3FTPA

Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from burkholderia pseudomallei at 2.05 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
248
structure length
248
Chain Sequence
DKTLDKQVAIVTGASRGIGRAIALELARRGAMVIGTATTEAGAEGIGAAFKQAGLEGRGAVLNVNDATAVDALVESTLKEFGALNVLVNNAGITQDQLAMRMKDDEWDAVIDTNLKAVFRLSRAVLRPMMKARGGRIVNITSVVGSAGNPGQVNYAAAKAGVAGMTRALAREIGSRGITVNCVAPGFIDTDMTKGLPQEQQTALKTQIPLGRLGSPEDIAHAVAFLASPQAGYITGTTLHVNGGMFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
total genus 84
structure length 248
sequence length 248
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2009-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ftpA00
2BH9A 2P5YA 1LTHR 3F4LA 4IDDA 2GN8A 4M55A 4B4UA 4XEHA 1F0YA 3GGGA 1JDJA 3FBTA 3KV3O 4UUOA 4KUGA 1QG6A 4GLLA 4KZPA 4RZIA 1GZ4A 1WMBA 1ADCA 3FNHA 2C07A 4YQYA 7MDHA 3CIFA 4NZ9A 5ENDA 1KVRA 3O8QA 1DC4A 1KY4A 2Q49A 5F5NA 2Y93A 1ZIDA 5FF9A 3OIFA 5L95A 5IJZA 3BTOA 1ENOA 1LRJA 3AY6A 4CM4A 1WDMA 4QO7A 1HDYA 2NU9A 1XCBA 1EK5A 1QLJA 1XQ6A 4UAGA 3V5NA 4GVLA 1YE3A 1MXFA 2NTJA 1M6WA 2OP0A 4UVEA 4BNLA 5BQFA 3TF5A 1U4OA 4YJGB 5JC8A 2PD3A 4AJNA 3AM5A 3QVXA 3I4FA 1B8PA 1IHXA 2Q1SA 2W2LD 4G5HA 2ZB3A 2FR8A 1MLDA 1SB9A 3FHLA 4WE3A 3T4XA 1HT0A 1Q0QA 2VQ3A 4W4TA 2C7GA 3KSZO 4M89A 1Q1NA 5FI3A 3PZBA 4E2WA 1WPQA 1WMAA 1ADGA 4CMBA 1UAGA 1I3MA 3ZWCA 5G0WA 3X2EA 3SBOA 1N7GA 5GMOA 1KYQA 1HE5A 1NPYA 3OJFA 4R3NA 4CUZA 1FJHA 4CJXA 1M67A 3TQHA 4E5MA 1GR0A 4ND4A 1QRRA 3EY4A 1JA9A 1DOHA 5DNAA 2Q1TA 3WBBA 2FPGA 4I1IA 2Y99A 2DFDA 3COSA 3M2PA 2XF8A 3ZWNA 2PGJA 3ROKA 5CDYA 1E3IA 1UZMA 3M1LA 1ISFA 5ER6A 1JVSA 2OMEA 3D3WB 1XKQA 4AG3A 3DTYA 3AOEC 2WYWA 1NVGA 1TA4A 4IXWA 3E5MA 4ZD6A 4N5MA 4LRSB 4BNHA 3U9LA 2BGMA 1GQ2A 5DF1A 2E82A 4JQCA 1PJCA 3VZSA 5H82A 2G17A 2Z5LA 3C3XA 4ND2A 2ZJ0A 1PS0A 4DC0A 3FPCA 3TPCA 3GMSA 2GN6A 3BMOB 2VRBA 4FFPA 4Y98A 1A27A 4O63O 4JJFA 3ORFA 3VTFA 1I5RA 1NAHA 1ZKMA 4FBGA 4LISA 1YRLA 3W4IA 3M6IA 3EVTA 3ASUA 5G2OA 5TF4A 4LGVA 4NBRA 3NUGA 2VCYA 1W0CA 4PG7A 3JQFA 3JQBA 4A5OA 1AN9A 5I9LA 2GYYA 3FN4A 3JYLA 2NVWA 2X5OA 1BTOA 2EJVA 3I9MA 4RO0A 4HV4A 3WB9A 2J8ZA 2Y05A 4CMKA 4NBVA 4YRDA 4D43A 5AQ1A 3GHHA 2P91A 5TT1A 1KC1A 3V8BA 5CEEA 1K6XA 3DB2A 4PG8A 4F45A 2PWZA 3OETA 4Q3CA 1DRVA 2D2IA 3EGOA 4E3ZA 1IULA 1DRWA 4E0BA 1V3UA 1NQTA 1PJLA 1PZFA 1T2AA 3D4OA 3LLVA 3PFFA 3VAZA 2W98A 4EUEA 1XU7A 1VC2A 3G49A 3ZH2A 2PFGA 3EZYA 4U8GA 5BNFA 4DIFA 3DOJA 3GN1A 1FDVA 1A5ZA 5IN5A 4CM8B 5JAIA 5KJCA 4ALMA 5HS4A 4TKMA 1PGOA 1UUFA 1VM6A 2ZB7A 3UCXA 1E1MA 4NMHA 1PGNA 1SC6A 4JGBA 2EXXA 4QFCA 4BMNA 5DOZA 1YDWA 2PGLA 3DBRA 4BB5A 1U9JA 4FGWA 5JY6A 3TL2A 3V2GA 2EKPA 5T8KA 1T2FA 1DJNA 4YAEA 3WFIA 5JLAA 2WWRA 2D8AA 3OSUA 1JWBB 3PQFA 1ZZEA 4WLEA 1PJSA 2O3UA 4RVDA 4Y8VA 3UN1A 3ASVA 3I1JA 5AXBA 4WNIA 5TJ9A 1HEUA 4A10A 3E18A 4DYVA 1Y5MA 4OOEA 1T2EA 1I2ZA 4EUHA 2JCVA 3ZHXA 2O2SA 3PYLA 3QVTA 2GD1O 4EUFA 2X23A 3VZQA 4BNIA 1MA0A 3OQ6A 4YJFA 3NRCA 2W2LA 5KIAA 2IODA 1EZ4A 1QORA 1LSSA 3D64A 2O4CA 1U7TA 5A1TA 3WS7A 2Z95A 1IB6A 1X13A 1I24A 1JKFA 1E1LA 4YJDA 2Q4EA 5JDIC 4BKOA 3HNPA 1HSZA 4NBTA 2A92A 1NPTO 2NLOA 1GD1O 5TNXA 3WMWA 4GWGA 3BTSA 3DXFA 4WOKA 4FQ8A 1LU9A 2UYYA 4W82A 2W4QA 5IDQA 1LXCA 4IQ0A 4U0JA 3ZWWA 3O38A 1I3NA 2HSDA 4HFJA 3SVTA 3H4VA 2GF2A 2PV7A 2GDZA 3GDFA 2CFCA 2YUTA 1KC3A 1ZMOA 1F8GA 1H0KA 1U8XX 1YO6A 3AM4A 1P45A 4OHUA 4P4NA 4PG4A 3DZKA 4TRNA 3UCFA 2WEKA 3GFBA 4D0SA 3STHA 2D5CA 3JYQA 2FWMX 2VT3A 3ANMA 4OXKA 3DHYA 4WASA 2AQ8A 1UDAA 4FDAA 3VDRA 1Y8QB 3PDUA 2ZIZA 1LQUA 4MKZA 5C7LO 3AY7A 4FPXA 3PGXA 3A14A 1BWSA 4WKGA 3F9IA 1YBAA 1SOVA 1V3VA 1HE3A 1CQIA 1UXHA 5G4LA 1FXSA 3TRIA 5F3RA 6ADHA 1O89A 5EJ2A 3F5QA 3BZUA 4OIMA 4DRYA 4J9UE 2A35A 2V6MA 3ZWMA 3RUIA 4DUPA 2NU6A 4IUYA 4JJIA 4OKNA 3TNLA 1GADO 2FPIA 1EVJA 3DBRB 1UP7A 3DWFA 2Q1UA 1N9GB 1AUPA 1QYXA 2OBYA 3H9GA 4P4LA 1QR6A 4ID9A 5L7TA 3CPSA 1DC6A 4PLCA 4WCFC 1Y1PA 2HMUA 3ZWYA 5CDUA 2PTGA 5CEFA 4AVYA 3RKRA 3JQ6A 3AI3A 4PLYA 3OJLA 1BDMA 2JD0A 2O3TA 2ZYAA 3GY0A 4RVFA 4M86A 4YA6A 1WZIA 1K5HA 2BI8A 1EE2A 1P0CA 2HMSA 3B20A 3NV9A 2C59A 3AW9A 5DT9A 4P4GA 1I3LA 1NFQA 1ZK3A 2R2GA 1E3JA 1PWZA 3S1LA 4BO5A 3HN7A 3KYDB 3FSRA 3VZPA 1H6BA 4DL9A 3GZNA 3JQ9A 3V1YA 3K30A 4J4TA 4QFDA 3ZW8A 3PHLA 1NHWA 4IIVA 2Y68A 4RVHA 2NU7A 5LC1A 2HRBA 3CZMA 2FZWA 3PLRA 4ZRMA 4OJNA 4GBJA 4OXYA 1S7CA 4NQZA 3RWBA 3SX2A 3DZHA 3PVZA 5L7YA 2RH8A 1ZNQO 3PK0A 2VOJA 2NVUA 2WYUA 3U4IA 4ITUA 3HFGA 5IFLA 1I0ZA 4HXYA 5HM8A 5TSDA 5KTKA 5DOVA 4IQGA 2FHSA 2NACA 1QYWA 3I9OA 3DR3A 4JBHA 4BL5A 1R4MB 4NFHA 4N5LA 1PS9A 2QW8A 4XRRA 3I52A 4YT8A 3L6OO 1ZCJA 3KBOA 5AVOA 3ZHZA 3Q1LA 3U09A 1LRLA 2EP7A 4QSMA 3UH1A 1O94A 1SB8A 3HHPA 2VTEA 2BGKA 2LDBA 3IKTA 1H2BA 4B4WA 3HDHA 1MV8A 4ZJUA 4XGIA 3ADOA 2E6UX 2G0TA 1DC5A 4ONEA 4DPMA 5KOIA 1BVUA 1ZJZA 1DB3A 2QX7A 2D0IA 2JHGA 2ZATA 2P9CA 3MOGA 1UDCA 1J0XO 4CMAA 4CQMB 1GUZA 2VUUA 1Y5RA 3QWBA 3BA1A 3GVHA 1NM5A 2J3IA 4ALNA 1B8VA 3OJ0A 3EDMA 1C1DA 1VLLA 3R3JA 4GAEA 2YHIB 3RI3A 1B0AA 3BHJA 3MJ4A 5KVQA 5FEUA 1ZEJA 2HK9A 1NP3A 5JSFA 5IZCC 2OP1A 3D4PA 3WGTA 4B7CA 3CMCO 5IN4A 1J4AA 2AEJA 4PZDA 5A04A 3GT0A 1W6UA 2IYPA 2OORA 3K2BA 4IDCA 3AUAA 3D5TA 1WP4A 1WWKA 1OFGA 5EL0A 2QYTA 3VH1A 4XDZA 1Z7EA 4DQUA 2POQX 1PJ4A 5A3JA 3MWDB 2CY0A 1SCUA 3P5SA 3AY3A 2Y66A 4GX1A 4P22A 1OAAA 1PQWA 3H3FA 1BSVA 4MOWA 5CAEA 1GZ3A 1HTBA 3L07A 4IJKA 2NVUB 4QXMA 1V0JA 3FCOA 2YHUA 2QYSA 2YY7A 4OQYA 4LCEA 4GQAA 4XB2A 3NTQA 4TSKA 3VHRA 1E3LA 1QV7A 5AXAA 4ZRNA 2EIHA 4FC7A 3U4CA 3QVSA 3I5MA 4U0KA 4CR6A 5F5LA 1HLPA 2HAEA 2XPCA 3QQPA 4NDNE 5U9CA 2V6GA 1HF3A 2A9FA 4WEOA 4YJHB 4IQ8A 2Q2QA 1LX6A 1YB4A 4UUNA 5BR7A 5IDXA 5KJEA 4GI2A 1ZMTA 4IXTA 5B37A 4R41A 1BXZA 3F1KA 3WICA 4QT0A 2RBEA 1SAYA 1AHIA 1V8BA 2D1YA 3H2ZA 3NTRA 4PRLA 1U4SA 4WNCA 4NU6A 5A9SB 2YW9A 2VT2A 1NWHA 5TRTA 3E1KA 2GO1A 1SBYA 4J7CA 3WQRA 2FSVA 4WCFB 4RF4A 5KKAA 1GFSA 2DUWA 3H5RA 1WNTA 1A9ZA 3QIVA 5I8WA 2X86A 3GH3A 1MFZA 4NU5A 4R3WA 2C5AA 4ESOA 3W8FA 2I65A 3WOHA 4FN4A 1EVZA 1T1RA 3I4CA 2PD4A 5IDYA 5TS3A 3ROMA 1DJQA 3QLJA 4HNGA 3QRWA 2FMUA 2YFHA 2F1KA 1HWYA 2FRDA 1MFPA 4I5DA 4RPLA 5K9ZA 4E12A 5F1OA 1X15A 4BNJA 1NYTA 3NT5A 5CP8A 4PVDA 2Q2WA 3PDJA 2WE8A 3P2YA 1DHTA 4PRKA 3WGYA 1GU7A 1NWCA 2PZMA 5KVVA 4XJSA 3ZWAA 3S2GA 2JHFA 1M66A 3C1TA 1LA2A 5AOVA 2LDXA 2J5QA 3G1UA 3HWRA 4RVGA 4E33A 5IXYA 2E48A 2WDZA 2XXJA 3DMYA 1B26A 4RZHA 4DPLA 1NQ5A 2O3QA 3MEQA 4WLFA 4OOFA 4WLOA 3WXBA 3DL2A 3LT1A 1BVRA 1PS8A 4YT2A 5JXWA 3KZVA 1DIAA 3FWZA 5JS6A 1Q0HA 5GZ3A 2WMDA 2X7HA 4FIZA 2I67A 4I8XA 3JCZA 2CZCA 1R4NA 3P19A 1JKJA 5A05A 1CDOA 2HMWA 4J0EA 1T2DA 1T4DA 3DBLB 1WVGA 1X7HA 2HO5A 1FF9A 3SC6A 3ZWOA 4BNFA 2Y0CA 2OXIA 1K0UA 3PXXA 4ND3A 4BGUA 1Z75A 1SEPA 2D3TA 4PLHA 4TRRA 1T2CA 3BMOA 1OBFO 2OOSA 1K3TA 3QWHA 1IZ0A 4E5KA 4HP8A 4OSPA 4AJEA 1XLTA 1KEPA 1DFGA 3ZZNA 2CVQA 2FP4A 1LEHA 5JDCA 4BIIA 2F00A 3RFXA 3ZWXA 4OXNA 4EJ6A 2O50A 3F47A 3P7MA 1Y8RA 1M76A 4J1SA 3JTMA 5ADHA 4D41A 3RC9A 3ZWBA 1TLTA 1ZUD1 3LC7O 2C29D 4GH5A 4Z3DA 1I32A 2OZPA 3R0IA 3GG2A 3H9UA 2J3KA 1P33A 3H9JA 3OIDA 1LSOA 3AU8A 2QRLA 2PH3A 4L74A 3ZCXA 1E3WB 5L3ZA 3UOGA 5KJFA 1U5CA 5KJ1A 5EPOA 4D3SA 1DHRA 3GA0A 3HUDA 1DRUA 3QWIA 1U3VA 3VDQA 3KSDO 1I2BA 4FW8A 4QTZA 4RF2A 4LN1A 2FY8A 3DBHB 1Q0LA 5JYEA 3GNSA 2DAPA 4BNYA 5JDIA 3AK4A 5L51A 1YONA 3QHAA 3RUCA 1U1IA 4CV2A 1KEUA 2PZJA 3IJPA 1XA0A 1ZJYA 4Q9NA 4WK6A 5TIIA 2FN7A 3LC1O 4K6FA 1VL8A 1Y7TA 2X0NA 1MB4A 3DO5A 4M49A 3TN7A 1CERA 2CD9A 2JFHA 5LDGA 1LSUA 4P8RA 3VC7A 4AJ4A 1TT7A 4CLEA 3DQPA 3HJAA 4QO8A 4ND5A 4BNGA 4RV9A 4DLBA 4DPKA 2Q2VA 4URFA 1E7MA 5BSGA 1JU9A 1TI7A 3GGPA 3WX0A 5KKCA 3ADPA 1LDGA 3INTA 5DULA 1FMCA 1X1EA 4BKUA 2JL1A 4W6ZA 3SLKA 1GQYA 1HXHA 1UP4A 2ET6A 3W8DA 3AM3A 1E7YA 4EJ0A 4BUCA 1UXGA 1B15A 3VPFA 1ZBQA 1ORRA 3IOYA 4DIBA 2JD2A 3DBHA 1Y81A 5AXDA 1O8CA 3WQSB 4GLOA 4JN6B 2I3AA 2YDYA 3F3SA 4R01A 2P9GA 4BNNA 5G0TA 4TVOA 5GY7A 3EW7A 1L7DA 4B3HA 2FR0A 5I9NA 1CYDA 4KOAA 4K28A 4HKTA 3X2FA 4K6CA 1PZHA 2OL4A 5CPBA 2WD8A 1IPFA 1K89A 3GNTA 3ZHBA 4FJ0A 3WYCA 4D3FA 5BNIA 3O9ZA 1ZK0A 4IS3A 3GPIA 2H9IA 1PQPA 4O5OA 2V6FA 4E31A 5LCXA 3HZZA 1JLLA 2B4RO 1BDBA 3UICA 1CIVA 1P1HA 2DTEA 3NDRA 3RU9A 5DCYA 1AXGA 4LMRA 2V7PA 3HDQA 3IQDB 3V1TC 3ABIA 2HJRA 4GX0A 3MJEA 3W4KA 3AJRA 4TROA 1E1KA 2UUOA 2AXQA 3RC1A 3I23A 3D0OA 3EAGA 3PYMA 1ZK2A 2GN9A 4G2NA 1I3KA 5C7IO 4Q3AA 1QYVA 4PLGA 4YXFA 4MP8A 3E9MA 5BNTA 3UAGA 1DC3A 3GVIA 2DPGA 3GAFA 3TZHA 4GVXA 4B4VA 3HG7A 1U8FO 4FD3A 1Z45A 4KP7A 2X9VA 3ZV4A 4J9VA 2I6TA 5MDHA 1HYEA 5CFZA 2BFOA 2P4QA 1UXIA 4PLPA 3C7DB 4E21A 1BRMA 2NTVA 3PPIA 3MTJA 2X5JO 5G4KA 3E03A 1O6ZA 1GPDG 3HDYA 5ES3A 1MC4A 2D4AA 1CEQA 4XB1A 1G0OA 5BSFA 4UUMA 4YAJA 3LF2A 3OH8A 1W8DA 1TEHA 1U2DA 4AJJA 5B4UA 4FSHA 2EF1A 2C2XA 2IZZA 1M6HA 3FNFA 1E7RA 3NKLA 3BMQB 4TMFA 3H5NA 3GF4A 3KRTA 3GG9A 1FK8A 4JNKA 1GCUA 3JD0A 3PRJA 3E82A 4C4OA 3WIEA 3U4HA 1PTJA 2PA3A 3LQFA 3DZJA 2BFPA 3GZ4A 4YRBA 3JQAA 1U7HA 2GGSA 2VWQA 3CSDA 4Z9XA 3H5AA 1UR5A 8LDHA 3RKUA 4B7XA 2PH5A 2Q3EA 1F12A 4FFLA 3ICPA 3M2TA 4FJ1A 4AJOA 3PJDA 1MP0A 5G4KB 4HNHA 2HDHA 2JKVA 3EUWA 4NJMB 1DBVO 1Y6JA 4IDAA 1PGPA 5DCUA 3U0BA 3K6JA 1LUAA 5F1KA 2IRWA 3U3XA 1GDHA 3GVCA 2NADA 5DZSA 4XIYA 3GC6A 3GEMA 1BMDA 3LZ6A 1ULSA 5THQA 1IHYA 1OI7A 2TMGA 3ANLA 4BO3A 5L45A 2G5CA 3WWZA 2EWMA 3PHHA 5JAQA 6LDHA 4BS9A 4CQLB 4Q3DA 3OHSX 2VWPA 1C1XA 1PR3A 5A5EA 1EQ2A 4QEDA 3WBFA 4PVCA 5G0UA 1XELA 5JYDA 4LMPA 2YZ7A 2GN4A 4BKRA 2AW5A 1Q7CA 3T7EA 2YYYA 4U7WA 4X54A 4DA9A 4MKRA 5G0VA 4E32A 1LI4A 4PG5A 3RQSA 4GPD1 1YKFA 2CDAA 3C1AA 3VPSA 1F14A 4IMRA 1U3TA 1G1AA 1NNUA 2GERA 3ENNA 2WD7A 1KEVA 1MUUA 2VRCA 4RORA 3DZGA 2BLLA 1BXKA 2ZTUA 3O03A 5HRUA 4GX5A 1DSSG 3QY9A 4WUVA 3VTZA 3D1LA 3HE3A 5I7FA 2VWHA 3KLPX 4OH1A 5I7EA 2J5KA 1ISHA 1ZO8A 2EV9A 4N7RA 4BO8A 4ZA2A 4XDYA 3E9NA 5ER9A 1MC5A 1R66A 4J91A 4DWVA 2I76A 4W9NC 1SO8A 5CHEA 1AE1A 3RIHA 4ZICA 4FS3A 2RCYA 2Y1FA 3GEGA 4DQVA 4DLAA 1H2HA 2B4QA 1E92A 2X5KO 3L4BA 4XGNA 4IZIA 1BW9A 3KM0A 2ZKLA 4Y67A 2WJPA 3ZDFA 3JQGA 4S1VA 2NQ8A 4J2HA 2VZ0A 4R16A 2H6EA 4RVUA 2EGGA 1K6IA 1H5QA 1UH5A 1HSOA 2X8LA 3WTBA 2PR2A 4A2CA 4JXKA 1EFLA 1E7WA 2ZB4A 2VYND 2O23A 2W2KB 1E3SA 1FDWA 3ICCA 1K6JA 5H83A 1VJ1A 1UXJA 4YPOA 3VVCA 3GGOA 4A03A 1PIWA 4NI5A 1NQOA 3K31A 1PJ3A 3QE3A 3H65A 3WJ7A 1TVEA 2BI7A 2GSDA 2VHYA 1C14A 4I5EA 4D42A 2DVMA 1Z73A 1PZGA 1RYEA 4W7HA 4FOSA 3OM9A 1FDUA 5BSHA 1R4MA 1X0VA 4Z6KA 3TOZA 5KNLA 3Q9NA 4CODB 1CF2O 1SNYA 3CUKA 3WDSA 4AJPA 4CMEA 4DMMA 4E5NA 2IYOA 2J5RA 2YFQA 3ETDA 5IG2A 1YH3A 2ZTLA 3C8MA 3GMDA 1XSEA 3JSAA 1EVIA 2EW8A 3QA9A 4WCFA 1NAIA 1W73A 4CM8A 1HZZA 2CMDA 2DBRA 3GVPA 3DOCA 4O6VA 5JBIA 4L9RA 2VN8A 3D5QA 3E9QA 1RPNA 4NJOA 1ML3A 4QQRA 2OUIA 3B1FA 4LW8A 1Z82A 3U62A 4CMHA 2IE0A 3KUXA 4BO4A 5AXCA 3NGXA 4DBVO 1Y9AA 1OC4A 1M75A 1DFHA 4R1NA 1EUZA 1X0XA 3IC5A 3KSUA 3NYWA 5DP2A 3M1AA 2CDBA 2Y0DA 5L53A 1B3RA 3UF0A 2PKQP 1E7SA 2DBZA 2DLDA 2HMTA 1P31A 1P77A 3ZN2A 5COQA 1I8TA 1R12A 1GYRA 5JCJD 2BRUA 3HB4X 5T6BA 3H8VA 1E7QA 2E4AA 4YT5A 1RM0A 4FFMA 1X1TA 2VHZA 3O8QB 2DTDA 3E8XA 4WEQA 1IYZA 1GYQA 3CEAA 2PGDA 3BIOA 1YBMA 3EYWA 3WNQA 5I7VA 2EKLA 2CSUA 2ZK7A 5JFOA 3ZW9A 4L8VA 3W6UA 1DLJA 2EKQA 2YDXA 3TZ6A 5A5FA 4NK4A 3GPDG 3PWKA 5K6AA 2O3SA 4QECA 2ZB8A 3HSKA 3IKVA 2VYNA 3RBZA 1E3WA 1F06A 1RYDA 4EW6A 3JV7A 3UVEA 3S2FA 4H16A 2I99A 5A03A 5DP1A 5C3MA 4UULA 2C5EA 1ADFA 2O3RA 3GR6A 3I3OA 4L0QA 4J3FA 5HA5A 1ZFNA 4D44A 2DUUA 1ISIA 3IP3A 3RJ9A 1V35A 4H3VA 1QSGA 1NX6A 3ZNQA 3MJSA 2X22A 2HKIA 3AOGA 3KB6A 1P3DA 4J49A 4OKIA 2I5PO 3TDKA 4BO0A 4BQRA 3GUYA 5TT0A 5A3VA 2EERA 3I6QA 3MOIA 2I9PA 3OMLA 4GWKA 1ZH8A 2WYVA 1HLDA 4YWJA 1YOVA 2RAFA 1AHHA 4RCVA 4UVDA 3PFWO 4J1NA 4GKBA 1MGOA 4PLTA 2GLXA 4JBGA 1GEEA 3QVOA 3H6KA 1JKIA 1R37A 4CV0A 2VRCD 4I9HA 3SXPA 2FR1A 3NJ8A 1A71A 4H15A 4XQCA 2Z1MA 4FOOA 1A7KA 2CUKA 2GRAA 2HU2A 2NTNA 3MCVA 4R4JA 3WGHA 3FNGA 4IMPA 3B1JA 3ZV3A 4UVGA 1NVMB 3S2EA 4BMSA 2C2YA 2D5AA 4DGSA 3I9LA 1X7DA 1A4IA 4LVUA 4ZGWA 5U1PA 4IINA 4AJ2A 4BQPA 5CEJA 5LDHA 4K9DA 3GN2A 3RC7A 2VTDA 4FFNA 4NK5A 3IIEA 4CUKA 3DFZA 2O7SA 1YB1A 4BNWA 5B1YA 1XG5A 1VKNA 1GAEO 1ZSYA 2O2YA 4CM4B 2W90A 4M87A 5ILOA 3CMMA 2GASA 3TWOA 3VOSA 2Y1GA 4F46A 1XYGA 3GNQA 2BFMA 3RU7A 1KETA 3PZRA 1RM5A 3NDJA 4HY3A 3K8ZA 3HDJA 4MDHA 1P44A 4XYMA 3WMXA 4NIMA 3A4VA 1PR9A 2EGHA 3RVDA 1EUDA 4NFSA 5FI5A 1DLIA 3L77A 3KLMX 1C0IA 1H93A 4J16A 3DHEA 4JIGA 3FNEA 3ZHYA 1CWUA 2RHRA 1OMOA 1LC3A 5T8KC 4CLRB 1ISMA 2G82A 1PJBA 2HMVA 2AA3A 3O4RA 1UAYA 3R1IA 4E2ZA 1R0SA 1YL6A 2HUNA 4CM3A 2Y1DA 2DQ4A 4BNXA 1HYGA 3RC2A 2P5UA 3F1LA 4RQTA 4OMUA 2HLPA 4PLFA 3WJAA 3WQQA 3AU9A 3GRKA 1NASA 3LK7A 3KYCB 5H81A 3H3JA 1CQJA 2UV8A 5IDWA 4W9NA 3BAZA 4EZBA 2X9GA 3HN2A 1YDEA 2ZQZA 3DHNA 4E2XA 4F6LA 4EYEA 5ICMA 4IM7A 3KETA 2IZ0A 2O4UX 3MTGA 4OQZA 4PZEA 4YB8A 4PGFA 1O9BA 2P9EA 3JQ8B 5HWSA 4L75A 4AJIA 3OJEA 2ZYDA 4IJUA 5GZ6A 4G81A 1JWAB 2ZQYA 1ZSNA 4M8SA 4TKLA 4WPGA 5F1PA 4B79A 4C7KA 1YVEI 5JNLA 5JW6A 4BV8A 1F8FA 1BG6A 2JJYA 3OFSA 4CLHA 3KOUA 1ISGA 5IAAA 3WLEA 3TFOA 2WM3A 5FYDA 4DIOA 4RF5A 3N74A 5BSEA 2Q4BA 1M2WA 2X0RA 3LDHA 2Y1OA 1ZXBA 4IDFA 3WGZA 5CDSA 1VSUA 3DMTA 1RWBA 3DC2A 3LT2A 2CF6A 1O0SA 3PIIA 4BNTA 3L6DA 3PHIA 3UUWA 3T4EA 1NVTA 1LDEA 2V65A 1R6DA 4J4HA 4O59O 3EC7A 3ON5A 3ITKA 1ZK4A 3VVBA 2VHXA 1YJ8A 4R69A 4EDFA 3DOOA 4ALIA 1HRDA 1CJCA 1X7GA 3Q9UA 1WDLA 2UAGA 4BV9A 2NWQA 4CMEC 5JC1A 4UEOA 1UJMA 3L9XA 1A9YA 4ILKA 4CM5A 4RL6A 1N7HA 1YL7A 4RJTA 4IIUA 3I9NA 3PWSA 4U6QA 4XJTA 3D4NA 4ZQGA 2ILTA 1LLQA 1YBVA 3VKVA 4BGIA 1PGQA 1WLYA 2O3JA 5CPFA 4HFMA 4J6FA 5EQFA 4CLDA 4PLVA 4GL4A 1QP8A 4CMIB 5JY1A 2QRJA 4I5GA 4EITA 1VPDA 4EI2A 2WTBA 4QX6A 4CM9A 2YV3A 3EVNA 4UREA 2VYVA 4MVJA 3TFQA 5L4SA 3EMKA 3K5PA 1IE3A 3WGQA 1NPDA 1I30A 3DAGA 3QW2A 4L4RA 4GMGA 4OYRA 3JQAB 3KYCA 4K26A 1ONOA 1C0KA 4YQZA 4J43A 4MVJD 4ALJA 4XYEA 1LSJA 1HETA 3MZ0A 3PJEA 1GY8A 3V1UA 1U28A 2HCTA 5L9AA 4FFOA 1KS9A 4NJMA 5A9RA 1KBZA 2AQHA 1DO8A 3WR5A 4DLLA 1U5AA 5MGBA 3Q3CA 2VNAA 4Z0PA 3BMCB 4LK3A 4YAGA 1HDCA 3RASA 4Z3KA 3BHIA 3QP9A 4MVJG 3PIDA 4GKVA 5F21A 3BMNA 2B35A 4BO7A 3WLFA 2QG4A 4GSKA 2P68A 3AWDA 4HADA 4DBZA 2OFPA 4DXHA 4DMLA 4WCDA 3K2EA 2WE7A 2R6JA 3FTNA 1H6CA 1GTMA 3IUPA 1PJQA 2GZ2A 1T25A 1WW8A 3A28A 3GFGA 3IL2A 4U5QA 3AFNA 4UUPA 1PZEA 2OHXA 4XX0A 3NTOA 3PHJA 7ADHA 1E0DA 2Q99A 3AUUA 3JQGB 4NNJA 4UEKA 4L4SA 4HUJA 2YHIA 4MP3A 5EINA 1EEHA 3L0DA 4BNVA 1A72A 4TZTA 4DC1A 1YXMA 3DZBA 4XZ3A 4AJHA 1J49A 3LF1A 3UKOA 3GHYA 3ZU2A 3PQEA 4A0SA 4RQUA 4PN3A 4MVJE 3IDSA 5COAA 3LLSA 4NPCA 5ITWA 3ZWPA 2C54A 3OICA 4LRTB 1NR7A 3LSYA 3ONDA 1VRWA 1EE9A 2ZJ1A 4PCVA 1YQDA 1HYHA 1QV6A 2AQKA 2CNBA 1Y8RB 1G6KA 1RKXA 4JLWA 4XGKA 3U49A 1NR1A 1YL5A 1K2WA 3B70A 1R0LA 4MVJH 2PNFA 2XOXA 3PEFA 4RPJA 5EMHA 4BO2A 3NX4A 3HQ4O 4II3A 5JDCC 3WGIA 2RH4A 3A06A 4JP3A 1PGJA 3DZIA 4PZCA 3OF2A 3Q2IA 1TT5A 3TL3A 1Y8QA 3N7UA 2JFGA 4XD2A 4Y6PA 4J0FA 4MP6A 4Y6SA 3TSCA 1B14A 4WECA 5DCWA 3CE6A 3W4JA 4R9RA 2Q50A 4E6PA 3FBGA 2GUGA 2JCXA 4CQLA 4A27A 1MG0A 1IZ9A 2AEFA 2NQTA 1PL6A 3RUAA 3TZQA 3R3SA 4CM1A 3JQ7A 4Y9DA 4J4BA 4JK3A 1I36A 4LVCA 1DIHA 4PG6A 4R54A 5K0ZA 1N92A 1RM3A 4NHEA 3DDNA 2BGLA 3FR7A 5I9MA 3V2UA 1VE9A 1S6YA 1X14A 4MO2A 1U3UA 5KCZA 1VJ0A 1B16A 1BGVA 4A26A 4IZHA 3PWZA 2PZLA 3BHMA 5CDGA 1EFKA 3TJRA 2YV2A 3UCEA 2NM0A 3RFVA 3WFJA 3NDIA 3JYOA 3SLGA 4EJMA 1BHSA 5JAMA 1UXKA 4BVAA 2VWGA 1PJ2A 2GZ3A 1SMKA 3WNVA 3KEQA 4CMCA 2NV6A 5EIOA 3PGJA 4I9UA 2DBQA 5A9SA 1GQQA 2NU8A 2P4HX 5CG1A 5TJHA 3INGA 1R0KA 1QYCA 4NBUA 3ZNPA 4N54A 1VI2A 3NT4A 4IJWA 3QWFA 5A02A 4TZKA 1NHGA 1V6AA 4D7AA 2B5VA 5DBGA 3OECA 2QQ5A 1ZEMA 2DKNA 1AGNA 1Z74A 2WSBA 1PU2A 1AXEA 4RDHA 1XHLA 1LLDA 4XCVA 1P9LA 2DBVO 3CXRA 5EESA 3I9JA 3JD4A 4CMGA 2J3HA 4II2A 2W2KA 1QKIA 5KJ6A 3KHUA 1R16A 4UVHA 3K73O 4TRMA 4XWYA 5CDTA 1B8UA 1HZJA 1E1NA 2O7QA 3KYBA 3DBVO 3VH3A 3ZU3A 4KUEA 4KUHA 1KIFA 1WAMA 1EMDA 4NFYA 3A9WA 5ENVA 3KXDA 1V3TA 1WDKA 1VL6A 4JJGA 2EG9A 3EZLA 5T67A 5GZ1A 3RROA 4YAIA 3IJRA 1LQTA 1HE2A 4GMFA 1YQGA 3RUEA 3FF4A 4MIYA 5JCJA 1EBUA 2Z1NA 2HK8A 3JQFC 2GR9A 1OC2A 4E2YA 1ZK1A 1DEHA 2AE2A 4KTVE 4ZQBA 4ZQHA 3RBVA 3UHAA 1N5DA 2G1UA 2R00C 3K9QO 4XA8A 4B4OA 1E5QA 2BHLA 4DQXA 3S8MA 4IBOA 1ENYA 2EP5A 3GUCA 2Q46A 4BO1A 4DYDA 3DMTC 4C7JA 4XRGA 2AEMA 3NEPX 5KVCA 5J23A 3S55A 1BW9B 3MJVA 2HK7A 1C1DB 1DDOA 1YQXA 1ENZA 1R4NB 4N5NA 1DIRA 2B37A 3W8EA 1Y9EA 4P38A 4YCAA 5A9TA 1KERA 3OBBA 3AUSA 1TXGA 3W1VA 1GV0A 5C7OO 5IZ4A 4OSOA 3OIGA 1ZVMA 3GK3A 4KTTE 5HBRA 2J3JA 2DM6A 3E5RA 1JN0A 3JD3A 5TGDA 3KO8A 1GV1A 4M54A 4CQMA 2B69A 3WYBA 5ITVA 2IEBA 2PK3A 4PFJA 1QMGA 3OQBA 3INRA 1ISJA 1CRWG 4BGEA 1EDZA 5B4VA 1P1RA 3VKUA 1H9BA 1G0NA 5L4LA 1ULUA 3LT4A 4MIOA 1EUCA 3SEFA 3LT0A 4RPKA 3C7AA 4EBFA 3RD5A 2C20A 2C0CA 5DBFA 1D8AA 4IDGA 4IS2A 3BMCA 3UW3A 1H6AA 3CINA 4D3DA 1LRKA 2UUPA 3AI1A 3PJGA 4JCOA 5I7SA 3RUHA 5BT9A 4CLXA 3C7CB 3FTPA 5KWEA 2PY6A 1E6EA 4LSMA 1O95A 2BMAA 2E37A 5JMPA 2JD1A 2AG5A 4BHTA 4U6SA 4BO9A 2JCYA 3DFUA 3HFSA 1NXQA 3G79A 4XKJA 1T24A 4XQEA 1P1JA 2VHVA 4INAA 1B3BA 1E5LA 3ETGA 3H9QA 3JYPA 4TRJA 4YVFA 1ZSVA 3QSGA 4LCJA 1WZEA 3Q6IA 2Y0EA 4O1MA 1I33A 1ADBA 4MPDA 1JW9B 1XGKA 2ZTMA 4L4XA 4XYLA 3ITDA 4FR5A 5IZCA 8ADHA 4BKPA 3NGLA 4GX2A 1IL0A 2X4GA 3PYXA 1LDYA 4MJLA 2G76A 4CPDA 5L4NA 2VUSA 3Q2KA 2IXBA 3E6AA 3WSWA 4ROSA 2C82A 2FSSA 3DTTA 4EEXA 2DTXA 1XIVA 4I5FA 4HFRA 1VKOA 5CG2A 1T26A 2I66A 2IXAA 4OL9A 5T64A 2J6IA 3LC2O 3D7LA 4AICA 1LC0A 1EK6A 3ROQA 3GDGA 3GRPA 3N58A 3OA2A 4CM7A 4CM9D 1ZW1A 1Z7BA 3T7CA 1SPXA 2YJZA 1MG5A 5JO9A 1T4BA 3SJUA 2RIRA 4D0RA 4BKQA 4J7XA 3ANNA 1BXGB 1D1TA 2EW2A 4YDRA 4R51A 3JQ7B 4MVJP 2AMFA 3WYEA 3PLNA 2IDZA 4B8WA 3AFMA 1U3WA 1D4FA 2AQIA 3VH4A 3QWAA 3K92A 4MVJI 1CETA 4R1TA 1QLHA 1J5PA 3ZNNA 4CMIA 3NJ4A 2GZ1A 2FOIA 4ZQFA 1HDGO 2X0JA 4CQMD 2B0JA 4MVJM 2XAAA 4JX8A 1VJTA 4Z0HO 2DU8A 1GUFA 1XR3A 2Y1CA 4CMJA 1OZAA 2QZZA 3IMFA 1SOWA 3G0OA 2XXBA 1KEWA 3I9KA 1O5IA 1L7EA 4NBWA 4ZU3A 3ZU4A 3C85A 3FWNA 4YR9A 1IUKA 3DONA 4NR0A 2X9NA 9LDBA 2QRKA 4KDFA 4TWRA 1I2CA 2DT5A 2ZYGA 1J6UA 4B3IA 5C37A 5TC4A 5JE8A 2YQ5A 4FC6A 1LJ8A 1JQBA 4TQGA 4MIEA 1C3VA 4AJ1A 4E13A 3GLQA 1NBOA 1HDOA 1L1FA 3SC4A 2BF7A 2HQ1A 2DFVA 4OM8A 3PHGA 2YQ4A 4BNZA 1B2LA 3VZRA 1E6UA 4UEJA 2A94A 3L4BC 4PLWA 2Y67A 1ZXLA 4ZQEA 4YACA 4GGOA 4D45A 3OA0A 5HS6A 1LDNA 4IGFA 3ONFA 2VHWA 3OEYA 3B1KA 3PP8A 1SZJG 5EERA 1KVSA 4ZVVA 3WG9A 3ZU5A 4CV1A 5L40A 3ZNOA 1E6WA 3NT2A 3LVFO 4YTEA 3RFTA 1GPJA 4R1UA 1XEAA 3TZCA 4XYGA 4BB6A 3KTDA 4GSLA 4Z9FA 3DAPA 4CM6A 4D46A 3ENKA 5JPIA 3JQ8A 2X0IA 3FRJA 3L4SO 3ONEA 1EVYA 3JD1A 3FPLA 4GGPA 1P0FA 2VNSA 3G17A 4B3JA 2Q45A 3I6IA 1LLUA 1E3EA 4R5MA 3U5TA 1OOEA 1KOLA 4D79A 1P74A 1LBEA 3LU1A 1DPGA 1BXGA 1Q2XA 2E49A 3A1NA 4Q3BA 3ZV6A 4ZHSA 2PKQO 3WGGA 1DAPA 3BXXA 5A4DA 4FJ2A 1GL3A 1KY5A 2HRZA 4J2OA 1PL8A 3GVXA 4WGGA 4IDBA 4L76A 5AYVA 4EEZA 2ZCUA 4KQXA 4MINA 1DAOA 1XQ1A 4J90A 1EDOA 1YB5A 4W7IA 5HTOA 4DREA 2AE1A 2PZKA 5FWNA 1HE4A 1ENPA 3F4BA 4KWIA 3BMQA 4XR9A 3VH2A 5TX7A 3IS3A 4AFNA 1IY8A 3I83A 3BTVA 4MKXA 1FDSA 4BGVA 1KVQA 1RJWA 2PLAA 5EN4A 5T5QA 2UVDA 4RDIA 1EBFA 1JTVA 1NFRA 4F3YA 4AJKA 3JQEA 1P1IA 3JD2A 3JQDA 1V9LA 2RHCA 2ZTVA 3RUDA 5TLSA 3E48A 3ZV5A 3EK2A 1YGYA 3OP4A 3TOXA 4XYBA 1MXHA 1HL3A 4HWKA 4RF3A 3RSHA 5B4TA 3WIDA 3MWEB 1Q7GA 1T1SA 5JO0A 3JQAD 1GEGA 3ZGYA 3Q0EA 1ONPA 3DZFA 4YYZA 2D59A 1C0LA 5IF3A 1A7AA 1NQAO 4WLVA 2O48X 3DAFA 5DN9A 3FI9A 4RGBA 2AHRA 1YJQA 4J1TA 3GEDA 3WSVA 4HX5A 2IZ1A 4E4YA 2X58A 1HDRA 1N8KA 1NTOA 1N1GA 2QZ9A 5THKA 1PSDA 1WXDA 4RPHA 4Q39A 2AG8A 4NG5A 4JROA 1DIBA 3S2IA 1LDBA 1QXSA 3WTCA 4YT4A 3H7AA 1PX0A 3F46A 4BNKA 3C24A 1LLCA 3QV1A 4YBZA 4DTIA 1PEDA 1P1KA 2WD7B 1GZ6A 1H94A 3CTMA 3RJ5A 2DPHA 4E5PA 2FPPA 3NAQA 1VSVA 2BFAA 4XIJA 1F17A 2HJSA 2EHDA 1B7GO 2UDPA 2NNLD 4CV3A 2QHXA 2R00A 4EGFA 3KVOA 4NH4A 2B36A 4S3MA 4HFNA 3ZWVA 3V2HA 3Q11A 3IUSA 4WJZA 3P2OA 2BD0A 2SCUA 3R6DA 3IP1A 3GDOA 4IPTA 1N2SA 4BOYA 4CL3A 1PWXA 1I01A 4WLNA 4JP2A 4N18A 2OGUA 1IOLA 5A06A 3RAJA 2W8ZA 4YJFB 3ZI0A 2VUTA 2DC1A 3PQDA 1JAXA 2CVOA 3K96A 3KEOA 2H1SA 4FFRA 5C5IA 4YEDA 3DEYX 1PJTA 4TVBA 5DDIP 4Q3NA 2CVZA 4E5YA 4JBIA 3O26A 1W4ZA 3LYLA 3VPGA 3VPXA 3MJCA 4CLOB 3RBXA 4KWHA 3PJFA 5B12A 2NUAA 1LDMA 4A7PA 3UXYA 4RPGA 5IXSA 4Y6RA 1UDBA 4I08A 1YS4A 2V6BA 4OGWA 3L6EA 1H6DA 3WWYA 4XR4A 2I3GA 1DXYA 1Z6ZA 4WLUA 4YAKA 2VZ9A 4LSWA 4DVJA 3GQVA 4ZN6A 4G65A 3ROPA 3WGOA 4Z9YA 2NSDA 4Z0TA 1C1XB 4W99A 2IEDA 1XDWA 3B6ZA 1PQUA 2CDCA 3C1OA 3CH6A 2FZEA 5TQVA 2P2SA 1Q7BA 1C0PA 5ILGA 5FFFA 2TMDA 4FB5A 3OJOA 3KYDA 1DIGA 4ND1A 2CF5A 3GZNB 1KVUA 4RVSA 4F6CA 4M1QA 4BNMA 3U4DA 2C7VA 4CLOA 4MVJF 1E77A 3GAZA 4WOJA 4B7UA 1YWGO 2X1HA 2VYVD 1TT5B 4CR7A 3FR8A 4QUKA 3JQBC 2VZ8A 3RCBA 4B8ZA 3HADA 3G1TA 1GUYA 1DFIA 2BELA 4AL4A 5L7WA 5JMWA 1TB4A 4IDEA 4A73A 2JAPA 3JQCA 1UZLA 3FD8A 1JAYA 4Q3EA 1UP6A 1N9GA 4L73A 4BO6A 4YRAA 4R68A 3ST7A 2PKRA 3OQ1A 4IY1A 3CZRA 5K6AC 3D3EA 4UVIA 3TZKA 1LNQA 1I10A 2BKAA 5EQDA 4YJHA 3JYNA 1VL0A 3MJTA 1R15A 1U2GA 2PD6A 5U4QA 4R5HA 1P1FA 5KVSA 4R1SA 3H9EO 3AOEA 2B5WA 2GCGA 1D1SA 3GOHA 3IAHA 4IJVA 2Y1EA 1D3AA 2YV1A 3F5SA 4H7PA 3OEWA 4I9NA 1XU9A 4IGEA 3ETEA 1EQUA 3CKYA 3EHEA 1QYDA 2JAHA 1UZNA 3RUFA 1GYPA 1ONNA 4ALLA 1JVBA 3L9WA 5COBA 1ID1A 3G3EA 4OAQA 4RLHA 1SEVA 4FGSA 1HDZA 3UGKA 4CUJA 4FCCA 2H5LA 4HBGA 2ZCVA 5JAZA 3ULKA 2QIOA 1KVTA 4J7UA 5JCXA 3HB5X 4PLZA 3F6YA 1YOVB 3QJ5A 3DBLA 4KQWA 4KMSA 2Q1WA 1IPEA 4KDEA 4PIVA 2EJWA 2GPTA 4CR8A 3PTZA 3VPHA 4J1QA 2GNAA 5DBIA 1A4UA 3H2SA 1MX3A 2VOEA 4XQGA 2B4TO 4BMVA 3BTUA 1N1EA 4OO3A 1D7OA 3AUTA 2EEZA 1H9AA 1PL7A 1XWFA 1HKUA 1HDXA 3D3WA 4RLSA 1NFFA 3PI7A 5G0SA 9LDTA 2JFFA 4BNUA 3UFXA 1GCOA 4K1LA 4XQ9A 5I8ZA 5ICSA 3BYZA 3QVWA 4AJLA 4ALKA 4E30A 2H63A 1RM4A 3W6ZA 4R9SA 2NVBA 3BMNB 2B83A 5T57A 3SJ7A 2OO5A 3JQ9C 4YJGA 1FDTA 2A4KA 2X6TA 4CLRA 4O0LA 1ARZA 2OBNA 4CL8A 3AI2A
chains in the Genus database with same CATH superfamily
2FB9A 2P5YA 3GCDA 3MJHA 3K7EA 4F4UA 3BN3A 4B4UA 1M6VB 3MIIA 2FZKA 4N3NA 3FBTA 1QG6A 1EH5A 2BUAA 3HB0A 2NUTA 5TMPA 3C3KA 1IUOA 2H29A 1N9KA 3WRWA 1FNCA 1Q5PA 3CIFA 3QYPA 4NYIR 4DQ0A 5DYIA 2CXTA 3F8WA 2NO9A 2YZKA 2Y93A 3QEMB 1N2CE 2QW0X 3M9XA 3HWWA 4JJ8A 4MCIA 2I7DA 4W7SA 5IRCD 1NN3A 3W9SA 2WILA 4DSNA 2ZUEA 1M8PA 1BHQ1 1ENOA 2BF4A 2NSJA 5AK3A 2ZT5A 3S2YA 4KLRA 2B2XA 2FEXA 4QO7A 2NU9A 4L51A 3MMNA 5TF0A 1EK5A 4L4ZA 1XQ6A 3K5WA 3NHLA 4FSXA 4UAGA 4GVLA 4IIJF 4LJYA 5EUMA 1Q1EA 1MXFA 2OLEA 5LP6B 4IGIA 3LTNC 3JASA 3W5CA 1TM2A 3D1JA 2OP0A 3TF5A 5L3VA 4P3YA 5AJYA 2GN1A 2P1ZA 4E46A 2ODAA 3QNUA 3KQVA 4I9FA 1F9EA 4JQSA 1IHXA 2W2LD 1CE8A 2AI2A 1B76A 1DMSA 1N3BA 2A9JA 1F8UA 1MDFA 1V45E 2XEDA 1N34B 4JT2A 4REQA 4P31A 1Q0QA 4W4TA 4LC9A 4H6PA 5BO5A 5C5CA 4ZTUB 2NMVA 1AF4A 3CLUC 4ZU1X 1L0BA 1N2CA 2C7GA 2WWGA 4M89A 2QNBA 4CKCB 5FI3A 4GI3A 5BR8B 4RPCA 4E2WA 1ADGA 4UNQA 2VG8A 1I3MA 5G0WA 3ZD7A 4IO1A 1RJGA 3OJXA 4X1IB 4BZXA 1N2JA 2VO1A 2KSQA 3OJFA 4CUZA 4MR8A 5JVDB 2OMKA 1W2HA 3LECA 4RZQA 3ADDA 5E6UA 1QRRA 5IJAA 5H8WA 3EY4A 5H9VA 3NALA 2RAPA 1E2HA 1S5PA 3EIUA 5E1OA 2WP8J 2QD1A 2PTHA 3DDSA 3IILA 2FPMA 1LY1A 3G59A 3ZWNA 2QTMA 1MAAA 1UZMA 4DN6A 2IUTA 3FPHA 2VDKB 5ER6A 1GRRA 2FMIA 2UVQA 4BVBA 5BVGA 1RPZA 3SY8A 4BC0A 5KHLB 1XL0A 2P2YA 4XSVA 1SKMA 1XKQA 4A8JB 4NYMQ 1CB7A 3C3BA 3EXHB 4XPIA 4KSBA 4TMTA 5B6IA 3H05A 1TA4A 3JRWA 3E5MA 4IXWA 3AGPA 1TE2A 4MV1A 3ETCA 4LRSB 4AU1A 4BNHA 2AYZA 2BGMA 1M1NB 2LCFA 4XWGA 1TF2A 3P2MA 5DGTA 2XCQA 2OBFA 3TCKA 5H82A 2G17A 2IYYA 4MYSA 1DTWB 4B17A 3MSXA 1K9SA 2Z5LA 1M7GA 3C3XA 3M49A 4QU0A 3TSOA 3A27A 2FXIA 3UAWA 3C6XA 1XZIA 1Q6YA 4PN7A 3LT5A 3FPCA 4HL6A 4TLLB 4TXNA 4KBYA 3S28A 3BMOB 2VRBA 1A27A 4O63O 3ORFA 1XDDA 2AGVA 5J4VA 3WY9A 1YRLA 1LJUA 1IQUA 2R7LA 1AQ6A 2VSXA 3IUYA 4IOMA 4ZVUA 5TF4A 3S1AA 2Z6AA 2DLCX 3WHLA 4LHZA 3NUGA 1W0CA 1M1ZA 2FOLA 3CLTD 3PEVA 5BXQC 5I9LA 4ZDJA 5HCUA 4N7JA 5JJIA 1KMIY 2VRNA 3LVQE 1U80A 3FN4A 4CKWB 1WETA 3DDZX 3UB4A 4Y2HA 2OHHA 2ZRNA 1SOUA 3ES9A 3LZCA 3W6PA 3W5BA 2R25B 4AMVA 1WX1A 1Y7HA 5EXSA 4A6DA 1H1LA 2Y05A 2JK0A 5REQA 3UOAB 4ARZB 2XSZD 3GHHA 5DHRA 5TT1A 1KC1A 3VR4H 3A9CA 5CEEA 5AW4A 3LZDA 1YZVA 1M74A 4NXNB 5FL3A 3U80A 2I7VA 1N5JA 4KAXA 4MR7B 1X8KA 3SM9A 4F45A 4Q3CA 3CUVA 1CTQA 4A2QA 1N0UA 1IULA 3NS7A 1V3UA 1PZFA 4CCWA 5BOSA 1S02A 3BG5A 1Z47A 4M7PA 1WOYA 2I03A 6REQB 4EUEA 1XU7A 2PFGA 1G60A 3EZYA 4FGZA 4QFBA 5JI3E 1LPNA 3KCQA 2M98A 3DOJA 3R3YA 4PC3A 1FDVA 4E70A 1U0RA 2IOYA 5IN5A 1ZCAA 3W4JA 1YRAA 3IUMA 2B5OA 4WZZA 2HHLA 4IIYA 5HS4A 2PVCA 5M2QA 3DLBA 1EIZA 2CNNA 2BV3A 1PGOA 4UFPA 2ZB7A 3G0BA 1H2ZA 4NMHA 5DWQA 4ZVRA 4JGBA 4RXUA 3SFVA 3V3KA 1W5TA 2GOYA 1AQLA 1K4YA 1YR7A 1YZUA 1UKCA 3DBRA 4AP9A 1RXSA 1U9JA 3HCAA 3H99A 4FGWA 1UK6A 3R3WA 4HDNB 1G20B 1UDXA 5B1SA 4FTWA 3OAAD 3VM6A 4ASUD 2XZOA 4TM7A 1OZHA 4U7FA 4LZJA 5F51A 3HXKA 2Q9CA 3WFIA 5HHTA 2AOUB 1NLUA 2D8AA 2WJ4A 5IJ0A 3WGMA 1E66A 4JIMA 2GTHA 2AF4C 4NPHA 4WLEA 3W0LB 3PD7A 1L5SA 2H16A 2XUAA 3TQSA 3UN1A 4MV8A 2ZANA 2RCNA 1OREA 4A10A 2WY2D 5A5DA 4FCVA 5KWSA 1T2EA 4RDCA 3GJSA 4J0HA 5TE9A 3CH4B 3GROA 1H4SA 1ZAYA 2V5UA 4EUFA 4NV1A 5HPYB 4WSOA 3ESRA 5SYNA 3VRHA 5A4FS 2BZ0A 1GZUA 4YJFA 3NRCA 1SD1A 1Y7PA 4KQHA 4Q05A 1JHYA 3ZR4B 5ENZA 1LSSA 3D64A 3A1EA 3CW9A 1U7TA 4M53A 5EZQA 1H1DA 3EXAA 1IB6A 1I24A 2WV9A 4RQBA 4YJDA 4AWXA 1XD2A 1CBUA 1XF9A 4Z4CA 4U63A 2NLOA 1Y34E 3V3TA 1H3FA 3MTIA 1U9IC 1A76A 1Z18A 3EG9A 2L0XA 3NNNA 4GWGA 4UAUA 1T43A 4ZZIA 1P61B 2O1EA 3NHAA 3P2EA 1VMKA 2W22A 4MPPA 4OSEA 5EZ5A 1CUFA 5JS7A 4EHKA 3DKIA 3ET5A 3JX9A 4S2EA 2VPWA 4LDNA 3ZWWA 4QJ4A 1JLLB 4YV7A 4WMLA 1RRKA 1UT6A 5J4KA 3SVTA 3H4VA 1C3OB 2GF2A 3RTAA 2IHNA 2DBYA 1VE5A 3PF9A 3KX2A 4GXQA 1H0KA 2FCAA 4E51A 3AM4A 1I2AA 1P45A 2A0XA 4TRNA 1J99A 3RFCA 2II6A 3UCFA 1UEJA 5KUTA 3EDRA 4X1KA 3G2IA 1ZG3A 4JH0A 1YIDA 4D0SA 3ZQ6A 3UC9A 2VT3A 4HH0A 4G4JA 1M2NA 2XQVA 1JLSA 1P6UA 2F62A 4WASA 4FDAA 4KGXA 4EGSA 4I1PA 3PDUA 3NI2A 2ZIZA 3L18A 4LOAA 4BVLA 3H75A 4IH9A 2QQGA 5CBPA 5C7LO 3AY7A 4NV3A 3WV5A 5H9WA 2PIAA 4JHXA 4DZTA 1M5UA 3IRVA 1PV1A 1YBAA 5ADUS 4GOKA 1LVGA 1V3VA 1D0VA 1HE3A 2NZ2A 1R74A 2ZVDA 1U7XA 1R3DA 5G4LA 2P65A 4M0UA 5CNJA 4B85A 1RD4A 2V6MA 3ZOKA 3MLBA 4A8TA 3AVXA 4EG7A 1DCFA 1GCGA 1ODSA 4DUPA 2RJNA 1J90A 2P90A 2ODQA 3KWMA 4IUYA 1AMOA 4OKNA 3TNLA 5MGNA 1OWPA 2DE0X 3W2FA 4CHGA 3A58B 3MLAA 5HFJA 2Q1UA 1N9GB 1QYXA 3FVTA 4KQGA 2ZE7A 3L7NA 2K5UA 3VTAA 3W5JA 4ACAA 3DMFA 5LYJB 4GP6A 2C7PA 2NU9B 4DSAA 1QM5A 2AUMA 1V43A 5CXUA 3ZWYA 4BFSA 1ZD5A 5CEFA 1IBSA 2PTGA 4E94A 4AVYA 2WKSA 1JQLB 1GZ5A 1ZQ1A 2OUKA 1T9GR 3JASB 3JQ6A 1N5IA 5HX7A 4UUAA 2V1UA 1MOSA 4FFSA 3OJLA 1BDMA 1COZA 2A1TS 1RYBA 2R8XA 2DEUA 4TWIA 3BM5A 4OGGA 1WZIA 4P3OA 1ODIA 4ZU6X 2VA9A 3W5AA 5KMGB 3N6VA 3H11B 5ESWA 3OZVA 2OLJA 1PP4A 4UU8A 2WIJA 3NV9A 4C0HA 4YAWA 4M1KA 2FA9A 4G5YA 4P4GA 4WFIA 1KI8A 4V1CB 1I3LA 1HL7A 1N2CB 4CKCA 3PQ3A 2R2GA 3EVDA 5E6RA 3EWNA 3FOWA 1E3JA 4D9MA 2VJBA 2QM7A 2IFTA 1AB6A 4DIBA 5FTWA 2YS7A 4AZWA 2CL6X 1ZWLA 4ZFNA 4FEAA 3NONA 2RI1A 1NXOA 1T1GA 3GZNA 3KJFA 3V42A 4LY6A 5IK2D 3B89A 2VJQA 5ITZB 2FJ0A 4QIHA 1JHVA 4J4TA 1J70A 1C30B 4QFDA 3ZW8A 4KO1S 1UJ5A 1NHWA 4LI3X 1QHIA 2IOFK 2Y68A 5IBPA 3T35A 1BIFA 2HRBA 3CZMA 3T3EA 3E05A 4MCAA 1FYXA 4XJXA 4OJNA 1UPAA 4MRAA 3B7PA 3F6PA 2PRJA 3HWSA 3P1JA 4OHRA 5DCLA 4NQZA 3RWBA 3PVZA 4TTIA 2W2QA 3P27A 4G5GA 5BMVB 5LQCA 3PK0A 2WYUA 3U4IA 3K1ZA 1H5NA 3N2NA 3P9SA 1O0CA 1EFPB 1Q44A 1I0ZA 5HM8A 5EVCA 5KTKA 1Y9ZA 3H19A 1T3SA 1A9QA 2FSPA 3O74A 1A2BA 1YHNA 3VU8A 3D7NA 1QYWA 2Q5QA 4PNEA 4BL5A 1VKZA 2PWYA 4P84A 4NFHA 2IS6A 4HUQA 4NWIA 2BC9A 5FR2A 3I52A 4V3BA 1BXRA 3KBOA 3AZPA 3WRYA 4FD2A 1M1YA 2QPTA 1DTWA 3QXXA 1MAWA 4Q12A 2KHZA 2P0EA 2FE1A 1O94A 1KO5A 3HHPA 4PICA 2VTEA 3AR6A 1RCTE 4AECA 3ESYA 3TD2A 3BBPA 1EE1A 3RHFA 2WQ6A 4EG6A 1CJSA 1NVAA 3CUWA 4LNAA 4UTVA 1FJ2A 1MV8A 4GZ3A 2EATA 1ZUWA 1JQAA 3ADOA 4R2KA 3VPAA 2AI3A 3L7IA 5EJ9A 1LFAA 4R9VA 5CX4A 1E18A 1V7ZA 3BX1A 2ZATA 3NZEA 4PEVA 1K06A 1UDCA 2YHSA 2VUUA 2WTAA 4M1ZA 2IT1A 2RGEA 3BA1A 2IEYA 3ODGA 5ALEA 2GAIA 5ALGA 2IH4A 5ALYA 1FSFA 3BHJA 5KVQA 1ZEJA 3UT0A 1CP3A 2YNMA 4YP7A 1SKYE 3C70A 4CTKA 3L92A 4HEJA 4YALA 4BRUA 5BW5A 4FNGA 4D98A 2WSYB 5IN4A 3I92A 1H3NA 1U99A 2EARA 4MK4A 3SBEA 2FUCA 1XZNA 3LBFA 4DDTA 4FYJA 1MJGM 3AI7A 3SKVA 4AYWA 1L1QA 3UK6A 4C7MA 4DR7B 3SQWA 3AUAA 4QOSA 2DY0A 4LDJA 5EL0A 5LBTA 5FCDA 2Z30A 4F4JA 2ON6A 5KREA 1PWYE 3GDWA 3Q5DA 2WVAA 4A6XA 4QUIA 2ZRAA 1FZTA 2HHHB 1QGZA 4P22A 1FNNA 1QVRA 2OENG 3CNOA 3U6BA 4INOA 1SM4A 1V0JA 3FCOA 2QYSA 4NYJR 3UJDA 4IVRA 1JH9A 1FSPA 3PT9A 2NZYA 1V25A 2HR1A 3NTQA 4TSKA 3VHRA 4GGMX 1DX6A 5F1YA 2AJLI 3M1IA 4B76A 5KYWB 2N0SA 2AWNA 3IBFA 1AV7A 2DQSA 1Y0BA 4L57A 4MB0A 4WKPA 2C9CA 4XB6B 5DTEA 4BN4A 1COWD 2H4JA 1UWVA 4LV6A 2P9BA 1A8IA 4GPEA 4DBLC 3JALA 2HHAA 3H4MA 4IQ8A 3AQIA 4DFDA 1EESA 5JG7A 1YB4A 3KUKA 3L6CA 3OQVA 3UQZA 3ZCPA 5CCEA 1E4VA 4OREX 4DLRA 5BN1A 5KJEA 1OA0A 4ND7A 4OQFA 5B58T 1L5YA 2FK8A 3QA3E 4GE0A 1X7YA 3I76A 3F1KA 1HLGA 4QQNA 1AHIA 1YZNA 2WPDA 4UD6A 4PRLA 2FK7A 4WNCA 4IEFB 4CVNA 1TCBA 1VMIA 1SBYA 3ZD9A 4G0YA 4J7CA 3ELDA 1B74A 3WQRA 5JFGA 1B41A 1Q20A 4WCFB 1XOIA 1PFQA 4KKXB 3ZVLA 1X7WA 1TM4E 5DGIA 1OLUB 3EC2A 2X86A 3GH3A 5CK4A 1MFZA 2BONA 2C8LA 4NU5A 3TZBA 1T34A 4RULA 1ZD2P 4R3WA 5MF6A 3TW8A 3D4IA 4B3BA 4ENUA 4F1KA 4G1UC 3FRIA 2BISA 2PX4A 3I58A 1OT3A 3PVSA 4C87A 5TS3A 3CE9A 3ROMA 1OPXA 3H04A 4H1VA 1S8OA 2PG3A 2RHJA 2ECQA 3JALB 2O7VA 3QE4A 3IVAA 4ZT2A 5EPUA 5EWJB 2OD2A 2CYAA 4U4AA 5CP8A 5LP6F 3Q12A 3C4VA 1CRQA 4PVDA 5FD8A 2ZXFA 3STXA 2HA3A 4TLAA 4D4IA 4IG4A 3GRFA 2HADA 1O2DA 1TC2A 2Q2NA 3SKXA 2CHQA 1C4WA 1DHTA 2GEFA 2GD2A 1CZHA 2V74B 4KODA 5EE1A 5FIUA 3B2QA 1NMXA 3TUIC 2QTTA 2VDPB 3OE7D 6YASA 1UEIA 1E9RA 4W5WA 2PZMA 3HEMA 3IV7A 1OFHA 3HXLA 4L8GA 2EF0A 3CX3A 2GMWA 2JHFA 1OXVA 3DGFC 3QMWA 2P9FA 1OV4A 1S1CA 3P0RA 2OKCA 3VZBA 1X1SA 3BDAA 3LPLA 2J5QA 4MDFA 3HWRA 1PQ4A 4TLDA 3UFXB 4ZYLA 5IXYA 2XXJA 2WDZA 3GFVA 4RHFA 1U2QA 3U7JA 2W6IA 2FWBA 4MI6A 5D87A 1NBHA 3JAMA 2B1IA 1IC6A 2XQIA 4HQ6A 2HF2A 3WRXC 4HH1A 4JZKA 1PNVA 1WV0A 1IHUA 4OOFA 3HUFA 1W52X 3DL2A 3WXBA 3MBIA 3TD9A 2O8EB 2P9YA 2C77A 2CWWA 3AMVA 4QGSA 4IDOA 4MV4A 5IAEA 4YT2A 2C7RA 1UBNA 4HB0A 5JXWA 3G2PA 2ORWA 2H2HA 1DIAA 5EJFA 1V4NA 3UFBA 4R71A 2GVDC 3JWHA 1IJKA 4RGQA 5GZ3A 2CE7A 1HM5A 4I8XA 1F1JA 1LQ2A 2DFPA 3USES 2HMWA 3O2JA 2BEWB 3KQTA 5LBUA 3DBLB 2VTBB 1X7HA 2BGWA 2NT4A 4UDOA 5B5SA 3ZWOA 2EFHB 4DB2A 3C3AA 4FZVA 1EIWA 2R79A 1E2MA 3OU7A 2QLLA 1Z75A 3RV3A 1KXZA 1SEPA 3SSOA 2WICA 5BSRA 1UF9A 4TRRA 1T2CA 1JR3A 1R9JA 1NJ2A 2EFYA 3QWHA 2FE4A 2XJ4A 2CFSA 3O94A 4JJ7A 4PV7A 3CC8A 1JGTA 4K9KA 4RCZA 2NYVA 2XTNA 1XLTA 4XUCA 4UNIA 3RH0A 4CL0A 1DFGA 2M1XA 1LEHA 1OZFA 3ILXA 4HGOA 4KL8S 5EIWA 4K87A 4JQZA 4URXR 1NLYA 3ZZ0A 1T5HX 3H9BA 2J07A 4O4JB 5EE0A 5DN6D 1M33A 3P7MA 3H8WA 3UJ9A 3K3PA 4RVCA 2UUBB 4LV5B 1ZYUA 3ZWBA 1ODTC 1R9NA 1TLTA 2PSSA 1K8XB 4IQ4A 4OVKA 1MR3F 5CIQA 1SXHA 3IULA 4GH5A 4GMDA 3PIRA 4MYHA 1GWNA 3R7WB 5LJIA 3AEUB 1W1UA 3UG6A 4F8EA 1P4AA 1QWOA 2J3KA 5GVSA 1B93A 1JI0A 2C88A 5IM4A 2PH3A 3H42B 4RELA 4QDJA 3U39A 4CCSA 4DCNA 4OIFA 4PZPA 1J0AA 3LFUA 5L3ZA 3BB1A 3SC2B 5KJFA 2H8KA 2GBIA 2RD2A 4IILA 1K08A 1BQ3A 4JR2A 1SC1A 1DRUA 2CNKA 3SGLA 5JNSA 5JS2A 4REOA 3VDQA 5CB4F 2PUWA 4Q9IA 3G8AA 2R8RA 2GF0A 4JI3B 2FFRA 1V5EA 5BMVA 2Q7DA 5IAOA 3DL0A 3EE6A 3FLEA 4H3HB 1QQ6A 2DAPA 1II9A 4QGFA 4J07A 5JDIA 1XMSA 3AK4A 1LWOA 1YONA 2NAFA 3EB9A 1Z4KA 3O95A 1SHZA 1AZSC 2BL4A 2R6R1 4QREA 2ZBRA 4TN1A 5EKXA 1L5OA 3TIXB 1VL8A 4HYTA 1KHHA 4I66A 4GBGA 1MB4A 5T6MA 1I1HA 3IVRA 2CD9A 3FHCB 1LSUA 4KE7A 4O4IB 1RBMA 4KGZA 3VC7A 2JJMA 5CJPA 4AJ4A 4BLRA 5G02A 4I4TA 4AUEA 3HJAA 1FFBA 2HXYA 1FTGA 2Q2VA 1MEJA 3FFWA 4JU9A 4URFA 3WNDA 2ATIA 3X0DA 4DRXB 5BSGA 1M1XB 4D6PA 4WI1A 1LDGA 2PX3A 3INTA 2XBLA 4OP1A 4BKUA 1W59A 4HT3B 3SLKA 3W8DA 4IIGA 2ET6A 1QGDA 1E7YA 5JCOA 4EJ0A 2BDEA 4UTNA 3DE7X 1B15A 3IEUA 3O2QB 4XPZA 3RT7A 5A6SA 1XZLA 3IOYA 1TLLA 3MN1A 3N9IA 2JD2A 2X0DA 3SR3A 3CVOA 3GLSA 4C01A 2OVFA 2C58A 3AEQA 1CY8A 4GMHA 2VH1A 2FV8A 2A58A 4CQNA 2QQEA 3QEAZ 1IRIA 1ESEA 4A9AA 2GEUA 4R01A 4JS0A 4MUNA 3WKCA 4TVOA 3RVPA 1PR0A 3UWMA 4B3HA 2FR0A 1IOWA 3FPFA 3WDLA 3S8YA 3LA8A 2ECKA 3TAXA 1B0PA 2VDNB 3M34A 2FEKA 5FDFA 2VAMA 1UKVY 2MYTA 1DAEA 1XPOA 5CPBA 2EWVA 4C6HA 1XI2A 1FXUA 4C3UA 2OEPA 4P0TA 4YMWA 2UZAA 3BL5A 1ZK0A 2GNPA 2NXNA 3NTVA 1C8VB 1ZMBA 2H9IA 3W8NA 1NSTA 1PQPA 2V6FA 1DKUA 2PU7A 3J81A 2LWIA 3RADC 3ZY3A 1WXFA 5CTAA 1VB3A 1I1OA 1T0HB 2DTEA 3RREA 3RU9A 2ST1A 3NDRA 3QPWA 3UICA 4ARSA 3QHQA 1AXGA 4LMRA 1G64A 2YNMC 3IKMB 4RKRA 2AFVA 2Z5VA 1MN6A 2W6NA 3L05A 3EMVA 2IZ5A 1JJAA 2VF5X 3DOHA 3N1UA 4K9QA 3T54A 3WGKA 5BVHA 3ORQA 5I4CA 2PV0A 3MJEA 3NOXA 1QOZA 1T6ZA 3AJRA 4KNWA 2UUOA 3G8CA 1CFZA 3CT4A 3RC1A 2FR8C 1ZK2A 2GN9A 3PYMA 4G2NA 4P93A 5C7IO 1UK7A 2D1SA 5E7JA 2BH2A 5IKPA 1FXWF 2FGJA 2ISQA 4N03A 2RGDA 4PGAA 4FXPA 4TV9B 5BWLA 1JKXA 1NG1A 2C57A 3FVRA 3GAFA 4NDAA 3TZHA 5AW2A 2VZEA 2P62A 3HG7A 2BZGA 3LBYA 4B4VA 2W8BA 4KP7A 3PE4A 5DK6A 3NORA 2J87A 4WZAB 4J9VA 3ZV4A 4TYWA 2VNKA 1HYEA 2ZR7A 2Q8QA 4LJKA 1UXIA 3BPSA 3LY9A 3U7QA 2XI4A 4Z4IA 3DYVA 2CKDA 3KQMA 3PFBA 4AKHA 2WVGA 3FXAA 3FZYA 2RHBA 4N9WA 2F4NA 4QPNA 3GLVA 1UT8A 5ES3A 2D4AA 1R8XA 1QHEA 3RSOA 1EDDA 4YAJA 1E69A 1U0FA 2JGKA 4R6WA 4TYPA 3T3DA 4EENA 3OH8A 4YUWA 3R24A 3AILA 5EJ8A 1NV8A 1SUBA 4FSHA 4HWOA 2C2XA 4LZOA 2IZZA 3O3OB 3H2GA 4RE5A 3FNFA 3IOMA 3VOTA 4BWVA 3NKLA 2G4LA 3A1UA 2H85A 3BMQB 3WYDA 2BSAA 4BAGA 10MHA 3MCWA 3ZZ1A 3TCNA 4ARCA 1ZESA 2I0FA 5IPFA 1CEYA 3VR3A 2R751 1GCUA 3K70C 4MVXA 2RE8A 2JJ1A 4X7RA 4NNOA 3WIEA 4C2UA 3HJHA 1PJRA 4JY7A 4U2GA 1X80B 3WHKA 3DZJA 3N8KA 4KLNA 3NWJA 4OQMA 2W70A 3JQAA 4GQIA 1B6GA 3FTFA 4ZYWA 2GAOA 1DE0A 3H5AA 1XZMA 8LDHA 1CUXA 1TTQB 2C4UA 2QX9A 3E81A 3FYUA 3L1JA 4PF1A 4DIKA 1E8DA 1I7QB 4FFLA 1QHHA 1RWPA 2H4ZA 2YJ5A 3PC2A 4ILEA 4BV3A 4EFMA 4AJOA 3PJDA 1DO2A 1PG2A 3FLAA 2PZEA 4HNHA 2HDHA 2JKVA 3EUWA 2JLQA 3LL7A 4GI7A 4YFYA 3TVYA 4B6FA 4EEKA 1EXMA 3PX3A 1R2QA 1E6KA 4KWEA 4YMLA 5KVAA 5G40A 4B3RB 4H7KA 5ALJA 4H3SA 1N6HA 2IRWA 1GDHA 3RE1A 5CDFA 2QUZA 1KBQA 2VAXA 4TV8B 3GVCA 2C84A 1OFTA 2ERYA 5K4HA 3HKEB 3TXYA 1H3EA 2FX3A 3MTBA 1TADA 3G2NA 1ULSA 2ZI4A 3KUDA 4QG7A 1OW3B 4AF7A 1T10A 4RMJA 3ANLA 4RUKA 5THQA 4BO3A 4YCLA 3OTQA 4PO3X 1FFWA 3B2NA 5F64A 3EISA 1G8HA 4Q3DA 4U2CA 4O2RA 3PUYA 1EQ2A 4QEDA 3ITEA 2Q21A 4NTZA 5G0UA 5K3CA 5LXTF 3W5DA 2IIPA 3IQWA 4V0NA 2FHPA 2YZ7A 2W6QA 2H9AA 2YWGA 4X54A 3NG1A 3T06B 4MKRA 1VMEA 1SUFA 3AY0A 1I0LA 3IODA 2C4TA 1IQRA 4IOJA 4PG5A 1RXWA 4LF4B 2BEWA 2VTBA 4YC7A 3BWCA 3BL8A 2CDAA 3L8HA 4KH0A 4YMGA 2P79A 3DCNA 3WL7A 3H2BA 2R1ZA 4IMRA 4FB4A 2BTQA 4UE3S 1U3TA 2GERA 1G1AA 2QRGA 3ENNA 3K8YA 1KO8A 1P2VA 2C99A 4LJLA 3GYGA 1KEVA 2VRCA 3QVMA 4BV2A 4ZI2A 2H57A 3DZGA 3COWA 3LHKA 3HI4A 4RK7A 4DMGA 5EHXA 1PLLA 1UK9A 5AICA 2XYPA 1QTIA 3QY9A 3VTZA 3WXMA 3AHCA 4TQAA 4M0FA 3DULA 2CXOA 5TMBA 1V1RA 4NULA 1I1NA 2AZ4A 4TUYB 5F2EA 5HJ2A 2CFTA 1FFGA 5C51B 2XGGA 4J91A 1J8FA 4KE9A 1JECA 4ZT6A 3X43A 2MYPA 3ZG6A 5C8VA 1B6TA 3NYRA 3RIHA 2G71A 4IOLA 1E2LA 3LUBA 4ZICA 5BWOA 2X2EA 2AKYA 4LNHA 3C4JA 3E3LA 1L6RA 2RCYA 3F7OA 4M76B 4RIGA 2WM2A 3WIVA 5CLJA 4DLAA 2I9KA 4X20A 5TQJA 1E92A 3A9SA 5C32A 2H2WA 4L28A 2CDRA 3JWIA 4HATA 2WJPA 3VR0A 3JQGA 4Y0NA 4S1VA 2NQ8A 3REFA 1JE0A 4O4LF 3V7UA 5L6MB 2QTGA 2ZWPA 5FULA 1K6IA 1SQFA 3OQOA 4DB4A 4LOHA 2X8LA 3BJIC 1ZGCA 3WTBA 4KREA 2AXNA 4OD0A 5E3JA 3VHLB 2HH9A 1PE0A 5JH7B 1NDHA 1CJUC 4Y0AA 5G3ZA 4KV7A 1FDWA 3ICCA 5A0FA 5H83A 3ZH9B 1KDVA 3DZCA 4HDKA 1D2NA 1RWNA 3CU5A 1UXJA 2ZIUB 3THRA 4A03A 3PTAA 4A1OA 5B3KA 4FNMA 3LQ1A 3KQUA 3WA7A 3NFYA 1U8CB 3MD9A 2R48A 1SVWA 4L3OA 3F96A 1V5GA 4QGGA 3Q8MA 4FE7A 4JB2A 3WWEA 1TVEA 2BI7A 2GSDA 3TLYA 3Q7TA 4MJ3A 1TM7E 4U7HA 4GM1A 4QBGB 2JVIA 2INGX 3E3MA 3H18A 4Q0MA 4FOSA 3OM9A 1FDUA 5BSHA 1Z5UA 4Z6KA 2IITA 5BRJA 3Q9NA 4CODB 2GZAA 3EC1A 4U2FA 3VYTB 1L5QA 4DV4B 3S7TA 2L18A 4DMMA 4QDTA 3A70A 2YFQA 1RNLA 4MRMB 4OHXA 3C41J 2ZJZA 3GMDA 4UBOA 2CN1A 2PH7A 5AVYA 2RHLA 3IXLA 3X1MA 1YR6A 4CZ2A 2FOXA 1Z7GA 4AKSA 4NU0A 3HU2A 4PQEA 1XTRA 5FA8A 4KJXA 1QS0A 2CV1A 1VBMA 2AMYA 2NO0A 3MJFA 2OXTA 3SVLA 1JZQA 5CT9A 4OK5A 1IY2A 2DBRA 2YZGA 3WIOA 4NESA 4BP8A 2VQFB 3U44A 5EA2A 3RW9A 4K9MA 1RPNA 2YXDA 1ML3A 4RDXA 3G7SA 1BX1A 1NQXA 4LW8A 5AVJA 1W36D 3MMXA 4W1QA 2HWYA 4EYOA 1P4RA 3CLHA 4RHXA 1XU4A 4DAOA 3H97A 2X3FA 3NGXA 5CFNA 4RTSA 3N8GA 2I78A 4C0WA 3OX3A 4OQNA 5AUNB 1DFHA 3KDPA 3AL0C 3L7CA 3QQ5A 4QUEA 1X9GA 4YMHA 1VSQA 1X0XA 2WSSA 3NYWA 2I2AA 1SXPA 1FP1D 2WWWA 1D2RA 3WZLA 4C7XA 2IBMA 3WIUA 5K3EA 2BCGY 1B3RA 3LRPA 1U9YA 3LY8A 4K6KA 3UF0A 4B71A 4P35A 5CFRA 1NKVA 3T5CA 3IBYA 1OWOA 2RARA 1EFUA 1SK8A 4UDXX 3ZN2A 4B6SA 3O2SB 1RMQA 1A3CA 4MV7A 4EY7A 3B1ZA 4B1FA 4EVRA 5KNDD 1MB3A 1WA5A 1TVKB 4P7GA 1G55A 5J2TB 2R6CA 2VHZA 4FFMA 3V8NA 2DTDA 3KT8A 1IY0A 3A26A 2QVGA 3H5IA 4R7TA 5C81A 3C3CA 5I01A 2BTEA 4RMHA 1CZKA 1YJAA 3BIOA 1JFFA 2ZRGA 2BBSA 4MWDA 4UUBA 1EXNA 1RABA 2NZXA 1OD6A 2RHOA 4NQRA 3BWVA 4U7TB 2W00A 2RB5A 4RACA 5K6RA 2YDXA 1SUAA 3B51X 3CEPB 4LHSA 4TKZA 4BVGA 4PPGA 4BVFA 5K6AA 4OQXA 1RR6A 1A97A 4QECA 2VDWA 4RIIA 2HFKA 1R0CA 3IPAA 4I9GA 4Z4HA 3LPMA 4PIPA 5IKXA 1DWOA 1YACA 5HIAA 5ARBA 2G8NA 3SC2A 3V33A 1ZNZA 1QYIA 2WU8A 3HEAA 2HO4A 3JV7A 4N0DA 3MSCA 3UVEA 3S2FA 1KPGA 2GPSA 1X87A 1UBMS 2I99A 4H1HA 1D7AA 4LQCA 3G23A 4RL4A 3N6RA 5DP1A 3U13A 3VDNB 2WB2A 1L4KA 2P67A 5D6NA 4GYJA 2FRVA 1ZFNA 1JMVA 1FU8A 2QSYA 5CT4A 2GBLC 2YXPX 2C7BA 2AI1A 1VZ3A 3LHFA 4H3VA 2R1VA 5NLLA 1HFJA 1KDPA 2JFVA 5AKZA 3QYFA 2ZRFA 3R5JA 3ZE6A 1NSYA 4BQRA 4CIAA 5KTRA 1KWKA 1QTRA 4D25A 1BMFD 3G2LA 1JDZA 3MINA 1WBJB 5CBKA 1FC0A 4QYIA 4R84A 1Q1GA 4KRYA 1FNSA 3H9CA 1NVBA 3HZHA 1ZH8A 2LGJA 3NH6A 4FM9A 2ID8A 1IHDA 2YHBA 2VDMB 2RB4A 3OFNA 4Q00A 4RETA 4HDMB 4NMMA 1EU1A 3SPXA 1JJFA 1AHHA 2COKA 4G9EA 2GM3A 3EVEA 1WS6A 1IN5A 4J1NA 2C9YA 2R7NA 4G4IA 4EG5A 5KCMA 5K8IA 1MGOA 1N6LA 1L8LA 4PLTA 2I22A 3HMKA 4RK0A 1MZVA 4UW9A 2MOKA 2RKBA 3KDSE 1GTRA 1NW6A 2VRCD 4I9HA 5CJ2A 3SXPA 1CULC 2FR1A 1R6XA 3NJ8A 2Z1MA 2GX6A 1A7KA 4R4JA 1X1QA 1VIAA 2YY5A 3FNGA 3Q8XB 4IMPA 3TQQA 5EWLA 3U3KA 5AVSA 1JSRA 3A25A 4KWCA 5AJWA 1Y82A 2H54A 1A4IA 3QOYA 3V8RA 1Z37A 3ZDEA 1NZJA 2H3EA 1RWVA 2QS9A 2YWHA 4K9DA 4X5OA 2RBGA 5F7JA 1I80A 4G4SP 4BLUA 4CUKA 4E5DA 3MCAA 4K9SA 3ILSA 4JI7B 1YB1A 1A5AB 5B1YA 1Z5ZA 3SYTA 4AIRA 3MXOA 1VKNA 1GAEO 1GQSA 2FW6A 4TGLA 2X0EA 3CMMA 1RYYA 2GASA 4AUMA 4BKMA 3C48A 4BRWA 3GU3A 4YHBA 3EDCA 4X84A 1Z6YA 2C0QA 4PGGA 4EY5A 1RLJA 2PKEA 2BKVA 3BH0A 3V4PB 3PZRA 1RM5A 3NDJA 2PRYA 5LLTA 1R8SA 2HWXA 1KAOA 1V5WA 2ZSHA 1PR9A 4B6JA 2ZS8A 4HLCA 3CNHA 2GWHA 3LY5A 4NFSA 2DB3A 1S89A 3NCHA 2JZOA 1HRKA 3FZQA 1BJRE 1YGPA 5FNZA 3VVMA 3GJRA 4Q4JA 4RH3A 2FPUA 2BFFA 5THXA 3FNEA 2NN3C 2QW1A 2B94A 4EQ6A 1RVV1 1CWUA 3OPVA 4X64B 1SCNE 3CZ9A 2Z4TA 4S1OA 2DQZA 2G82A 3QFRA 4UQPA 4CLRB 1YAHA 3BE5A 1Q95A 1Y8AA 3ROFA 3U3ZA 4BE7B 1GSHA 3JR7A 1UAYA 1QG2A 2FFBA 1R0SA 1NE7A 2HUNA 3C7KA 2Y76A 2QXYA 3AL3A 3QFSA 2EAUA 2VTVA 3CF4A 3UATA 4HZUB 2YJ3A 3VNUA 3TX6A 5CVCA 3TRDA 3T3IA 1G66A 3F1LA 4RQTA 1KYTA 1F5SA 4GR9A 2YS6A 2EOAA 3DQZA 1IOZA 1R18A 2PSDA 3M81A 1O7JA 4PLFA 3WJAA 4LC0A 5GAJA 3LK7A 4R05A 4FMBB 4WESB 3EUAA 5H81A 4H4DA 2UV8A 5IDWA 2VXOA 1LKZA 2ZUBA 4W9NA 1FU7A 3BAZA 4ZWNA 2JFYA 3HN2A 1DOZA 1YDEA 4OATA 1AGPA 2WKRA 2I8CA 3GEHA 4IM7A 1XN1A 4X8HA 2O4UX 3MTGA 1SCDA 1RMTA 4PZEA 3GFSA 2CLDX 4QATA 3TEMA 3U4MA 4I50A 3JQ8B 1P3JA 1LPMA 3T7IA 3SXUB 4V0LA 3UWKA 3RFUA 5HWSA 2HPHA 4L75A 3EXG1 1L5WA 1P1CA 4G2TA 2XRMA 2HNKA 4IJUA 5GZ6A 2OYRA 3R3UA 1MIHA 1ZI8A 1YE5A 2IA5A 3G02A 3KOZA 4M8SA 4JMPA 3TTSA 3ZHQA 4B2PA 4Y2TA 1H8ED 3CX4A 4C7KA 1YVEI 4NEGA 5JW6A 4URYR 4R7GA 1NJFA 3A1FA 3QG5A 1H42A 3DV0A 1ISGA 3H84A 4E09A 4X6YA 3RRJA 2HZ7A 2Z1DA 1I4EB 2IC5A 4DIOA 2IELA 1M2WA 5TR9A 1WSDA 2G83A 3SHTA 2A8YA 5ECGC 3AF2A 4X65B 2CF6A 4TKVA 3PHIA 4I50F 3G2OA 3UUWA 1QQ5A 1DQZA 1DKMA 1PG5A 2NZVG 3G8BA 2PUEA 1W5EA 4MKGA 2QG6A 1DVRA 1L5RA 5D51S 1RTTA 3VVBA 2BKLA 4AQ7A 1E4EB 4R69A 2A59A 3DMGA 3DOOA 4WN3A 1HRDA 3H1AA 4FGLA 3IAM1 4ALIA 2XB2A 4MITA 1RYHA 2YIDA 1QNFA 3I9FA 2PJZA 2PKXA 2UAGA 3LX8A 3Q9UA 4NBSA 4CMEC 1JIUA 1L5KA 3PNBA 3UTCA 3KLBA 4CG1A 2H1FA 3RSGA 5FPQA 4KLZA 3WDMA 3QE2A 3VSEA 4ILKA 1RWXA 4CM5A 1SRRA 5LOVA 1QGED 5BVGB 5KTTA 4IIUA 3BEDA 2FMXA 2C83A 2OQIA 3BCSA 4U6QA 1XAHA 4ZQGA 2ILTA 4L2IB 4XPIB 3TLXA 1YBVA 4DZZA 1M5TA 1IK6A 3AESA 5CLHA 4BGIA 1WLYA 3PQ6A 2V0GA 3TLMA 4C30A 3R74A 3AIOA 1QRTA 1JJIA 1OLOA 5KI6A 4IUBS 4GL4A 4PLVA 3BXEA 5AI8A 1N5MA 4B81A 4B47A 2C2BA 1PR2A 1QP8A 5KTOA 1UOEA 3MUNA 4RY2A 1GXSB 2QRJA 4LTDA 1R5JA 3KXIA 4EITA 3V4RA 2A9RA 1VPDA 1V8PA 3FM9A 3PQCA 1YQ9A 2WTBA 3D1VA 4LMAA 5DYYA 2LNDA 2Q0XA 4CM9A 4ZI7A 1N3IA 3GGDA 1Z4LA 5DMXA 2QLTA 4EKYA 2WMYA 1KFEB 3OMWA 4UREA 1DQRA 4GR5A 3LKVA 1R27A 1OVMA 4MVJA 3W04A 3ZX4A 1D4AA 5FWXA 1I13A 3NAMA 3VSAA 1YDHA 1D6JA 3DAGA 1I30A 3OJWA 3QW2A 2X6RA 4OYRA 3KYCA 2BPOA 1RJDA 1TUBB 4K26A 1YVUA 5KOYA 4IVNA 5F9MA 3VNRA 3B12A 4D9JA 5HKAA 2VIIA 3WL8A 5MFZA 1LSJA 4F4DA 1DT5A 3MZ0A 2V6JA 1U28A 3IQIX 1C1HA 1T4GA 1T9GS 2HCTA 3A4IA 3E4CA 1I7LA 3NWBA 1N77A 4BX9A 4QOFA 2A9KA 1KBZA 3ZE1B 3K0CC 4I3FA 2AQHA 1KQFA 4B0PA 3JVDA 3M4NA 1TDJA 3O4GA 2VNAA 3M3DA 3KSAC 3EVCA 1A1VA 3BMCB 5C4MA 3WMEA 2PX0A 2QRZA 3RASA 2XEXA 2BM9A 2QTWB 4FGKA 2REBA 3PIDA 1VGVA 2B3TA 3IESA 2F2TA 2DOKA 2X5NA 5FXMA 4YRJA 4BN5A 2DULA 2XIJA 1R0BA 2DSNA 2ENWA 1AKNA 2K2QB 2VNHA