3FTPA

Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from burkholderia pseudomallei at 2.05 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
248
structure length
248
Chain Sequence
DKTLDKQVAIVTGASRGIGRAIALELARRGAMVIGTATTEAGAEGIGAAFKQAGLEGRGAVLNVNDATAVDALVESTLKEFGALNVLVNNAGITQDQLAMRMKDDEWDAVIDTNLKAVFRLSRAVLRPMMKARGGRIVNITSVVGSAGNPGQVNYAAAKAGVAGMTRALAREIGSRGITVNCVAPGFIDTDMTKGLPQEQQTALKTQIPLGRLGSPEDIAHAVAFLASPQAGYITGTTLHVNGGMFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia pseudomallei
total genus 84
structure length 248
sequence length 248
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2009-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ftpA00
3GG2A 3BTVA 3NTQA 4J7UA 4XJSA 3DC2A 4CM4B 4KTTE 4CR8A 5I9NA 4JJIA 2BKAA 3B1FA 2EJVA 3D3EA 4FOSA 1LDGA 1FXSA 3AWDA 4CLXA 3WIEA 1PIWA 3E18A 3ETDA 1BXGB 1DIGA 2BFOA 1HDXA 1KVTA 5CDSA 1I3MA 1N8KA 3SC6A 3X2EA 3U9LA 4B4WA 1KYQA 3ITKA 3QWBA 2WYVA 3S55A 3CZRA 2CZCA 4OQZA 2YFQA 3AM3A 1Y8QB 4BO0A 2IZZA 1ISHA 2Z1MA 4AL4A 4XEHA 4MP6A 1C0KA 1JLLA 1SEVA 2J5RA 3RD5A 1ISFA 3A4VA 1HLDA 3KZVA 5DULA 3L07A 4XYLA 1GADO 1H9BA 3DZGA 4HY3A 1EVZA 4FSHA 3ANLA 3F1KA 1LC0A 2BI7A 1C1DB 3PDUA 4ND5A 1D8AA 3S2FA 3PTZA 1BVUA 4TWRA 4R1SA 4FOOA 4B3JA 1HSZA 4E5YA 2Q46A 1YRLA 3LT1A 3CMCO 4RGBA 3UFXA 1FDSA 4Y6RA 2BMAA 2OORA 2Q3EA 5JDCA 1ADFA 3AOEA 1DOHA 3RROA 1X7DA 5L7YA 4LGVA 3ZWBA 4EEZA 1LLQA 4R41A 2IE0A 4RCVA 5I7VA 3QJ5A 1I3NA 1EFLA 1YL5A 3F3SA 1GUZA 5LCXA 4XJTA 5KOIA 2E82A 5KTKA 2EHDA 1GEEA 1JQBA 4XGKA 4EJ0A 1QKIA 3OICA 1A27A 4TQGA 1R0SA 2R2GA 3TFQA 3G1UA 2EKQA 3I6QA 3D4NA 3ZU5A 4YRDA 4E0BA 5GY7A 4I9HA 4ALKA 5F21A 3PWZA 4R4JA 5GZ6A 1KY4A 1NWHA 2C54A 3EW7A 4Z9XA 1T2FA 2OBYA 1PR9A 3O03A 5KIAA 4K6FA 1U3UA 3RUIA 1EVJA 1RM0A 2BRUA 4A10A 3WGHA 3K5PA 1T24A 3OEYA 2BGMA 3JYQA 3JD4A 3JYLA 3TZCA 2Y0EA 3FN4A 5HWSA 4M1QA 3MWDB 1X14A 4JJFA 3WGGA 1HXHA 2X4GA 1E7QA 4JNKA 2NM0A 2VWPA 4Q3CA 4J0FA 1J0XO 2ZTLA 4YAJA 5KVVA 3R1IA 3F1LA 4FS3A 1NWCA 1GZ6A 3UVEA 3RASA 4BKQA 1QLHA 2PZJA 3PJGA 3U5TA 5C37A 1B26A 3UICA 4DLAA 1TT7A 4J91A 3DBHB 2ZQZA 4IZHA 1DB3A 1WWKA 3DZKA 4NFYA 3BHMA 4FBGA 4RVFA 4YR9A 1E3LA 3I4CA 3MJ4A 3AY3A 3ZV6A 5BNIA 1XU9A 4CMIA 3JD0A 1SAYA 4NK5A 5DCWA 1TEHA 4ZQGA 2HMWA 3LSYA 4R16A 2D5AA 3GH3A 1D3AA 1YB5A 1QRRA 1E7MA 1GV1A 2AQIA 4EITA 3OFSA 4J2OA 1ZMOA 4WUVA 2YV3A 5IZCA 1U8FO 3X2FA 4J1TA 4B3HA 4E13A 4D0RA 3GVHA 3H65A 3WTBA 4OMUA 4RF2A 3F4BA 1NBOA 4IDDA 1E3SA 5K6AA 3DAPA 4OAQA 2Y1CA 1P1KA 2X5OA 5IJZA 1DC4A 3LLVA 4LSWA 3ASUA 3WIDA 3PQDA 4Y6PA 1CERA 1O0SA 4IZIA 4BMSA 3GPDG 1B8UA 3GLQA 3PVZA 5HBRA 3GQVA 4AJPA 1ORRA 1ZXBA 4CL3A 3DHYA 5COBA 3PQEA 1PZGA 3BHJA 4DL9A 5H82A 1I2CA 4F6LA 5MGBA 2FN7A 1H9AA 3BMCB 3ZU3A 2C5AA 5A9TA 4B7XA 4E2ZA 1X1EA 1HDZA 2GN9A 3QP9A 1EQUA 3IIEA 4JIGA 1MXFA 2OZPA 4GLOA 2AQ8A 2GDZA 2OFPA 4UEJA 2PGLA 5F1PA 1JDJA 3UOGA 4E30A 3WYBA 3CEAA 3KOUA 2AEMA 4CQMA 5CDYA 5A5FA 4UVEA 1Q7GA 5JAMA 2FZEA 4BKRA 1U7TA 4D43A 3VKVA 1ZCJA 5ES3A 3RU7A 3MJTA 4EJMA 1KVSA 4NBVA 4TVBA 3GDOA 5ADHA 3P2OA 3TFOA 1MUUA 4LW8A 2X9NA 3MOIA 4YQYA 3GUYA 4GI2A 4Y6SA 5JYEA 3DOOA 4LVCA 4YPOA 3LC7O 1E7SA 1OOEA 2JD0A 3GDGA 1FK8A 3IAHA 5JO9A 3ST7A 1LRJA 2EP7A 2GPTA 5L51A 4ZVVA 4DBZA 5G4LA 1M2WA 1DC6A 1ZK4A 3AUAA 1NXQA 2Y66A 5JCXA 3ROMA 4RF3A 4NNJA 2FOIA 2EEZA 2EXXA 4AJEA 1W6UA 1BRMA 1YBVA 1DRUA 4J9UE 4JLWA 1D1SA 2HLPA 3HN7A 4QFCA 4BNWA 4L8VA 4DTIA 2FP4A 1M76A 3U0BA 3E48A 4YAIA 1IYZA 1PGJA 5JPIA 4DUPA 2BGKA 5T5QA 4MKRA 4WCFB 4FB5A 1Y5RA 2PV7A 3BZUA 3IP1A 4BO2A 1I33A 4NU5A 1E3IA 1RJWA 4AJHA 1RYDA 2Q99A 3WX0A 3RU9A 2ZATA 4CJXA 2X1HA 3WMWA 2BI8A 1E92A 3HQ4O 1TA4A 2J3JA 1H5QA 3D3WA 1QYDA 1Y6JA 3N74A 1Z82A 4N5LA 1HT0A 4KP7A 3U4DA 1SEPA 2OUIA 4J1NA 1B3BA 4DYVA 4JXKA 3HG7A 4S1VA 4II2A 2D59A 4BKUA 2C59A 2HRZA 1VLLA 2ZB8A 3VTFA 4WCFC 1H0KA 2I3AA 4MDHA 3QRWA 2Y0DA 4D46A 4R54A 2I3GA 2VQ3A 1XDWA 3G3EA 1R0KA 3I9LA 3KBOA 4II3A 1VC2A 3DO5A 3WGZA 1GZ3A 3T7EA 1PQUA 3TOZA 2A9FA 1A72A 1ZJYA 5DN9A 4WOKA 4PCVA 4XR9A 3BMOA 1IULA 1KETA 1GQQA 1R16A 2Q45A 4LMRA 3IS3A 2E4AA 2XF8A 4CLOB 2NVWA 4JBIA 3H2ZA 3ZNPA 5G0TA 3ZWXA 1O8CA 3DOJA 5TT1A 1TVEA 1IY8A 4O1MA 4DIOA 1NHGA 3PXXA 4PLWA 4YJFB 2YV2A 4R68A 4AFNA 3NTOA 4M49A 2D2IA 5JO0A 2GERA 4BNKA 3C8MA 1HDRA 3TSCA 1V3TA 4ROSA 3QVWA 3IUPA 1VJ0A 1MC4A 2D3TA 4NQZA 3RBVA 4U5QA 5ITWA 1YH3A 2EJWA 2UYYA 2Y1DA 1VJTA 3LU1A 4HFRA 2D5CA 4YJHB 2HK9A 4W9NC 1JKFA 1HWYA 3ZZNA 3RBXA 2O2YA 1NR7A 3GPIA 1WDLA 2FMUA 2PZLA 3OP4A 4FJ0A 4IJUA 3TRIA 4AG3A 4BNXA 4C7JA 2UUOA 2JL1A 4W4TA 3HDYA 3H6KA 2Q1SA 5JBIA 3JYOA 3TN7A 1P9LA 2BLLA 1OAAA 2WD7B 1WPQA 1DRWA 3K2EA 4LRTB 3H9EO 4P38A 3ZWYA 4E2WA 1SZJG 1W4ZA 3UCXA 4JN6B 4E5MA 4PLYA 1P0FA 3ETGA 4Y8VA 4ZU3A 3NGLA 3UGKA 1PS8A 3JQ9C 3D7LA 3KYCB 4FDAA 5IAAA 1P0CA 4U6QA 5DOZA 4P8RA 3FRJA 1K6JA 4UVIA 5KCZA 4ZQFA 2PZKA 3ZHBA 5BQFA 2GN8A 2JD2A 1KERA 4NG5A 5I9MA 2YHUA 4PG5A 3STHA 1PL6A 4J3FA 3B6ZA 4IY1A 1Y8RB 3GGGA 1ULUA 3ZU2A 2Q4BA 1T25A 1EEHA 2WD8A 4MP3A 3JQGB 4GSLA 1NR1A 2JHGA 3CE6A 3RBZA 1GYPA 1R6DA 2VWHA 7MDHA 3UCEA 4YBZA 4UREA 3WYEA 4J1SA 1EMDA 1M6WA 4XRRA 3K73O 2CFCA 4RL6A 3SLKA 3JD2A 2BGLA 1LDEA 3LLSA 4HBGA 1R4NA 2FRDA 1HF3A 4YXFA 1DFGA 4A03A 4DLBA 2PD3A 3OECA 1KC1A 3ZU4A 4BO1A 3W8FA 2VZ0A 1O94A 1VRWA 4GX2A 3I9NA 3L4BC 1ID1A 3V1TC 1GQYA 1VKNA 4TVOA 4BNGA 3NT5A 1T1RA 3ADPA 1Z74A 1DO8A 3V1YA 4CM9A 3Q9UA 1O6ZA 1IUKA 3DAFA 5L4LA 4RVGA 2VNAA 5L40A 4QX6A 2GRAA 5KKAA 1PTJA 3MEQA 4M86A 1P44A 1SMKA 3BA1A 4PLCA 1TB4A 1H2HA 3GC6A 1TXGA 3H4VA 3O8QA 3AFMA 3QW2A 4S3MA 2PFGA 5ILGA 3EC7A 4H3VA 8ADHA 4OKNA 5A9SA 1U2DA 2ZB4A 2X86A 1CJCA 3FPLA 3L0DA 1LQTA 4PZCA 1ONPA 3D4OA 1AHIA 4AJ4A 1AN9A 2F00A 2QW8A 3WGQA 4YAGA 4BKPA 1ZNQO 4B79A 1PL8A 1YS4A 4CR6A 3VH3A 4E32A 4Q3EA 4ZA2A 5CEFA 4R3NA 2VYVA 3A1NA 4J49A 1T1SA 3RC2A 5JY6A 2FWMX 3RFTA 3TQHA 2O3JA 2PNFA 3HB5X 4QQRA 1E1KA 3HSKA 1DFIA 3NRCA 4OIMA 2HDHA 3GA0A 4MVJM 4EDFA 4DPMA 3GGOA 1N1GA 2FPIA 5CDTA 5TRTA 1K3TA 1KVQA 1JTVA 2CUKA 3IJRA 4QEDA 2Y1EA 3GY0A 4JK3A 2CVOA 1YBMA 3OBBA 1X15A 2B36A 4FIZA 4J43A 4PRLA 1R4MA 1PS9A 1BDMA 3AI1A 4BNJA 2YUTA 3WGTA 3KXDA 3EZLA 2LDXA 1NAIA 4GH5A 2ET6A 4J2HA 3AM4A 5IDWA 2IYOA 3OIGA 3E8XA 5COQA 1ZO8A 4UVHA 4OXNA 1TI7A 4YT5A 4YAKA 1MX3A 1DFHA 2P9CA 3CH6A 4BQRA 3SVTA 5CHEA 2NACA 3GAFA 1EK5A 3GEGA 4I8XA 3GHYA 2Q2VA 4CMBA 3T4EA 1JA9A 3WGOA 5JMPA 5JC8A 1A9ZA 1AGNA 1DAOA 1KY5A 1ZBQA 5TNXA 2G1UA 4WOJA 3DZFA 2GUGA 3ZNOA 5CAEA 4UVDA 2RHCA 5TT0A 1U7HA 4GGOA 4CV1A 2G0TA 4NR0A 2VOEA 1C0IA 4WCDA 3SX2A 1CIVA 4CMHA 1W8DA 1BVRA 4LRSB 4DQUA 4YB8A 1NNUA 3DBLA 4A26A 1XU7A 1WZIA 5AOVA 4Q3DA 3TPCA 4IDGA 3OMLA 4P4NA 3MTJA 1C0PA 1U3TA 5DBGA 3RKUA 1P3DA 2QHXA 1F8GA 2NQTA 4WLFA 1V6AA 2YDYA 1K0UA 1B8VA 3F47A 2XXBA 5THQA 4CMGA 2Q2WA 4PLZA 3VHRA 2AW5A 1U4SA 5FWNA 1XG5A 3LYLA 3C1TA 1U3WA 2HJRA 2A94A 4BV8A 5FEUA 3AUSA 3BMQA 2X8LA 4H7PA 4KDEA 4XQCA 5L45A 1JN0A 3UCFA 2NUAA 4J9VA 2O7QA 1DC3A 3GRPA 1GDHA 1LNQA 4MKXA 3LQFA 4BNLA 1ULSA 1A5ZA 1CQJA 1PR3A 3H5AA 4HV4A 2CDBA 2HUNA 4UAGA 4E5NA 1RPNA 1WXDA 3ZW8A 2W2LD 3HDJA 4RV9A 3WJAA 3Q3CA 3EY4A 2B83A 3WXBA 3G1TA 3BAZA 2YQ5A 4AVYA 1VPDA 2GGSA 2P4QA 2IODA 3AK4A 1T4BA 2GCGA 3S2IA 4XDZA 1O5IA 5AVOA 4G2NA 4D0SA 3VZQA 4L74A 4XQEA 3TWOA 2GO1A 4TZTA 2X5JO 3FTPA 4LK3A 4C7KA 4BNIA 4CMIB 3GRKA 2OBNA 3JQFA 2VYND 1F12A 1HL3A 1NQAO 2EKLA 3K6JA 3MJSA 4R69A 1EUZA 4RVSA 4WNCA 1ADGA 3NV9A 1LSSA 3GAZA 2DBVO 4C4OA 4CM8B 5JNLA 2ZYDA 4Z0HO 1T2AA 4PZDA 2JKVA 5I8ZA 4ND3A 3DFZA 3LZ6A 1HLPA 1P45A 1ZW1A 3LT4A 4HX5A 2QYSA 2P4HX 3M6IA 2B37A 3CKYA 2NU6A 4I08A 3OIDA 5G0UA 3KLPX 4Q3BA 1LDYA 3U3XA 4BNMA 1GPJA 3TJRA 1TLTA 4DA9A 5KVSA 3OQ6A 5EQDA 3ZH2A 4IDFA 4R1TA 4L4XA 2YDXA 2NU9A 1GY8A 2BD0A 4DQXA 3U4HA 5JLAA 3K92A 3PEFA 1U3VA 1HZJA 3LF1A 4FC6A 2G82A 5IZCC 4FFRA 5LDHA 4HFJA 1P1FA 3M2PA 1E3JA 1P74A 3OA2A 1P31A 1NVTA 1CF2O 3F4LA 1I36A 4PG6A 3ROKA 2B35A 2EERA 4U0KA 4ZICA 1ARZA 1ZZEA 2OOSA 2UV8A 5JAIA 1B16A 1QR6A 3RAJA 3ZWWA 4IGFA 4WASA 1U5CA 5THKA 2JHFA 4CQMB 1A7AA 4XDYA 2VWQA 3SLGA 2EW8A 5TQVA 5CG2A 4XYBA 1GQ2A 1Q1NA 1LXCA 1U4OA 4XYMA 2EGHA 4CQMD 4MVJH 5L95A 3H9QA 4WK6A 4KWIA 1KC3A 5EESA 3PHJA 3F5SA 4BNHA 1NVGA 2ZKLA 4MO2A 4RQTA 3H3FA 4FQ8A 1NYTA 5U4QA 1E3WA 4ZN6A 1HYEA 1OC2A 4G5HA 2ZB3A 3L6EA 4IS3A 4D3SA 1SBYA 1Y5MA 4W6ZA 5CEJA 3V8BA 3R6DA 2PD6A 3FR8A 1LTHR 1XQ1A 3ABIA 3OJOA 5A9RA 1XHLA 2SCUA 5FFFA 2X9GA 3C1AA 1QMGA 1MGOA 3FNEA 4N18A 3TOXA 1PGPA 4HKTA 4PGFA 2ZCUA 4GWKA 5CPFA 1GU7A 2Y68A 4PG7A 2WYUA 1T2DA 3S8MA 5DNAA 3O26A 4CMAA 1ZFNA 3FWZA 1W73A 1PX0A 5I9LA 5T67A 1GFSA 1S6YA 4ALMA 4YCAA 2Y05A 4A27A 2FSSA 1UR5A 2NLOA 2QIOA 1KS9A 2Q1UA 3PLNA 5JAZA 2HK8A 3NEPX 3WWYA 4XB2A 1KBZA 1PJCA 2Y1FA 1KOLA 1C1XA 3L9WA 4RF5A 2P9EA 1VSVA 3E1KA 3BTSA 2NTNA 2C2XA 3D3WB 4OHUA 4GLLA 3DXFA 4GKVA 3VZPA 3INRA 4RPJA 4RO0A 3A06A 4P4GA 3KTDA 1GYRA 1VSUA 2BF7A 3HZZA 2P2SA 3IJPA 4IS2A 1ISGA 1UP7A 1PWZA 5L7WA 4ALJA 3GVPA 3ICCA 1ZK1A 2V6GA 4B8WA 4CMEC 4DVJA 3SBOA 1I32A 1HYGA 2RH4A 1AUPA 1QG6A 3KB6A 4HFMA 1GEGA 4LMPA 5JW6A 4ALLA 2HSDA 1WMBA 4MOWA 1H6AA 3GNQA 2FY8A 2J6IA 3I3OA 3VAZA 3GNSA 3H8VA 3BMOB 1MB4A 2GF2A 1H6DA 4J7CA 4N7RA 2QQ5A 3T7CA 3E6AA 4BNVA 4OOEA 4TROA 3JQ8A 1PZEA 4Q39A 3MJCA 4IIUA 1IB6A 4E5KA 3KSZO 4R3WA 1R15A 4YDRA 1NFRA 2IEDA 1BWSA 3WOHA 5I8WA 3INTA 2OO5A 2EF1A 1EUCA 3IKVA 2H6EA 4B4VA 2QYTA 3FI9A 2AA3A 4PIVA 4G81A 3HUDA 5T6BA 4J4BA 1GV0A 2OL4A 2B69A 1UDAA 1EVIA 5HM8A 3BXXA 4GKBA 4Z9YA 2NSDA 3BYZA 1NP3A 1DEHA 3DTTA 4UUOA 2ZJ1A 3PYMA 4PG8A 3JQCA 4GL4A 1DJQA 2ZTUA 3CSDA 2JFHA 3OA0A 5DZSA 2E49A 2O3SA 5C7LO 3VPHA 2O48X 2DBRA 1DBVO 1YXMA 4B4OA 4R01A 5GZ1A 2AE1A 5T8KC 3ZW9A 3KEQA 1ZSNA 3ZWCA 3VC7A 1P33A 1IPFA 2PK3A 1OI7A 1UXHA 4TRJA 1LU9A 1MV8A 4BB6A 4F6CA 5GMOA 5ILOA 4IMPA 1PJ3A 4U6SA 4XKJA 3JQ7A 5A04A 2XPCA 3I9JA 2DC1A 1L7DA 3HDHA 5K9ZA 5IXSA 1ZSYA 4U8GA 1S7CA 3DWFA 1NVMB 4BKOA 5A4DA 3D0OA 4YJGA 4R9RA 3LF2A 3PGXA 5EPOA 1I3LA 2QZZA 2GR9A 3KVOA 1U5AA 3VH2A 2J8ZA 4R9SA 2P91A 3OEWA 3CTMA 3LC2O 2V6BA 3WTCA 1BMDA 2J3KA 3NTRA 1YBAA 4PLGA 3PIIA 1F14A 3Q9NA 5JY1A 3NYWA 1J4AA 3HJAA 3PP8A 3E82A 4YYZA 4WJZA 3UKOA 5BSEA 3GUCA 1I2ZA 3C24A 1PQWA 2O4UX 3CPSA 4IJKA 2ZQYA 5JCJA 1U2GA 2ZK7A 3AY6A 5JE8A 2Q4EA 2R00C 1GL3A 4J1QA 1IOLA 3RUFA 4NFHA 2IEBA 2E37A 4AJNA 1UXJA 1R4NB 4A0SA 5IDYA 1LDNA 1GD1O 2WM3A 2RH8A 2ZIZA 2Q2QA 3VPFA 5GZ3A 2QG4A 4BHTA 1VJ1A 3KEOA 1HEUA 2VRCD 2CVZA 9LDTA 3I83A 1M75A 4XQ9A 1H6BA 4YEDA 1CETA 3KV3O 1I2BA 4KMSA 3GOHA 1U8XX 4ND2A 2Z95A 4QT0A 4UULA 1RM3A 3DMTA 3EVTA 1LRLA 3GK3A 1SNYA 2CY0A 1K5HA 2WWRA 3ON5A 3AY7A 3E9QA 5CP8A 4ND1A 2J5KA 3FR7A 3QWIA 5AXBA 4A5OA 4J6FA 2I65A 4BGIA 4CM9D 4F3YA 4DMMA 4AJLA 3S2EA 1LI4A 1ADBA 3O8QB 5AXAA 4BVAA 2D4AA 1F06A 5EIOA 5A9SB 2WYWA 3A28A 1K2WA 4IQ8A 4B8ZA 4FGSA 3TL3A 3DHNA 4J4HA 1NAHA 4UUMA 1UXGA 3AW9A 2VOJA 4RF4A 1PWXA 2A92A 3RCBA 1QP8A 2Y1GA 3TZ6A 1F0YA 5A3VA 4BL5A 3RSHA 1KEWA 4NJMA 2UUPA 1BDBA 1DLJA 2YW9A 1LA2A 2JCXA 2NU8A 3VPSA 4DYDA 4OGWA 4MVJG 1NFQA 3EAGA 4ZGWA 3UUWA 3E03A 5TSDA 1B2LA 1ZH8A 4I5DA 2Q1WA 3QWFA 3D5TA 3PPIA 3CMMA 1IZ0A 2EG9A 3C7AA 3FTNA 3AI2A 1R4MB 3JTMA 2B4TO 4WGGA 4BO9A 5A1TA 2ZTMA 1EE2A 3PZBA 4MIOA 2OXIA 3WLEA 5KVCA 1GTMA 2O2SA 2OP0A 3DHEA 2C0CA 3JCZA 2C5EA 1G1AA 1E7YA 1N1EA 2A35A 2X23A 2WEKA 1VE9A 4CV2A 3EMKA 4RLHA 2GSDA 3HADA 3U4IA 4OKIA 5KJEA 4E31A 4G65A 2HKIA 4NBTA 1SO8A 1BGVA 2DAPA 4O6VA 4TMFA 4M89A 5AXDA 1NQTA 3GVIA 1O9BA 1EDOA 1TT5A 3JQEA 4P4LA 4WLEA 1ZK0A 5LC1A 3ZWVA 1DXYA 1HKUA 3GZ4A 3HHPA 4MP8A 3DBLB 3H7AA 4O5OA 1FDVA 3IDSA 2H5LA 2VN8A 3UH1A 4D79A 6LDHA 4XR4A 2C07A 2JAHA 3PYLA 4GAEA 4NPCA 4ALNA 4TZKA 1NPTO 3IQDB 4L4RA 1ISMA 2GLXA 4BNYA 4RVDA 4AICA 3IMFA 4FJ1A 2XAAA 1NHWA 3WFIA 4IJWA 1UUFA 5JAQA 3ZWAA 4WNIA 2VUTA 3DAGA 1H93A 2FPGA 3FCOA 3BHIA 3BMQB 3EDMA 2CDAA 1WP4A 2PH3A 3RWBA 4CODB 1JVSA 2W2KA 1ENOA 3NJ8A 4BO7A 1YVEI 8LDHA 3FNFA 5JYDA 4MIYA 3I9KA 3GNTA 2Z5LA 2NV6A 4E12A 5G4KA 1A71A 1CQIA 3WLFA 2GZ2A 3TZQA 1HDYA 2FR8A 4RJTA 1CYDA 1I10A 3H5NA 4MKZA 2VWGA 1E5LA 3BMNA 1HSOA 1P1HA 4LCEA 4OXKA 3PHGA 5B4UA 2ILTA 3F46A 1UH5A 4XIJA 4IBOA 2AG8A 2PTGA 5JC1A 3ONFA 2W4QA 4TRNA 1LQUA 4WECA 2C7GA 1UDCA 3RC1A 1MA0A 1V35A 1YQGA 2DFVA 1YB4A 1QORA 4CM5A 5TF4A 4FGWA 3RUAA 4DIFA 3EHEA 4BGEA 4LN1A 2DKNA 3F6YA 4JX8A 2VZ8A 3PI7A 4IUYA 3UF0A 5KNLA 3E5RA 4DIBA 3P5SA 5U9CA 2J3HA 2POQX 3O9ZA 3GZNA 4INAA 4LVUA 3V1UA 1IPEA 2D1YA 3PWKA 4GWGA 2AEJA 3JQDA 4BGUA 1PJTA 4RPGA 1NFFA 3DR3A 4R1UA 4BNZA 4EW6A 2PZMA 2O4CA 3NX4A 4IIVA 1V0JA 3ZV5A 3A14A 4GMFA 1Z75A 3MOGA 1WAMA 1BW9A 5L4SA 3DBRA 2VUUA 4YRBA 4BO3A 4I1IA 5EMHA 3HWRA 4BOYA 1UZNA 2RIRA 4K1LA 5DF1A 1BXKA 4M87A 2BELA 3CUKA 4FW8A 1ZEJA 3N7UA 1VM6A 1U1IA 4B3IA 2FZWA 1XWFA 4D41A 1E5QA 2AQHA 3JQBC 5JDIA 4L0QA 4OM8A 3COSA 2YJZA 2PKQP 4GX1A 2AMFA 4L9RA 3NT4A 5L3ZA 3MTGA 5ITVA 1PEDA 2HMVA 3CINA 1ZK2A 4F45A 3BTUA 1ZVMA 1EE9A 2DU8A 2HMTA 3FF4A 5B12A 5I7FA 4DGSA 4IQ0A 1QV7A 4W82A 1PJSA 3PJDA 3DB2A 3KYBA 1C3VA 2F1KA 3DL2A 1ZJZA 4UEKA 3JQAA 4IXTA 4PN3A 2P5UA 3UHAA 4O0LA 1P77A 2ZTVA 3FNGA 1E3WB 5KKCA 4BNFA 3KUXA 5EL0A 5IFLA 7ADHA 4ZRMA 2JCVA 3JV7A 2C20A 4KUHA 3QVTA 4XB1A 2RAFA 2YHIA 4CUZA 4WE3A 1ENYA 4R1NA 5BNFA 3MJEA 3KYDA 1PGOA 4D7AA 2X6TA 1Z45A 3CZMA 4XCVA 3H9UA 1SPXA 3G17A 3SJUA 4DPLA 1GZ4A 3PRJA 3R0IA 1Y9AA 4CMKA 4GGPA 4XWYA 1LEHA 3C3XA 3NKLA 5F3RA 1NQOA 3JD1A 4NMHA 4OQYA 3ASVA 1JAXA 4Y9DA 3OM9A 5JDCC 3AOEC 5MDHA 2FHSA 3CXRA 1JW9B 4CQLA 5EINA 4K26A 5TGDA 2VZ9A 2VRBA 1PS0A 3QE3A 5TS3A 4HXYA 3S2GA 3ZNQA 2WE8A 1JWAB 1EVYA 3B70A 4FR5A 1EBUA 1C1XB 1YQXA 1M67A 2RHRA 4QUKA 1YOVA 4Q9NA 3I9OA 3N58A 1X0VA 4JP3A 5KJ1A 3NGXA 1CWUA 3L9XA 4IGEA 1XQ6A 4BNUA 3ZWMA 4R51A 1HDOA 2I66A 2YQ4A 1E3EA 5HTOA 3ENNA 2EWMA 4DC0A 1I5RA 3ANMA 3QLJA 5C7IO 4CL8A 1QYWA 3VZRA 1JU9A 1WZEA 3PHHA 3QVXA 4BNTA 5DCUA 3W8DA 5KJFA 4Z0TA 1PJ2A 3L4BA 3OH8A 1E7RA 3E9NA 3WB9A 1D4FA 3PK0A 3QSGA 1YGYA 5FYDA 4ESOA 4WLOA 3H9GA 4J0EA 4OH1A 1IE3A 4IPTA 3VDQA 1BG6A 1YDWA 3IC5A 4MINA 1WVGA 1YB1A 1UZLA 1YO6A 3PZRA 2VTDA 3GDFA 4EYEA 3H2SA 4E21A 4ZRNA 1WNTA 3PLRA 3K31A 2WDZA 3TF5A 4YRAA 3PIDA 3ZN2A 3RUDA 1QYXA 3GFGA 1RYEA 2GYYA 2WE7A 3RC9A 1RWBA 3JQ8B 4J4TA 4ND4A 3KHUA 5J23A 2O50A 4KUGA 2DT5A 4NHEA 2UVDA 4ZHSA 1N7HA 3GVCA 1JKIA 4KDFA 4KUEA 1BSVA 1M6HA 5C7OO 3RFVA 1XGKA 2NVBA 1N9GA 4DXHA 4MVJI 2EKPA 2PA3A 1T2EA 1C14A 1XIVA 2I6TA 3OJ0A 1VL6A 4O59O 4RPHA 3NJ4A 1R12A 2B4RO 3BIOA 1ZKMA 2H63A 3FNHA 9LDBA 3QY9A 3KETA 1IL0A 4XYGA 4J90A 2CNBA 4QECA 4RZHA 1LSUA 2IRWA 3W4JA 1KEUA 1CRWG 3C85A 2BH9A 3U49A 5K0ZA 5DOVA 2HU2A 5IZ4A 4FCCA 3FD8A 3WQSB 3SXPA 4CPDA 1V3UA 1Q0QA 3UW3A 3C7DB 4OO3A 4YA6A 5DP2A 5G0SA 4RVHA 4E6PA 4TSKA 5K6AC 3AU8A 3FPCA 3VH1A 5CPBA 2P9GA 4NIMA 5G0WA 2ZYGA 4RORA 1U28A 5BR7A 1N5DA 4CMJA 3H5RA 4HADA 3AUTA 3FHLA 2DUUA 2G5CA 4JJGA 4LISA 4WLUA 2O7SA 3JQ7B 1JWBB 1AXEA 4FD3A 1M66A 3L6OO 1KIFA 1ZXLA 5HA5A 5T64A 1LLUA 1EK6A 2PY6A 1IZ9A 2YY7A 3M2TA 5A5EA 2X22A 3IUSA 4N54A 1A4IA 1E1MA 1PSDA 1ISIA 4L4SA 3ZDFA 4YJGB 3FBGA 1UP6A 2AG5A 5L53A 4OSOA 1UAYA 2PKRA 1ENPA 5ER6A 2VNSA 2HCTA 5AQ1A 3Q11A 2ZCVA 3QV1A 3V2HA 1V8BA 4RQUA 1DSSG 4HUJA 3QWHA 4R5HA 4AJKA 3KLMX 4DWVA 4N5MA 3JSAA 5I7EA 5G2OA 1N92A 1EFKA 1ZIDA 4BNNA 2O3QA 1ML3A 1Q0HA 4E2XA 3ENKA 1GAEO 3K30A 2WSBA 3I23A 1FDTA 1VL8A 3ZWOA 5KWEA 3U09A 1EQ2A 3GHHA 1X0XA 5JCJD 3ZI0A 1XYGA 3U62A 3ZCXA 2HK7A 3RJ9A 1JKJA 5ER9A 4PVDA 2JAPA 2HMUA 4FC7A 5IN5A 3ONEA 2VHXA 5H81A 3RUCA 4E4YA 4XYEA 3IOYA 3O4RA 2X7HA 3VOSA 1NM5A 3AJRA 1MG0A 3K8ZA 3ZGYA 4E33A 3AOGA 3DBVO 2Q1TA 2YYYA 4CLRA 4I5FA 2AQKA 2I5PO 5JMWA 4NK4A 4EJ6A 4JBHA 1YL6A 3WDSA 3DZHA 5F5LA 4K9DA 3FBTA 4B4UA 3MCVA 3B1JA 4D3DA 1BTOA 3WBBA 5TX7A 4A7PA 3AM5A 1G0OA 1JAYA 4IINA 5ENDA 1KVUA 5KVQA 3ICPA 4TKMA 1DRVA 5AYVA 2O3TA 4M54A 4Z3DA 2B4QA 3EGOA 2RCYA 1HE4A 2W2LA 2NU7A 5COAA 4KQWA 4XIYA 1O95A 3ONDA 5JSFA 3BTOA 3A9WA 3DMTC 3DOCA 5TJHA 2LDBA 1PL7A 2D8AA 2CMDA 4JGBA 4NJMB 5L9AA 2YZ7A 1EZ4A 1XR3A 3PDJA 3R3SA 4BO5A 4GBJA 2HJSA 1DIHA 3RIHA 4BB5A 1MXHA 1Y1PA 2GASA 2VHVA 2FR1A 2PLAA 1B0AA 3RQSA 3TL2A 5C5IA 2P68A 1OC4A 2WMDA 1ONNA 2I67A 2CDCA 2DBQA 3ORFA 1SOVA 4PLVA 5FF9A 5CG1A 3V5NA 2VYNA 4YQZA 4PZEA 4D45A 3LK7A 3PJFA 1ENZA 3PFWO 4IQGA 2HMSA 4DREA 1ISJA 1YL7A 2E48A 1ONOA 3DDNA 3AI3A 4M8SA 5DCYA 4EUFA 3PQFA 1SC6A 4E2YA 1MFPA 4IDBA 5TIIA 1YDEA 1QXSA 2P5YA 1B8PA 4NU6A 4CM8A 1NPYA 4DC1A 4NJOA 1QYVA 2Y67A 1LLCA 3HE3A 4MVJA 4CV0A 3ITDA 1EBFA 3I1JA 3ANNA 4PLTA 5FI5A 2NVUA 1TT5B 4YAEA 3QQPA 1B15A 3PYXA 4BMVA 5B4VA 1WDKA 1AXGA 3I9MA 4CM4A 2DFDA 2VHZA 3GN2A 3LT2A 4KTVE 3L4SO 3ADOA 1V9LA 1QV6A 4J16A 4MPDA 2XXJA 4MIEA 3F9IA 1VL0A 4NBRA 1BXGA 2OHXA 5A03A 1XELA 5CFZA 4XA8A 5EERA 4QO8A 3JYNA 3D4PA 4FPXA 2DTDA 4F46A 3WGIA 3UXYA 4GVLA 2VUSA 3VVCA 2Y93A 2NWQA 1Y8QA 3G79A 2BHLA 4CUJA 1NPDA 4ILKA 5T57A 4N5NA 3D5QA 4ALIA 2ZB7A 3F5QA 4FFPA 1X7HA 4BUCA 4PLHA 4RZIA 2I76A 4ZQEA 2HO5A 1Q7CA 2IZ0A 5L7TA 4B7CA 1MG5A 1YQDA 2W2KB 5JS6A 1EUDA 1C1DA 3O38A 2DUWA 3QWAA 1GUFA 2WJPA 2B5VA 4NFSA 3OJLA 5G4KB 5BSGA 1XLTA 5IG2A 3W4IA 4CM7A 5BNTA 3ZV4A 1PZFA 2X9VA 1ADCA 1Z7EA 1W0CA 2B0JA 1PJQA 1QSGA 1YE3A 1V3VA 3W1VA 1BHSA 2TMGA 3LT0A 1ZMTA 4UVGA 3BMNB 3ULKA 3EK2A 3K2BA 3WMXA 4BO8A 4HNGA 2VCYA 2OP1A 3EZYA 2UAGA 4BQPA 1LDBA 1ZSVA 5DDIP 3P2YA 4D3FA 4K6CA 3HNPA 4GX0A 4ZQHA 5KJCA 1DIAA 5CEEA 1UAGA 1EDZA 2PR2A 4EGFA 1Q2XA 2GN4A 4IDCA 5B1YA 1LC3A 2EW2A 4EUHA 4FFOA 5JFOA 4RPLA 2VTEA 4A2CA 1E7WA 1ZUD1 1WDMA 4XQGA 3NDRA 2BFAA 3NDIA 2PGDA 3E5MA 4PLFA 4KZPA 3OQBA 2CVQA 2W98A 4PVCA 4R5MA 3INGA 5U1PA 4OOFA 1Z7BA 1I30A 3ZWNA 4KQXA 4XD2A 1DHTA 2V6MA 2CSUA 1VKOA 4CMEA 2Z1NA 2D0IA 4EI2A 1VI2A 3GZNB 4NI5A 3RJ5A 3P7MA 2CD9A 2YV1A 4D44A 1RKXA 3PHLA 4DRYA 4JP2A 3V2UA 1N7GA 3G49A 4Z6KA 4XX0A 1K6IA 3JQ6A 3DZBA 1E1LA 3KO8A 3HFSA 1H94A 3OETA 1BW9B 2AHRA 1YKFA 1DDOA 3GT0A 4AJ2A 2VYVD 3DBRB 4I5GA 1Q7BA 2HRBA 3NUGA 1UXKA 3FWNA 1LRKA 2JJYA 2PH5A 3Q2IA 3DBHA 3GMSA 2NADA 4CLEA 4GX5A 2H9IA 3K9QO 5B4TA 4CLDA 1T2CA 3EUWA 1DC5A 4Z9FA 1PQPA 5A05A 1E6WA 2DPGA 1I01A 2J5QA 2NTVA 5AXCA 4P22A 3CIFA 2FPPA 3GEDA 5TC4A 4L73A 2G17A 3MJVA 3Q1LA 4OSPA 3SJ7A 3TDKA 1A9YA 3GR6A 5IF3A 3L77A 1WW8A 4I9NA 5F1OA 1JVBA 3H3JA 3WR5A 2Q49A 3LC1O 1UJMA 3ZHXA 4MJLA 1G6KA 3PFFA 4ZJUA 1Z73A 1NX6A 4ZD6A 2V6FA 3JQAB 2CF5A 3H9JA 5L4NA 3EVNA 4OYRA 5T8KA 4YACA 2Q50A 2DLDA 1OBFO 1PGQA 2E6UX 2GD1O 1GCUA 3JQAD 4PG4A 3RKRA 4NH4A 4RPKA 2IDZA 5A06A 5JDIC 3RC7A 1B7GO 1R0LA 1XA0A 4EUEA 2PWZA 4UUPA 3Q2KA 1NASA 2YHIB 3D1LA 3GMDA 2EP5A 1WMAA 3KYDB 1A4UA 3ZHYA 3HB4X 3B1KA 3JYPA 3JD3A 1YONA 2PGJA 2OMEA 4TKLA 4A73A 2JCYA 3BMCA 4QSMA 1MP0A 3ETEA 3IKTA 5TJ9A 5IXYA 2W8ZA 1QLJA 3QHAA 3OIFA 3LDHA 1AE1A 4CM6A 1FDUA 1K6XA 5TLSA 1H6CA 2A4KA 1SOWA 3WSVA 4DLLA 3KM0A 1Y81A 3GG9A 4CQLB 1GPDG 3OSUA 3I4FA 4HFNA 4DQVA 4JQCA 3AFNA 4AJJA 4LCJA 2V65A 5ICSA 3LVFO 1ZK3A 1J49A 2IXBA 1KVRA 1U9JA 3U4CA 3HDQA 2O3RA 3QVSA 3VDRA 1FMCA 2R00A 1DIRA 1YOVB 4WEOA 3DTYA 3PGJA 1RM4A 1ZEMA 2AEFA 5HS4A 4H15A 4Y98A 4MVJE 4CUKA 4RLSA 5EQFA 2NNLD 2X58A 1PGNA 1SB9A 2AXQA 3ROQA 2DVMA 3M1LA 5I7SA 1GYQA 2X0JA 4DPKA 2O23A 1E77A 3HFGA 3GF4A 4URFA 3OF2A 3C1OA 1E0DA 2JD1A 5ICMA 4HWKA 1HDCA 4CM1A 2IYPA 3KRTA 1FDWA 4K28A 2X0NA 3GFBA 1HYHA 3WGYA 1X1TA 3B20A 5FI3A 3VVBA 1FF9A 1B3RA 1I24A 1LUAA 1N2SA 5BT9A 2DPHA 4BV9A 4W7HA 2QZ9A 4E5PA 2TMDA 3DEYX 5EN4A 1FJHA 3K96A 3UN1A 2QRLA 1WLYA 4L75A 3QVOA 2GN6A 2X0RA 4ID9A 4AJOA 1QYCA 1Q0LA 1HDGO 3PWSA 4JBGA 5DT9A 5LDGA 1J5PA 6ADHA 3NDJA 2VRCA 1I3KA 1GUYA 3I52A 1LBEA 3P19A 3ZHZA 2H1SA 4CR7A 4WCFA 5BSFA 1DPGA 1HRDA 3Q0EA 1HE5A 3RUEA 1CEQA 1C0LA 5HRUA 1NTOA 2W90A 1R37A 4U7WA 4YWJA 1DHRA 1YWGO 1HE2A 1N9GB 4FN4A 4KOAA 2WTBA 3OHSX 3WQRA 3OJFA 3PJEA 1CDOA 4IJVA 4X54A 2EV9A 5A02A 1G0NA 4NBWA 4FFMA 4XZ3A 4QO7A 3JQFC 2DTXA 5DP1A 3RI3A 3V2GA 3W6UA 2O3UA 4CLHA 1UDBA 4Z0PA 4EEXA 3ZNNA 2X5KO 3G0OA 3SEFA 4ITUA 1T4DA 3DMYA 3WNVA 2VT3A 4GSKA 5F1KA 1L7EA 2Y99A 1BXZA 1O89A 4QTZA 4QFDA 3GEMA 4WEQA 4NBUA 2RBEA 3GGPA 2DQ4A 3GVXA 2GZ3A 1KEVA 4W7IA 4XGIA 2I99A 4LSMA 4UUNA 4U0JA 4FFNA 1LJ8A 3HN2A 2Y1OA 1PJLA 3W6ZA 5IN4A 1F17A 1LDMA 2VHYA 4QXMA 2PKQO 4Z3KA 2BFPA 1LLDA 2HQ1A 4NZ9A 4EZBA 1Y9EA 1Z6ZA 4AJIA 2OGUA 4WLVA 3VZSA 1AHHA 2C2YA 3MZ0A 1P1IA 4W9NA 4RDIA 4CLOA 3RVDA 1A7KA 3DZJA 2EIHA 3D64A 1P1RA 4GQAA 4YT4A 4BMNA 1K89A 4Y67A 1H2BA 1GCOA 4JCOA 1F8FA 4YJFA 2R6JA 4BS9A 3T4XA 4NDNE 4YT8A 4WKGA 4PRKA 3DONA 1HETA 3ZV3A 5JXWA 5CDUA 5G0VA 1DJNA 4D42A 3I5MA 1UXIA 5F5NA 1I0ZA 4L76A 4OJNA 2QRKA 1XSEA 3W8EA 4CM3A 2DTEA 3JQ9A 4BO6A 3QA9A 3WFJA 1MFZA 4YJHA 3TNLA 4AJ1A 4J7XA 1PJ4A 3W4KA 3TZHA 4HNHA 3DQPA 4MVJP 4EBFA 1SCUA 4RDHA 3WSWA 1XKQA 5DBFA 1HZZA 3VKUA 3PHIA 5CDGA 4CV3A 3I6IA 2FSVA 4GVXA 2WD7A 2GZ1A 5EJ2A 1UP4A 3OQ1A 2G76A 4IXWA 3WQQA 1PU2A 1X7GA 1NQ5A 2PD4A 5A3JA 4DBVO 4CLRB 5BSHA 4RVUA 3RFXA 4HP8A 4ONEA 2IZ1A 3WICA 4M55A 4BO4A 2C82A 3FSRA 3DFUA 5IDQA 2V7PA 2JFGA 3KYCA 1B14A 1P1JA 4Q3AA 3IP3A 4TRMA 1SB8A 4FJ2A 2ZJ0A 3AU9A 4OL9A 2DM6A 4KWHA 3AUUA 4TRRA 4FFLA 2GNAA 1LSOA 3M1AA 1E1NA 1YJQA 3RUHA 2HAEA 3WNQA 2NTJA 5H83A 1MLDA 5ENVA 1E6UA 4XGNA 4XRGA 3S1LA 1D7OA 1DAPA 2CF6A 2VHWA 3C7CB 2JFFA 1X13A 1Y8RA 1J6UA 4UEOA 3WBFA 2UDPA 3WS7A 1HE3A 3MWEB 2B5WA 3WYCA 4IDEA 4E3ZA 1UZMA 2X0IA 3JQGA 3KSDO 4W99A 3Q6IA 1T26A 3L6DA 1LSJA 3IL2A 4B7UA 2DBZA 4MVJF 1L1FA 3ZWPA 3UAGA 2C29D 4DMLA 3NAQA 3WWZA 4YVFA 5B37A 3WJ7A 4O63O 4YT2A 3WG9A 1XCBA 4H16A 3SC4A 1PJBA 1OFGA 3GN1A 4CMCA 2NQ8A 1IHYA 4Q3NA 3VTZA 2XOXA 4I5EA 4WPGA 4GMGA 4PLPA 3DZIA 2I9PA 2BFMA 4YJDA 4JROA 1I8TA 2VT2A 3R3JA 1OMOA 3ROPA 1YJ8A 3E9MA 1PZHA 1DLIA 3KSUA 1HTBA 5IDXA 3NT2A 1RM5A 3EYWA 4PFJA 1D1TA 4YTEA 1GR0A 1KEPA 4IM7A 2QRJA 3QIVA 1DIBA 2J3IA 4IDAA 3VPGA 1R66A 4WLNA 1OZAA 2C7VA 4BIIA 5HS6A 1IHXA 2Y0CA 1MC5A 2AE2A 2FR0A 4OXYA 2YFHA 2EGGA 4ZQBA 3TZKA 5C3MA 5KJ6A 4MVJD 4IMRA 5DBIA 2NVUB 3VH4A 2ZYAA 3JQBA 4I9UA 3VPXA 1Y7TA 3OJEA 2IXAA 4BGVA 1LX6A 2QX7A 4GPD1 1XEAA 1E6EA
chains in the Genus database with same CATH superfamily
2JJ8A 4X71A 1RAIA 5IH3A 1ACJA 5CVDA 2HSJA 5FBQB 4CM4B 4HRAA 5I9NA 4JJIA 2C7OA 1Q83A 4YCJA 4CF6A 1FXSA 4KXUA 1G2IA 3DF7A 1X1CA 3R4CA 1N3LA 1QNFA 4I2VA 4DZTA 3D6MA 3RK4A 3UUFA 3KU4A 1ZIOA 1ETHA 5CDSA 2NO4A 2IHZA 3SC6A 3I62A 4B4WA 1JE0A 1AGXA 4F8EA 3QWBA 3O93A 2WYVA 1J8YF 1IUNA 2CZCA 4OQZA 4PV7A 3AVTA 5C9ZA 3GPCA 2MSNA 1J22A 1NNLA 4BO0A 1A76A 1W0JD 2X1LA 2ZJ4A 2QYOA 4XEHA 4MP6A 3D8SA 5LFAA 3G5TA 3WGNA 2J5RA 1JLLA 1Z2AA 5K2OA 1I4LD 1J0BA 1ISFA 4CFZA 5K99A 3MJDA 2ILVA 5DULA 1GADO 2VJMA 5D5HA 5AHKA 3RNOA 4HO1X 2RONA 4DIMA 3IP9A 4EB3A 4JYBA 1J9GA 3A4LA 3MYYA 4WD3A 1C1DB 2UZAA 1EK2A 1D8AA 4ND5A 5EUMA 3WGMA 1MOZA 3WWEA 2J6HA 2VXOA 3K3PA 2QAGA 2FU5C 1MAWA 4X3PA 4HAIA 4Q1BA 3RC8A 1P2SA 4MUGA 4HMPA 2V4MA 4K05A 5GJCA 4P4UA 3LT1A 4Q24A 1ESNA 4Z8XA 1T3SA 2C3PA 4JLPA 4Y6RA 2BMAA 2Q3EA 1ADFA 1KI9A 3ZD7A 3KOZA 4EF6A 4ZVMA 2QRMA 3UMBA 2J3LA 3L0IB 1N5JA 1U9IC 4M83A 4EEZA 3ZHRA 1LLQA 3C97A 2IE0A 1RZRA 5I7VA 4ZI7B 1I3NA 5C8YA 1R9NA 1J8MF 3F3SA 1GUZA 3SQMA 1R6XA 4XJTA 2GXQA 4GIBA 1KBOA 2QPLA 4IOJA 4Q9LA 5CFQA 3PX7A 1NVFA 5CX4A 1NLFA 5KTKA 1DBPA 2ZUDA 1LW7A 1JQBA 3M1YA 4OL0A 4ZODA 4CIDA 4EJ0A 2K7FA 4KE8A 4I1OA 1KPIA 2QJTA 5EMMA 3TLAA 1EFHA 3A9SA 3ORRA 1BEUB 1RYFA 2HDWA 2TS1A 4YUAA 3UMMA 3N05A 2B1QA 3PE4A 1GRRA 1PDOA 4FOTA 2EKQA 4V3BA 3RFUA 2QA5A 4ZHQA 1SQ6A 1Z33A 3KHSA 3WWOA 4Q9HA 4E0BA 4LF9B 1U0EA 4I9HA 2XNCA 1MOPA 2IHVA 3IPRA 4KE7A 5J40A 3KS9A 3GJ5A 1KY4A 5JISA 1W7AA 4GUDA 2XBUA 3TXYA 5EZYA 2C54A 2CMKA 4Q7EA 2XI4A 5L3QB 2OBYA 1PR9A 2IZ7A 3RUIA 3G8YA 1L5QA 1OR8A 1XNJA 3R6GA 3WGHA 1TECE 2XKBA 1ZN9A 3RV4A 2Z56A 2HCJB 4A15A 1XU4A 2BGMA 1VPVA 3JYQA 3M5CA 3G7UA 4WXPA 5AKLA 3TQCA 5A0TA 3HUFA 5LD2B 3GIWA 1SVOA 2JFPA 5ALPA 5INTA 4M8KA 3CUEF 4JJFA 4XIFA 2Q3MA 1OIWA 2RGWA 1KK2A 1P9NA 4P53A 5DM2A 3WGGA 5BQ3A 4OX9Y 4IHJF 4JNKA 4RKYA 1KYTA 4BLPA 1W93A 2OMKA 1K27A 1CY6A 2P2CA 2VWPA 4J0FA 4Q3CA 3ZXXA 2ONJA 4EATA 4Z86A 2C1EA 3BDAA 3R1IA 4FS3A 2KW5A 2OPBA 2IV2X 4Z4HA 3PE3A 1QLHA 1I1NA 2W48A 3PJGA 4D25A 3D7MA 3OZSA 3PR2B 4DLAA 3UICA 2IS4A 4PPNA 3PD1A 3BRQA 4QPJC 4QOEA 1OXBB 1VJ5A 3DBHB 1VYVA 2ZQZA 2UVQA 4HX9A 5E4FA 2I6QA 1P4JA 3F71A 3HUEA 1WWKA 3DZKA 4KWTA 2EOAA 1D2MA 4NFYA 5DBHX 1E3LA 4YR9A 1CVIA 3FOAA 5TARA 1OTXA 1KE1A 1SUCA 1JYFA 3I4CA 1YOBA 2WQ6A 4XQ0A 3MJ4A 2OTCA 2J0UA 1XZIA 3AY3A 5BNIA 2IDMA 4QPNA 2B1IA 4KDRA 3VR6D 5DCWA 4CMIA 1RCTE 3SSAA 3F9CA 2SKCA 1Z63A 1JSZA 3CLSD 2WSSA 2R1TB 2QPOA 2VI5A 2QZSA 2YZKA 4CEHA 1J25A 2BUAA 4HSEA 5JH7B 1AIPA 1FUIA 2AQIA 1K7SN 4EITA 2ZR7A 2VBIA 1PCXA 2CJYA 2ZRQA 4KXFB 4B85A 1KJIA 4WUVA 3ETCA 3IIMA 5BV0A 5IZCA 4J1TA 2RGAA 4MR8B 4B3HA 1GR1A 5D86A 1Y5IA 2W7TA 2WUDA 5K6AA 1H1DA 1E3SA 1S9HA 3PFBA 1OBHA 1P1KA 2CXXA 2X5OA 1ZJWA 2BHRA 2I78A 1PP4A 4FU0A 5K3SA 1NLUA 5ICCA 1Z4OA 2NZYA 3PQDA 2JI4A 2PRIA 3CLSC 4ENQA 1OH5A 2ZUUA 1B8UA 2BEWB 2AC7A 3O8RA 1K9SA 5A4KA 4JT2A 1ORRA 4X5OA 1SQGA 2EX1A 4H4DA 3TD6A 4F3CA 3ZW7A 4YUYA 2J0QA 1XZPA 1RI4A 2NAPA 5FFNA 1EFPB 1X19A 1YZYA 3PQEA 3BHJA 3RGGA 4BVLA 5LZ5A 1I2CA 4AZ3A 4YCDA 1H9AA 2GAJA 4B7XA 5A9TA 4E2ZA 1HDZA 4UM9D 2GN9A 3FZNA 3HRKA 3P8ZA 4L3VA 3ANYB 1H4QA 4AIIA 3H1GA 5JZBA 4HDSA 1JIJA 2QV0A 4HDMA 4FK8A 3P97A 4GUAA 2CLOB 3CE9A 1N0UA 2KPOA 3IIEA 5BT8A 2RGBA 3K20A 2JIOA 2OZPA 2DY1A 5JV5A 1RC8A 3IUQA 4G26A 4GLOA 4MB0A 1E32A 2AQ8A 5DTJA 4KOEC 5AOAA 4B2LA 3AR5A 1FPMA 2ZIEA 5EWJA 3E3AA 1NSYA 3WLPA 3WYBA 4E1BA 1M5UA 2FX3A 3CEAA 1KFCB 1RQNA 1CUIA 2AEMA 4TWBA 4EJ2A 1WY7A 2XYRA 4UVEA 4YP7A 3H99A 2YWDA 4BBJA 5HDQA 3A31A 5B3KA 5JAMA 4D43A 2Z8YM 2HSGA 2MMGA 1YMQA 3REQB 4NZYA 1CQIB 4S05A 5KYYB 3QU7A 1U0RA 5AHWA 4X94A 1KXJA 1R9JA 4DWJA 2W6PA 2I7XA 3IB6A 5SY6A 3ZC3A 5T4EA 3W2GA 3T99A 4LW8A 1NE2A 1T9CA 4KJXA 4PCUA 4RY8A 3MOIA 2X8JB 3L0ZA 4YREA 3NKFA 2J7PD 5CT9A 2O2XA 4Y6SA 4CCYB 3SVLA 5I5GA 3KOYA 4LVCA 1VLJA 5K3DA 4GBED 1OOEA 5JI3E 2P8SA 2QRQA 1RYNA 3VV3A 3S2SA 3ST7A 3IQHX 4GOMD 1L4NA 2JCBA 4Q4AA 4YECA 4BFZA 5G4LA 1Z28A 4ZMBA 5A62A 1NXQA 5JCXA 4KLNA 3ROMA 4RF3A 2E89A 4NNJA 1HQCA 2KYRA 3SOZA 3TIGA 2CUZA 3DPUA 2A1UB 1W6UA 1BRMA 2MSCB 4LJ7A 1L3CA 3BREA 5FV4A 5TQ0B 2XNKA 1D1SA 2JBAB 3CX4A 2H1LA 4FMCF 4L8VA 1E4EA 4M7RA 4U2EA 5EJFA 3T0FA 2WHRA 4BC0A 1N2EA 4F5DA 1IYZA 1V37A 4MV5A 4QGFA 5JBNA 1DPFA 4LZZA 1E0AA 5J4YA 1EJ6A 3T61A 4WCFB 4FB5A 1L4EA 3GRAA 5JASA 2PV7A 3BZUA 1DJMA 3OFJA 4O4JA 3U9TA 1BCSB 1EDDA 5IM5A 2QTMA 3DOIA 3FIJA 1RYDA 3VU1A 4DLRA 3WX0A 2RE8A 1W2HA 3IR5A 3VU9B 2W2MA 4BZPA 5DTQA 4CJXA 2D2XA 4OB7A 4B3CA 4E5UA 2BZ0A 4UPDA 2VUHB 3LUAA 3N0TA 4P2BA 1EKXA 3MYRA 2WZBA 4KACA 4F9FA 3S7ZA 1AK2A 2CXUA 1O3YA 3F74A 4RIIA 4WA7A 3MTIA 3UOWA 3DUFA 3A1VA 3BVPA 3LC0A 4IOLA 4H7EA 5AW8A 5ALTA 1KU0A 2DOKA 4DYVA 5TPWA 3WAJA 5MN5A 3HYNA 2V03A 3P2JA 4QZVA 2BFWA 4YRLA 3W7AA 5KOHB 1GUAA 2HRZA 1O6BA 4LWOA 2FK8A 4R7GA 4ZPJA 3STYA 1NW3A 1GWNA 3YASA 1H0KA 5AR1A 2I3AA 4MVCA 3QRWA 2IH2A 4CZ2A 3IVGA 4R54A 3G3EA 4EG4A 5DHFA 1T15A 5K3FA 4GZ5A 2I22A 1JA0A 2XUDA 4Y1GA 1JG4A 1H1TA 2XDQA 2JF0A 3BIWA 4MPPA 1PQUA 2JFOA 2A9FA 2H5EA 4TM8A 4TVKA 5JI2E 1A72A 1SBTA 4AMGA 4ZCTA 4WOKA 4URWR 2RFLA 3BMOA 3R7AA 4IEIA 2A1TS 1R16A 2Q45A 4LMRA 4X1KB 4E1VA 4LXXA 1ULTA 4O2AA 5BRJA 1P2UA 1D5WA 3IS3A 4D3YA 4JBIA 2MINA 3H2ZA 4AMYA 1O8CA 2QSJA 2ISQA 3DOJA 2K2QB 1TVEA 4KPFC 1AQ6A 1ZW6A 2WF8A 4N4AA 5FADA 3R5FA 4DIOA 2O8CA 5BO5A 3N3AC 4BBAA 1JG3A 1RSZA 1W94A 3PXXA 2HLHA 3DC7A 1II9A 4R68A 2CK3D 5SZIA 4DG9A 3NTOA 2JLYA 3EPKA 3G88A 2QMQA 2B4YA 5JO0A 4MYRA 3C8MA 2MTBA 3F8WA 3TM4A 2CL5A 1LI5A 1SQ0A 3QVMA 1HDRA 2XMRA 4NX2A 3C15C 4O2BA 4YHHB 1POXA 8AT1A 3P9IA 1EYZA 5IAKA 3QE2A 3SC3A 4BZZA 2D3TA 3RBVA 1HC7A 3CEMA 3E3LA 3M7IA 2EFHB 3P0FA 5EY5B 2IUYA 2QM8A 5HUQA 2D5CA 1L8XA 1E20A 3EIOA 5IH7A 3BD8A 1JKFA 4DKJA 2O2YA 3A2MA 3UJAA 1NR7A 3GPIA 2XWJI 5I9BA 2C2HA 2FMUA 1IZ7A 4LKRA 16PKA 2R8YA 4MHSA 4BNXA 3ONNA 3FDIA 2GBIA 2UUOA 2DUNA 4C7JA 2FZVA 4DNQA 9GPBA 4OQMA 3D02A 5KTRA 3H2HA 3H6KA 3JS5A 3VNUA 1QAOA 1MCZA 2RK3A 3O3NB 3EW9A 2FEXA 2FWAA 1UF9A 2BLLA 1O96A 2OZLB 2XITA 4L0CA 3E84A 1JZSA 3HVKA 1SRRA 4YMHA 1XNHA 1W19A 3IMKA 4V0QA 1MZVA 2F3PA 3EIXA 5DNVA 4EPTA 3VO2A 1P0FA 2VXBA 4QREA 6Q21A 2C42A 2WFMA 3UGKA 2MSWA 4HVCA 4IO1A 3LO8A 3OQVA 2XMDA 4I1YA 1VE6A 4PQEA 4R8VA 3B3AA 1TZKA 1RWNA 2WABA 5BW8A 1BX0A 2I2DA 2F43B 5DV9A 4CU2A 4DILA 3PG5A 5K05A 4XVCA 3FRJA 4C4AA 2JGEA 4M0MA 4YMTA 2GN8A 3S4YA 2NW6A 4RUKA 4RK0A 2A9KA 4RWEA 2RC5A 3H8SA 3T7RA 3HHEA 1FBNA 1CZUA 1J2EA 1AT1A 1OZ0A 3KDAA 3DMGA 3PX2A 3IBGA 1V47A 3B6ZA 3HZRA 4OIFA 4PNEA 4G2TA 5B7QA 2PE5A 1Q0TA 3EULA 1CS0B 1NZJA 5HIAA 2D1RA 4IIDA 3WLQA 4YRMA 3FKQA 1Z38A 2GHIA 3T9EA 2ZG6A 4R1PA 3R8XA 3R5HA 2BHSA 3FCUB 2V7TA 5FWYB 1V5GA 2ONZA 2VWHA 4Y9RA 4UQPA 4LSZA 4C0WA 1LQ2A 7MDHA 3KZXA 2WB2A 2GA8A 1WHSB 1Y1TA 2VS1A 2OY0A 3TX2A 3WYEA 4L22A 3ZCVA 4FR0A 1QHIA 3K73O 2R8PA 4MB6A 2BE9A 1PK9A 2HLNA 3CLTD 4O4IA 3PUXA 2PX6A 4C88A 2HDOA 2XDWA 1HF3A 3K8QA 4WBNA 5EHZA 1ZHFA 3A4NA 2ZETA 3EXIB 1XEXB 4A03A 4R0NA 4CG2A 2O59A 4QC2A 1JBKA 3OZWA 4DEVA 3B6KA 2H07A 4J8PA 1WUHS 5D1NA 2VZ0A 4G25A 5SZKB 3W8FA 1O94A 4JI6B 2VNJA 3I9NA 2GCIA 4JEHA 3V1TC 3IMCA 3R0ZA 3ETHA 1VKNA 3NT5A 4MR7B 3HJRA 3DMFA 1T1RA 5AI8A 5DEOA 3U3KA 2XKKA 1Z74A 1KQ3A 4DSZA 3THYB 4F91B 4CW7A 3U4GA 2ZRMA 5LPNA 2H1HA 1IUKA 1GGKA 1TZ2A 3CLTC 3DEAA 3PB3A 4RVGA 2VNAA 4YROA 3WA6A 3CVXA 3EJ6A 1Q14A 3N8HA 2YN4A 3AZPA 4M86A 3URKA 4EHIA 3Q7RA 1TB4A 1M33A 1TXGA 3O8QA 4Q48A 3CKKA 3EC7A 4H3VA 4DRXA 3ND9A 2VP4A 3OZBA 4PXAA 3RIYA 2QXYA 8ADHA 1FFGA 1X80A 3MPUA 1S3SA 1E2DA 4Q6WA 2RGYA 2ZB4A 1CR0A 1CJCA 1KZHA 3HWX1 2H2WA 1L5GB 3W0LB 3P0HA 5AM4A 3D4OA 3DE7X 3WYFA 1AHIA 2JHCA 2N46A 1AN9A 3DKKA 3IDAA 3FPFA 4EMUA 2FMIA 4YAGA 5B2EA 4BXOB 4GMDA 1QHHB 1YS4A 3JQPA 3SQWA 1W36B 3V32A 5CEFA 3ELDA 4IIJF 1KP2A 2VYVA 1U0GA 2WTXA 2XRYA 4IUCS 4P34A 4XEUA 3OEEA 4PTLA 3OLQA 3D3JA 3ACDA 3T52A 1E1KA 4X1YB 1YDHA 1DFIA 3ELUA 3OPMA 2CHUA 4OIMA 4O33A 3RS8A 2W2NA 3UMRA 3VPAA 1FQJA 1KJWA 2O8NA 2ZBGA 1DXQA 2AL7A 5B5SA 1LVGA 4PPGA 3RV3A 3GGOA 4C06A 4RTRA 2PUJA 1XX6A 1K3TA 5BN5A 2CUKA 1IWBB 4JWKA 4QEDA 5E4JA 3AVWA 4CETA 1VMKA 1K7YA 2OWEA 2DHQA 3A6EA 1UFVA 2UVPB 3ZD6A 1OXUA 1UBRS 5AKHA 5A7HA 3OUZA 1DTWA 2ODWA 3AI1A 3HWSA 4HXGA 3RVMA 4LV5B 3SXUA 4A6DA 1BA2A 1NJGA 3KXDA 1H1LA 4HAVA 3EGCA 1U2EA 2QKYA 4OHBA 5FP0A 3WY9A 2NO0A 1L4KA 2BR3A 2V5VA 3AM4A 1P9OA 4J2HA 1C7IA 4RKFA 2JLXA 3E8XA 2GJ8A 3JWHA 1ZO8A 3AEXA 4UVHA 3T9CA 3WOVA 5HIMA 3FUCA 5C1DA 2RG7A 1DFHA 2FA9A 3CH6A 2H3EA 2YS7A 4N9WA 4ZVQA 3EZ7A 2WY2D 3VDXA 4HAXA 4V2UA 4BJHB 3GHYA 2Q2VA 1T1JA 1Z29A 5CLGA 4S35A 5AKXA 1GG2A 3OC0A 5EEGA 1C9JA 4O4HA 3UFXB 1S8AA 1F51E 2PUDA 1A9ZA 5JWOA 1ZBQA 4JJ7A 2IVZA 3H75A 1ZD3A 3DZFA 1P29A 4UMEA 2BYTA 3ZNOA 5CAEA 1TK2A 1R8XA 4HB2A 4GGOA 4OF4A 3MINA 4UVDA 3VR2D 3LBHA 1W8DA 2O8FA 4LRSB 4S2EA 4DDWA 4DV4B 2QJRA 3L6CA 1XU7A 4OQNA 4DIDA 1WZIA 5IJ0B 4HAWA 5JW6A 2WF6A 3TPCA 4BLOA 1J07A 2C2GA 3DDSA 4IDGA 3OMLA 4WNAB 1MT0A 2WUEA 4P4NA 3ZVRA 4UJ5A 4AWAA 3NC1C 2ZBPA 3PSAA 3RKUA 3W5AA 2FCAA 1P3DA 3WIBA 1DJPA 2OBMA 2NYUA 2PQ2A 4WLFA 3AKYA 3SDZA 1GUBA 2VPTA 2VP6A 3D0RA 1A8UA 2OZKA 3C3MA 3DCJA 2I2XB 2XXBA 4L85A 3TLBA 1PFGA 3EARA 3FCEA 4KO4S 1PNTA 4HH4A 3KEMA 5THQA 5IEJA 3VHRA 1U4SA 1OLSB 2A0WA 4M0FA 1QJ4A 1LF5A 1DG1G 3FVVA 1PFUA 3L40A 3C1TA 4MW7A 5JJCA 1M72A 1S2IA 1U3WA 2I6GA 2A94A 4DHEA 4M60A 3MBIA 2X8LA 3P9PA 4XQCA 1JN0A 1XHEA 4RM2A 5FTWA 3UCFA 3WYAA 1Z5WA 1DP4A 4J9VA 4WFKA 4A92A 2J59A 4WKNA 2C2KA 1LNQA 4QULA 1JEYA 5IHXA 3IODA 2BBWA 4BB0A 1CK4A 4P98A 3AIIA 4R6WA 1W4AA 2C4HA 3G2OA 1OBOA 1YB6A 3OQMA 1XA4A 5ALYA 3TBHA 5HQ3A 1NF9A 3C6MA 4RV9A 3EY4A 4CI0B 1TM7E 5DI3A 5BPFA 1O95D 3H5VA 4XFDA 2GILA 5DSTA 5CFMA 4JI8B 3C98A 3P5BA 4OD0A 1KMMA 2XKAA 3U4QA 3MILA 1F4PA 1O8BA 4IKPA 1GAWA 4IIYA 4XDZA 4YCBA 1R0YA 3VZQA 5KOJB 3QJGA 3MVEA 3FPBA 4XQEA 3D31A 1GA4A 1TC1A 3TWOA 3FX2A 2X5JO 3NUQA 2BEVA 2ZB2A 4LK3A 3V8MA 4F9TA 4C7KA 1E64A 1CPYA 5JBQA 1IBLB 2QMHA 3MJRA 1ZUHA 4MLZA 5B2ZA 3UQZA 4F4JA 5M2QA 1DNPA 5ALKA 1CY4A 1NQAO 2QUBA 2EKLA 4MUNA 3VI3B 1EUZA 4EPRA 5ENZA 1O95C 4DCSA 1PV4A 4PSKA 1LSSA 1U1FA 5E6RA 3MQ2A 1LTQA 1RJGA 3DZDA 4I14A 1IXKA 3BGVA 4L78A 2IIVA 1RRVA 1SVNA 2WU1A 3AEZA 1P5RA 4BQIA 3LZ6A 1HLPA 3WWDA 4HX5A 3B3GA 4HOYA 2WHQA 4JELA 1SPBS 2PYDA 5KNDD 2YBDA 4CCSA 3ZCQA 3SBDA 4UTOA 1ODKA 2IOFA 5ED4A 1HQDA 3IYLW 3LL7A 4QUJA 1Z4QA 2XADA 3QPDA 1TM3E 2QG6A 4YMVA 1NBWB 1UC5B 4LYDA 2MHCA 1T13A 2IXEA 3DKIA 1K97A 3EB9A 3LV8A 4R1TA 4EMTA 1B6RA 1JAHA 4XX1A 5FUXA 4L4XA 2YDXA 3L92A 2AN5A 1Z5OA 2NU9A 1VMDA 3MFQA 4IMIB 4MV8A 4MWZA 1Y3HA 5DASA 5AVKA 4FKBA 1KQPA 2BAGA 3HDTA 1R2QA 3F3YA 5FPQA 3K92A 1OF1A 3LRTA 4EHBA 5DRYA 2DBYA 3GLFE 4PYQA 2Q07A 4REQA 1P7YA 4JJKA 1U8AA 3BN3A 4NJMA 1PG0A 3HXTA 4B17A 4U6NA 3JWIA 4EUKA 1IUPA 2WVAA 4NYIR 4AKTA 2Q6LA 3BJMA 4HFJA 1JH9A 3M2PA 4CQJA 1P74A 4MULA 1CEEA 5TPZD 3Q15C 2IWRA 3ZKWA 1X2BA 1OHHD 4ZICA 5IK2A 1AMNA 2HHHB 1ZZEA 3MT8A 4NS4A 3LCCA 2UV8A 3H6HA 2X0DA 3U39A 4E94A 5LZ9A 1QR6A 4OHPA 1RYHA 5LZ7A 2PL3A 3RT9A 3ZWWA 1QCZA 1KBQA 2QORA 5B58T 3BBLA 3RSFA 1IOWA 5THKA 4A0QA 3FWPA 4CQMB 4RTPA 1UOEA 5L3RA 3A1UA 5TQVA 1G9TA 3HJHA 3MGKA 2DEUA 1U4OA 3IAS1 3NG1A 2EGHA 3Q41A 2I1LA 3BH0A 4XYMA 2Y2UA 4MVJH 4TV8F 4RCZA 4DEYA 2R79A 3UT0A 2P9HA 2OGZA 1C8LA 4OMCA 2GZAA 3PHJA 3RVBA 4BNHA 1R3UA 4BTEA 4DCJA 4FQ8A 2IIQA 1NYTA 3NEYA 4ND8B 2OGSA 1DO0A 3EAFA 4Q05A 3FVRA 4ZN6A 3O8BA 4D3SA 1WCIB 4H9GA 2PBRA 3NBFA 1Y5MA 1IG0A 3QGMA 4W6ZA 5JMOA 3I61A 2ZJ3A 3PU6A 4MO9A 3T3OA 3I2GA 2ORED 4PRYA 5H3LA 5J47A 1JHYA 1FP7A 1Q3KA 1XBTA 3JZFA 2Q3FA 1LTHR 5F2OA 4TMTA 1P75A 1G66A 2GFHA 3GRZA 4KAXA 2FFBA 1KTVA 2JGJA 4AYXA 3SK0A 2F1OA 4NYMR 1SBQA 1QMGA 1KI7A 4KQEA 3DS8A 1KQOA 1PGPA 2XW6A 4PGFA 5JPCA 3G5MA 1M34A 3GOQA 2ZS8A 4HXEB 3RYHB 2OO3A 1CIPA 1TU4A 4AUKA 2Q62A 3V8VA 2YWBA 4OGKA 5DNAA 4C01A 3O26A 4CMAA 1XLVA 3ZJ4A 3H2JA 3DDHA 3CQ9A 3D8NA 3FCCA 3GLUA 3LPCA 2X0EA 5I9LA 3BB1A 4KQGA 2B3TA 1Z4PX 3SOPA 3GQBA 3M4NA 2PU7A 4A27A 4JQYA 1G60A 1WMSA 4X84A 1NC1A 2FSSA 3RHZA 1AUXA 3PLNA 1BJRE 3AONB 2Q6IA 5JAZA 2AZTA 4DR7B 1CY8A 3NEPX 1JDBB 4NL4H 4B76A 4ER0A 1N2GA 1KBZA 1Z06A 4GR9A 1NXVA 4UW9A 5EXPA 2AD1A 3P2IA 5FTKA 2G8NA 3OTHA 4RYDA 4KPUB 5C8VA 3CUTA 3TLGB 3NU1A 2I33A 2H57A 1G291 2EDAA 2JI7A 1BEZA 3CRMA 3CF4A 1V8FA 3E1KA 4G0QA 4GZ6A 5M3BA 4EKYA 1VIMA 5KSOA 3D3WB 4DARA 4WY8A 5K8TA 2ATVA 3DXFA 4PFQA 2XNDA 1SVMA 1ZGAA 1ZRMA 5HJEA 1QE3A 3A06A 1YC2A 3BDIA 4RMJA 1G38A 4U2BA 2P2SA 3DCYA 4GGMX 5FA8A 1UP7A 5REQA 2XF2A 3B5JA 3ICCA 1NVKA 1G8GA 1U0LA 2V6GA 3KQTA 1XV5A 4B8WA 5KSZA 2OB2A 5B58C 3RYCA 4ALLA 5FTLA 2YXEA 1WMBA 4JI3B 4E5SA 4G9EA 3H05A 3I3OA 1TU3A 1FNCA 1MA3A 5JNTA 3MCWA 1JHVA 2FQ1A 3GNSA 3WMFA 4RTSA 2WTEA 3S2YA 3DW1X 4UZSA 4ZDWA 1RYZA 4J3NA 1JHDA 1AKTA 2UYOA 4J2TA 2BGTA 3FTEA 1AG9A 4N7RA 3RIXA 4BNVA 5I45A 2L82A 1BQEA 4YH1A 4Q39A 2ORYA 2W2QA 3UJ8A 1IB6A 4E5KA 1RS0A 2LD4A 1R15A 4TTTS 1ZH4A 4OYHA 3WKBA 8ATCA 4KLRA 3INTA 1WL8A 4UCQA 2O8BA 1EUCA 3IKVA 3LDUA 3S81A 4D92A 2QYTA 3BQ9A 3GLHE 1XHFA 2IU3A 2AA3A 1E6CA 4PIVA 1HE1C 1ST3A 5FBKA 5C2JB 4J4BA 3FZQA 3M8KA 3M9WA 1EFVA 1JJ7A 5ALJA 5HM8A 3BXXA 4K6KA 5EKDA 3IXQA 2NSDA 1JBQA 7REQA 3DTTA 1VL5A 4QTYA 4EB6A 4PHHA 1IB0A 5KDLA 9ATCA 4JUIA 4HK4A 1TCCA 3KL2A 2DRIA 5HP4A 2CNOA 2YVQA 1IRXA 2JFHA 3HI4A 2OLJA 5J5VA 2QL7A 3SWWA 4CXMA 4OHWA 1NQXA 1M6YA 3PQCA 4FEYA 1T0IA 2O3SA 3VPHA 2C5GA 2QTNA 1B6TA 2ZUWA 2WHPA 3CVOA 4GPBA 2DBRA 4XLZA 5FOWA 3AVVA 1L5SA 5LBTA 2H0RA 1DAKA 3WRYC 4R01A 1N5MA 1NZDA 2C1XA 2ZBFA 5T8KC 3SQLA 1U1EA 3QFFA 1JP7A 4OI4A 4P4SB 5DGHA 3SIPA 3VC7A 1LBHA 3ZWCA 1OI7A 5BW4A 2I2FA 2I2WA 4ER6A 4AI6A 4Y2UA 2BFBA 4ZOCA 3H8WA 4F6CA 2J0SA 3EOAI 4B8YA 5LP6C 5A2QA 4HNAB 4U6SA 3G7NA 4AX8A 4IX1A 2XPCA 3I9JA 1FYXA 1QCCA 1XDSA 5HKAA 2CCGA 2YVLA 2YRWA 5DHAA 3LQ4A 1L8LA 3HGTA 1RXUA 1S7CA 1UBJS 3EWAA 4D80A 1JPJA 4YJGA 1Z34A 3NXKA 4QRDA 2VNIA 3K4HA 4EFMA 2ZT6A 1U5AA 4JLMA 4R9SA 4PAOA 3NBKA 3NB0A 3QTTA 5IKXA 4FX2A 3LC2O 4J0HA 3QPVA 4EYQA 3N8IA 2X4DA 3NTRA 5DU2A 1WU8A 1PFKA 1YBAA 3MUOA 5LA6B 2CJWA 1W8IA 2R2AA 4MAFA 4FDLA 4MV0A 4ZOLF 1S01A 5J1SB 3NYWA 1J4AA 5KMGA 2X2PA 3PP8A 4QGGA 4BCBA 4C89A 1RQXA 2A57A 2B9VA 4MNTA 4WJZA 4HDNA 4YYZA 4TS1A 3C24A 1PQWA 3IE1A 4IJKA 4LS3A 2OYRA 1U2GA 2ZK7A 4EG3A 1QG0A 1K7CA 4OG2A 4D0NA 1BKYA 3QLTA 4I55B 1XEWY 5LIRA 3DNPA 1RAGA 4A0SA 2ZZMA 1DQYA 3T95A 1KKUA 5EMLA 4G1VA 2X0FA 1RJ9A 2FLWA 4U7FA 1Z8NA 1HEUA 3CNBA 1MO4A 2ATIA 3RVKA 3TH5A 3I83A 3KV1A 3LZCA 4RGYA 3H1PA 3ZZTA 3UV7A 4XQ9A 1P7PA 4ASUD 2IYUA 4KR0A 2GBFA 3KV3O 1I2BA 1BE1A 1K9VF 4KYIB 5FQOA 3D7SA 1GAXA 1RM3A 2I4TA 3WBKA 4BFYA 1NUUA 3DMTA 1XCPA 5LP6B 3EVTA 1UBLS 5CP8A 1O97D 1ZA1A 1XP5A 2CXQA 4GECA 2J5KA 3AHFA 3QWIA 4NEQA 2PRYA 5AXBA 3SZOA 1W88A 5EQJB 4A5OA 4BGIA 4CM9D 5BV1A 3N9IA 3V7NA 4RD2A 4IQFA 5AXAA 4BVAA 2B6HA 1VLMA 2D4AA 4D9MA 3A28A 1K2WA 1LB1B 1Y3BE 3IKJA 5KPJA 1GGNA 3A7DA 2JBHA 1F7UA 4P5PA 3SZRA 1RP1A 1KDPA 4A36A 3DYIA 2ZJBA 4J4HA 4DIKA 2ZRGA 1L7OA 2PUGA 1TM2A 4FE3A 3TAHA 2BBOA 3AW9A 3NNNA 4FYIA 3K0EA 3RCBA 1QF6A 3MLBA 2HUPA 5EJ4A 2AOXA 2PS3A 1O97C 2QN9A 2Y1GA 2X8BA 3NETA 4GPEA 3SJCA 5B1SA 2BCEA 3UAXA 4ZVSA 3E4DA 3FF1A 3TZ6A 4CT5A 4G0MA 2GAIA 5EZQA 4ESHA 1KEWA 2WWTA 1M0TA 3EZ9A 2WW8A 1IHOA 3PENA 1LA2A 2JCXA 4J3JA 2RGNA 4GM4A 1F2VA 3TG2A 1EB9A 4G9GA 1T8WA 1OU0A 3L7YA 1TAQA 1I7DA 1P2BA 3E03A 1C80A 1UBHS 1Q0RA 1Y7HA 1Z5VA 1NDQA 2QLTA 3FBWA 5EHIA 5TEVA 4B3GA 1P2FA 4E5DA 2VJNA 1ZH8A 3BFJA 4M9XA 3F4KA 3QWFA 3U5ZB 1P8JA 1PX2A 2JB9A 3ESXA 1NQWA 1KGSA 3PUYA 2B4TO 1ZUIA 4R1QA 2QSZA 1YKGA 4BO9A 2PUAA 3ZBPA 1Y6RA 3FFAA 4BAUA 1MORA 4ZI3A 1IJFA 1GTSA 6YASA 5LYJB 2Z58A 1OBCA 3GUVA 4MA4A 3FLEA 3OFKA 4ME6A 1O5TA 2O2SA 2YJGA 4WKPA 1JIUA 2OP0A 3B9PA 3CBGA 3H2BA 2JNWA 3TLJA 1G1AA 1E7YA 2FW1A 4TLCA 2I03A 1SN7A 4AF7A 2AFHB 3VKGA 1CZNA 2ZIUB 4B9EA 3EMKA 2GSDA 4XE5A 1MO6A 4OKIA 5KJEA 4E31A 5M7EA 3PHCA 1YS7A 3JZDA 1SCAA 4HQKA 4L28A 4LYFA 4KQ6A 4NULA 1SO8A 4Q82A 1BC5A 1Z2EA 4TMFA 3WGUA 4F9EA 2GT1A 1VMEA 2QDXA 3GVIA 3K1AA 1GTG1 1E98A 2BFEB 4EKEA 1P9RA 4BWFB 4LF7B 3TIVA 4CF7A 3ERCA 1N1DA 3GZ4A 1ZMXA 3G59A 4TUYF 4F5EA 3H9CA 3O47A 3NEAA 3BPSA 3WKCA 3H7AA 4EJSA 2CB0A 1TQ2A 4LQDA 4NBLA 4NENB 4AY5A 4TTJA 3UH1A 2GM5A 5CLIA 4UEWA 1HEYA 1Q50A 1KDOA 4GAEA 4UFOA 2ZFUA 4ALNA 4MQEB 1ZIXA 4F84A 1QF7A 4B3RB 3QMVA 3X1YA 3KYJB 1QH1A 4ZOBA 1Q0UA 2XT6A 3AEYA 3BE5A 3E3NA 4JYCA 5DK4A 4BNYA 4AQYB 4D9JA 4GYWA 1L9KA 2XMQA 5JHGB 3D3KA 4FJ1A 3Q3GE 2FEPA 3WFIA 3E15A 1JJVA 2VSNA 5JAQA 1YMVA 2BM9A 4Q01A 1D2GA 2N1BA 2FXIA 4DA4A 1W76A 3DAGA 3MK31 4PRZA 4CGYA 1UM9A 3LPMA 4RTNA 4YP1A 4W1SA 3KLBA 3KC2A 2RK4A 2QJWA 3RWBA 1FUKA 1JVSA 2OXRA 1ENOA 4QGBA 3B48A 2IU6A 2NUAB 4BO7A 5A5DA 1VCNA 4Y1EA 8LDHA 3I5YA 1B41A 2WT8A 4QLAA 1N5IA 1CQJB 1KDYA 1V4BA 4K9QA 1YR3A 1VCMA 3C6XA 1M2NA 1L7RA 2DLCX 4QBGB 1NV9A 3ESZA 1CQIA 2PSEA 2GZ2A 2Q6KA 5IBPA 3UTCA 4C0BA 3K0HA 1HDYA 3EE6A 3LVQE 4IIEA 1WEKA 2AF3C 2ZU6A 2WNHA 3GEIA 1I10A 2PXXA 3A3KA 5A6SA 4DR1B 3CT6A 3COJA 4E70A 2WFAA 1EGVB 3I8OA 4GI7A 4PX5A 2W2XA 4MUKA 3WB2A 4JZYA 2EX0A 1P1HA 2Z6AA 2WSIA 4LCEA 3DWIA 1S2DA 2XQKA 3SHTA 4MS1A 3CH7A 4XIJA 5B4UA 1UH5A 1HRKA 1OGIA 2K87A 3EUAA 3K9CA 1NVVQ 1QYIA 3F9RA 3OPYI 3GL9A 3PQ5A 4HZGA 2PTGA 4EAAA 2WAAA 2E6KA 1UFRA 2J45A 1XCOA 3ICVA 5FULA 2W4QA 4WECA 1RYYA 5DXJA 1F8UA 1FP1D 3MA0A 3FUVA 3MT7A 5E3IA 2COUA 4LRXA 3CJRA 4EF4A 5G02A 1SQ5A 1Q16A 4J94A 4ACBA 4DV0B 2F8SA 1YQGA 5K6RA 2DFVA 5AKZA 3ZIAA 1GFZA 4JEMA 4ZOQI 1BKSB 5KX5B 1KEEA 1GVHA 4QM6A 4A0FA 2VUIB 3EHEA 5C35A 4BGEA 2DKNA 3EG9B 3F6YA 4EW3A 1QP4A 1RQGA 2WU8A 3PI7A 4LA4A 1ISRA 4QYWA 3U1TA 4OB6A 1NUTA 1IM8A 4L5CA 1T3HA 3AR7A 1ZOLA 4NH0A 5KNLA 3GJ3A 3P5SA 4NEGA 4P7BA 4F12A 1FFDA 2POQX 3LKDA 4LVUA 4P2GA 1IPEA 2RHHA 2D1YA 4GWGA 2QJFA 4OHCA 4BGUA 1P5JA 1PJTA 4TTQA 4R1UA 5UKDA 3TI9A 4FHZA 2P2GA 2Q5LA 3LTNC 2WIGA 4IIVA 2OFFA 1UQRA 1HV8A 1DBIA 3NC0C 4N7BA 5BUQA 2ABWA 2V5AA 4D8VA 1A8HA 1VIVA 1OH6A 1RHMA 2XTJA 4KN8A 2ZWAA 4A9AA 5KWSA 1PR5A 3DL0A 5T3UA 2AFIE 3FTCA 2AR9A 4LMAA 2RIRA 4KR2A 5KOYA 2IS2A 2JJ2A 4UOEA 5KYUB 1T43A 1ESDA 4JYZA 5FH9A 2IEGA 1VM6A 4GXNA 1FVHA 3R44A 4MUMA 5CTAA 2FZWA 3KYIB 1XWFA 3IEIA 4Z7NB 2W5UA 3HB1A 2Z6UA 1TAGA 2AN1A 2JI9A 3SFVA 4EENA 3UXHA 1ZHOA 2C98A 3VJRA 1ZY2A 2YIMA 2AQHA 2PWAA 5JDIA 4UCWA 2FDRA 2YJZA 2PKQP 4GX1A 1GGEA 2AMFA 1BCRA 4QOSA 5DBEX 2ZJ6A 4MGIR 2WSYB 3LBFA 3MTGA 2ZJFA 3WL6A 5ITVA 1PEDA 1CNFA 1PZXA 3AG6A 3KEGA 3UAOA 1AO0A 5JNRA 4LTNA 3BTUA 3O1IC 4QOHA 2FYTA 4UHDA 4BVBA 1EE9A 2KS6A 1ADJA 1NSFA 4IIJB 5B12A 3I04A 4DGSA 4C3OB 4QXRA 2AG6A 4BX2A 1Q0SA 4W82A 1PJSA 1EDBA 1DG9A 3DB2A 4QD3A 4CG1A 3HN6A 1EU1A 2I6UA 1R0WA 2F1KA 2IX9A 3DL2A 3IE0A 5BVGB 3N2GB 2P5UA 1W581 4O0LA 4B2PA 2VPQA 1E3WB 1JLMA 1Z8FA 3C3BA 3ICQB 2REQB 4IICA 1JG6A 2CNWD 3MHPA 4QAQA 1WXWA 4RDCA 1KDZA 2WTNA 4H1UA 2JAQA 2Y4OA 1RZRD 1X86B 3L8GA 5PGMA 4CUZA 2F3SA 2GYVA 1ZMRA 4DV5B 4BTVA 4L57A 2PS0A 3K2IA 4LE0A 2Q8PA 1CUVA 4FLMA 3CZPA 3H9UA 3SJUA 3G17A 1FVOA 2IDJA 2WJZB 3CR3C 1GZ4A 3FFBA 4UOZA 1Y9AA 4CMKA 5JD4A 2FOXA 1E62A 4MW0A 3PEWA 5AVRA 2VSFA 4QRHA 2ATEA 1EVEA 1Z5GA 5D1HA 1VHTA 1XJCA 3MWJA 4EY8A 4DR6B 3JD1A 4OQYA 4Y9DA 3SMQA 1K5GA 1JAXA 2O2GA 3ASVA 3ZGOA 1GRVA 3TNDA 5ESXA 3VO9A 1YMUA 5MDHA 3NAMA 2XUOA 1JW9B 4QYIB 3JWJA 1PDWA 4MWOA 5ALOA 4K26A 2WM9B 4JLNA 1GSIA 1NMSA 3EXHB 2YMLA 1PS0A 3NHWA 4U7GA 2CJXA 4HXYA 2WE8A 3OZGA 1EVYA 4QEZA 3B70A 4YLEA 1YQXA 3BGDA 2RGDA 2Z2YA 4FHCA 4OBWA 3OSZA 5KJ1A 4DG8A 4FYWA 4Z99A 3PNLA 4WINA 1BEEA 1GZHB 1XQ6A 4MUBA 5ALEA 2I66A 2ACWA 2YQ4A 5JD5A 1A2BA 1QGAA 2Q2OA 3SM3A 2QI9F 4F3RA 3D8UA 3LMKA 3ZD8A