3FTPA

Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from burkholderia pseudomallei at 2.05 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
248
structure length
248
Chain Sequence
DKTLDKQVAIVTGASRGIGRAIALELARRGAMVIGTATTEAGAEGIGAAFKQAGLEGRGAVLNVNDATAVDALVESTLKEFGALNVLVNNAGITQDQLAMRMKDDEWDAVIDTNLKAVFRLSRAVLRPMMKARGGRIVNITSVVGSAGNPGQVNYAAAKAGVAGMTRALAREIGSRGITVNCVAPGFIDTDMTKGLPQEQQTALKTQIPLGRLGSPEDIAHAVAFLASPQAGYITGTTLHVNGGMFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Oxidoreductase
total genus 84
structure length 248
sequence length 248
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2009-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ftpA00
1LJ8A 2C20A 4CLEA 2RHRA 1HYHA 1H94A 2ZB4A 4KWHA 6ADHA 2HK9A 3PLNA 3INRA 3AU8A 1W0CA 3WGOA 2Y1EA 2IXBA 1O94A 2LDXA 3RUEA 1ZNQO 5JMPA 4KUEA 5CDGA 2X1HA 3GR6A 3OETA 1VPDA 1EUDA 1NFFA 4M54A 4TSKA 5U1PA 1ONNA 1ZSNA 1R66A 4RQUA 1SOWA 5F1KA 4UREA 3ZH2A 5G4LA 4XYMA 4R3WA 2OUIA 4PVCA 1GD1O 4OQZA 1U3UA 4MP8A 3QVTA 3TL3A 4PG8A 2JHFA 1IZ9A 1E1MA 1ZIDA 3AOEC 3WWZA 2NVUA 2AEMA 2DBVO 2HSDA 4J6FA 4NPCA 3UKOA 3HFGA 3OM9A 1O0SA 1GV0A 3GLQA 3QP9A 1GYRA 1PTJA 3PQEA 1YBVA 1GUZA 2ET6A 4TMFA 2VRBA 1QLJA 5KVVA 4JJIA 4N7RA 3WSWA 2I5PO 1CERA 3ENKA 1ONPA 1T1RA 3H8VA 1LQTA 3H5AA 1MB4A 5IDYA 2JKVA 3FN4A 3O26A 5JCJA 1N7GA 2OHXA 1M6WA 4RZIA 4OJNA 1Y9AA 4PLFA 4EDFA 1MA0A 5IG2A 4R16A 1YDWA 1E3IA 3Q3CA 3JSAA 4J4BA 2POQX 4XA8A 3OMLA 4II3A 2B4QA 3HJAA 2YHIA 4NFSA 5JCXA 1PS0A 4AJPA 1GZ4A 5JW6A 4AICA 4UVHA 3HSKA 5B4UA 3I4FA 1P31A 4DPLA 2B4TO 2OBYA 3UCEA 2Q45A 4ALIA 4ZA2A 5CEFA 1EZ4A 2IZ0A 3ON5A 1R37A 4IQ8A 1FDTA 2WD7A 2QHXA 3SXPA 3Q11A 2CSUA 1SPXA 5F21A 4AJHA 1VKOA 1DSSG 1G0NA 2AE1A 3OJOA 4IZHA 2PZJA 4GQAA 2X8LA 3EZYA 4BVAA 5A3JA 4CM8A 3AY3A 1E7WA 3Q1LA 1NTOA 4WLEA 4GMFA 5JDCA 1TLTA 1JU9A 4NFHA 5H83A 8LDHA 1C14A 4CODB 2W2KA 4YQZA 2C29D 3CINA 2BRUA 2X0IA 2WYVA 3MWEB 2NUAA 3GH3A 1R0SA 2PZMA 4LW8A 1BGVA 1I33A 3D5TA 4CM3A 4DIBA 1DIGA 1R0KA 1PIWA 4NMHA 2W2LD 4RGBA 3OF2A 3VZSA 1ARZA 1KVQA 3DBRA 3UHAA 1UP4A 3W1VA 1V6AA 4DUPA 1DPGA 4JCOA 2CMDA 4CMEC 2NU9A 4D3FA 1UH5A 3LT1A 5DCWA 3HQ4O 4BKUA 4E2WA 4I5EA 3AOGA 1KEUA 1Q7BA 4E13A 4KMSA 1LSSA 4W82A 1RPNA 4CMIB 5KIAA 1K6XA 4UVIA 4F3YA 2P5UA 2Q46A 2X9VA 2PKQP 4I5DA 3WGTA 3AI2A 2JJYA 1A72A 2GPTA 4ZD6A 3RC2A 2QQ5A 1LSJA 3AY6A 3DZBA 4ILKA 3ZWNA 3LLVA 1SEPA 4L73A 3KYCB 4GSKA 5BSFA 1GUFA 3ZHBA 2JFGA 2XF8A 3JYPA 4AJKA 4GPD1 2JCVA 4CR8A 3FTPA 1DLIA 4FC7A 1JDJA 4JROA 4ZU3A 1O6ZA 2B36A 2DTEA 2Y05A 3KRTA 4BL5A 1OFGA 1I2ZA 1UZLA 5EERA 3VTFA 1E1NA 1E3SA 2PA3A 5CPBA 4DLLA 5JBIA 3TOZA 1KVRA 2P68A 2WYWA 2BELA 2IZ1A 1NQAO 2YUTA 1GR0A 5EN4A 3JQEA 1HL3A 2NU8A 3GPDG 2PFGA 4R9RA 2J6IA 3EVNA 3F4BA 4LRTB 1GAEO 1C1XA 1NHWA 5JAMA 3ZV6A 1ISIA 2PTGA 3OJEA 1GY8A 1H6BA 2AQHA 1QYDA 4HV4A 1UDAA 3PDUA 2YFHA 4DRYA 4IMRA 3H6KA 5ER6A 4FOSA 1Q1NA 1WNTA 5CDUA 4I5FA 4PIVA 2P91A 4JJGA 3IJPA 3JQGB 3JQAD 4QSMA 1GYQA 3F4LA 4ND5A 4NJOA 4DMLA 4BKRA 3RASA 3SX2A 4ALJA 2NTVA 5IFLA 2EJWA 2DBZA 3RC7A 2HUNA 3C24A 1MXFA 3E1KA 1LLCA 4NI5A 4UAGA 2VZ8A 3DZIA 4WEOA 3LVFO 5CEEA 2TMDA 1DXYA 4XIYA 3MTGA 4WOJA 4E33A 4OXNA 2J8ZA 2EJVA 3KSDO 2VWGA 1D8AA 3JQFA 4AJ2A 4Q3CA 3AI3A 3DONA 3ZU4A 2E37A 1KBZA 3LU1A 3A4VA 2PGDA 2X23A 4EEXA 4M1QA 3RBVA 1E6EA 4MKXA 2NADA 4YTEA 5JAQA 4E32A 3I4CA 4XQEA 3TFQA 5J23A 2GSDA 5FF9A 4BOYA 4GLLA 3ASUA 4RF4A 4BQRA 4FFLA 1Q7CA 2YZ7A 1P33A 5L7TA 3O8QB 4OKNA 2Z1MA 1B16A 1E3WA 2I67A 2XAAA 3GEMA 4QTZA 3E5MA 3TRIA 4BMVA 3H5RA 3EAGA 4IPTA 4YBZA 3QVXA 3JQCA 5DZSA 3IP3A 3IS3A 4L9RA 4J4HA 1YQDA 3I3OA 3S2EA 3C85A 4R4JA 4O0LA 4KDFA 1X7HA 3RC9A 2Q4EA 3G1TA 6LDHA 5CDSA 3H2ZA 4IUYA 4NZ9A 2GYYA 1PJ3A 3GNTA 4CM4B 4BKPA 5BNTA 4NFYA 1UXKA 2P5YA 1Z6ZA 5A1TA 4CLRA 1LRLA 3IIEA 4PN3A 2WM3A 4MKZA 3MJSA 5T5QA 1TT7A 2VOJA 3K5PA 4YAIA 2EEZA 4B7UA 1EUZA 1KETA 2E6UX 1Z7EA 1A4UA 1LQUA 2AG5A 4ALLA 2VZ9A 2RBEA 3TSCA 2WEKA 5F1PA 1YH3A 2X0RA 3WLFA 2PY6A 1GL3A 4Q3DA 1ENZA 3I9KA 3D4PA 1EVZA 4J7XA 4FFRA 4GLOA 3KM0A 4ONEA 2CF6A 3D4NA 1VC2A 5KWEA 1NAHA 4PLCA 4AJ1A 5BQFA 1SMKA 3BTVA 1UDCA 4YAEA 5EJ2A 4DGSA 5EINA 2QRJA 3PPIA 2YV3A 1XU9A 1TEHA 3V5NA 3OICA 4YXFA 5I7EA 4ZICA 4TRRA 5JO0A 2D2IA 1QYWA 3OJFA 3G79A 1TVEA 4ALNA 4DBVO 1FDWA 4E4YA 4H7PA 2C2XA 1ZJZA 2G5CA 3I1JA 4LGVA 5K6AC 2QZ9A 2CVQA 4PLZA 2EXXA 2DBRA 4C7JA 5KVCA 4P4LA 5JDIA 3MJTA 3GDOA 1E3LA 2Z1NA 4QUKA 1GEEA 1E7QA 1X15A 5BSHA 1F8FA 3NGLA 3KSUA 2Y0CA 3E48A 2WJPA 3ZWVA 2IXAA 4GSLA 3WJ7A 3ABIA 3VPFA 4DA9A 1LU9A 1R15A 2B5WA 1XCBA 2BFOA 3HN7A 4KQXA 4PG7A 3UUWA 4TKMA 4HUJA 2FHSA 5JMWA 2X5KO 2P9CA 2NU6A 4XJTA 1O9BA 1F8GA 3V8BA 4CM7A 5BSGA 3DEYX 2HQ1A 4UEKA 1MC4A 2NTJA 2I6TA 3NAQA 3G0OA 4D42A 4GI2A 1R4NA 4L4XA 3G3EA 1GCUA 3K96A 3L77A 2YHUA 2NM0A 3X2FA 3CKYA 1WW8A 4PLHA 1MC5A 2DTDA 4WLNA 4R68A 3GNSA 3LK7A 4E5MA 4QECA 3PFWO 4NBWA 1J4AA 2O4CA 4PG4A 1YXMA 3SC4A 2PGJA 5GZ3A 2UDPA 4XRRA 4R5MA 5I8WA 2PD3A 3JQ7A 4WPGA 2ZTMA 1PSDA 4K26A 3VKUA 2ZATA 2DPGA 1P3DA 1W4ZA 3PZRA 5EPOA 4Y98A 1NVTA 3V1YA 5IZCC 3K92A 2VUSA 5KJFA 3DBHB 3WTCA 1BMDA 2HK7A 1ISFA 3JYLA 1P44A 3H3JA 3JQ8A 1KEWA 1MG0A 1P1HA 4CMBA 2Y1OA 2Y68A 1I24A 4R1SA 1EFLA 4HNGA 3L07A 1BXGA 1AHHA 2UUPA 4PFJA 2GNAA 1P1RA 1SO8A 4U0JA 1DLJA 3D7LA 3GRPA 2J5QA 1BW9A 1KIFA 1XWFA 2HMUA 2NTNA 1NYTA 1JQBA 3A28A 2IYOA 2GASA 4B3JA 4DQXA 3GT0A 5F3RA 2I99A 4G65A 3R3SA 4YPOA 4UVDA 4ALMA 4DVJA 2O3TA 2Y93A 2XXBA 2W98A 1K0UA 1T4DA 3K31A 4R5HA 4GVXA 3LZ6A 2QRKA 5T64A 4PLPA 1DO8A 2WMDA 5A05A 4DYVA 2DC1A 3QIVA 1DFGA 4UULA 1VE9A 3GG9A 3AM5A 5TGDA 4E5NA 4RO0A 1JN0A 1WMAA 3A14A 5A02A 1EVYA 3BMNA 2A92A 1WMBA 2ZTVA 2FR8A 3CPSA 3ONEA 4LSMA 2FPPA 1VSVA 4FIZA 5ENDA 3B20A 1PGJA 2O7QA 4II2A 3A9WA 4BKQA 4HBGA 5AQ1A 4CUKA 2CVOA 1K89A 4I9HA 1N7HA 3ZHXA 1B3RA 4FSHA 2Q4BA 3WFJA 5ES3A 4BNZA 1HDZA 1PS9A 1E77A 1L7DA 3SVTA 5AVOA 4OL9A 4QO7A 5CPFA 3BMCA 2ZYDA 1J0XO 1OC2A 3NJ8A 5IDWA 3RFXA 1NHGA 1WZEA 1CEQA 1HLDA 3GZNA 5HBRA 2A35A 3U4DA 3V2GA 3QW2A 2V6MA 3PHJA 3QWAA 5GY7A 5IF3A 1C1DA 3FNGA 3NT4A 4ZQHA 1J6UA 2FR1A 1ULSA 1YVEI 5JAIA 3PHLA 4IZIA 1IPEA 4PG6A 4PLWA 2P4HX 4PCVA 3JD3A 5H82A 5TT1A 3IL2A 2FPGA 4P38A 4CV3A 1VRWA 3WYBA 3LT4A 1OAAA 5A06A 5U9CA 2ILTA 1H9AA 1EK5A 1ZK0A 2EW8A 5A04A 2QYTA 4IQ0A 3WLEA 4OSOA 2EKQA 1U9JA 1GCOA 3VVCA 4OO3A 1YJ8A 3RUCA 4BO7A 3ASVA 3AUUA 3WSVA 4B4WA 3GDFA 1PU2A 3GEGA 5TJ9A 4J4TA 2ZJ0A 4FB5A 4B4UA 1N5DA 1U2GA 4AJLA 5ENVA 2DUUA 5T6BA 4AG3A 3WFIA 4NBUA 4D44A 1IZ0A 3PVZA 4TZTA 3W8DA 2ZYAA 5FYDA 1CYDA 2AHRA 3K30A 1E1LA 4YDRA 2VNAA 4CLOB 1CRWG 1PR3A 3QVOA 3L0DA 5F1OA 2W2LA 3ADPA 4CMCA 1HDOA 2Y0EA 1WDMA 4BO6A 4D7AA 3FR8A 2FSSA 1EQ2A 1U2DA 1RM4A 2HDHA 3C1TA 3ZWYA 4WCFA 2JAPA 4B7CA 2D4AA 1PJ4A 3D64A 3S2GA 1JAXA 4UUOA 2O3QA 3L6EA 3GFGA 2D5AA 2VT3A 2Y99A 3GRKA 5B37A 3NDIA 4N18A 3TPCA 4Z0PA 3V2UA 4BO9A 4MVJM 4YT4A 2FZEA 4Q39A 3WGQA 3UAGA 1TT5B 3M1LA 3WMXA 1E7RA 3F5SA 4W7HA 2BFMA 3ZWPA 1AE1A 4EZBA 5L7WA 1EFKA 1UXHA 2VT2A 1MXHA 1ZEMA 3O4RA 2D8AA 2Q2QA 2DBQA 4BO8A 4IDFA 3P2OA 2HMSA 1Y8RB 1E0DA 4RPJA 4J7CA 4TRNA 3VVBA 1IHYA 4GKBA 1EMDA 1VJ0A 2ZB3A 5DP2A 1MFPA 1N2SA 1HRDA 1NPDA 3OA0A 2CUKA 4J7UA 5DDIP 3B1KA 3TFOA 3AI1A 5F5LA 2NVBA 1SB8A 2JD1A 1HT0A 1ZKMA 4CM9D 4LCJA 5ER9A 1YJQA 4P4GA 1DIHA 5HM8A 2YYYA 1DRUA 3B6ZA 3M2TA 1YGYA 4LISA 4JLWA 2D1YA 3IC5A 2X4GA 3WQRA 1NR1A 1YE3A 4CM1A 3DBLB 1OZAA 1QR6A 2PK3A 3EZLA 3W4IA 3MOIA 2CDBA 4YRAA 1A9ZA 2B35A 1B26A 1T25A 3PJGA 4J90A 4BNHA 3DHEA 3GMDA 2HMVA 3JV7A 3L6DA 3G17A 4ZRMA 1R12A 2JD2A 4CMIA 1VL6A 3ZI0A 4XQGA 3OECA 1U3VA 4N5MA 4JK3A 3DOCA 3O9ZA 3PP8A 1LDBA 1E5QA 1IULA 1IOLA 3EMKA 3KYCA 5T8KA 2OMEA 4JXKA 4MVJF 3DXFA 5DCUA 3GAFA 5HWSA 2VWQA 1L1FA 4YJFB 5KNLA 4I9NA 4RVFA 5FWNA 4HKTA 1XU7A 1U7HA 1WP4A 4OQYA 4R3NA 3LC7O 4XWYA 4HFRA 4OM8A 4BNWA 1S7CA 2ZB7A 1DC3A 1LA2A 3KEQA 2JCXA 3NT2A 5GZ1A 1MUUA 2DFDA 3CZMA 3ENNA 5TS3A 4CMHA 1EE2A 1JW9B 1XA0A 4KUGA 4QXMA 4CQMD 3GHHA 4OOEA 1M2WA 4BO2A 4BS9A 4J16A 3LQFA 3TWOA 1QORA 1LDMA 4MIOA 2J5RA 1V3VA 1DHRA 5TT0A 5JYDA 4A73A 2WTBA 3GAZA 1LSOA 3VH4A 5DBFA 4YWJA 3VHRA 1LC0A 4W99A 3WGGA 3GG2A 1T24A 3E18A 2X86A 3H9GA 4R9SA 1TXGA 3KTDA 5ICMA 2IE0A 3GEDA 4IDDA 3OEYA 4TZKA 3VKVA 4URFA 1SC6A 4W4TA 4KDEA 1I3MA 3E5RA 3JQGA 1SCUA 4MVJG 2AW5A 3ZWMA 2BH9A 3QSGA 4OIMA 4L74A 4NQZA 4WOKA 2VHXA 1Q7GA 4TRMA 5COBA 3CSDA 2FY8A 3ROPA 2W4QA 4RVGA 4RL6A 1WLYA 3IOYA 4GL4A 1I3KA 1YL5A 4BO0A 3FNHA 1LLQA 1W8DA 1C0KA 3DMTC 1T2FA 4B3IA 2C82A 3ZWAA 4NBVA 3AFNA 1D7OA 3K9QO 5ILOA 2QYSA 1GU7A 4FGWA 4CMAA 4XZ3A 4CV1A 4E5YA 4K9DA 4D46A 2DM6A 1FMCA 1ZMTA 3KHUA 1PL6A 4HFNA 4BO1A 4D79A 4XIJA 1XQ1A 4JX8A 4E5KA 3D3EA 3OIFA 3ADOA 3W8FA 1TI7A 3O38A 1B8UA 4NJMB 1QMGA 1QYXA 1NWHA 2VTEA 1U4SA 4U7WA 2ZIZA 3F9IA 5AXAA 4J0EA 5L40A 1ENYA 4JN6B 3BHIA 4LVCA 1C0LA 1LRKA 3PXXA 4P4NA 1UXJA 1Z73A 3FRJA 2I9PA 3O8QA 1HDYA 1F0YA 2A9FA 5IDQA 1T26A 1P1IA 1AXGA 4OKIA 1P0CA 2EIHA 1DEHA 3F46A 2OBNA 4YACA 5CFZA 2Y67A 1K6JA 4XYLA 1C3VA 1YB1A 2DUWA 4YAKA 3COSA 4N5LA 4B8ZA 4NNJA 2DU8A 2W90A 3L9XA 3RIHA 4QX6A 2EKLA 2FN7A 4OMUA 2EERA 4BNNA 2ZQZA 3PWZA 3MJ4A 3FBGA 4DPKA 4NIMA 3T7CA 3AK4A 3ZWBA 4YR9A 3NV9A 5L53A 4YB8A 1BDBA 3FI9A 3PQDA 2HLPA 2GERA 4TRJA 2WWRA 5A4DA 1PZGA 4LK3A 3MWDB 1C0PA 1QYCA 2YDXA 5EQFA 5IJZA 2VHWA 3MJEA 4E12A 5L4NA 4FJ0A 4BGVA 5G0WA 2JL1A 5HRUA 3D3WB 1LXCA 1XR3A 3OEWA 5AYVA 4IXTA 3HNPA 3I6IA 4YJHB 2VZ0A 2Q1UA 3ZU2A 4QEDA 1QV6A 1LUAA 5EQDA 1HDGO 1XHLA 3JQBC 4LN1A 1DDOA 4RVHA 2WE7A 4Y6PA 4YAGA 4MVJE 5COAA 1IYZA 1HETA 1YL6A 1YDEA 4FJ2A 1LDEA 2R00C 3HN2A 3N7UA 1NNUA 5TSDA 3DZHA 4BO4A 4BGIA 3NT5A 2Z5LA 1K5HA 5ICSA 4I8XA 3W4JA 2DFVA 2FZWA 4IJKA 4RF3A 1PQPA 3DHNA 5I8ZA 3EK2A 5KVQA 4FS3A 3FNEA 4TWRA 1B14A 4BNXA 1GTMA 4A7PA 1HTBA 3F1LA 3JQ6A 2GRAA 4BHTA 1EBFA 2HMWA 1MLDA 3U9LA 5MGBA 1ZVMA 1UAGA 4ROSA 3CXRA 1V8BA 1B7GO 1K2WA 5THKA 2H9IA 1NFQA 2AQIA 1C0IA 4R1NA 2NV6A 4MVJD 2O4UX 4XGIA 2NVUB 1DAPA 1UDBA 4GBJA 3TQHA 3IKTA 2VYND 4G5HA 3H2SA 3OA2A 2RAFA 4HFMA 1H5QA 1ZK2A 3ROKA 2C7GA 5A03A 2Q50A 4LSWA 3LLSA 5A5FA 1WAMA 3WXBA 3ULKA 1GPJA 2R2GA 1YBAA 1K3TA 3WGYA 7ADHA 3KZVA 4JBIA 3RROA 1R0LA 5G0UA 4U6QA 4AFNA 2PGLA 3DAGA 3V1TC 3RBZA 1U4OA 1ZBQA 2BGLA 4XQ9A 3ZNNA 3H7AA 1Y6JA 4M87A 3SEFA 4FGSA 1Y8QB 3OSUA 1WPQA 1A71A 4RZHA 1YONA 3GHYA 4J9UE 1I3NA 1DC6A 3FR7A 3Q9NA 4D0RA 1M6HA 1MG5A 2DT5A 1H2HA 3MCVA 3GDGA 1ADBA 1JWAB 1U3TA 1N92A 1FDVA 2Y1GA 3I52A 3WBBA 2HU2A 4XYGA 4R01A 3SLKA 4BV8A 4GKVA 4XEHA 3TZCA 4JP3A 3DFZA 3WX0A 5IDXA 3U0BA 3GQVA 3DBHA 3ROQA 3HZZA 4CM8B 3UCXA 4CMJA 1BWSA 4R51A 2D3TA 4GX0A 4WNIA 3C3XA 3I9NA 3TL2A 5MDHA 3WR5A 4WEQA 2HJRA 4A26A 1NP3A 2VCYA 1P74A 3MZ0A 1YBMA 3AM4A 3L4SO 1I3LA 3W8EA 4A27A 1KC3A 3GVIA 3W6UA 4I1IA 4BNJA 4BNGA 1KVSA 1LDYA 1EDOA 1ZSYA 2X6TA 1MV8A 4BNYA 2RIRA 4B4VA 3ANLA 2ZB8A 5DF1A 3KLMX 3RSHA 2QX7A 4ZN6A 3KETA 4UUMA 3C8MA 5BR7A 2UVDA 4E31A 4D3SA 1N9GB 4C7KA 3LF2A 3E9MA 3D5QA 3V1UA 2AQKA 3GZ4A 2LDBA 4CL3A 4GH5A 2BHLA 5CDTA 5IAAA 1CF2O 4J0FA 1KERA 4YA6A 3DTYA 1HLPA 4L76A 1DAOA 4XX0A 2RH4A 4Y6SA 3OBBA 4J91A 5IXYA 2HJSA 3ZNOA 2GD1O 4PVDA 1EBUA 1ISHA 3WYEA 3FHLA 4Q3NA 3PQFA 4RVUA 1LDNA 3JQDA 4IDAA 1DFHA 2D5CA 2UUOA 2VOEA 3BTSA 3RUAA 3E9NA 3IDSA 2NU7A 3AUSA 1ISGA 1ZXLA 5G2OA 4UUPA 3PJFA 2HMTA 5DT9A 3IKVA 3ICCA 2G1UA 2Q1WA 2VWPA 1H6CA 2DQ4A 3BMQA 3WNQA 1W73A 3BTOA 4TROA 4PRLA 3TZKA 4IDEA 1H2BA 2PNFA 3IQDB 3RWBA 3ZCXA 1YQXA 2EP7A 2YDYA 3DAFA 1DC4A 3FPCA 1VLLA 3ETGA 1DIBA 3LT2A 3FF4A 3BHMA 4BNIA 2VTDA 2GDZA 3ORFA 4WLFA 3H5NA 3U4HA 1M66A 3QA9A 1U5CA 1WXDA 3EUWA 5LDGA 4KTVE 4W9NC 1X7GA 3GGOA 3GN2A 3PYXA 5G4KB 1KVUA 3R3JA 3VZPA 3ZU5A 1H93A 1YB5A 3L4BC 2PKQO 4RF2A 1ZFNA 3GGPA 2QG4A 4EYEA 1XQ6A 1I01A 2P4QA 1GPDG 5EL0A 4MOWA 4ND1A 4DPMA 4E21A 3C1AA 3MEQA 2O48X 3SBOA 3ZWWA 4J49A 1QLHA 4DC1A 3ZNPA 5AXDA 2F00A 3B70A 4XRGA 1EQUA 1YKFA 4L8VA 5A5EA 5HS4A 1ZXBA 1PJBA 2BI7A 1M76A 1NVGA 2A94A 3QY9A 5A9SB 2ZTUA 2O2YA 3QE3A 5FI3A 1DRVA 2PH3A 3S55A 2DKNA 4J2OA 1NQ5A 4MDHA 2JCYA 2JFHA 5K6AA 3NKLA 5DNAA 1AXEA 4GMGA 4CM9A 5JC1A 4HWKA 3WYCA 2DVMA 2EF1A 2GN9A 3K8ZA 1NPYA 3DQPA 4CLOA 1ENOA 1H6AA 4EJMA 3U5TA 2Y0DA 2VYVA 3PYMA 2IYPA 3ANMA 4JQCA 3WNVA 1DFIA 3EYWA 2O3SA 2PKRA 3PK0A 1GQ2A 1R6DA 3DB2A 2H6EA 1DOHA 1Z75A 3ONFA 4X54A 1WDKA 1ZK3A 5IZ4A 3K2BA 3HUDA 3T4XA 1NWCA 1F06A 5DOZA 3FBTA 3VH2A 2YV1A 2GN6A 4BNMA 5CDYA 4E30A 1E5LA 3HFSA 2I3GA 1TT5A 2VUTA 3BMOB 3FTNA 1YS4A 3QVWA 4XGKA 5EIOA 4D41A 1JAYA 1P0FA 4FBGA 3KEOA 1GQQA 1T2DA 3OFSA 4IM7A 4A0SA 4RPGA 5KJEA 3NX4A 4BMSA 3Q6IA 2JAHA 2FP4A 4NBRA 5JE8A 3KYDB 4CLRB 4FPXA 4IS3A 1Y8RA 3PGXA 3WTBA 2OL4A 1YO6A 2TMGA 1E7YA 2BGKA 1VL8A 2Q1TA 1FDSA 2F1KA 1L7EA 4F6CA 1U3WA 3NTQA 3UCFA 4BO3A 3QLJA 5JY6A 1T2EA 5L3ZA 3ZHYA 2OP1A 2YW9A 3LDHA 3WQSB 4HY3A 4BIIA 2VHVA 4D0SA 1HZZA 1AUPA 1BHSA 3S2IA 3WWYA 1QKIA 3DO5A 1ZK1A 4RF5A 1HEUA 4XCVA 4CQMA 1W6UA 4RLSA 3ZWCA 3I83A 1VM6A 2PD6A 1O8CA 4L75A 4MKRA 3RKUA 3DBLA 9LDTA 4DQUA 4CM6A 1H0KA 4RPHA 2CFCA 1PS8A 4ZQBA 4Z6KA 2HCTA 3NDJA 2WE8A 1ONOA 3IJRA 1XDWA 3PIIA 3GMSA 5B12A 1ZW1A 2FR0A 3LYLA 1SNYA 3NUGA 4CLXA 1BVUA 1EE9A 3DZKA 3LC1O 1Y1PA 2PH5A 3BAZA 3DC2A 3EDMA 4KOAA 4ZVVA 2CVZA 1V3TA 4MP6A 1EUCA 4RV9A 4C4OA 4Z9YA 3PFFA 2PLAA 5L51A 4UVEA 3AWDA 1HSOA 1EDZA 4CUZA 1ZZEA 2BFPA 4R1TA 2FRDA 3MTJA 2ZCUA 4A5OA 1KS9A 2EKPA 2I66A 1HYEA 3I9MA 5L45A 3QWHA 4AJIA 4WCFC 3KUXA 2C7VA 4NBTA 1IY8A 3FNFA 2GF2A 3M6IA 5G0SA 4NK5A 3PZBA 2DPHA 3S2FA 3GVCA 2VNSA 1GFSA 4KZPA 1HZJA 1DIAA 1I30A 2GR9A 2UYYA 1AGNA 3PI7A 3INTA 3BZUA 3TZHA 4J9VA 5C7LO 4EI2A 5IXSA 2C5AA 1SB9A 5FI5A 4EUEA 1LBEA 3ZU3A 4WASA 1XKQA 4E6PA 1UXGA 1I8TA 1PL8A 3FPLA 1KOLA 1G0OA 1KEPA 4R41A 1Z82A 2GCGA 1P77A 1S6YA 4FFMA 5EESA 5TQVA 1SOVA 3KOUA 9LDBA 1FK8A 1G1AA 2PZKA 4FC6A 5JS6A 3GY0A 1PWXA 3L9WA 2Y1DA 4MVJH 1QYVA 1IHXA 4CMKA 1O5IA 3QWIA 2B0JA 2DAPA 1N1GA 4HNHA 1KYQA 5CP8A 4B79A 3NTOA 1NASA 4WUVA 2NNLD 2OXIA 4XR9A 4F45A 1J49A 2WD8A 4F46A 1ORRA 2CY0A 4H16A 1KC1A 2E48A 2GN8A 1CQIA 5LCXA 5F5NA 2CDAA 1UJMA 3JQ9C 5B4VA 3MOGA 1ZSVA 3GK3A 2B83A 1B3BA 1NQOA 2AEFA 2NQ8A 4L0QA 4UUNA 2UV8A 3WG9A 5KCZA 3KB6A 1E7MA 5JNLA 3G49A 3RVDA 4D43A 3ZHZA 2B5VA 2VQ3A 3U4CA 1E3JA 4U5QA 4IGFA 2IEDA 2NWQA 4FQ8A 3IMFA 4Q3AA 3ZGYA 1T2AA 2X0NA 4FOOA 1Y5MA 5DBGA 1R16A 2BF7A 3GNQA 4ZQEA 2EWMA 1IUKA 1E92A 2X0JA 1TA4A 2Y1CA 2VYVD 2Q99A 3M1AA 2DTXA 2EHDA 1U28A 2HKIA 3ZN2A 2QW8A 1CWUA 2OOSA 2PD4A 4IIUA 4IDBA 3EVTA 3I23A 4YJDA 4FFNA 4NU5A 2G76A 4PLGA 2AQ8A 3PLRA 4YQYA 1A4IA 1ZMOA 3BIOA 4FCCA 3I9JA 3LSYA 1HDCA 1GV1A 3VH1A 2ZTLA 3NTRA 1VKNA 5TRTA 4DLBA 4NR0A 4WE3A 4MVJA 4YAJA 2NQTA 2PZLA 1HXHA 1I5RA 2VYNA 4XB2A 1B8VA 1N1EA 1UZNA 4MINA 3EW7A 3ZWOA 4Z9XA 2W8ZA 1LSUA 3GZNB 2J5KA 5CG2A 1O89A 5HTOA 4ITUA 1GUYA 4MO2A 1LRJA 3D3WA 3HWRA 1GZ3A 4CR6A 1HWYA 1T1SA 3DTTA 5A9RA 1C1DB 2BKAA 4YJHA 1EEHA 1P1FA 3JD4A 2HK8A 1PZFA 1JKJA 4LCEA 3UOGA 1ADFA 1M75A 2O3UA 1SBYA 5T57A 5JO9A 4YRDA 4W6ZA 1P1KA 2H5LA 1I10A 2VHYA 3DAPA 3S8MA 5JXWA 1YRLA 4BB6A 2SCUA 2QRLA 3O03A 4P22A 4CLHA 1U7TA 4XYBA 4YJGB 1RM5A 4Q9NA 1EVIA 3LF1A 4MJLA 1V35A 3U09A 3U49A 4BNTA 3AW9A 3UN1A 5KOIA 3QWBA 5KVSA 5COQA 3P19A 4IGEA 4CQLB 4XYEA 3CMCO 4XGNA 1ISMA 4NK4A 4PLTA 5JPIA 1MP0A 4MP3A 1NVMB 1IE3A 4Y67A 1Q0LA 3SJUA 4CV0A 5JY1A 3SLGA 3KVOA 1R4MB 4DMMA 3T4EA 4LMRA 1I0ZA 3EC7A 1AN9A 5JDCC 3VDQA 4EW6A 1T4BA 4GVLA 4KWIA 4EGFA 2FSVA 4FN4A 4O59O 2CNBA 3FCOA 4CR7A 4JNKA 4YT8A 2QZZA 4HADA 4CL8A 2RH8A 2XXJA 5L9AA 2Q3EA 4KP7A 4J1NA 2OORA 2RCYA 2PV7A 4MIYA 3PJDA 1ZEJA 2P2SA 5ILGA 4WCFB 3WS7A 4JBHA 3N74A 4BNLA 4IS2A 2D59A 2VWHA 2B4RO 3SC6A 1I36A 4BUCA 2I3AA 2V6FA 5IN5A 3GOHA 1VL0A 4BGEA 5JAZA 1D1SA 5C37A 3RKRA 1Y8QA 2Q49A 1UXIA 2Y66A 1X1EA 2O23A 3AOEA 2GLXA 1WZIA 4QFCA 2EP5A 4N5NA 5KJCA 3H9QA 4XDZA 5HA5A 2YY7A 4BNVA 5ADHA 1HF3A 4J43A 1VSUA 3TF5A 4TKLA 3C7CB 2XOXA 1YL7A 4EUHA 2HAEA 4AJOA 3RFVA 4INAA 2J3IA 4BNFA 4GGOA 1V9LA 4ZHSA 1FXSA 1YOVB 2ZJ1A 2NSDA 3GUYA 4IXWA 2CF5A 3C7DB 1E6UA 2QIOA 4XR4A 4DQVA 5L95A 4IDCA 4AJ4A 1PEDA 3HB4X 1WWKA 3I9LA 3K2EA 4L4RA 4RDHA 4JJFA 1PZHA 3A1NA 4CM4A 1Z7BA 3OQ6A 3UH1A 1ADCA 3LT0A 2ZK7A 1EVJA 3EGOA 4ND3A 4BNKA 3DMTA 3KO8A 3ITDA 4I9UA 4QO8A 4NDNE 2C07A 3NEPX 3LC2O 1RKXA 1WDLA 4HP8A 1XLTA 2AG8A 2Z95A 3AUAA 3RUDA 3H65A 3OIGA 1N9GA 1IB6A 1CJCA 1VI2A 3VAZA 3WICA 1KEVA 3GVHA 3TJRA 1SZJG 1UR5A 3B1FA 1LX6A 1XYGA 4IJVA 1HDRA 2JHGA 3JQAB 5CEJA 1BDMA 4XDYA 3MJCA 4IMPA 1ID1A 1Z45A 3DOJA 4RVDA 3OJLA 4HFJA 3TZQA 3ANNA 1IL0A 4G81A 5TIIA 1P45A 1OC4A 3F47A 4LVUA 4D45A 1ADGA 4FDAA 1XGKA 3HDJA 2VN8A 1M67A 5KJ6A 3DMYA 3EY4A 3ICPA 1H6DA 4RPLA 4E2ZA 5AOVA 5TLSA 2BGMA 2VHZA 1JKIA 1HE2A 1B0AA 5TC4A 1J5PA 4M89A 3U4IA 3UXYA 4G2NA 1GADO 4WLVA 3JQFC 2I65A 4CMEA 5C3MA 2R6JA 4PRKA 4WNCA 4DIOA 1F17A 4QFDA 4RORA 1ISJA 3VPXA 2IRWA 3DDNA 3RCBA 5FFFA 5DBIA 1KVTA 3K73O 4XD2A 1V0JA 3UICA 3R1IA 4E5PA 2DLDA 2O3JA 1DHTA 3FSRA 1DRWA 1UZMA 1PR9A 1QSGA 3HHPA 1F14A 3P5SA 4GAEA 1JVSA 4B7XA 2GO1A 1YB4A 3X2EA 3JYOA 4OGWA 1RYDA 1SAYA 3KV3O 3WJAA 3AY7A 1Y5RA 1BTOA 3WDSA 4ZGWA 5G4KA 4CUJA 4Y8VA 3W4KA 2EW2A 1XELA 2A4KA 2HRBA 2O2SA 4WJZA 3FWNA 3TOXA 1PJTA 3JQBA 2XPCA 4JIGA 5JFOA 1BXKA 1ZK4A 1X0XA 4L4SA 1MFZA 1OI7A 2J3HA 2R00A 4IIVA 2X5JO 4R54A 4YT5A 4YRBA 4ESOA 2VUUA 2ZQYA 3PHHA 3PYLA 3RUIA 3KXDA 4A2CA 4NG5A 5BNIA 4B4OA 2YHIB 3HB5X 2FOIA 3RAJA 2JD0A 1NQTA 3JTMA 4CV2A 4ZQGA 4O63O 5A9SA 4CJXA 5KTKA 1DIRA 3U62A 4J3FA 3CEAA 1NBOA 1G6KA 1YQGA 3OIDA 5I9NA 2AMFA 2GZ3A 2JFFA 1NXQA 2WD7B 3D1LA 1I2BA 3UGKA 3VPGA 4GX1A 5I9MA 1Q0QA 5TX7A 3NGXA 2G0TA 3Q9UA 5JYEA 1DC5A 2GZ2A 2YV2A 3VH3A 3NYWA 3VDRA 5ITWA 5C5IA 3UF0A 3JD1A 4OSPA 3C7AA 4J1QA 1RWBA 2YJZA 3RD5A 5LC1A 2PR2A 4AJNA 3PDJA 4RCVA 5KKAA 3PRJA 3WB9A 2W2KB 4BKOA 3E03A 3TDKA 1ENPA 3CTMA 4EITA 4BQPA 3IUPA 2O7SA 2CDCA 5DOVA 4WGGA 4RDIA 3CMMA 4EEZA 5L4SA 3CE6A 3DBRB 5CHEA 3OQBA 1NAIA 3BMOA 4TVOA 5JCJD 1U8FO 2X58A 4TVBA 5I7VA 2BLLA 3VZRA 3WBFA 4EUFA 3PHIA 1Q0HA 3N58A 4XKJA 5JDIC 1PJCA 1CDOA 5L7YA 3ZV5A 4I5GA 3KYDA 3PWKA 4FJ1A 1UAYA 3WGIA 1DJNA 4U6SA 1K6IA 1A27A 1A5ZA 3E9QA 3ZV4A 1OOEA 2C59A 3WOHA 4CMGA 4RVSA 3L6OO 4WECA 5ITVA 1GEGA 1I2CA 1Q2XA 4BO5A 4XB1A 5FEUA 4DYDA 3QV1A 5DCYA 4PZDA 1E1KA 1DBVO 3F1KA 3IAHA 3QWFA 2WSBA 4GGPA 4RPKA 3DHYA 3ST7A 4BMNA 4ALKA 4YVFA 4FW8A 1LLDA 2O3RA 1JKFA 3ZZNA 3JYNA 5TJHA 3GA0A 5DN9A 5GMOA 3RJ5A 3K6JA 3QQPA 4DL9A 1LLUA 3INGA 4BB5A 3E82A 4U0KA 1JLLA 3NRCA 3IUSA 3UVEA 1T2CA 1FJHA 3KSZO 4HXYA 4ZRNA 1C1XB 3NJ4A 3PTZA 4PLYA 3F6YA 2B69A 2C54A 1O95A 4FR5A 4DBZA 5IN4A 3ROMA 2AXQA 2HRZA 4PZEA 1N8KA 4RLHA 2BFAA 4S1VA 2J3JA 4Z3DA 1OMOA 1PZEA 4BGUA 1D1TA 2GZ1A 4K28A 2EG9A 1P9LA 4ZJUA 2ZYGA 1XSEA 3P7MA 4IINA 4MIEA 1Y7TA 4OHUA 5AXCA 2X9NA 3H9EO 1JVBA 3ETDA 4O5OA 3NDRA 2YQ5A 1E7SA 4WK6A 4IJUA 4PGFA 3QHAA 4KTTE 3ZWXA 4DLAA 3R6DA 2Q1SA 4W7IA 5TF4A 7MDHA 3DR3A 4WLUA 1HSZA 3BHJA 2B37A 4GWKA 2E82A 3DFUA 5A3VA 2GGSA 1QG6A 1PJQA 1XIVA 3PJEA 3HG7A 4DREA 1XG5A 1FDUA 2NVWA 4AVYA 3ZDFA 2V65A 4E0BA 4IY1A 1A7KA 1GZ6A 1BRMA 3JCZA 5A9TA 5C7IO 1MX3A 3GN1A 1WVGA 4IBOA 1B8PA 2OZPA 2FWMX 2EGGA 2UAGA 2G17A 4XJSA 1PGNA 5I9LA 1LDGA 1PJ2A 1X7DA 4GWGA 4ID9A 5L4LA 5I7SA 1BXZA 4IJWA 4R69A 1BVRA 5AXBA 5LDHA 1A9YA 3WIDA 2WYUA 2ZCVA 3RC1A 4P8RA 4RQTA 5H81A 4CPDA 1RYEA 2GUGA 1PGPA 3PIDA 1E3WB 4KQWA 3STHA 4Y6RA 2OGUA 4WLOA 4M55A 4XQCA 4IQGA 4BV9A 4CM5A 4W9NA 5K9ZA 1ULUA 3TNLA 3AUTA 1ML3A 3BXXA 4E2YA 5GZ6A 1JTVA 3GF4A 3L4BA 1DJQA 2H63A 1Y81A 3TZ6A 3UW3A 1B2LA 1NFRA 2EGHA 3RQSA 1HE4A 3I9OA 3V2HA 3D4OA 4BNUA 1AHIA 2D0IA 5I7FA 4NH4A 2G82A 4O6VA 4HX5A 2OP0A 3D0OA 4NHEA 3GUCA 2V6GA 3AFMA 2E49A 1D3AA 1OBFO 4K1LA 4ND2A 3ONDA 2YFQA 2X22A 3OH8A 3ZW9A 2VRCA 1F12A 1X13A 1P1JA 3PEFA 3A06A 5THQA 4NU6A 3E6AA 1ZJYA 2YQ4A 2NLOA 3M2PA 4I08A 3JYQA 4K6CA 5IZCA 1U8XX 4Z3KA 5B1YA 2X5OA 5U4QA 1D4FA 4DIFA 3IP1A 3G1UA 2NACA 3OP4A 4UEOA 3GFBA 3H4VA 3DBVO 3HADA 1NX6A 2AE2A 1QRRA 2HO5A 4KUHA 4QQRA 4MVJP 2CD9A 3DZFA 3BA1A 4OOFA 3GGGA 3F3SA 1JA9A 2V6BA 3PGJA 3BTUA 3QVSA 4LMPA 1BG6A 2IZZA 3H9UA 1KY5A 3ITKA 4FFOA 4D3DA 1DB3A 4Y9DA 2Q2WA 3OHSX 1U1IA 3U3XA 4MVJI 3ZNQA 1HKUA 3RFTA 3ZV3A 1RJWA 2BMAA 2RHCA 1UUFA 3CUKA 2FMUA 4JGBA 3FD8A 4AJEA 2BI8A 4ZQFA 4DC0A 4WKGA 4M49A 3QRWA 3WIEA 1CQJA 1PGQA 4AJJA 2H1SA 4YEDA 1E3EA 3VOSA 2AEJA 4QT0A 1UP7A 3BMQB 1NPTO 3WMWA 3HDYA 1QXSA 1PJLA 2IEBA 1PL7A 1Y9EA 1B15A 3I5MA 1YWGO 4MPDA 4YT2A 4YJFA 3MJVA 1X1TA 4M8SA 5BSEA 5KJ1A 4M86A 1IPFA 1GDHA 4EJ0A 1PQWA 3Q0EA 2E4AA 4Z0TA 5BNFA 4PG5A 1LEHA 5JSFA 3HDQA 2CZCA 2GN4A 4OXYA 2BD0A 1PJSA 4Q3EA 4O1MA 3OQ1A 4OYRA 3PWSA 4F6LA 2Y1FA 2FPIA 3DZJA 1BSVA 4YJGA 3VC7A 1R4NB 4B8WA 1PGOA 1UP6A 4Z0HO 3UFXA 3ZW8A 3WQQA 1KY4A 4CQLA 5C7OO 3CIFA 3B1JA 1HDXA 4E3ZA 3I6QA 1HE3A 1VJ1A 8ADHA 3CZRA 3GPIA 4S3MA 3DZGA 4OAQA 2AA3A 4WCDA 1MGOA 3SJ7A 3DWFA 4UVGA 5HS6A 2C2YA 4YYZA 5DULA 3JQ7B 4Q3BA 3RU7A 3KYBA 4R1UA 1TB4A 3R0IA 4FD3A 1R4MA 1ZCJA 4OH1A 5G0VA 2J3KA 3KLPX 3RUHA 1EK6A 3TN7A 1Z74A 5DP1A 1A7AA 1ZUD1 1X0VA 2OO5A 3W6ZA 1CETA 2OFPA 4CLDA 1GYPA 1X14A 1I32A 3JQ8B 2I76A 3VTZA 1VJTA 4YCAA 2P9EA 3JD0A 3QJ5A 1NM5A 4K6FA 1BXGB 4IDGA 2P9GA 3DL2A 4EBFA 1LI4A 3PHGA 1BW9B 4H15A 1V3UA 2V7PA 4LRSB 4J1TA 4JP2A 1RM0A 3RJ9A 4NJMA 2Q2VA 3CH6A 1HE5A 4E2XA 4PZCA 1SEVA 3C1OA 1LNQA 3DOOA 3RUFA 5CAEA 2PWZA 2X9GA 5BT9A 3F5QA 3FWZA 3H9JA 4AL4A 1QP8A 3ETEA 5T8KC 4B3HA 4Z9FA 1H9BA 3WGZA 3P2YA 5JLAA 5EMHA 2C5EA 4H3VA 4ND4A 3VZQA 3WGHA 1YOVA 3BMNB 3RBXA 4U8GA 1ZO8A 1LTHR 4DXHA 4J1SA 3BYZA 3AM3A 1JWBB 2EV9A 3KBOA 5TNXA 1RM3A 3HDHA 4N54A 4PLVA 4A03A 3HE3A 4OXKA 1FF9A 3GC6A 3RI3A 4RJTA 5JC8A 1NR7A 4EJ6A 3H3FA 1GQYA 2WDZA 1ZH8A 3EHEA 1E6WA 4GX2A 2IDZA 4CQMB 4GX5A 1PQUA 2C0CA 3VPSA 5K0ZA 5T67A 4FFPA 1PWZA 3BMCB 4JBGA 3GVXA 3T7EA 3JD2A 2O50A 3OJ0A 3S1LA 4J2HA 1XEAA 3E8XA 1LC3A 1U5AA 3JQ9A 3AJRA 3Q2KA 4A10A 5CG1A 1PX0A 3Q2IA 4UEJA 3RU9A 2IODA 4DWVA 1QV7A 3AU9A 4TQGA 3VPHA 2VRCD 1HYGA 3GVPA 3JQAA 5G0TA 1CIVA 5KKCA 2ZKLA 5B4TA 4DTIA 2X7HA
chains in the Genus database with same CATH superfamily
1XHFA 2HCJB 4IVQA 2F90A 4OQQA 3B1VA 4KWHA 2PZFA 2B30A 1IOWA 5HJ2A 2OLEA 2BFDB 2FVXA 1ZM2A 4RY9A 3AU8A 4OI1A 4JYBA 3GJ8A 4HYTA 4TLDA 5H4GA 3RUEA 3U0VA 3VTKA 3ZGYA 1Z35A 1ZNQO 3R2JA 1RE1A 4FGLA 2O8BA 2IH5A 5CLFA 1V11B 3C5WP 3V8NA 3K09A 1W36D 3AIIA 1L7QA 1QOPB 2ZXUA 3OETA 3N6XA 1VPDA 1NQUA 4H6XA 1EUDA 3P4UA 4TSKA 1QNLA 2VZLA 1ONNA 3G2LA 2H48A 4KN6A 4RQUA 1SOWA 4EYQA 3VU8A 3EVZA 5F1KA 5HJ5A 3ZH2A 4MRMB 1O5OA 4XYMA 3DDWA 2JK0A 1RP7A 4OLBA 2OUIA 2VH1A 1TADA 4PVCA 2QJOA 4OQZA 1OHHD 3QVTA 3EXFB 4PG8A 2JHFA 1RQLA 1P39A 2L82A 4M1MA 3WWZA 2HSDA 2DQZA 3SC2B 3KQSA 4XTRA 3CRNA 1O0SA 4HB2A 1N9KA 3BE5A 5IVPA 4HHEA 3QA3E 2PNJA 4KYIB 4AKTA 4TMFA 2R6FA 2CFTA 2VRBA 2WU8A 4N7RA 4DR4B 2GK6A 3KLOA 3N53A 4MGEA 4TTJA 4ZZ0A 5H4HA 1LQTA 3H5AA 1MB4A 2BIFA 1J8QA 2G8NA 5IT4A 1GNQA 4X3OA 3I2FA 2OWEA 2I8CA 4HMOA 4ZCQA 1X80A 1XV5A 3HBAA 4OAOA 4TUYA 4YRLA 2JASA 5DW0A 4UHKA 4KO8A 3TAUA 4EK9A 2UUCB 1E0JA 2DF8A 3VSEA 4F84A 1N0IA 2NYVA 5IG2A 3A26A 1GPWB 3HXTA 4R2JA 1IWOA 1P18A 2QVXX 4IDNA 4M0MA 1E3IA 2GPJA 1SKBA 4R16A 4YRTA 1GQRA 1OXXK 3OMLA 3WNCA 4RTLA 4KACA 4PAQA 5BVHB 1UDRA 4B8YA 5JCXA 4TYQA 5K0JA 2C4KA 2WC1A 3A37A 4GR5A 4N8EA 1VMAA 1R5JA 2Q9AA 4OMCA 1ZOSA 4HH0A 2D7CA 2OBYA 1Z63A 5CEFA 4IIHA 1O6BA 1EZ4A 2QUBA 3ON5A 4UNIA 4ZI5A 3EZ2A 3RJTA 3O5AA 4QARA 5LQCA 2C0PA 3BSYA 1U1FA 4EKEA 2BTQA 5HP4A 1SPXA 1WHTB 4C3ZA 4R8MA 5F21A 4AJHA 4KDCA 3F6EX 1DSSG 4DSOA 4IKPA 1Z15A 4CKEA 1E9EA 1HT1E 4GQAA 2VXCA 1UJCA 3AY3A 3GH1A 3PXAA 4V02A 1V9CA 4XSGA 4N0PA 2WYHA 4GMFA 3N2IA 4NAHA 4D9GA 5JDCA 5EZQA 2RAUA 2ZRMA 3ZDQA 3FJYA 2WSSA 3KVNA 3P9NA 1GGVA 3LO8A 1U7UA 1DQSA 3C3CA 1SVNA 3V8QA 3OKPA 2PE5A 2R7KA 3N2YA 4LW8A 3E3AA 1G98A 2HWWA 2PUHA 2QL6A 3EZ6A 3S2SA 5ALVA 1KE1A 1COWD 2WY2D 4I81A 2JJ2A 3VZSA 4ZGBA 1ARZA 1L6RA 4YECA 5ENZA 4L6IA 2E1PA 2C04A 1OT5A 1DPGA 2IZ6A 3QVMA 4JCOA 4D3FA 221PA 1RJFA 5B6IA 3I6BA 1YZVA 4TS1A 4JYAB 4E2WA 5ALKA 4ESHA 3VNSA 4B73A 1GM5A 1CLUA 1CS0A 4N0QA 1NQVA 2EKZA 1EXMA 4W82A 4WDRA 5FLEX 2I4TA 2BKEA 5FWAA 4CMIB 3FCYA 1K6XA 4GNKA 1U3CA 1TA0A 2QN8A 3BB1A 4UVIA 4F3YA 2HXSA 2GMWA 3AI2A 3TW4A 4FYKA 3H3XA 4GI5A 5IFKA 1LSJA 3ZWNA 1ND6A 2OZKA 2IPOA 2IP1A 3KYCB 1SU6A 4JOQA 3DKRA 5DGIA 2JFGA 2XF8A 2C8JA 1GSAA 4CR8A 3TTVA 2FUNB 3CWZA 4JROA 4Q05A 3SZRA 3IR6A 2DTEA 3WWCA 1Y34E 4BL5A 3PTLA 1HYQA 2GFHA 5FAKA 4C1BA 1X1QA 1FYVA 1BH6A 3TFWA 4QYMA 3KB8A 5EERA 2E4WA 4L6CA 4WOCA 5CDHA 5AIAA 2PA3A 1RJGA 4FCWA 4FYIA 1UADA 3TOZA 4B45A 1A0OA 1KVRA 4DLKA 3HUTA 4ZMBA 2YUTA 4WJKB 5EEGA 3BBLA 1L4UA 4M1TA 5LA6F 5JWRA 2A14A 1YAHA 2C8KA 3FFBA 4LPSA 3AUXA 3P45A 3MWKA 3HNRA 4M7WA 4NECA 4UTZA 4V3CA 5ESRA 4YJ2A 2IVZA 4JYZA 4O4IA 4B71A 1QE3A 1NHWA 1CJMA 5TQJA 4FE4A 4AYXA 3SDZA 2VSYA 4NYMR 4A6DA 1BEZA 2CBGA 3GCZA 1L5OA 2PTGA 3AZOA 4KR0A 1CHNA 3I9FA 1GY8A 2VPPA 5I9BA 1BX1A 3JAKA 3ORHA 3LSTA 3TIGA 2YFHA 3WWPA 2E5FA 4HEQA 4MV7A 4ZAZA 4DRYA 1Z5GA 1W0KD 4YX9A 3H6KA 3ER6A 1I94B 3L7NA 3CR8A 4BMYA 1Q1NA 4ZZIA 2BP7A 1U11A 3VU0A 3L0OA 5CDUA 4I5FA 3DWGA 1T6BY 3QENA 4QSMA 3FMOB 2C5HA 2EFCB 2ZAGA 3KZOA 1Q17A 2I1VB 4PCLA 1E64A 2RMKA 4NJOA 3GLIA 4BQSA 2ZZKA 3MFQA 4EI8A 2NTVA 5JMTA 5IFLA 4RETA 3PU6A 3OHPA 4PQRA 2V58A 3RC7A 3S29A 1DAHA 4MXDA 1FYWA 4KXQA 4NI5A 3WK9A 5BSWA 3VJKA 1P5JA 4Q03A 5CT5A 1SKUA 2BKVA 3MTGA 3RGGA 1QAMA 2JLSA 2RH9B 4WA8A 4E33A 2O6LA 1ODKA 2OHVA 5LIPA 1NP6A 1PUJA 4AZ3B 4ZMSA 1L9KA 1TYEB 2J8ZA 1K9VF 3I0MA 4R2HA 3K1TA 2VWGA 3NU1A 4IIYA 2Z30A 3JQFA 4Q7KA 5FUWA 1AS0A 4Q3CA 1HR0B 3RT9A 5HFJA 2GAJA 4G0YA 4P5PA 3AUJB 4UMVA 5TV2A 1Z0ZA 4X6LA 2W42A 1ZONA 4OQPA 4WXEA 1YQEA 2G9ZA 2DT8A 2VDVE 2X23A 4GP7A 3IERA 2FPRA 4IEIA 4JBWA 4M1QA 3TKAA 5EXXA 1ODSA 2NADA 2Q3CA 4WZ6A 3KPYA 4O1IA 5I7AA 3LLMA 2WKRA 3LNCA 2PVCA 3ZH9B 3QG5A 3V7WA 2ZUTA 4BOYA 2HL6A 2AF4C 3KOXA 2HHAA 2R8EA 4FFLA 4GLLA 4PV7A 3AVTA 3NOVA 3VSAA 4KIFA 4ER0A 2DX7A 2N46A 2FXIA 3PC2A 1CUDA 2GJ4A 4DXDA 3U26A 1H23A 3MT7A 1DBRA 4K7JA 3O8QB 2OYSA 2AFVA 4OKNA 1R1DA 4OUDA 1B16A 1OD6A 3P9CA 2R8YA 3H5RA 3EAGA 3OLQA 1LS1A 4IPTA 4YBZA 4KN9S 1DNPA 5DZSA 3DQZA 1QAOA 5UKDA 3BD9A 4FWIB 1D4ZA 1Z5WA 1II0A 2JBAB 1P7YA 4HYYA 4HH4A 4AS1A 2BDEA 1JQ5A 1ODLA 4KN5A 2ZKIA 3C85A 3SCZA 4EM6A 5FOWA 3IMEA 1IBLB 4A91A 3NB0A 4QOFA 2DWPA 4S05A 5JRDS 2EJTA 3ORYA 2BGGA 2Q4EA 3G1TA 4QU8A 2GUWA 5AW9A 3EMVA 4O4LF 4MR7A 3OPNA 5FO0A 2X0EA 3Q7RA 4QTUB 2GYYA 4BWGA 1DQRA 2TECE 1PJ3A 3Q88A 3KEGA 1KBQA 5SZJA 3BG5A 2D7DA 1C3EA 5A1TA 4Y0AA 4PNHA 1XVUA 3IIEA 5MN6A 3KEFA 2WM3A 5A2QA 5D6OA 5JJLA 3FXAA 5EY5B 4YAIA 2ZS8A 3F73A 2GLTA 5CLJA 3B2EA 1ISPA 4JT9A 3SYMA 1IUOA 4H0FA 4CF5A 1VKRA 3L46A 3TSCA 1QGOA 4RY0A 5A5VA 5JH7F 2BGIA 1XTVA 4IVRA 4WRRA 3WLFA 4HQRA 3R3HA 1FFEA 2QXUA 1GL3A 1UEIA 5K8UA 1ENZA 3N39C 3MRTA 4GI3A 4UNNA 4KYTA 5CK5A 4FFRA 2FWRA 5LWQA 2V4ZA 3L0YA 1R8SA 5EWMB 5JJCA 2VJLA 1Z5VA 2XW6A 2BM1A 5IASA 3IUBA 3D4NA 2CL5A 3OTQA 4C5CA 1ULTA 1DTWB 4YAEA 1NN1A 2ONKA 5A4MS 2QU7A 4A8JA 5IYZA 1PT7A 1R5BA 4RMJA 1DG9A 1NQXA 1JHVA 5HR5A 3RVRA 3CFYA 1XU9A 1TEHA 2IOFA 5ISMA 1HK7A 1Z36A 2ZAOA 3TR0A 5I7EA 3PFHA 5KC9A 1YQQA 4N5HX 2R6DA 4RNCA 1U2TA 3S4YA 1QZXA 1P8JA 4KAFA 1ZH4A 1TVEA 4A82A 1FDWA 1QP7A 3NBMA 3R7AA 2FU5C 3I1JA 4S35A 5K6AC 4HNQA 1U2SA 1JQ3A 1W88A 2CVQA 4PLZA 5LR6A 1BCSB 1RHUA 4HWRA 3B6MA 3H19A 1GT6A 4A9AA 1OWNA 3LCUA 3QVJA 2M1XA 4JI2B 1RYBA 3M4XA 1Q3HA 5AI0A 1E3LA 2Z1NA 5FBZA 3K0KA 1KI2A 4OHVA 1S9DA 1FVFA 3VR4D 1Q0PA 5A4IS 2VEOA 5BSHA 1CY2A 1ICIA 4I7EA 5FEMA 4DBLC 1D6JA 1UFVA 4KLAA 1EFPB 1JG1A 3D9QX 4ZHQB 5EYPA 4LVOA 2LRHA 5DHSA 1VI6A 2Y92A 1C81A 5CCXA 4PQEA 1LU9A 4KQXA 3UUWA 3COYA 1KA9H 4PG7A 1XXHB 4LNHA 3K6KA 3SD7A 1XA3A 3WYAA 5EJ4A 3SC3A 4EPYA 5JQGF 2F3RA 4PAMA 1EFVA 4MQ4A 4P32A 4MX8A 4CM7A 4ARCA 1HNWB 2Q4TA 4DA0A 2Y9MB 3DEYX 3FZYA 3DL0A 3DVAB 2R68A 1CE8A 2Z3VA 2DFLA 3EIHA 4XUEA 5B3LA 2FDCA 4ZCTA 2I6TA 4KI7A 2C4HA 3NAQA 3P52A 4B75A 2B7CA 4BLUA 1IM5A 4D42A 1PK9A 2Z2YA 1WBDA 1VA4A 4M88A 3CKMA 3L77A 1GCUA 2VFAA 2PEYA 1ZI6A 1I6LA 4LV6A 4O29A 4Q24A 1T5SA 4KCGA 2NM0A 1BE1A 4QBGB 4WNAA 3X2FA 2FHPA 2QENA 3AZQA 1SG0A 5L3QB 3FNQA 4WLNA 3LK7A 1C7JA 1KGDA 1MX5A 4K81B 1H4VB 3PFWO 1J4AA 1LCIA 4QJ3A 4R9UC 4L28A 5IH3A 3IQXA 1JFTA 3BXGA 1E18A 4NOJA 5GZ3A 2WPDA 3F3MA 2UDPA 4K40A 5HIIA 2GM5A 4DT1A 2PSSA 1JAIA 3ED5A 4WPGA 1QAQA 1G64A 4MUXA 4KO1S 2PUGA 1ULHA 1PSDA 1UOQA 3VKUA 4X66B 4G0MA 2YWRA 3QNWA 2DPGA 2ZRQA 1XCGB 1W4ZA 2XNCA 1IEWA 1XPUA 2VUSA 3FHCB 9ATCA 2WUWE 5J1SB 1JMYA 4D4IA 3CLVA 4D9EA 3CNBA 3F7NA 1XKLA 5IK2D 4G3XA 1P44A 3NBXX 3UGQA 2VPTA 3FKSD 4D97A 3DAYA 1MG0A 3H83A 4LKOA 1V5GA 3P9IA 1RXUA 2QRHA 3NCTA 5LP6A 2ZR9A 4HWOA 3VZDA 1UC9A 1AHHA 4KWEA 4AJLA 3BKXA 4U0JA 1NLFA 4URZR 4HRYA 3FHOA 2QRZA 1KO5A 2HTFA 1WZUA 2PXCA 4NYIQ 2PSHA 3FDXA 2J5QA 3WK7A 4BATA 3EXAA 2ZT8A 4ND7A 3EPLA 3U3JA 2HMUA 3R5HA 1WVMA 4XDGA 2JAQA 2OAEA 4HAYA 1R4ZA 3C3PA 4HD8A 2PRZA 2IYOA 2Q07A 4KFTA 5FLKA 3PKJA 1F2VA 2DSTA 3N7TA 1I6KA 1XD2A 3R3SA 4L4ZA 3SXUB 1YZ3A 1DIOB 2W98A 3BE6A 2HV9A 3KXLA 4QUIA 4WTOA 4DCSA 1K0UA 1KSGA 2IHJA 5CBKA 5DI3B 4CG0A 4WN9A 1ORTA 3LZ6A 5J2UF 2QRKA 4UTXA 1AIPA 5HMMA 3VC2A 3W1EA 5LKAA 5A05A 2R6GA 1GNRA 4B84A 4DYVA 3HKBA 3QIVA 3VI4B 3BJZA 1VE9A 2HDNB 3GG9A 2RI0A 5EJAA 1GL7A 1PK7A 2L18A 4Q9IA 1CXZA 5TGDA 4E5NA 1WMAA 3SQOA 2CHUA 3HEBA 3PENA 4O4HA 4YRZA 5JARA 3ONEA 1N6LA 2FPPA 2IUTA 1VSVA 1JSLA 1QP0A 4Q9AA 2PKXA 5K3SA 2AI2A 2RKOA 2CLEB 1MDBA 1RI2A 4HBGA 2F43B 4OJKA 1K89A 3SSAA 2ZG6A 4C4ZA 2YRFA 5KPJA 3EXEB 2XA1A 3A6DA 1UZAA 4FSHA 4Y2GA 1E2KA 3N70A 3DMGA 3HCRA 4DOMA 4P7BA 5BN3A 3P9PA 4MWCA 5AVOA 2NU7B 4QO7A 3ZLVA 2DY1A 2ZYSA 4FI3F 1WIWA 2ZYDA 3G2MA 3D3NA 4MYUA 2ECFA 4BUJA 1OC2A 4B6QA 2VJKA 4D92A 3HVRA 1CEQA 1JEYA 2VHCA 3DE4X 3FWHA 1YSCA 5HBRA 1GZVA 2BFEA 3K6SA 4G8JA 2KBEA 1F9AA 4FONA 2WAXA 2HWXA 2V6MA 4TTSA 1S5PA 5D3KA 1C1DA 4Y2TA 1U3GA 2RCNA 2RGXA 4C7MA 3RK1A 5I7WA 1DXQA 1LY1A 4R0MA 2WZQA 1BFUA 2VNKA 2W2TA 1IOVA 2OAQ1 2VBGA 3GP3A 3DFFA 2P0EA 4W8OA 3JD3A 1K86A 5H82A 3M6MD 5TT1A 3RWOA 1A2KC 3TDMA 3UIEA 5ALXA 4XWOA 5IJ9A 1W93A 1U02A 3U3DA 2FRXA 2QLBA 2Q27A 3HR4A 4OLJA 4TKUB 3UPUA 5A06A 3SQWA 3TLEA 1VKZA 4JI5B 1H9AA 3FVRA 4EO9A 3O9MA 3RTDA 2XH8A 1XL0A 2EW8A 3UBTA 2QYTA 4QDUA 4YC7A 2AOTA 2RGYA 3HBMA 4OSOA 3IQHX 1CUHA 4QTYA 3FLEA 1D9XA 2AT1A 3JU3A 2HF7A 1N0WA 2P9FA 3RT7A 5E4FA 4A1FA 4HTAA 4PXYA 4UCFA 3BMXA 2XRYA 3AQ4A 1YJ8A 3IEUA 2R47A 2XITA 4B4WA 5K3DA 3KKEA 3IR7A 4J4TA 5AKZA 5TJ9A 5EUBA 1J9ZA 2C1EA 1LPSA 3B6JA 1U2GA 3E3LA 4FMDF 4Q00A 3FNIA 2DQKA 5J4LA 4QBTA 1OIXA 2Q0HA 3FPEA 1Z08A 2ODTX 3WFIA 1VLZA 2ZITA 2QM7A 5B1IA 2CHVA 4UM7A 3RRBA 3O8DA 3PVZA 4TZTA 3Q8KA 4NS4A 1XP8A 4OQ4A 3W8DA 3HJCA 5JXIA 2REQA 1GGKA 2QMUA 5FYDA 2AHRA 1SCDA 1Y1KE 4MI3A 1SQFA 1GA4A 3TSAA 1TTPB 3UJPA 1PP4A 2YFYA 5EZYA 4ES6A 1NUUA 4ZQIA 4Q7EA 5TMEA 3A4IA 4FM9A 4MUIA 1XMIA 5G53C 1JIQA 3H8JA 5F1OA 3L0DA 3BN3A 4ISCA 1JJ7A 1VCIA 2XOKD 3VNRA 4CMCA 4Z99A 2Y0EA 1N8NA 1M6VB 5CM2Z 1WDMA 3NHLA 4BO6A 4Z2AA 1PG2A 2RBGA 2ERYA 1U2DA 3ZWYA 1VCNA 3C1TA 1R0ZA 3LRPA 3HO1A 4XPIA 1L7BA 5GV7A 3D64A 2NAPA 5ITSA 4RBNA 1UOOA 4KH0A 4HEA6 3ROGA 2O3QA 4GSYA 3TE7A 1USWA 1E32A 2VT3A 3GRKA 4FR0A 2ZYVX 1T9GR 4RPCA 2FZEA 4Q39A 4ZTBA 3NTXA 3OU6A 3E9CA 4K9KA 2WZBA 1E7RA 2Q3HA 4F56A 2X76A 2XCTB 1RYFA 2WJ3A 4FXPA 3CUEF 4QUEA 4US2R 1BMQA 2PGOA 3M82A 1MXHA 1OXVA 1X1RA 2IOHA 1AGPA 3HPRA 3CR3C 3O4RA 4RYLA 4US1R 5JSHA 4JL8A 1I0LA 1CUBA 3AY0A 4F2GA 2Q2QA 4KR2A 1I9GA 2DBQA 2G0NA 2HMSA 1JAZA 3NHRA 2UYHA 1R9MA 3DLTA 3VVBA 4UQLA 4DEXA 3N86A 1EMDA 1BGXT 1OH7A 2ZUVA 1DOAA 3A2LA 3NOQA 4FP9A 4K87A 3C39A 1N2SA 1HRDA 1C1HA 1SBCA 2CUKA 4H3HB 2RC5A 4Q4JB 1OLXA 2AFHE 3AI1A 4V0SA 5F5LA 4DSTA 1HT0A 2QRUA 2UYOA 5HVNA 6PFKA 4JZYA 3MWEA 1CJTC 1K88A 4RU1A 2YJ5A 5DPMA 2VP3A 4UNQA 1H0SA 3V8MA 5KHLB 1S2NA 1XUOA 2MSKA 2Q7DA 2IY9A 2VRNA 1DRUA 2HLDA 2XBUA 2YYYA 3M2TA 4OIFA 4AO8A 2E21A 1E8DA 4LISA 5IM5A 2ZBRA 4UMDA 4CCYA 5M7EA 3DKIA 5J4KA 4EGSA 3N59A 4LE1A 1KO8A 2A9PA 2QKYA 4TMVA 1Z16A 2O07A 2AIRA 1QR6A 2PK3A 1LX7A 5H5JA 3W4IA 3TIXB 5JISA 4BIMA 1T25A 3C8DA 1A9PA 1YR9A 4BNHA 3DHEA 3GMDA 5LZ2A 4DLZA 1YV9A 1ZM7A 1VL6A 1TUEA 2PQ6A 4PS0A 1BX0A 2KLBA 2JJMA 2YXNA 3OECA 4YLEA 1VI5A 4LC1A 4YK7A 3O1JC 4NXMB 2Z2XA 3HLYA 5HK8A 3DOCA 3O9ZA 1TQHA 4HNAA 5LYJB 3HCNA 1KK0A 2ZIFA 3GLKA 4I4TB 4NNPA 2ZIWB 4P92A 4IG9A 4U2FA 1SKAA 1U1CA 1IULA 3OF5A 2FSVC 1QCZA 5ED0A 4BFYA 2RGNC 3SG0A 2NZXA 2OMEA 3G0BA 5E38A 3IE1A 3GO4A 3TRHA 4QICA 1FCJA 1KXJA 2ADOA 4ARZA 2G1AA 4WNYA 1L1FA 2OXTA 3KB1A 1G2QA 4YJFB 5HWSA 5LDDC 1IEQA 4EHKA 1BDJA 1U7ZA 3OUUA 1GIAA 4U63A 2CE2X 5CA1F 3UMCA 4EF5A 1Q0UA 3HY3A 3WADA 2J31A 1QTRA 4ARUA 4BNWA 4Z7QB 1MRNA 1XZCA 4JVSB 2ZB7A 4L50A 3QEKA 2IS2A 2R5FA 4WERA 3R6WA 2YCLA 1AKYA 1MUUA 1F5SA 2J4FA 1UC4B 3DE1X 4GBGA 3ENNA 3RLIA 5TS3A 2PHZA 4URUR 1T3GA 5CTJA 4QXMA 5IPFA 4EJFA 4EIWA 4CQMD 4UMFA 1M2WA 2R66A 1I6MA 2G4CA 2J0EA 2J5RA 3OX3A 4MIOA 4LXQA 2JI6A 3HJRA 3U39A 1OTYA 2L19A 4IGAA 3GLFB 1Z26A 1P1CA 1FLAA 3U1TA 1XAGA 1LC0A 2EFJA 2EAUA 3EQZA 3IJEB 1QHEA 1RTTA 4GLFA 1FYXA 2NXEA 1L5RA 1M2JA 1N3BA 4MAAA 2IE0A 4IDDA 3MD0A 4F71A 5KNBD 2LKDA 3HVKA 3QEBZ 1I3MA 3E5RA 4BNDA 4TM8A 3ZUPA 4MVJG 2AW5A 4OX9Y 2Z0MA 1V16A 5DO9A 4TVKA 1UBUS 2I80A 3PFIA 2LWIA 5K99A 1E4OA 4Z7OB 3EH2A 5CITA 1ZDMA 2DCMA 3NBUA 3ILXA 4QPZA 4JQYA 3W2HA 1I3KA 1T8TA 2VXOA 1YL5A 3IDOA 4DILA 2VTBB 1VSTA 3TTWA 1GU1A 1F1JA 3QFHA 3WYFA 3O31A 4B3IA 3AFNA 3W2IA 4BX0A 2QYSA 3IUQA 1DC8A 5AJTA 1NUSA 1Z17A 4XZ3A 1L4MA 5E9AA 1PYOA 4L5IA 1L6IA 4HFNA 1XLTC 3IE2A 1PL6A 3Q10A 2WNIA 1AB6A 2BH2A 2CNKA 1TO2E 2WQ7A 3R3VA 5KI6A 2X8AA 2R0QC 4CU2A 3NRJA 5D7NA 5IHPA 2TMYA 2WBLC 3AG5A 2VTEA 1YZQA 3TX6A 3HXKA 2ZIZA 3F9IA 2IV3A 5L40A 1ENYA 1JILA 3AEKA 4LVCA 1C0LA 2HXGA 3P4XA 1JLSA 1Y3IA 3IBFA 2ASVA 3DWEX 3BIXA 4FNAA 1F6WA 3FRJA 4U7GA 1SQGA 3G5MA 3PPYA 1U0GA 2LD4A 4KQ9A 5AW4A 3N76A 5KTYA 1JQAA 4B3DA 2EIHA 2FUEA 4UHBA 1YTUA 2DHRA 4YACA 2ENWA 3BQ9A 1LF0A 4URWR 4UE3S 5KWEA 4XYLA 4X45A 4O8CA 5JD4A 1YB1A 2DUWA 3KOZA 3Q7SA 1E9RA 1L0BA 1MGPA 1SVIA 3IBCA 4RE6A 4ZI2A 2EKLA 3EISA 2G25A 1EJ0A 1W85A 3AIMA 5BP7A 3CY6A 2D2EA 2RDMA 4LV5B 2G9VA 3O91A 3ZWBA 3NV9A 4O33A 1DBWA 3HXQA 2VSNA 4YB8A 1BDBA 3OKFA 4E14A 2V0GA 2HLPA 4EFMA 2IHKA 2EX4A 1QF9A 1VE6A 2CEKA 3A9VA 4RA9B 2XE6A 2QROA 4EL5A 5A4DA 5IT5A 5LP1A 4BN0A 2I8AA 3E58A 1C0PA 1E79D 1ZZGA 2YDXA 5EQFA 5F5XA 2O2JA 2VHWA 4G9BA 3BD8A 4MI9A 4BGVA 3QXCA 4AKHA 4ZDIA 4O2BB 2CWWA 3STWA 4ZO9A 3D3WB 4Y2YA 1WV1A 4HTFA 1XMOB 2FQXA 3CLKA 4IXTA 3REOA 3KR1A 4CN8A 2W6IA 4ZWNA 4YJHB 3D0QA 1N7JA 5AOBA 2CV1A 1JKJB 3CZAA 1CRLA 1LUAA 4X1IA 2O5VA 4YAGA 2BW0A 4PZ0A 1O58A 1Q3TA 1WUKS 1YL6A 1YDEA 1UWLA 2R00C 1GGHA 3LHSA 4PYRA 1ACLA 1NNUA 1T8WA 4H7EA 2HRRA 4MWDA 4BGIA 4BO4A 1UMBB 2H3HA 3PCTA 4QATA 4M76B 1ZNWA 1JEDA 2JARA 3QKRB 2FAXA 1ZOPA 5H59A 5AOAA 5EJ5A 3FDJA 3DHNA 4CT4B 4R9VA 4LS3A 5K2MA 3DCNA 3IEIA 3FNEA 2GA8A 1B14A 3LQ4A 4RZUA 2EARA 1MO2A 3ZTWA 4AJ9A 2GRAA 4BHTA 2E5LB 5BNZA 2DR0A 3U9LA 1K06A 3DKPA 5HTKA 1ZVMA 4M8IA 3PC7A 5K1ZA 3K7EA 4ROSA 2P41A 4G84A 3K9BA 4DLVA 1A5AB 2NV6A 1T13A 3NHUA 3OZIA 4QVGA 5F3WB 2DKOA 2PANA 2QN6A 1DAPA 1LWNA 1OTXA 1P3Y1 3DLPX 3EIWA 1RZRA 3ZWKA 3VAAA 3I73A 5KKNB 6CHYA 1K97A 1ZK2A 1CEXA 1N0UA 4GG1A 2ZPUA 3FTQA 3ROKA 5A03A 2EBHX 3BUSA 3LLSA 5FL3A 3TKYA 3HJHA 1DUVG 1MVLA 4ITVA 3CG0A 3E22B 3K20A 3A4MA 1FNNA 1MH1A 1R0LA 2I2WA 3QYFA 3PPVA 4FEGA 1WA5A 4AFNA 1VJ5A 1Y1QA 2CL7X 4MR9A 5LZ8A 5HIMA 1ZBQA 2BGLA 1RHKA 3IAEA 2YXPX 4LIPD 3ZGLA 3O74A 2FSHA 1Y6JA 1WZCA 2ZWOA 4M87A 3SEFA 4FGSA 4GT1A 1A82A 5EZYB 2C1ZA 1Y8QB 3T7SA 3DT8A 3PXGA 2WT9A 3S2YA 5GONF 1CDEA 1SFRA 1VXRA 1DTEA 1ZJ6A 3AGPA 3Q9NA 4K2AA 5EC8A 3KX2A 5CXSA 4D0RA 1LPAB 5DLDA 2DT5A 5DM0A 1UFQA 1UK6A 1ADBA 4U8HA 2OCKA 1CPYA 2QLFA 2OCIA 3NIGB 5CXXA 4HGOA 4IHJF 4HPXB 2R96A 4TTRA 5KTPA 2P6RA 3WBBA 2R8OA 2PRYA 4IWXA 4R01A 4GKVA 1DG1G 4DG8A 4XEHA 1MC1A 1KI1A 4JP3A 3L49A 3OJWA 121PA 1P61B 3OSZA 3HZZA 4CMJA 1NVUQ 1V6CA 3Q9SA 5DTIA 5JYBA 3C3XA 4DDMA 2ZP1A 4KFSA 1X77A 5J4HA 4NICA 5AVSA 4WEQA 3VC1A 4B9EA 5JQWA 4LY6A 2Q62A 4Q1CA 4YCJA 4ZTUB 3MZ0A 1O08A 2YIDA 2PTHA 3AM4A 3RPEA 1YFLA 3AG6A 2NNWB 3LDFA 3E27A 3PXUA 2DLCX 3L1IA 2Z5GA 3NHWA 4QXQA 3AILA 3CM0A 1EM6A 3PCRB 3QKWA 4U2KA 2IS6A 1MV8A 1XN4A 1JHDA 4BNYA 4F9TA 1KAEA 5KTRA 1BJRE 3L0CA 2IH2A 4BFVA 1W0JD 3ANLA 3SOZA 1R9GA 2ZB8A 3L6CA 5CM8B 3K1AA 5DF1A 4ZN6A 1F38A 3UXMA 4C7KA 2HYIC 3E9MA 2AJBA 2ZJ7A 1E63A 3K4QA 2LDBA 4GH5A 3T0IA 4HEHA 3L7YA 2OV4A 4U2DA 4D3XA 1V8FA 1K7CA 1TM3E 4WCVA 1KERA 2R8PA 3M4ZA 4IJ5A 4YA6A 5FBRB 3TBKA 3UT6A 3V8VA 3GD7A 1R50A 1G63A 4COKA 4M0LA 1USVA 4UJ5A 1Q20A 3OBBA 3VDMA 2F4NA 3ACDA 4FTWA 1Z37A 2WABA 2HJSA 4CKBB 1EX6A 2IDJA 5D84A 2GD1O 4QOEA 1EBUA 3ECSA 3X1YA 1ISHA 3VYUB 4KE9A 2CB0A 4BAUA 3WYEA 1C7IA 1GDDA 1CQZA 3N05A 1J0AA 4OQNA 5HDBB 1ZRMA 2CL0X 2EU8A 4UKDA 5JFGA 4X91A 2YL2A 4JBLA 4Q9LA 2WAAA 4G4IA 4IDAA 5HBGA 1VGQA 3JWJA 5LBUA 1D04A 2R1UA 1QG0A 2D5CA 5B7QA 1XMVA 1X92A 5JEDA 1TM4E 3HXMA 1Z4IA 1ISGA 3RYIB 3NBQA 1Y5LA 2FJUA 3IKVA 1KAMA 4AXBA 4YPVA 1NI3A 3SKXA 1P2VA 1W73A 2I4LA 4JJ6A 1DQNA 5JQGA 2Z8XA 1U7DA 3LCVB 2X8JA 3OQIA 4R1QA 3TIFA 3I28A 5FBWB 3MC1A 2YDYA 3FUXA 2FN3A 1DC4A 3IH5A 5JSQA 1KRWA 1TJ3A 4KAAA 1DS6A 1MJNA 4L8YA 1W7AA 3FF4A 4IWYA 1OROA 3EG9B 2G80A 2GDZA 3M6UA 3VX4A 1AK2A 5AO9A 4B6OA 4MYRA 1FRQA 1L7AA 1NVEA 4MW9A 1U5CA 4M1YA 5LDGA 4KTVE 4OP3A 3IPXA 3X1DA 4ZCPA 4AXXA 1KVUA 3A8TA 4REMA 1YB5A 1TZBA 1FBNA 2ON6A 3L4BC 3I30X 4ZYTA 2PKQO 3O21A 4KQHA 1E2NA 1VHWA 3H0EA 5DISB 1L4NA 4NBKA 1YMQA 1ZFNA 2PRIA 5G3YA 3QGMA 3SM3A 1WSWA 1Z33A 3VR6A 3QI2A 1XRNA 2XGSA 1GPDG 5EL0A 4E21A 1MX9A 1KY3A 4DMGA 4DQLA 3WHKA 5CLLA 3ESDA 4IUDS 4CKCB 3MEQA 1VB5A 4MEAA 3ZWWA 3BIFA 2Q5FA 4RK4A 2HNBA 4DC1A 1LB1B 3DVLA 3ZNPA 3TLXA 1SG9A 2YJGA 1EQUA 2Z6VA 5HS4A 3UJNA 1ZXBA 3K9NA 1H2WA 1PJBA 2BI7A 2X4LA 3LBHA 1AUOA 1XXHE 2IL1A 4RELA 4WKCA 3RAGA 3B1WA 2ZTUA 4LZAA 1BJKA 3RS7A 4PYJA 2O2YA 5CFOA 4RS4A 5FI3A 1JLKA 1HPLA 3S55A 4YREA 4MDHA 3O4IA 2JFHA 4JEMA 5K6AA 2ODWA 1QF7A 1VL2A 4D8VA 1AXEA 1N5JA 1U04A 2RBKA 2VBIA 1AZLA 4UTOA 4EKGA 4F4FA 3KXIA 2AZDA 3A11A 3UMJA 1BX3A 5D1HA 1ECCA 5K20A 2GN9A 1TYZA 3EULA 3DQPA 2EJUA 3ZI7A 4HDOB 1O1YA 2XRFA 2HOQA 3BE8A 3U5TA 1Q21A 3MQFA 1OLUA 1G9SA 1PFUA 3SXJA 2VDPB 3ZPXA 2A0WA 2AJDA 1NNLA 4GU5A 4KXWA 6REQB 3FOFC 5IANA 1W36C 4RHCA 10MHA 2BM8A 5FR1A 1KDPA 5DSZA 4HNRA 1I2MA 1R6DA 3DB2A 1QZZA 4ARIA 2H6EA 4J0DA 4DQ0A 3DKKA 1BHO1 3K2BA 4OB7A 3GRVA 1GG8A 3AJDA 3AVPA 5D3QA 1V43A 3THYB 4LWQA 1F06A 4JAVC 3JRWA 2Z56A 2CLMB 2CYAA 2YV1A 5DOZA 3OWOA 4E30A 1E5LA 5IF9A 1IEVA 1QCCA 2QA5A 3EXG1 1EWKA 4D41A 1YS4A 1P0FA 1PR6A 3PJRA 1RWWA 3AL2A 4UMEA 3UAOA 1YFKA 4DRZA 2O2EA 5AVJA 3V80A 4H1VA 3GELA 4G07A 2IIQA 4NCHA 4RPGA 4A0SA 4BMSA 4CF7A 1R9NA 4TWZA 5L3RA 2O2DA 3V9AA 4NZPA 3WKCA 4DDKA 3ZQJA 1YASA 2IPAB 2ORIA 2XCLA 1Z2DA 3DXZA 3DYIA 2PUVA 3M6AA 1MAWA 3P9RA 4ZP1A 4OHZA 4CLRB 1Y8RA 5KWVA 4LPKA 3FI0A 3WTBA 3BGOS 1EM8A 2AFIB 3FW1A 3ICOA 3QNUA 2ZZMA 2XHZA 2O8FB 3L8HA 2XNSA 2NPIA 4X95A 1I7NA 1EA5A 1FDSA 1EFCA 2P8SA 2XBMA 4F6CA 3RK0A 5J40A 1FJGB 2DMRA 4D0NA 4K6KA 3ENWA 4TTQA 4BX2A 2BMDA 2XKBA 2OP1A 2XWSA 2YVUA 3C3MA 3E3NA 2C2OA 3FFTA 3LC0A 3LDHA 3WQSB 4AZVA 4PYKA 2HQSA 1KMCA 2VS1A 3V1LA 2QTVA 2X13A 3S2IA 5BVGB 1FRVA 2ZSBA 5K8LA 1Z6AA 3E15A 1QCYA 3ELWA 4FLFA 3PPWA 4XCVA 1PFQA 1IY0A 4KLCA 2C99A 3ZWCA 3I83A 4B76A 1PCXA 1VM6A 3THWA 3U7QA 1ZGZA 2PUFA 1O8CA 4Y6QA 4L75A 1U2EA 3ZXYA 2ZSUA 9LDTA 1FU7A 1THMA 2YUIA 1H0KA 3DE3X 3PQ3A 2CFCA 4BP9A 2EX1A 3DEHA 2MYTA 1BWQA 3CYFA 5F9FA 4AKGA 1WO8A 2ZI7A 2BHNA 1IHPA 3LGAA 4FQ5A 1C3LA 2WE8A 1ONOA 2ZVDA 1XDWA 3IJRA 5JT1A 3ER8A 2PAAA 5J5AA 1T3SA 2A6PA 4CLXA 4ZT6A 1FU8A 2P1ZA 2Z9BA 1EE9A 3K9GA 2CKMA 3C15C 3LC1O 4QHYA 5I7HA 2CSXA 4QDTA 2GAFA 2IY8A 1SCBA 2EDAA 1K7YA 1JT9A 1U8ZA 2XVXA 4ZVVA 3AINA 4DEYA 4L51A 2QGNA 1EUCA 3QEMA 4IV8A 5AM4A 2QRVB 3PFFA 2ZBGA 1KJNA 2FX3A 3LH5A 4Z9YA 4BMVA 1HSOA 1IN1A 5K01A 1S3SA 1JIUA 2CVFA 2PLWA 2XT6A 4X9XA 4ZO4A 3WWDA 4CEJA 1M8JA 3COWA 3CRQA 4R1TA 1MDFA 2NOAA 3K0HA 4OYHA 3IVAA 3LPNA 4C22A 4WZBA 4JKIA 1LF5A 3QWHA 3HU2A 3I2HA 3MHPA 2C9MA 3FSJX 4WADA 4XD7A 2JGKA 2FLKA 2GF2A 1JZSA 1UODA 3LHKA 4U1RA 5A2GA 5A3QA 1QS0A 2V7EA 3OPYB 4AWXA 2DPHA 3S2FA 3WNZA 3U81A 3REQA 3SHWA 2J0VA 3OFVA 3UJ8A 2PUCA 1GFSA 1T9BA 3IOCA 4KAXA 1K6EA 3FCSB 1QFZA 1OV4A 3DGFC 3OAAD 4ZOLB 1AKQA 4EJSC 4AAYA 3HKEB 4L5BA 3I45A 2C5AA 1DMSA 1JFFB 1S8AA 2A1UB 1QHXA 3KD2A 1XKQA 3CO0S 1UXGA 5MFZA 2NUPA 1C4WA 4RTRA 2XYPA 1G0OA 3UG7A 1WF3A 5P8WA 3I8OA 3TECE 4R41A 2N0SA 1GRRA 3KZNA 5F7XA 1TAUA 5DSTA 4CEHB 1FUUA 3PTAA 4BU0A 1DJPA 1S6YA 1X3LA 2AC2A 2VL7A 4G1EB 5IS2A 2PMDA 3OE1A 3PRYA 4F1KA 4KNYA 1X38A 4UD2A 1J39A 3VI3B 1JVNA 3OCXA 1KSFX 1P2FA 2Y1DA 3DP9A 4UM8B 4XUDA 3SYKA 3UMVA 4OI0A 5E7QA 3TVDA 2IBMA 2YC4C 4FFWA 5IT0A 3EEFA 1XFAA 2B0JA 2HSGA 2R2AA 2B8NA 3RFCA 4R6XA 1G7SA 2JLBA 3QY0A 4URVR 3MUFA 1WY5A 3G5TA 2XYHA 3R6GA 1I7PA 4LHEA 4B79A 3NAZA 4B34A 4F45A 2O0KA 2YC2C 3CBGA 5TS2A 3O1IC 3W2TA 1Y7HA 4G4SO 3LUKA 4K8RB 3JATB 5K0BA 3E05A 3FGNA 1KC1A 4H16A 4WQMA 4ZAXA 6AT1A 3B5IA 2H4FA 1HY3A 5JNVA 2E48A 1CUFA 2F62A 3EEOA 1UPAA 1VHJA 2CDAA 2EKBA 1OFHA 3LKVA 3N0VA 2B83A 1EGQA 1GPLA 1EVLA 3P2MA 4II7A 4LDAA 3W06A 1JTEA 5KCZA 3KB6A 4ZVNA 1XTQA 3HU3A 3U4QB 1E3JA 5FULA 4G5XA 4CTNA 3K5HA 1E5DA 1TLFA 3KV1A 1CUCA 4FQ8A 3IMFA 3L7CA 3HH8A 4N01A 1CNEA 3U7RA 4EHNA 4F5YA 1Z13A 1Y42X 2H57A 3GNQA 5ALGA 2EWMA 5C80A 4TT8A 3NIWA 4B1FA 2FWIA 2VYVD 2B98A 5GV8A 2AK2A 2EHDA 2H0QA 1XK6A 2F59A 4S04A 5EP3A 3B5JA 2BT4A 2VAPA 2YXBA 1WSBA 2ZWVA 3EVTA 4R8RA 1KQPA 3B6EA