1BVYF

Complex of the heme and fmn-binding domains of the cytochrome p450(bm-3)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
152
structure length
152
Chain Sequence
NTPLLVLYGSNMGTAEGTARDLADIAMSKGFAPQVATLDSHAGNLPREGAVLIVTASYNGHPPDNAKQFVDWLDQASADEVKGVRYSVFGCGDKNWATTYQKVPAFIDETLAAKGAENIADRGEADASDDFEGTYEEWREHMWSDVAAYFNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords PROTEIN (CYTOCHROME P450 BM-3)
publication title Structure of a cytochrome P450-redox partner electron-transfer complex.
pubmed doi rcsb
source organism Bacillus megaterium
total genus 46
structure length 152
sequence length 152
ec nomenclature ec 1.14.14.1: Unspecific monooxygenase.
pdb deposition date 1998-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1bvyF00
4Y9UA 5ULLA 2BF4A 6NULA 4FGJA 4PTZA 4N82A 4PTYA 4QOEA 2XOEA 1FVXA 3OVMA 2MTBA 2M6SA 3TE7A 3K20A 3OX2A 4NULA 1AMOA 3B6JA 4XDGA 2FX2A 1D03A 3K1YA 1J9EA 3OX3A 3UXEA 4DILA 1CZHA 1DX9A 3O73A 2HPVA 2FCRA 3W79A 1RTTA 5EAIA 5LBUA 5NULA 3LT5A 2ARKA 3GFSA 2FZVA 3NFRA 3KLBA 4LTNA 4S24A 2QX9A 5NLLA 5LJIA 4HS4A 1YCHA 1AKUA 1QRDA 4C76A 3GFQA 4QOFA 4CF6A 3ESYA 1H69A 4GI5A 2MWMA 2V9CA 2HNBA 1CZKA 1WSWA 3W77A 2BN4A 4C0XA 5LJLA 2QMYA 1OBVA 4R81A 2FAXA 3OWXA 3F6SA 3W78A 1YDGA 1ZWKA 4LA4A 1V4BA 2Z9CA 5F12A 4J8PA 3FVWA 4BMOB 4YAWA 3NHSA 4YQEA 4GR9A 1YKGA 2OHHA 4FX2A 3NHUA 2KQUA 1CZLA 3L9XA 3NHWA 1B1CA 1H66A 2GSWA 5EA2A 2D5IA 3N3BC 4C14A 5JROA 1KBOA 3KAQA 1BU5A 4CETA 3EYWA 2MOKA 4LAFA 5LMCA 1C7EA 4LTMA 4DY4A 1JA0A 3NHJA 2X2OA 3RPEA 5F51A 2Q9UA 1OBOA 4XDHA 2OYSA 3S2YA 3ZHOA 1CZOA 4U7GA 3NHLA 2M6RA 3UXHA 5BUCA 1E5DA 1FLVA 3B6KA 5A4KA 3QE2A 3GAMA 1QBGA 4QOJA 3NHPA 3LCMA 4GQIA 3SVLA 2V5VA 3FX2A 4DIKA 1FLAA 2OHJA 3ESZA 1YRHA 3W7AA 5B3LA 3FW1A 1YCFA 3JSXA 4YAOA 4BMPB 5LVAA 2Z9BA 3OWHA 4QOIA 2WC1A 2Q62A 3QFCA 4H2DA 1J9GA 2BPOA 3TZBA 4ZVKA 4HEQA 2V5UA 2QX4A 3KEGA 4ICIA 3GFRA 4NLLA 2FDXA 5TGZA 2R96A 2ZKIA 3U7RA 2Z98A 3OJXA 2F1OA 2RG1A 1ZWLA 4Y7CA 1D4AA 2FVXA 3ESXA 2Z9DA 1KBQA 1D04A 2QR2A 3FNIA 4F8YA 1DXQA 3QFRA 4LTDA 2FOXA 1ZX1A 3R6WA 3HA2A 1RLIA 3D7NA 1FX1A 1AKRA 3F90A 2XODA 2FLVA 4N65A 1QHEA 1VMEA 5FUQA 1RLJA 3L9WA 3FJOA 2N1MA 1XT6A 4M0CA 3N39C 3HR4A 4QODA 2AMJA 4QOHA 1YCGA 1TLLA 1JA1A 3U7IA 1C7FA 1FUEA 4ZVLA 1T0IA 1YOBA 3OX1A 1BVYF 2BMVA 4YAUA 2QWXA 2OHIA 1QR2A 3O2NA 2B3DA 3NHKA 1NNI1 1XI2A 5LLDA 3KAPA 3NLLA 4C0WA 2BZSA 4YALA 1CZNA 2QMZA 5EMNA 2HNAA 1CZRA 1XYYA 5B3KA 1F4PA 4Y9RA 2A5LA 1J9ZA 4U7HA 4U7FA 3NHFA 4ESEA 3NHYA 1AKWA 3G5MA 1X77A 2QX8A 3ES9A 2KLBA 1AG9A 1SG0A 3TEMA 5FX2A 1DXOA 5F4BA 1SQSA 1FLNA 2QX6A 3P0RA 5FA6A 3HLYA 1TIKA 4FGLA 3N3AC 1I1OA 4QOGA 1AKTA 1CZUA 1FTGA 1FLDA 1WSBA 3EDOA 3OJWA 2W5UA 2FZ5A 4PU0A 1AHNA 1J8QA 4OXXA 2X2PA 3B6MA 4H6PA 4FGKA 3NHRA 4N9QA 1XYVA 2MT9A 4ZVMA 1AKVA 3F6RA 5LBTA 1AKQA 4YAFA 2R97A 4D02A 1AZLA 1OFVA 1GG5A 3B6IA 1T5BA 3F2VA 1RCFA 4ZVNA
chains in the Genus database with same CATH superfamily
5F52A 1NJ1A 2PBFA 4Z54A 5LP6F 1BCSA 2Z1MA 2VATA 1YDEA 2YN0A 3OMWA 3HVUA 1VLJA 3ZHVA 3H5NA 2E4YA 3CIFA 2PHZA 3NCHA 4N82A 4TQUS 1VSUA 1PD1A 1TU3A 5ALPA 2OGSA 3LSTA 3L79A 3MCAA 3SU8A 4AX4A 1GU7A 2FMTA 1P77A 2EJBA 3I6QA 3LIIA 3E9QA 1TD1A 1KDVA 1V4VA 1YF3A 3GPLA 3AF1A 1LBQA 4QUKA 3QVVA 5GZ6A 1P2TA 1X80B 2VHWA 3ORHA 4UD2A 3K20A 5AKYA 4WPGA 3B6JA 4WLFA 3H5RA 4P98A 2B1JA 4XDGA 4CM9A 2ATXA 2FWAA 4XWWA 1D03A 4WLNA 5CDTA 1EBUA 2XKKA 3JQ6A 3RW9A 2PGAA 4LBZA 4JI8B 4FWIB 1JHOA 2Y2UA 1YZLA 1V5GA 4LCEA 4E7PA 1K5GA 4ZYLA 3LY5A 4DY6A 1XAJA 3AJEA 3NIGB 3UMSA 5CBKA 2C54A 2WKQA 2B8WA 4EEKA 3ACDA 2QRVA 3CHYA 3Q6NA 4AG6A 3JR3A 4FMCF 1XC7A 1QRUA 1K8XB 1L7DA 1OYYA 2EF0A 2PT9A 2AFVA 2VT2A 1UXHA 1YFZA 3DFIA 1IXYA 2HT1A 4DUGA 1KTIA 2F55A 1VECA 1W49A 3A3OA 1CUBA 4W9NC 4L5CA 1FOEB 5FA8A 5IEBA 3VGJA 3ZE7A 4HX9A 1IEXA 2NN3C 4AF7A 4D0NA 4N39A 3HL4A 1X7YA 4US0R 4JBGA 1S2LA 4ZEXA 3BJMA 2Z43A 1PQ4A 2Q49A 1R0SA 3OA2A 3V7WA 1JFRA 1KJNA 1VKOA 2F17A 1MDFA 3CLRC 3ETNA 3K53A 5KNBA 5CYFA 1PZFA 3BSFA 2IXGA 1E1LA 3FTNA 4MCAA 2P5TB 1AQIA 3JPWA 5CP8A 2QDXA 3WX0A 3ZDAA 1VI2A 4F04A 3D8BA 4IDPA 2WMYA 4B6JA 2HY7A 5TNXA 4UPEA 4CR7A 2FK7A 2W2KB 1MKYA 3TSAA 3ZJVA 1BE1A 1DG1G 4MYDA 1JDTA 2XNJA 2DT5A 1B0PA 3QI2A 5AOAA 3TEJA 4INOA 1VKNA 1CQXA 5LZ8A 1ARZA 2N0SA 1T1EA 4V1CA 4DSOA 3HCEA 3I61A 1MT0A 3FGNA 1DV2A 3F71A 5KYWB 2BN4A 2FGJA 2R6AA 3MMZA 4J1TC 3JRXA 4XB2A 5AW5A 4NU5A 1H2RS 1VXOA 2SICE 4PIPA 3WNDA 3IPRA 2NADA 1KYYA 3MCZA 1GFZA 4BNJA 1RAIA 1I8TA 4LF7B 2XQJA 3O83A 1JEEA 5TPWB 3OZRA 3HABA 4DCJA 2WB4A 4TYQA 1TQ6A 3W6OA 3FIJA 4IIEA 1UBJS 1Y1PA 4EI9A 5LWQA 1K6XA 1A2BA 3N2LA 1P9NA 1RNLA 2FPGB 5CRIA 1L4YA 1EJBA 2WI8A 1UKEA 2YINC 3FH0A 4AMUA 1ENPA 3H16A 3IBTA 4D9NA 4D57A 5IVHA 3IT0A 2EZUA 3M1LA 3TG2A 3ELYA 3TB6A 4L27A 1JWLA 2PM8A 3RODA 2WU8A 1KNQA 1GUFA 1R4NA 3WYEA 5K05A 1YRYE 1JJIA 3CUKA 2XE7A 4IQFA 3P5SA 2QAGB 4BQRA 1DEHA 2IW3A 3GHYA 5ALEA 4JELA 1EXVA 2DTEA 1QG2A 3H3XA 1QO0D 4BBAA 1UEXC 2IXEA 4NE2A 5ER6A 3GRVA 4HJRA 4MS3A 3IIMA 2Z6UA 5AKXA 3THYA 3K5IA 5IDYA 3LPMA 2Q0QA 2A5DA 2FMUA 3V4SA 3ROQA 3TNDA 4EJ0A 2V3VA 4I5GA 1I3CA 5IASA 3G88A 3PEEA 2PV0A 3NHUA 1R7RA 3Q7PA 1I4DD 5ESRA 2DTXA 2QVLA 4MQEA 1H2YA 3RFTA 4A16A 2J7PA 3BXEA 2C5FA 3A9RA 4EL0A 1Z17A 3I83A 3PR2B 2GSWA 3TLBA 1QHSA 1C41A 2HCBA 3MJRA 3TDMA 5E7MA 3GBSA 4DCCA 5GZ3A 3HA7A 3UUWA 3OHSX 3N8GA 5SV2A 1D1SA 4EO9A 2BR5A 2QQ0A 1BOOA 1NY6A 3C7KA 2HO4A 2XNCA 2ZT7A 4AQ7A 4URVR 1WM1A 1P0FA 4K5QA 1L1RA 4MHTA 2FDCA 3DOJA 2H6EA 3JW8A 3L4EA 3TTUA 4DJTA 4GMDA 1NKSA 5F2KA 4BWGA 3AC0A 3HNRA 4LIPD 1F3LA 4TXJA 2F59A 2O7RA 3WK4A 5KMGB 1TMOA 1XZGA 3THOA 3RT7A 5F51A 3BWEA 5CG2A 1IBMB 1Y8RA 3Q6IA 3K9FC 1HBJA 4O29A 4EB0A 3BIWA 1MH9A 2D8MA 5LB2A 3IAM1 3R20A 4XVHA 5CFQA 3VBCA 2QVBA 3TLCA 1P6QA 1SUAA 5DBFA 4CUZA 3GU3A 1OAOA 3IALA 1D3AA 1KU6A 4I14A 4OKNA 3EC7A 1Z18A 2GWHA 3OOHA 5DX8A 4UARA 2O7SA 1SZJG 4HWRA 4A03A 3AERA 1BMDA 4MUKA 4UEOA 3V5NA 4ZDKA 4MVJI 3ROXA 3TZEA 1XAHA 1IG0A 2JFZA 3O3OB 5DE3A 1TKCA 4DV7B 3NJRA 4RL4A 4DJ5X 1U2TA 1KO4A 3LCUA 3KOWA 3OM1A 1RPTA 1SVNA 1USVA 3R09A 2W43A 1BSVA 1RMQA 5F3RA 4YRSA 4Z4FA 3ZI0A 2FN9A 2BVNA 3CUSA 1QUFA 3TTSA 4BB0A 2IQ5A 3T1OA 1FLAA 5AKKA 5JAZA 3OY7A 1IN7A 3SJ7A 3JQ8B 3T9DA 1YRHA 2HSEA 1NVAA 3UGJA 1E3EA 1X1QA 1T24A 3QLUA 4M0LA 4PYIA 2DETA 5IYZF 5LMUB 2X8JA 4P0TA 3CGWA 5C1IA 1TUBB 2WJ4A 3H1FA 1YAHA 1E6WA 1EFCA 1L5ZA 2JW5A 2C2XA 4R8LA 2YV2A 3HXKA 1IZ8A 2AJCA 1HFWA 2VPZA 1UOPA 3EGWA 3O93A 2LKCA 4YWHA 4DLVA 2FR8A 4WXYB 4KDEA 2WSMA 3OEEA 3D3JA 1YQXA 3TOZA 1MXHA 2CNWD 3HB4X 3H2KA 3N8NA 4N5HX 1VFNA 3ZQKA 2I9KA 1U1FA 2V4MA 2X76A 5IFLA 1D0VA 4LZNA 5LQAA 5EN4A 3A6LA 2DHEA 2OE2A 1SKUA 4M1ZA 5IAGA 5DT2A 3M1AA 1HYBA 2ID4A 1EUCB 3BE8A 3MK31 2N3ZA 3PXDA 4PLPA 3A05A 4WT7A 1ES9A 3ETLA 2C2MA 1BW9A 1U8EA 3L43A 3I04A 4JXKA 2PH1A 3FKQA 3DDUA 3IHLA 3H87A 4NXMB 1E5XA 4H35A 3G02A 5DHAA 3X1ZA 2IZOA 4OM8A 1OU0A 1WXGA 3GLHE 1EP3B 4DABA 2FWJA 1DUSA 4ICIA 1K9VF 2CXOA 2LZ0A 5DSTA 4NLLA 4NFHA 3SBXA 3TRJA 4RQTA 2F9FA 2HU7A 2X8LA 5JAIA 1MNAA 4U1RA 1T5LA 3VTKA 3GN1A 3ZWWA 1SHLA 4BKMA 2VL7A 3H1EA 2IA5A 4HDNB 4Q3AA 1XRQA 3AETB 4NPAA 3WWEA 2F1OA 1UC5B 3OF5A 3AVWA 1ADYA 1QIDA 1KYTA 2W98A 1C3OB 3PA6A 4LYDA 1CIPA 3ZW8A 4CBVA 5JECA 3QPAA 1MV8A 3DL7A 3TL2A 2VJOA 2P9TA 3ESXA 2ZP1A 2HJGA 1GHTA 2IXBA 3UBTA 4FYPA 4HLQB 4PHCA 4PFSA 5T57A 2VS1A 3K4HA 1I51A 1I3OA 1I30A 3UMFA 3LWZA 1KARA 3FFAA 1ZM7A 1AS0A 4KLNA 5EOVA 2CJYA 3HA5A 3QXCA 1KSFX 2QQ5A 2VXCA 1MC1A 2FE1A 3O7MA 3OETA 3MTBA 1L2TA 1G1MA 3A9CA 2WUGA 1SKMA 2C99A 3OCCA 1R5BA 3RWOA 3TX2A 3AEYA 3TZKA 4JQSA 1RXIA 4L7VA 4FC7A 2ZTLA 1JEYA 2DPHA 3OFNA 4HYQA 3FKJA 3K0AB 3GCXA 5I47A 1HH4A 5ENVA 1HOTA 2OM2A 3T0FA 1GDDA 1GVNB 4K1XA 1WZ2A 4XIIA 4M9SA 3LU1A 1D7AA 3W6NA 4QGFA 5FOSA 4AMGA 2VO1A 3QU5A 4RELA 4HPWA 5DM4A 1Z07A 4D42A 1NVVQ 3CNQS 5FTJA 1XEWY 2W2KA 2WYWA 5AHXA 3G0IA 3G8AA 4FGWA 2RB4A 3WAKA 3SLGA 2IYNA 1Q0ZA 2QTHA 2V6FA 3P9KA 4F6LA 4EKNB 4Z1OA 4BFTA 4PGFA 2P9YA 2ZUUA 3EAFA 1UPBA 5BW6B 3AVQA 4CGZA 5DX1A 1QVWA 1B2RA 3N39C 3RRFA 4CM3A 2IS1A 5EERA 1NOKA 4LX0A 4IJUA 2JKVA 3OJ0A 2OQIA 1OGJA 5KYWA 5J40A 4AJPA 2Y9PB 3A9VA 2DWCA 4OPMA 2EIHA 2FOLA 4LY9A 3VSAA 3IJ5A 1JIKA 2R60A 3O7WA 3OICA 4OP1A 1UBSB 2BGMA 3LQ2A 4IIHA 4OP3A 5DYIA 4ARSA 2Q4RA 2VZ0A 2QMOA 4RZQA 1IWPB 4AKIA 5TPWA 3FFBA 1JUDA 3A70A 4MEJA 4XGQA 4C01A 5K45A 2O8CB 3ZLTA 2BGNA 4M8NE 5LN1A 1R6AA 1CBUA 3KD2A 3W4JA 2V6IA 4EW2A 2CMFA 2OCIA 2FPGA 3H83A 4L0QA 4QXQA 4F9FA 5H5JA 1IHPA 4DLAA 3ZVRA 3DBIA 1JA9A 5TXGA 3I9JA 4YC7A 2JHGA 2Y2VA 2P2YA 3WRXC 4OK3A 3HYSA 5CVTA 2OFWA 4MIKA 1P74A 4R8KA 3NV7A 4FFNA 2AJLI 4U2KA 1K3UB 2ODBA 3BL6A 1IXSB 1E3IA 2KHZA 2UAGA 4NS1A 3TTYA 5KWEA 2QAGA 1XI2A 1ABBA 3EDCA 3KLMX 1NATA 3M9WA 3RRJA 3W1EA 4ZDIA 1I2CA 4EB6B 4EVQA 3B8HA 1AQYA 3AHEA 5SYNA 3A3YA 3PKJA 1CZNA 1EK0A 2G17A 5EMNA 2AOUA 3GO4A 3PDWA 4TWBA 3AHCA 2PT5A 4PYNA 1Z2CA 1GILA 4UU1A 2ET6A 4HLUA 1ISJA 1XKXA 2HDNB 4A23A 5CCBA 5IG2A 4D9HA 3OZEA 4Y2JA 3JYHA 5FFMA 1KAOA 5FNVF 2GAOA 2F4NA 1X1AA 1ZD8A 3UKOA 4DQDA 3R3VA 5LQJA 1MA0A 2XLBA 3FNRA 4HAYA 3D8NA 1HYHA 1E61A 2WHXA 4IZOA 4WZ6A 3VC3A 3BE4A 2C0PA 2XIQA 2P4QA 2Y93A 3DJFA 5CK4A 1KVTA 3UWPA 4EFLA 1C3XA 1KY3A 1N2IA 2WIDA 3HJAA 1VE6A 3FBTA 3PUIA 2PZ8A 2EKPA 2H65A 4DRYA 4J7CA 3WKEA 3K0HA 2KLBA 1DXHA 2P9ZA 1GU0A 2QNRA 3AVPA 3HU2A 3N0TA 5HKOA 1I2ZA 2Z1DA 4BDTA 3T1VA 3LPLA 3BE5A 3FKSD 4GMXA 1XZFA 5KMGA 4U5XA 1WVIA 4ZFNA 4WOPA 3IC5A 1ZCZA 5JFOA 5K6TA 3AP3A 1RM3A 1UQUA 1YE3A 2QM8A 3TEMA 2G9VA 3K9GA 1GQOA 5FNVB 1RE1A 3M4NA 4RH1A 4YXFA 3C41J 4V3CA 4UTRA 2VPIA 3PCRB 3PC4A 4Y30A 2W42A 4KXUA 2QXUA 3KFVA 2IGTA 1UJCA 1C0EA 4L16A 3AVYA 2A5YB 3LC1O 3IMKA 3P32A 4V02A 2VTBA 2BTQA 5JSFA 5F21A 1GN8A 4D9MA 5B30A 1G2OA 2NX2A 2ZDGA 4K9SA 1A7AA 1JAZA 4ZICA 1QX4A 1KH3A 1KMMA 3KOUA 3SY8A 2ZRAA 1C7RA 3NKVA 2G6BA 3KQVA 2X42A 4S2UA 2Y1LA 3S2ZA 5ARCA 3HN6A 4R4JA 4WIAA 3MWYW 1D4ZA 2H57A 3RC3A 5KQPA 3QY0A 3ZZ0A 2OUKA 1QRTA 4JHXA 1H93A 4LNAA 3WYAA 1A69A 2HQRA 2IYLD 4INZA 3GRCA 2H1CA 4JQYA 4LZLA 3GLIB 1ZD4A 4LVNA 1FFEA 1J7JA 2JRLA 1GQFA 2RGCA 4G5HA 4CUKA 4EPVA 3JQ8A 2X2PA 2BH2A 2REOA 2RONA 5EJ5A 2BEUB 3O92A 5C31A 1PD0A 4Q1FA 4KSCA 4ZOLB 4X84A 3B6MA 1PLKA 4NDZA 4ZANA 4CDRA 6REQB 2ZJ7A 1TUBA 1GGNA 1ZMBA 3BWDD 1QSGA 3H5VA 1NJ8A 4FSXA 4E12A 4YRGA 1LBHA 2IOFA 4BNIA 5LBIA 1O6CA 3IIEA 3AVTA 2DSNA 4PGMA 2FU5C 2X1MA 4YAFA 1T6NA 4M1QA 1W5TA 1P7ZA 3LYLA 4MVJM 4P54A 2R84A 1CX9B 3CNBA 2WV7A 1Q57A 1KSJA 4X3PA 1VYTA 3C6MA 3PJDA 4PVCA 4YJDA 4CIDA 5FBQB 3FCYA 4UVEA 3VZQA 4F45A 1TMKA 1TW3A 2X0IA 5EIXA 2JFWA 3P0HA 3GNLA 3PXUA 4WQMA 1T4MA 2BT4A 1QONA 5MFZA 1F8YA 1LVHA 1Z0ZA 4HADA 2Q3CA 1EUCA 2JEOA 3FHLA 3JATB 4U7TB 3SBOA 5BXQC 5CT6A 5B3JA 3K8QA 2PX0A 2OMEA 4JWKA 1M2OB 1VDMA 4ACAA 2EVWX 4AUKA 1MGPA 4G6ZA 4YJ2B 1ZLXA 2CDNA 4JI1B 1CJUC 4AO7A 4NXNB 1GFIA 3OLVA 2ENWA 2Q50A 3PUWA 4WY8A 3T5PA 4OHOA 4A8HA 1HDIA 4LYFA 5KYGA 4TS4A 2FN4A 2VDUE 1JLMA 1UOOA 1V41E 2QENA 3E9YA 3PUJA 4Y9SA 1L4MA 2M6SA 2Q2WA 3SKVA 3UAXA 4KMRA 4R6XA 3V34A 4DPMA 3G9UA 2QZ4A 4MVJF 2IIPA 1KO8A 2GBIA 2VYVD 3WNZA 1PL6A 4OKSA 4U4AA 2ZCVA 3PWZA 2CVHA 2FX2A 4JL8A 2HBYA 3OJOA 4QATA 1OYOA 3R0JA 2BFDA 4X95A 4LISA 3AETA 2Q1XA 3SE0A 3ZUGA 1XTJA 3FCCA 5CGQB 3IJEB 4J0EA 3UXEA 1GQRA 1RW4A 4EVSA 1E9VA 4FGSA 5AJWA 3SJZA 1KOJA 1C3OA 3H2SA 5FLYA 1TW2A 3AM5A 3O8LA 1C5KA 1H0KA 1P73A 2Z2JA 3K2EA 4G37A 1GTMA 4R9RA 4P4LA 3WRYC 4E07A 1EKXA 2RHGB 1NBME 3K8OE 3NG1A 4RKWA 3G2IA 3ZX4A 2O0LA 2Z0MA 4D9CA 2IFTA 2V96A 4ILKA 3UFXB 4DLXA 2DUMA 3SVTA 1GPMA 3RGWS 3JD3A 1Z28A 1BWPA 3GGOA 3M81A 4OB6A 3INRA 3LKBA 1T36B 1JH9A 2PSJA 1A4XA 3ZN2A 5EXPA 2OXFA 1VGVA 4CR8A 4HNRA 1CJVC 3ZWOA 1ISFA 5TIIA 4B3CA 2IBTA 3P9XA 2AYXA 1DQSA 2NAPA 2IY8A 2J3QA 2C8VA 1FSFA 2AB0A 1V26A 2Z57A 2ZJ2A 5AH0A 3CX3A 1QRDA 2PUVA 2QIOA 3F5FA 4YXWD 1IUKA 3QJYA 1CPYA 2DPYA 3MJVA 2NZJA 3K0AA 1EX6A 3CMCO 1CUSA 3EK2A 4FMBB 3PIRA 1RRFA 4E3ZA 1U0FA 5K6RA 1IPHA 1WVMA 1HSZA 3V32A 1KDPA 1DE0A 3LHFA 3DE7X 2CK3A 3M9XA 1O6GA 5K3FB 1XELA 3C3CA 1U65A 2V9CA 4Q7EA 4DR4B 1R9NA 2QP3A 1YGPA 3KUCA 4UULA 4MQFB 4PCVA 3BGWA 5A5DA 1ESDA 1H23A 1JR3D 1DU4A 4CQMD 5C4MA 3O8RA 5IBRA 3E7FA 5ESDA 3D8HA 5FOQA 3RAFC 3INTA 4OX9B 2WR8A 5TARA 4WI1A 3B3JA 4E2WA 4X92A 5KYXB 3LY9A 4J9UE 5T64A 5K20A 5CEJA 1I6WA 1PZNA 2JI4A 4R2HA 3G17A 3HJRA 5CIWA 2AG0A 1A9TA 4OHPA 5H1YA 1ZGGA 1XLWA 1J1ZA 2R85A 3IP6A 3IVGA 3L7AA 4MVJH 3B89A 3KNZA 1NJGA 3Q8WA 4G0PA 3WL6A 4C6TA 4DPKA 1FSPA 1N0UA 2Z9CA 4R9VA 5J2UF 1AUXA 1HF3A 1RT9A 3RVMA 5AR1A 5GM2A 3GNTA 3PI7A 2ZPUA 2FZGA 1F20A 4OY3A 2O8CA 4DMCA 3QWHA 2JIQA 1IOLA 3EIQA 2R87A 1DC5A 5F1KA 1CCWA 3U4IA 2XMQA 1XZJA 1PLLA 4NOKA 1ZC4A 3PYXA 3QWIA 1RWNA 2Q99A 4HVLA 5AUOB 3OM9A 2UZAA 3U80A 1NF3A 1FRFS 1JAYA 2AR7A 2Q5JA 2C5GA 3A28A 4L15A 3KRTA 4DLYA 1TM4E 4FWTA 4KK3A 1EXWA 1FTWA 3DXYA 5LQUA 4CHTA 4B3FX 2C3OA 2D1RA 2GBPA 4QFBA 2FFRA 3ZE2B 1U98A 4UNSA 1ZK4A 4EB6A 3DZDA 5THKA 3G2JA 5J2UB 4BWYA 2D2EA 1VG8A 3FSEA 3W5IA 3L49A 4DZZA 4RJTA 1R1DA 1U7ZA 2IEZA 2A6PA 2OCXA 3GP5A 3EZ7A 4OLBA 1YQDA 2HA6A 3GAFA 3ONVA 4YPFA 3ZI4A 4BEVA 3A6JA 2BCJQ 5LLTA 1OB2A 2I1LA 1BXKA 1TQ2A 4QTZA 1GUAA 2QVXX 4PBSA 3WKAA 1G4AE 4NJOA 7MDHA 4TYYA 3RJ5A 5E6RB 4HS9A 1OI7A 1QIJA 1ZRNA 2WA2A 3MILA 4B09A 4KITB 5KOIA 4WEQA 1GA4A 1JDBB 2OKGA 3ISTA 5B12A 3ER6A 3CNLA 3DMTA 3D4OA 3E2MA 3I42A 2H4HA 5HMLA 1NI5A 4AX8A 5C2JB 2R4TA 5HIAA 4BJ6A 3LNCA 2J45A 5LMCA 1KP2A 5ELXA 3W1VA 2E7ZA 4YGXB 2H8KA 1SM4A 4TL8A 3FCOA 1LDEA 4RDHA 4BMYA 2Y1OA 3V1MA 5KC8A 4RM3A 3V2UA 4EGSA 1OFHA 3OQ6A 4ZAWA 1D6SA 2EG5A 4OQNA 1YB1A 1UJ5A 2GHTA 2WD7A 1YAJA 5EUMA 2Q9UA 3ZTYA 1LI7A 3KXDA 1DKOA 4MRNA 3W3AH 3VC1A 5H7XA 4UAVA 3RJ9A 2P0AA 2BEKA 4N7BA 1EAYA 2QP9X 2R6JA 1WHTB 4ZYTA 4AZWA 3KUKA 2VEDA 1EDOA 2V74B 3KTOA 3OKAA 4LHZA 5C8YA 3DZIA 5FNVA 5FI3A 2W6ZA 1G98A 1K4YA 4LZAA 4IGAA 4G9EA 3GJ4A 4YMGA 1BS2A 4L9WA 5BOVA 4CF3A 1Y3CE 4CIWA 2X5KO 4GE0A 5DHFA 3UJBA 1CJCA 1U6JA 3MJSA 4WN3A 1RC0A 1P31A 1SH7A 1ULAA 1XTQA 2HF8A 3GRKA 4KXVA 4EMTA 3VTZA 2I8CA 4XQGA 1V95A 1NMZA 5I5GA 3ORRA 3RI3A 2V5VA 4HNSA 1M72A 2J9XB 2CZGA 3FX2A 3PEFA 4RTNA 5BRAA 2CFIA 3CEAA 3ORYA 4MCHA 5FIUA 2JGFA 4Z0TA 1BWRA 2GZ3A 1CNEA 2GPJA 2VK4A 4GP9A 2K6GA 4JLUA 1QVAA 1MX9A 3RIHA 1ULUA 4HFRA 3EFOB 1K7SN 3ORSA 4LRXA 4C3OB 2V6JA 2W90A 3L41A 4OL0A 4B6QA 2PLFA 3UO8B 2HIMA 4B81A 3GLIA 1R3UA 1AUVA 4MVJD 4N5MA 4WK4B 2XCIA 3FW1A 4WINA 2FWMX 3DAGA 3FLAA 1CRQA 1DAMA 3QNWA 3IT1A 2Q6OA 4RTKA 4LJ6A 5IJ9B 1QE3A 3FWPA 3GPCA 4FN5A 2BEUA 2Y27A 2XWSA 3G8YA 5DB4A 4I8DA 1O7JA 3KT0A 1EJ0A 3ND5A 3BCHA 4ZOLA 4ZT4A 4BYMA 2BP7B 1FFSA 4Q3OA 6REQA 5HJEA 4NKRA 2V45A 1LSOA 4XIGS 2GEKA 1PNOA 5A1TA 4BWFB 4GZ5A 4RTMA 1DKQA 2NV0A 1ODLA 1S9HA 4MPJA 1UWCA 4OHBA 4CMIB 1XZAA 4URYR 1F2VA 2P6PA 3R0VA 4TXMA 4XASA 3J80A 5BP7A 4QTTB 1UP4A 1F14A 4QJIA 4L8VA 3KUUA 4JA2A 5L51A 2GBCA 1X1CA 4FR5A 2V5UA 1RZVA 2XUDA 2GH1A 2W6JD 3B9PA 1F9EA 1V7ZA 3BQ9A 3A9UA 3K5PA 2ZTSA 1AKNA 1F1BA 2G70A 2QLLA 4QU5A 3IRVA 4FFDA 5EP1A 5TS2A 1BDJA 3HPQA 1AA9A 2CVOA 2SNIE 4EVIA 1M2OA 1Q7BA 3Q9SA 1GTSA 2V7WA 3S7TA 2PMDA 1N3IA 3GJ7A 2H06A 3A1WA 5AW4A 2C29D 3U6KA 4YJ2A 4IS2A 1QZ3A 1SBCA 2AW5A 2XNSA 2E4WA 1FS4A 3IAHA 5ADWA 3N8DA 4BJHB 2D8AA 3LXUX 3FVTA 4NVRA 1BJRE 1V8ZA 2PRKA 3MD9A 2IH5A 4QE3A 4BZQA 3NTXA 2Q6IA 3NWJA 1L5YA 4OHXA 3I53A 4JSRA 1ZJYA 4LBYA 4LMRA 3DE0X 1SUPA 4NESA 5TEVA 1YTUA 1OPRA 5EJIA 3ZDEA 1H8HD 2H3HA 2HHJA 5C32A 5K8UA 2BGWA 1FFHA 4G23A 4CM4B 3VUEA 4B6PA 3F67A 3A36A 2ZAMA 2C59A 3QJGA 4OQMA 4AG5A 1MO3A 4N5IX 4LSZA 3W3AD 1N6IA 3W6PA 1ZFNA 2WHYA 1YHZA 1L6IA 1FS6A 1SOWA 1TPYA 3HJCA 1BHO1 4P8RA 3TRDA 3VYWA 3HM9A 2V1UA 1COWA 1TA9A 2BFPA 1HDCA 3KJHA 3UFXA 1DCKA 1V96A 1TFRA 4ER3A 1PX2A 3OQOA 1YFJA 3DDZX 2C2BA 4P3YA 2CDRA 1ZMTA 2OP0A 4UHCA 1C30B 1T36A 5DTMA 2BBTA 2G63A 1U9IA 2UKDA 2VSYA 4DSAA 3CCBA 4NONA 3S2IA 3SSOA 4W8GA 3G2MA 1U2ZA 3G0GA 4I4NA 3KD3A 4M9ZA 3FHCB 2H2FA 1XEWX 4GEKA 4RACA 5FDFA 3PNSA 1E2GA 4PX2A 4JITA 4PSDA 4ILEA 1NYQA 3MNFA 5GQSA 4N0MA 4H15A 1IHOA 1QGDA 2YUTA 3BVPA 3PUHA 4I6EA 2O7QA 1NAHA 3EA0A 2QMUA 2J4DA 4IH1A 2X3UA 2FZEA 4L78A 2H1WA 4RETA 3T3DA 1NW7A 5K3FA 2ROQA 5CW2A 1PWZA 2B82A 3AX6A 5HQJA 5HW0A 4ZT3A 5LM3A 3VKVA 1J0AA 4UPDA 5FPKA 3J7AC 2OBBA 1TGVA 3BSSA 3JARB 1NVWQ 1RHMA 2PVPA 2EIXA 2XBLA 3QLTA 2DF8A 2R7AA 3I3OA 5FOTA 5IC5A 3V2GA 1QR6A 5T3YA 4TLDA 2YY7A 3WRVA 5KYXA 3WAJA 3H1BA 4W4TA 4AI6A 4RUKA 4JD5A 4W8HA 3FYDA 5HR5A 4A26A 4GD3Q 1NN3A 1CUHA 4HWKA 2FZLA 3U3JA 3PRJA 1SQGA 3RS8A 1AKMA 1G42A 1G2QA 3FTDA 4P34A 4UQOA 1P7YA 1ZIOA 2ZKLA 4V0LA 1ZYUA 5JR3A 3EY9A 3S99A 3WSWA 3K5WA 5JASA 3OTHA 3HE3A 1WU7A 5I9BA 1F0KA 2O52A 4JJEA 4EG6A 1ZH2A 1NQWA 1CP3A 3B2EA 4LDAA 1G21B 1I2AA 2C4NA 1RZUA 2QR5A 3E1SA 1KO5A 1NW4A 3DBHA 3Q9UA 3RC2A 3M4YA 5LLDA 2XWBF 2WU1A 3AJRA 4HC4A 4QD3A 5TSDA 3ZOKA 4FYVA 1LTHR 1NXVA 2P69A 2NSHA 4B35A 4YRNA 2DWOA 4FOOA 3QEAZ 1O4WA 3KL2A 3OZDA 2WY2D 4RULA 2PKYX 2QMZA 1EM6A 1I5RA 1NE2A 1O08A 1P9RA 2VWHA 4J9VA 5F76A 3E8XA 4OG2A 4YAIA 5M7EA 4UM8B 3CG4A 5AHKA 3DZBA 4I9HA 5FBRB 5JS6A 5J2UA 2Z08A 3PUYA 2F8LA 4CIAA 2H2GA 3NW9A 3BZWA 1I0LA 5K0CA 1E2LA 3UGTA 2Q1TA 2OV8A 4LJAA 2QSZA 5IWCA 3HFRA 1CJBA 3EG9B 3ZLVA 1ZOLA 1J0EA 4RPLA 5E6RA 4Q6WA 5C5EA 4ABTA 4WJKB 1PNRA 5JY6A 3LECA 3CT6A 2R9VA 5E9AA 1LY1A 1LRLA 2PMKA 2GTHA 3GLQA 2ZB7A 3YASA 5L8VA 3WGHA 2GBFA 4WOJA 3VO9A 1Q0TA 2J08A 2UV8A 1ZOIA 2IUSA 3QKSA 2DXIA 5TR9A 3W5VA 1ST2A 2I4IA 4HEJA 4WSOA 4E03A 5K0GA 2O8EB 5KO2A 4KIWA 5DLYA 4RK7A 2HA4A 1JBQA 3BGSA 3JQBA 4OQLA 3AQIA 3FZQA 5EXXA 4WFJA 5IW8A 3A14A 3Q3HA 1ECJA 1RWWA 1FLNA 3O1JC 3GDWA 4F93B 2GT1A 3IT3A 4TSKA 3WZ2A 3BKWA 1ZW1A 4BRUA 2X0NA 3IIKA 4F3KA 1EVQA 3R8FA 3RQSA 2HDOA 1M1NB 1WHTA 1HO3A 1NHWA 1Q95A 3EZNA 4XEHA 4BNDB 3CF2A 3LVRE 4MUYA 2QAJA 3SJUA 3STYA 1DBQA 3QEKA 3F4LA 3DLPX 1R5JA 1KJWA 3HHPA 1FDVA 3N5KA 3AH8A 5DNWA 3FMFA 1HE5A 4HXEB 4G0VA 2GERA 4X71A 4AFNA 4ANFA 5J4LA 3G0HA 5CX4A 2AFIE 1PJ8A 5H68A 4L72A 4RKFA 1QMGA 1EWQA 2PEYA 2W4QA 4OB8A 1KFEB 1OGYA 2PUEA 4ZO6A 3KKQA 4EATA 2O5CA 2ZAGA 2O07A 1A5AB 4XDYA 2DLDA 1N2SA 4X6XA 1PQWA 2AHOA 3CXUA 4U3JB 5CCEA 2VBIA 2I76A 2VUTA 4P0PB 1E3QA 3WQSB 4TQAA 5KAMA 2J3IA 3OIGA 3WO0A 2I99A 3W7VA 3EFOA 3MJFA 4R2KA 2ON6A 4BB5A 1WMEA 3BEDA 1U11A 1TCVA 1T4CB 2I80A 2WW8A 3PUKA 3KS9A 5SZIA 1KAGA 4BZZA 1RRPA 3K9WA 3SDBA 3ZQJA 4BGEA 3GRAA 1VXRA 4EY8A 4LFAB 1M7HA 3EQ7A 5IJ9A 4TLAA 3B8EA 5FEUA 1NR1A 1Z6AA 2GYUA 2EV9A 3WI7A 4HMOA 2BP7A 1E6CA 1NMXA 1VCHA 3K9NA 3QBTA 3SOPA 1RQLA 2IOYA 4C0AC 1E1YA 4F9GA 1EGHA 1TJNA 1GG5A 2YHAA 2HYDA 2ZRCA 5D01A 4QQFA 3OC6A 2BLNA 1EFHA 2JEZA 2L0XA 5JRDS 1EM8B 2GF9A 1XU4A 4CMIA 5EC8A 1JTVA 1DAGA 1J8YF 2NYUA 3GEBA 4YJ3B 5T6MA 4ALMA 2IDJA 2O2HA 1W2GA 1WETA 3QPUA 1O95A 3P96A 2I91A 1YZHA 3IAXA 4PFQA 1UAYA 2IYSA 3D8RA 3UT6A 2WTEA 1NDQA 2P4EA 3TD6A 4R2MA 4DG5A 1ZM2A 2DHRA 1VLZA 3CH7A 4LHVA 5F77A 3MMSA 1J22A 3LPDA 4II7A 4GAEA 3V9AA 4P7KA 1OIXA 3TE7A 1HMYA 2Q27A 2F8SA 1BNCA 4U2EA 4I9NA 4IEIA 5JTTA 3AF0A 3CLTC 3SC6A 1YZ3A 3AG6A 1PVOA 2MINB 1SXJD 3R0XA 1G41A 2QK4A 1DHRA 1QFSA 2PG3A 3AINA 3D7LA 3LQ1A 4B48A 5B6IA 1CT9A 1L5LA 4BN4A 3U4QB 1ML4A 1TM1E 4JX8A 2Z5GA 2OLJA 4I9UA 4RV5A 2VIIA 4BNHA 4N3NA 3RUFA 3OJCA 2G04A 4U9HS 4D3YA 2J3EA 2FRDA 1CUUA 2JGLA 3GXOA 1WTAA 4RKEA 4UMFA 4CM4A 2JRCA 5LCXA 4X64B 5TMPA 1QLJA 3QPDA 5FPHA 3KLBA 4DMHA 4XM0A 4N3AA 4CQJA 1AH2A 2ZJOA 4FHFA 3U81A 4O3MA 4LYGA 1RYZA 1NE7A 4TMFA 4C22A 3H8VA 5IKXA 4LF9B 1B7GO 2QB5A 3FYSA 4XCQA 2AFHE 3T4EA 1T3GA 4CZ2A 3ONDA 4FHZA 1YBHA 4RLHA 4KK4A 1T3LA 4RSHA 3ZHTA 5C5CA 2W2VA 2HQ1A 1C30A 4QOFA 2R25B 4LXXA 5CX1B 3WV5A 2GO7A 1CB7A 1WMAA 2O2ZA 1J20A 2BHNA 3W2GA 4I1OA 2XMDA 3C1AA 3B70A 1JG4A 2GKOA 4RZSA 5GV8A 1RFLA 3VAYA 4F4CA 5JNUA 3IAFA 1JLHA 2MWMA 3K96A 5ALXA 4ZJPA 5EIBD 1NBAA 4MV3A 4IEFB 1IHUA 4ZZ3A 3BFXA 4GPZA 2QUBA 1JS1X 1YQGA 2D1FA 3PPXA 4KX3A 4KXMA 5DHTA 5HEKA 3FNFA 5I48A 1L4NA 2R8ZA 2JFUA 4NYIR 4WRRA 1FP1D 1WF6A 2EKLA 3LX6A 3VHQA 1QGAA 4EHFA 4C0XA 2HGSA 5TS3A 4F2WA 2BBWA 1BDIA 4LWQA 4IWXA 4FLEA 1Z5ZA 4EB3A 3Q15C 1YKFA 3BIOA 3IE2A 2XH8A 2M2IA 4CWAA 1WLSA 4JLMA 1YJCA 4D81A 5CXUA 4B3XA 1IJKA 2Q7XA 1QE0A 3OEHA 3JARA 1K6EA 3SHQA 4QICA 3R7WB 5FCDA 3V7UA 4C0HA 2DEUA 2QG9A 1E4EB 4C7JA 1YDGA 3BGIA 4KV9A 3A4IA 4RVUA 2BC9A 3BTSA 1XCPA 3I01M 3NM5A 4Z9BA 1ZD9A 3AM3A 1A9SA 3DO8A 4UMEA 4MV0A 3TFQA 8OHMA 1WJGA 3S70A 1SXGA 1NXWA 1PGPA 2D00A 3VR6D 3VZDA 3PKZA 3ZCUA 5B1EA 3CLUC 3RVBA 2C5BA 5G1PA 1D09A 3HLKA 4TWIA 4DCPA 4XDZA 4OHFA 2DQ4A 3B1JA 4XH9B 5A2QA 1W581 2HFJA 4L08A 2X7HA 3M3HA 4YAWA 3U26A 3L0OA 3NHSA 4I36A 1R4ZA 2AIRA 2AOWA 1XU9A 2QQFA 3DFMA 4UATA 2H4WA 3VO8A 1P3JA 4RHTA 2M1XA 2WZBA 1XFDA 1AZWA 1N5DA 1CFZA 1L7VC 3DDOA 1FRVA 2ZRJA 2D2FA 1S3GA 2CHUA 3HGMA 1LNSA 4RS3A 1UIRA 2CL0X 2VK2A 3KKKA 3RRYA 4AO6A 3W8RA 3IAAA 4E88A 2Z95A 4KOAA 3AY0A 1NFRA 3OCXA 3FYUA 5IT9A 1ORWA 1TVEA 5FTLA 2REBA 2AN9A 1PUIA 3UYKA 2M98A 1TUGA 3V4OA 2ZE6A 4DPLA 5AJZA 3T0GA 1HE4A 3I37X 5E0OA 3RRMA 2E4ZA 1H5UA 2IZ5A 1H9BA 1IG3A 1MAWA 1T9ZA 2FY8A 1B8VA 3R8XA 4C14A 4OATA 1Q77A 2ZXUA 3ZV6A 4ARBA 1F12A 2CGEA 2RHJA 4RC9A 2IXDA 3EGEA 3ROPA 3ZIAD 4DHEA 4I4IA 3AHJA 5EE0A 3UJHA 3PVZA 3DUFA 3BL5A 2A9JA 3FCXA 2Y6UA 3WXBA 3M6AA 4IDCA 4RTRA 2H1SA 2X9QA 4NH4A 1P1FA 1JA0A 3EG9A 4IKEA 2P65A 3H2BA 2XZOA 1GZVA 5I7FA 4YCDA 3GLSA 2BFEB 2W11A 2WEKA 4NSNA 1Z82A 3MLBA 4JEHA 1J7KA 1O77A 5IANA 1TA4A 3SIRA 2JFOA 4J1NA 3ZGZA 3GCGA 4QGAA 2O8EA 3QYFA 1VP3A 3QJ5A 4PIVA 4DNFA 2DLCX 4FS8A 2CXSA 2C4MA 2FFAA 2R2AA 2Y0BA 3PFBA 4FFSA 2W2OA 4WDRA 4ND7A 5K6AA 1QH9A 2NPFA 1JAXA 3EA4A 2X86A 1ZUIA 2K7ZA 4G56A 4O8CA 2ZREA 3SQMA 3K6SB 2IS2A 1HYQA 4GLFA 1FFWA 1S2MA 1E5DA 5F9MA 3PA8A 3MA0A 3ZXIA 3G2KA 3D5QA 4TOIA 4MP8A 2I4RA 3NGXA 5SICE 5KYYB 3GMTA 1N9ZA 1M1NA 3OZVA 4BNDA 4UM9B 1KAEA 3DFKA 2DFDA 1SHJA 1OPXA 1LLCA 1T2NA 2Y0CA 4GQIA 4QT0A 4UEJA 3SVLA 1E7YA 1DAEA 3A37A 2ZDHA 2Y71A 1PFGA 3PFGA 1NLZA 5DK4A 3FUWA 1NAIA 2I6FA 1KEKA 1ODKA 4LXTA 2FQXA 1R6UA 5JI2E 3H9GA 5IF9A 2JD1A 3GHHA 2PRYA 4NR0A 4YAGA 2SKDA 2H8GA 4YUYA 1SVWA 4EGQA 3C16C 4G9GA 1AVTA 4DV2B 2WVAA 1MC4A 1NZJA 2ATIA 4U3JA 4UHKA 2NO4A 4MI1A 4KREA 2PRIA 1RIIA 2M6KA 4A10A 4Q9NA 1Z63A 5JS7A 3ZEIA 3VOAA 1W93A 3K72B 3UTCA 1N34B 1G8YA 5D3QA 4EJ2A 4OH1A 3LM8A 3EVZA 3QHQA 5LVAA 1VE1A 3HCRA 3CZRA 3HN7A 1JXOA 3QUAA 3F4KA 1IHXA 3STVA 4B87A 5IJAA 3RVRA 3WRWA 1PZXA 2C94A 1T4CA 2BOVA 3MTIA 4M22A 5B3JC 1ORRA 4IIUA 4PZDA 3C39A 3PX7A 2BM0A 1KE2A 1SWWA 3FTQA 4WY2A 4E4RA 1SHUX 2OOSA 1UMDB 3F7OA 3GFPA 2YJ4A 2JL1A 4KO8A 4D8VA 4DLKA 2G1JA 1OUMA 4MPDA 5E1DA 3H1AA 5HDQA 2P9EA 2YFKA 5CR9A 3LVFO 3GA5A 4M9UA 1A77A 3PNKA 3R9KA 3I9KA 4F4UA 4FHDA 1FDSA 3OTGA 1E2PA 2IDKA 1KGDA 4FEYA 4IX9A 2KMLA 1JI0A 1RQ7A 2YL2A 1ESMA 3A6EA 1EM8A 4L50A 3T7JA 4GQBA 3C98A 3E6AA 3KZXA 1NMYA 4YJ3A 5FR2A 1N9GB 2JFBA 1VL1A 4MQLA 2B83A 4O1IA 2VT3A 4HDRA 4X44A 2FDXA 1DFGA 2QL6A 3MRTA 4JQOA 3U62A 3JAKB 2VDNB 3QKIA 2CMGA 1ZU4A 3NC4A 2X2EA 2YMPA 4RDCA 3EPLA 4II3A 4Z9XA 2HDWA 3BM5A 1I7DA 1FW6A 2OOKA 1FNCA 1OWNA 3WWZA 5COBA 3DC7A 2VP9A 1E0KA 1MOZA 2A57A 3MPOA 3N8KA 1BE6A 1M2NA 2IP4A 1RC8A 1QCCA 4FHGA 1JH8A 2I4NA 1S2IA 1T3HA 1VSTA 3AY7A 3PNMA 2X1VA 3AJDA 2AMYA 2IBMA 5GONF 1PL0A 3OLZA 2MINA 2WSYB 4XAQA 3UUGA 2K7FA 1CQPA 2H3EA 2J3MA 2QZ9A 1DIHA 1Q11A 1KI2A 5FOUA 4ZJUA 3U4QA 4B3TB 1IIBA 1Y1SA 2VHYA 2C4KA 2XYPA 4W1SA 3SEFA 4LW8A 2FLKA 3R24A 1DIRA 1U0EA 3PFNA 3V8VA 3E58A 4YECA 2VBFA 3E03A 2P91A 3R6WA 2I78A 3PC6A 1RLIA 4V2IA 3PD1A 4AJHA 1Q7RA 1T5SA 1CVLA 1GQQA 4L0DA 5BQFA 1WABA 3DOIA 5HCNA 1RWQA 1TU4A 4FDUA 4J3FA 3EOBI 1DSSG 2LVBA 2B5VA 3F90A 4MRPA 4AUMA 1MVOA 2IDZA 1P45A 3CUTA 3BF8A 4JUBA 4MGKR 1JQDA 4LKOA 2GK6A 3A2NA 4Q5IA 5KOHB 4INPA 4MTLA 2AZDA 1KMHB 2DZDA 4FGUA 2GM9A 4BKOA 3DE4X 4RTQA 4PCAA 4WHMA 4G0NA 2O3UA 4RE5A 4WXRA 5CX1A 2BFCB 3NBZC 1JPNA 1L9XA 5KINB 4TV8F 1OOEA 3UJAA 5IN4A 2IX3A 3SNKA 1FTYA 1W75A 4KMSA 1QOQB 3JASB 3JD1A 3X1WA 3FPLA 3LHSA 5F2OA 1Y6ZA 3ZDQA 3WYCA 5D6NA 2I4MA 4BQPA 3ITNA 1UODA 2DERA 3AEKB 3HR4A 3LYAA 4IM7A 4AUNA 1W29A 4MWEA 4M38A 4EJFA 1LI5A 3ID6C 5EESA 2ZR7A 1O03A 5IUNC 3GVXA 2I6TA 1VKHA 1AKEA 5EJAA 3ZCPA 1NTOA 2GESA 3O2SB 4HQLA 2LNDA 3ZWXA 1L1FA 4J0JA 4KO3S 5BYAA 1V5FA 4B76A 3V48A 3GEDA 2BISA 1XZIA 1Z5UA 1YRBA 3PUVA 2ZRQA 3CU5A 4KJZA 2C1EA 5DXAA 2I55A 4TV8B 3R7WA 2C04A 2OHOA 3D4NA 3DMHA 2R6HA 1E4EA 3IT2A 3LKZA 1JE0A 4JR2A 4KSYA 1XLTA 4MUMA 4R68A 2N1BA 1RRVA 2XNHA 4WK2B 3HDTA 4PC1A 1X9HA 1NRWA 3NHZA 3SZLA 3H2ZA 2PUBA 1D7OA 2YMQA 2G1KA 5CMLA 1QHGA 3A1SA 3AEUB 3PXCX 5EMKA 1VP9A 4V3BA 4EA6A 1MRNA 5IAEA 3BGDA 3NHKA 3LUHA 3M89A 2AF4C 4DLPA 3QVXA 1MR3F 2QT1A 1TAUA 1KORA 4INAA 4KUEA 5AJVB 3DMFA 1B0AA 1SUWA 2HUNA 4KZPA 1J0DA 2VSXA 2RJOA 3EZLA 4NAVA 4RZXA 4YUWA 4CG2A 3ZZ1A 4E2XA 1DPFA 1WWKA 3NLLA 3A9TA 3D7SA 2I03A 4JXJA 2WPDA 3G8DA 3K0CA 4PE5B 2AXEA 3S2SA 3SQLA 1N25A 4R2LA 1CS0B 2B78A 3ETHA 2PH3A 3AP1A 4A91A 2IYRA 1VE5A 4XFDA 4ZOBA 1U8FO 2RHLA 1U63A 1E4YA 1Q0RA 4L8WB 3COZA 4DJAA 1T8WA 3A6HA 1UBLS 1Z9BA 2EBWA 1JHZA 2VUHB 3NWOA 3VVBA 2PA3A 3G9XA 3ND6A 3SPXA 1KA9H 1U6KA 1G8SA 2FMIA 5LB4A 4AKTA 5KJCA 2O7NA 5TGDA 3I8XA 4Q4AB 2A5FA 3BXZA 3SC2B 2X9GA 3UHAA 3ZCVA 5LOVF 1CEEA 1WUKS 3PXAA 2B0JA 1YL6A 3W2HA 1FJ2A 1BC5A 3F47A 3GGSA 4JLSA 5DJ5A 2QGFA 3EGVA 1RYFA 4DLUA 4OQPA 4KXQA 5DGTA 5ICEA 3O90A 1ZEMA 3VR1A 4BZWA 5JDIA 1U2GA 2HL6A 2NSLA 1DO8A 5BQ3A 5A62A 1GAJA 3H9BA 4RF4A 2NZVG 4CT4B 1YBMA 3E7WA 2P35A 2VQFB 2BFEA 3FVQA 2VWPA 2C8KA 3RVQA 4FK8A 1PTJC 3WV4A 1YS4A 4I4TF 1QQTA 1LC0A 4Q7LA 4BHTA 3WFIA 1Z2PX 5LOVB 2QKYA 2L19A 2XKJE 2DC1A 2JCSA 4G1FA 4P93A 1ZXLA 5EE9A 1BXZA 1WCYA 2HSZA 5KQSA 2II6A 3NIBA 4OQZA 4KVFA 2JLSA 5AP9A 5WRFA 3GLHB 3PL5A 1GPDG 1MIOA 1Q5PA 3DL0A 2P2CA 5CFOA 3GEMA 1C29B 2EX0A 3H8JA 1P81A 2FPSA 4JIMA 1H0HA 2WAAA 5KYYA 4X62B 2VC2B 5G0WA 1T9HA 4GIBA 1E20A 4R1UA 1JHPA 3TN7A 4Z9YA 1FMLA 2AG5A 1P0MA 2R6ZA 5EP4A 2PXHA 3F8TA 4QYTA 1FLDA 2VP4A 3AM4A 4YIKA 3I45A 1OHHD 2JZNA 4FZRA 4PG7A 5JBNA 1ULBA 4I4TB 5DPMA 5FLEX 1OAKA 1VIYA 2FP3A 2JKYA 1QFZA 1NR7A 3WYDA 2ZYVX 4ZAGA 1PJTA 5JISA 4Y9TA 4Q4LA 4N49A 3DFZA 1JEJA 2XPCA 5BN5B 2AEEA 1H0SA 4RTSA 2ZSAA 2YZNA 4F4IA 5DHPA 4QL3A 3RSOA 2B21A 2FEKA 3SC4A 1I4OA 4QZVA 4Z2AA 3NBXX 4JBXA 4JP8A 1C3EA 1IZYA 4AMVA 1AQJA 3EUWA 1DQPA 1IHDA 4I1YA 4LHWA 4UBKA 4DA0A 1DB3A 3DCJA 1AQ6A 1U7DA 1UR5A 3FOAA 4O2BF 5IM5A 4DSNA 1KRXA 2O57A 5FEMA 4PSAA 3AI7A 2G4LA 3OZBA 3QG1A 2G5GX 4J94A 2RBEA 5D7NA 1VHDA 5LQRA 3I5MA 1PQYA 2JCVA 4TVSA 5AK0A 4U6QA 3H5OA 5IVDA 3W05A 4KR6A 1UMDA 1SD2A 3D1JA 2CD7A 1U1IA 2BF4A 2ZYAA 3OUUA 4FBLA 1V9LA 5TC4A 1DWUA 2GHIA 1DEAA 3O8DA 1ID1A 1J8FA 2ZYWX 2WFZA 1L4LA 3CWZA 4M2LA 1FRZA 4NCJA 4CE6A 1XN1A 5DHQA 4YRBA 4ZYUA 2WIAA 1RHKA 5BSEA 3O4GA 1SCNE 3OTWA 1NYTA 1XF1A 3DCYA 1XDWA 2NXJA 5KDDA 2EYQA 1MDBA 4WDQA 3V1LA 1S96A 2WUDA 3HYCA 2RJ3A 5JG7A 1SZDA 4A2WA 3ZE8A 4YCAA 3T5CA 2WZCA 2O14A 3NONA 2QSYA 2UVQA 2E5WA 3JAKA 3V55A 3LF2A 3BF7A 2NZXA 3U7EB 3DT8A 3ZQ6A 4FZVA 4XA8A 2R2GA 3KQOA 2OPHA 2L18A 3VH1A 4B3BA 5FHRA 1YO6A 3NOXA 4GNRA 1H94A 2YJZA 1RLMA 4QOSA 4XUCA 4K81B 2BMWA 1M0SA 2XXBA 3AYXB 1YI0A 2COEA 2WSBA 3S81A 3R9XB 1O9HA 1C8KA 5TJHA 1WA5A 1R16A 5K0LA 1EFKA 4B5KA 5AOCA 1ACMA 1SCQA 4OXNA 1Q15A 3TIIA 4A2CA 4E1BA 3TKYA 4OQ4A 5LBUA 1F1JA 3SK0A 1XZ8A 1ZSNA 1NNEA 2Z6VA 2WAYA 4ZCQA 2GPNA 2J5XA 3MTGA 2B0CA 1EEXB 3RO7A 4RLSA 3ECAA 3OEYA 2QIPA 5ETJA 1RWKA 3FPEA 1HQDA 1QCYA 2FEPA 5CT5A 1Y3FE 1T6ZA 2GHQA 3U61B 1O1YA 3E35A 4L51A 2Z83A 5L6MB 3NM6B 4TMVA 5CH8A 4OHZA 2HN9A 4G3XA 3TAUA 2HDHA 1PR4A 4C9BA 3OCJA 1ZNYA 4NIMA 1ZUNB 2HWYA 1G8GA 4FI3F 3F49S 3JQFA 4GX0A 4RPKA 5FHQA 4BO6A 2OK8A 3ROEA 1ZM4A 1I7NA 3ETJA 1OH6A 1W36C 1UJ4A 3AJ8A 2B61A 3ESYA 2CJPA 4ZO7A 5TE9A 2OAP1 3M3DA 3ZWBA 5CFPA 5KOHA 5EJ9A 1Y37A 1KMHA 3DZ8A 3LWNA 4I9FA 1QGYA 2GGSA 1LGYA 2VAVA 3QA3E 4J7UA 3VUFA 4UAUA 4WL0A 1B3RA 3MG9A 5DGXA 4F92B 2XNDA 2BFCA 3W77A 3VR5H 1QYWA 2IW1A 3ZD8A 3WHLA 5BOSB 1KAHA 2ZR0A 1MEEA 3QHAA 2VJDA 2NZYA 3JASA 3RU9A 4ZCPA 3EMVA 3GEHA 5E2BA 4PZLA 1KJQA 1QIMA 1V5WA 2E55A 2KW5A 1GWNA 5HG0A 3VJLA 3HNOA 3AEKA 5LUAA 2P5UA 3VOSA 2PWAA 3WZMA 3W4IA 2DSTA 3AFNA 5ED0A 3WIDA 4AMYA 1JV2B 1RWVA 4K6CA 3RBZA 3GVCA 4DQXA 1XVUA 5BSRA 2RAPA 1GA6A 3U7QB 3WLJA 1ZKDA 2FSSA 4X00A 4JBLA 2ECOA 5KCMA 3RIMA 1OAOC 3E0QA 4CFZA 3ZIUA 5DLPA 4IFBA 1KDOA 4WFKA 1T2EA 4UOEA 4RD3A 3VR4H 2ACKA 1Y4AE 4HWSA 3QWAA 1NASA 4IGIA 1QYRA 2QRJA 4BLWA 4ZI2A 2J48A 4MO9A 2XRZA 3TKLA 3NAQA 3AVOA 4OYLA 1OU4A 4ZK2A 4JS0A 3AEUA 1J90A 3LAWA 4EY6A 1NVDA 2AL7A 1T1GA 2K2QB 4JR1A 4S35A 5AQEA 3QF7A 1NQXA 4QTYA 4ZYWA 3AR5A 2R86A 3PG5A 3WMRA 3U16A 2OHHA 1VPWA 3NOVA 2R3SA 4O33A 2ENUA 4B8ZA 4LZPA 1JTFA 1XPRA 3AUXA 3QBJA 4MX8A 4M1SA 3TDNA 3J81k 4L5AA 1U8AA 5EKXA 4FFRA 3EZ2A 4FDLA 1E79A 1CS0A 4N7RA 3FUCA 2D5IA 2PTHA 4DLBA 4REQB 4AYXA 1CIVA 3I62A 1U9JA 2Q45A 1RHQA 1R9JA 3AKYA 4PC2A 4PLHA 4A82A 3TTTA 2I62A 4QYWA 1X1BA 2HLNA 4YUAA 5CB4B 5H59A 1GM5A 2EATA 4PIMA 4WFIA 4TM7A 4XYMA 4BX3A 3D6FA 3CPSA 3SBDA 4O0MA 1X86B 4YCCA 1WW8A 4EPTA 1ZD3A 5AVZA 1TTTA 5A6SB 1O5OA 1GKIA 4Q4AA 3SC2A 3CJQA 2WIGA 2VH5R 3GQVA 4HX5A 4LTMA 3MWEB 3PCTA 4X1IB 2CLKB 1UBGA 1ULZA 1TCUA 2ETVA 4OAOA 1SIWA 3ZZTA 4UBNA 4XIJA 3UB4A 2GEFA 5IXJA 1MNQA 1ESEA 3FOZA 2ZYDA 2W83A 3HJFA 4D6YA 4FMDF 5CT4A 4XZ3A 3HA3A 4MQ4A 2OCKA 1SCDA 4HP8A 1RBQA 1PGQA 3G3EA 1IWBB 3VYSB 1X7ZB 2XCUA 5HYVA 2NO1A 2VHCA 5FBHA 5I4CA 1WZEA 5EIOA 1Z5GA 1Z45A 4GOMD 3HY4A 5EYPB 1L5MA 5ALOA 5KVCA 1XVLA 3TCXB 2FZKA 3QENA 3OQNA 4NZPA 2HRDA 3OLWA 1OX4B 4IV8A 1GUYA 3TXXA 3NTVA 4K9OA 1FMJA 1LS6A 1Q19A 1XCGB 3O8QB 4OX9Y 5LOVA 4OYRA 1WDLA 2EWVA 4I3GA 5H0IA 1YE8A 2HU8A 3ZZMA 3EJ6A 3VOBA 1E8MA 2YVKA 4XFJA 2WJYA 4G5YA 1BGVA 5A1JA 1NL3A 2B7CA 4FMDB 2QRGA 3HXTA 4M86A 2A88A 3BWVA 4XJTA 3I4CA 1ORVA 4C7MA 3QFHA 4L9AA 4QBIA 4GW3A 3P0EA 2AN4A 3PNYA 4MUXA 4NL4H 4ENPA 2HC9A 2C2ZA 3GLGE 1P4RA 2BBSA 4A8PA 1N77A 3N2NA 4YWJA 4EENA 5HBRA 5ALRA 1TM3E 2MYTA 4PBRA 3IOCA 2ORED 4KQKA 5I9NA 4DS3A 3UHOA 2XUAA 3GIWA 3OZXA 1JSXA 4I4TA 1B42A 5D85A 1G5IA 5AO9A 9MHTA 3UJ9A 4XSGA 4QJBA 1DAOA 1IXKA 5LP6C 3LXXA 2PMEA 1UPAA 3RS7A 5LDDC 5F9FA 1BJKA 1TB4A 5BN5A 2JGRA 1EHIA 4KFSA 4WZAB 1CUAA 3RF6A 1R8QA 3VR4D 1JSRA 3ZVKA 3BCRA 2PVSA 1DTWB 1SZCA 5FFNA 4A0FA 1YH3A 1M8JA 5AK4A 2X4LA 2R1TB 2D3TA 3DTNA 4FONA 2BPOA 3B7WA 3A11A 4UE3S 2X4IA 3ILSA 4LMAA 1A96A 4AMBA 3ZGLA 2MSNA 5JYBA 4MTCA 1TU0A 4CV0A 4MW1A 3AW8A 4X8OA 3ZWKA 1D9XA 1BVHA 3QGMA 4H7JA 1ONSA 4R54A 1MVLA 4Z0PA 4RKQA 2OZKA 1I33A 1CY0A 4X6YA 2XDQB 4EUHA 1DJOA 4ND8A 1R4AA 2R79A 4JYBA 4RD4A 3IMCA 2ZRMA 5DWQA 5FB3A 1XG5A 2QZPA 3WGNA 3L7KA 2HXGA 1PUXA 2ZJ4A 1W7AA 1VBFA 1TK3A 2TMGA 3UVEA 4QLAA 4ND3A 1OWMA 3NWBA 5HILA 1VM6A 2Q5EA 4HAOA 1ZNXA 5DI3B 5TRTA 4Z49A 2CKMA 2NNLD 1M2JA 3U7RA 4KFCA 3HYRA 5CH5A 4KNWA 3IOEA 5BQOA 3ZH2A 3T7TA 3GYGA 4U7DA 1Q44A 1HL7A 1G64A 1E3TA 1NY5A 2WMDA 5KSPA 5UKDA 3K94A 1X3LA 1HNWB 1VL8A 3MWFA 2Q6VA 2WBLC 4D9JA 1UBEA 2RDMA 3R44A 1I32A 3R7BA 1KEEB 4MV9A 4UXJA 4KQ2A 2VQEB 3K2IA 4QNMA 4F4FA 5EWMB 3UT5B 3FNIA 3VR5A 3GLFE 3LT4A 2D0DA 1K5PA 3K9QO 1X1RA 4F8YA 2RH4A 2CHGA 3R9XA 2UYGA 1UF9A 1NZFA 3BQNB 3I6MA 3PLRA 9GPBA 1QP0A 1H5NA 3KYIB 4U2FA 2VCHA 2D7CA 4Z7NB 3D7NA 4NFLA 1TZ2A 4QO7A 2FK8A 2HV8A 2DKOA 2WOOA 4UM9D 3DDNA 1VLQA 1N78A 3AUSA 5CA1B 1OLXA 2CF5A 2Z3ZA 1PQUA 1ULSA 3NATA 4UHBA 3CLSD 1Y8CA 4P82A 1I14A 1B1AA 3K1ZA 2ZBRA 4LUCA 5JCXA 4NCAA 1U94A 1RLJA 1OTXA 2H2IA 3M8KA 4LOKA 2OSVA 4Z2YA 5SY6A 1R6DA 4YT2A 3KU4A 4BEJA 2OVFA 1ZUNA 2JVJA 3TLYA 1V71A 1GGVA 3UWSA 1NU8A 4HLUC 4QULA 3D59A 3DD5A 4ZRDA 4K46A 1C9KA 5HVNA 1VSBA 1OVMA 1VLMA 4LE1A 3E82A 3AXTA 1PAUA 4B2PA 5E3HA 4EF6A 5A4FS 4HFJA 2OO5A 3SHWA 4MWZA 2P1ZA 4GI2A 4DYVA 3NU1A 1PT5A 4QDOA 3DXZA 1KI3A 4MK4A 1NI3A 3GC6A 1VC2A 4WXHA 4RBNA 3W9SA 4B74A 5IU6A 1NOJA 3IE0A 3R7FA 1BS1A 3WMGA 1ISPA 2CXHA 2E4UA 5KQMA 2DFVA 1AK1A 1FDIA 2HCJB 3COJA 1IN1A 1NG9A 1JA1A 1UC4B 2GK4A 3JZFA 4RWZA 4B47A 3T7AA 1YUNA 4GBJA 2J32A 1UKCA 4LVOA 3WL3A 4GPEA 2I7CA 3LTEA 2GM5A 3N7UA 1DKRA 3O1HB 3HSKA 1Z4JA 1R4MB 1X7DA 1BVYF 2RHRA 4DCTA 1V6AA 1NIPA 4XQEA 1D6NA 2H16A 3U7QA 3DFUA 2P6OA 3F3YA 1S3IA 4ALNA 2OFOA 2ZT8A 3D81A 1P4HA 1KK3A 1ZN2A 2QRNA 1KQOA 3Q11A 2I7XA 2HIHA 2R7KA 3PGLA 4UCXA 1HT2E 2KPOA 3JZAA 2ORWA 2WJIA 2LUOA 3PKIA 4IV0A 4QEDA 4WK0B 4ZEWA 3ZCQA 1RXSA 5DMHA 2WHQA 5J2TB 2JIZA 3MS7A 1RYMA 3E23A 5HF6A 1ZAKA 4A6DA 2Q3BA 3L84A 1DC6A 4J29A 5AW9A 1L7BA 4URXR 3G8CA 2CHQA 4YHHB 1GA1A 3O26A 3QW2A 4QXRA 1Y5RA 1NBMD 1X94A 3GR6A 2I4LA 2VP3A 3EQZA 3I39X 4W1QA 3S8EA 3C6KA 4Y9RA 4UVIA 1X38A 2PD4A 2WF5A 1P61B 4YI5A 1KZ1A 1MPTA 1ZRMA 2AR9A 4UUPA 1RPNA 2IBSA 5JCZA 4D7AA 3K0BA 4FEEA 4NV3A 4X6UA 3AYZB 2C0CA 1SULA 1GDTA 5KSWB 3UIEA 3ND8A 1H2WA 1M73E 3JZMA 5CB4A 3LL7A 3W8EA 1VQ1A 1E6UA 3QU4A 4KBGA 1P1HA 4A27A 4GPTA 1XJ0A 1TNDA 4UJ3A 4D46A 5A6SA 2ZI6A 3PHJA 2B2NA 2PGIA 4X1IA 3MWEA 4CIVA 1PBTA 1TLTA 3KE8A 3BTOA 4O6VA 4ZCSA 5JO9A 3CKKA 4JP3A 5LXTF 3N86A 4I3FA 3X1MA 2GCEA 5TMEA 1W4RA 2PH7A 1GKLA 3CTPA 1V5EA 5E8JA 3ZU6A 2H0QA 4L4ZA 1JB1A 1C1YA 3W2EA 5AJTA 3T38A 1ANKA 1VB5A 1VDZA 1N92A 1QOPB 1X7ZA 2FLWA 2I6XA 2P9FA 3M9LA 3I09A 4GXQA 4OLJA 5FA6A 1MFPA 1W0JA 1P7PA 4TL6A 4QGGA 4DA8A 2CZCA 3M82A 2XYGA 5EYPA 4G67A 3TW6A 1S3SA 4PLFA 5KDLA 3UEOA 4BLVA 1MJFA 1A8SA 3FOWA 3Q5DA 4O2AF 1OX4A 2WDZA 2ZS8A 4M1WA 2ZSJA 1AN9A 4F84A 1ATZA 4WN9B 2P9HA 3O8QA 3BK1A 4HB2A 2ERXA 4PWYA 4ZHQB 1RAFA 2FWNA 3IXMA 2JAQA 3OA0A 5D3KA 5F3WB 5JUWA 1ONOA 1VB3A 4LSWA 2A58A 5KU1A 1VA4A 4AECA 4W9NA 5LXTB 4BY9E 4DMUB 3C4QA 1N1EA 1VHWA 1UJNA 4HGRA 4TLEA 5K7SA 1XCBA 4OCZA 3SEZA 5ESWA 2GYWA 1PV1A 1A8IA 1EQUA 4PQRA 2FZ5A 2HZBA 4UNIA 5CVUA 3T5BA 3CH4B 4IUDS 4NP6A 3ZBQA 3KPVA 4LJ5A 4ZVPA 4QQ8A 5LQNA 1WP4A 1XEXB 4ZK6A 2QGZA 2VDQB 4O2AB 2EJVA 4C4TA 1F0NA 1GITA 5CFMA 3DYBA 2ECQA 3GFVA 1C50A 4JGIA 1KXJA 3RC1A 2OECA 4QHTA 4N48A 5HNKA 3NC0C 2HIGA 3H84A 2A5GA 5I7RA 2P9CA 2QD2A 1TKAA 2CW5A 1N5LA 2AN5A 2P3SA 1J49A 5JMTA 4N8EA 1L5HB 1KU0A 4QC2A 4WBSA 4WZAA 3EX7C 5LQMA 1OD6A 1E8DA 1OLSB 1B4DA 4Q9LA 1THZA 3ETCA 3QOXA 1PDVA 4W5JA 1DTWA 1U4OA 3UWOA 1C4XA 4J1TA 1XMQB 3KTFA 1TO6A 2CWDA 1PR6A 3GJYA 7AT1A 3Q87B 4D44A 1B8OA 2AYZA 2BZ0A 4MKHA 3S8MA 4AWXA 4BCDA 5CDFE 3AHIA 1U3FA 1XQ1A 3GW8A 4URWR 2A0YA 2J87A 4B31A 1DOAA 4YASA 1LUAA 4IUCS 1KETA 2QTAA 3EH2A 1SIBE 4OXQA 3SMVA 9LDBA 5M04A 5IVIA 1SU8A 2ODWA 5IN5A 4FCTA 2XDQA 1YR2A 1TZKA 2YJGA 4QU8A 2IPLA 4YUXA 1X39A 3VU8A 4J4TA 3D6MA 2VQ6A 4TXNA 2HKIA 5EHIA 4ITVA 1M6YA 1NVXQ 4BNUA 5DBEX 1JIQA 4GEGA 4ZODA 3AVVA 1CRPA 2EQAA 2BFBB 1AMOA 1P5HA 3EVCA 1Q0HA 3LLMA 4BRSA 1VHLA 5DI3A 1N0WA 2VT7A 3EGIA 4PFJA 5AVKA 3WQHA 3GD7A 3NYWA 1T9CA 1CG6A 1B14A 5KYTA 1J9EA 1SUFA 3BOSA 3W04A 4RL6A 1GG2A 4GC9A 1XALA 3KV3O 2ZSBA 1Q21A 4ZALA 1Z0FA 1ZHFA 3UCFA 1KEEA 2AMVA 4R2XA 3C8MA 3W79A 4BXOB 1ESNA 2P68A 3PR1A 3WNQA 4CG3A 3B3FA 3P94A 4ROSA 1TEHA 2IEIA 2IHKA 4J0QA 5EWMA 3UT5A 4ZJZA 3U1BA 3NFRA 2E89A 4Q4DA 4UW9A 4FKZA 2RK4A 1P9OA 1EB8A 3G2LA 4PY2A 3GBVA 4R1MA 4K9QA 1SK9A 1JIUA 2Z30A 3IQHX 1ONNA 4MSUA 4RTOA 3X1DA 5DYGA 4C5CA 5NLLA 3MC1A 4BP9A 2POCA 4LDPA 2V8OA 4ZHSA 5BUQA 4BAUA 1QHXA 2GD6A 3FOCA 4FFOA 4DC9A 1XXHE 5CA1A 3LUBA 3P9SA 4ETWA 1B74A 3IUEA 2UUBB 1OCEA 2W4MA 2EFCB 3VH4A 3ZWPA 1LK5A 3O4JA 3BZBA 3KVVA 1A9QA 5LIPA 4RS4A 2OXEA 1GZSA 2HLDD 1K6JA 2ZSKA 3JTEA 4HUJA 5EQDA 1DG9A 1VMKA 2GFHA 1GPNA 1FU7A 1WSWA 1U9CA 1QQ5A 1V43A 2BFMA 3EGDB 5BNFA 3RNLA 4G1BA 4C78A 3ITKA 5BWCA 2FQYA 5HE8A 4Y1EA 3INGA 4R81A 4L4SA 4WKPA 2R5FA 4QTUB 4XXHA 1DNPA 5ECYA 1V8BA 1RYHA 5I9TA 2DWQA 3D3WB 4QUIA 4Q3LA 2YVAA 2CLLB 3G1UA 2NUAB 1GQYA 5LA6F 3Q4GA 1YZNA 1UBRS 4I1IA 1ZJ6A 2C00A 3GELA 4CODB 3KB8A 3D6AA 5BSGA 5FORA 4EGFA 1XJCA 5HWSA 3ELBA 3KHTA 5T67A 2VJLA 5B58T 2CEAA 2EAUA 4XPZA 3E15A 4NCHA 3LGSA 1OYWA 1R4MA 3IEPA 1S02A 2FKAA 3PQCA 4YV1A 3CLVA 4ZV4A 1W85B 4IKPA 3L4BA 3EQ2A 3ISVA 4GR9A 3WGUA 3BXHA 4XLTA 3O4RA 1HGXA 3MMPA 3MYYA 2QG4A 2ZIWB 3MSXA 3PE3A 2XUHA 4IQGA 4W1PA 4EY3A 4IQ8A 3C24A 1BCRB 1QWOA 1PFVA 4D80A 2K4MA 1H8EA 1N2CB 2BUAA 1K4MA 1DIAA 2WICA 1Z06A 4H60A 4ZAXA 5AW7A 2KQUA 4BC1A 3OFSA 3RS2A 1T15A 2XVAA 2GAFA 5J2TA 3CVWA 1XCLA 2RGEA 5ICCA 3TGLA 3IP7A 2GZAA 2C9OA 3EHDA 4ZD6A 1AGPA 2M9MA 2YY5A 3L7BA 1RCTE 5HMMA 3V00A 2QYOA 2V6MA 5F73A 1RWOA 4EHDA 1RTKA 1KWKA 2R65A 4MR8B 2YYSA 3C5CA 1DLJA 3V1UA 1VSVA 3K1JA 4D4JA 2YHIB 4LAFA 4P36A 3D5EA 4QDUA 1I1NA 1Z83A 1ORHA 4G84A 4LRTB 3T3MB 1U7XA 3A2LA 4IL5A 5FV7A 2OCAA 1KI1A 1G7SA 3N05A 4LK2A 1M6HA 1Y82A 2X7JA 3KX2A 221PA 4XIFA 3OAAA 4U6NA 4JUIA 2C61A 4PO1A 3NT4A 4QA9A 2WSSA 1E69A 5FUBA 2QP4A 4BCCA 4PAOA 2BDEA 1QTQA 4IJWA 1JSLA 4LGCA 3T5TA 5IK2D 2AWNA 1DTSA 2IHVA 1SG9A 2D1TA 2E1RA 4GXTA 3NDBB 3UHFA 1CDZA 1KTVA 3B1ZA 3D5TA 3KWJA 3B2QA 1MUUA 3DLTA 4OKIA 3HWWA 4QPDA 3LQ4A 1OI3A 3B6KA 1ZITA 4LPSA 1CY8A 4KN6A 5ER9A 3EHEA 2WOJA 4IHAA 4DQUA 2QY9A 1JMYA 4ZVRA 5BMVF 3O2QB 3AU9A 4QOJA 2WWGA 2B8NA 2X9VA 2GZRA 4RD1A 2A33A 1HZZA 4OOFA 2Q4BA 3HSSA 2AV6A 4DCGA 4O4IB 3L18A 4Q7KA 4WN9A 8ATCA 3ZHBA 3ZJUA 2HU2A 4ZHQA 2BTOA 2HBZA 3LDUA 4E5YA 5CBPB 5JALA 4Y2UA 3C3DA 1N5RA 3ND7A 1NOIA 2HHCA 5JWRA 1RBYA 4YRIA 1LJUA 1GFSA 5LXTA 4LJRA 2ZUVA 4WW0A 1MQAA 2ZEJA 3U0VA 1G8MA 2OORC 1HDEA 2N75A 4QX6A 4RH0A 4DKXA 4ZQFA 4PV7A 5HQTA 3ETDA 3QX9A 1UZNA 1XDGA 5COQA 3JSXA 1G7TA 2XQVA 1S6YA 2GR9A 1Z7GA 4YRLA 2QE7A 3PSAA 3GUYA 3LW8A 3VAAA 4Y0AA 1XEXA 1TL7C 4GDMA 1TJPB 1WMDA 4LCBA 3IDQA 4C6SA 1OYVA 2GK3A 4BKPA 3QIAA 4P80A 1G63A 1CDOA 1L9KA 1CERA 1N2HA 2GPBA 3AUJB 3D7RA 3CUUA 1YKSA 5DM2A 1WMSA 3DA8A 4B9AA 4B6FA 3PDUA 4EA9A 1YB7A 5K0SA 1PVDA 2O2XA 3CC8A 3R2JA 5PGMA 3SG0A 2JIRA 3PE6A 1S2GA 4JWTA 4RJIA 4NX2A 4MVJP 3HUTA 1L5HA 2I2AA 5A02A 3A04A 3QRWA 2HQOA 3G2HA 1OLSA 3O4HA 3GZ4A 5ALLA 1YIAA 1P1BA 1AZTA 1DINA 2AK2A 3DAFA 5BWLA 2C2HA 4BP3A 4OLAA 4HD8A 2VXOA 3E3LA 4MYSA 3BEOA 3M6FA 4R69A 1RLTA 1ZA2A 4MINA 1C9DB 1CIJA 1PP4A 1XBTA 1ATIA 1W59A 3IP5A 3S40A 3SYTA 3V3TA 3G1WA 2C9DA 1Q7EA 1BX0A 4YQZA 1ZHOA 3K92A 2ZATA 3CS3A 3VKGA 3TM4A 3RYIB 2RHMA 3EF0A 5C7OO 3ZWMA 1I3KA 3BILA 3BJZA 4JU9A 3H0EA 2GYVA 1Z2OX 3HFJA 1YDMA 2FEMA 3KSUA 3P2KA 1Z8NA 3WRXA 1XVIA 1GT91 1V7QA 2IYWA 3KL4A 3WYFA 3OZFA 3MS4A 1OXMA 2FXIA 1D4AA 2BFBA 2Q9BA 3GZTB 2XIJA 4UMDA 1IULA 4IY1A 2GCGA 2Q3FA 4DL9A 4ZI7F 2ZRHA 3L6RA 3VHXB 1ZZGA 3IAS6 4NHEA 5K3DA 3FVRA 2PZAA 2GMWA 4K7JA 1DO2A 4OHKA 4EGJA 1XMXA 4QPZA 1PYDA 4TKMA 1RJDA 1WL8A 4JXZA 3ZDYB 4G1UC 3OE7D 1M34A 3FF1A 2O0MA 5J9FA 3KP1A 3QFRA 4QHSA 4ER6A 2JJQA 1H2ZA 1WW3A 4J49A 2B8EA 1L7RA 2WVGA 3JYNA 4LC1A 2HHLA 1A98A 1SXIA 1N33B 5J63A 4JVNA 2MMGA 3EJWA 2YXBA 4IMIB 3FTCA 4TUYF 3PX2A 4DWWA 1Z6TA 2ODAA 4PGAA 5DBHX 2QGNA 2QM7A 1Z56C 3N2EA 4IHQA 1TRHA 1X2BA 4QJ5A 4ZI7B 3VDMA 2JA2A 1TXGA 2KLHA 3HB5X 5H80A 2DJ5A 3QXHA 1IE3A 2Q28A 2XMGA 2YC4C 4C21A 3HJTA 2OYRA 3KOOA 4XVQA 4GKVA 1CUXA 1I9CA 4L8GA 1N1DA 4A1OA 1X8KA 3O95A 3UMJA 5CA0F 1P6XA 3AVXA 4KXXA 4MITA 4R41A 1Z26A 3GA7A 1A9PA 3M5DA 1EUYA 1DCMA 1HL3A 1L7MA 1WUHS 2OHXA 3S68A 2WM8A 3IL2A 2A8YA 2AUMA 3IPYA 3VV3A 3DCNA 5I9MA 5ES4B 3ZBPA 3LHDA 4LFBB 4BIIA 4TMYA 1N8TA 1UL1X 1YI1A 4I5DA 4CMGA 5EHZA 2CY0A 3BQMB 1I4TD 1JEQB 2VZ8A 1U90A 4LF5B 4QOHA 3UFBA 1E0DA 5I5EA 1M6EX 4JUFA 1JDBC 3UHJA 2HK8A 3GRYA 3VKFA 1NVEA 4RESA 2B1QA 3OOYA 4ND5A 4ZEOA 3U7IA 3T9AA 4UDOA 4PW0A 2POQX 4XFKA 1PNVA 2H1HA 2OBXA 2TYSB 3D3WA 3KSZO 5AK6A 3REGA 3WLRA 5CA0B 1M2GA 1UBHS 2D2IA 1X7GA 1K5DA 3BAFA 3JQBC 3C7TA 1SCAA 4UCWA 4EBFA 3KB1A 4YNBA 3NDRA 3SQXA 1V48A 5DIFA 3TYXA 5L4NA 2XGJA 3ZK7A 4Y6RA 2OC9A 4D9EA 4K9KA 3V4PB 3HTXA 1IQUA 1J00A 4WNIA 3E7DA 3DB2A 2C7OA 4RYLA 1IN6A 2GI4A 2HMVA 2YZKA 3LBIA 2VF8A 3ONEA 4MEAA 5JSKA 2Z56A 2PX3A 1GYRA 1NX6A 3AESB 3CNOA 1PEKE 3HEMA 4PRZA 5KKAA 4X6LA 1JB9A 1W85A 2D4AA 2WUEA 2BDUA 3MWGA 4IKOA 3T7RA 3IVCA 1PJBA 1RAGA 2J9YB 3OE7A 3BXPA 4MVWA 3KEMA 4NEGA 2HZ7A 3EBPA 1AHIA 4WCFB 4IHJB 3C6QA 4O2RA 1T10A 1TAQA 1ZINA 3B6ZA 1BCRA 2HNAA 1W44A 4HVAA 1BQEA 1N2CA 4MH0R 2XEDA 2XUOA 2RHCA 2JDIA 3EEQA 2CFRA 4M0UA 5U1PA 5KC9A 1IK4A 4M1YA 4EFMA 5FUYA 1J9ZA 1Q0LA 1PWEA 3C6YA 4CTOA 1PBNA 4BNTA 2BGRA 4D98A 5C53B 4DREA 3C15C 1VJDA 3AEZA 3G5AA 2NYAA 2V0NA 1EXDA 4MR8A 1GR0A 1G3QA 4YAEA 3BK7A 1TOAA 4G4GA 4RHCA 1SC9A 4TSFA 3VR2D 1WKVA 2YHIA 3GWZA 4RA6B 1QHYA 4YV0A 2XOKA 4Z5XA 1OSNA 1U31A 2XB9A 3HDGA 4EI2A 4JHLA 4F56A 1BKYA 1KYVA 1EVKA 2G3YA 4RWEA 4E5NA 1E6LA 1Q1QA 2X0FA 5JPDA 2ZZNA 2W58A 3V42A 3U40A 2GQ0A 3BB4A 2OLKA 4W9RA 1G9XA 4FOSA 2FX5A 3UICA 4KO2S 2E0IA 3ZWAA 3K15A 3V7NA 5FRDA 2G07A 4JOCA 3RVLA 2R5WA 1EBBA 2JAUA 4II2A 2C97A 4M4SA 2RMKA 4MB0A 3SC3A 3SR0A 3HO6A 5C5IA 2O9JA 2GCOB 2OBLA 4L0MA 1V3UA 4LF8B 3HUFA 1C81A 4PLWA 1RI4A 1R10A 4ZKEA 2MYPA 5CIYA 1E1QA 2VJNA 1OFUX 3FSRA 3MAAC 2HR1A 2BGJA 4DDTA 3WRYA 3KT3A 3A8TA 4MS1B 4E5SA 5A0FA 1SC4A 2LKDA 2CLFB 4CU2A 1ZCBA 2V55B 1M8FA 1SU7A 3PF8A 2NUTB 3V4RA 2H5LA 3Q85A 4QBTA 3ZZNA 4EOGA 2F8TA 4K3VA 5EIWA 3TCNA 1P5FA 5HTKA 3B53X 1WSBA 3W9UA 5COAA 4O4IA 4FDTA 5FUVA 1MQSA 3DB1A 2PGXA 4RXMA 5CBPA 2FMHA 4GQAA 5KPJA 1KSHA 1ABEA 2JBWA 2UVDA 3C8ZA 3DDCA 3VNAA 1BMQA 1Z7EA 1FP6A 4OIFA 1T4DA 2QV7A 3MWLA 4UHJA 4JT9A 2Z8XA 1O5TA 2BSAA 4FB4A 3JQAB 4N9QA 1S8NA 3CT4A 2RHDA 3IJRA 4DIDA 3LOUA 3I1YA 2A0UA 2SCUB 4F5YA 2FG5A 3P2IA 2H31A 1FY2A 1NQOA 2X8WA 3P71T 3SAJA 4DDVA 2JKZA 3FB1A 3H9QA 1KGSA 4CLRB 1ZCAA 1K7YA 2DH5A 2Q07A 4G41A 5K09A 3P2JA 3ENWA 4ERXA 3ROTA 3QPCA 2GEDA 1NU6A 1PDWA 1I0ZA 1G66A 3VRHA 4NFYA 4G5QA 2FV8A 2BI7A 3F2VA 4M9RA 2WF6A 3RVNA 1G1AA 1LWNA 1VJ1A 2QAIA 3MQFA 1PFYA 2CF6A 3UJ6A 1IEWA 4L07A 3ET4A 4D56A 3CZQA 1VPTA 1KAQA 3FI0A 1SAYA 3II6X 3Q1KA 4O4JF 3VM6A 2IP2A 4JYMA 2OBFA 4Q1DA 2OUIA 4RGBA 1T1IA 3L5OA 4AU1A 3WG9A 4EJ6A 3QE9Y 5FLXA 1CJMA 1QV9A 1SNYA 2ECFA 4JOQA 3T3NA 1Q14A 1UJMA 1FVXA 3D3NA 2JJ8A 4OB7A 5AKEA 3GBPA 1XQXA 3A10A 3H17A 1DWQA 2P8JA 3KYDB