3GRCA

Crystal structure of a sensor protein from polaromonas sp. js666
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
125
structure length
125
Chain Sequence
PRPRILICEDDPDIARLLNLMLEKGGFDSDMVHSAAQALEQVARRPYAAMTVDLNLPDQDGVSLIRALRRDSRTRDLAIVVVSANAREGELEFNSQPLAVSTWLEKPIDENLLILSLHRAIDNMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a sensor protein from Polaromonas sp. JS666
rcsb
source organism Polaromonas sp. js666
molecule tags Transferase
molecule keywords Sensor protein, Kinase
total genus 41
structure length 125
sequence length 125
chains with identical sequence B, C, D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3grcA00
2MSLA 1RZRD 3MA0A 3L49A 3LUCA 1KRXA 3KKEA 3SQNA 4PICA 1ZH4A 5EWMA 4L85A 3KYIB 7ABPA 3C3MA 2P9HA 5FWYA 4N03A 1K68A 1M2FA 4LE2A 4N47A 1ZN2A 4DQDA 5HSGA 4TN5A 4RXUA 5FBHA 2HQOA 1P8AA 1JF8A 4KNYA 3DLBA 4RS3A 4HNRA 3OM1A 3ILHA 4KZKA 4D74A 4MR8A 1NXWA 4RY8A 4QPJC 2IPNA 1YTUA 5TPZA 1EAYA 2I6FA 3JVIA 2FMKA 2R25B 5TPWB 1Z26A 3LUGA 3OLZA 3LUDA 4S05A 1U8TA 5DTEA 1D1QA 5EWMB 1FSPA 2PUBA 1YIOA 3K4HA 1QKKA 1RXEA 2E4UA 3NHZA 3HXMA 4TLLB 4EVSA 1DBQA 4RKRA 4EVRA 2PUGA 2PUCA 2LUOA 2A9QA 2A9PA 4G0YA 4KV7A 2JVJA 4MAAA 3CRNA 3TX6A 2R47A 1Z2DA 2PMCA 3Q9SA 2TMYA 3KCNA 1ISSA 3C97A 1USKA 3H6HA 4WT7A 4RK0A 1L5ZA 3M6MD 4RWEA 4JAVC 4G97A 1OXBB 4YO7A 3CKMA 3OQOA 5C5EA 3CHYA 3CFYA 1EFAA 3QX9A 2WJAA 3MYYA 4MR8B 3C3KA 4YLEA 4Z0NA 3OO0A 3RVQA 1W9HA 2HJ9A 5EWLB 4F06A 1GUDA 1BVHA 4W5NA 4IILA 5TQ0B 1TM2A 3LTEA 3F6PA 4N41A 2B4AA 3RQIA 5KQMA 4Y9TA 1JFSA 3Q7SA 4CBVA 1QP7A 1FQWA 4ETNA 3RVSA 1KGSA 2JVIA 4E7OA 4ZMRA 4NQRA 5CNMA 5HQJA 2MYNA 3UK0A 3HK2A 2JK1A 2H3HA 2M98A 2E4XA 2JRLA 5IBQA 4MS4B 1JH9A 4NCAA 2WY2D 4IF4A 2FQYA 4Z4CA 3CZ5A 3IP9A 4RZSA 3HM9A 2XDYA 3O2SB 4RY0A 1P2FA 2L18A 3OQNA 4XARA 4MQEA 1AB5A 1ABEA 2WMYA 5JNUA 3L6UA 1D1PA 2PL9A 4MS3B 3G85A 4G0QA 3A3KA 3CZCA 3HUTA 1RXIA 2FLKA 8ABPA 1GCGA 3GYBA 5DCLA 4MQFB 1JYFA 3DLHA 1VKRA 3SNKA 1W25A 3QLTA 4EY3A 2CHFA 3OMXA 1QO0D 5IUKC 1I3CA 3JTEA 3SAJA 3EQ2A 3VNAA 5JNRA 3SM9A 2R4QA 1ZESA 4RV5A 2DRIA 3ILYA 2H0AA 5IC5A 4W5OA 4RK7A 1YS6A 4Z9AA 4EGSA 4KQCA 1JLKA 3F7NA 5FWYB 2FN8A 2PAFA 3HUUA 3KS9A 3N0XA 1E6MA 1DJMA 3KTOA 3OO1A 1JHZA 2QXYA 4GNRA 4QICA 5JNSA 4E7PA 3JPWA 1Z2EA 2GKGA 1ZITA 4N0QA 4P1ZA 3RH0A 2MYPA 4F12A 1QP0A 4IMIB 5D2CA 4F11A 2L2QA 5GOTA 3O2JA 1APBA 5TPWA 4JOQA 4FE4A 5ED4A 1A2OA 2QV0A 4DN6A 3BILA 4KVFA 1Z18A 2CD7A 1PHRA 2PLNA 4RK1A 3P9YA 3QLUA 4Z9BA 5GQSA 4PZ0A 3UUGA 4JA2A 3F6CA 4HNQA 1DBWA 1NY5A 4N76A 3FFXA 2QW1A 2W42A 3OMWA 4FB4A 1YMUA 3RVOA 3RVRA 4YP9A 3LUHA 3H5IA 1PEAA 3KLOA 2FMHA 2LPMA 1NXXA 1A0OA 1AB6A 4G0XA 4YV7A 1JBEA 1NXOA 2WJWA 3HS3A 4EUKA 4KPYA 1Z25A 3BREA 3FFTA 4UHKA 3OLYA 1DCFA 1VLZA 3KHTA 4MR9B 3EDCA 3RVKA 3CU5A 3Q7RA 4PE5B 3HJFA 2JBAB 1LJUA 4LDZA 2FKAA 2Q5CA 4KFCA 4H3HB 2PUAA 2QU7A 4EYKA 2E4WA 5BRAA 3EAFA 6ABPA 1SXGA 1DBPA 3EJWA 3D02A 1MVOA 3H1GA 3M9WA 3O2QB 2RGYA 3A0UA 4RY9A 1TJYA 4OG2A 3HSYA 3I09A 4IGAA 4OLBA 1VRVA 5FWXB 3OM0A 4EYGA 1R8JA 1USIA 3H75A 1ABFA 2FMIA 3QK7A 1HEYA 2PJUA 3QLUC 4Q6WA 1E2BA 2IYNA 1DCKA 2PE5A 4NICA 1QQAA 2WB4A 3OLVA 3FMVA 3O1HB 3D8UA 3H5VA 4KQ9A 2RJNA 4ZYLA 4EYQA 1RPJA 3CG0A 1VPWA 4Z4IA 4Z4EA 3EULA 2OQRA 2QZJA 3G1WA 4MYRA 3LUAA 2FEKA 1GCAA 2QSJA 4WZZA 3E3MA 4F3TA 1XHEA 4O5AA 3H5WA 3GT7A 3O1IC 1YMVA 3NNNA 4M88A 2NZUG 1SXHA 2P4UA 1TLFA 4MQFA 3LOPA 5IUNC 1T34A 4RKQA 4PYRA 3H5OA 2FQWA 1EWTA 2VUIB 1Z13A 3SY8A 4P98A 3LUKA 3F73A 2LBPA 2FW0A 1KRWA 1M5TA 4Z4FA 1BAPA 3EQZA 1DG9A 1YVUA 3EODA 3Q41A 4LZLA 3QEMB 3DZDA 3HDGA 4PEVA 2JCGA 2E4YA 4D6YA 3IPCA 1YK0A 4MR9A 3I45A 5IX8A 4RSMA 1NXTA 3GRCA 2JB9A 1B00A 4XLTA 4RXTA 4KRFA 4LDAA 4MLCA 3HZHA 3O74A 2FMFA 2QVGA 5ABPA 2N9UA 4YRZA 2M1ZA 4MS1B 3T8YA 3LMKA 1P6QA 3C3WA 4Z4HA 1XWWA 3JVDA 3IP7A 4KK3A 5BQ3A 3CLKA 4OBBA 2V0NA 1QMPA 4ZPJA 4WXEA 3NBMA 4D6XA 1M2EA 1JL3A 3KJXA 3QEKA 5KWSA 2L19A 3QELB 5HM6A 2NT3A 2MYUA 1ZHHA 4EVQA 2ZWMA 3M9XA 2FEWB 3LUJA 4LE1A 4MRMB 1YS7A 4OATA 1PEYA 1ZGGA 3ROFA 2VUHB 1MAVA 1JFVA 2IPMA 9ABPA 3GV0A 5CNIA 4H3KB 1U2PA 4LE0A 3O75A 4IRXA 4XFKA 1EWVA 4LX8A 3HVRA 4RK6A 3H1FA 3IP5A 4W5RA 1UDRA 3H1EA 4G0MA 2NZVG 3RVPA 1E6LA 1JYEA 2B1JA 1DC8A 2NUBA 4Q6BA 3IP6A 1Y1LA 4MR7B 4YS6A 2RDMA 4Q7EA 5B3JA 2FQXA 4N0PA 5TE9A 2E4VA 1BDIA 1Z15A 2NT4A 2RJOA 1CYEA 1F51E 4KREA 4MLDA 1BDJA 1Z16A 2GI4A 2LP4Y 3BRSA 3QLVC 4JB0A 5DLEA 4F8JA 1QO0A 1TMYA 1ZGZA 2FXIA 3B2NA 2GBPA 3Q7TA 1MIHA 3HV2A 4QYWA 4B09A 5IUJC 3BRQA 2WWVD 5FWXA 5KI6A 1ZAYA 3OLWA 4NCBA 1WETA 1H9CA 5I4CA 5JNWA 3LKBA 5HKOA 2CWDA 3LFTA 4MS3A 3TMYA 1NXSA 4KK4A 1LJLA 3RVJA 3HEBA 1CHNA 4ETMA 2FTKE 5CHYA 1DCMA 4W5QA 2L17A 2ZAYA 3TB6A 1U2QA 5DKFA 5F64A 5C5CA 4Z4GA 3KG2A 4TLMB 1FFWA 2F8SA 2IKSA 4JB2A 1A04A 1NXVA 4MR7A 4YR7A 5TQ2B 1NXPA 5JNVA 5JS1A 2PUFA 2BGGA 1DRKA 5TQ0A 5KC9A 3GL9A 3LKVA 4IMJB 2YHAA 2AYZA 4MPTA 1F4VA 5KQGA 1ZVVA 1RZRA 4O1HA 1ZH2A 4YCSA 1EHCA 5DGCA 4L4UA 2CHEA 2OENG 5CNJA 3MQ4A 3N8IA 5JNTA 4WXMA 2HQBA 2A9OA 1U0SY 1FFGA 2QVCA 2PL1A 3CTPA 1URPA 1GLGA 3LUFA 3DGEC 3GWGA 1NATA 2E4ZA 3EGCA 6CHYA 5JS2A 2MSKA 3TO5A 4ETIA 1C0EA 4UHJA 4G86A 1ISRA 1SD5A 3O1JC 1JX6A 4G0ZA 2IPAB 5CNKA 4ZJPA 1DZ3A 3KYJB 1NTRA 2PKXA 3IPAA 3NNDA 3A0RB 4LRQA 1MB3A 1K66A 1Z17A 4TMYA 3RVMA 3T38A 1QQBA 1GUBA 3NHMA 4O1IA 3W9SA 3UKJA 3O21A 4EYOA 3E61A 3TD9A 5BR1A 3GA5A 4JP1A 5EWJB 3FGZA 2PUEA 3VNBA 1PNRA 3RVLA 2FN9A 5T7BA 3JS5A 3MMNA 1BA2A 4OLAA 4YWHA 4RXMA 3OQMA 1IIBA 2FVYA 3H6GA 3S99A 1LBHA 4RDCA 2FLWA 3CS3A 1PUXA 1DRJA 4HYEA 2JBAA 1RNLA 2HSGA 5IEJA 5FBKA 3KLNA 1D2AA 4KMRA 4MQEB 4RK4A 4RU1A 1CEYA 5B3JC 5T3YA 3FFWA 3HCWA 2O20A 4G0PA 2IOYA 3HO1A 3DGFC 2YHBA 2ID9A 3N6VA 2ID7A 3KSMA 4OTZA 4Z99A 2IPLA 3H5LA 3MIZA 1MB0A 3I5AA 1PNTA 3JY6A 5TPZD 3ROTA 4ZMSA 1JWLA 5EWJA 2LIVA 3MF4A 1M5UA 3NNSA 1P6UA 5TQJA 4G0OA 3DBIA 4WWHA 1QP4A 2GWRA 5E3JA 1Z12A 2JVKA 2FEPA 4XASA 2QR3A 3QEMA 4RK5A 3SG0A 3RVNA 1SRRA 1DP4A 1TVMA 4H60A 3GBPA 3T6KA 4FE7A 1J56A 4GPAA 5PNTA 3R0JA 1FFSA 2MSWA 3N53A 1L5YA 1E6KA 1QPZA 3A10A 2PUDA 2R48A 3T95A 2WRZA 5KC8A 2A9RA 4W5TA 3QLVA 3BBLA 3Q15C 4JASB 4YGXB 1OXKB 1D4ZA 1JDNA 3HDVA 1ZDMA 2F8TA 2IDMA 3CG4A 5KQPA 3GBVA 4S04A 3N75A 4WUTA 2FSPA 1USGA 2VK2A 1QNLA 4MS1A 1XHFA 1JFTA 2GX6A 4DADA 2MYTA 4XAQA 3K9CA 1SXIA 4XXHA 3URMA 2HPHA 2VYCA 1EWKA 1ZY2A 4MS4A 2KYRA 3H5TA 3QELA 3OLXA 4QYMA 1BDHA 5IULC 2HQRA 4MRMA 1KMIY 3C6QA 1LK0A 4MGEA 1YK1A 4NV3A 2J48A 1D5WA 2AYXA 3N0RA 5BRJA 3I42A 5IEBA 3N0WA 1DC7A 1U04A 5EWLA 3FDFA 1JDPA 1S8NA 3IDOA 2X7XA 3MM4A 4HNSA 4ML3A 1LBIA 3CNBA 1C4WA 5TQ2A 5KQLA 3JPYA 3QX8A
chains in the Genus database with same CATH superfamily
1ESZA 2V0GA 4KVGA 1UPTA 2O2GA 2O2JA 4NEGA 5E9JA 5CLGA 2ODPA 1XN4A 2JFPA 2PA0A 2QPLA 3D7NA 3EGXB 3KXKA 1GL9B 2VNHA 1PTKA 2IZ7A 3JSAA 4NDAA 3RBXA 4KXWA 5IS2A 2C2XA 4PYJA 5FTKA 1GSAA 1IHYA 5JWOA 2JGDB 4N01A 3DPSA 5G0TA 1M2FA 2D7JA 1EFRA 1KY3A 1NAHA 3EY9A 5DHAA 4PYNA 4DQDA 3H2KA 1NOIA 3ISTA 4G0WA 4KTVE 4PGHA 3QBTA 4B3GA 3LOUA 5HRUA 3JYQA 4PHFA 2Q7OE 3K1AA 1ZSVA 4NU8X 1CX9B 1EVYA 5LM3A 1OXSC 1AN9A 1WE2A 5DI3A 1DAGA 1H2HA 3A4IA 3V6LA 4DC9A 4W8GA 3CUUA 3L7BA 1MGPA 3VR4A 4BFXA 3AHDA 4MPDA 4L8VA 3OZXA 3PJDA 4HSEA 2XQJA 3PNVA 1A2QA 3MGCA 1KDTA 2GEVA 2HDWA 3O83A 4S3MA 3RYFA 1Y3IA 2ZIGA 4O8ZA 2I6XA 5HJEA 2YJZA 1WO8A 3EXIA 1E77A 1V8BA 3G0OA 1RZ3A 3BCHA 1WXXA 2C99A 2W2KA 4GRDA 4IXNA 4RADA 3TLEA 1J6UA 1AK1A 1M7HA 1U11A 2XNKA 1MX3A 1YDMA 2E4UA 1F2UB 5ESRA 5F98A 1Z0DA 2DUWA 3QWAA 4JL5A 3WIEA 1IRXA 4HDRA 2SHKA 4X6LA 1LRKA 3FX2A 5CFPA 2YN2A 2JVJA 3C6KA 1R6DA 4ZRNA 5CYOA 4POOA 2I91A 2JS7A 2FMTA 4QGFA 3OWOA 2X0EA 4AJKA 5B5SA 3KZKA 3TECE 2WUEA 1L5ZA 1LSJA 1NZDA 2NAFA 2JGAA 3AQIA 3F2VA 1GPH1 1AS3A 2O50A 2QIPA 1DAKA 1YL5A 3WQRA 4HJRA 4MJ3A 4OAPA 2E6UX 2QMOA 1XTSA 4YLEA 3KWFA 1A97A 2DFLA 1WVMA 1TJ3A 1YTLA 3PIRA 2F48A 4HSGA 4KQ2A 1KP2A 1LDMA 1LPNA 1YUMA 2W48A 4QYXA 2R86A 1NBEA 3VZSA 1V8PA 3HKCA 1UBMS 1BS2A 1XZGA 3CEAA 5DW3A 1KEVA 2W4IA 4E5PA 5B7GA 3MCAA 3NEAA 4XR4A 1GSHA 5TMBA 1OV6A 3D9QX 3DTVD 3UG7A 3VR4D 4MVJP 1EB9A 4K5QA 1IN8A 2Z56A 2H2FA 3Q3IA 5B1IA 1XEFA 4DLWA 1U7WA 1U80A 1XHLA 3WNQA 2JFYA 1X8JA 1ZM7A 3MW8A 3U1TA 4Z9YA 2P3OA 1DEHA 1HORA 3NBQA 1VSTA 5JJBA 3PRHA 3DV0B 1AN0A 4GOKA 1JQDA 2WY2D 4II3A 3AUTA 5DBFA 3ZLTA 3KJQA 1PFVA 2FRXA 5B7NA 2CMDA 4KE9A 2ZWAA 1G2PA 2OV1A 5ECYA 1KHHA 5FLXA 1M9NA 2PSHA 5AW9A 4ZHQA 2I6TA 5CTJA 4B5KA 8ABPA 3MSXA 4Q24A 1VE6A 2BI4A 4QTUB 1PZGA 3SEZA 2OVFA 4DWJA 2QTRA 2CVQA 4H6VA 2RI6A 3OMXA 3T1YB 3AL2A 4JOSA 4QNMA 2VKTA 3EQ2A 1V7ZA 4BU1A 4OPMA 3NKLA 3O4HA 2XJ4A 3REFA 2CEAA 2OK7A 4R31A 2YXNA 5FA6A 5J2TF 5IC5A 2NO7A 4XM1A 5J9FA 1N7IA 2W6JA 3F96A 5K3FA 4EYSA 5C32A 2Z58A 4QUKA 3REQB 4JC0A 3MK31 1NMQA 2GO1A 4LZNA 4BP1A 3KU1A 5HBGA 1Y1SA 2Q1YA 3THYA 4LY0A 2Q8PA 4RKEA 1GRCA 4LRTB 3V2GA 4M9CA 4YLYA 4F45A 8ADHA 2ZSUA 4IX1A 4FB5A 2R84A 3N8DA 4GDMA 4I9NA 4HTFA 3AKEA 2ET6A 5I7WA 3Q88A 1K4MA 1RBMA 3G2NA 5ALNA 5KAPA 2NP6A 1IC6A 5LKRA 4W8HA 2FHSA 3P27A 2FWNA 2VWHA 4WD3A 2VTBA 1SD2A 2UXBB 3VOBA 4IOMA 4D45A 5K9ZA 4B9AA 3G8YA 4KWCA 2B78A 2VPXA 4EUSA 3THWA 3JYOA 1D07A 4YP7A 3S1AB 2O8BB 3S7ZA 4B3MB 3O47A 1VJDA 3P4YA 3U3OA 1JHMA 5DBHX 2DR3A 2FOIA 4J2TA 4LHSA 1DBWA 2DFVA 5E4YA 3IHWA 3Q3VA 2RGNA 3KE9A 2ISQA 4RKYA 2YQ4A 2YFYA 4WH0A 4J9UE 2P8JA 2VDWA 3HQ4O 3KLOA 2FMHA 4ER7A 1PJLA 5BR4A 1SKMA 3DA8A 2GPYA 3QFSA 1MT0A 1J8MF 1T8PA 5CUQA 2H1LA 3QFCA 4DV0B 1CXZA 4S24A 2PTGA 4L4XA 3U3RA 1RWBA 2RGAA 4YAWA 5CLFA 3OEEA 3BIFA 1Q1BA 2NM0A 3F9IA 1CS0A 3HJFA 3FNHA 3S2GA 3G8CA 3L0ZA 4I9FA 2A33A 1P0PA 1LJUA 1HRKA 3J7TA 1C4KA 4UE3S 2Y0DA 3UN1A 2DTEA 2Q3CA 3LYLA 1XRNA 3L8YA 3PRJA 2C78A 4HC4A 3AB3A 3O82A 1AGYA 5JAHA 5ITZB 3DYIA 4MV7A 3FSJX 2K7ZA 4AP9A 3H1GA 3D02A 1YJ8A 4EW3A 4JXJA 2CLIB 3M9LA 4N6NA 4OP3A 3WRWA 1TJYA 4RZ3A 2OD2A 2XTNA 3IBYA 4WNAA 4NFSA 3PTAA 3O5AA 5AKIA 5ES3A 3HJGA 1WUIS 2VRWA 3AQ4A 4IO1A 1P1HA 3W7VA 5BURA 5DLDA 1KMHA 3MMSA 1NSYA 2QXUA 3AK4A 3MTBA 1N2CB 3PUWA 5IMBA 3QVSA 4JOBA 4JXKA 4LCBA 4RDIA 4YVFA 3KLBA 2B35A 4EYQA 3Q3CA 3QGMA 1BFKA 1YHYA 1LXCA 3UXYA 1VPWA 1K06A 4C6TA 1PQYA 1Y9DA 2CB9A 5EMNA 3H18A 2JD1A 1QTNA 4BNDB 1U7DA 1GCAA 2BVNA 3SHVA 2YHIB 5JY6A 5B55A 1PQUA 4M98A 2V96A 3IO5A 3PPYA 1OWLA 1L7OA 4EP1A 4LJRA 3KYCB 3EBLA 3OZSA 3WLOA 2FZLA 4G24A 1TEZA 3KYBA 4R68A 1A9PA 4ZWNA 1T34A 1TM7E 4L78A 3LPMA 4GPEA 4C21A 3I72A 4EJ0A 4I2VA 4KQGA 5JECA 5JDIA 4UHEA 1JLLA 3OCYA 2OB1A 1Q7CA 4I2NA 2FW0A 1GCOA 1M5TA 4C3OB 1E7SA 4B0OA 3ITNA 3KOYA 1GZHB 3EOZA 4F9FA 3TTYA 3FVRA 1ACLA 4MPPA 4WZBE 5G1PA 2Q9CA 2PRIA 1D0SA 1H3FA 5ALLA 5KO2A 1TPYA 2AD5A 4DG8A 2DKNA 1HLPA 4QJ5A 1RHUA 1Y3CE 3DZDA 1ZS9A 3DBVO 3VSDA 3W8RA 2O05A 5FF9A 2XV1A 3OPMA 4IJVA 4HDQB 4BASA 3DKPA 2A4MA 1XTJA 1MV8A 1YHNA 4CKXA 5LIRA 2BE9A 5AOAA 2C84A 4O4LF 4RXTA 4BRWA 1WKBA 1O0SA 2R62A 3HYLA 3INYA 4MLCA 2QX6A 4XPIB 3OIUA 4OQDA 4TRNA 3VKVA 6REQA 1T9KA 3UMBA 2XD4A 3V6MA 2R65A 5KOJB 3QWBA 5LBUA 4DIEA 1P2GA 4OX9B 3WL5A 1ZAKA 1BHJA 4Y7DA 3PX7A 4B7UA 2Q99A 3KQHA 3AEUA 4JU8A 3OU7A 1KAOA 1AV7A 4ZPJA 1XAHA 4G37A 5DHUA 3GEBA 4DQLA 2QS9A 3HTXA 2QD2A 1N2GA 2JLCA 3NHLA 2NT3A 4PNZA 1UJBA 1PR2A 2OZLB 3T41A 4HVCA 4J1QA 2A0YA 1X1EA 2H63A 3HVUA 4UBMA 4OI1A 5FPKA 5TRTA 1R0CA 5F3DA 1U2PA 4KW7A 4CKEA 2D5IA 3EPKA 3HCAA 3IAEA 2O0LA 4RTSA 1SULA 3LQ1A 4RK6A 4HADA 1OWMA 4W5RA 1AF7A 3DL0A 3F90A 1OX4B 2D00A 5AK6A 3WLSA 3FCXA 1I3KA 3DMFA 3I62A 1RSZA 4JLBA 4DIOA 4U02A 5I7RA 2WV9A 3EIEA 3EMDA 3L2OB 1QDUA 1ZD8A 3IAM6 4IH4A 5CFNA 5SZJA 2YXEA 4I4IA 4QATA 1VMEA 2NT4A 3OJLA 1S5PA 2XZLA 3QLVC 3FPHA 3ISJA 4RZXA 3SC2B 2JAOA 1ZM3A 1RBYA 3KB1A 3KE8A 1P61B 1ZGZA 4NDNE 5AKGA 4B6GA 3MTJA 4LN1A 5E6SA 2KS6A 5IYZF 3ZNPA 3VZQA 4GX1A 4QTTB 3PSAA 3I6IA 3KZXA 1RCUA 2QTZA 4R98A 4C7BA 4DQKA 2AZMA 2WZBA 1E2IA 2H2IA 4ARAA 2V4MA 4XGKA 4XYGA 5EFZA 4HWTA 2MU1A 3EXHC 3MBKA 5HKOA 2JH3A 1FYEA 3U19A 1IY1A 4GT1A 5KOYA 1SHJA 1NVFA 5A02A 4DS3A 3L7OA 3DOEA 2XTZA 3P4XA 2XNHA 3T5TA 2HXYA 1G5HA 2WP8J 1E94E 3BIXA 2VP5A 1AMOA 1WP4A 1B43A 1O96B 5IAAA 3O4RA 3U3MA 3HMQA 4A7PA 1O9BA 2W2TA 1A04A 1NXVA 4UUOA 3VZPA 3MB5A 1W87A 4D99A 1OTYA 5TQ0A 2IH2A 1II8B 2ONKA 2Q5EA 1NMEA 3L0OA 3ZY3A 3FXAA 4MUYA 2W2XA 2ZBVA 2ZRQA 4WXHA 3GZTB 1KMNA 4AS2A 3B6IA 4TZ0A 1T3LA 1WCXA 3ZVLA 5A2GA 1QJCA 4LC9A 1MRZA 1SWVA 2PD4A 1KEUA 4ETWA 1H2XA 3K16A 1B4DA 2X4DA 4BO0A 4NG5A 5C4GB 3VYVA 1D6MA 1O7JA 1J1ZA 4HRYA 4F6CA 5JMPA 3C8ZA 4BQNA 2WLSA 2DETA 3G5MA 4RHXA 3AW9A 1OYYA 3CY6A 1JQKA 2FW6A 3PKJA 3QE3A 4TMZA 3SJ7A 1DO0A 1S8OA 2PVCA 2W0MA 1KYIA 5E1DA 2I03A 5JZ9A 3L1KA 1ID1A 3O3NB 4TKZA 4Y2YA 1E58A 4UNSA 1C0EA 2E5FA 2PH5A 2ZKLA 2P1RA 4PO8A 1XU7A 1NJ1A 1RAGA 2CCGA 1YFZA 2YTZA 2GFIA 5CP8A 4QSHA 1DUIA 2BR3A 3W1WA 4LXIA 2CGEA 1XCJA 1IAVA 4UDOA 4JVLA 1OE0A 1VL2A 4BV3A 3VJRA 4ZJPA 3BA1A 1NTRA 4ZT7A 3ELWA 1Z17A 3OPNA 4DL9A 1X1BA 2X9GA 3MTGA 3P0HA 4JJ6A 5DB4A 5CDYA 2BBSA 4TMKA 2I1LA 1H1LB 3ILVA 4BNYA 3CZPA 4R4JA 4QPZA 2AE2A 1WDWB 1D03A 2PBLA 4KGZA 4ASUD 4BFZA 4DMMA 5DYWA 2Z4RA 4KMSA 4BV2A 5CFQA 3QM1A 1LK7A 2GDJA 2HBYA 3OQ1A 4O08A 4RYLA 4BP8A 2FZGA 4D4LA 5JSFA 2CXOA 1PUXA 1R10A 2Z09A 3QU9A 4IM7A 1A5SB 4IWXA 4NE7A 3ZGOA 1AKEA 2ECKA 3A6KA 1EG7A 2C5BA 1H6AA 1XXHB 4KQMA 4ESHA 3IE0A 4AFNA 2ZYWX 2V74B 3A36A 4KVZA 1FSGA 2QVLA 1OYWA 2OYCA 2FDXA 3ON5A 5B3JC 4MQLA 4KWHA 2O20A 3HO1A 1UP7A 4AN0A 1WHTA 2X8WA 1LI4A 5KTSA 5I7SA 4XI9A 1RZUA 3AXTA 3I8OA 4HWSA 3A6EA 1KK2A 4TYNA 3P7MA 6GPBA 1W5SA 4QDTA 2I9PA 1N1DA 3FR7A 3SZOA 4Z3KA 4TQ9A 1XB2A 1I2AA 1MAUA 1QCCA 3C5CA 2RGXA 4CIWA 2GM5A 3E5NA 1QR6A 2YY7A 4GRAA 2AOUB 3GAMA 1V1MA 4ABYA 4HATA 2AFIA 3MT7A 1SWWA 1Z4JA 3NZEA 4XWYA 3IRUA 5BYKA 3IURA 3DEZA 4A03A 3AI7A 1H2EA 3M49A 4AF8A 1Q0TA 1LCIA 4HUQB 1E6KA 2Q2OA 3HUEA 1F20A 4LY3A 2WV7A 2NTVA 3AKYA 5U9CA 2JLZA 5L8VA 1K4KA 1T4GA 3LH5A 1OXKB 2YMLA 1ZEJA 3ZW7A 3BMXA 3CSSA 4PQRA 5D85A 2EKQA 2X58A 3GWZA 3WGTA 3L1UA 4AJNA 1L0BA 5CYGA 4I4TA 5EP2A 1ZHOA 2VK2A 4Y6SA 3VPSA 1PYGA 2X1HA 2NYAA 2RHLA 3BH6A 2VDMB 2OOSA 1Y5IA 1Q57A 2ZGVA 2ZRJA 3BRWD 1CQXA 1H1LA 2ZS7A 3IJRA 4Y6OA 2I3ZA 5ADHA 4UNNA 3JQAB 3RUCA 1E9RA 1V5WA 1R16A 1VB5A 3DZGA 1NRWA 1Y3AA 2GZMA 4BYGA 1UPFA 1O97D 4EENA 3HBAA 1VMKA 3PP8A 4J76A 3BJRA 4IINA 3D3WA 3OAAA 2TMDA 2AFHA 1BWSA 3T3DA 3QF4B 5JSUA 4EEKA 1M6HA 2HQRA 4JI2B 1P9NA 3ICOA 2O19A 2ZM5A 2VYVD 2PNJA 4CV3A 1UT6A 2XSZA 3FPKA 1GGKA 1TTTA 4L9RA 1OFUA 3WKBA 4F60A 1XQ9A 1XZHA 2Q07A 3OA0A 4DIKA 5IZCC 2FPOA 4AUEA 1MJHA 4HP8A 5EZYF 4Z1MD 1ACJA 4QFMA 5KQLA 3W9BA 1KK3A 5JD5A 1TO6A 3K31A 4GI3A 1VHJA 5H4GA 1KTIA 1PJBA 2V7UA 2WAOA 2EP7A 2XT0A 3AUYA 4FNGA 3DAPA 2JIOA 4RM3A 4TWIA 3C85A 5EWMA 5FI3A 1KQGA 1CJUC 2Y93A 1XTUA 2C8JA 2IEDA 1H2RS 3FBWA 4IOLA 1M1NA 4Y1RB 3E2PA 1Z2PX 2QOEA 4JI7B 3QE4A 1ZCBA 1JKMA 2GN6A 2XJ9A 3KTAA 3NC4A 4TQAA 3ZQ4A 1RC0A 4DSOA 3BD9A 1MMFB 4JP2A 1S2OA 2QRQA 4M22A 1F7VA 1V3VA 1ENYA 2OV2A 5JAZA 2XYVA 3H2YA 2CHVA 4UNPA 1E20A 1NXWA 3A11A 4HUQA 2BT4A 2YOFA 4DIUA 1HMYA 2V6BA 5TPZA 3C5VA 2OHFA 3B9RA 3JVEA 4NFLA 1W75A 4TZKA 1QG2A 3E8SA 1XBTA 2H9IA 4GQBA 3BS4A 4KIFA 4M76B 3SM3A 1CZNA 4O63O 3T35A 2DFNA 1XTRA 4FFWA 2IYYA 4Y7CA 1NVGA 2X0JA 1EBBA 2ZW9A 2QSYA 3FMIA 3WDMA 3RADC 3P9KA 1XPRA 1YB5A 4LXHA 3T5CA 2XUGA 3ZUPA 2WYVA 2XOKA 4BWVA 4TLLB 1M2KA 1NBMD 2CCJA 4X3CA 5IF9A 3MINA 2WJJA 2WVHA 4RKRA 1FIUA 1XNQB 4F3NA 1GDHA 3LZCA 2A9QA 1Z6GA 3BWVA 3KKOA 3P9XA 2V97A 1CRQA 4Z86A 1WB5A 4LK3A 3NFRA 1YR6A 4CMIA 5KS2A 3TRHA 1D0VA 1ODJA 1HKUA 2VAXA 3QI7A 2AEMA 1HT0A 4UD6A 2XDQB 1WD5A 4WW0A 3DHWC 4LTDA 3H83A 2AFHB 4FS8A 1ADYA 2HLPA 4V3BA 2GEUA 4D3FA 2NUTA 3A1SA 2PKEA 1YS9A 1M54A 1FYFA 3D3QA 4MR8B 1BXZA 2AN4A 4TT3D 5DM0A 4BBZA 4EX7A 8AT1A 2KW5A 5AXAA 3K9NA 1QKJA 3WGHA 3AJAA 2EBFX 3DE2X 2KBEA 1JI3A 5T4FA 5LU8A 4W5NA 5YASA 1G6Q1 3HKCB 2Q0XA 2BTQB 4S0XA 2CXTA 3RS2A 2P5YA 5EPOA 4DMHA 3AJRA 3RQIA 1XMOB 4P7KA 2O59A 4KODA 3NBUA 1NNSA 2BEVB 1JP7A 3RO7A 3VBCA 2IYSA 2C1EA 3ZHXA 3Q3JB 2JVIA 3KQTA 3UMRA 3NLLA 1RJ9B 1HE4A 1V37A 1YOBA 4FDVA 4NQRA 3ZGNA 2JK1A 2XODA 3VSBA 3BB1A 1O08A 4CCYA 5ITWA 3PIIA 3HB4X 2D5BA 1TCVA 4JU9A 4KHZA 2DLNA 3O0TA 4P4LA 1CP2A 5GJBA 1UH5A 2GF9A 1TKCA 2WPNA 3A14A 2GRUA 3PFBA 4LWOA 1P29A 3TSYA 4YCLA 2BFWA 2ZB4A 1HTBA 3PF9A 2B1IA 3Q2OA 1NQWA 1NGSA 3PLNA 4MYSA 2NWQA 3T7SA 2WK1A 2JJMA 4B3JA 2NLOA 3BJEA 3F71A 3BEDA 4G0QA 3R5SA 2R2GA 3UIEA 1QVZA 3FKSA 2O3UA 3Q5DA 1E96A 4DCMA 4KKXB 4NHEA 2HEGA 2QLBA 1Q1GA 2OLKA 3IAS1 5ESDA 2Y27A 2EDCA 3RARA 1UBHS 1E69A 2HNBA 5LQKA 1VSVA 4CTNA 4FYMA 2Z2KA 4MWEA 3TH5A 5CXQA 1RFGE 2SCUB 3I3SR 2F64A 2Q9UA 1K27A 3RUAA 5A0VA 4G8BA 4A6DA 3VBEA 2QSZA 1MG0A 4EJMA 2EZUA 5JFTA 3N74A 1JLKA 3BTSA 3L0YA 1Q7EA 3N0XA 4O6VA 3P26A 2QLTA 3D7MA 3JQFA 3V2HA 1S2MA 2R6AA 1G7TA 4L6IA 1AZTA 3GLFA 1TZMA 2FOLA 3N2IA 3G2IA 4MVYA 3ZQ6A 1KWGA 2RIRA 3N2KA 3ZBPA 5CW2A 2X2OA 3DUFA 3EEFA 1OJ7A 3Q3EA 2DBZA 3THSA 1EFUA 4X54A 1GADO 5TSDA 1H9AA 2CL7X 3AY3A 3NRBA 4L9WA 1XVUA 3KZ1E 4N3BA 2YUIA 1FLVA 3O95A 5ED4A 2PA3A 4W9NC 1DAPA 1YFKA 2ZR8A 3O03A 4AWXA 4AUMA 2O8NA 2PLNA 3ER6A 3R6GA 3T7RA 4NAUA 3AI2A 1C9NA 4FNOA 1BE0A 3FG9A 5CT4A 4D9KA 1T2VA 3ZJVA 3GJZA 1MORA 3NX4A 2Q3EA 1Z8NA 2EEPA 4D57A 1M2NA 3NUQA 1DGQA 4N76A 3DW3X 5ENZA 2QW1A 2BM9A 2ZAMA 2Y67A 1WSWA 2OHIA 3T1TA 1KPIA 3BD7A 3DAFA 2WDZA 2C8LA 2JD2A 2HCBA 2O0MA 3L5KA 3WY9A 4KQHA 5IKXA 4JUFA 3ZCRA 2VDRB 3HLKA 4WQMA 1CCWA 4A0SA 2WIDA 4KP7A 2W6MA 4WLEA 3W7AA 3FFTA 5GVRA 3PEWA 3HGQA 1V8OA 3PGVA 1NM5C 3R0ZA 3RVKA 2NPFA 3BTOA 2AW5A 3AH8A 2D2FA 2RHRA 4OOFA 2Q1TA 3CW8X 3R6TA 5C8DA 3TQFA 2BGLA 2FKAA 1P5RA 4FVTA 4PIPA 5A2QA 1TRKA 3AM1A 2VK1A 4Q4HA 4FOSA 2JEYA 4MIKA 3RREA 3PPIA 1Z88A 4XSGA 4WCFB 2WB2A 1XPOA 3R3YA 4CTMA 4AY5A 2DUNA 1NBWB 2NXWA 4AJ9A 2BEKA 1RRFA 3SNHA 3WJAA 2W00A 5L45A 3JAWA 1U2RA 2VSXA 4HKTA 1AKUA 3MIIA 4OJNA 1L3BA 1SXPA 2Q27A 4JUDX 1USIA 2I1VB 3L5OA 3QK7A 2R6DA 3QLUC 5HXAA 2RD2A 1QIFA 3RFXA 3EQ6A 4TUYB 2G06A 2BFPA 1XL0A 3RKSA 3FMVA 5H68A 1WB6A 2J0UA 3UWSA 4LF4B 3ORYA 3JQBA 1G3MA 4F1WA 1I5EA 3CG0A 4C76A 4HN9A 2YW9A 2OQRA 1RKQA 2IQIA 4DRXB 1D0IA 3WLAA 4CEIB 2FEKA 2V7WA 3MS4A 4E2ZA 4EO9A 1IHOA 4WZZA 3CO5A 1N5LA 2QYTA 2WVAA 4IUDS 4QEDA 5IVDA 1FJGB 2Q5QA 4GMDA 3NWPA 4PYIA 2R7NA 4J0FA 3NP9A 3LDFA 4UW9A 4F9GA 3NNNA 1SUCA 3WJ1A 5AQ1A 2QHXA 1K63A 2MT9A 1O77A 5AI8A 4AT1A 5A9RA 1ORIA 4TRRA 1WEHA 3H5OA 4RTPA 1UPAA 1Z0FA 4OF4A 4U7WA 5BUQA 1Z8DA 3C7DB 2P9GA 1CLEA 1ZMOA 2M1XA 1WW3A 2CVOA 3JWPA 1QU2A 3M6VA 3HPRA 2GYYA 4X1KB 1Z36A 3O3OB 2JI7A 4P54A 1ISMA 2RK6A 2YW2A 2X4IA 1HUQA 3L8DA 4OK3A 1OR8A 2ZTUA 4FDTA 5KNCH 1DFGA 3UMMA 2XMCA 2B4KA 2VQ6A 3F4LA 4ZZ2A 3HR4A 2J09A 1DKUA 1RAAA 2DX7A 4QREA 4YQYA 1KK1A 5BSMA 1QZZA 5HJ7A 1B00A 1JR2A 1ZCAA 3HKBB 4MQMA 4AD8A 1U0RA 5HHTA 5KHLB 1RHJA 4PLZA 5AESA 2OZEA 3OEHA 3R4CA 1XTQA 1BS9A 2QRLA 2ZTMA 4YJ2A 1TM5E 2FJ0A 3NDBB 2AOTB 3IMKA 2C96A 4B6SA 1HG0A 1CDZA 3U4DA 3GGJA 4YRZA 3PE3A 3W05A 4KK3A 4HB3A 3QENA 4IX9A 5J2UF 5GINE 4BUJA 1JSCA 2LTAA 3GEIA 4KYVA 3MTEA 4QFCA 2WF5A 5GADl 1MQ9A 3LA8A 4WXEA 3NBMA 6Q21A 1PGNA 8ATCA 3KXIA 1XTBA 2VRBA 1ZG3A 2OZLA 2ILTA 5G1NA 5KOIA 5EHGA 1Y8CA 1TF2A 1DRUA 1C9MA 1PEYA 2H52A 2Y76A 1GIAA 1P77A 1MAVA 3IHTA 1VDMA 2I6SA 1ZNZA 4NFYA 1VHLA 4PSAA 4YXFA 1XVLA 3EZ2A 4OL9A 2OLJA 3RFTA 5IN4A 1B14A 1L5GB 4UFOA 4FMPA 4AI6A 2VAPA 4GKVA 1EGQA 3I9LA 5G41A 3OPYB 3H1EA 4RH1A 4LXYA 4B33A 2NZVG 4D8YA 3RUIA 6LDHA 1Y6ZA 2NUBA 1UXHA 2PKQP 4W5JA 4R1TA 4UEKA 4LOIA 5GM2A 3GT0A 3GFFA 2PH1A 1BN6A 4C4RA 2C9MA 4HEA6 4Q7EA 1JDUA 1OV4A 5H9WA 4OCZA 1YZVA 2C04A 2EW8A 3T3NA 1L2TA 2YN4A 4KCGA 5K51A 3M82A 3WLJA 4A92A 1BDJA 1E5QA 1Z16A 2NADA 5FL7A 4AIIA 4Q3AA 5CYPA 3W8DA 1TMYA 5C8YA 4LS3A 3UPDA 4EJSC 3THXB 1TK2A 3KVRA 1ZCJA 2XYGA 4F3KA 4C01A 2NVBA 1H93A 5EUQB 4J1TA 1ORRA 3D8HA 2FZ4A 1U7XA 3BRWA 3AVVA 1O2DA 1W85A 1DKRA 1DQRA 2PX0A 4HI0E 4UPDA 5C4IA 1DCTA 4KQJA 4MGHA 3C6YA 3TEJA 3IRVA 1HE8B 1QH0A 4KQKA 1PJ3A 2H4ZA 2O8VA 4XIFA 2WAMA 5F64A 3WGIA 3K0AA 1XNGA 1LZKA 2IXDA 1HF3A 2O07A 4CMEA 2H00A 1FFWA 2W2PA 1FYVA 3CB4A 3DV9A 1JZSA 4GG1A 2Q2WA 4JB2A 3GYGA 3LU1A 2QORA 4KUHA 1EQAA 3RTCA 4MK4A 1PR4A 2FG7C 1A5AB 3DE3X 2RHHA 4EGAA 1E3MA 3I9V1 1T9DA 3DWIA 4EG1A 3OCXA 5K05A 3FM9A 1DDOA 5AVZA 3GA0A 5DGCA 1E62A 2CHEA 2SECE 2AZDA 5JH7A 3PXBA 4EHDA 2PL3A 3RU7A 1BGVA 2I7XA 3DVAA 4BZZA 3DZCA 4H6WA 1QGED 1UMBA 4ID9A 2I9KA 1XD2B 1JIXA 1URPA 2YUTA 2A5GA 3JARA 4EQ6B 2PUHA 1Y8RB 3KAKA 5H1YA 3KB8A 4I46A 1NW5A 3FCSB 5KNDA 2H2WA 1TQ4A 1D4AA 5AJWA 1YDFA 2WIBA 4L7VA 2XT9A 5BYAA 1SD5A 3WDLA 5IFKA 3KV1A 2C5EA 4HAYA 4XB1A 4X91A 4GOOD 3HJUA 2GBIA 1Q3KA 3NNDA 2PKRA 2B25A 3DMPA 3I12A 1JAYA 3LPLA 3LCUA 3O9ZA 1ZQ1A 2GTPA 4WK4B 3SOZA 2WU4A 3VPBA 4E2FA 3FI0A 3MERA 3O21A 2WC1A 3H8JA 5EWJB 1IK4A 5KVSA 5ALIA 1PW5A 3GQBB 5BV2P 3MOSA 3R8FA 1Y9ZA 1HFWA 3GZ4A 3LQKA 1PZNA 2XMQA 3Q1KA 1C9YA 2YWEA 3A32A 3MC1A 1U0HC 3O92A 3JD2A 1J5EB 2J4DA 2P2LA 2W6PA 2W2OA 3CS3A 2IVZA 1Y7HA 2J5RA 3E1KA 5AD1A 4JITA 1HE3A 2HHAA 4R1NA 3RC8A 1YL6A 3TS1A 6PFKA 2IELA 4V2UA 2ID4A 5L3RA 4F1JA 2PX2A 1MHTA 5JG7A 3J7AC 1K8QA 3G0BA 2XIQA 1RU3A 1ZN8A 4R83A 5FUYA 4D92A 3HCWA 2CLKB 1I6WA 1SK8A 1P7YA 1QZ3A 1UPUA 2EYUA 2I3BA 1TTPB 3NAMA 1L5FA 3WYFA 5CB4A 2ZDHA 4MX8A 5B4UA 2OORC 5ERGB 1RRCA 3CPEA 1ODCA 1QE5A 4IDBA 1IG0A 4JX9A 5KYYB 2HNKA 2VLBA 2W6JD 4XCXA 1PL8A 3IDSA 3VSCA 3E1SA 4UTXA 4MKGA 1P6UA 5TQJA 3OZVA 3WK9A 4BOYA 5JROA 1U3VA 4ZVQA 3PFNA 3B36A 5DTIA 1MZPA 2FPIA 1E3JA 3A58B 2VP3A 3SDZA 3Q7PA 3O73A 4XM0A 2RGUA 3SG0A 2C95A 3BK1A 4BVBA 4RENA 1SIWA 3EYWA 1AKRA 1FDIA 3RKRA 2NV0A 5FR1A 2V65A 1X1TA 3FJ1A 4WZBB 4I1VA 3EG9A 1U6KA 4HG2A 2LKCA 4XWOA 2DCMA 3VJMA 2GLXA 1NPTO 4E5VA 5FB3A 1AK2A 3DOHA 2C97A 3W1EA 1NASA 4EX6A 1DWUA 4JI4B 5CVUA 3QLVA 4L51A 3LC0A 2BHRA 1CK4A 4L57A 9LDBA 2DTDA 2JLUA 3OY2A 1T0HB 4IIBA 1L1RA 1WULS 4BAGA 3HDVA 2DQYA 3AB8A 3TNYA 3GHYA 3MNFA 3AU8A 5J47A 5K8IA 1CZHA 1ZCFA 2D54A 2XQIA 4H7HA 1JVSA 3SKVA 3T7IA 1GGEA 4S04A 2GLUA 4DMCA 3IE1A 3PT9A 2OP0A 3TOSA 2CXXA 2HU7A 1GR0A 1L8XA 4FSDA 1EK1A 2OYRA 2PTHA 3TXXA 5EG5A 2B8EA 4RY2A 1ZI6A 2XGGA 2YX1A 3KVNA 2ONJA 4DNOA 7REQB 2A4KA 2ZRGA 5AW3A 4EF6A 10MHA 3URMA 4TLBA 3PC4A 2O8CB 1RWQA 1RKBA 3QOXA 1ZY2A 2VZ0A 4XWTA 1C8LA 1A88A 4GBGA 2PXXA 3A4LA 3S8MA 3D6JA 3UMYA 4XIYA 4V0OA 5K3BA 4EG7A 4H1UA 1IUKA 3PC2A 4HAWA 4F0JA 1ZGHA 1Y37A 1WY5A 1A96A 2W2VA 5GZ3A 3KZCA 4GLBA 1YDGA 4BX0A 4M1OA 5KSPA 1NMYA 1S8NA 2W90A 4HZUA 2JZNA 3IDOA 3NOQA 4HNSA 4QOGA 5CLLA 5TF4A 1LNQA 1RQGA 4C4SA 1P45A 1QR2A 4PYKA 2A0UA 3LKDA 4J4TA 1N1GA 4JP8A 1JDSA 1FMLA 1YCFA 2HREA 4GGOA 2F9FA 3TCKA 5B2FA 1G21A 2HMSA 4UOEA 2WILA 1OB2A 3A3OA 1YZGA 1IXSB 4LJ6A 4AXXA 4C4PA 4TYYA 4OHUA 4P4TA 1IJKA 1V47A 4REQA 1DX4A 2QN7A 3ITDA 4Q1AA 3CLRD 3FCCA 4HQLA 3ZVRA 5GTDA 5HSGA 3BYZA 5LZ5A 2BH9A 5JMOA 4QGBA 2HXSA 1T8UA 3MFYA 2XUJA 2X1LA 2NUPA 3P9SA 2O7NA 3JQAD 4Q7JB 4BMZA 3FCOA 4GDFA 4MYTA 1KI8A 2I22A 3LO8A 3D3EA 3BG5A 2JIPA 4DA7A 3BFVA 3BF7A 3UCXA 3DPIA 3RNLA 1E2LA 3S5UA 4EW2A 1UQRA 3LRTA 4ZEXA 2ONYA 2VHQA 4EW1A 1GGMA 2W22A 3KC2A 3V4OA 2BCGY 2XNDA 3ZCTA 4RTJA 4AY6A 2R25B 1TIKA 2GN2A 3LCMA 2IE8A 1X7WB 3UJ3X 4S05A 4AY4A 5DTEA 2BMEA 4M83A 4U4AA 2ZRAA 3OZFA 1WZEA 2IGTA 1QMGA 1DBQA 1USWA 4UBLA 4ZVLA 2PUCA 2YY5A 1NR5A 4Q4AA 2NZWA 5AM0A 3OJOA 1MPTA 4O0MA 5I01A 1QG4A 5DJ5A 1NSTA 5CEEA 3K0BA 1JFLA 3M6MD 5B6PA 2XMRA 4PPYA 1Q20A 3KSDO 2C3OA 4NZMA 3T54A 4GBED 2JATA 3CHYA 5H3HA 3ESYA 3PUZA 2WJAA 4ZKEA 1UODA 3TW8A 3AHJA 3N2ZB 5LNK6 3BT7A 4J91A 4EPYA 3T4EA 5JARA 5JW6A 1K5HA 3HGMA 1PLLA 2BTQA 5ALPA 1N25A 1TK3A 4TXMA 5HKAA 4MVJG 4HH0A 2ECQA 1K97A 1PWZA 2GN1A 4ND5A 2CFIA 3QYFA 3L7JA 3CXRA 3AGQA 4WDQA 3N2LA 1YD7A 3MT9A 5E4FA 3PUYA 2H3HA 3EGVA 1MQAA 2F1KA 2I87A 2F8LA 4REQB 3TLCA 5FCDA 4MS4B 2I76A 4JK3A 2CLOB 3IB6A 2O48X 2OV4A 4KAAA 2J3DA 1CNFA 3BXPA 3TIVA 2JNWA 5ITSA 3ABRB 1FF9A 3LUBA 3TQOA 5C2JB 3HP4A 4JBGA 3NETA 3JALA 2WMYA 1BG6A 1L4NA 1VG1A 3KEGA 2Q6LA 1VIDA 3N86A 5G4LA 1NBAA 2I1QA 2PL9A 3N8GA 2O7SA 4C04A 2IGBA 5FWDA 2IDJA 3CJQA 5J40A 4M8KA 3FD8A 2ODAA 2B9EA 2OAP1 5EZYB 4QL3A 3FNIA 3TKAA 4RTRA 3SNKA 4AO8A 4QWWA 4WCVA 4JJAA 5F5XA 1AQUA 2C9ZA 5HGJA 3U4GA 2WJVA 1NRIA 1YQUA 3VO1A 3MN1A 2IBTA 1F6WA 1GZ5A 4DR7B 1DV1A 1CQJA 4MA4A 5JASA 1B2RA 4ZO9A 1OAAA 1ZRNA 1V48A 1Y6RA 3UMVA 1YS6A 3PUVA 3QBJA 3HJHA 2O2EA 4EGSA 2H4XA 4C0BA 2F1RA 3M6IA 4K9NA 4M36A 3KSBC 1IWPB 2I2XB 2JD0A 4PC6A 3IKVA 4RE5A 4TL6A 3RSFA 3HUDA 3QYAA 1L5QA 1N57A 3WLRA 4TSKA 4B4VA 1QFJA 2ZSBA 3EH2A 4D2IA 3DQZA 3HA7A 3HCBA 4C43A 2VDOB 5I7UA 2OG1A 3ZK7A 5C5IA 3GF4A 3V1UA 4V0SA 1TM3E 4DOMA 2WUDA 2ZSHA 2BYTA 3L7DA 5CX1B 1QP0A 1E1NA 3AR6A 3H2HA 4QM7A 4OQXA 5AM5A 5JH7F 3C41J 1NUTA 2IYPA 3HDJA 3GLIE 3AF5A 2W93A 1W5EA 2CD7A 1NVVQ 2AA3A 5DSZA 4AZ3B 3FF1A 3VC1A 1N5MA 3I9OA 4R3UC 1A9XB 1BJKA 2OSVA 3JQ8B 4GIBA 2JGDA 4QJIA 1PZHA 3CPHA 4YFYA 3SI7A 3K5WA 4LQDA 4UM9D 4YAEA 4WY8A 3G5TA 5I5GA 1O0BA 4GQAA 3L7KA 3L8CA 3HZZA 2YWCA 3PHBE 1BHO1 1U3UA 4QULA 4XB6B 5DE3A 4EGJA 4DUZB 2L82A 4MB2A 4W9RA 4IHJB 2XVMA 2JC3A 3I9MA 2OHOA 2J6CA 3JWGA 3ORSA 4QVIA 2YZNA 1JKXA 1JA9A 1PR9A 3V2UA 3AR9A 3NHJA 1Z25A 4NZZA 2R8RA 4O25A 1NWCA 2O7RA 4UHKA 2DXIA 3UMFA 4MA5A 1I0LA 3JZDA 3L3BA 5BPFA 5LQAA 4RGBA 1CYDA 1PDVA 1QC5B 4QXQA 4YJ3F 4OMFG 4C4YA 4EJFA 2R8YA 4OMDA 1XYYA 1XP5A 2D0OB 4DM3A 1OFVA 2YWJA 3C3CA 2CK3D 3GLVA 3W2FA 4F3YA 1PJZA 1VGRA 4NP6A 2PD3A 2G25A 4ZYYA 3PNPA 4I9GA 2HV9A 2Q3JA 4BQRA 4I5EA 1H2WA 2PLFA 3DCNA 2NACA 2NNWB 4R9NA 3HJNA 4Y2PA 3BULA 2HHHB 3DDZX 1CQJB 3RCBA 2WMNB 3NEJA 1PV2A 3SBDA 5E9WA 3K70C 2OCBA 1G19A 2D2XA 1U9IC 1A5BB 1HEYA 1TNDA 1A95A 2FMIA 4HNAA 2BMAA 1TQHA 3ESZA 2QTWB 4O3FA 1XFAA 4HNHA 5FI0B 5A4IS 3DEIA 4G5OA 4NOLA 1W93A 4KQ9A 4O2AA 1O87A 4TSFD 4UCXA 2JFQA 4UAUA 4G41A 3O8QB 4OK5A 3FRJA 1I3OA 3PXCX 3LC7O 3QG1A 3GJ0A 1U3WA 2QZJA 1PT7A 2DC1A 2OMEA 3HXOA 2E1RA 1SKBA 2BEJA 2WKWA 3PNQA 4IAOA 1F48A 4NMXB 3VR5A 4X92A 2CVFA 2XEDA 5C35A 4Q12A 4FDLA 5CX1A 3NCHA 3IVGA 1CPYA 2AN5A 2I33A 4K9MA 3CV3A 5FI1B 5NULA 2BUBA 3VR2D 2XNJA 5CX4A 2PWPA 3BD6A 1YRQA 2AMVA 1YXMA 3PNKA 2FV8A 2ZVJA 1E99A 4UUBA 4OH1A 4RW0A 4ENVA 5BO5A 1V2GA 1LLFA 1F6BA 1ENOA 1Z13A 4G4JA 1XEWY 2WKQA 3F8WA 3D64A 3LUKA 3MVEA 1T1RA 5JI2E 5M2QA 1IMOA 1PG5A 3UMGA 3GNSA 4CQNA 2BR4A 1TJ4A 3T3IA 5BN4A 2P5UA 5EXTA 1E2GA 4PAOA 1ZGBA 2G9VA 2WFZA 3DM5A 1BSVA 3QPVA 2HSWA 2PG3A 1E7YA 2CBXA 2UVQA 3QEMB 1S0UA 3DFZA 3E7WA 4ZTBA 4L5IA 1YA6A 2GAJA 4S1TA 3SIWA 3WC4A 3ETNA 3ZH2A 3TLZA 4EBFA 1WNFA 3PG5A 3DLCA 4QYTA 4RTQA 3W5DA 1ZLYA 3R40A 1IEWA 4YX9A 3CBGA 3W3AH 4J3JA 5E8RA 3C2QA 1UC4B 1NF2A 4KRFA 4UBIA 1JB1A 5AHRA 4HQOA 5TC4A 4EOGA 3ESQA 1IHDA 2ADMA 5EJ9A 2O8FA 3UJPA 3RRMA 2W6IA 5A05A 1P0CA 3EW7A 3VR5D 1GZVA 2W83A 1YULA 5LQMA 4G5RA 4HEA1 3J80A 3HPQA 3C3WA 1F5NA 5D51S 3CF4G 3S27A 3RRZA 4X97A 3TBKA 3FAKA 1LTQA 1QH8B 3IL2A 3ZI0A 2UUAB 2DYKA 1BS1A 2H1CA 2JGKA 3M6LA 1MCZA 4FWIB 5IBPA 4G36A 4DPKA 3K1TA 1C4XA 2VAVA 4ZYXA 5THQA 3I9NA 1K6JA 1F2TA 1UWCA 1KDVA 4LJYA 4URVR 1YS7A 4DARA 1GRQA 3IT0A 3LYHA 4HH4A 3S6JA 3TJZA 5JXJA 2C2KA 4BMYA 4AZSA 2CV0A 4H3KB 2Z9CA 1I1NA 3GJXC 3PPXA 3WRXC 4CV1A 3R5FA 1PFWA 2ZT7A 3NC1C 5JSKA 4JX8A 2CF6A 1VG8A 2JRCA 2R1VB 2XKBA 4PG6A 4WKCA 5L3QB 2BUAA 3HFSA 4JP5A 4ROSA 3RVPA 1JIIA 3M8KA 3IP6A 1UFKA 2GBFA 5EL0A 2PWAA 2LW7A 3GEMA 5FI5A 4EABA 4DKJA 3FDIA 4E32A 3MJSA 1KAEA 1M6EX 1QB7A 5FRDA 5A6VA 5LZ4A 5DASA 3AKZA 3NO4A 3QOYA 2PUFA 2F3TA 1Y34E 3EZ6A 2GZ2A 4I3GA 2EZ8A 5BVHA 1YR9A 2CLMB 2COKA 3QP9A 1H8HA 1HE2A 4R9RA 4K8RB 5DCWA 5GONB 4AP5A 5JAUA 3D8RA 3K0EA 3CQ9A 2EAUA 4TKVA 3D3JA 3BTVA 4B09A 2P9TA 2QM3A 4RGQA 2NO4A 4U2GA 3WZMA 4EFMA 3DBHB 4HWGA 5CBKA 1B1CA 1RXVA 1VSUA 1WUHS 1IJEA 4JP3A 1HZJA 2NW6A 2WU3A 1K7YA 2A3RA 4HDMB 1ZSNA 3FHTA 3ZHSA 4IKEA 2X5JO 1EFLA 4MI1A 3A6LA 4KK4A 3UPTA 4ETMA 5A9TA 2H92A 2CL6X 1W8DA 3AYZB 3EVEA 4I08A 4MW0A 4NJEA 1RTTA 2H2HA 4HLQB 3MOGA 4Z4GA 2MINA 3S2ZA 4EEZA 5MN4A 1L5SA 4ZFNA 3UK7A 2G5PA 1RWPA 1UEXC 2BF7A 2I66A 3OT1B 4N6GA 5KNBD 1NF8A 4TLAA 3PF8A 5AKZA 1OYOA 3EBPA 4WNAB 3OQJA 2JHGA 1AQNA 4YCJA 1NV9A 1UBGA 4H27A 3U62A 2VPZA 4RHUA 2AT1A 3OM8A 2HEIA 3T0GA 1ZVVA 4IFTA 3DHYA 4IZHA 3W8EA 1GEEA 5JSYA 1N77A 3ODPA 4FR0A 3DKKA 3UHOA 4AXBA 3EEQA 2DBRA 2GUWA 3JSXA 4EUFA 2B4RO 1BDBA 1WG8A 5FPYA 3QEJA 3DVAB 1YDWA 1GPJA 1T2AA 1LRJA 4LY9A 2FFRA 2JJYA 3ZV3A 3UFXA 1VSQA 3FWKA 4Q21A 2H2GA 3D2CA 4AG3A 1RHRA 2E1PA 1IEVA 1Y8RA 4U3JB 5AKHA 4N18A 4CMGA 4BLSA 4LDRA 4JWKA 3WNCA 3U48A 4YJFA 4C5AA 3AESB 1NE7A 1FJ2A 5EUCA 2P2YA 4G0NA 4KR3A 1TAHA 3MJEA 1X2EA 4I36A 3PICA 3T5DA 4Z8YA 1M7BA 4ID3A 5LP1A 4BNUA 3DMDA 3X1XA 3WRXA 1UK7A 2IK8A 3U6BA 2IHKA 1IBCA 2VKQA 3NHMA 4Z0TA 3SS7X 4B81A 3LBAA 4FJ0A 4PWYA 2HSEA 4UMFA 4KGVA 5EP1A 3OOJA 1RYEA 1I9CA 2A59A 3G0CA 4GKBA 1TUIA 4P80A 1QWOA 1H0SA 4ND6A 4BKUA 4EL5A 1NONA 1UDCA 2RI1A 1U8EA 4YWHA 2H4HA 3HV0A 2FZWA 3OQMA 1V5FA 2CJPA 4W5HA 1XDSA 3HWX1 2B5OA 4RJIA 4MINA 2QN3A 5KTRA 5K4GA 1EGVB 2QN2A 4DJEC 1PL6A 3OBIA 2WYOA 1H69A 2I2BA 1J0XO 1DIRA 3B53X 4HS4A 4DILA 2JJ2A 5L51A 3ANSA 4EHHA 3EQ8A 2ZKIA 4Y0AA 3K20A 4FOTA 1QQTA 3IEMA 1QV7A 2UKDA 4V39A 2SKEA 4IIFA 3JWIA 3CGWA 1ILEA 3IB3A 3LK7A 4FJ2A 3AETA 4LVCA 4NEHB 1L4HA 1TYCA 2XUFA 2COEA 3E8MA 2D1YA 2IT1A 3N6XA 5A3VA 5REQA 4BV9A 2QVBA 1F0YA 4QAQA 1G8HA 2GF2A 1JU4A 2HMUA 3LD9A 1VCOA 3L9WA 2KE5A 3BCRA 1TJNA 3GY0A 1ZK2A 1I4LD 3O4FA 4I14A 5KSOA 2BFDA 3LE8A 3LX8A 5J5VA 3DZ8A 4OQPA 4H60A 4NPCA 3GNQA 3QFTA 4XJVA 4Y6PA 4MRRA 5LZ8A 4ERXA 3CJTA 3AIKA 3ZCUA 3U09A 3R0JA 5JDCC 2ADOA 1XKTA 1TOAA 5KYWA 2ZBGA 3CCCA 3G02A 4PC1A 1LLQA 3UAXA 5KPJA 1QYWA 5TIIA 1JEYA 3OFKA 3PUIA 4HRAA 5KC8A 3HNPA 4GI1A 1W36D 3D1VA 3STWA 4FFVA 1TPZA 1SOAA 3F1LA 4ZT4A 2RAPA 3O3MB 1WDLA 4GZ6A 2R00C 1KDZA 1D4ZA 4WOKA 2Z98A 2OXIA 5B3AA 1HNZB 4YPFA 1YRAA 1H0KA 1P4GA 1RWNA 2YXLA 1LRLA 1SHZA 5JCZA 5LMZA 3CBQA 5L7TA 1A1VA 4QUIA 4LK2A 5HF5A 4J16A 3F3KA 4W7IA 3U7JA 1TUGA 1E1YA 5DLQC 5AW0A 4QX6A 3ML1A 1QLHA 2CLCX 4Y0NA 1B8VA 3H2BA 4IQ4A 3ZJYA 4US0R 3AFHA 3ICEA 2WFLA 1ZSYA 5CA0A 2JI8A 2YASA 3PU6A 4M0UA 5G0WA 3UB3A 1ONNA 1SNYA 5EKDA 4Q9JA 1MT3A 3FPEA 2O2XA 2ZFUA 1YV9A 4KYTA 3IQXA 3BVPA 2C20A 3O26A 2YJTD 3Q98A 4JT2A 2WIJA 3TI9A 3BD8A 3YASA 3IAHA 3N0WA 2FSGA 4K6CA 1U1FA 3AG5A 5HW0A 1XMPA 4ZAWA 3V8VA 5EHZA 1M5RA 3NIBA 4QLBA 1LBIA 4NC9A 3HABA 3ZWOA 2MSLA 1U28C 2E49A 2IU4A 1L8QA 3KJZA 4Q3LA 5JMWA 3G59A 1I4WA 3WQHA 1EHIA 4NMHA 2CZQA 1Z0UA 4JJKA 1DIHA 1T8RA 4D9FA 1Q92A 4B6RA 2B7CA 4AM8A 3KOWA 4ITUA 3WKDA 2O6HA 3LXMA 5FWYA 1GNVA 3D7RA 1DFHA 1E9BA 3RM3A 1NIPA 3PC3A 4ZIRB 3LC2O 1JT2A 1YOVA 1YFLA 3NGXA 4ZI5A 3RRYA 5C8ZA 5ULLA 1M8JA 4YUWA 1CUYA 4CFYA 5BW4A 4NLLA 3O7MA 4IIJF 2EOAA 3RAGA 5DX0A 1A8IA 2B82A 2GJ8A 1PR1A 3N28A 4Y8VA 1M6YA 2PQ6A 4RDXA 2QTTA 1OIVA 4B6QA 3GJ3A 4YRJA 2JFZA 4TUYF 1KMQA 4CKWB 3HZOA 4PG4A 3TKYA 4N0EA 3UAWA 1UWVA 4W9MC 1FCJA 4DVGA 5JAQA 5BSHA 3CLSD 4G01B 5GP1A 1JG7A 4H0NA 1DINA 1MC5A 2HRZA 3P97A 1AGXA 3E23A 3FLBA 5I7FA 4NJMA 3NWEA 3NRCA 4BN4A 5IZ4A 1N8KA 4Q4LA 1ECJA 4H9GA 1QRTA 1V4VA 3GXOA 1RXEA 5G3YA 5HMLA 2OBBA 1KEKA 1U94A 4EVRA 1C7RA 2LUOA 3TZCA 5HF8A 1TF7A 2CJFA 3GFPA 4XQGA 3COJA 1PWYE 1F8FA 3Q2IA 3H6HA 2A8YA 3FVQA 4I6JA 1FQKA 2C8VA 1K6XA 1HQKA 1VL5A 3GCDA 4JJIA 5FBRB 2JARA 3NHRA 1P2VA 2CBZA 4OQLA 1OA0A 1QP8A 3OEHD 2XCTB 1NLFA 3FHLA 3DMNA 3LHIA 4D4KA 3ZD7A 2ACKA 5H70A 1JKJA 4UXJA 5E2AA 4BE7B 2P67A 1I5OA 4HEQA 4Q7KA 4U00A 2BGUA 4KU4A 4H7JA 4OXXA 3RIMA 4NMLA 2KHZA 4BO3A 1DC4A 5KQMA 1IN4A 1JAZA 1I4DD 3A6FA 4MULA 4X20B 1U4NA 5F35A 2DP4E 2UZAA 3ZVKA 1IEQA 4R9VA 5HQJA 4ZYWA 3V2IA 2SKDA 4JBLA 4YWJA 3EVAA 1FZQA 2R1UA 3HLTA 1ZK4A 4L08A 4XGNA 3TZQA 2WF9A 2V6GA 3RF7A 5HOEA 1ZVKA 2CL0X 4E3ZA 4LHYA 4MUFA 1S2NA 5AJVB 2UV8A 4WN9B 3O31A 4JGIA 5DSTA 1KSGA 2QLJA 2VF5X 1SG9A 3H9UA 3EDQA 3F74A 5AXCA 3BXFA 3RFVA 2ZB8A 2ETXA 2YJNA 3KPUA 1P2FA 1UC5B 2L18A 4AJPA 4EB3A 5BNWA 2QRZA 4LXXA 4MQEA 3TDMA 4Y2XA 3VYWA 2UDPA 3OE4A 1O4VA 2IHTA 5FOTA 1B1AA 5LUAA 1R6XA 1RXIA 2BTOA 1W2WB 1T0BA 4KFSA 2G6BA 1L7NA 2HK6A 2RGDA 1KYVA 5DT2A 1NNUA 3RWMB 2AF3C 1BW9B 1LBSA 4HFRA 3ZYCA 4IQ0A 3RFUA 4KITB 3TK1A 3WRYA 4E14A 1YT5A 1AXEA 2D2VA 5DIFA 1A4XA 5D1HA 1VPVA 3I2FA 4I0WB 4BNTA 4D0NA 1HEUA 3TQQA 1FSZA 2DF8A 1VGVA 3AB7A 4B83A 1M73E 1VHTA 4RVGA 1SVKA 3NHBA 3TBFA 5EIEA 5CT8A 1MF7A 4CMIB 2FUNB 4JQZA 4XGIA 2Z6QA 1TYEB 5B1YA 3QF4A 1E6MA 4U39A 5IG2A 2POQX 1ITZA 5JHGB 4AO7A 2V98A 3LX6A 1J7JA 2H8GA 5G4KA 2PJRA 1JYSA 1W88A 5AW1A 3VOAA 2FPPB 2G70A 3RH0A 4BDSA 4F12A 4TTIA 5KOHB 4AJJA 2PYZA 2WWYA 2BOVA 1C7IA 2ZRCA 1N2BA 2C4UA 1BJRE 3QKRA 3NIDB 1JTFA 1X92A 4BXOA 3FWNA 2SICE 1M8PA 1Y1KE 4NCHA 3P9RA 1XA3A 4RK1A 2WJGA 4A0GA 4EY5A 3CLUD 1GGJA 2Y77A 2W43A 2QE7D 4YAGA 1GAEO 4MV3A 2O3SA 4A91A 1HL7A 3BAFA 2C57A 2QMUA 4L8GA 1KIMA 1P39A 2F3SA 2HCFA 4EVIA 4XWKA 1ZR2A 2G9RA 1M10A 1NFFA 1KVSA 2PZEA 3GLKA 3UWMA 1KK0A 1XZEA 3Q6IA 3T1HB 4OHKA 1UIMA 1PEAA 2W2NA 4LOAA 2XZOA 2LPMA 1NXXA 4YUXA 4KR2A 2EKZA 2EJBA 3P5SA 4DDVA 4PW0A 1HSOA 4CU5A 2V4ZA 3ZDYB 4Q4JB 1CRPA 4FUTA 4ZOLB 3CT6A 2JFOA 2Y4NA 2JBAB 1P1KA 4LGYA 3EZNA 2RC6A 3C1AA 5FTLA 2NYUA 1Z08A 3W5AA 5IYZA 3ITKA 4G3XA 7ADHA 2EQAA 2F90A 4E5SA 1SA0A 2EL7A 2VHXA 3T12A 1TXGA 4BNVA 2XRYA 2P65A 1VJRA 1Y7PA 3VPHA 4A8TA 2B36A 3W90A 3I09A 1WMFA 4Z1MA 2YJ6A 4NL4H 2WHPB 3REGA 1NN0A 2P62A 4QJ3A 5HIAA 4BO6A 3FKQA 4PS1A 2CN1A 2QR2A 5EIAA 4YYZA 4DB4A 4ZALA 1BGWA 1UBOS 2WWIA 2ZYGA 1QYVA 1GQRA 2FN7A 3D8UA 3RC3A 1N5KA 4BIIA 3R5JA 4HNVA 4UTNA 4DMFA 3KUDA 3NT5A 5G0UA 1PSWA 2WJ3A 1LI5A 1Q1NA 3R2JA 1AO0A 1N8SA 4KE7A 1E98A 1O03A 2G88A 2GA8A 4MYRA 3VKFA 1AKQA 1P9OA 4CIDA 4QT4A 4YHHB 3TLJA 5JRJA 3PGXA 3R24A 2OHGA 5CTAA 4ZQIA 1NNEA 3CLTD 1GKLA 4R7ZA 1XN1A 5K20A 2EX0A 1M1XB 3PX2A 3J81A 4B34A 3UJDA 1WCV1 3NH9A 1PZMA 4PYRA 4PGFA 2AFVA 2G36A 5DIZA 3KALA 1WOMA 2ZVPX 2PU7A 2FSSA 3OIVA 4OQQA 1QIJA 5BNFA 2K2QB 4MO9A 1P3JA 3RASA 1XTIA 3OF5A 3ER9A 3AHFA 3JR7A 2IYZA 5AHOA 5ENDA 1MXFA 2FH5B 2XD9A 3D43A 4BEWA 2J0SA 4NVRA 1QK3A 2JFNA 3QVMA 5BSUA 3PQ7A 4X24A 6ADHA 3ICVA 3GN2A 2XEXA 4KRGA 3WHKA 5JRDS 1SCUA 1OF1A 1UMCA 1CDDA 2CBGA 4RZHA 4BO5A 4D6YA 3IPCA 4KIJA 5IX8A 1FTQA 5EZQA 4K8OA 4CCSA 3WKEA 3C74A 3LAWA 3EGIA 1AGRA 5JTTA 2PRJA 1QO9A 2ONZA 1AK9A 1OLUB 1UM8A 2FI1A 3V1LA 5JXIA 1I5RA 2VJDA 1CUFA 4JFAA 2NUAA 4BRZA 5BSWA 2GN8A 2IYUA 3A9SA 1E8MA 3FOZA 3PITA 5KREA 3LOQA 5HJ5A 5MGBA 1VLMA 2JJ2D 1E3WB 3R4VA 4M46A 1KZ4A 4ND1A 3CGGA 2FLVA 5L3VA 4JJEA 1EVLA 2WA2A 3NYQA 1Q2XA 3IP7A 4S0ZA 1PTJA 3SR0A 1Q50A 5J5CA 1LNZA 4OKIA 2H16A 4JC8A 3SF8A 3C98A 2VDLB 1IXRC 3DOIA 2QD1A 5ILOA 1NW7A 2ZB2A 3ZV5A 5FWAA 1VOTA 3UHPA 1WD7A 3A06A 3CUSA 3LWZA 4FEYA 2WNSA 4PNPA 2QD4A 4AMZA 1CKEA 4KWIA 3L04A 5BW8A 3DAOA 1PQWA 4YROA 1CBUA 2PRZA 4B2PA 3X2SA 5I3ZA 3QUSA 2ZYDA 2KLHA 2RHGB 4BEBA 4LE0A 4WV3A 3E9DA 2VF2A 4DCUA 5LYYA 2IL1A 3JR3A 3ENKA 1I6KA 3VPAA 1R9GA 2RGBA 2YL2A 5HVNA 1WQ3A 4ZZ0A 1L4KA 4E03A 4ZMBA 1F3OA 1GN8A 2IIPA 4JIMA 2F4NA 2YWRA 2W71A 4LCEA 1V8DA 5B3JA 1FUYB 2E3JA 4ZDKA 1IUPA 3H9EO 3R9XA 1LNSA 1DVRA 1JIQA 1HDXA 2RJOA 3I76A 1O8BA 3VFDA 2C0CA 3BRSA 4TV8A 4ZAYA 4DJFC 4F2PA 5DXFA 3E3OA 4IIVA 3UZUA 1GG5A 3EWAA 1U3DA 3C5HA 1SC9A 2YBDA 3NKFA 5FBWB 2JCSA 1RVDA 3LXUX 3LT1A 4PTZA 3KTDA 1V9SA 1GDTA 4FYYA 1T3SA 2AZXA 3H99A 3A6ZA 2QZ9A 1W19A 2BZ1A 3Q40A 3E7DA 1VIAA 2HPVA 3TMYA 4AZ0B 1NXSA 5JR3A 4RV9A 5JD4A 3H9QA 4CTJA 4MOWA 3LCRA 2VNIA 3VZDA 3Q5GA 4OBXA 1Q14A 3IBFA 4M9UA 3ANXA 3IOEA 1NFRA 4P38A 5DKFA 2ZPTX 5DTQA 4AKTA 5CXUA 2V7XA 5CDGA 1FRZA 721PA 3WB1A 4A0RA 1S96A 2QL9A 3TM5A 1NW6A 2EWVA 4GO1A 5JS1A 2JHPA 4GOLD 3VH3A 2P2NA 1E3WA 1E32A 1JR4A 1I3NA 3FF4A 3GL9A 2A3NA 2H08A 1IVSA 3H97A 5EOVA 3OD5A 3GP5A 1A50B 1F4VA 3GMDA 3UQZA 4ZOEA 2D59A 3SX2A 4DLTA 4DQVA 2HPZA 3EUWA 3DPUA 1JAHA 3T0IA 2UUPA 2GTIA 4D43A 1KZ9A 1BYIA 3PA6A 1X8LA 3DB1A 3G2LA 2DSTA 3NAQA 1GHTA 2FRDA 2V7BA 4AS3A 3IEIA 1QRSA 1WMAA 4ZEOA 3I1FA 2Z5VA 4A6XA 1GU1A 4UREA 2RJ3A 1UPXA 4P58A 3K0KA 3GB9A 2LE0A 4K28A 3SSOA 1SIOA 4NH0A 4MYUA 1X7XB 3KJFA 4MCIA 1J2TA 2XWQA 2B0JA 3GLGE 4R9UC 2FRVA 1RXSA 2CFTA 4EYEA 3SVLA 4NFHA 4C4AA 2EX1A 4FI3F 3U0BA 4C89A 4BJHB 3B6MA 3HFRA 4WK2B 3WBKA 1ZI9A 2C83A 3KQLA 4FKMA 3PC7A 3Q5EA 3E61A 4M54A 3RUDA 4A0QA 4GC5A 2G7ZA 3RVLA 2CUTA 1UBFA 5HF9A 1G5FA 3BORA 3GCXA 4FMDF 4YAIA 3MMNA 3VUEA 3OZEA 4DKXA 1B8OA 1GZDA 5BUZA 1T36B 3K2IA 4N6OA 4I55A 4NYMR 4HQFA 5I7AA 3IT2A 1Y0BA 1MOPA 3IEPA 4OXYA 4QAJA 3WWYA 3OJWA 4OIMA 2R6GA 1RC8A 1KBOA 1I7DA 1BRTA 1DRJA 1KVRA 2IIVA 2VXYA 5SYMA 1XVAA 2EX4A 2GXUA 3SYNA 2TMKA 3TVYA 2ZCJA 1CUSA 1D2AA 1EU1A 4LTMA 4RU1A 4X5OA 1CEYA 3WBBA 3DMHA 2PMFA 4MVJM 1G16A 4PRZA 4GL4A 4BTVA 1O97C 4WGGA 2DOKA 3PZBA 2F55A 3QVXA 3DYBA 3X43A 4MNTA 1AX9A 2WKRA 1LDNA 2L0XA 2WYIA 3AETB 3FYSA 4MUGA 1JWLA 2AQKA 1M5UA 1LDEA 4LISA 5FH9A 1I33A 5KHOC 1B6RA 4WWHA 1TC2A 1Z7YA 2FFBA 3ENQA 4KKVA 5T3UA 1ORWA 5JC1A 5DMXA 4PN3A 3NBKA 4BCBA 4OJKA 3TLAA 2PZBA 3FYUB 3KDAA 2Z2ZA 1UCFA 3KUCA 3X1JA 4LAFA 1J56A 1TU3A 2BRUA 4YP1A 4UTOA 4F92B 1FVHA 4B46A 3HDQA 1HX7A 4M7OA 2PUDA 2OC4A 4D4HA 4XIJA 4WE3A 3T95A 2FR8A 1E2FA 2WRZA 3GAZA 2A9RA 1KETA 4I8DA 1K5PA 3UUFA 3O91A 4FNMA 3A25A 5EMKA 4TSRA 1J2RA 3P9QA 5CIQA 4YGXB 3BMOB 3KWJA 3RS4A 2B99A 1PI3A 2X0IA 1R5OA 3HCPA 2C2YA 3X1KA 1SXJE 1XJQA 1F06A 3L8ZA 3VOSA 4ZJYA 1DAEA 1R0YA 2BGMA 2QX7A 4ZAFA 1PT5A 3WLHA 4MW4A 3ZHZA 7YASA 4ZTZB 4BFLA 1QLJA 1DKLA 1PJSA 3FUVA 3KL4A 1L1FA 3WWDA 2OOKA 3BOSA 3F49S 2FW8A 3HFJA 4BLUA 4C0KA 1MVNA 2BZ0A 5LJLA 2C54A 1J8DA 1N2CE 1A9TA 2OCLA 2P9BA 2ZIZA 3IP3A 4DLAA 1T8TA 3OLXA 3OFJA 4FXOA 1N9GB 1S7CA 2G28A 3CCFA 4LJ7A 4OQ4A 4XEUA 521PA 4ABTA 3QX7A 4MXDA 2OFPA 2H48A 2RHOA 1H4TA 4LG1A 2VP0A 4OFZA 4EIWA 2CK3A 2BGIA 3RR2A 1QAOA 1YB1A 4GX2A 16PKA 1WV1A 3QXGA 1DC7A 1FXWF 4RHTA 1JLRA 3E9EA 1W0KA 4KAJA 4MKXA 2C4WA 5IH3A 5C1IA 1ZD1A 1WPGA 3HN2A 3UCEA 1VHQA 4D9GA 3VVCA 1Q1ZA 4D3SA 3NB0A 4O5OA 2W4MA 4RZ2A 1KRXA 1MN6A 2PWBA 3BIOA 5C51B 2QVZX 4ZRDA 2E87A 3M1AA 1UFRA 1DJNA 3O8LA 4RVHA 1J7KA 4DCGA 5BN3B 2DPYA 1AQ6A 2OYSA 4M1YA 4V1CA 3FNEA 4QTZA 2CUZA 5FHQA 2PZ8A 3PXXA 1PBNA 3CUTA 4ZT3A 2WHQA 4KL8S 1NLMA 4ZVPA 5CB8A 5FBHA 5BT9A 4BNFA 3I1JA 3ACCA 1DJLA 3JARB 4B48A 3WXBA 4EQ6A 2ZXEA 1XD8A 4KNYA 1QHHB 1EA7A 3B2QA 4TKLA 2WTEA 3HBNA 3WFIA 4YRMA 2DQSA 2JFHA 3MJVA 3RU9A 4BNWA 4CF6A 1DEXA 1PN3A 2J9ZB 2QMQA 3M4YA 3FB1A 3N59A 4E08A 2E9SA 4Q7LA 1RC1A 4JLAA 5LA6B 4ZYVA 4WBNF 2ZJBA 4PZAA 1J1UA 2FR1A 2Z1DA 3DCIA 1Z26A 1ZRSA 5FL3A 3STHA 4D9EA 2MSCB 3LBIA 4K9LA 2NZJA 4UU8A 1YIOA 3HYNA 1RJEA 3OOSA 4HDNB 3SYLA 2NSJA 4BZPA 1MO4A 4NYJR 4IIDA 1ND6A 3D4PA 4P93A 1JJ7A 2FUG6 5H80A 4UMEA 3D4NA 1VA5A 2ATXA 2DSNA 3D5TA 3DQQA 2XF8A 4M0FA 1NQTA 4PY2A 1EVJA 2XVXA 2R47A 1F60A 5AI6A 2XVAA 1H6DA 1SZDA 3U44B 1TUBB 3NR2A 4O4IA 4XX0B 4Q16A 1USKA 2I7CA 1XYVA 2F67A 5THKA 1E92A 2E85A 5U4XA 3WHLA 1G7RA 3WFZA 1N2EA 4Q9AA 2D0PB 3IIMA 4QVGA 1AZSC 3TOCA 5BRAA 2UVPB 4IHAA 2BLLA 2XY4A 1EFAA 1R6TA 5K4HA 1T9BA 1CNEA 2XMDA 3QMPA 1A7UA 4I4NA 1JHAA 1OD6A 2C07A 3TQSA 1UDXA 1ZVMA 4GMHA 1UWKA 1Z0IA 1JUDA 3KAQA 3UNXA 5TQ0B 2CLLB 3TNJA 5I9TA 3AEKB 3IERA 3ORHA 1I2CA 3R7AA 2IWHA 3ROGA 2FMXA 2ATIA 3PC8C 4M2LA 1VJ1A 3QIAA 3DP9A 3VMFA 1Y1TA 2FZVA 3BXEA 4EO4A 1IIRA 4TQUS 3RVSA 4DREA 3ORQA 4RJTA 3N3AC 1FBTA 1QHIA 1R27A 4FYPA 2K5UA 5CNMA 3UENA 1FRFS 2G4LA 4MJ7A 2OQIA 1T2FA 2ZUUA 3R7WA 4NABA 3OECA 4BFTA 2O1XA 4RLHA 1G20B 1I6MA 4ENSA 3C24A 4HL6A 3GT3A 3KSUA 4NAVA 3TAHA 4CLRB 5CA0F 3IP9A 4RZSA 1OZAA 1E2PA 5FQNA 5ELLA 2ZITA 3EOAI 3K8YA 3PCRB 4ESVA 3N5KA 1E2MA 2PN1A 1D1PA 3RU3A 5CPFA 4UPEA 2BAGA 1RLMA 3U7QB 2FLKA 2NU6B 2YWHA 1RADA 5FBLB 2D06A 3AF0A 3C43A 3STYA 2IUUA 1UOQA 1KJWA 2QTVB 4EHLA 1H8HD 2X5XA 1ZL0A 3AP2A 5IAGA 4B2IA 3EGDA 3SQWA 5JANA 4G5QA 1KO4A 1QG0A 1YI1A 2GJAA 1W9MA 1TYAE 3QA9A 3TIGA 4ARVA 1UJ4A 4RKWA 1NVMB 1KIFA 5IVIA 3JQAA 1EP1B 1XEXB 4IJQA 5DHQA 4KNWA 4DTCA 2FSFA 2K7FA 2GA9A 5BQPA 1XZIA 4XQ9A 2GPJA 1D4FA 3KTOA 1XXHA 2V7TA 3DDSA 4IXDA 1JHZA 1W4LA 2QXYA 3I2YX 2H1SA 4J07A 4QICA 4I1UA 3E5RA 2Q7XA 5FOUA 2IFTA 2XNDD 5M3BA 2WM9B 5AOCA 1IVYA 3BMNA 3ORRA 2J4CA 3OQPA 3Q10A 2M2IA 4Q3OA 2HLDD 1A8HA 3UGTA 1QTRA 3U3KA 1WF6A 1SBCA 3BQNB 1NU8A 1NJ8A 1HFKA 4GU5A 3DQPA 1P5JA 2EATA 3FBGA 4FYHA 4QASA 4FJ1A 1SXJD 3JQEA 3PXAA 4KN8A 4HS9A 2A86A 4W7HA 2DJ5A 3GDGA 3DWEX 1FQOA 1ISGA 3P9YA 4LXTA 4IYJA 4NRDA 1CVLA 4PZ0A 5EKUA 3JVVA 3WAJA 2X2FA 1UM9A 2FVXA 4GLJA 2IYQA 4GEGA 1U8CB 5T8KA 3T1QA 1Z4OA 2FWMX 3RT1A 3OZUA 1OFIA 1HMPA 1M2HA 4XYMA 5AVSA 3RVRA 4AAYA 1LLDA 3H5AA 1LWOA 5AK5A 1D2MA 3U7RA 1VYUA 4A2WA 3PGJA 5K0ZA 4C2UA 1F17A 3LVFO 1XOIA 2WJWA 3S8YA 2NZ8A 3RG2A 4A82A 3MJDA 5CFZA 3EXEB 3TIFA 5D84A 3FMPB 5B53A 2D1QA 3VHXA 1QCYA 2HUPA 2Z43A 3C6XA 3WLIA 2FPRA 3R20A 1GTZA 2NU6A 5LQNA 3GEPA 3D6AA 4JR1A 5B64A 2BGTA 2ZJ3A 4KYUA 5BMVA 1WBJB 1O6BA 3A28A 2QNBA 4ZI7A 2CFOA 2GYWA 3PYMA 2OCIA 2VWPA 4IGEA 3TTXA 2OAEA 4OSPA 1ADJA 4J7XA 4FGWA 2RGYA 5K8JB 5LSAA 4ACBA 1X9HA 3NONA 4CKCA 5KCZA 3DVSX 2GVZC 2XUPA 1MV5A 5JQWA 4IEEA 1F9AA 3EXAA 2P79A 4NWIA 1DCKA 2D74A 4P86A 4ENRA 3PNBA 5FYDA 5BR8B 3SIXA 3ZOZA 3PDJA 4J94A 1SHLA 4ECAA 3OEWA 1FOEB 3AILA 4HF7A 1D2RA 2IKQA 1WA5A 1K3FA 5IWAB 1JH8A 5ICCA 4G6ZA 4D4IA 3CUYA 4LF8B 2H1IA 3G13A 2JF0A 2QSJA 1OKKD 2RHJA 3BN3A 4AF6A 1CY8A 1FS4A 4HAUA 4AROA 3A1VA 2IRWA 2QY6A 4BVKA 1FLDA 2VTKA 3G0HA 2ERYA 2CHQA 4M88A 4YAOA 2CMFA 2M6LA 1YKGA 2P69A 5AKEA 3L7CA 5LB2A 4JMPA 3LOPA 5FA5A 1SURA 3K8QA 3D81A 4NOJA 3L8FA 5ALSA 1G6HA 1SVIA 1V5EA 5LXTF 5B7QA 2AKEA 2HN9A 1DOZA 5KTMA 1CRWG 2N1BA 3G8AA 5BWBA 2O8DB 1KZ6A 4LIPD 1KRWA 3JV7A 1L7BA 1QV6A 2GQ0A 1K98A 2IYWA 1VCMA 3B1VA 1SH7A 3T3OA 1JU9A 3V4FA 4RJ2A 1XNHA 2ORED 4K9OA 4Y2HA 4B4DA 4NENB 2GN9A 2DQKA 4M8LA 2E4YA 4S12A 3V80A 4LHVA 5JLJA 4PU0A 4P5EA 1T4CB 1K6EA 1VFPA 5G02A 1TJ5A 5FUXA