3GRCA

Crystal structure of a sensor protein from polaromonas sp. js666
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
125
structure length
125
Chain Sequence
PRPRILICEDDPDIARLLNLMLEKGGFDSDMVHSAAQALEQVARRPYAAMTVDLNLPDQDGVSLIRALRRDSRTRDLAIVVVSANAREGELEFNSQPLAVSTWLEKPIDENLLILSLHRAIDNMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein, Kinase
publication title Crystal structure of a sensor protein from Polaromonas sp. JS666
rcsb
source organism Polaromonas sp. js666
molecule tags Transferase
total genus 41
structure length 125
sequence length 125
chains with identical sequence B, C, D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3grcA00
2X7XA 5KC8A 2PUDA 3QLUA 4ETMA 3KYJB 3TX6A 4QYWA 1PNTA 4IMJB 4G0ZA 2A9OA 2DRIA 4Z0NA 4IGAA 5TQJA 2GKGA 3QEKA 3QK7A 1YMVA 1I3CA 3NBMA 8ABPA 1C0EA 3CTPA 2CWDA 4LE0A 2QW1A 5CNJA 2PUGA 1DCMA 4Z99A 1QP7A 1XHEA 2FTKE 4KREA 4ETIA 3GRCA 2QV0A 1MAVA 3N8IA 1HEYA 4GNRA 1JBEA 4G0QA 3OO1A 1BA2A 1NXOA 2R48A 3F73A 3O1JC 1NXWA 4Z4EA 3H75A 5TPWA 4WWHA 2PUAA 3LKBA 2JVKA 4ML3A 3N0WA 4Z4CA 4ETNA 2IKSA 4EVSA 4YRZA 2FMIA 1DP4A 4O1HA 1JHZA 5FWYA 1K68A 2QVCA 1Z16A 5D2CA 4RK6A 3EDCA 3HSYA 4HNSA 4Z4FA 3JPWA 3GT7A 7ABPA 4XAQA 3CKMA 4DADA 1SD5A 4KPYA 3M9WA 4JB2A 3I42A 3LUDA 2PUFA 4PE5B 4MR7A 1C4WA 3T38A 4OBBA 2IYNA 2RDMA 3O1IC 2R25B 1JLKA 4FE4A 4FE7A 1DZ3A 3CFYA 4N03A 1A0OA 3HVRA 4JOQA 1NXPA 3QLVC 5CHYA 3SG0A 2MYPA 3O2JA 3QELA 3QX9A 3OLZA 4MYRA 4N0PA 3N0XA 1VPWA 4KV7A 2VUIB 3TD9A 2HSGA 2PJUA 5TQ2B 2RGYA 4WXEA 2H3HA 3C3MA 4WUTA 4YV7A 1W9HA 1AB6A 1RNLA 5KQPA 3O74A 3KS9A 5BRJA 1U04A 2MYTA 4N76A 4QPJC 2JVIA 3CU5A 4RXMA 3HJFA 2JRLA 2WY2D 3DBIA 4F8JA 1M5TA 3SM9A 4L85A 1FFSA 3L6UA 4RY0A 3LUCA 4G0PA 4YS6A 1ZESA 1GCAA 4CBVA 3GBPA 4MR8A 2VK2A 3BREA 5JNUA 1VKRA 3D8UA 1MVOA 1JWLA 3LOPA 1NXVA 1DCKA 3FGZA 4HNQA 1ZAYA 4G0MA 2E4VA 2MYUA 2BGGA 4OLAA 1NTRA 3OM0A 4L4UA 3MM4A 1DBWA 4H60A 5JNRA 1QP4A 1QO0D 2NT3A 2P4UA 4NCAA 1E2BA 4P98A 1EAYA 4RXUA 3HCWA 3F7NA 1FFGA 3N6VA 3H1FA 2LUOA 5F64A 3QLVA 4HYEA 1ISSA 1FFWA 2JB9A 4KNYA 5HM6A 3RVLA 1Z12A 2MSWA 4ZYLA 2HJ9A 3OMWA 4G86A 3Q7RA 4O1IA 2A9PA 4PZ0A 3RH0A 1FQWA 4MS3A 4Q6BA 1QQBA 2IOYA 2JK1A 2M98A 4DN6A 2H0AA 3LTEA 4YO7A 3HUTA 4TLLB 4W5OA 5T3YA 4EVRA 3VNBA 1U2QA 2L18A 3LUAA 2HQRA 1DJMA 3K4HA 3CNBA 4KK3A 4JAVC 3RVPA 3RVMA 3W9SA 3HO1A 4TMYA 3KJXA 4F06A 5HSGA 4EUKA 1QMPA 3FFXA 5I4CA 2LIVA 2HQOA 4RK4A 3GYBA 2NZVG 3NNDA 1S8NA 2A9QA 2FQXA 1JYFA 4XLTA 5FWXB 2CHEA 4RWEA 2E4UA 2MYNA 4RZSA 3E3MA 2HPHA 2ID7A 3QLTA 4MPTA 4D6YA 1ZDMA 3CZ5A 3EODA 3IP6A 3NHMA 4RV5A 2WJWA 1D2AA 1MIHA 4EYQA 2YHBA 1U8TA 4KRFA 3I45A 2PKXA 4P1ZA 4RK1A 3HZHA 5T7BA 3HM9A 1YK0A 1XWWA 2E4YA 3L49A 3C3KA 4NICA 2L17A 3OQNA 4H3HB 4RY8A 1CYEA 3EQ2A 4MQEB 1YS7A 5TPZD 4MLCA 5IEJA 4TLMB 1SXHA 2GWRA 3A0RB 3RVNA 3IPAA 4KVFA 5HQJA 4LZLA 2E4ZA 2FMHA 3MYYA 5IUJC 3LUFA 4RXTA 2QVGA 4RKQA 1YIOA 1P2FA 3M9XA 2FXIA 2XDYA 5IULC 9ABPA 2GBPA 5CNKA 1P6UA 1K66A 1TJYA 3BRQA 4KK4A 2NT4A 5JNVA 3HEBA 1VRVA 2IPAB 3DGFC 1D5WA 4LDZA 3BILA 4TN5A 4YLEA 1AB5A 2R47A 3A10A 3LKVA 3NHZA 4MRMA 5CNIA 3KHTA 4KMRA 2AYXA 4D74A 1QQAA 4RY9A 1OXKB 1MB0A 3QEMA 1BAPA 3B2NA 4Z4HA 1M5UA 5HKOA 1Z2DA 3O2SB 3LUJA 4DQDA 2JBAA 1WETA 4IMIB 3OLYA 1CEYA 1F51E 1PEAA 2MSKA 1Z2EA 1M2EA 4LE2A 3SAJA 2FSPA 5TQ0A 3ILYA 1ZH4A 2P9HA 3D02A 3GV0A 5TPWB 2V0NA 4YCSA 4KQCA 4MQFA 3JVDA 4MS1A 5C5CA 5TE9A 5KC9A 1DBQA 2FKAA 2FMFA 3RVKA 4Q6WA 5EWLA 5IEBA 2E4XA 3M6MD 1JF8A 3Q7SA 4QYMA 4ZPJA 5IC5A 1L5ZA 2NZUG 4S05A 3H5TA 3OLXA 4MR9A 3RVOA 3OLWA 4JA2A 4MR7B 1ABEA 1Z13A 2GI4A 5FBHA 1OXBB 3O1HB 3KSMA 1E6LA 3JY6A 4EY3A 1TM2A 4N0QA 3CLKA 1J56A 1JYEA 2A9RA 1APBA 3C3WA 2L19A 3O75A 3KG2A 4D6XA 5KQGA 3EULA 1B00A 3LUKA 3UUGA 3QELB 3VNAA 3H5LA 4F12A 3IP7A 4NCBA 1Z25A 1MB3A 3JTEA 4GPAA 1CHNA 4F3TA 1DG9A 4PYRA 3MF4A 3ROTA 2IPLA 2QU7A 4PICA 3T6KA 1M2FA 4KQ9A 4W5QA 1KRWA 3K9CA 2I6FA 3H5WA 3SY8A 2M1ZA 1EHCA 4JP1A 3DZDA 1P8AA 1R8JA 3C6QA 5DTEA 3DGEC 1QNLA 2CHFA 4W5TA 3BBLA 3ROFA 2GX6A 5EWJA 1E6KA 3OLVA 2ZWMA 1JL3A 3HDVA 5IUKC 4RKRA 5ED4A 4Z9BA 2B4AA 3MQ4A 4E7PA 5JNWA 2QR3A 4WZZA 5BR1A 3F6PA 1LBHA 3CRNA 4MS4A 1VLZA 2PE5A 5DKFA 4MR8B 5KWSA 1SXIA 1RXIA 3FFWA 1KRXA 1IIBA 1USGA 3FDFA 2FEKA 1DRJA 3DLHA 4ZJPA 1NATA 3TB6A 4ZMSA 1KGSA 5KI6A 1KMIY 4UHKA 2J48A 3GWGA 2PL9A 3UKJA 3MMNA 5EWMB 3P9YA 3Q9SA 2KYRA 3OQOA 1Y1LA 1ZN2A 2LP4Y 1EWTA 1RXEA 2RJOA 4Z4GA 1EFAA 3IDOA 4XXHA 1FSPA 3Q15C 2LBPA 3N75A 4WXMA 4IILA 3EQZA 3T8YA 4XARA 3HS3A 3MA0A 4JASB 3LMKA 4MS3B 4OATA 5IX8A 1RZRD 2WRZA 6CHYA 4RS3A 3LFTA 1ZH2A 2ID9A 3O21A 3O2QB 4NQRA 2FLKA 4NV3A 4RDCA 4G0OA 4W5NA 1F4VA 4YGXB 2RJNA 1Z15A 3G85A 2FLWA 3H1EA 4LDAA 2B1JA 3C97A 3GL9A 5JS1A 3Q7TA 1QO0A 1USIA 3OQMA 1T34A 2PUBA 1L5YA 1NXSA 2ZAYA 4RK5A 2CD7A 2FVYA 4LX8A 3EJWA 5BRAA 2VUHB 3A3KA 3H1GA 3A0UA 3H6HA 1D1PA 3JPYA 1DRKA 3UK0A 4H3KB 3RQIA 4N41A 1LBIA 2HQBA 4G97A 1PUXA 4FB4A 3T95A 1JX6A 1A2OA 1ISRA 4OTZA 4WT7A 5E3JA 3TO5A 1QKKA 4YR7A 4OLBA 3I5AA 3KYIB 3I09A 3DLBA 5JS2A 1ZITA 3S99A 1DCFA 4EYGA 2FW0A 3ILHA 3KTOA 2F8TA 5C5EA 3KCNA 2NUBA 4IRXA 3OM1A 3HXMA 4Q7EA 3RVRA 3IP9A 1QPZA 4B09A 2N9UA 1PEYA 3JS5A 1TMYA 3MIZA 3G1WA 4LE1A 1Z26A 2PL1A 1ZY2A 2PLNA 2WWVD 4W5RA 1RZRA 3QX8A 1ZGZA 1GUBA 5KQMA 5FWYB 4XASA 1W25A 2FEWB 2VYCA 2WMYA 4LRQA 4EYKA 3LUHA 1UDRA 1YVUA 2FMKA 3KKEA 4MRMB 2FN8A 4S04A 4Y9TA 3QEMB 5TQ2A 3RVSA 2YHAA 4ZMRA 1DC7A 1GUDA 2E4WA 4MGEA 1QP0A 4M88A 4EVQA 1GCGA 5JNSA 1LJUA 5TPZA 4E7OA 2JBAB 4JB0A 3H6GA 1TLFA 4HNRA 3NNSA 2AYZA 3EGCA 5TQ0B 4RSMA 1YS6A 1JFVA 2PAFA 3RVQA 5B3JC 3SQNA 3H5OA 2Q5CA 4MQFB 1LK0A 2LPMA 4MS1B 3CZCA 2QXYA 5GOTA 1JH9A 1TVMA 1YK1A 2TMYA 3FFTA 5EWLB 4YP9A 1Z18A 5ABPA 3JVIA 5FBKA 4G0YA 2F8SA 1BVHA 3E61A 3GA5A 3OMXA 4MR9B 5KQLA 2FQYA 3Q41A 4XFKA 2PUEA 1URPA 3GBVA 3HDGA 3HV2A 3RVJA 1A04A 1SRRA 4OG2A 4EYOA 3BRSA 1LJLA 2PMCA 5GQSA 6ABPA 5DLEA 1JFTA 1BDJA 3EAFA 2FN9A 1BDHA 1P6QA 3SNKA 2L2QA 1E6MA 1U0SY 1ABFA 1ZVVA 5IBQA 3N53A 1NXTA 5BQ3A 1YMUA 1XHFA 4UHJA 1ZHHA 2FEPA 2JCGA 3KLNA 3IPCA 5JNTA 3QLUC 3CG0A 2O20A 3N0RA 4QICA 4MLDA 1USKA 4Z4IA 5DGCA 5DCLA 4RU1A 1H9CA 2OQRA 3NNNA 3CS3A 3KLOA 4IF4A 5EWMA 1GLGA 4RK0A 2IPMA 5B3JA 3H5VA 3CHYA 5EWJB 5PNTA 1DC8A 1D4ZA 3LUGA 2QZJA 1JDPA 1PHRA 2MSLA 3HUUA 3OO0A 3R0JA 5FWXA 2IDMA 1PNRA 4N47A 3CG4A 4G0XA 4PEVA 5CNMA 1NXXA 3URMA 1BDIA 1DBPA 2QSJA 4MS4B 3F6CA 2W42A 1Z17A 4F11A 1RPJA 4EGSA 3FMVA 4YWHA 1YTUA 3TMYA 1U2PA 4MAAA 2FQWA 4KZKA 1SXGA 3H5IA 2R4QA 4Z9AA 1D1QA 1ZGGA 1JFSA 2JVJA 1EWVA 4KFCA 2WB4A 1NY5A 4MQEA 3IP5A 5IUNC 2IPNA 2OENG 4O5AA 1JDNA 4RK7A 2WJAA 1EWKA 2PUCA 3HK2A
chains in the Genus database with same CATH superfamily
1YZHA 1QQ7A 1TLTA 2HWYA 1ZRHA 3AMVA 1KRHA 4CLXA 1TM4E 2Q6LA 3HRIA 5FQOA 4GMXA 2Q4EA 5HVNA 1QG4A 1GRRA 1RQ2A 1E7WA 2C4NA 2B5OA 1K86A 2C8KA 2ERCA 5CM8B 4WLUA 3WV5A 2Q8PA 1I1NA 1UZLA 4JR1A 4S0ZA 4HH1A 4MITA 1U2EA 2CUNA 3K5HA 4X8HA 2Z09A 4N0MA 9MHTA 1WU7A 4JUBA 1XTRA 2EP8A 2QRQA 2F62A 4JJ7A 1FSZA 4Z99A 3RRZA 5IANA 3R9KA 1B23P 3PA6A 1EXWA 2BSXA 5JFOA 2A33A 3BJEA 3TRDA 1AH2A 1MRSA 1P33A 5DN9A 5EHNA 3URKA 1E3LA 5HJEA 1DU4A 3MELA 4PN7A 2X4IA 3PZRA 4MVJF 4A1OA 5H8WA 2QYOA 1NXWA 2W4IA 3ASUA 2F6RA 4UEQA 4C22A 5CDYA 1ACJA 2MMCA 2AIRA 3ISJA 4CEHB 1L5OA 1JLRA 3LKBA 4ML3A 3LTNC 1KA9H 4J0JA 1J06A 1UZNA 3H5NA 1POXA 3TRFA 5F98A 1BWSA 1EMDA 1V1RB 3HXQA 3V8BA 1D03A 5ECDA 4QGBA 5ALKA 5ALYA 4UHBA 4NAHA 3PVSA 1JHXA 5JATA 3PF9A 3FKQA 3RFCA 3V8MA 2NO6A 4CLDA 3PIIA 5ULLA 4P3KA 4XSGA 3FN4A 3OPVA 3UJAA 5EE5B 1C4WA 3FVRA 1KNQA 3K0AB 1XVLA 1TUGA 3RTAA 3AR5A 4YJGA 1EP2B 2GK7A 2A4KA 4GXQA 4QPNA 2NV2B 1N3YA 4YCBA 3TE6A 3P0HA 3T9FA 1Y6JA 4I3GA 1M34E 1U9JA 1L7VC 3II6X 2FDRA 3WFJA 3ZTYA 4ZU3A 1XI2A 4TSFD 3SG0A 4JC0A 3KR2A 1FCJA 4WE3A 3IEUA 3L6DA 3QX9A 1BXKA 1H65A 1W35A 4M1OA 4I46A 1OHHD 3PL1A 4WKGA 4C0HA 2NU7B 2B6NA 2QNBA 1NQTA 3VZQA 1AQIA 1ZVKA 1T8YA 5AKZA 3T3EA 2OBYA 2IQIA 1DTSA 3LRPA 4L8VA 5A7FA 5BW4A 4M21A 1R4NB 3HJAA 3KQVA 4WXEA 3LDAA 3NJRA 1NL3A 5EIXA 1N2GA 4KUHA 4YGYA 5DV9A 1C9JA 3ZU6A 1WZIA 3A2LA 1H66A 4OYHA 3DAGA 3INNA 5K09A 5LQUA 3IE0A 1KXJA 3DBIA 4P92A 3S28A 4R7ZA 2A14A 2F4NA 1BMQA 4G5OA 5ALOA 4L08A 4ER3A 2GD2A 1FP1D 3O9ZA 4Z7OB 1L7RA 3WICA 4PU0A 4JLJA 5ALUA 4AZ0B 1NNUA 4LVUA 1Q0RA 1AHPA 2VNJA 4QT4A 1Z6ZA 2BW0A 4R16A 5A9SB 4R6XA 2FJUA 4DIOA 1U7XA 4O2AB 3U4GA 1EWYA 2O3QA 4BB5A 4DR2B 5HP4A 3FGZA 4NG5A 1XX6A 4JVSB 1Q17A 4D4KA 4ABTA 1E6UA 2ZE6A 3VPAA 3ZQJA 1KMHB 1VLHA 4PXAA 5JNRA 2JLQA 2ACKA 3RC3A 2ODWA 3FHOA 3GEGA 3LCCA 4ND7A 3GCZA 4FTWA 4WLNA 1NP7A 2PX4A 4CW7A 2XRZA 2CLEB 4HYEA 3FYUA 1YDWA 3GFPA 2IYEA 3OC6A 5BN4B 3RF6A 3ZI0A 1VJTA 5A3JA 4N5IX 4EPYA 2CZCA 1XROA 2C5GA 2V3WA 2WOOA 4CTNA 1TKCA 4L95C 4YALA 1EGQA 2GLTA 1ZM2A 2Z6AA 1GR1A 1M5RA 3QWHA 2GLXA 1ZM9A 1YZGA 4TTVA 5AOVA 3RV4A 6ADHA 4YO7A 5IH3A 3ZU3A 1SUFA 3IOEA 4BUZA 5JYEA 2EJTA 1NASA 1YGPA 4QFMA 4BO4A 1HX7A 1QB8A 5JISA 1L1QA 3RVMA 3MJDA 2RGRA 5AM4A 2RGGA 2OV4A 2O07A 1L9XA 3LVRE 1ZMBA 4RK4A 1IVSA 1Z2AA 2VRNA 4G5QA 1VHLA 5KMGB 3QQ5A 2WT4A 1H2YA 1VE3A 4IHKA 5A5GA 3DOFA 1YDHA 1ZCAA 4EG0A 4URXR 1JE0A 2CVZA 2EQBA 2ECPA 1PR3A 2R5FA 4LDNA 2HQSA 4NV1A 4Q47A 1SJ9A 3I5MA 5HIMA 4BKUA 3HLYA 3QEAZ 1BOFA 4J8PA 4K1LA 3LK7A 4EYQA 2FSVC 4J1SA 2GJ8A 5BSFA 2PKXA 4AJ2A 1WEHA 3KQHA 1PBTA 2L82A 4P1ZA 4BGEA 1WD7A 3IH5A 1JI0A 1XZKA 3KSRA 3KSAC 5LIPA 2E4YA 5KJ1A 1U5CA 2G80A 2VZEA 3NVDA 3WMXA 3C3KA 1PZNA 2P6MA 1T5TA 3KFLA 3Q6MA 4XWWA 4E15A 1E58A 3MINB 4TV9B 3W2GA 2XGGA 2B25A 1JIQA 3A4IA 3L7CA 4CV2A 2ZZNA 2OHHA 5ALPA 4LMAA 3V32A 1JGTA 3MOGA 4U63A 5IEJA 3ILSA 1A76A 1KI7A 4A0RA 3GPDG 2VT3A 1KYWA 4QEDA 5HG0A 1XZEA 3MYYA 3WGKA 2QL7A 4Q9IA 1ZUNB 5A5FA 3VBEA 2ZT7A 4I50B 5D7NA 1Z35A 1Y3HA 4L1KA 3D7SA 1PS9A 4TL6A 4WIAA 4Y2HA 1CUUA 1P1KA 2EBWA 4M6WA 1KKMA 2X0RA 4G5FA 3QPBA 2ZROA 1NW5A 5H83A 1CT9A 1DC5A 1VCMA 1DLJA 1NI4B 4NOLA 3OTHA 3KQWA 3VO9A 2I3GA 3I9JA 1ZIYA 2VWPA 2ZRJA 3BX1A 2Q46A 3UHJA 4B6PA 2WZQA 3OLCX 5LM3A 3EVAA 1NW6A 5FOXA 3UXMA 2Q07A 4YJ2F 1HK7A 3TFQA 2XH8A 1KFEB 1T24A 4EJ0A 2DBVO 4WY5A 4KIFA 4ZREA 3TMKA 2YOHA 1TEVA 1OVGA 1YBAA 3H3XA 2QTZA 4M2LA 2QZSA 4HQ6A 2FB9A 4HL6A 1ZUHA 3ZXIA 3RYCA 1JSRA 3CVXA 3ANYB 4GLFA 4A0SA 3I0MA 1ZCJA 1I2AA 5D5PA 1TI7A 1WUYA 1Z7YA 1A9XB 1SXJC 1WW3A 3AF3A 3HUFA 4P4TA 4UNSA 3VR2A 4Z53A 1JFFB 1VE6A 4PIMA 3G9UA 1Z6TA 3OZXA 2JASA 3C1UA 1ZWKA 3PYXA 4HAOA 4JJEA 4LYFA 4ZCQA 2YDYA 3TZHA 5GZ3A 4N54A 4IJ6A 1L5ZA 3KB6A 4CKWA 1AS3A 1XCBA 5A4MS 2AUMA 2XRMA 3WJ2A 5AVXA 3B6JA 1PJZA 3BCUA 1WCIA 2BR4A 4F7DA 4RVOA 4EKNB 2XMCA 4GM1A 4NTZA 1Q84A 4LGYA 4YVFA 4ACAA 1JRLA 4WADA 1FP4A 2C7QA 5MN6A 3BMQB 3AR7A 3LUKA 3IBFA 1UZUA 4C06A 1IJBA 2WD9A 4BZQA 5K5EA 2QPTA 3GLRA 2ZB7A 1W5TA 2BHLA 4Z9FA 3WHPA 4DUGA 5CA0B 4MQUA 5KNCD 1JYSA 1MMFB 1XRLA 3UAZA 5C46F 3FSRA 1UZMA 4FYYA 2FNAA 3R3UA 3DZDA 1SIOA 3I4FA 2X9VA 5JS6A 1YRAA 5EMNA 5JBIA 1FYVA 4HYTA 1W5SA 1IH8A 1N2IA 1ZLYA 3IUMA 4G4SP 2AD1A 3SJZA 3UMVA 5IHPA 2FSUA 2WLTA 2VXOA 5ED0A 2BJVA 4QDJA 1LWOA 4CIXA 1E7MA 4JHLA 4WZZA 3HYSA 2SKDA 1DVRA 4DFDA 3DZJA 3AVTA 2FOIA 3TF5A 1NLUA 1D1SA 1I2CA 1YR1A 2IYFA 4Q21A 2I67A 4Y2XA 4YRKA 3FYDA 1SQ0A 4JBLA 3BH0A 4E31A 2V5VA 4EFMA 2GK4A 3GD5A 5EZYB 5DLDA 4PG8A 2JLXA 2ZULA 4UHKA 3A6PC 3B6IA 1JLHA 1UBJS 1YZKA 2Z1NA 2F9FA 4G5XA 3GGDA 3VPXA 3O94A 2KYRA 4KRGA 3LHIA 5E7IA 5C8DA 1J0CA 3K8OE 2PR2A 5ADUS 1ZSYA 3FWNA 5HOEA 1QK5A 4IJWA 4H7HA 3W2FA 2ZBGA 1RXEA 2PLFA 1TO1E 5EZSA 4UTVA 3PNOA 4X7BA 1E89A 3F7TA 5DYTA 5EXXA 5C80A 1BYUA 5C35A 5T67A 4ID3A 1N0IA 1SB9A 1YR8A 4L6CA 5DLYA 3T8YA 1G60A 3TZLA 1EUQA 4EI7A 1QGED 1GPUA 1YNOA 3MWLA 2FWJA 2C3UA 5JSFA 3NIBA 4AJEA 1ZI9A 5CW1A 3ICQB 2P9GA 3OPYA 3AVVA 4RNCA 1ZZGA 2O2YA 1OT3A 1UDAA 4UTPA 1CEEA 3VH3A 2IYWA 4QULA 3VU8A 4I36A 1F4VA 4B35A 4C6TB 2B61A 4J2HA 1HA3A 3RFUA 1ARZA 4O4LA 5A6VA 1SVOA 2GAIA 3W9YA 3ORSA 2ZDQA 3BXPA 3JQ9C 1CQXA 4BFXA 3QF7A 4UTOA 4DLLA 4ES6A 1ZD9A 2PZEA 3DR5A 5G0VA 5JS8A 1D8AA 5FWNA 1GVHA 3E35A 2J85A 3H1GA 3I1YA 3COVA 1NUAA 1RT9A 1LW7A 1P4RA 2XR1A 4TQAA 1MABA 1PLKA 3EZGA 1A1SA 4GOJA 4PYKA 4QQRA 5AKHA 5FFNA 1B8NA 5GONA 5BNZA 5I47A 4X66B 2CW5A 2PR7A 3CZRA 2OP0A 3WGUA 4A15A 1EWQA 5AK0A 2EFGA 5DLQC 3ITEA 1TFUA 4DLUA 2GEVA 2QG6A 3ZXUB 3PZBA 4YAUA 2Q3HA 1YU9A 3I32A 3IQWA 1GYRA 2J3LA 4JLVA 3RUCA 3OSZA 2V1UA 4NBWA 5P8WA 3IULA 2PLWA 1GA1A 1LRLA 1T6NA 3OM1A 3TDNA 4MCJA 3MCAA 3PQ5A 2HIHA 3QKSA 2YL2A 4MA4A 3ZQKA 5KOHA 4K26A 2IYPA 3OUUA 3MIZA 2JAOA 1A8PA 5EZ6B 3MOIA 1RACA 3RK4A 2PVCA 1GV0A 1P44A 2C4UA 3GHHA 1ZY2A 4OI1A 1IPHA 2V7VA 5AVQA 5IM4A 3VC2A 3QX8A 2BISA 2GZDA 4XSHA 4C3UA 4IDHA 1MPXA 2IL1A 3IPRA 3GFOA 3KOOA 4HGZA 3FF1A 4JBWA 5EKUA 1BXRA 1K8QA 3DDCA 3IHWA 1UPTA 1MX5A 2HFJA 3VNRA 1HZZA 3RD5A 1W5EA 3QWIA 5BYAA 2GBIA 3B5IA 3EVNA 2OQIA 3SHTA 4QSMA 1IY8A 3D3EA 4X7MA 2XT9A 4ZTBA 5EI5A 3N05A 4ND4A 3UBMA 3C3JA 1VP9A 4E7OA 1CZUA 1PGOA 1GSHA 1QV9A 2V6JA 1T8UA 3BKXA 3EIXA 3T9CA 9LDTA 1T2NA 3RK0A 2Q3JA 2G17A 2RIRA 3RBZA 1IQPA 2PZGA 4JI5B 1G5IA 1ONBA 1RD4A 3LX8A 3D2BA 4KQGA 4ERNA 1C14A 2PK3A 4L4RA 2IE8A 2NTNA 2PEYA 4UBMA 3MTBA 4C4RA 1JH9A 1H2HA 2C88A 5A0FA 5IAGA 1Y3AA 4JVNA 4EK9A 5EHGA 4D0RA 3S2IA 4M0MA 5IAAA 3H2SA 4GUDA 4BJ6A 1XE3A 4BWYA 1KXZA 1E3EA 1W36C 3KM0A 1IZYA 1P1JA 2DCMA 1H1LB 4X7RA 5AJTA 2ZUFA 3PDJA 3HYNA 2P7IA 1S7CA 1BFUA 2W6JA 1HLPA 3G6KA 4BX9A 4HZGA 4MUKA 4Y0AA 5FI1B 4BFUA 1PSWA 3PNQA 3DVAA 2PL5A 2AEEA 1PQ4A 3EZNA 5DCUA 5KX5A 2VT2A 2HK7A 4RLFA 4PZZA 4WZBB 3WQHA 1DQYA 2ETXA 3AY3A 2GM9A 3GJZA 4U6NA 3R7BA 3KB1A 2VTEA 1FVFA 3LD9A 3GYGA 4GWGA 4H6XA 4PFJA 4PGGA 3OIDA 1JJBA 1RXYA 3DFMA 4H27A 4UD6A 2B99A 3ROGA 2FF5A 2R1VB 2WUEA 3HWWA 2JCYA 4KJXA 1ILEA 2QAGC 5HKKA 2X6QA 4N3AA 1QZZA 1USKA 1YDEA 2C07A 2Q0QA 1GM5A 4Z4IA 1YB5A 2CFCA 2EEZA 3GLQA 3THYA 2W0SA 2GETA 4FGKA 2NOAA 3I9KA 2AZDA 2ZRNA 2HMVA 4QD3A 3UAGA 2NU6A 4BVAA 3BWMA 1XTJA 3H8JA 3TOSA 1RYZA 2I99A 2JJMA 4NE2A 3RS8A 2QGNA 3W1VA 3A70A 3IB3A 4BATA 5DW0A 3R3HA 4U8GA 3ETNA 1DIRA 1NC1A 3HP1A 5I8PA 2NM0A 2A6PA 1KY2A 1NSTA 3MUOA 4WN3A 3L7JA 4XB2A 2UYCA 4Q1VA 4EGSA 4MGKR 4TMFA 1SBCA 4LJ8A 4PZPA 5A05A 1AMOA 4YXWD 2GAJA 1ML3A 4BZZA 3B1JA 2R3SA 3L0ZA 3NTOA 2FPIB 1ESCA 4C7OA 3AUJB 3BE4A 4A16A 4Q3OA 3IL2A 2YIMA 4B5KA 4XWOA 1GSIA 4GLJA 4DNFA 1JXOA 3GW8A 4G9GA 4L02A 5BMVB 2IXBA 5C0OE 1LVHA 4BRWA 3HCNA 2OA0A 4DLPA 5BR4A 3PC7A 1C0PA 3MD9A 1N75A 1X8KA 1SC6A 3CIFA 4ZP1A 1T2CA 2C8LA 2PDAA 4ODIA 4K9RA 2F9MA 3R7WB 5F5NA 4DY4A 5FNVB 3G2LA 4JYMA 4Y6PA 4JFRA 2QRKA 4ZYXA 4E08A 2CNNA 2AG5A 1EWKA 1MC5A 2R65A 1E0DA 2AC7A 2CV2A 1ZJYA 4XVRA 1F7UA 1P9OA 3EUAA 1XELA 1Z75A 3V3TA 2RFLA 4XDHA 4XRRA 3FCAA 2B78A 3OCZA 4WUVA 4KX5A 2Z9DA 1L9KA 1WG8A 1WB4A 3HB0A 4KP7A 3T5DA 3DBHA 3DMTC 1KE2A 3E23A 2A5DA 5B5SA 3ELDA 4FYXA 4BFWA 1LWNA 4UVEA 2BGTA 1ZMOA 4YQYA 3NJ8A 1U5BB 2VXCA 2CWDA 5LUAA 1CZOA 3UXYA 1Z0DA 3R6DA 4A3SA 3FFAA 4EW6A 3DFFA 4EPTA 1XAGA 3D0QA 3QXHA 4UKDA 4NYJR 2O8FA 3NALA 5BQPA 3OO1A 4L9SA 2RHRA 1T26A 3N8DA 3O7MA 4J7CA 3WK5A 1UJ2A 1IPFA 3ZIDA 4LFBB 2VDLB 2X15A 1OE0A 4HJRA 5DT9A 2FETA 2O4UX 2RKWA 3U4QB 3AHIA 3TOCA 1CVLA 4FFMA 4WWHA 5AI0A 4YV0A 4FR0A 5AUQA 3N0WA 1QV7A 5B37A 3PPYA 3L82B 1RXVA 1RJ9B 2NO9A 3G49A 4TMVA 1K68A 2BOVA 5HCUA 4MINA 4OGGA 5EXEA 3LJKA 4KQFA 2IH5A 5KDDA 1XC7A 2I2FA 3DP7A 3ZK7A 4EHIA 1CVIA 3CO0S 5BQXA 4Z4FA 3H11B 2JLUA 2G07A 2VHJA 1OFTA 3LY9A 3OZGA 3R5TA 4GR4A 4WW0A 4B8WA 1V11B 4K9NA 1C8KA 4FCVA 5B6PA 3OUZA 4TM7A 1Q7RA 2XWSA 2QN6A 1HE1C 3CCCA 2I54A 2W48A 3CLTC 1GN9A 2I3DA 2VAWA 5EMLA 3G9QA 1UT5A 2CXOA 3R3WA 2V6MA 3OF2A 1TX4B 1M2OA 4NI5A 1IRXA 4GECA 3ZWBA 4BO3A 4ZFNA 1VLQA 4WPGA 2BLLA 3BICA 1JZQA 1YVRA 2DFNA 1E9FA 1W0JA 3SPXA 2DLNA 1FJXA 2D1TA 1BCRA 3CNEA 5C8XA 3IOCA 3ZHQA 2IYRA 2F1HA 5IBRA 4EENA 3I2FA 3T7JA 2Y4NA 2ZU6A 3FUVA 4R81A 4UU0A 5F2EA 4LGMA 3C3BA 1U80A 1NDHA 2RGNC 3NH9A 2QROA 4QDTA 5E4TA 2QMZA 1RZUA 3EEYA 2A5FA 2V9CA 4RACA 1G8AA 4AJNA 2W00A 1PDVA 2A84A 1N77A 3RSHA 2AQHA 2XZOA 2I91A 2YV2A 3KEOA 4DSTA 1TFRA 3JVEA 1WM1A 3M82A 5EIBC 1Q3TA 3TLJA 1XF9A 3W8NA 3PL5A 1OAOA 1P29A 3PWKA 4DIBA 2AMLA 3SM9A 1E7YA 1ORVA 2YXBA 4L85A 4YUYA 3WMFA 3N2ZB 5EA2A 4CEIB 4N6OA 3IMGA 4ZJUA 4OX9B 1S3GA 4RW0A 1EK0A 1GCAA 1SQ5A 1GZ6A 3SEQA 4LXUA 1XNJA 2HRCA 3D8UA 4OK6A 1R8XA 5DK6A 3A4NA 3RS5A 5JO0A 5J2UF 3ZJTA 2JIMA 1N2CA 2VWGA 2OCYC 4RENA 4O4HF 2O8BA 2VXBA 1UC5B 1SELA 3AM4A 3CUSA 4EY6A 5DOZA 2A3RA 4DKXA 2CNBA 2DT5A 1F9AA 4H60A 4YECA 5CUQA 1VKOA 1TMGE 2ZTHA 3JQDA 4FDUA 4G67A 2ECKA 4YP5A 4EUNA 5I7WA 2AKAB 2H4ZA 2HMSA 2XQJA 4LNUA 1EKXA 2R11A 4J0QA 4ANFA 4GPZA 3TVYA 5AVYA 3DLAA 1ZHFA 2NQTA 1YAHA 4UM9B 4ZOAA 1R3UA 4M0LA 4ZPXA 2IUUA 1LBQA 3DL2A 1YU6A 3L1HA 1CNFA 2BP7B 2G5TA 3VSCA 3PFHA 1W96A 1B74A 2VQ6A 3CH7A 4DC1A 3A1EA 4Z7JA 2C00A 3OFJA 1KYTA 1HFEL 1FXWA 2DY0A 3E27A 2IJGX 1W88A 2ZW9A 1C0IA 4HCJA 5DXAA 3WAKA 2RH5A 4TWZA 5T3YA 1XEFA 5AJVB 3TLBA 1W29A 1EH5A 2L18A 2YYYA 3R4VA 4NC9A 3V3KA 2XGOA 4MRNA 4O0MA 1U90A 1YB4A 3RFXA 2PRYA 2GBLA 3CNBA 1ORRA 4UCFA 3FXAA 3QMVA 1XKQA 5DX0A 3EEFA 3MWDA 3I3OA 3ZDCA 1KI1A 4LTDA 1W6RA 2KBEA 4BVGA 1FC0A 3UMBA 5FWXB 3C45A 3N3BC 2DF8A 4MOWA 4WEOA 2NGRA 1D6JA 3EODA 4ND2A 4RAQA 2FUNB 1W46A 4DEYA 1MIHA 5J3JA 2IEAA 2P27A 3HVJA 3ILVA 3VZDA 4RMIA 1QX3A 1JZTA 2J07A 2JEZA 3ADOA 3WL6A 3ETGA 1J39A 4N1AA 3VNVA 4H9GA 1W34A 4IDPA 3QEBZ 2FG5A 3WLHA 3X1YA 5A71A 2PH3A 2XMGA 4Y98A 2CHGA 1K5DA 4XEUA 2FPLA 2ZIGA 3DDSA 1KIAA 3NUQA 4CHTA 2P9ZA 3IQDB 1KSGA 3VHRA 1E60A 1LLUA 2G1AA 4K3UA 2O2ZA 3EGWA 4PHHA 1KFBB 1SPBS 2BEJA 2PT5A 2VJQA 3S29A 4TV8A 1V26A 1ZNZA 3PFNA 4CETA 3IT1A 2HHJA 4PO9A 5G53C 4GZ3A 2XOEA 1RQRA 2WTMA 1U0FA 3ZNNA 4PG4A 4YCMA 5TF0A 4HWPA 2NQ8A 2XEXA 3FMFA 4BNMA 1H42A 5IULC 5B1EA 3C43A 3ONWA 4BVJA 1LFDB 2J7PD 1ZIOA 2G06A 5LMZA 3PC6A 5KCMA 1NX9A 5KYNA 2GZRA 4HDRA 4DR6B 1FNDA 2QSUA 1OFUX 2YV3A 2XYRA 3F3YA 4FSDA 3U3MA 3R9XA 3HB9A 3BVPA 5LQCA 2C82A 1AB5A 1R0CA 2JFHA 3O47A 4W1PA 2HN9A 3TLMA 3VYTB 2D2VA 3CVJA 1Y5LA 2ZRHA 2W2PA 4QDZA 4LVCA 2EGUA 2VJBA 3VC3A 2P41A 3KD3A 4LMRA 1EK5A 4HDMB 4X1OA 3GEBA 2WAXA 5B6JA 1CDOA 3OPQA 1ONNA 2FP3A 1PEAA 1JR6A 3IO3A 1JUDA 1JILA 1SXJD 1V39A 4ZT6A 2JFUA 1NZDA 1SUSA 2JL1A 4UNIA 4E1AA 2FW9A 4Q01A 3B7WA 4GVLA 2XUAA 1N6LA 4NY1A 3RYFA 4DRZA 1N25A 3VZSA 4AO8A 4XWYA 4NXMB 1V1MB 1RI1A 4UUAA 4M87A 2QM3A 4G01B 1UXOA 1Q3HA 3P52A 5K3BA 2AG8A 1KMCA 2QTWB 4D6PA 4FGJA 4H2DA 4IVNA 2FSSA 4R9UC 4FU0A 1MV8A 4EO9A 4A36A 1NVEA 4S2UA 2XZDA 1T36B 5K3DA 4BC0A 3C74A 1BKYA 1O6BA 1PN3A 2ZIFA 1AZTA 5TGTA 1GD1O 2R5WA 2IC5A 2Q9AA 2Z98A 4LWPA 2DQSA 2L19A 1KETA 3G1TA 1PT6A 1QJ4A 4PQEA 1PV4A 4DNXA 4HAIA 3AEKB 1I2MA 1N2XA 3DA8A 121PA 5ALQA 4E32A 4DV7B 1IHOA 1UJMA 1IQUA 3B60A 2W6ZA 4OI2A 1DKQA 2O0JA 3THOA 4CODB 4L72A 4GPAA 5IS2A 4LYHA 4M89A 3DZCA 3U1BA 4Y9UA 2RKBA 1RAGA 2OCKA 3OETA 1Z22A 2DBZA 4WSOA 1Q3KA 3ROTA 4MTLA 4PICA 4YUWA 4CMJA 4EECA 2YFYA 2IK8A 5F64A 1PHPA 3P9KA 5J23A 1OX4B 1KMHA 3RHSA 2PZBA 1F5SA 3RG2A 5HNKA 1Y8QB 4KWEA 2ECOA 4UEOA 3U3JA 1K9SA 2VDJA 1QNLA 2XUPA 3GZJA 1OPRA 3PGJA 2BGUA 3QHPA 3RC9A 3ROFA 5KMGA 2VJYA 3QU9A 2QE6A 4CU5A 2HL6A 3H3FA 1P3JA 2VZ9A 4HDOB 2ZM5A 2ISCA 2FPMA 1KHTA 1RQXA 1P4GA 2SHKA 3BIXA 5JNWA 3UTCA 3IEMA 4ND5A 3OD5A 4OH7A 2NUTA 4Q9AA 3REOA 3OHMA 1HGXA 3PCTA 1VKNA 1SG6A 1R4AA 5ESWA 1I7DA 1JE1A 1UPAA 2D3TA 3DJYA 1JH8A 3KQMA 2J87A 4ZQHA 1XQ9A 2FEKA 2VATA 4JWTA 5ITWA 1L1FA 4DKJA 2D5AA 4XVUA 3WWPA 4BDTA 4D9HA 4KLAA 3RODA 4OOEA 2HU5A 2GNPA 4HB2A 1X7GA 1U28A 1GU1A 5I8WA 3HCOA 1ZONA 4P3PA 3MTJA 4QLAA 1OA0A 1C50A 1L4LA 1EWTA 3AKDA 5FO1A 1IXKA 2GCIA 4ZIRA 5CIYA 1K2VN 1WUHS 2HF8A 3WO0A 1U2GA 8LDHA 5ADHA 1E59A 3EZ2A 4FFOA 2OXCA 1CQJB 2ZSBA 1BQ4A 1PL8A 2Q3EA 4AF6A 1G8HA 3DFUA 5DBIA 4AN4A 4ZYWA 6REQB 1DTEA 2EW1A 4CNBA 4DWWA 2E9SA 2NP7A 1ZAKA 4I4TA 3BJMA 2EJWA 5I5GA 5TXGA 2NMVA 4RDCA 3ZHZA 4BZXA 1J97A 5M2QA 2HFKA 4GU5A 1LTQA 1FYFA 4YGXB 3K1ZA 1E92A 2XNCA 3UICA 4I0WB 1DINA 3FPHA 1JR2A 1R00A 4II3A 4B80A 4FR5A 4ZOLF 3OF3A 3F6YA 3UAWA 4RTJA 5AHKA 2C9DA 3ZLJA 4G6ZA 1N8SA 1CJCA 1TQDA 1CQZA 1IPEA 4MYSA 2B2CA 4K9LA 3SGLA 5ENDA 3C3DA 2OAGA 1VIVA 4D46A 4Z4GA 3EZ7A 3K9HA 1UADA 2B7BA 3SQXA 1N2SA 2HMTA 2OZLB 1DRKA 1P9RA 3PKJA 4Y2YA 1KE1A 2UZ1A 3TX2A 1II9A 2HPZA 3KR0A 4HMPA 4IVRA 4WT7A 5E3JA 2Z83A 2WLSA 4EFDA 4P34A 1O6ZA 2DYKA 2G5CA 2BFAA 1SXPA 5A5DA 3E2PA 4IPTA 4O4JF 3EC7A 3SJ7A 5DJ5A 4E2YA 3HHPA 2IX3A 2ZE5A 3L4KA 3ZHBA 1E3DA 2VDKB 3KCNA 3PUYA 4BLWA 5TMDA 1NU8A 1O6CA 3WZLA 3OJFA 5EMHA 3RVRA 1V16B 3N2LA 2OB2A 2HEIA 4YJ2B 5HCIA 5LXTA 5GVSA 3BL8A 1NVFA 3CGGA 3QYJA 2ZSUA 1P60A 2Z6QA 3Q8XB 3NRJA 4XB1A 3BF7A 3OT4A 3FIUA 3JQBA 3K5PA 1TT5A 4J0KA 4XASA 5BY2A 4RYLA 3EMKA 2B6HA 5HDQA 2VH5R 3KKEA 4XJVA 3BD8A 4U2BA 1QB7A 1CS0A 3QJ5A 2FWMX 3PX3A 4Y9TA 1C1XA 1DFHA 3EE6A 5A02A 3IA2A 1RRCA 1JMKC 2H4HA 1PGPA 2I1VB 1JN0A 1QGOA 1BMTA 3B52X 3GEEA 5KJCA 4I55A 1XGKA 1REQB 3IURA 1CBUA 3VMMA 2FVXA 4JSYA 1IZZA 2FN4A 1HDOA 3B7PA 1UFOA 1CQIB 2YH2A 3TLEA 1H8HA 4GKJB 5G1OA 3HLKA 4F3KA 4RIIA 2XLBA 5K0JA 3ZKAA 4ENRA 3TUJC 1GVNB 3LBNA 3UF0A 3T7SA 3FFTA 1T2VA 4D42A 4QOHA 5KSZA 4YFVA 4ARAA 1T8PA 1W36D 1YJCA 4BFTA 3LBHA 3RBVA 3RREA 2F8SA 3DTYA 1HT1E 2Y76A 1NRIA 3HRKA 3UWSA 5EJ6A 4D0NA 2BMFA 4K86A 1AMNA 3GEIA 2RHTA 3HABA 1GPDG 3NZEA 3Q41A 4HDNA 4IY1A 4CKZA 5MF6A 4K46A 5FA8A 1ZCZA 3HDGA 3P4XA 3AU8A 1NPTO 4X45A 1RU3A 1D2CA 3NOXA 2YJTD 3NAGA 4WMLA 4LBWA 3ZZTA 3HI6A 1A4XA 2AYYA 2YVKA 4LQDA 4Q82A 5EJAA 2PKYX 1CEQA 1ORWA 1WPQA 1WSBA 4TLCA 4YI3A 1ZUWA 5LU8A 2Q0XA 3J7TA 2X5KO 4NK5A 4GL4A 4DR7B 1W2GA 2XUQA 2ZS7A 3SNKA 3USCS 1XQYA 3CIOA 1W1WA 2XWQA 3WL5A 1OKKA 4AP9A 3UGJA 4FIDA 2LXNA 2W2OA 4M86A 2Q3BA 5I9SA 1PQPA 3B1FA 3GZ4A 1JPJA 3K9NA 1SCNE 5CBPB 1R0KA 1UKAA 1ZHHA 4HAZA 3GEHA 4KSYA 1ICEA 1K7FB 1PW7A 2GFIA 2VZ8A 3PC2A 3G8YA 4YTEA 4TWAA 3HB1A 4AUEA 2J1LA 2WKQA 3KQYA 4IZ6A 4YBZA 5C2JB 6Q21A 4FGZA 1E1YA 2W4QA 5DCLA 3QU2A 4N39A 4DV4B 5FOWA 1F6WA 5BW8A 5CGZA 3I05A 3UFXA 3A1WA 1BVYF 3O6VA 4GBED 4M9UA 5DXFA 3A9TA 2AZTA 3DWFA 5EWJB 4DM7A 1DC8A 2ZUSA 1CUHA 3ER8A 3TKYA 1HOTA 3K2IA 1AGXA 3IP1A 4AJ9A 2D0OB 2VP9A 3FCXA 1J07A 1M2HA 2B1RA 2PNFA 3OX1A 4Z0PA 3WAJA 1SIWA 2BFCA 1PX2A 3AZOA 1YJAA 2CKMA 1T5BA 3IO5A 2QX8A 1EVJA 2FMTA 4DCJA 5AIBA 5AHOA 4YMWA 2D3WA 1JIVA 1MD9A 4GP7A 3DXFA 4L9WA 1TU4A 1D9ZA 4CKCB 5IT4A 3QX7A 5KYXA 4F3NA 3AR8A 1JFSA 3VOSA 3ADCA 5K0LA 1K1EA 5CLIA 2QBYA 1R0XA 5T4BA 1E2EA 4QAQA 1N7GA 1A95A 2IX9A 4NONA 4BV8A 3EY9A 4F38A 1E4EB 2ORIA 2JLSA 2ZBVA 2D8AA 5ES3A 5GJCA 4CPDA 3T41A 1U7ZA 1W0KD 1JDNA 1T9GS 4X6YA 2PRSA 3RS4A 3A6ZA 4I5DA 3R8XA 1UJ5A 3ODGA 3DOHA 1T3SA 1GG2A 1HEUA 2CZGA 4FSHA 4R5HA 3C3AA 4PWYA 3RSLA 2QP4A 4HEQA 1PVVA 4KE8A 4PYLA 1RJGA 2ON6A 3BMCB 2CLLB 3RBAA 4V2IA 1I3CA 2O3UA 4XQGA 2B8TA 3OEEA 1VPEA 5JROA 2NVBA 5JH7A 5HIJA 2YJ4A 1A97A 3QF4A 1J2RA 3RSZA 4E11A 4IQ8A 4HGYA 1YA4A 2BELA 2H1LA 3WGTA 2FK8A 4G26A 2AJ8A 3VR3D 4G2NA 5JSQA 1Y89A 1JU4A 2V5UA 3QENA 4HRXA 1KSHA 4OY3A 5AHWA 5D01A 5D5HA 2XQGA 3SS7X 1GTVA 4S12A 1EHYA 2GSWA 4JB3A 1JQJC 1LS6A 1QRRA 2PUAA 1LY1A 1ZS9A 3PQCA 4J9UE 3YASA 3GDWA 2ERXA 4J2TA 2OPBA 2V7XA 3AH8A 3CPJB 3DOOA 5AI9A 2FMIA 5ETJA 2ZT5A 2R7KA 2ZJBA 4CKBB 2QM0A 5C5IA 4LQCA 4YJFA 5D85A 2JA1A 1W8DA 1Z36A 3BFPA 3ZHTA 3TBKA 4LXTA 4OXRA 5F33A 4KX3A 4AY5A 3KVYA 1U3FA 2GO1A 2ZJYA 3CLTD 5AJUA 1SD5A 3GC6A 3WHIA 1ZK3A 3ICEA 3QPVA 3VV3A 5C53B 2PCJA 3CF4A 3FH0A 4YDQA 4KPGA 2J3EA 1Z0UA 2F1JA 2IXEA 4O8ZA 4YROA 2Q8NA 3LH5A 3C7CB 4IZIA 1AGYA 4BHTA 2R25B 3SC2A 5P21A 4ONEA 4Q16A 4DBZA 1PDWA 1N1EA 4W9NA 1IUNA 5I9TA 1SEVA 1Z08A 1ZNXA 4JNCA 1UM8A 2CVOA 1EESA 1JHVA 5DK4A 1A9OA 1C29B 1QRSA 5WRFA 1F48A 4B1FA 4D8VA 4Y30A 4ZI7A 2PD4A 3A9SA 1WXWA 1WXIA 2COKA 4LY9A 5DBOA 4EABA 3ND7A 1XVTA 4YJ3A 4BXOA 1KGDA 5EIBD 3C3MA 4OKNA 4NLLA 1T4DA 3KJIA 3QA3E 2YHUA 3N0TA 4R2LA 3KPJA 4NNOA 1P7ZA 3FTPA 2ZWVA 2GAFA 5CA1A 3G8DA 1VG1A 2Z43A 5THXA 4IX1A 3G13A 1RKVA 4DLTA 3HJFA 2NUPA 3R6WA 3ESYA 4MI3A 2JFFA 2C58A 4BNNA 2HPVA 5FUWA 1LX6A 4KPUB 3SYTA 5JD6A 2PEZA 3L6UA 4RTRA 4R2WA 1SOAA 2WIKA 5D6OA 1YO6A 2EDCA 2O2GA 3OCVA 3CLRC 1PGQA 4YREA 1K2WA 1GTMA 4X1YB 5JZOA 2VP2A 4MNTA 3WRVA 1KIFA 2RBGA 5BWBA 2QQFA 2WYHA 1UBHS 3RIEA 3QOXA 3IESA 3M2PA 2ZT6A 1NW7A 4HJXA 1XMPA 2Z56A 5CW2A 4B40A 3OE1A 1FFYA 1SGWA 2B4KA 1HDEA 4BNYA 3GLKA 2VNIA 2IHUA 2A67A 2Q5FA 1TMOA 1LSOA 5COAA 5D86A 5B64A 1PZEA 3NTRA 1BD3A 3T3GA 3WTCA 5I45A 3BFVA 4PVCA 3DAFA 3Q1LA 2MSWA 2ZR8A 5CK5A 3V1NA 1YQUA 2ZUTA 1DPGA 5DNEA 4IDBA 4TSFA 3JQ7A 1OI3A 2ASVA 2POQX 4YPFA 5TX7A 3NYQA 1LSJA 2OHXA 1OHHA 3BD7A 4CIBA 1BC5A 4O63O 4LZAA 1EZ4A 2IDJA 4UE3S 2JBWA 3WBKA 4ZZIA 1N8TA 3MS7A 3ZGNA 1JT9A 4H7PA 3Q0TA 2HQRA 4F3RA 4KGZA 3K4HA 1DJMA 3K09A 5LYJF 1Z5UA 4AJ4A 2H3EA 2R97A 1ZJ4A 4XVHA 1FB5A 2HZBA 5LWHA 2PMDA 3E3LA 3VJKA 3LCVB 4Y2SA 3VUFA 4NR0A 1MXHA 2JAXA 1YS2X 2VSNA 3CH4B 3PC8C 5HF6A 2JJ1D 3I6BA 2WAAA 4DLSA 4EKDA 4ZHQA 1D2AA 1BXGB 2QORA 3V4OA 4CL2A 2H63A 3ZWOA 1CUAA 1HFWA 1KTVA 3K8YA 4KODA 2V8OA 3DXXA 4IP0A 1ESDA 1IU9A 1QWOA 1VCIA 4FFSA 2CN1A 3GUVA 4L5AA 5DI3B 4MQ6A 3TQTA 4F6RB 2QX7A 3M1IA 3SIRA 3LQKA 4REQA 5IWAB 3BT7A 5ECYA 3VDRA 1GUZA 3CX3A 5J1SB 4RFSB 3QVGA 4LBVA 3GH1A 3NHWA 5EYPA 4LZWA 2GZMA 4GZ5A 3EPKA 1NMXA 1FVXA 5AW3A 2YBDA 2Z0MA 2TMDA 4R7TA 4XM2A 1G8SA 3K8ZA 1QANA 1F14A 1ZD1A 4IV8A 1P2FA 2GN9A 5HOQA 2XDYA 3TXXA 4NPAA 1XDSA 4Q9NA 5HIAA 3P9RA 3EVBA 5AW9A 1L7PA 4RVFA 3K0CA 3EQ7A 4L2IB 1X3LA 4B85A 4CCWA 1QS0A 4QTTB 1DKNA 2QUAA 2WF5A 3B3FA 1T43A 3NXKA 4L8LA 4LDZA 1BCSA 3K20A 1KDVA 4Z4CA 1EFVA 2AYXA 5LJLA 3OT5A 1MJGA 4WAUA 3CNOA 1KEZA 3NTQA 1BEUB 5DP2A 1YGYA 2NW6A 5AESA 5CDGA 3T34A 1IFXA 3OX2A 2G9ZA 1B73A 2IZ0A 5GINE 3UAVA 1F51E 2KM1A 3NS7A 4PC7A 1UBSB 3PRYA 4FNMA 1OAAA 1CUJA 1U0HC 2AWOA 2FPSA 2P9HA 1FLAA 4B4WA 3ST7A 3FLAA 4EGCB 5HTOA 2VBIA 2IA5A 3E53A 2V0NA 4RIEA 1JS1X 3OPYI 2LTAA 2OC4A 4KR3A 4KPFC 4MVJE 1BZYA 1G2OA 2P9BA 5AO9A 2FMFA 4WASA 2HSZA 3O95A 3S2GA 4AUKA 1SBNE 1UBEA 2QRVA 2IS4A 2Z2ZA 4QYMA 2X1HA 1K5GA 1ACMA 2FMUA 3L7MA 3GLGB 3PX2A 1HNXB 5LA6F 2IITA 1MLDA 5AXAA 1OTHA 1C7RA 4BTEA 3LC2O 4RQBA 2EL7A 5JDIA 4QPPA 1E9BA 5LSAA 1DAIA 3G23A 1IHDA 2FPRA 3KSMA 3M70A 3N8HA 4LI0A 4UM8B 3TRJA 4D2IA 3CMMA 1HQKA 521PA 4MRRA 4EY7A 1MC1A 3ZLVA 4C4TA 4EGQA 3QI7A 2GRUA 1OQAA 3UMMA 4F4FA 2C29D 3FUCA 4QECA 3IP7A 1Q0QA 2VR1A 3E70C 5I7SA 2PS3A 1SCJA 5A0TA 1U4SA 1MB3A 4HQRA 2P5SA 2W2VA 2XCOA 5I3CA 4OHBA 2O8CA 4Y6LA 4IOLA 1R5NA 3HB5X 5B4TA 1T6BY 3BL5A 1A5AB 4HGNA 1VDZA 1Z0FA 2G9UA 4E5SA 1P8AA 2CVHA 4LXYA 3WRXA 5J2UB 4GMDA 4EVIA 5DTEA 3LI2A 1U81A 2P5UA 4G1MB 4O4HB 4GQIA 5FPPA 5C7IO 4L9AA 2P1DA 5HBGA 1IXYA 4MIKA 3NWPA 4DR5B 3CRW1 3Q3CA 1A5ZA 1YIDA 3WGQA 4AO6A 5ED4A 1H05A 4RVSA 5SZHB 2QOEA 5IYZF 3R7AA 4V1CB 2W6QA 3OCXA 4GPD1 4LCJA 2VHQA 3PVZA 4LUCA 3S7ZA 1EI9A 2XE7A 4EB6A 5B30A 4DARA 1RXIA 1XRMA 1WY5A 3PRHA 1USGA 2HJWA 2ZUDA 1CD5A 2Z2XA 4INPA 3L1UA 1U94A 3QLEA 3TBHA 5EG5A 1I01A 4OP3A 3D8HA 3P9YA 1TW3A 2OOSA 1N0WA 3AYZB 4RQUA 3STHA 2VG8A 4EG6A 4HN9A 2VC2B 2J5XA 2X8JA 1LPOA 2X5JO 1E2IA 1QF6A 4IH4A 4Q03A 1P7WA 1X19A 3PS9A 4K6OA 1II8A 3DV2A 2XJ9A 4AIRA 3KTAB 4DIMA 3B2QA 1T9AA 3AIIA 4XARA 4YCCA 2X8WA 4MS3B 1T8RA 4NFYA 1FTNA 1N36B 1KY3A 4TZKA 1ATZA 3TTVA 4YAIA 2WSLA 1G6OA 1DIGA 2GA9A 3GOQA 5LD2B 4OLHA 1HFJA 4Q66C 4N5MA 2ZYSA 3GAFA 3C3CA 3GRPA 1UQUA 1XTTA 1J2JA 2TECE 5KNCA 3U61B 2OTCA 2PU7A 1IN4A 3NWOA 5DTMA 2FLWA 4LDAA 1UMDB 1OSNA 2H52A 1CB7A 1LJ8A 3VR0A 2FX3A 1OH5A 1F4LA 3NC1C 1HDRA 1B76A 1R37A 4HGOA 2AB0A 3Q6NA 4ENTA 1OV6A 5AI8A 4BP8A 2DERA 1I7SB 1QC5B 3RKUA 3ZW8A 1CR1A 4MYCA 5BRAA 2JAHA 3H9QA 3ZI4A 1XJ0A 1OWOA 3IIEA 4P0QB 3SEAA 1XFDA 1J24A 4Y0NA 5L6LB 4V0LA 3U7HB 3M49A 5JPIA 1H23A 5E0OA 5L3SB 1AHIA 2X5NA 1ZFNA 2GTPA 1OXTA 2Q1TA 3EXHB 3HJRA 3TTYA 3V48A 3T9BA 4OTZA 2HIGA 4JLKA 4QRIA 3V2UA 5JEEA 2QRMA 4QXQA 2MTBA 1OLUB 3ESDA 4WEQA 4YR7A 1XJWA 1FRNA 5KEIA 5MGNA 4LF8B 3BZUA 2IVFA 2B82A 7AT1A 3U6KA 2REXB 3KJEA 4HUJA 1F20A 1M67A 2CMHA 2AOTB 1H69A 4I5IA 3WYFA 4HDMA 5DM60 4B82A 4XWTA 2GERA 5CJJA 3EZ6A 1NNSA 4IOJA 3B1XA 3KYDA 2EWMA 4AMVA 4V03A 3EXIB 1DUIA 1H2ZA 4CMIA 1FE8A 3KTDA 3SD7A 2Y99A 2RB4A 5IH7A 2C8VA 5I4KA 2PL1A 3A1CA 4BFCA 4QM7A 1E0AA 2PLNA 1RHRA 2A5GA 1I3LA 5FWYB 3CM0A 5KQRA 1QIIA 1TAHA 2XUFA 2WU1A 3LUHA 5FV4A 5BQOA 4JK3A 1JFLA 1GFSA 3RS0A 2LDXA 4WZAA 1J4AA 3EIQA 3GG2A 1AKVA 3G2KA 1FXUA 2AVDA 1FDIA 2ZTUA 2Y77A 5ALWA 1Y7IA 2ZYGA 1JR3A 4REOA 2QLBA 5FTWA 1N0UA 2BBSA 2J0UB 3EISA 5TPZA 4FR2A 5FBWB 5F2NA 4ZVMA 1J8VA 2IYLD 4L8GA 4RZ2A 2YIDA 4EZBA 3IC5A 5DNCA 1AX9A 1T0HB 1U5AA 1JFVA 3N70A 4RLQA 5SZIA 1AQ6A 4DAEA 3FR7A 4MUGA 4CM7A 1XEXA 2Q4BA 3H5OA 3EK2A 2A88A 4MQFB 1QFMA 4MS1B 4O2BA 1ST3A 3L7LA 4RVDA 2M6RA 4Y9DA 1IJFA 3WC4A 2BR3A 3MPOA 1K97A 1XD2B 2ZJ2A 4RTKA 1B8UA 1ECJA 1I8TA 2XA9A 3KSBC 5FBKA 3D5EA 3HKCA 4X3CA 1FLVA 3KX2A 3N7UA 1UXHA 3NIDB 4HZUB 1I3OA 2D1YA 2GPJA 2IEZA 1UR5A 1G3UA 3RVJA 4DIEA 4AQ7A 2VTKA 1CERA 3D5QA 3QA9A 3A1FA 4FT4A 2RK3A 2C3OA 3PITA 2VOJA 3QH4A 3BZBA 4RJKA 4RH1A 3UC9A 2JGDA 1QF9A 2X9LA 3E3OA 4LYAA 1KYVA 1SZPA 1TO6A 3FTCA 3DCIA 4MLZA 4UD2A 4XD2A 1N2HA 2IHBA 3JTMA 1NSFA 1RADA 1YZVA 4UATA 1UFVA 4M8SA 1ENOA 1Y37A 3N53A 3GQVA 4R8RA 1UMBB 5EPUA 1TCVA 3EHDA 5HUHA 2H5EA 1EXNA 3S1LA 1IRIA 1BSVA 3ICVA 3K9BA 3VTAA 4BMPB 4FOTA 1J2YA 4Q4JB 2BV3A 2HMUA 2DHRA 2RGAA 1L5HB 4QYTA 3ZJYA 5EOVA 4OXKA 2OQRA 3LY8A 3WLIA 3SE7A 3WYEA 2BH2A 2RI6A 4TKUB 1L7QA 3GNLA 1DV1A 1YB1A 4X41A 2MCFA 4J1QA 4LJYA 4W8HA 2HB6A 3V1KA 4HDSB 3CF4G 1I7NA 3QU4A 3JWPA 3LUGA 1XO1A 3G9TA 1FDVA 1OIXA 2XXJA 4YB8A 4HHEA 4BVHA 1A9SA 2OCDA 4QYSA 4CI9A 4Z2YA 2OFWA 4BMNA 5B2EA 2QSJA 5EKXA 4ND8B 4X6LA 4AJPA 4FDLA 1XKLA 1XN4A 2AOUA 2P79A 4FT2A 5I7RA 2W83A 1OGJA 2XF2A 3JQGA 1NMZA 2VYND 1LGYA 1SQSA 2ACEA 1E20A 1WV1A 3DMHA 3R23A 4KZKA 1H3NA 2Z3VA 3H5IA 4GBGA 3SHFA 3KAJA 4OJYA 1OC4A 1A7UA 1ZGGA 3RS2A 2BFOA 3OZ7A 1ZRSA 5DNDA 4Z49A 2JZOA 1UBCA 4D9JA 1E7SA 1HC7A 2P65A 1FS4A 4QXAA 5J4YA 1H3EA 1B2RA 5KYYB 3D7NA 2DQ4A 3EW9A 4MW4A 4G4JA 4YQEA 4PXSA 4ZKEA 4FMDF 4HS9A 3TQOA 3F2IA 4QA9A 4JNKA 1D4OA 4EHLA 1XALA 4OQ4A 4ZOLB 5EHIA 3AHGA 3KDAA 3ZDYB 4PTYA 3TLKA 2BLNA 5B7GA 2QVZX 3GEPA 5DHRA 1XT6A 2W8BB 4G0ZA 1AK1A 3BHJA 1E6WA 3RF7A 3W77A 3NI2A 5CCXA 4MWTA 1R27A 2KJQA 3CTPA 1U2ZA 3QX3A 4BE7B 3B20A 4LE0A 4F0JA 2QW1A 3QVJA 3UGKA 4P84A 4H7IA 4X93A 3ZZNA 3UOWA 1Q0UA 5BVGA 5ICSA 3DBVO 3GRCA 1V5EA 2W9XA 4BJHB 1UK8A 1LRJA 4G0QA 4O4JB 3HFJA 1QDUA 3EGEA 4ZQEA 1VXOA 3IR5A 3QMPA 1KJWA 3WB0A 1XTZA 1VSBA 2X0FA 1BQ3A 1YULA 3K9LA 2JVKA 3FDZA 4EPXA 3ZGVA 4FP9A 1QK3A 5DSZA 4QGAA 2OUKA 4OHXA 4FFNA 3KNZA 1Z16A 1VRCA 3LGSA 3TQQA 1YIAA 1NJFA 2HX1A 3CT4A 4FN5A 2OO5C 2P3QA 2OZVA 4XLLA 3T7CA 5JI3E 4YRBA 3X0DA 5JJIA 4EG3A 1DAMA 4Q5IA 4TZ6A 2YW9A 3C8HA 4PLTA 3UN1A 3JQAD 4D9BA 4E2ZA 1SAYA 4JKOA 5JSHA 5JADA 3EGDA 2OHFA 3OJOA 4WVLA 4BQEA 5K8CA 3RGGA 4IIFA 4YXFA 1NI3A 3DEKA 1NKSA 4G36A 3O1IC 2Y2UA 1PRYA 2I2DA 3H2HA 2PUHA 4ZVOA 4IGKA 3HBJA 1ORHA 2I4IA 5HYVA 3V4PB 3HFGA 1O08A 2MYPA 5L3QB 3DZHA 2XE6A 3T52A 2AE1A 4YCNA 2NU8A 1MAAA 1RHJA 2VNHA 1XOIA 3RHFA 4UBNA 2QRNA 3DH0A 3O8OB 1WKVA 4DJJA 2VUIB 2IODA 1Y3DE 1BW9A 1W2WB 3KJGA 3OA0A 4H4CA 3E81A 1XZPA 1L8XA 3GLHA 2PKRA 5TJ9A 2NLOA 1KI6B 4H7KA 2E55A 3QWFA 4URWR 1FFAA 1U8ZA 2AFVA 4RXMA 3IQZA 3L84A 1CQPA 5AJYA 4BMXA 1CRWG 2NZWA 4C5BA 4MROA 1V5FA 3H5AA 2P0EA 4QHYA 4OIMA 1N3BA 2GARA 4RJTA 3UPTA 4G0UA 1QG0A 3HGTA 2GMWA 4UOQA 2ANCA 1NAHA 2H65A 3E9YA 1TIKA 3B9RA 1DOAA 3SP1A 2QMHA 3R3VA 1DDOA 3FAKA 4LF7B 1L4KA 5EUCA 3LFHA 2GYYA 1HE3A 1XWIA 2PUTA 1EGHA 3DOIA 4YLGA 4L07A 1JIJA 3V1YA 4B3RB 1RQPA 1NV8A 1ZM7A 1COWD 1ZK0A 1Z07A 5GPBA 2AJTA 3LOUA 1JAXA 2HZ7A 3Q98A 3SFZA 1I5RA 3RRNA 1ADBA 1PR6A 3F74A 2HBRA 2HYDA 4A0GA 1NVVQ 1JKJA 5HM6A 4CHGA 2IZ5A 3PVCA 4R8KA 3U4HA 4E5PA 3L1KA 1L4GA 2DWOA 1NBIA 4TN1A 1ESNA 2XMPA 4Q4HB 1VLMA 1EFKA 2HUPA 2WU8A 3RH0A 1DAKA 3NHBA 1FQWA 3PK0A 3FHTA 1C3LA 1UM9A 1WCYA 1TD9A 2AN1A 2QD4A 4RMGA 4R71A 4GSYA 1V4BA 2XYPA 1B0UA 2BL4A 2OHJA 3WL4A 5BMOA 4CR7A 1JAZA 1FDSA 4F2DA 1C7FA 4YAKA 1WBDA 5D84A 1WSDA 4PINA 1W87A 3WRWA 2JFNA 4H1VA 4P3NA 4Y7CA 5CXXA 3I8XA 4PFKA 3SIXA 4F06A 4ZC1A 2BFPA 3UENA 5IPFA 3O8CA 3BH6A 1Y3FE 4GGOA 2XXAB 4JR0A 4XLTA 1P1RA 3WKAA 4DWOA 3ZQUA 2ZUUA 4FZ5A 4RJJA 4MKIA 3QLTA 3R7LA 2V4ZA 5FX2A 2VYVD 1EIZA 3D4IA 5T6MA 2WJWA 1M1YB 1H6BA 2ZB4A 3JATA 1YB2A 3U7QA 3ZLUA 1LBTA 1E2HA 2QY6A 4RKYA 5DHPA 5E2BA 2VKTA 2XADA 1JHUA 2DKFA 3MS2A 4RQAA 1R10A 3LS2A 3UJBA 4TX1A 3DDZX 3I52A 2L17A 4O4IF 1VI2A 3V8EA 1J7KA 3EVGA 4PZCA 3VKFA 2EX4A 3W0LB 3WL8A 3AFNA 3W2HA 4C5CA 1GPBA 2W4MA 4MQEB 1Z5VA 4C7JA 1YRBA 1XRRA 2X2FA 2JGRA 3H4VA 3QY9A 2BJWA 4JCCA 5ERYA 4B4KA 4CUJA 1JEYA 2CYBA 4LPKA 3VH2A 4R40A 2UUOA 4QDXA 4FBLA 3C8MA 3FIJA 2IUYA 4BNGA 5EP1A 5ALJA 2XX3A 3GUYA 4RA9B 1V3TA 1X13A 2CEAA 2FXIA 2G36A 3NT2A 2WG0A 5AK3A 1QIJA 2X2EA 4RGBA 1BDMA 1DAPA 3KETA 1AKRA 5TY0A 4KXXA 1IK4A 3SBXA 4KPEC 1FW6A 2P5TB 4TOIA 4TN5A 2C1ZA 3A10A 1ZOPA 4WBSA 5CNIA 1JWAB 1GSAA 2C9ZA 1E7QA 3R74A 4BEJA 4UE6A 2J9YB 1IBRA 2ZPTX 4QYIA 3ZDQA 4JL6A 1P6XA 5ESDA 5JD3A 2HD4A 4Z4HA 2PQ0A 2O8NA 3GT3A 5CDSA 5CIQA 5KPDA 1ZM4A 3QNMA 4WZ6A 2G5PA 4DXHA 1PG5A 5EN4A 3BOSA 2J6CA 4DB4A 1GITA 2JBAA 2QPOA 3ZY3A 3O4RA 4EO4A 2FSVA 2GZAA 1Z2EA 3FNBA 4KDEA 1JB9A 1QPGA 1ZH4A 2OOKA 2FZWA 4XTCS 5LDHA 1HDGO 1N9KA 3K8QA 2R1TA 1SUPA 1ZGJA 1SVSA 2CBXA 4AECA 5FJJA 3DLTA 2AC4A 2UVPB 1L7XA 3D3KA 4U3JA 3AB3A 4U1RA 1U1GA 3UT0A 1PR0A 3SZOA 3E6AA 4NBKA 3T3NA 1SC9A 4YRLA 3JCZA 5G2OA 4KR9A 3VR1A 3LGAA 3DD1A 1DRWA 1JVNA 1X7XB 3IUSA 1RRKA 2ODAA 5DBFA 1NP3A 2ZSJA 2ZBDA 3UB3A 2CB0A 4ZT5A 3BD6A 1L7MA 2W6NA 3ETHA 4CKEB 3AI1A 4B7XA 3WIUA 3G5UA 1AXEA 1E6LA 2JHPA 1ETUA 2GN8A 2O48X 3CKKA 4QBTA 5BRNA 3QE9Y 3N39C 3DAOA 2OBBA 3DE6X 5KBYA 1X1RA 1T2FA 4IS2A 4KBGA 1E1MA 4KH1A 5DF1A 5IAEA 2ORED 2J7PA 2MU1A 4H0CA 4HXFB 4GL2A 3I9NA 1X7WB 2XWPA 4XYGA 2VJOA 3ASYA 4KGXA 4YCLA 3WB1A 3N2YA 3SZMA 3LL7A 3LVFO 4NCJA 4CYMA 1KJ8A 2REQB 2EBFX 1ODLA 3SY8A 5LLSA 1JEOA 2X19A 2P9YA 4DSOA 1Q0TA 4OHYA 1WD5A 3ED5A 2X8AA 1CR2A 4OQMA 4E5VA 3B53X 3ZTTA 3T1YB 3ASVA 3DW3X 5T4FA 4BP9A 4N5DA 4D5EA 1WULS 3TGLA 2LD4A 3S7TA 3C8DA 1JL3A 2DPHA 2EBHX 4M1ZA 4TWIA 1AV6A 1SXJA 4FC6A 5KVAA 4E7PA 1JKXA 4MW0A 1DUSA 1N6KA 2O5VA 3MJTA 4B48A 3U81A 2ECFA 1H0SA 4JB8A 1NNLA 1GXSB 2P8SA 3A28A 1IEWA 4U7GA 5DKFA 5T64A 1UPXA 1L8QA 3T3DA 3FDFA 4GF5A 1GUFA 1E8NA 1L7BA 2BFEA 3RCBA 4FCCA 2JI8A 1L3CA 3ZOZA 1RIFA 1NWCA 2C8JA 2EG5A 3ANMA 3KWMA 1KQOA 3GWGA 4KN9S 1AQYA 4TWBA 5AICA 3N5KA 3BXOA 3IUNA 3Q9SA 3RC7A 1M2GA 3CNQS 3EF3A 3I6QA 4FWTA 2I9PA 3G5LA 3ZOKA 3THXB 3BBPA 3CKLA 1B43A 1IK6A 1SC3A 2RJOA 2Q62A 2LV8A 3L3BA 3PUJA 4NYMR 2PLAA 4NCXA 5DFAA 3SSOA 4BLRA 3F5MA 3QBEA 1KMNA 2Q28A 3FMIA 3QZUA 3R7FA 1NPDA 3NBFA 4K9SA 1AUVA 5F52A 5IX8A 4KR7A 1TTPB 3LMKA 1RZRD 2J09A 2FZVA 4WFKA 2R60A 4P38A 1ZU5A 4NZMA 2IWRA 3LFTA 2Q1XA 4QHSA 3GRYA 1V7ZA 2A1UA 1K7CA 4CDNA 5CDFE 3K0FA 1IXSB 4QVGA 5FOQA 3RT7A 5CX4A 2OBXA 3C97A 1O0SA 1XZFA 2FLVA 3KAKA 3OPXA 1YCHA 2XGSA 3QXJA 4D44A 5IKEA 2XCRB 2IS2A 1I10A 2WFMA 3U4MA 5G3ZA 2BEVB 3OQMA 3SF8A 4B3IA 2RGDA 4BCDA 3FOFC 1JSZA 1L5YA 1OBFO 3S55A 3CRZA 5KTRA 4JI2B 3HYLA 4EI9A 4P5EA 1JDTA 4WA7A 2DFPA 3O1LA 5DIZA 4G84A 2B9VA 3OQHA 4PFQA 2OQ2A 3DFIA 3KELA 4N65A 3GCWA 4N8SA 1P3Y1 5JWRA 3PUKA 4XIIA 4PRYA 2E2WA 1NONA 1XD8A 5EERA 3T0GA 3GJ3A 5BSGA 3ETLA 2YHSA 3IMFA 1Y3IA 1N2EA 4DB2A 4KN5A 1JXAA 2NIPA 3PE4A 5JQGB 4QRDA 2CNDA 3HCAA 4Z9XA 5MN4A 1NLYA 5ALRA 3HY3A 5SY6A 4GOND 1ZC4A 4N0EA 3QVSA 3EXEB 3DB1A 1FS6A 3CO5A 2J5RA 3AY7A 4I6GA 4X1IB 1VKJA 3QUTA 4RH3A 5JC8A 3EWIA 1G5PA 1ODIA 2WTXA 1Y8RB 2IOHA 2A9JA 3P4UA 2VZLA 2IYTA 3EIWA 3I8OA 1DJLA 3JS5A 4M49A 2ROQA 2C1EA 2YMLA 4JT2A 5JFGA 3E9NA 5T6BA 2F90A 1V95A 2OP1A 5ER6A 2B3DA 1N2OA 2FWNA 3KEFA 3ZD9A 3GLIB 1ZGZA 2WD7A 3N7TA 3AHJA 4V3CA 1HG1A 3NH6A 3OHSX 4WERA 1QH1A 1Y33E 1YVUA 3LKZA 5CYGA 5JZSA 3WY9A 1MXFA 4ZOEA 3ZQ4A 1VECA 3E22B 4Q24A 1YRYE 1YUNA 2ZXFA 3JQ9A 5E6RB 2O4CA 2YHAA 2QTBA 3RVSA 3LPAA 2EERA 2V6BA 4YAWA 4IOKA 5KYTA 1O95D 1EBUA 1WE2A 4RA6A 3ML1A 3PX7A 2PA0A 1ICIA 1E9RA 3O8DA 5AKEA 5B3JC 1R0BA 3IIKA 2BR5A 3OAAD 4NZYA 2X4LA 1FSSA 1Z4IA 3KKQA 2BIFA 3P27A 3COSA 1RKBA 3GROA 1TZKA 2CJXA 4N12A 5IF9A 3CZCA 1ZCBA 2QXYA 3GRZA 3CVOA 5K4HA 2P11A 1YK1A 3PGXA 5A4DA 4QBGB 3HRHA 4DPLA 2UZIR 3OOYA 4WK2B 4GS5A 4WVFA 4NJOA 3HWSA 2ZREA 5FLYA 3K1AA 4DLAA 3GLTA 1OASA 4I99A 4XFKA 5FHQA 1UKVY 3AILA 3HV2A 2YUTA 3KYCA 3WG9A 2VCYA 3SZRA 1EK1A 3UUFA 5D3MA 1CY7A 1UEXC 3V4LA 1O0CA 2L0XA 4K3VA 3OX4A 3U4CA 3WK4A 5A3RA 2Z3WA 5IJ9B 8MHTA 3EAFA 4NYIQ 2XTZA 3UANA 1CY0A 2HRZA 2YNMC 3EA0A 4YRQA 5FI0B 3E1SA 4IDGA 3RYIB 1AS0A 1U0SY 3SI7A 1MDFA 1GZVA 4LZOA 4CIAA 5AH0A 1LK5A 1ZVVA 2H8KA 3PEVA 3JWHA 3WLNA 2DP4E 3MFYA 2WOJA 2JCGA 4YIKA 5KOJA 4ROTA 4HDKA 2JANA 3TVDA 3VUEA 1QHHA 1JLLB 2JH8A 5FL7D 1BHQ1 3MJHA 2MINA 3ZNQA 2HQ1A 1EX6A 2I6UA 1GKLA 2GT1A 3DTNA 1NIJA 2YZKA 3JQAB 4Q7QA 1QYVA 2GD6A 5LR6A 3UJPA 4LDJA 4K1XA 1IDOA 5PNTA 4QATA 3RAPR 3BDAA 2O7VA 4MKFA 4L15A 3R0JA 2HXYA 4M1TA 3GUCA 4QO7A 3QXSA 2OT3B 4JJFA 3NKLA 1K7EB 4NNPA 4PEVA 2XD9A 1DBPA 1UANA 4BB0A 3E8SA 4RANA 2V4UA 1AQLA 4RS4A 1X80A 1UAYA 3N2KA 2O54A 4RPGA 2XMZA 4MAAA 4BFLA 4BBPA 2HV8A 4CV0A 4M46A 5BW5A 2JVJA 2LRHA 3MWJA 4NJMA 3AKZA 1T4GA 3FVQA 4CM9D 2IBTA 1T8TA 2FR0A 4P83A 5IT0A 1CY6A 5JBNA 1MJHA 5H81A 4OPMA 1VQ1A 4RPCA 5D87A 5JY6A 2AI2A 3C5EA 2A58A 3O82A 4K28A 2GEJA 2XTNA 4D0GA 3F71A 3VYWA 1U0LA 1P81A 3PHCA 2VP3A 1VM6A 3OEWA 4HB0A 4IRUB 2LKDA 4RTNA 1NT4A 2K4MA 2OCIA 3S6JA 1Z4KA 4XGKA 1EHIA 2PRJA 5ECGC 2BJHA 4BDSA 1I7LA 3MJRA 4F2PA 2YV5A 2QAGA 1YV9A 4QYWA 2VSYA 2YHIA 5CCEA 2DRIA 4Z0NA 1C5KA 3U49A 1DBIA 3LCRA 3L4SO 1SU7A 1ZD8A 3RC2A 2JAUA 5IN5A 1LH0A 3AINA 3QE2A 5DVZA 3VTFA 3L7YA 4LJLA 1T4CA 2ZJ6A 5LZ8A 4F6LA 3ND5A 4DR1B 3WGGA 3KQTA 3PSHA 4IHJA 2QZ9A 1I4LD 4PG7A 4XD7D 2ZBQA 4JLAA 3P94A 3EIHA 3RJ5A 1UJ6A 1KKLA 2V6GA 3LT1A 1HEYA 1XYGA 2C9YA 3OFNA 5BT8A 4OYRA 3HB4X 221PA 3AKYA 3VHXA 3ZEAA 2JD0A 4AKSA 2UYGA 3IJPA 1NJ5A 2CXPA 1QNFA 2QX6A 4K40A 4FDTA 4U7DA 2NO4A 3D7KA 3D6UA 1RI2A 4IDCA 3AR2A 3BTOA 1HFKA 4G56A 5FWYA 3TLYA 4B7UA 3LSTA 4AXBA 3HL4A 4W8OA 5H02A 2F3RA 4LX0A 5BOSB 1RE0A 2FN3A 4B46A 3JPWA 3GT7A 3B3AA 3TN7A 1SQ6A 4XAQA 4B2YA 2IPXA 3A3PA 2ZBRA 3R77A 5IDYA 4UQLA 2VQFB 1DX9A 4P3YA 1I9GA 1M6YA 3S68A 5FKJA 3STXA 3TEJA 1PK9A 3MMSA 2Q45A 1E61A 1T5IA 1BU8A 1PNVA 3EOZA 3I2KA 2FR1A 1T4MA 1YWGO 2WD8A 2R6HA 3EGOA 1QORA 3LQFA 2YVLA 3IQFA 4NG4A 5A6SB 3RT1A 3RRMA 2PZ8A 1W0KA 3UPUA 5REQB 2FFQA 2YX1A 1CVRA 2PXAA 4MEBA 3TVTA 2HHHB 3GJ7A 4N7RA 2DE0X 1JU3A 3DMTA 4MUBA 1ZRNA 1HEIA 2UUCB 4P32A 2EFEB 1FTSA 1UBFA 3TINA 3OLZA 4C0AC 4IXWA 1XD2A 3T1QA 3CVWA 1GAJA 1IM8A 1WDWB 3SDBA 4A8PA 4J6FA 4MEJA 2CLKB 5FFMA 5HJ2A 2E3JA 3JD0A 2COEA 2Y0BA 2PJUA 4FLMA 4DQ0A 3WZMA 4NDNE 1UEJA 4CV1A 1RPTA 2BHSA 2ZJFA 3MSCA 3O74A 1LLCA 5AT1A 3RRFA 3WZ2A 1L7DA 3NDPA 3PNBA 1USUA 3CU5A 5FOTA 2MOKA 5J2TA 1U9IC 3VR3A 5KPJA 4F8JA 3WQSB 5B3LA 1P9WA 4M55A 4XCQA 3QEJA 4PCVA 3NG1A 5KB3A 4CFSA 5J5CA 4BQIA 3V8QA 5JAOA 1RYYA 4NU8X 2O7SA 2GN0A 2I29A 5BN3A 3K96A 1SUCA 3OCCA 1JXMA 1RYNA 1IM2A 2R00C 4AG6A 2CSUA 1A9PA 5LN1A 4QBHA 3MM4A 3QE4A 3GUZA 3B9BA 1N5IA 5CURA 3WLOA 6LDHA 3SXUA 1QO0D 1H4VB 1G8YA 4C14A 1Q0SA 3FW1A 2CNLA 3T1HB 3V4ZA 3K73O 2QNRA 5F4BA 3W5AA 2IV2X 1VZ3A 4NJEA 2VP5A 2H18A 4AO7A 5KKNB 1KKUA 1ENZA 3DEJA 3L18A 2A59A 4MV7A 4A2WA 3D4BA 4K2AA 1GO2A 2HSEA 1JFRA 3AT1A 3ANLA 1LTKA 4FYIA 1BOOA 3S81A 3OBIA 4KXYA 1U8CB 3P2KA 4BEWA 2A9PA 2MR5A 1P1FA 2JDID 4ETWA 4KITB 4AS3A 3ZWMA 1E5XA 3INRA 1QQBA 1SK9A 2RGNA 4CIDA 1EM8A 3PLNA 2H0AA 1L5NA 2G40A 2GHTA 5AW2A 4ESEA 5IC4A 4TLLB 1MJGM 4H18A 4X5OA 4BUJA 4TGLA 4CL8A 2UXCB 4GX2A 3WWOA 4TXLA 1R5JA 4CLOB 4WKNA 1ID1A 3R7DA 5AM1A 4V0MA 1Z5OA 1X0XA 4DEXA 2GN1A 1OYWA 3DE3X 3FLBA 2ZVQX 3OZIA 3IVGA 4WNAB 2J3QA 3KIPA 3ZW7A 3ZWAA 1S8NA 4OP2A 4DHWA 5KVVA 1L4FA 1D7AA 3GRVA 3FD8A 1RAHA 4RZSA 5C8YA 1AZSC 1KI2A 3ZE6A 4P0PB 5KOIA 4YCDA 4D82A 2B4TO 4KLRA 4RV5A 4E46A 2VDWB 3ZCRA 1NOKA 5EZ5A 5CR9A 2IE0A 2NSDA 4D4IA 2C9MA 3O9VA 5T7BA 1PK7A 1PJTA 4J0IA 3H8SA 2HIAA 5DN6A 2FQ1A 3I6MA 4GLLA 4P31A 1NLZA 1E2LA 1YZLA 1NHGA 5J5VA 4PYNA 1UOOA 3SC3A 5BV1A 1RJEA 1GA6A 2VTBB 1SXHA 2YOGA 2I8CA 3IPAA 4OGKA 4BGUA 3KPWA 5JAIA 3O8RA 3G7UA 4KYVA 1Y63A 2WKRA 4C78A 4RXTA 2JIBA 2QVGA 2TMKA 2X8LA 3FCEA 5BV7A 2YC4C 1M1YE 1WUTA 4YEDA 5DMHA 1GPJA 1BG6A 1VB5A 3M9XA 1M9NA 3TPFA 4RHXA 8OHMA 5JR3A 3R76A 5JSKA 3FBWA 1P6UA 5EZQA 2DOKA 2Q5EA 3TJRA 4HOYA 2F48A 5FBRB 4GSKA 1PWXA 3HTXA 1PAUA 3DM9B 3HEBA 1Q7BA 2RHHA 2NTVA 2V5AA 3D6MA 1JJIA 3GJYA 3VDXA 4C4SA 2J0QA 2R47A 4BWGA 3ZCSA 1CNEA 2AFIB 2GJSA 5I4IA 4MCHA 721PA 2OO7A 2P5YA 4EDHA 4LQ4A 3AM1A 4CXMA 1JA9A 3GP5A 4JLPA 3ONFA 1M5UA 4KE6A 4CM4A 2I7TA 2NVUA 1PBNA 2CFTA 4C7BA 5I7FA 2VJKA 3FGOA 3VU0A 4PRKA 5LP6C 1EDZA 1CEYA 1AQUA 2MSKA 3E9CA 5K0FA 5E8JA 4F93B 5KYWB 3VSAA 4U6QA 3EW7A 1C8VB 2CFSA 3OE4A 4MA0A 1JDVA 3TYXA 3DBLA 5HILA 3VOAA 1KWGA 2O6LA 1F6DA 4I66A 2D59A 2D7CA 2FKAA 3D3JA 3DYVA 4Q3BA 1NMSA 1H94A 4J4BA 3M6LA 4DSNA 3MTEA 1LDBA 2H1CA 3O3MB 4TUYA 5AVUA 1N2ZA 4QRHA 4EITA 1CFZA 4R3UC 4F1KA 5KNDH 2FQQA 3DW1X 1WOMA 3H04A 3RO7A 2FV8A 2GJAA 2JCSA 3A2NA 2ECQA 1U6KA 3T3IA 5L45A 3RE1A 4EH1A 1LKZA 2GI4A 3T5MA 5KIAA 2VRCD 5IK2A 3CC8A 4EX6A 1TM2A 1Z5PA 5L6MB 1HE5A 2DPGA 4JJIA 4AP6A 1IN1A 2WIAA 4PVDA 1MB9A 3PTLA 3KG2A 4B17A 1M8JA 4D6XA 1GDHA 2H92A 1JZSA 2PX8A 5IJ0A 3CPHA 1WPRA 4NCBA 4BS9A 3HDTA 5BORA 3SKVA 1B6GA 1O87A 3Q72A 1KDPA 1R5BA 5K3FB 2R84A 2EX0A 2JIQA 4F3TA 3GFQA 3VU9B 5NULA 3ET4A 1CZKA 1I2BA 1FVOA 1I51A 1PJCA 2I6FA 4IGIA 3UC5A 3WNCA 5B36A 1TZMA 3I2IA 1BYIA 4RM3A 5BVHB 1OFUA 1XNQB 3HU1A 1ZYUA 1VI5A 1XCOA 3C6QA 3OTIA 3Q9LA 4QL3A 5B58T 3UFBA 5CFMA 1I13A <