1BVYF

Complex of the heme and fmn-binding domains of the cytochrome p450(bm-3)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
152
structure length
152
Chain Sequence
b'NTPLLVLYGSNMGTAEGTARDLADIAMSKGFAPQVATLDSHAGNLPREGAVLIVTASYNGHPPDNAKQFVDWLDQASADEVKGVRYSVFGCGDKNWATTYQKVPAFIDETLAAKGAENIADRGEADASDDFEGTYEEWREHMWSDVAAYFNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (CYTOCHROME P450 BM-3)
publication title Structure of a cytochrome P450-redox partner electron-transfer complex.
pubmed doi rcsb
source organism Bacillus megaterium
molecule tags Oxidoreductase
total genus 46
structure length 152
sequence length 152
ec nomenclature ec 1.14.14.1: Unspecific monooxygenase.
pdb deposition date 1998-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1bvyF00
3NHPA 1NNI1 2OHJA 1ZWLA 3K20A 4YAUA 2V9CA 2FZVA 3B6IA 2MOKA 2Q62A 2BZSA 1RCFA 2D5IA 4Y9UA 1RLJA 4BMPB 3TEMA 1OFVA 3OWXA 1ZWKA 2BF4A 5FX2A 3B6JA 2FZ5A 3GFSA 4GQIA 3QFCA 2M6RA 4NULA 4F8YA 1FUEA 3B6MA 5LMCA 3NHLA 3QE2A 3FJOA 5LVAA 4LAFA 5LJLA 1YCFA 3G5MA 2MWMA 4YAWA 2Z9BA 3N3AC 3OX3A 2ZKIA 1C7EA 4YAFA 2QX4A 3ZHOA 4PTYA 1TIKA 3W77A 3LT5A 4YALA 1QRDA 1DX9A 4ICIA 1WSWA 1YKGA 6NULA 1FVXA 1YOBA 4QODA 4ZVKA 2Z9DA 1FLNA 2WC1A 3SVLA 4ZVMA 1KBOA 3ESZA 1YCGA 3NHJA 3FVWA 1RTTA 3R6WA 1SQSA 5JROA 1VMEA 4LTNA 4H2DA 4FGLA 3TZBA 2V5VA 4HEQA 3KAPA 5LBTA 4DY4A 3HR4A 1J9EA 2HNAA 1V4BA 1XT6A 4HS4A 2XODA 5EAIA 2FLVA 2BN4A 4FX2A 3NHSA 3OVMA 3LCMA 2F1OA 3NHWA 4QOFA 1CZLA 3HA2A 4N65A 3NFRA 3OX2A 2QWXA 1D4AA 4YAOA 5B3LA 1CZHA 4N82A 3NHRA 3JSXA 1GG5A 1YCHA 1AG9A 5EMNA 1CZKA 1X77A 4YQEA 3KEGA 1J9GA 2QMYA 3QFRA 2B3DA 3W78A 1FX1A 3ES9A 1AKRA 1CZUA 5NULA 1D03A 3UXHA 3O73A 4DIKA 4LTMA 5TGZA 5F51A 2Z98A 3KAQA 2QX9A 1JA1A 3U7IA 2FAXA 1AMOA 1QHEA 1H69A 3UXEA 2R97A 2M6SA 1J9ZA 2R96A 2FX2A 3OJXA 3NHYA 3L9WA 4FGKA 3NLLA 1QBGA 1JA0A 2RG1A 2W5UA 4GI5A 1AKWA 2FVXA 2QR2A 2KQUA 4C76A 4J8PA 2A5LA 1FTGA 3TE7A 3K1YA 2BMVA 3P0RA 3FW1A 1AKUA 2BPOA 3RPEA 1KBQA 4Y7CA 1C7FA 4NLLA 1J8QA 4U7HA 4QOGA 1SG0A 1QR2A 4ESEA 1ZX1A 1TLLA 4C14A 5NLLA 4OXXA 4QOHA 1AKVA 4CETA 5LJIA 3OWHA 4U7GA 1AKQA 1T5BA 5F12A 1H66A 5B3KA 5LLDA 4XDHA 4XDGA 3ESYA 3FX2A 2FCRA 2QX8A 4ZVNA 4S24A 5BUCA 1FLDA 3F6SA 3HLYA 1RLIA 1FLAA 2X2OA 3N39C 1F4PA 4LA4A 2OHHA 1XYVA 3F90A 1AZLA 1OBVA 2X2PA 4Y9RA 4GR9A 2N1MA 1D04A 3B6KA 3KLBA 3NHUA 2OHIA 4LTDA 3OX1A 2HNBA 5A4KA 3GAMA 3W7AA 2Q9UA 1B1CA 4C0XA 1E5DA 4PU0A 1XI2A 1CZNA 4D02A 4QOEA 5LBUA 4CF6A 3NHKA 1AHNA 2GSWA 4QOIA 2AMJA 2ARKA 1AKTA 1T0IA 4DILA 3O2NA 1I1OA 1DXOA 3GFQA 3NHFA 2KLBA 1YRHA 5ULLA 4H6PA 1CZRA 3FNIA 4U7FA 3GFRA 1FLVA 1BU5A 3L9XA 4R81A 3EYWA 2QMZA 2HPVA 1OBOA 5F4BA 2MTBA 1YDGA 2OYSA 3EDOA 1BVYF 4M0CA 1XYYA 3F2VA 2Z9CA 2XOEA 5FUQA 5EA2A 4C0WA 3D7NA 3U7RA 4PTZA 4QOJA 2MT9A 3OJWA 1WSBA 2FOXA 5FA6A 3ESXA 1DXQA 4BMOB 2V5UA 4N9QA 4ZVLA 3W79A 4FGJA 3S2YA 3F6RA 3N3BC 2QX6A 2FDXA 1CZOA
chains in the Genus database with same CATH superfamily
1EFUA 1JAZA 1YE5A 2ZJZA 4X54A 1HI9A 1X8XA 4PIVA 2WHEA 2QVZX 1DQZA 4FI3F 4CL3A 3OPYI 1RAGA 1WRBA 4JP8A 4FLMA 3MAAC 3QOFA 4FOTA 2W2OA 2Z1MA 4H08A 4RK1A 2MOKA 5GGYA 3OCYA 5JISA 2R5NA 1E94E 1TM7E 2PGLA 1YC5A 4U9HS 5G1PA 1BS9A 2PEYA 4QQKA 3RUCA 2B1JA 4HYQA 4BKRA 4PG8A 4CM7A 4ALJA 2MSNA 3AFOA 2D54A 1SELA 1GUBA 3V34A 1Z7YA 3IR5A 4GPEA 4PAWA 4WN9B 5BN4A 3BEDA 3D02A 3HJAA 4ZO4A 4R51A 1IQ0A 3SFTA 3U40A 1SO8A 3USCS 4OB8A 2GZMA 3OJ0A 3HDTA 2QGNA 1LCIA 1KEEB 2DG2A 4HH1A 2VSQA 3WIOA 2CUZA 1KE1A 2QVBA 4EPTA 1E9FA 4LOJA 3DZCA 3EG9A 1QC5B 3E7DA 4QT0A 3ZWBA 1FJHA 4CM6A 2PJUA 4B3SB 3AILA 3KKQA 3OHSX 3V1NA 5JI2E 2ZXUA 2XOKD 4NTZA 5CB0A 2HW8A 4PWZA 3GIWA 4GWKA 3CN7A 3WYBA 1VPTA 4CYMA 1Z45A 1HT0A 2QLTA 1S9HA 4Q0MA 5FYDA 3TFOA 2C7QA 4LY3A 3D0KA 4HTAA 4M9XA 4CGYA 2WHPB 1AD2A 5JY6A 3KE8A 4TLCA 1WDMA 5BNZA 2RHBA 4Q4CA 2PZKA 4Z1MD 4F06A 3BREA 4KXVA 2R25B 1Z4OA 2FQQA 3PNMA 5HE8A 2BKLA 3OCZA 3Q6NA 4Y2SA 1ENPA 3HEBA 3OTOB 1DO0A 4UEWA 5DT2A 1E2EA 1J0EA 4KPUA 3B7WA 4I9GA 1F6DA 3SC4A 3UGKA 2OWEA 4HBZA 4AMYA 5BWOA 2KPOA 3X43A 4MGHA 4MV5A 4FHCA 1WZNA 2CLFB 4TN1A 3WB9A 3WQHA 5IHXA 1ISIA 3BULA 3NHLA 4GICA 3T5TA 1MA3A 4B3DA 2L82A 1J24A 1Z0KA 4HFJA 1BWQA 3DKKA 1A95A 4M2LA 3MRSA 3N3AC 4CTMA 3PSAA 8AT1A 3IQGX 5K6AC 3FFTA 3T0IA 1PG2A 2JD2A 3D7SA 3P9SA 2UXCB 4UATA 3BDAA 2D5BA 3B9BA 4IEEA 6AT1A 5LC1A 3IA7A 2PXHA 4YRZA 4JUAA 5EC8A 1GCOA 2Q29A 1C1XA 5DXJA 5BSWA 2Q9BA 3NBZC 4DZTA 4PONA 4ETWA 5BWLA 2WAOA 1ZK2A 5HM6A 1BXGB 3DDZX 4E2XA 4AJ4A 5FWYB 1H8EA 4YI3A 3KJGA 3OZCA 7MDHA 1LPMA 3A1CA 3QUBA 2XUZA 1LPAB 2WA1A 4AKTA 1KHHA 1AGNA 4GMDA 1YZNA 2WFZA 1C0PA 2PH1A 5JAZA 4CZ2A 3LUJA 1G2OA 3TQOA 5JCXA 5JAIA 3GJRA 4B35A 4EKNB 2V59A 1S2GA 4IEIA 4M89A 4TXMA 3TRIA 2FEXA 2RKBA 5L7WA 1UK7A 1U1DA 3O21A 4GHWA 2ZYRA 4I1PA 1YBHA 2OCKA 3DBHA 3V8VA 3VYVA 4YV1A 4ND5A 2BKVA 3ESZA 3QBTA 2B2XA 3PE4A 5IVDA 3PZRA 3VZSA 3ZZNA 4BNIA 5K0SA 5L45A 3N8DA 2WJVA 4Q5IA 7REQB 3FUTA 4HQKA 4FGZA 1RZRA 4B3GA 5FWXA 3HA5A 2ORIA 3FB1A 2CBGA 3F67A 3KXDA 4KXUA 5KVCA 3ONDA 1W581 2EKPA 3M5CA 1ISJA 4IFTA 5JTUA 2V6GA 2C3OA 4EGQA 1OC4A 1PD0A 3NP7A 4JJ4A 4WERA 3LJKA 4BDSA 1HMPA 1ES9A 5EVJA 3WRXC 3WDLA 1I4WA 3PDWA 4J3NA 3RVNA 3SF8A 3E2IA 3CX6A 1V3TA 3BA6A 1KSFX 2BFOA 3SSMA 1Z7EA 3DZ8A 4ALMA 4I14A 5HGJA 3ZTYA 4ENSA 2JGDB 4YHBA 5DNAA 1JIVA 4UUAA 1XE3A 1AT1A 2NGRA 4DDHA 5TJ9A 1CUWA 2GK4A 2AE1A 3BM5A 3PR2B 2J31A 2HLDD 3W3AA 4GPD1 1KRHA 4RO0A 2Q6IA 4AY5A 3L1KA 3UAVA 3V8RA 2ANCA 3EMBA 3KUUA 1IEQA 2FSPA 4K9PA 3DMRA 3KPYA 4IJKA 2HDNB 4R98A 2FE1A 5DTJA 1JAXA 3PPWA 1EK1A 2X9VA 4R9SA 5DBEX 2DHEA 5EKXA 1SCJA 3LUGA 4OBBA 1D2NA 4D6PA 3LPMA 2CB0A 3OZAA 4IQ8A 5AYVA 1HE1C 1P7WA 4ROTA 5J40A 4GKJB 1HYHA 2E37A 2G1AA 1N25A 1THGA 1A2KC 2ZBDA 4JCOA 2J8ZA 5AI6A 2DFTA 4ZYUA 5B7NA 1K3UB 1SVSA 2HD4A 1OI3A 2DQYA 2QTCA 4IL5A 4YWHA 4ETMA 3UAYA 1XR3A 3QP9A 3AG6A 4V0KA 1UIRA 1PR4A 1VSVA 2ZAMA 1XD8A 1XCGB 2C5GA 4F8JA 4FKZA 4DT1B 4EQZA 1UOOA 5CXXA 4KMRA 5LA6B 3ZLUA 1JQDA 2WNSA 1SU8A 5IAKA 3N2IA 4JENA 5B58C 2CL6X 3VR2A 2HMWA 2ETXA 3IB6A 3N07A 4U2KA 5JSKA 3WX0A 3U0BA 3KWFA 5D87A 1CRPA 1F3LA 2DR3A 2TSYB 3K1ZA 3LTEA 5A9TA 3EUWA 3JSXA 1GG5A 4I1IA 2GQ0A 5IBPA 1AG9A 1RXEA 2QGFA 4IIVA 2UU9B 4E15A 1X77A 4IZIA 4CT4B 1E6UA 3ZS8A 2HJGA 4MRNA 5KPJA 4EKYA 3NBYC 4TWIA 5K0NA 2I1LA 2B3DA 2REQB 3DVRX 3OF2A 4ZQHA 3ICOA 2YHBA 4IDBA 4RM2A 4LF4B 5CJJA 1E7YA 3ICQB 2J41A 4E12A 5JXJA 3O73A 3SHWA 1DKLA 1PL6A 1DADA 5E9WA 1NX6A 1BCRA 3SBEA 3SKYA 5ENDA 1EG2A 2QY9A 4OQXA 4BV9A 3W5CA 4LZAA 3JAMA 2XUDA 1KJYA 1IHXA 3F46A 3IBTA 1UKBA 3JALA 1NJ5A 1WQ3A 3UIEA 3EEFA 2C2HA 4ND1A 5KOHB 5MGBA 3GGOA 3QKSB 4NV1A 3I1JA 1OBHA 2X4DA 2PD4A 3AVXA 3HKEB 1JXMA 4QDKA 3JQ9C 2YZKA 4LXTA 4QTYA 2DLCX 1EK5A 3S2ZA 4AX4A 2FY8A 2CZQA 2RHTA 1JR3E 1YZQA 1ZICA 5HMMA 5E4FA 2BHSA 1AUQA 4TMKA 4B17A 1P6UA 5BQOA 3M6MD 5IUJC 1TYAE 4IDQA 1W47A 5KHAA 2VYCA 4GI5A 2EWVA 3A1UA 3IJEB 2QD3A 3GZTB 1IXYA 1PGJA 1AE1A 1QZ3A 4BCBA 4LJKA 2QM0A 3QRWA 4I3HA 2GWHA 1X2EA 2FPPA 3IO5A 4ZAWA 3DB1A 3UOAB 1X1QA 3RF7A 3EGVA 5D3QA 2R0QC 3A1TA 4Z9XA 3CO5A 4C4SA 2PKYX 1N2BA 1F51E 2DKOA 4F1JA 5BPHA 4KGZA 3VKFA 4LSMA 1Q19A 5EXPA 2QN6A 5EHIA 1RS0A 1AGYA 2DCUA 1DJLA 2XE7A 1DKPA 4I9NA 4NH4A 5AOVA 3RS8A 4D8XA 2ACKA 3Q1LA 3DKIA 3PX2A 3BF8A 3K8YA 3BFJA 4LE0A 3G17A 3HWWA 2BPOA 2QT1A 1XQ6A 3IUQA 3CEJA 3RPEA 1OH7A 1Z7WA 4GFDA 4P5PA 1HDCA 3WWZA 3BILA 4XUCA 5ALJA 1GLNA 4BVEA 2PSJA 5CFLA 1M34A 4BNZA 4BEJA 2XF2A 4G24A 3IVCA 4HGNA 4O8CA 2BBSA 4XYEA 4B3IA 3OTGA 2LWIA 3I09A 3KS9A 3P0FA 4QWMA 4HAZA 2RK4A 3VDQA 3FPJA 4TTQA 3I04M 4ND8B 4EHIA 1GIAA 3LX4A 4MVXA 4P08A 4DNFA 2FEAA 2XDQA 4P4NA 4MGYR 5ALOA 4RUKA 4HFNA 4F96A 2OCPA 1E2MA 3SXPA 4U7GA 5LU8A 2EG5A 2JFWA 9LDBA 5EJ4A 5JOQA 3ZXSA 1O6BA 4EFNA 1UMBA 3E70C 4WJLA 3IO3A 4DR4B 3BAFA 1MO5A 2WSLA 3BC1A 1Y7PA 1RABA 3PNSA 1L7NA 1RWXA 2HA4A 1Z07A 2C8LA 4NJMA 4P5DA 1Z62A 2GAFA 4I1RA 4D4MA 2F8TA 3DWEX 4LDRA 1UDWA 4D98A 2QRGA 3TZ6A 1IM8A 5AVZA 4AN4A 4MQ5A 4BKQA 4B7ZA 1FXWA 2XMDA 3BGIA 1CVLA 2C7VA 1BN7A 1GKYA 2EFDB 4N0DA 1FLAA 2ZCVA 4L4ZA 1ZGAA 2JFFA 3LTNC 3DH0A 3DOOA 3DNMA 3N39C 3WWYA 1GRCA 1XTSA 1F0PA 1KQPA 1EX6A 2JHCA 2OHHA 4IIJB 4JC0A 2IF2A 4G81A 5HM8A 4ACAA 3F6PA 4XGIA 4NWIA 1L9XA 3AEUB 3KLMX 5HBGA 1BEEA 1IVNA 3OLZA 4Y2TA 4D4JA 5KREA 3M3HA 1ID1A 3KLNA 1ZJZA 3O90A 4L95C 2VTVA 3HGTA 3ZHUA 2FUKA 3DLAA 3MW8A 1Y6RA 4AMGA 4B6RA 1EQAA 3FUVA 4PGHA 1CXZA 3WI7A 1PRYA 4EKGA 3MTDA 1WG8A 3KQHA 2O8DA 4O4HA 4AKEA 5HOQA 5KTYA 1SXGA 3ANYB 3AP3A 2AR0A 1U9CA 4ZCMA 3I92A 4KX5A 1U0JA 4KQ9A 4UNPA 4HN2A 2OORA 4O4JA 1ATZA 1C1HA 1OYWA 3DVQX 2E82A 2FQWA 3OKAA 3CIFA 3OPQA 4GVLA 4I50B 4OO3A 4R2HA 4KR2A 1C7ZA 3DBVO 2P4SA 3J7TA 5CGQB 5F7OA 4NU0A 3K2EA 3OCCA 1JQ5A 3QVKA 1JZSA 4NG4A 5E2IA 1KDYA 2AF4C 4PF1A 1NLYA 3AM5A 3PRYA 3O83A 3U4GA 1CHNA 1RWWA 1UKYA 4TV9F 4C7BA 2PG3A 2WIJA 4Y9TA 3ERCA 4DBZA 3B60A 3BH0A 5CLFA 4Q21A 2GN8A 2V7GA 2RI6A 4D6YA 1YU9A 3KWMA 1P75A 3HB1A 2QM7A 3INYA 4QOEA 2RH4A 4LSZA 4UUMA 2D5CA 2QE6A 4M0LA 4MP8A 2AT1A 2G71A 3DO6A 4OXNA 3A26A 5DPMA 2I62A 1XLTA 3SAJA 2J59A 3ZH9B 3ZD7A 3ZHYA 1JR3A 1BMFD 3JATA 5ALMA 3SVZA 1JUDA 5A5GA 2ZOSA 4UTPA 1H0HA 1KDRA 2DZDA 3EY9A 3IBCA 3IIJA 1W36C 2ZVDA 2Q4BA 5A3QA 4RV4A 2WAYA 2ZRNA 3H6KA 2AXPA 2DPHA 2CDRA 3AU9A 2G88A 5IKOA 2Y9PB 4UHJA 1QIFA 2XNHA 5EGNA 3HU1A 4AJLA 4AT1A 4ARSA 2OT3B 4JLVA 4Z1OA 5JDIA 3ZBPA 3R76A 2LDBA 1V5IA 2NO5A 1ZA1A 4TYNA 1F60A 4QNMA 4EYSA 2XMPA 1USVA 1ZJ5A 3VNSA 2OLJA 1HZZC 2H7XA 5G0UA 3RRNA 5LIRA 4BBPA 4H6WA 5A9SA 4ZYYA 5DCYA 1W5BA 2CLIB 1GEEA 1WO8A 4HLDA 1ZCJA 3V42A 2YWCA 5CLQA 5L3VA 4ERNA 4EHHA 3NQ41 2OCIA 2YHIB 3DL7A 4WNIA 4O3MA 1TADA 2EZUA 2V54A 2QM3A 4K9MA 4X92A 2TMDA 1DZIA 3RU3A 3N7UA 4NDZA 1M72A 3W3AD 4R5HA 2AJ8A 1E4EA 1NBMD 2I4RA 3COZA 4RZSA 2VAPA 2A4MA 2J08A 3NC1C 2HXGA 5GONF 9GPBA 1U4SA 4OLHA 3WGVA 4OJMX 3TJRA 1Y1TA 2XKBA 3VDMA 5J47A 4RPJA 5IF3A 3HLKA 3ZIUA 3Q7SA 4OIFA 1L7AA 3EGXB 1NF8A 1YVUA 4ZYLA 2ONJA 2Q28A 1M75A 3RS5A 4UMVA 2ZIGA 3SYNA 3V4VB 4RYLA 1XZGA 4PLWA 2BFEB 5T5QA 3STVA 3OTWA 4YMIA 5TQ0A 1QGED 5GZ1A 3FFWA 3GLUA 4W8HA 2M98A 3DWIA 4AF8A 3CIOA 1CLUA 3SZRA 1KI3A 1ARZA 1Q6YA 3P2MA 3PQCA 5AUQA 2PUFA 1EA7A 1VCIA 1HORA 2XHEA 2JIZA 3IEKA 4QEZA 4GH5A 3U3OA 3CVYA 2XB6A 2C54A 4GGPA 1YHYA 4KRYA 3A06A 3TBKA 4H4EA 3QHQA 2NZVG 5HF8A 4AIRA 3H2GA 2WVJA 1WJGA 2B2NA 3E7WA 2P3OA 3ROFA 1UFKA 5C53B 2C2WA 2XMZA 1Q2UA 2P5UA 1MENA 1NJ6A 2GILA 4JGIA 3CKKA 4BNKA 4DZRA 2GAAA 1V8FA 3IIKA 1DTWA 2QX6A 2EW1A 4YCLA 2OK8A 3VX4A 5LPNA 2CV1A 4RIGA 1HTWA 3LC0A 4MKZA 2H08A 3A1SA 4N4AA 3OIDA 3TTSA 1ZRMA 2HHJA 5H68A 3WGQA 4QASA 4C20A 4YMLA 1IBMB 2J3DA 1AO0A 2IC5A 2XV1A 1UBHS 2R68A 3EFOA 2P4QA 5HTKA 2CEKA 2FR8C 3OM0A 5K2MA 2HC9A 2OQVA 8GPBA 1L8OA 2JI9A 2DC1A 3HWSA 4MMXB 5JC1A 4G1EB 2BEWB 1SEVA 3AI1A 2D5IA 2GCEA 2WWHA 3H0EA 4GBMA 4MRRA 4RMJA 5KOJB 5A0FA 3OQMA 3KR0A 3MOGA 3NM5A 3T54A 3TEMA 4XUEA 4M1QA 1NF3A 1OFVA 2HDOA 3PNKA 4TQUS 1ZL2A 4AP9A 1NVXQ 3NEAA 2FDCA 3IE1A 2FHPA 3CSUA 5BOSA 2YFYA 1PJRA 1B14A 1OASA 1QKIA 4IJ6A 1BJRE 3BFKA 4RMGA 4I3GA 5EP2A 4K40A 4PAGA 1WETA 1BHJA 2X0NA 3G0HA 3EUAA 2B7CA 5A6SA 2J3EA 2RI1A 5EP1A 4S1TA 3IP7A 1SUIA 2GD2A 4M9RA 1OAKA 3G0IA 4OKSA 3QMMA 3QZUA 3KTAA 3WKEA 5FX2A 4X7RA 1YRLA 2A7XA 4R1TA 4PXYA 3VHLB 4X1YA 2XMBA 3CT4A 4Q01A 1ZD3A 4X00A 1CW2B 2YV1A 2DFDA 4WZZA 1XJWA 2D8MA 3QF4B 1NYTA 2AN5A 3F78A 4UTZA 2X76A 5FCDA 3ZQ6A 4DA6A 1FUEA 4W8OA 4GOND 1IM2A 3ICVA 4HOYA 4RSGA 1IATA 8LDHA 3JQBA 5YASA 3NATA 3SM9A 4BASA 2J7PA 2E89A 5FTNA 3PF8A 3DMYA 3U9LA 3M1LA 4GBED 1Y8CA 1HR0B 1X80B 1EJ6A 3I5XA 1XMVA 1P1FA 3OPYA 4J7AA 2BLLA 3MTGA 2WJ3A 5D5QA 2CKMA 1PSDA 1N6HA 4FPXA 4EGSA 4G86A 2Y3IA 3ZLTA 1ZG3A 5LDHA 4UOZA 3TUJC 1MAUA 3AG5A 1U2RA 4ZOLF 2LIPA 2QYHA 5TS2A 1XZMA 3QOYA 4EW2A 2HXYA 2YWXA 4DCNA 1JB9A 2WMNB 3LLMA 4X3OA 2DWCA 3E8SA 1LI5A 1Z13A 2JW5A 4GMHA 1M9NA 3CRNA 5AKKA 1QIDA 4D9CA 4AZWA 1PWXA 3NHMA 3N2KB 1E2DA 4CUJA 1GAXA 1I9CA 3CZRA 2V7UA 4LBVA 2Z3ZA 2R4TA 4D56A 2FP4A 2Y0DA 1TECE 1F5SA 1ZL0A 4TMTA 3MLEA 4B7UA 3PEYA 3FZQA 4H77A 4LW8A 1TD9A 5ECYA 3DEAA 4MWDA 4A27A 3AB3A 3Q3IA 5EJAA 1P2UA 3GZJA 4HGQA 1G3UA 1LFAA 2IYPA 4RADA 5KOIA 1ZHFA 4PNZA 2GWRA 1RYBA 3BAZA 2RIRA 1LSOA 1W35A 4LYDA 3IAHA 4YJ3B 3TM5A 2IUFA 2PKQP 1LU9A 4MPRA 5DHSA 4XCQA 3H9UA 4PYKA 4O63O 1G2IA 4Y2XA 1G64A 1H2BA 3QE4A 1V3QE 2WVHA 2AOUB 3QU5A 1M1YB 1I8TA 2XY4A 2Y1LA 3U4IA 1LWOA 2AD1A 2EOAA 2GXUA 5ADUS 3ANSA 1W5FA 1EJ2A 3OZBA 3I4CA 3V97A 3K9WA 3VKUA 1SZDA 2JAPA 2RK3A 5L4SA 1E0AA 3OZUA 4WT7A 3ROZA 4IKOA 4P4SA 4JVOA 1GV1A 5GADl 2Y1DA 3A4VA 3H8VA 5GWXA 4WUVA 1OU4A 2ZE7A 1ZIOA 3WGJA 1MQSA 2VHQA 3TDMA 5I8WA 2W4MA 3HV2A 4XD7A 2XCRB 4QM6A 3F7NA 5AW1A 5JYBA 1W94A 2W42A 4IDDA 3HBNA 3R0JA 5E95A 4BMYA 4OGKA 3CVUA 3ZDDA 1B8VA 1ZBDA 2IZ5A 3IV9A 4MV8A 4PQGA 4ZHSA 1GPKA 4NESA 5ER6A 5J1TB 1PWHA 1RBQA 1K86A 4JX8A 3R6LA 1N5MA 2PBZA 3B1JA 4HEQA 5A5VA 4TVSA 3WSVA 4URVR 4NMLA 1RPJA 4XDYA 1S2OA 1N75A 2Q2VA 2H48A 4WOJA 3R9KA 3EZGA 3IYLW 4GYKA 1ECLA 4JLMA 4HH0A 1HT1E 3AO0B 2FQ1A 2M32A 4GUAA 1AN0A 3FFXA 4HS4A 4NPAA 5J43A 1UBMS 5IJ0A 4BMCA 4HZUA 4UZSA 1R0CA 2ETVA 4P84A 3WTCA 2I22A 3ZU5A 3ZQJA 1EUZA 2NLOA 3BFPA 3WVNA 1IN7A 4OHCA 1Y82A 2FLVA 4EZBA 4CKCB 1T8TA 4DDMA 4JQSA 5TMDA 2GUGA 1M1UA 1FTQA 2J9FB 5MFPA 2IEZA 3ZJVA 2XXJA 3OIWA 3LQYA 1TMKA 2P9FA 1ZM3A 1BDMA 4INAA 2BR4A 1LRLA 3GEGA 4FBMA 1JHVA 2BEUA 2VF8A 1FRZA 1WQ1R 3D4LA 2PLAA 1GPUA 4QNNA 2WU3A 2X5NA 4E33A 5JZ9A 2VK8A 3R3YA 4EHNA 3CLUD 2WICA 1BEUB 3PD1A 1EUCB 3WWOA 4EZEA 4RVFA 1XOIA 4I19A 1T2EA 3DMNA 1RQGA 1QTIA 2JAWA 4LQLA 1FP4B 4BGUA 2ZS9A 4H7EA 4JEIA 3MUNA 5CB4A 5H4HA 1CZHA 1YT5A 2IP4A 2QVGA 3KJEA 5EY5B 4N82A 1DIBA 5KWVA 3B8HA 2PGJA 1RPTA 4AD8A 4YGYA 4OQ4A 3TJZA 5HK9A 5EKUA 3GCWA 4NZMA 5EMKA 1CZKA 2VNAA 3HJHA 4UXIA 3LO8A 4OHRA 1DTEA 4HDMA 1E92A 2LBPA 5HCNA 1FFXA 4BKPA 4CKWB 3B82A 1G20B 1LPBB 1MC5A 3HVHA 3I61A 1DDOA 1Z6PA 3I62A 4DUPA 2OGSA 1CF2O 3QFRA 3ORSA 4WV3A 4BFSA 5HF9A 1T34A 5EJ8A 2NPOA 2PANA 2V9PA 1Z22A 3AETB 4INPA 5D7NA 2EU8A 1E1RD 2OILA 5CYFA 3HP1A 3MRVA 3OUTA 3N5CA 1EE1A 1E5VA 3ISTA 1X9HA 1Y5NA 1G8JA 4KOAA 1EHIA 1D2GA 1SHKA 2B8EA 3CV3A 3GFPA 5CCXA 5A03A 1I10A 2PSEA 4K6KA 2CK3D 1Z82A 3JQ7A 3TLGA 5JJLA 3VQTA 4K6CA 3LBNA 1OPRA 5C8DA 3ZWAA 1X6VA 2BFWA 2Y4NA 2VTBA 1E3WB 1Z26A 1NDHA 4MI3A 3B3FA 2BR3A 3C8MA 1P4GA 3QWBA 1QHEA 1UKVY 5D5HA 3TZHA 3K7EA 1KI6B 3HZZA 2FXVA 1BXZA 4N3BA 4RK5A 4YJ2B 3UWMA 2NYVA 4Z1MA 1NMQA 4OMCA 3X1DA 3HXOA 1Z7GA 3P0JA 1HURA 2CN1A 2EKQA 4FGKA 5E9QA 4TKUB 3W8RA 5JRJA 1G19A 2PV0A 1MNQA 1U0RA 3E9CA 3OZDA 3R4VA 4P31A 5EIAA 3TL6A 3D4PA 1I30A 1II8A 2PT9A 2QM8A 3KLOA 1QE0A 3MAGA 3LWBA 3OUUA 3SZGA 3IEVA 2IGTA 2FVXA 1DV2A 1I7LA 1K6JA 2GEUA 1NJGA 1P18A 4CUZA 3KM0A 1ZU5A 3FSRA 3RUFA 1NBHA 4B3BA 4UUQA 1M8KA 1E3QA 2DHQA 4PYQA 3ILXA 4M1OA 3BXFA 1FTGA 4KZKA 2AK3A 1ESCA 2H1LA 3Q8WA 4KHZA 2G0TA 3L4BC 2ZR8A 3CFYA 1HDXA 1JYFA 1QGDA 2AXEA 4YQZA 1TAQA 2QN9A 3NGMA 4ITRC 3JVIA 5AI8A 2YS7A 3GZNA 4MWBA 5HFNA 3UMGA 3WLKX 4AJNA 1BGWA 4D57A 4KQ2A 5J4KA 1UPFA 2AJTA 1XN4A 3M70A 4LF7B 2CVPA 3B2NA 1N7HA 4FU0A 1ONNA 5LMZA 4NLLA 1VBNA 5FXMA 4CIVA 2QBYB 3KXKA 5CM8B 4DLTA 1BVHA 5I7HA 4MAMA 1X1AA 3ZDFA 5ES3A 2JIPA 4YO8A 3Q3EA 4HAWA 4E5UA 1DIGA 3ER9A 2ZRPA 4B87A 3PGA1 2ZYSA 2XXAB 2EGGA 2YFKA 4IP0A 5CVUA 5JQWA 1FU4A 3H9EO 1XHEA 5JJ5A 2DUJA 4GRIA 3BWCA 3PU6A 3UFXA 1AKQA 1XEXB 4G41A 3P94A 4JWKA 4ZOBA 4DMRA 4MS4A 4LS3A 3ZH2A 3K72B 1GYRA 4BP1A 3A3NA 4TMWA 1LQ2A 3LCVB 3LHFA 1HA3A 1P9NA 5JHGB 4WZAE 4OFWA 3AK4A 2R84A 3JQ8B 1OAOA 4UVEA 2B69A 3GAAA 2EZ8A 3T5CA 3OU2A 1VTKA 4BN4A 5HKAA 5LNK1 1NQOA 2BZ0A 3HLYA 4NBRA 2RGUA 1NW7A 5DYYA 3MNFA 4KE9A 3L92A 4HMPA 4UMEA 4YJKA 4L72A 3F7TA 1J5XA 5I3ZA 1SBTA 4JYZA 5C5CA 5DGIA 1Y9ZA 1E3JA 4CV0A 3HVIA 1AKNA 4OX9Y 4BTEA 2VJMA 1XKXA 2P65A 2GBCA 5KYVA 3EIWA 4BFTA 3PWTA 1CQPA 3JYHA 5LZ2A 2J3MA 4F9FA 3F90A 4R01A 4CR8A 2BJHA 1JP7A 1PJ8A 1F2UB 1WB6A 4L3WA 2YMLA 1L4EA 3TIVA 1JXQA 3ODGA 5LUAA 1XQ1A 4FYYA 4FOOA 1TYBE 1N2CE 4FLFA 4UBKA 3ETDA 1W8IA 1TZMA 3L07A 4C0BA 3BXZA 1M7HA 1HETA 1ZRHA 3ZNNA 3NHZA 2HA7A 3BN3A 1FYEA 1NGSA 3C3AA 3GIDA 3LY5A 4N54A 5F64A 1UBEA 2HU5A 4D0GA 4MLZA 1QPGA 4F4JA 1YS2X 2OAEA 4GLJA 4LXGA 3HJGA 1L5MA 1YE8A 4NJOA 3DCIA 2PGAA 5DU2A 1YQGA 1N1EA 3CJRA 4KAJA 4HP8A 4LGMA 3ZOZA 4KMMA 4G67A 1RWPA 4IY1A 2C07A 2O6HA 2JHGA 3NOOA 1GUDA 3K6KA 5EIBD 1GA4A 3ESAA 2VATA 1V5WA 2R00C 3UYLA 3HU3A 1X8JA 2MYUA 2FWRA 2JLBA 2C5BA 3EODA 4NMHA 4D9NA 3MXTA 1T6BY 2CXXA 4NS1A 1DQYA 1I36A 1GXSB 2P2LA 2IXGA 3AKYA 1XU9A 1I32A 2GPTA 2JHAA 2ZRAA 4RGQA 3RG2A 4DNXA 3PWSA 4F46A 5AM2A 4KRFA 4RD0A 1FFYA 3M33A 3EXHB 3UTDA 2KWIA 3CONA 3K4HA 3NDRA 1GPDG 1A4IA 1LSSA 1XTUA 5FBZA 3TLEA 4TLLB 4AJPA 4R8RA 4A92A 4HNGA 1WA5A 3TPZA 3ZCTA 5HJEA 1JHOA 5IJWA 2HDHA 3F4KA 4MW4A 5DISB 3FLAA 5BV2P 4EUKA 1B2RA 2LNDA 3KPJA 3D3EA 5KTOA 3H83A 2I78A 3IOCA 2C3MA 4QOIA 2X14A 2IXBA 2NZUG 3H9CA 2Q5OA 3LW7A 4IGFA 1R18A 4QYXA 5ELXA 3COJA 1SBZA 2YJGA 1U6KA 1GGEA 2DBQA 4OJTA 2J33A 3OLYA 4GC5A 2E85A 3IULA 1P3DA 2QW0X 3ROPA 2GJ8A 4DMMA 4JGGA 2B7LA 3LBAA 4GGOA 4A15A 1UBCA 4BUJA 2A0FA 3JVVA 3U9TA 2D3TA 2ATCA 1W4LA 2ZT6A 2IYAA 2OGTA 2WG1A 3DYIA 4BUZA 3HCEA 3A9VA 4ADSG 2V4UA 2KLBA 3D1JA 3T15A 1GT6A 3I9NA 4EG4A 2E4WA 4HEA1 1YZFA 2IOFK 3X0DA 4LRUA 4F5DA 2ERYA 4HX9A 4WN9A 4J4TA 3HU2A 4UW9A 4UAVA 2Z6UA 2QRPA 3ZQUA 4EOGA 1A8PA 4DPKA 1ZNZA 3SJ7A 3SKVA 1EM8B 2PSHA 1KEEA 1Y7TA 1MF7A 2VCEA 1SBYA 1H5QA 1R5NA 1AQYA 3CCCA 1UFQA 3L0SA 2V6IA 3LGXA 3ORRA 4G9GA 3UWPA 1QC5A 4GOOD 2JA1A 1DWPA 1JDBB 3LI2A 2HB6A 2FJUA 3GGPA 2DBZA 4N47A 2PPLA 1QG0A 3AUXA 4MO9A 4Y9SA 5C7OO 4IDHA 2P5SA 4AJ9A 3GD5A 5J5VA 1EVJA 3EDOA 1U5AA 4A4DA 1AXEA 2C9MA 5ENVA 3M9WA 2WJJA 4JI3B 2WQ6A 3EIXA 3HGMA 4MLPA 4JOCA 2WHPA 3X1XA 5CFOA 1C29B 2RKOA 3H2IA 2C2YA 5EG5A 1I3MA 4MARA 3C15C 3WHPA 2W6IA 4O4LB 2NU8B 1UXIA 3FAZA 1XPUA 3M9XA 5BP7A 3G0GA 4ILKA 1DXQA 1DIRA 1HPLA 1RM0A 3ZYZA 5E8RA 1JG3A 5BNFA 4K0KB 4K8OA 3WJ1A 1JKXA 2ST1A 2PYDA 3STHA 3C5EA 4EQ6B 3TMKA 4EKDA 1P4SA 5EZSA 3UA3A 4ISBA 2EFCB 2I6SA 1L7MA 4NMWA 2JD0A 3IDQA 1T5DX 5HZMA 3RADC 7MHTA 2EJWA 2CGEA 2EKZA 5COAA 1U9IC 3AY6A 1RW4A 3GUZA 4WZ6A 3FDJA 5DNDA 3UQYS 3V8MA 1VA4A 1AV6A 3WDSA 2BAGA 4ZI7F 3I9LA 2GNPA 3REGA 1L4BA 4QJ5A 2WYHA 4P32A 1IY2A 4NNPA 3CNLA 4EX7A 2VOJA 1SC6A 2VFAA 3ENZA 3QNMA 2XKAA 5BURA 2VLIA 3S6JA 5FHQA 2I4NA 3QU9A 4PLYA 3RASA 4D80A 5TQVA 4DNOA 4UDYX 3RVBA 2Y1XA 2VT2A 2HSJA 2RK6A 2QVLA 3ROKA 1UAYA 3HXMA 5CH3A 2X6QA 2C7BA 4MUXA 2Q4RA 4ENVA 5HR5A 3OE5A 5FNVF 3BSFA 3ROTA 3TGWA 1M6EX 2ZYVX 1PR2A 3ROEA 2PWAA 5TC4A 2R86A 3HHEA 4D9BA 1U7TA 3B9QA 3H18A 3OMLA 1BXGA 4ENTA 4C4TA 3ENWA 2G7MC 4H1HA 2H4JA 1CJKC 2ODQA 5FWYA 1WY7A 2JGIA 4FFWA 1OF1A 1X15A 2N46A 5EMHA 5KNBH 4O4IB 3T7SA 5CXUA 5KTPA 4TSFA 3K70C 3ZD9A 1V25A 4Y2HA 1CUZA 4Q7KA 3ZHBA 1RJDA 1Z0SA 2FZWA 3AX6A 3EQ9A 1AC5A 4CFZA 4Q00A 3D6VA 2CE7A 3R24A 3UG6A 4YYZA 4DA7A 1H85A 4BNDB 1ABBA 3Q1KA 2WJ4A 3ORYA 3B6JA 5TIIA 4RH0A 4JDUA 4IX9A 1PFGA 4MA4A 4UULA 4U9UA 5ED0A 2IOFA 4PSKA 2YJ4A 5EXDA 3T7TA 4C5BA 1SXJB 3PQ2A 4M76B 4LJYA 4CEHB 3BIJA 4MPJA 3CLHA 2IEAA 3DVSX 7REQA 1Z6XA 2R6DA 1NW6A 1WMBA 2YJ5A 3UAWA 4AN1A 1YQDA 4Y6LA 4BHTA 4UTRA 5LMCA 5AQEA 1MB4A 4HVTA 1H9CA 1VIVA 2R1ZA 2Z4RA 3DOJA 1MRSA 3DV0B 1KVQA 4PSVA 3KQSA 2RD2A 1I6LA 2GZRA 1Z4NA 2OOSA 3H5NA 1ODIA 1PGQA 4L8FA 4OY3A 4PZCA 5CNJA 5D1NA 3QEAZ 2OORC 2OHFA 4C0HA 4JI2B 3LDAA 1OWNA 1UDXA 1REQB 2VYVD 4R0NA 1ULZA 3GJ8A 4LX0A 5FI0B 4HBGA 3FM9A 5F1YA 2JGDA 3CPHA 1KQ3A 3QI7A 5DN6D 1JEOA 3L7IA 4MSUA 1NVAA 2VA9A 3WB2A 5C4IA 2A0YA 5J23A 4DW8A 4FIDA 4F4CA 1R0LA 1N1MA 1NJ1A 2DPXA 3PC7A 1TUBB 1ICEA 2EIHA 3PUXA 5BN3B 4KR3A 4UE3S 5LZ7A 1TZ2A 1W5EA 1BGVA 2HBRA 1EXDA 1QRRA 1RMQA 4PLZA 2CJPA 4FC6A 2JIBA 5B37A 4I3FA 2ZKIA 3FHOA 3HL4A 1K68A 4YAFA 2IKQA 1PT9A 2QEQA 2EX4A 3B1ZA 3JTMA 1WCYA 2CL0X 4L50A 1SKQA 4C4YA 2V6FA 3SHVA 4K88A 1NW5A 3FCEA 1G21B 1P9OA 1NE2A 1QORA 5L7YA 2MIIA 1XLTC 5JD3A 1X1RA 5IS2A 1RCTE 1T3ZA 1EDOA 5EERA 2ZJ4A 2QG9A 4AM8A 4MQ6A 2PFSA 4IUCS 4B43A 4MDYA 1U7ZA 2F2TA 2NXCA 4X8HA 1CRZA 2GX6A 2REXB 4EK9A 4QLBA 3MGGA 3TXAA 1OWLA 4DT1A 3IX7A 5LA6A 5AKHA 2JCXA 2XTMA 2HO5A 3P19A 1Q3HA 4B44A 5BXYA 1ADFA 1D2RA 5AUNB 5B6JA 4OREX 3FPBA 3GRRA 4Q4AB 3SVLA 2Q1UA 4Z3OA 3H17A 5DT9A 3L8GA 1BO6A 4CCYA 2F9MA 4BO6A 4OB6A 3LXRA 4RTMA 2GD0A 1TVEA 4HHEA 2VP0A 1Q7GA 4HQFA 1O96B 1PQWA 1ZNXA 2FZLA 1XRPA 3VR4A 2W2PA 3WIBA 4UU8A 4DDTA 5JSQA 1CEQA 3ZWWA 4LJ5A 5HGXA 4HUJA 1ST2A 4IQ0A 4KDEA 1JU9A 2V0NA 4E21A 1J4AA 3WGZA 5T4EA 2HWUA 5KPDA 1HT2E 3G82C 3DO5A 1V16A 1S96A 2OXIA 4R1NA 4UAJA 2AEMA 4HAXA 2REQA 2OCDA 1W96A 2P9TA 1KZYC 4EJSC 3FVTA 3CNEA 4O0LA 4AWXA 2XTAA 5CVTA 4O08A 3IGFA 3OCUA 4CMEA 1QIKA 1F2VA 1Y4SA 2PGNA 2X15A 2X8WA 2R1TB 3HC7A 5ARCA 3RFXA 3W1VA 4DUGA 4C3VA 3G9XA 1B6SA 1M54A 3DDOA 1IZZA 2FSVA 3GU3A 3BRQA 1ZH0A 3Q3GE 4DYDA 1CJTC 4MUNA 4E6EA 5KOHA 2QQ5A 4DMHA 3QKSA 3LU1A 3HUEA 1J07A 2C82A 1SUFA 2PAFA 3AEYA 1I3OA 3HKEA 3QYAA 2ID7A 1H0RA 1TU4A 4G4IA 2AVDA 1T2VA 4J3FA 3K71B 3KZVA 1XMOB 1WWKA 4HDOB 1XA3A 1ZO8A 1MOQA 2H17A 2YXNA 3ER6A 5AIAA 5KKAA 3R8XA 4CM1A 4UOQA 3FWPA 4F72A 2C2ZA 1JEYB 2CVFA 2C4MA 3FWZA 1MO3A 3L8CA 1WPXA 1ZZGA 4BVLA 4QATA 2XITA 4RGBA 1E9EA 5LKRA 1VE9A 2E55A 3TUZC 4M60A 3CLKA 4D3SA 4PPQA 1EUDB 3EVGA 3V4OA 5KWSA 4C5AA 4H4CA 3FYHA 4TLDA 2IPAB 4TLEA 2WIDA 2FJ0A 1QQ5A 3CLTD 4ABTA 4TWBA 4MUJA 3AOEA 3ENVA 3CN9A 4EHDA 1Q74A 1P74A 1Z56C 2QWXA 3C7AA 4ME6A 2JC3A 3SDZA 4K9KA 3H4TA 3F0TA 4YAIA 3BMNA 3LL7A 2CL5A 3PBKA 5LDDC 1QGUB 3Q6MA 4EKIA 3V1YA 5AVJA 3SBDA 4QSHA 3BQ9A 3OFVA 1M6VB 4BNJA 2PCLA 4OSPA 4YDQA 5KNDD 1WDWB 1DRJA 3QE9Y 2YL2A 3LQKA 4ANFA 4JNKA 3HZOA 2I3AA 2XCUA 4LFAB 3G7SA 4KQWA 2BP7B 4BZZA 3FRIA 3AHIA 5MFZA 2C96A 4GLBA 1E2BA 1SCIA 5AVXA 4GXQA 4C3UA 2AR9A 1PX0A 1NUTA 1PT6A 2G8NA 3EFBA 4ND8A 3IERA 3DE6X 4UVGA 3FLBA 1DAIA 3JQGB 4J4BA 1EG7A 1EX9A 3OA2A 4D74A 3THWB 4K03A 1OX4B 2V7BA 7ABPA 4HNTA 1GNQA 2VP4A 2RGEA 2FPMA 3D5EA 4GLFA 3UXHA 4MI9A 2ZWVA 2PXCA 2ID4A 1CBUA 2DHDA 2FJPA 3CW9A 2OTCA 4H1TA 4QYMA 3VU9B 3W05A 2XEXA 1GYQA 1OT3A 3SEFA 3EVAA 5JNLA 5DP2A 2PGXA 4LMAA 1Z33A 2AOVA 2ZYIA 3JQBC 1N5DA 3KEMA 4EL5A 2GPBA 4QBIA 5L3SB 3Q3JB 2BRUA 1R8QA 4IV5A 2XVMA 3BSYA 4K46A 3NTVA 1B3BA 1UWKA 1O87A 2A0WA 2JAOA 1DO8A 1B0AA 2UVQA 3NHYA 4JB2A 1MC1A 5AHWA 1L7QA 1M73E 1B41A 1X3SA 4IPTA 3WFZA 2YDYA 4IIJA 2LZ0A 5BQFA 1Z0ZA 1IFXA 2RG1A 3SKXA 1DIAA 2RAUA 3GGCA 1E2FA 1SXJD 3RSHA 3AEUA 5IMBA 1GNRA 2EIXA 2F90A 4PIPA 4LE2A 5AVTA 1DQSA 2RGXA 4LRSB 3PUJA 3WDKA 1CUBA 3PIIA 5ALVA 1MT0A 2Z3VA 3DMGA 5KTNA 2DBRA 3G7NA 2OP1A 2IY7A 5JJCA 3S68A 3DE7X 1XTQA 4DLWA 3DV2A 4TWZA 1WTAA 2DUUA 1RC8A 2DQKA 3PNYA 1TQ2A 3UCXA 4INOA 3MBIA 1VIMA 4IMJB 1VQ1A 3FMGA 1JU3A 1N8NA 1IZYA 1X0VA 2PFKA 3G6WA 3HV0A 3M6WA 4Z0NA 5BOVA 3ZLBA 3DD5A 3RBVA 1J8QA 2OLKA 2QMUA 3FMPB 4X3PA 4RCYA 1Z7BA 4I50A 5DP1A 2I5PO 3VPGA 1IIBA 5HSGA 1WP9A 2IYVA 4FQ5A 2JLZA 2Z08A 3VSBA 4MVJD 1JILA 2H1SA 2CHFA 1X1CA 2BFCB 1YZKA 2GS9A 4HWKA 4Q34A 2AL7A 2XUPA 5JNTA 1ZGGA 4XYGA 1SQGA 4N76A 2F3PA 3BHJA 5I4CA 5HZGA 4FT4A 2O2EA 4ACBA 2IBMA 1H4TA 4QU5A 5C32A 1WVGA 4OTZA 3E53A 1EUQA 1PD1A 5AUPB 3A3PA 2VBFA 3P4UA 4BL5A 4ZCRA 3RSLA 1OIXA 4KXQA 4AS3A 1WR8A 4Q1EA 4DIMA 4Z51A 3D81A 1Z74A 4IKEA 4L3OA 4FLEA 2FMHA 5IT0A 2ZRQA 3I8XA 6LDHA 5M2QA 2Y1OA 1RBZA 2PT7A 5CG2A 4AZTA 4BIMA 3BTUA 4YDRA 4ZK2A 4TZ6A 3SX4A 2ONCA 2IA5A 1BJKA 3BXXA 2X5OA 3I8SA 2AZXA 1CUUA 3F3YA 3BGWA 3BWMA 1JE0A 3QPBA 5CNMA 1P45A 5F5NA 3DBOB 3ITKA 1EYZA 4AXXA 4ZANA 5AKLA 2DM6A 1CR2A 2HMAA 3V2UA 5DBHX 4BVBA 5K3FB 1W76A 2WHQA 4GBGA 4WZBE 3QEKA 4QYSA 1QIEA 2G06A 2V96A 4I1UA 1II0A 4JIMA 4URWR 3C5WP 5FYQA 3VJMA 1DP4A 3ZX5A 4N7MA 2Z4SA 3D7MA 4G1VA 4URYR 3AUYA 3B48A 4K81B 4XVUA 2NV6A 2O8EB 2WWYA 3D2LA 2PJDA 4F3KA 1Y80A 2ZDHA 2YHIA 4C0KA 1C2TA 1VG0B 2OCXA 4KQGA 1A9TA 2MSWA 4EMUA 1D04A 2IU0A 3BTOA 5BNTA 2J0QA 1QVWA 4MB2A 1U0SY 1XUOA 7ADHA 3ELDA 1LF5A 3OLXA 3FCYA 1UP7A 2QRLA 3G8CA 3GPDG 5IBRA 3UC5A 3JYPA 2OHIA 3SQXA 4YNBA 2VDKB 2WE8A 2YXPX 1OILA 2ICAA 3AIMA 2VVTA 1BWSA 4NRDA 4E03A 2Q3JA 3EGXA 3QG5A 4JYBA 4C6RA 1A9PA 5AKYA 2D5AA 2VQ3A 4A16A 4UMFA 2DY1A 2QYSA 2VRWA 4UASA 2I2CA 3MELA 3P2EA 4ZQFA 5FULA 2XRFA 1F14A 2BDEA 2BFEA 1WB9A 1XI2A 2DFLA 3CG0A 3K30A 2G5TA 3JQDA 4DG5A 1RYEA 3PRJA 1FTWA 3V33A 2B4TO 2IXDA 1ZIXA 3KUCA 3RABA 1LNZA 4UD6A 2NVUB 1YS4A 1VMIA 2YHAA 3FFBA 5HKKD 3NAQA 3C74A 3IUJA 1Y3IA 3LCRA 2I6UA 2JGJA 1QLJA 3NHKA 4G8JA 4HWOA 4M86A 3ZEIA 1QZZA 2FYTA 4IWNA 5EHXA 2NMVA 3TOCA 1QP0A 3R7WB 3IXLA 5CA1B 4WLFA 3C97A 3DLIA 4PRKA 3IKMB 2CEAA 3TQFA 5AW0A 1GU0A 2AYYA 3DDUA 3QEBZ 3HI4A 3NV9A 1Q3KA 4W5JA 2HYIC 3K0AB 4EH1A 3W8FA 1YI8A 1HEYA 2CNKA 1R6UA 1F8GA 2SICE 4BBAA 2HCRA 1JPNA 1OFHA 4FBLA 1ABEA 3BD9A 4CHTA 2V4MA 4YROA 3UT6A 5DHRA 3ZWMA 3A6PC 2ZQZA 4D4LA 4JLSA 4R0MA 4HF7A 3WRYC 2OZKA 5DLQC 5K9ZA 3NHFA 2WTBA 4G0ZA 4JP2A 1CQZA 4M88A 1Z5NA 2PS3A 5CD1A 2OCBA 3PUHA 3ITNA 3TGLA 5ALPA 2A59A 3UJPA 2BEWA 4GNRA 4IF6A 2PZBA 2XQGA 3GGSA 2YZ7A 4D9MA 3EZYA 4B45A 4DF3A 2CHUA 5KOJA 3C39A 1CNEA 1XVAA 2ECKA 3C16C 3MJCA 4OXIA 3KEOA 3D1VA 3W1WA 3Q7EA 3WQRA 2BGIA 3EMVA 1YUBA 3UK0A 3K6JA 4RFSB 3WMFA 3NYRA 4TYQA 3WYFA 4EVIA 2Z8YA 2XW6A 1FB5A 4A8TA 2IZOA 3EYWA 1XVTA 2H59A 1YZLA 3QMVA 3JU3A 3L6DA 4K9SA 4MEJA 4QSMA 3SD7A 2HK9A 1CUCA 2VPWA 4JHLA 4YT5A 3VPCA 1TMOA 1XFDA 3C5VA 3JZIA 3N2YA 2JVIA 4KXYA 1UZUA 5ENZA 2ZJ7A 3PGXA 1A77A 1UOPA 2QXUA 3QWAA 4YAGA 3WFIA 3ND9A 4K6HA 1EAMA 3FRHA 5AKEA 4ECAA 1E2IA 4YFVA 3PC3A 3R6GA 5BSFA 3NU1A 5JY1A 2ZAOA 2J9GA 3QF4A 3UYKA 2UXDB 3JR7A 4Q24A 3OD1A 1JQLB 1HGXA 1EK0A 5IK2D 1X86B 5AM3A 4J16A 5HMLA 2HYDA 1NM5A 1VJGA 3ZU4A 3THSA 1WMDA 3NJ8A 1D09A 1GFSA 4CUKA 3SS7X 4H7HA 3V8BA 1YR2A 4CLDA 1ZU4A 5KUTA 3QWIA 2A78A 4NBWA 3IPCA 2V5UA 3KVRA 3W5SA 4JROA 1X80A 2CFCA 4KIUA 3M6AA 5B55A 4NNJA 2R62A 4RA9B 4DQVA 1U2GA 1YOVB 1NN1A 5AKGA 1QFMA 3BCHA 3KQYA 3ZWCA 4ZAFA 1KJQA 4EB0A 1QQ7A 1VBKA 2P30A 1QFJA 3OMXA 3EA5A 4YP0A 3CINA 4EITA 3S2YA 2PTGA 1SHZA 1XNGA 3AUUA 1H6AA 1HYEA 3HTXA 3RROA 2Y1EA 2YRFA 3UK1A 4DDWA 1XN1A 1Y1QA 4XWAA 2DU8A 1WLYA 1NE7A 4TMYA 2BONA 4BJ3A 3N0RA 4LC9A 1OHHD 2OFXA 5EJIA 1G41A 2H6EA 4MWCA 4Q39A 2OFWA 3B6IA 4MWEA 4RZXA 1SVLA 2QU8A 2G63A 1V35A 1BOFA 2F1RA 3JCZA 3N2KA 3PFKA 2D1RA 3AFGA 1CQJB 3LDFA 4N5MA 2VP9A 3AR5A 4TTIA 3WK5A 4CMAA 1TLFA 1MLDA 1BRTA 2HJHA 1NMZA 3VVLA 2HWXA 3HO6A 4HJXA 1OAOC 3QKUA 3FKSD 4JI8B 4QQFA 1A9XB 3C6ZA 3SPXA 2IXFA 3DF7A 4UCWA 5CD9A 3GLTA 2H3EA 1P73A 3T7DA 2PA3A 5KB3A 3H4IA 3KDPA 1OGYA 4Q15A 3A4LA 4X85A 5DHUA 3WL3A 2JIMA 4G5SA 3FWHA 4CQJA 4YJ3A 1RAFA 3MJFA 1CUIA 3GP5A 3KQPA 2QTVB 1JWBB 2PX0A 4ILEA 5LLTA 4D96A 3E8MA 4RL6A 4URFA 1WIWA 4TROA 5CJ2A 1HNNA 2AI1A 3G2OA 2BVNA 3K5WA 2AOUA 3QK7A 1DO2A 1QP7A 2W8ZA 3EEYA 1ZXBA 1RHUA 1M1YA 2QENA 1QONA 2VXBA 2FZ5A 2Y1GA 1FXWF 1QVVA 1SHTX 3BE6A 1O89A 3E7FA 3M4ZA 3QFTA 1I5EA 4LXQA 4MIKA 5EPEA 2P67A 4KW7A 1R37A 5FFFA 1LTQA 1LBHA 5DI9A 4NY1A 2OYRA 1XTVA 3PFFA 1VI6A 5IEJA 1AA6A 2BW0A 2CVZA 4A5SA 4J0CA 3WKDA 2BBTA 1KK0A 1OUMA 1R8YA 2CFTA 1I3NA 2C3YA 2QLMA 3K0EA 1SIUA 3QVMA 1YZHA 5IAEA 3VYUB 1SXQA 5CJPA 3V8QA 1C0IA 4DIFA 2RG7A 2OXFA 3EPRA 4CM5A 5F98A 1OZAA 2P41A 3HB9A 4MGKR 5F4ZA 3HCNA 3NCHA 3CEPB 4HK4A 4KFSA 3IDOA 4AXBA 3PTAA 1JG7A 5ALDA 3ICWA 1IDOA 1UBNA 1NP7A 2A88A 3HXPA 3L0ZA 1NC1A 4IMPA 3LUAA 3G5MA 3Q6IA 1KZ1A 2X3UA 4PQEA 3V9AA 4Q18A 1YK1A 3LPCA 2B94A 1P7PA 2ZSEA 3G0CA 3LUKA 2XTJA 3I28A 4I8XA 4O4HF 5BYAA 1IN6A 2A7QA 2HUNA 1Y4AE 3UB4A 4XFKA 2P9EA 1NUHA 2F1HA 2HK7A 1AK2A 1PL0A 2Z2JA 3DV9A 1O57A 2HEGA 3O4VA 3A6FA 4HPWA 3T7IA 4XYLA 3MVEA 3KEFA 4II7A 3VFDA 1S4MA 1HZJA 5CPFA 5TX7A 2X8JB 3TCXB 1JDPA 3FDXA 4LXYA 3ETJA 1WCIB 1DWUA 4NBNA 4RY9A 4W7SA 2NU7B 3H7AA 1JXOA 3BQNB 3WMWA 3YASA 4CKCA 4RTNA 3EVBA 2YBDA 4BC1A 1DEAA 1SM4A 2I6GA 2J9FA 3LOUA 3U3ZA 5CLLA 4NI5A 3IUYA 3V4RA 3VYRB 4QQ8A 4WOKA 3GLRA 4YRJA 1KXZA 2HZ7A 4M49A 4QPJC 1H8HA 1CDEA 4FS8A 3ZD8A 1Y81A 3E58A 3RYHB 2QUJA 3RC1A 1OIVA 3B2EA 2ILTA 1EUCA 5ALZA 3QIVA 4BECA 4TKLA 1MPTA 1NT4A 2JANA 2HMYB 2YW9A 3BWDD 4QRIA 2LKDA 2AG6A 3ZU6A 3D3WB 4M7OA 1WV0A 1IHUA 1P77A 1FP4A 1MPXA 2C2OA 2FPLA 5CYOA 4FHEA 5JS1A 1KOLA 3NRCA 1MH1A 4TYWA 4YRQA 1K5PA 1TMYA 1C1YA 5HDQA 4NU6A 5I7RA 1FFWA 1ZH2A 3E5NA 3H8SA 4U2GA 4KIGA 4DMKA 1YQQA 2HH9A 3B3AA 2PUTA 3LWZA 4CKWA 1YC2A 2DB3A 2H0QA 1G20A 4BFYA 4DGQA 1MX9A 1T9BA 1UM8A 2XIQA 3MGBA 1P91A 1SQSA 4IJMA 5JG7A 3TX2A 3AETA 3ABOB 3PA6A 3BD8A 3K3PA 2WLTA 1B8PA 3TLMA 2ZULA 1XA4A 1NY6A 2IOYA 5CFMA 2CXTA 3OFKA 1F8FA 4IH4A 2OFOA 3C5CA 4RLFA 2FWNA 1M5RA 2CXOA 3PD7A 1XHLA 4KI7A 4XRRA 5HF6A 5HKBA 3JD2A 5BSVA 4V0RA 1PWEA 3OT1B 3QJGA 2AR7A 4FE7A 3NWEA 4NZOA 4ATNA 4R6WA 1E3WA 3KB1A 4BQFA 4F5EA 5IYZB 1XLUA 4C6SA 4UFNA 1K8RA 1JAIA 3K9QO 1QCYA 4UZEA 1YS1X 3ZK7A 1QCDA 2PMBA 3LECA 1YRQA 1CS0B 1KI6A 1O9HA 4NCJA 5AM1A 2V55B 5AHXA 4PZYA 1GU7A 4ZGWA 3SOZA 4YJ2A 1IJBA 1PTKA 1MB3A 1J56A 4Z9AA 4QGGA 4FK8A 4GNKA 4FX2A 3F9RA 5CCEA 2PWBA 4TKUA 1J1UA 5DHAA 3O4GA 2ID9A 3LCMA 1Z2EA 2HXSA 1N5JA 2AI2A 3KBOA 4RS4A 3TZQA 4PC2A 3G79A 2CXUA 1MVNA 3T61A 5KOYA 4RD6A 5C2JB 3HDHA 1GO2A 1SGWA 4G84A 4JBWA 5KBYA 1FUKA 4P7JA 2I7DA 4FDLA 2QLLA 2C2XA 2AC7A 1UBSB 4YMWA 1ESNA 4LJ6A 3EPKA 1CY1A 4YAOA 1OBCA 2FVYA 1PFKA 4NZ9A 4EUEA 1T0BA 3DZGA 4G5OA 3UAOA 3KJXA 1UC9A 4G37A 3Q7RA 1NL3A 2QROA 3LOQA 1NF9A 3QXSA 3IVRA 4JP1A 4P3YA 4JI0B 1IOVA 3NHRA 2PNFA 1IM5A 4DJEC 4YAJA 4YXWA 2YV3A 4N3AA 1TRHA 3J81A 2QBYA 2QT9A 1ODKA 2H2GA 1CKEA 2I87A 2A35A 1E0DA 1CQXA 1G4HA 3PJDA 2EEPA 2Y93A 4JJGA 3RJZA 2PUVA 4BNFA 1AX9A 2DTEA 4TXNA 4EGJA 3PFHA 4R4JA 4ROSA 1XU7A 4RIHA 3ZTWA 4PX3A 2XXAA 4JKYA 3GNSA 1X0XA 2WE7A 4Q4LA 2ZUTA 1E3TA 3IPYA 4ZT2A 4O59O 5NULA 1XG5A 4BCDA 4V1CB 4ZJYA 1XEXA 1KWGA 4IV0A 3N8IA 1IIRA 4GMXA 3IAFA 3T1NA 5FBQB 1O1YA 3O91A 3OIVA 1RHRA 2CDAA 2H07A 2Z98A 3B9PA 4MINA 1DEKA 2AMYA 1ZH4A 2QX9A 4Y7DA 4ZO6A 3KK0A 3JQ8A 1JA1A 1WE2A 4BLQA 4ZT7A 1K9SA 1ZK3A 1RM4A 3C3XA 1EVEA 3RDPA 1AMOA 3VTKA 2UYCA 4ZCPA 3UXEA 4ESVA 1G8GA 2VNSA 1UJ2A 2GBIA 4RETA 2VPXA 3E5RA 1Z6YA 4KXLA 2F3UA 3H65A 1HWYA 4G1FA 4OIMA 1T9AA 5DB4A 4L4RA 2EDAA 2F8MA 4RVGA 4C9BA 4H7FA 3I9FA 2VYVA 5BQ3A 3D0OA 1KI4A 1ETUA 1R6VA 1L5KA 4C76A 4G8CA 2WPDD 2JRCA 3OZEA 4F86A 2WOOA 4REQB 1Q11A 3TPFA 3GOHA 3ASYA 2X5XA 4P3OA 5KJEA 2M6KA 3RREA 2NP7A 4Q48A 1PW5A 1UP4A 3AESB 4YACA 3WWPA 1FYVA 5LYYA 3J7AC 1PG0A 1GILA 5J4YA 4G5YA 5G0WA 4X62B 3CTMA 3ET5A 3LP6A 3KKOA 4JI7B 2AJBA 1L5VA 2ZT7A 3LA6A 1O0SA 4NXNB 5FAXA 4MUAA 1DWQA 1QFYA 1QTQA 1KBQA 1MNAA 3BXPA 4LPSA 1H9AA 2EJBA 4KO2S 1T24A 4DUYB 4UBIA 2DWOA 2YMQA 3NVAA 2DJIA 2J45A 4N5DA 4QPDA 1TCCA 2QS9A 5IUNC 4F85A 1N2ZA 5DMHA 3VR4H 1M6WA 4AB1A 4Z6KA 5AI4A 2OHGA 5FJIA 4J1QA 1Z29A 3I42A 2G1UA 4C14A 2AS0A 4JK3A 1XDGA 4ER6A 3ZCSA 1U3GA 4PZLA 1GXSA 2WYWA 5DW3A 3TN7A 1K5HA 1RMYA 1A4UA 1VYVA 1SXJE 5LJIA 2B2CA 4HD8A 3DQQA 5EE3A 1JLKA 1QLHA 1KKLA 3EXHA 1DHRA 1YTUA 1T5BA 4UZFA 1HC7A 3LC7O 5DCWA 4AMZA 4DSAA 3CR7A 3IILA 3QI2A 2ZM6B 4YBRA 5BR1A 1MVOA 1LDNA 1YB7A 2DUWA 2WSSA 3B38A 2QI9C 5C37A 4RVHA 1NI3A 1EXMA 5AXAA 3QPDA 2ZG6A 1RWQA 3N0TA 3TL2A 3DKRA 4QU0A 3IEUA 1NNSA 4C6HA 4LF6B 4UQLA 3WWCA 4BNLA 2B83A 2YKGA 3OAAA 2XCSB 5DHQA 1T8PA 4G1MB 5HJ5A 1KSJA 2OBBA 3OQBA 4B2YA 1JHAA 4M9ZA 2WIGA 4JXKA 3T5MA 5HIAA 5I7EA 2HN9A 1QH1B 4URUR 4Q7MB 3N2ZB 4DQUA 3VA7A 4EEXA 3FZEA 2HQBA 1XL1A 1KY3A 3ET4A 1X13A 4NK5A 2DWQA 4BFWA 5EIEA 5JBNA 4MVJE 3IURA 3HYCA 5A5DA 4S0ZA 3V7YA 4XVCA 1HH4A 1AB6A 3T7EA 1LLQA 1UT6A 2PAAA 4ND3A 4OL9A 4E5DA 2V0CA 4OP2A 1BCSB 2A9RA 1YQUA 4M6WB 1EM8A 2QPOA 1KY2A 4RSMA 4YLYA 2SKDA 4IXMA 2VJKA 1ZNWA 2Z58A 3S55A 2VK1A 3B6KA 1RHMA 2VAVA 3RR2A 3KLBA 3VAAA 2EWWA 4H7KA 4J0HA 3IMEA 1LDEA 5DHPA 3RQSA 3ZIAA 1YDFA 3PQ4A 2A5DA 4QUDA 5FHRA 4LTDA 3FPHA 2QN2A 3BMCB 1SK8A 2XNDA 3M5DA 3P9YA 4Q9LA 2QRMA 1XMPA 5ESWA 5DYWA 5TT1A 2B8NA 2RHJA 2XBUA 3FWKA 3MM4A 3AC0A 2AKYA 1IPHA 3U3JA 4RCZA 4EJFA 1B6RA 4PN7A 1A7KA 3U13A 3QYJA 1L5FA 1JEQB 4RPKA 4BLUA 2Q9UA 1W44A 2V65A 4ND6A 2W6CX 2QQFA 1AIPA 2X6TA 4G1CA 4JOSA 1CT9A 3WXMA 1UQRA 2NU8A 4O4LA 4EB6B 1KRXA 4R40A 2YUTA 3H2JA 4U7WA 4KITB 4RTPA 2YFHA 1A9QA 2CYCA 2NZWA 2FEPA 3F47A 4OH7A 4D02A 1XC7A 2QR5A 4E31A 3U7GA 1SWWA 5CFZA 5C1BA 4P4LA 1HOTA 6GPBA 4B82A 2NYRA 2RAVA 1TVKB 3ZE2B 3N1UA 1MAWA 1ZGHA 2D0PB 3PDCA 1Q7EA 2YJ3A 4PIMA 4EQ6A 1LZKA 1Z5WA 2AFIB 3P9IA 4R0VA 2XQKA 4MA5A 1X39A 4Z8YA 2GT1A 1UM9B 1RSZA 5JNRA 1SRQA 1RYZA 1TKAA 2XEDA 4TMVA 2H2DA 1U2ZA 2RCYA 1SPBS 3LNCA 4PO1A 2FK8A 3FI9A 1SVIA 2QRVB 4S2EA 2HLHA 4WGFA 5ADVA 2ZIZA 1DHTA 1PZFA 1R8SA 2F8LA 3CUWA 3B6ZA 4YJGB 2GN6A 3HNOA 2LV8A 1Q7CA 1L5ZA 2EXXA 4DYHA 3DULA 3R9WA 2NZ8A 2HU8A 4D81A 2O3RA 3WIVA 1KEVA 5J4LA 1L5SA 1GGHA 3AIKA 4E7PA 2Z6AA 5EQTA 5LQKA 4E4RA 1KEPA 1LNQA 1PJSA 1RDFA 1YBVA 1V47A 1YRHA 3F6EX 3Q0IA 1ISGA 4JC8A 4RMNA 3PGVA 1DC3A 4UREA 4BWGA 4H6PA 2UKDA 1LWNA 2X9GA 1UPXA 4L2IB 3BEOA 3U09A 2BRUC 4Z0TA 3FCUB 5CBKA 3E9QA 2TRSB 2HBQA 3HBFA 3HB4X 3KVYA 1C8KA 2I76A 3D8UA 1U0BB 2VCHA 3LRXA 3D8BA 1A71A 1ANKA 2P9HA 3GT0A 3KEQA 2IHJA 1ZN7A 5DWQA 5FPSA 1GUZA 4O4IA 3RD5A 4DV1B 3FRJA 3B51X 2DGDA 1L3BA 3PI7A 1O6GA 1HM5A 5F4BA 1Z17A 4IVRA 4KE7A 2RGBA 4Y0VA 3TI7A 1XMQB 1K7YA 1L7BA 4LJ4A 3QY9A 1ZI6A 4OJYA 3VC7A 4BNDA 4OP1A 1CD5A 4JJEA 1XTKA 1S3FA 4C3OB 3T5PA 2VHEA 2ZTSA 2P0YA 3ZE8A 4C1NA 4EY4A 4QM7A 1GP2A 4IHJB 1LK0A 1MC8A 1GZVA 1SXJA 1NURA 3N2EA 3U49A 3ZWPA 4B8ZA 4CEHA 4HO1X 3AKCA 3R3JA 3D2BA 2P4EA 3NRJA 2ECOA 2JS7A 5H8WA 2A1TS 3CNBA 5FA6A 4JBIA 1OJ7A 2C83A 2WTEA 1BRMA 3KJQA 1JLMA 3DV0A 1YFKA 4F3CA 3AJ9A 1D2MA 4BV2A 1J0CA 3NTRA 1F0KA 4QHTA 1AU9A 3BMQB 1JNYA 2P5TB 2BGWA 1Z2PX 2H8GA 4RDCA 1D9ZA 1N0WA 3AL3A 1REQA 3ZWKA 2RGAA 4FW8A 4IRMA 1YE3A 1QIGA 1FVFA 3VU3A 2CYAA 2AJCA 1G4UR 2XWBF 4RK7A 4LY6A 2A1UB 2YVUA 1XZLA 1TUBA 1X9IA 2HIHA 3JQEA 5BN3A 4DTCA 1GN9A 3AHGA 4M8IA 1CZOA 3GLFB 2YYAA 1AGRA 1TK9A 3SC2B 3E3MA 1NQAO 1HEUA 2GYVA 1I0LA 2Y71A 4JLAA 4YAUA 2JATA 4OK3A 3EH1A 2O14A 4I2VA 4DCVA 2C3PA 5DYTA 4I5FA 4DV4B 4MCJA 1MABB 4UEJA 4NAHA 1G21A 3HY3A 3K09A 1GQQA 1HXHA 3I2GA 1E1QD 3IDFA 4FJ1A 5FV7A 4IHKA 1XZJA 5AVWA 4YVFA 4D0RA 4Y9UA 2ZJOA 4PZDA 2OKCA 2RBEA 4G0YA 1CQIB 2QLFA 3KOUA 4BMPB 5JD6A 2VDPB 1YVPA 2C2BA 2FUEA 1Q0HA 1TB4A 2JDIA 3LVBA 3M82A 5G3YA 3F7OA 1KZ6A 2W2NA 4X20B 1T10A 3S70A 3V3KA 4C0JA 2X8AA 2OPBA 1DJQA 1G5RA 4X1KB 1KEKA 4Z9YA 1DI0A 3L7AA 4H3VA 3SLRA 1QYIA 3CVOA 3R2JA 4EMSA 4RQAA 2P27A 1UC4B 2P0EA 1E9BA 2JASA 2JH3A 3NALA 5CURA 4F4FA 1P72A 1ILEA 2EQ5A 2FPKA 4QUAA 1TF5A 2VT6A 1M0SA 2ZJAA 1KPIA 4Q4AA 5E1MA 2W37A 2ANBA 4LPKA 3GUUA 1M8PA 5F52A 1VFNA 5DZSA 5HJ7A 3Q8XB 1O96A 1W34A 1WVIA 4QFMA 3A2NA 4LCEA 1XTBA 2AUMA 3O1HB 4I6JA 4G9BA 2BV3A 1FS5A 5E6UB 1RP1A 3VGJA 4YPOA 4KPEC 4N8EA 4C7KA 4DSNA 2C42A 3N58A 3KVOA 3ZK9A 4XASA 4MK4A 4CCSA 3BUSA 3GJ0A 5HS4A 5LYJF 2X4GA 4ENPA 2BM9A 4F4DA 1NI5A 3TLBA 2ZTUA 2C7OA 3ZW7A 1TT5B 1NKTA 4RTQA 4X8MA 1KVUA 5T3YA 4W8GA 5IDVA 1XEWY 4ID3A 2X58A 3FDZB 2R1TA 4XVHA 5GVRA 1ESDA 3BSWA 1NR7A 1U80A 1YB4A 1Z5ZA 2E48A 1CJVC 2K6GA 4KLCA 1NV9A 4JJ8A 3UUEA 3KALA 3HYSA 3CLUC 5BWMA 1P8AA 1CWUA 1I14A 1S02A 1FTSA 3COVA 4ZOEA 1FDVA 2AFHE 2YXDA 5EZYB 2QZJA 4JOBA 4PGFA 3W6UA 4DEVA 3VKHA 2BSXA 2Z56A 1DAPA 1LZLA 1U0GA 3C7DB 1NXSA 1V7PC 5K0LA 4DLKA 2ECPA 3MWGA 3OOSA 4PLFA 1R8JA 3STTA 4PTYA 3GB9A 1EKXA 3UJ3X 2QDKA 3LT5A 4XRGA 5DTEA 4MW6A 5FP0A 3L4SO 1U9ZA 1NN5A 1JEYA 4OXRA 4BU0A 1TPZA 1CVRA 3H75A 1FTNA 4P34A 3EARA 1JHDA 1Q1AA 3DXZA 3T34A 4N6NA 3A58B 4AZ3B 5JEDA 1EUDA 1XROA 2C9YA 2G4VA 5EWLB 2YNMA 4ZRDA 2UZ0A 3H11B 3GBVA 5D7BA 5IVHA 3E9EA 5H1YA 3O94A 2H51A 3LFUA 2I91A 5IJZA 1P3JA 4A3SA 4M0MA 4D92A 1IQRA 3K8QA 1PHRA 1QNFA 1Y6JA 2CXHA 5ARDA 1N9GB 1O58A 3UMBA 2ZRDA 4AULA 2OO5C 5LP1A 1TRKA 1L4UA 5GGXA 5LP6C 1QDEA 1T8UA 1ZMOA 2A9OA 1VGVA 2BZGA 2LRHA 3AF1A 5E0KB 1QGUA 4YT8A 3WK8A 1D6SA 1YWGO 5FBWB 5KYKA 1HYQA 3DLPX 3CUKA 5EESA 2IHYA 3GDOA 1M6VA 3BJIC 2J6BA 3M6FA 4XTRA 2AMVA 2ZAIA 1KC3A 1MGPA 2QIPA 4X6XA 3W2GA 1DBRA 3QWHA 1IOWA 2BP7A 3HVUA 2HTEA 3KPVA 4Z7JA 2B1IA 1G42A 1V5EA 1XK6A 5HG0A 1VRCA 3PUIA 5P8WA 4B31A 3N6RA 1CY2A 4FGLA 4YXFA 1V43A 4W6ZA 1U7XA 3JQGA 1G7RA 2RAFA 1W36B 1DJNA 1EX1A 1VE7A 1YJCA 3K2IA 1OX4A 1THMA 1UBGA 3THWA 3OTQA 1TZCA 5ITZB 1HQDA 4TRNA 4F6CA 5K3DA 5FRDA 3RV3A 2MYPA 5FPHA 4UNQA 3U3DA 3VU9A 3A6ZA 3KZXA 4MPTA 2IDMA 3STWA 4J16C 4JJAA 4ZDJA 1NM5C 1QF7A 2H2FA 2R3SA 3PQDA 5KHLB 1YRYE 5TPWB 4KYVA 4ARVA 1ODFA 4DWOA 2UYHA 2NN3C 3EGOA 5ITWA 3AVOA 4KQCA 1R0RE 3V5NA 5L3SA 3IAS1 1GQSA 4CW7A 3BE8A 1N0UA 4BU1A 1HLPA 1U2GC 3L82B 1QFZA 3DMFA 4B09A 1AOXA 3TLKA 3B78A 4LMRA 3VZCA 1B42A 2ONKA 3PFCA 3PWZA 4IOMA 4NS4A 2OSBA 3WYNA 3FWYA 3CW2A 1N3YA 1YB5A 3LX5A 2YY6A 3H7IA 4DR3B 4RA6B 1EM6A 4EYOA 1DOHA 3CRRA 3R20A 4K6MA 1UBKS 2CLOB 3ZDRA 2W2LA 1TTHA 2WYVA 4MRSA 5JCJA 1AHIA 1R1DA 1P60A 4NCKA 3RVKA 5SZHB 1EXVA 1XVUA 3C4QA 2JLWA 1A5AB 2XB9A 4M0DA 1P80A 4UHKA 5CW2A 4AY6A 4GPIB 4R9VA 1EPUA 1U28A 4KIFA 1VPDA 2H00A 3I45A 4Q3DA 2H4ZA 4BFLA 3GROA 4E88A 2I0FA 3L5KA 1L4KA 3HFRA 3F97A 3TNLA 2ZR9A 4ZARA 1DU4A 4AP5A 2JCSA 3OFJA 1TYEB 4DCMA 3B36A 4EGCB 2I8LA 4JZKA 3DZBA 1NHWA 1HQCA 1STOA 2R6FA 1R16A 4M46A 3DONA 2B9VA 5K6RA 421PA 1E98A 1FZQA 3HG7A 1UJ5A 1QYXA 3FI0A 1WNFA 2B1RA 3N59A 4BAUA 5A4DA 2W6OA 4UPDA 4NBVA 4QDZA 5ICCA 4AYXA 5JT1A 3B1VA 4EB8A 4BGEA 1ZONA 1JIQA 1NV8A 2R7NA 2BFCA 4KPFC 3D9QX 1R3UA 4Y2JA 3GN2A 3ZXUB 1SRRA 4KQFA 4WTOA 2LE0A 3DZKA 4LXIA 5I9MA 3VC2A 5A02A 4EY7A 2VXCA 5D6OA 1U65A 3GJZA 3H1AA 4HI0E 3LP5A 1VE5A 3NUQA 4DIKA 3ITDA 2P3QA 4JJZA 5FBVB 1GZ4A 1VM6A 2AKAB 3I9V1 3IVXA 4GL4A 3OT5A 1DCFA 1Z37A 5IUKC 3HXTA 3TAHA 2B0JA 2B82A 2QAJA 4HB0A 1EE2A 1KFJB 1R8XA 2IUEA 2XADA 5DOVA 2GD1O 1E1MA 1NBEA 4Y1FA 5IFLA 2AXQA 1H0SA 4G0VA 5DK6A 4M8LA 3QPWA 2WEKA 5E1BA 3R7DA 5JSYA 2X0DA 5ED4A 1NSYA 2Y99A 4A73A 4RGYA 1P7CA 1RWKA 4KN5A 3N76A 3MYRA 3R0XA 1YL7A 2FMXA 3C6BA 4I7EA 2QMHA 3BSSA 4U5QA 1A3CA 4MROA 4ZTBA 1EE9A 2WWGA 1SA0B 4WX2B 3RC3A 5K3FA 1UKEA 3PXXA 5J3JA 3LT0A 2CVQA 3LAWA 2EW2A 5DNVA 4W1RA 2YQ5A 3LDUA 4G5XA 2P68A 4X1IB 5EIBC 3MCTA 4MQFB 4TSKA 1U9JA 1OJLA 5HQ3B 5D86A 3ND8A 1EGHA 3S4YA 5KTRA 1T6YA 4YB8A 4JQOA 1N8SA 1FP6A 1Q0ZA 2F67A 2OG2A 4EGFA 1ZM4A 2CDNA 3BK2A 4M1MA 1XCLA 2O8EA 1IXRC 4JI4B 4MYTA 2O2ZA 3UC9A 5CT6A 1XTPA 3QLTA 4L5BA 4QJ3A 2B21A 5K51A 1Y4UA 3LDGA 2GOYA 5K8JB 3BXHA 3KB6A 1FRFS 3MJDA 3UMYA 2GYUA 4A8JC 4EHBA 2QSUA 2WF9A 5AK6A 5HE9A 1DAMA 4N0PA 5L6MB 1UEIA 4N01A 1BW9A 4KGDA 2HCFA 2EW8A 5FI1B 1KDVA 3TOVA 2XUFA 3WXBA 1ZOPA 2EBUA 3RAGA 4BQIA 4P0TA 2YWRA 3R44A 2IX3A 2AG0A 3DYVA 4B6GA 4DRYA 2CZCA 1V8ZA 1KI7A 1WOYA 1S2NA 4PNHA 3K9CA 4WUTA 2WFLB 2WF7A 4BQRA 2QKYA 2H31A 2WG0A 5DBIA 5HRCA 3C1UA 3D8RA 4QECA 5CLHA 4EHLA 4YPFA 4WECA 3QXXA 4L76A 2O1EA 4GXRA 1TCUA 2BM8A 4JEHA 1QQBA 4XE5A 3L6OO 1IQPA 3RBZA 3UQZA 1FFAA 1XMIA 3G2PA 4ZODA 1UPTA 1BFUA 2PUAA 3NBUA 5FUYA 4MULA 3UZUA 1DBQA 1TJ3A 2B3TA 3SFVA 4NZPA 4HEJA 3VSDA 1GRVA 1I2BA 1M1NB 3W5VA 1T3TA 3R7WA 4H59A 1OVGA 5CA1A 1U0LA 2R85A 3EZFA 3K35A 2NTJA 3LC2O 5H81A 4RZUA 3K0AA 4BVJA 3OIUA 1P4AA 1YUNA 2BE9A 4XCVA 2EBWA 4P6VF 2A92A 1K7EB 1A88A 1OA1A 3CX8A 3DM5A 3STUA 1V37A 1OYYA 3BS4A 4I9HA 4TVOA 4DAEA 4DFDA 3X2FA 4WESB 4D4IA 2HF8A 2C1XA 3Q9LA 5FOWA 3S2EA 4CI9A 1L4HA 2GKOA 2H1RA 1O97D 4X71A 5CEJA 4U7DA 1YQ9A 4YLGA 5CCBA 3I37X 1M10A 1NR5A 3V00A 7GPBA 4DV5B 1EESA 5JSHA 2MSEB 2AX3A 1T25A 3WRVA 4XVRA 5CB6A 1YQXA 4R3WA 4CT5A 4EA9A 2YQZA 2YUIA 4WXHA 3WZLA 2FI1A 5L6LB 4E6PA 4OLJA 3USES 4B9AA 1YA6A 3P2YA 1WUTA 1EFAA 3K1JA 2FZKA 1ACJA 1EK2A 3VR3D 1A9SA 4RFSA 1NBIA 4IZHA 5CEEA 1T9DA 4S05A 4PFJA 3HMKA 4L9SA 1XEWX 4YONB 5FO1A 5K8CA 4Z4IA 4R2IA 1P31A 3FOWA 2A5YB 1PFWA 4QX6A 1JHYA 3KD3A 1Z8FA 3RVOA 3IBFA 4BO0A 2YFQA 3MMNA 1DX4A 1VKRA 2QMQA 5REQB 2GLTA 4FXPA 5BRJA 3OH8A 1Y6GA 1PLLA 1U7DA 2D4HA 2EGUA 3NTQA 3GAMA 3PQEA 4GLLA 4GXNA 3V55A 4BGIA 4MVWA 5GV7A 4WNCA 3W9UA 3G1WA 5M04A 1C4OA 1WCWA 2AA3A 3HCWA 3W9SA 2O23A 3JARB 1VP3A 3CKMA 1N8TA 1CRQA 1QUFA 3E81A 5U9CA 1U8CB 3DHWC 2G67A 5DI3B 4CM9D 2XUJA 4AZVA 4RM3A 5C1DA 1W48A 2CFIA 4S1PA 2EZ4A 4RA9A 2GNAA 2YVLA 3EF3A 3VYWA 4URXR 1QKJA 3TLAA 4GU5A 3VPHA 1UXJA 1MTZA 2DTXA 3HLTA 4PV7A 4DN6A 3TKLA 1LLDA 2R6JA 1KXJA 3AXSA 4UU1A 1RJGA 2PKEA 5U1PA 3D8NA 5HQJA 4CM3A 1Q0RA 4S1OA 3ESRA 2PY6A 4Q3LA 4EPXA 2H5EA 1ILWA 4DUZB 1MVLA 1ULTA 3GH3A 3PJRA 4Q12A 3VR5A 4FNGA 4ZAYA 1U2QA 3H0CA 3EWIA 5EFOA 1VZ2A 5LQNA 2NXEA 4LOAA 1OZFA 3I58A 3I0ZA 5H5JA 4U0KA 4DMLA 3FCSB 3FJYA 2C2GA 3FY4A 2PJRA 2ES4A 4HX5A 1ZD5A 3E2MA 1OE0A 3SQDA 3VOBA 4EF6A 1OLSB 3IBYA 1A9XA 1AHHA 5JMOA 2ZVJA 1I4LD 3ZV6A 4DJJA 1L4NA 3WAJA 3GFBA 4CL2A 4DCCA 4ZQCB 1XRMA 1JBQA 3DXFA 3AR2A 3LQ2A 2AN1A 4O25A 3LZCA 5KSYA 5ECGC 1NVGA 4EW1A 2KLHA 3AKDA 1K97A 2QTVA 3BKWA 1I94B 3EG9B 4G36A 1WMFA 2YRWA 4RAOA 4B33A 5C9ZA 5B1EA 3VXKA 3MMZA 3UT5B 1AKMA 5U4QA 3DDNA 1HYGA 5J2TB 3OKPA 3GLIB 1TEZA 1PLJA 4L1KA 4U6NA 1HEIA 4N8DA 2R79A 1QFXA 2I54A 5TS3A 4KQXA 3V48A 2UZ1B 4COOA 2TYSB 2Q7XA 1GPWB 1Y9AA 4MA0A 2WPDA 5A4FS 3GRPA 5EI5A 1I6MA 3DPSA 3VVMA 1LTKA 5KCMA 4FSXA 2SKEA 4OHYA 2Z95A 1FU8A 4XWYA 1X7YB 4BLVA 1XU4A 1SUCA 3ZVRA 4ZTUB 1ORTA 1JW9B 3CRZA 1Q15A 4ER0A 3FMOB 1ODJA 3JWJA 2IEIA 3WGNA 5A1JA 1AQJA 3UOGA 1J2EA 1DKRA 4FFVA 4PSAA 4XA8A 3IFSA 4IIXA 1K7XB 1T29A 1Z4LA 4FNAA 1XTRA 1B93A 1N3IA 3VPDA 3RVQA 1KYWA 3X1KA 2ALJA 2ZZMA 2YDXA 2YYSA 2PX5A 3QPUA 4BQEA 3E7PA 4F4HA 1WXQA 4W9RA 1SOUA 4EHJA 3PQ7A 5BR8B 4OHPA 1SQFA 2BCEA 2AV6A 4I50F 4EG1A 3NORA 3W4KA 5FPTA 2UZAA 2IITA 4KQEA 5IJXA 3M83A 2X8JA 3UKDA 3ZJYA 2I7VA 2XKJE 4LCBA 1WCIA 2BFPA 2NU7A 2QLNA 4N6GA 4Q3BA 3ZKWB 1C1XB 2NO9A 1YS6A 3O74A 4ZJZA 3MK31 5JECA 4CMKA 4RHCA 2YICA 3OMWA 3NMUF 4UEKA 3TIIA 5JO0A 1MV8A 1L5HB 4RF4A 2ZB7A 2Z57A 3OWXA 3KIPA 1ZWKA 1P29A 4DYVA 3GT7A 3RYHA 3BF7A 4BOYA 2OFPA 3CF2A 1NNUA 1YIOA 3CEMA