRAA 2XOKA 2PJUA 2I2DA 3OUTA 4RSHA 3U31A 4CG1A 2F3RA 4NV0A 2WAXA 4FJ2A 5BN3A 4HPJB 4RZUA 1C1YA 1IB0A 1NQUA 1SG9A 2H2HA 2XT6A 2DJ5A 2GSWA 5LKRA 4AN1A 4TN5A 1GUYA 1XNHA 4BFYA 2BELA 1YL5A 2IYNA 3B38A 1QFYA 1EUDB 5SZJA 3IT3A 4UNQA 1FXWA 3FFWA 3TSAA 4FCCA 2Z56A 3ZK7A 3V42A 1ULTA 4I1YA 4EY8A 3QVJA 1A2KC 1VXOA 4HF7A 1VCNA 4RL4A 2P4HX 5F5XA 1LWOA 2P9JA 3RARA 3EQ8A 3LWBA 4BMYA 4F3TA 3PWKA 5EJIA 4ZYXA 4GICA 3ND9A 4DR1B 3LPNA 3CRNA 2X14A 4ZOBA 1TU0A 2NO1A 3P45A 1GLVA 5A5GA 4NL4H 5FNVA 3GGOA 3BFPA 5IABA 2Z98A 1GCAA 1D3AA 1K63A 1V35A 2VK1A 3B3JA 3KXKA 3CLUC 2HRQA 4MV9A 5IEBA 1ZRHA 1HZZC 1K97A 2C0QA 5HQ3A 3OICA 4U39A 4UHFA 5A0FA 1OXXK 2WJWA 4C30A 2PY6A 2O0HA 1MOPA 1R7RA 3GCGA 1QCCA 4KDCA 3ASYA 4RIHA 4X60A 3NHBA 5TMDA 3CSDA 4UTXA 1N7GA 1INLA 1NRIA 1O94A 2Q49A 2JI6A 1P9RA 1Z17A 2GAFA 2NNWB 4JR1A 3UB4A 4BIMA 4OJMX 3MQFA 1WQ1R 1YFKA 4AMZA 4KPFC 4RPIA 4DRYA 2BF7A 2I8LA 2XE6A 3K16A 4CM4B 4CL0A 1NLMA 4C0QC 1A7AA 3MWFA 2CWWA 2XMZA 3UW3A 3B6IA 2R8EA 4PQGA 4YRFA 1YR9A 5ICEA 3LBFA 3Q8KA 4IQ0A 1E3WA 3EGOA 1DAPA 3WYCA 1AO3A 2A5DA 3BA6A 4EJMA 3QY0A 1OI3A 1XKQA 5ALMA 4AKIA 3IUQA 3RFTA 3FTFA 4BEVA 2GM5A 2QEQA 4KXVA 3VC2A 1XVLA 4M0KA 3LPDA 5DO9A 2HCBA 4AF8A 1IC6A 1FFXB 2PFGA 3EQ9A 2J3KA 4FS8A 3FKQA 4HBZA 2BBWA 3NIFB 1OZAA 4CIAA 5EYPA 1GXSA 1RPTA 1C9YA 4CWAA 1YCGA 4C87A 3ZHTA 3ST7A 3VR6H 2QTFA 3WKEA 1Y80A 1QZ3A 1SVNA 2FUEA 1N8NA 1XL0A 2FGKA 4EHNA 5CDFE 3C98A 3K5PA 4H2DA 2QZSA 3C16C 5F9FA 3ICVA 3DV0A 5C9ZA 1D2GA 1UPTA 3TI7A 2ODBA 3Q3JB 3PJFA 421PA 3L8FA 4W5WA 2WHQA 5G41A 3UJ8A 2PGOA 1LPOA 4H4CA 2W2KB 4F97A 3VRHA 1YDWA 5IN4A 1CEXA 3BERA 1GGEA 4NTZA 2MOKA 3EXHC 4M1QA 4ATNA 4Y6RA 2IA5A 4DA7A 4AKEA 5JSZB 3CKYA 4FS3A 1Z5PA 3W4JA 4Z3KA 4Y6LA 4TL6A 4RTRA 1BFKA 3CU5A 3H97A 2JI4A 4GI5A 4S2EA 3T7KA 5L3SA 3U1BA 1RNLA 1DO2A 3WRYC 2ZBGA 4US1R 2ZYGA 4DLWA 1YZVA 4F5EA 2XXAA 3E84A 4GGOA 1IM2A 4K9NA 4YUXA 5JAPA 3AU8A 5JLJA 1FTGA 2Z30A 4RVSA 2QAGA 2JVIA 5JBNA 2P78A 3ZE6A 2DX7A 4XXHA 2CVQA 3RGGA 1G5RA 4EGQA 5KCZA 5HUQA 4BLPA 4D56A 5JQWA 1ZH4A 1FMTA 3OSZA 4FJ1A 3JWGA 4AWXA 3Q8XB 1A72A 4WD3A 4GLOA 1VSQA 4P38A 4D9IA 2VPYA 1YOVB 1ZVQA 4URUR 2F8SA 4H15A 3GZNA 3F2VA 4RDHA 1Y0BA 4OBBA 2XCSB 1Q2UA 3LL7A 3I92A 2ZBQA 3WYDA 3ISVA 1B2RA 2ZTLA 4KVZA 2CWDA 5HSGA 4HB0A 3IP1A 4OI0A 1JFRA 4FEEA 3AG5A 3U3OA 4AZWA 1A8UA 2PN1A 3RANA 3O0DA 3JQQA 2MTBA 3WQRA 1W29A 3IPXA 3H87A 3V1NA 3SC4A 2HTFA 3GJ7A 2QROA 1J21A 5ECWA 5D3ZA 2FH5B 3DO8A 1P45A 1P31A 1N0HA 1NW5A 4K9KA 1I9GA 1GFSA 3FPSA 5G53C 4F8JA 4JBWA 1UK7A 2EFHB 3PNPA 5BV0A 2F1KA 2CT8A 3CONA 3PCXA 1P3Y1 3SJUA 2BRUC 3CS3A 5DU2A 2HF7A 2ORYA 4PCAA 3F7OA 5C46F 5DGTA 4POOA 2GA9A 2VNHA 2VQ3A 1NGSA 2FTKE 1S1MA 1FS5A 2X7XA 4S1TA 4O4IF 1ANKA 4A6XA 3H4MA 2D4AA 4N3BA 3W8FA 2FCRA 4F92B 1F6DA 4N5HX 1KIFA 4BGDA 3VUFA 4ZTZB 1CZKA 1ZD5A 4O4HB 4Y9DA 3A1TA 3OZGA 1P4GA 1PHRA 1G3RA 5FPPA 4OX9B 4WDQA 4ENQA 1J8DA 1E7YA 1SVOA 4JIGA 2IL1A 3C4QA 3G2QA 4DBZA 1QP7A 3BEDA 1H0KA 4OY3A 1MOSA 5BSTA 3T5CA 1J90A 1X9HA 2QR5A 4N5DA 3ZGZA 3C3JA 3VOAA 4ER6A 4IV5A 3SE0A 4ZGBA 3PKIA 4LXTA 4U5XA 3EZ6A 1VCOA 4WLUA 4F04A 2ZPTX 4DXDA 1O0CA 3OZRA 1MNAA 5HCIA 4CQMD 5B4VA 2GEFA 1CZRA 3HZOA 3I9KA 1Z15A 4GBMA 4PZDA 1PR5A 4XDZA 1O7JA 1M73E 3FKJA 1H23A 1LPMA 1I7PA 3F46A 4CEJA 1XCBA 3GUCA 3SZRA 3TEFA 1XD2A 4BO8A 4FKMA 5EPUA 4IX1A 1YMVA 3Q5GA 3QMMA 1FJXA 4Z8YA 1KXZA 1M1YB 2JAQA 4DA4A 5LIPA 4KYIB 2VK2A 4LBYA 5CVEA 1XX6A 1A2BA 2HFKA 3L7LA 2YRWA 1EGVB 3ULKA 3ZE1B 2IEYA 3SMQA 3LUKA 3T12A 3MRTA 4CM6A 5ESDA 2VP4A 4NONA 2K5UA 1YBMA 3H3FA 1YMQA 4MW6A 1VLMA 4NNPA 5ESXA 3RVRA 1ZNZA 5EIEA 4ZGGA 5JXWA 3P1JA 3A4TA 3COZA 4U7FA 4L27A 4YDSA 3I72A 4O3MA 3REQB 4DR4B 2BEWA 2Y99A 4I9FA 4HTFA 1NXSA 4GDFA 2C5AA 3ROZA 2WTUA 1YBFA 2H48A 1P80A 5AI0A 1OXSC 1KSGA 3ZQ6A 1E2LA 4XWGA 4P2GA 5JW6A 1KQFA 3TGLA 4TKMA 2ODNA 1JEQA 4HSGA 3ZV6A 4DYVA 4L16A 3U4CA 1BDMA 5DNDA 2GZHA 3MGGA 3ZWQA 4L74A 2CBZA 2WPDA 3KZKA 3DFMA 3WFJA 4PG4A 3IP9A 1EB8A 2D1YA 1LBQA 5F4BA 1M6YA 1KAHA 1V3VA 1TO6A 1RCTE 3S68A 2H2FA 5JROA 4PBRA 4FN5A 2B6NA 1IIBA 2J48A 3KZ1E 4C5CA 2PUTA 1CDEA 4G9BA 3FX2A 2XWQA 1QVZA 1M83A 2DCMA 3N0WA 1U9CA 1VM6A 3QU7A 2GERA 4H6WA 4HS4A 1E58A 4X85A 3R3WA 3LBIA 1YGYA 4TMZA 2WG1A 4XGQA 4BE7B 4FZRA 4ER3A 4QGGA 4QXMA 4NAHA 1GHTA 1OA0A 1F8UA 3QYPA 4RLHA 1EUDA 2OM2A 2IBSA 1C8KA 4AJEA 1D4FA 3WLOA 1JLSA 1X14A 5KNBD 3H1PA 5FOTA 5EZYB 1H6AA 5CB4F 3HKDB 1P5RA 1VSVA 5LL6P 1NVVQ 3FE2A 3PXAA 1B23P 4QRHA 1YJCA 1NVAA 1WHSA 3U6BA 1E1CB 2AW5A 2V6FA 3MWDB 5CT9A 3MMNA 1GUDA 3C24A 1YOVA 2AEEA 1A9YA 1LJLA 5KOIA 3FAZA 1XZAA 1GAQA 3R77A 4MO2A 4D80A 4EHBA 5A1TA 3WGIA 1K7XB 1LRKA 2NADA 3L43A 4NRDA 5ITSA 2A59A 2J6BA 3VKWA 4K05A 4R1NA 2XNJA 3IP3A 3QX8A 5ALFA 1BS9A 2F59A 4HQFA 3KKPA 3PXXA 1X1TA 2PQ6A 3GLSA 4QBHA 3CXUA 4IYJA 3LT4A 3ZR4B 2VTKA 4FJ0A 1X7DA 4DLPA 2FF7A 3FFBA 5JJIA 4WXRA 4JDUA 1RE1A 2UZ1A 4JLPA 3NC4A 3ODGA 1T9GR 4EYGA 5C3MA 3ONVA 4MQEA 3BMNA 4LQLA 1JJBA 1PGOA 4EW3A 4E2XA 2Y1XA 5C51B 5A9RA 4MLCA 4N41A 2VAMA 3X1DA 1OBCA 2F43A 3GD7A 3BWXA 5C7OO 3I4LA 4BECA 2BSQA 3EW7A 1KZYC 5AM4A 4L85A 4JVOA 5EZ6B 1F9EA 1WNFA 2RAFA 4UXJA 4YI5A 5CHEA 3USCS 3ZVMA 2J32A 2G17A 4DZTA 1DAEA 3IODA 1Q0LA 4O1MA 1NVFA 1HZZA 1QV7A 3CCFA 3RU7A 5A9TA 4A2WA 3X43A 4OLBA 2YYYA 2C7RA 3O2QB 4NNOA 2ES4A 1DNPA 1QOPB 3ZGOA 2Z1MA 2YFYA 3TRIA 3CUUA 4DWJA 1DOAA 3AKEA 3GUVA 2G7ZA 4FEAA 5DTEA 2UUCB 2YS7A 1NJFA 2B8TA 2LKDA 3MJTA 1M2VB 1GQ2A 1GTG1 5TV2A 4NCBA 2RDMA 1Q1GA 4BP1A 5EP4A 2CF5A 4HNQA 4DL9A 5ISMA 2GYWA 2Y1LA 1L3CA 3PR1A 3E8SA 1UAYA 1PR4A 4M8SA 4KE8A 3KG2A 5CFQA 1X3SA 1X2EA 2QBYA 1LZLA 1JKJB 2W2NA 1TOAA 4J90A 4E2ZA 4LZNA 3FWZA 1CE8B 2ADMA 5FIUA 2HJWA 3IOBA 3BPSA 4GRAA 4JLMA 1MR3F 2G88A 1O96B 1Z9BA 2OGZA 1P81A 4O3FA 2I8CA 1Q77A 2DU8A 2G77B 2HNAA 2Z09A 2OAGA 3DBLA 4MP6A 4ND3A 1GQQA 2QLFA 5KYXA 4JLKA 1J0EA 2QMQA 4WK0B 4X44A 1AKYA 5BSUA 4ZVUA 3UG6A 3OE5A 3VZRA 3PDIA 4BZXA 1Q16A 3FTNA 4D98A 2D2XA 1K8XB 3HUTA 4LQCA 1OKKD 3VNAA 1EAYA 1KEWA 3GMIA 1FZQA 4YCNA 1MA0A 2QTNA 2ATIA 2JLZA 5DBEX 4X6YA 4INAA 4X95A 4YY3B 3GRUA 3R9XA 3A3NA 4H4DA 1DWQA 1QR6A 4U3JA 3PEFA 5ER9A 1UP4A 2GAAA 3R5XA 5G40A 2Q7OE 2G25A 2Q6TA 1G3MA 3DHEA 3V46A 3X1ZA 4BNDB 2O8BB 3TQFA 1ZAYA 3DM5A 1ZCFA 4X00A 4WTOA 1CF9A 5CT6A 4FR0A 1SY7A 2QB5A 4MW2A 4D6XA 1EWTA 3G9ZA 3O2JA 1X1BA 2OSBA 1R0CA 4OL9A 2JFQA 3KJEA 2CE7A 1MH9A 2GAOA 3U7QA 3DLBA 3HV2A 1U8CB 1QF9A 4IUDS 4JNCA 4BMVA 2EBHX 4BJHB 5IULC 3Q7EA 4C4YA 3DA8A 3RC3A 5JZOA 4D2IA 2Y8EA 3JQRA 3G9QA 2ACWA 4NBWA 1QQ6A 3TRKA 2YYZA 4G0NA 2WIFA 1TCBA 4WEOA 4V0KA 3TE7A 2VF2A 2W2XA 2XVXA 1X8KA 2LZ0A 1KJNA 2AG0A 5B6PA 1FP1D 4DKXA 5CVVA 2BMVA 2BKLA 3GUYA 5I7UA 4TYNA 5CD1A 1C2YA 1H1DA 2C5EA 3JYOA 1A9PA 1V5FA 4QUHA 2JJYA 2W98A 3UWMA 3VC3A 2WQZA 3FHCB 1DP4A 1BIFA 3LI2A 1UUFA 3JQDA 4HFMA 4UM9D 1LC3A 3DV9A 1NU8A 2WA1A 4ZK6A 2GWRA 5C2JB 4XVRA 3NWJA 5A6VA 4X62B 4AY3A 1GCOA 1RWXA 5KTNA 2VOJA 4GAEA 3TL2A 3HWX1 3Q6MA 1N5IA 2BGIA 2WHYA 3A31A 2FRDC 3D4LA 2QTRA 2QZPA 1LLCA 2H2WA 3IDAA 2J0QA 2GJ9A 2QTMA 4P6VF 5HVNA 3NHYA 3RIMA 5HQJA 3QLVA 2IHBA 2WWRA 5J43A 1HY3A 1ZDMA 2H85A 2AN9A 2O2HA 1OX4A 1I8TA 4D3ZA 4WA8A 2QZJA 1LXCA 1BH6A 1W34A 4IILA 5BW8A 4RZ3A 4A6EA 3U80A 1ZMTA 1MAHA 1AKNA 1XVTA 1U9IC 2VRCD 3NQ41 1RJ9A 1WUYA 4FNMA 4JSRA 3VSBA 1R4ZA 3OOHA 3ZBTA 3GRYA 5M29A 1XXLA 3CH5A 2QLBA 5LUAA 5KQSA 2AI3A 5FI5A 4OB7A 3WP1B 3FNGA 3K2QA 5ALRA 1QZZA 3F3KA 5M7EA 1Q84A 1ABEA 1J00A 2J3JA 3BRCA 3QVGB 4O4JB 3LC2O 3T54A 1V16B 3A32A 4JEIA 3RS3A 5IU6A 2FRDA 4OM7A 5A62A 4YMIA 3IUJA 1UWCA 3LXUX 3RREA 1G7CA 4L2IA 3I9MA 1XKXA 3MHPA 1OFVA 2CNKA 5D1NA 3TBKA 1NM5C 1GN9A 1Z18A 1LI4A 1ZJ5A 2QP3A 3FLMA 3SEAA 2W2PA 4XWWA 2COEA 3N75A 1O2DA 3UKDA 4ZQGA 4CXMA 4ZODA 3EMDA 4IW3B 3RWBA 1CIVA 3ELBA 1JFSA 1IHPA 3LHDA 4AB1A 1F8YA 1TKRA 4HEA1 3ZIAD 3OMWA 3PPVA 1H4SA 2OGSA 3GEDA 1EINA 2YASA 5FJIA 2ZWMA 2P67A 4LMAA 4NHEA 4BLSA 4BMPB 1HBJA 4P0PB 3QXHA 1OMOA 4NZNA 3K9HA 2VK8A 1AHPA 1LW7A 4DQLA 4P34A 1U90A 3ZWMA 1KSHA 2ZSHA 2IHKA 1T9KA 3B6JA 2JAHA 4FSDA 3TIFA 1JMVA 4E1AA 4MEBA 3LQYA 4PQRA 3VHRA 3CF6R 5ERGB 3G5TA 3W5VA 4NENB 2R4TA 2BTOA 4ABTA 2ZI7A 1TQ4A 2XMRA 5KKCA 4BKPA 4AYWA 1MAUA 2FPIA 4I5GA 1EFPA 2DQYA 2XUZA 4KAAA 3B2QA 5LZ4A 1UOQA 3TEJA 3UT5A 3U6KA 4II2A 4C05A 4DCGA 1MRNA 1NJGA 4K9QA 4MKHA 4WESA 4DMLA 2YY5A 3JQ7B 4NLLA 5G1OA 2R1TB 4EP1A