1MEOA

Human glycinamide ribonucleotide transformylase at ph 4.2
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
205
structure length
202
Chain Sequence
ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWVKEEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Phosphoribosylglycinamide formyltransferase
publication title Crystal structures of human GAR Tfase of low and high pH and with substrate beta-GAR
pubmed doi rcsb
source organism Homo sapiens
total genus 62
structure length 202
sequence length 205
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 2002-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 1meoA00
4DS3A 4Q12A 4ZYZA 4EW2A 4ZYVA 3Q0IA 4ZZ1A 2CFIA 3GARA 4EW3A 1S3IA 1RBZA 1MENA 1RBYA 3O1LA 1GRCA 3N0VA 4IQFA 4ZYYA 3DCJA 1C2TA 1RC0A 4ZYTA 4ZZ0A 5J63A 3TQRA 3DA8A 5CJJA 1ZLXA 4TTSA 4ZYWA 4TT8A 4TS4A 4ZZ2A 1NJSA 5J9FA 1CDDA 3NRBA 4ZYXA 1MEJA 2FMTA 4R8VA 1CDEA 1RC1A 2YWRA 1MEOA 4ZZ3A 1ZGHA 3R8XA 3LOUA 2BLNA 3OBIA 4NV1A 3W7BA 3P9XA 2BW0A 1YRWA 4YFYA 1FMTA 1GARA 4QPCA 1C3EA 4YFVA 3AUFA 4PZUA 1RBQA 1RBMA 3KCQA 3AV3A 2GARA 3TQQA 4EW1A 4S1NA 4QPDA 1JKXA 1ZLYA 4ZYUA
chains in the Genus database with same CATH superfamily
3THYB 2NM0A 2VJOA 3K94A 1GLVA 1VGRA 4GVLA 4PZYA 2QN3A 4IXTA 4IDEA 4CMHA 3BCUA 2Y68A 5JE8A 1X3LA 1XTJA 4GX2A 1CUHA 1JIXA 2GS9A 1SOUA 3PQ7A 3NH6A 4L76A 3LS2A 3P45A 2M6SA 2QORA 3MINA 3H5AA 4PPYA 3EZ6A 4D3XA 1LBQA 1WU8A 4IO1A 4UPDA 3COSA 5EWJB 4HB4A 1E7QA 1KAOA 2PIDA 3PWSA 1VXRA 3PRKE 4PYLA 3LPMA 4B43A 4CV1A 1MENA 4FFBA 1DAEA 2JGIA 1E62A 2XCRB 3B6MA 3U7JA 5ALZA 2PT7A 4BNVA 1GLNA 3OU6A 2FFHA 4DSZA 4QEDA 2GO1A 4RGVA 4BOYA 3LDHA 3GELA 1PQWA 2SCUA 2ZI9A 3HJRA 4MEJA 3HXOA 2RJOA 3KBBA 3KU1A 1ZW6A 2FMIA 5JZVA 4P54A 2OHGA 1HE8B 4J6FA 3STTA 4EGCB 2OHHA 4B34A 1JLLB 2FNAA 4M8KA 2C8JA 3KEOA 4MV5A 4RXUA 4KLNA 1ULTA 1X8XA 5JAIA 2W6CX 3C74A 2H0AA 1SXJA 2EL9A 5DIZA 5KJ1A 2QPAA 2RHMA 1LK0A 2G36A 1F2VA 4XARA 3R0QA 5TDHA 5IK2D 1TK3A 2X8LA 5GGXA 1WE2A 4LFBB 1B8VA 1VKRA 1YVUA 4MS4A 5JNUA 4OHXA 4I4IA 2OXCA 2DBVO 1D07A 2AEMA 2RH8A 1DBIA 1SA0B 3AVWA 3VPDA 1YIAA 1II0A 4ND1A 4OU5A 4HDRB 3DKIA 3MAGA 1UBSB 1GPNA 5EJ4A 3ZDXB 1A5TA 4Z0NA 1VJDA 3K73O 3EZ7A 5G4KB 2YVAA 1KHTA 1UXGA 1D1PA 1VYUA 2A9KA 2ZE5A 3G9XA 3R09A 3MJSA 4EVRA 4QODA 2ZE6A 1ZUIA 3C5VA 5FOTA 3WHKA 2J9ZB 3V4RA 5CGQB 1U0LA 1D2MA 3WL4A 4C14A 3WK5A 4HRAA 1ZM4A 4M9CA 4RANA 2P0YA 2YXLA 4QPZA 4AJEA 1LRLA 2YY7A 4WLOA 4TWAA 5HG0A 4L4UA 2ODTX 2PH1A 2R6HA 1TPYA 4BB6A 2RB5A 3MLAA 5LFAA 1W6RA 5HMMA 4JFRA 1CY1A 1CY8A 4Q1CA 3VUFA 2J48A 4BRZA 3EFEA 3B1YA 3EXEB 2ZQ5A 4O3MA 1FVHA 2QX7A 2J5XA 3L8DA 4E5SA 4NMLA 3VNSA 3NT5A 1YC2A 1WETA 2IOYA 2V3WA 1FMTA 3FYHA 2WSSD 3IBCA 3P1JA 4I2VA 4F60A 5J40A 1GSIA 1C1YA 2JB9A 2VF5X 3FDFA 1EP9A 1G8MA 5KYXB 1NXTA 1W34A 2REQA 5I7SA 3B6ZA 8ABPA 4C0SA 1Z7GA 2VUSA 2GBCA 1GRVA 4HB0A 1TXGA 3T99A 1QHYA 2ORIA 1QNFA 4IICA 4UNNA 4IS3A 1TMYA 3K0HA 1OVMA 4CKXA 2HFJA 1MC4A 2R5WA 2IYFA 3GEIA 3SQMA 2WB4A 2HAEA 2ZBRA 1D2NA 4KFSA 3VDMA 1JIVA 3W9YA 4R1TA 3RS2A 3FI0A 1OBHA 1URPA 3OEYA 3GRRA 3KQMA 1EX6A 3UBTA 1PVOA 3DKVA 3RK0A 3HJFA 3LQQA 3CG4A 2I6GA 2QM0A 1IDOA 3B89A 4FOPA 4Z9AA 3C5WP 2ZSAA 3LUHA 1E3DA 3R3SA 5KC8A 3U1BA 1I4EB 1XVTA 2WTNA 3MGAA 1HFJA 4K88A 1K6IA 1HQKA 3VR6D 5LD2B 2G71A 1Z8HA 2VI5A 3IBSA 4QRDA 3N05A 4MVJF 4DAOA 1G3IA 4BO1A 3LHFA 1HQDA 3MWGA 4DZRA 4C4PA 5AW6A 3R0JA 2W42A 2FK8A 2YIVX 4IX1A 2Q1UA 1DPGA 4R3WA 4TTJA 3U48A 2F8TA 1X19A 4TL8A 2PSSA 3U3DA 1XTBA 3T5GA 3C24A 4QFMA 1NQOA 3B85A 1N9ZA 1R12A 2Q8QA 3JVEA 2ZDGA 3MSXA 4OGFA 3I1FA 3I42A 2GBPA 4PQFA 4Q15A 2OHJA 1NVAA 5AMXA 3T61A 4Y98A 4UTRA 4Q1DA 2XNCA 1BDJA 3G2LA 1LD3A 4Y9TA 4G1BA 5JECA 3KKZA 1K4MA 2GBLC 1APBA 1NVBA 5FA8A 2H1HA 1GTL1 3AL0C 5KVCA 1XLTC 3FZGA 3IUEA 1T0PA 3FYUA 1TYZA 2GJAA 1JHDA 1OGJA 4UOZA 2BJHA 2OZLB 2IOFA 3TRFA 2VHTA 4QXOA 2EG9A 1BNCA 2NZWA 4HEA1 4RNDB 2AZDA 3WK8A 1P3JA 1UT5A 1VRWA 2G5TA 3CB2A 1H2XA 5CBKA 3DWIA 4K9QA 2YMQA 4J7CA 5JAOA 1KAGA 1SOWA 2FUKA 4X7MA 5KTKA 2XDAA 3L07A 4RS4A 1YDMA 4KPGA 4F3TA 2NU6B 3K1YA 1Z13A 4MV7A 4MUHA 5DM1A 4FC6A 1C5KA 3MG9A 2A3NA 2B4QA 1N5OX 3OLWA 3O84A 1Q1QA 4MIKA 5JZOA 1XZIA 2B8EA 2XSZA 2Y3IA 1TO6A 3PYLA 4OLAA 3GFOA 1JFRA 3BEOA 3HCRA 4HNAB 2AOXA 2O2SA 2OP1A 5F7XA 1HT1E 1WW8A 1CS0A 1RR6A 4XJTA 3EZ9A 2ZUTA 5JG7A 4M8LA 4E5YA 2COUA 5ALVA 4ZVNA 2HSDA 1VYTA 2P30A 3CE6A 4Q7KA 1ATZA 1OWMA 3A3NA 2P2ZA 1I6WA 3KS9A 3L7BA 1QO9A 3Q3EA 3R44A 4LF9B 2AFRA 1CBUA 3V8MA 1U1DA 2OO5A 4J4HA 1K9VF 5TMBA 3PFBA 1XAHA 4U2GA 4DDKA 4F3CA 1EM6A 4B09A 5BR1A 2J07A 4NS4A 5HKAA 3GZ4A 2ZB3A 1L2TA 3DHYA 4MRMB 4P9NA 2B2XA 4A4DA 4MV6A 4PX5A 4PYIA 3OPYB 4IYJA 2VF8A 3T3HA 3KJHA 3BD7A 1ULUA 2PRSA 3OWOA 4ARZA 3M4JA 4HBGA 3DZCA 4UXJA 5JV5A 3DMFA 3JQ6A 3EGIA 3UJ8A 4LX8A 1A2QA 1PLLA 3MJ4A 1QJ4A 4XUDA 2VT6A 5AI9A 3AKYA 1XL1A 3KFLA 3SDBA 3UOAB 2JG3A 1IK4A 1M2OA 4WNAA 1P7PA 1Y1TA 1E1RA 1DQRA 4M60A 4G5HA 3NKFA 1CJSA 2WU1A 3I73A 1V71A 3KCNA 3R3ZA 2WA1A 3GDGA 4G4IA 4RDCA 5H5JA 1N1MA 3LLUA 4PZAA 4QUHA 1SKUA 4L2IB 5ALLA 4BMCA 4RX1A 2MSDB 3I9MA 4FX5A 2W6NA 1N32B 2ZUBA 4OUDA 1KK1A 3USCS 3LIPA 1CZLA 1ZKMA 4MI1A 4Q9DA 3PE6A 4M49A 1QIHA 5DLDA 2KHZA 4B4WA 4BNMA 4N5DA 4F97A 1GDDA 4MRPA 3HA5A 2H54A 2NUPB 2BD0A 4H6XA 1CUEA 1T1IA 4Q7EA 1DPFA 4HMQA 4MV9A 4ESOA 3NUQA 1BDHA 3AU9A 4JNCA 4L8WB 1PJ8A 2CYCA 5FWNA 3V4PB 1RCFA 3PKJA 4B3JA 1OILA 1PZEA 2B9EA 4JODA 2VDVE 2WSBA 4EW2A 3OICA 4QPJC 3VC3A 2YWHA 5LVAA 1B0PA 2W6QA 3FMVA 3IQZA 4RU1A 4URYR 4AZTA 2JCBA 4BX9A 3H5VA 3T7KA 4FP9A 3VPXA 3ZCUA 5EPEA 3F3SA 2CK3A 3K8YA 3H2YA 4ZXPA 4JLSA 1L1QA 2F1JA 2Q3BA 3AM4A 4G0YA 4MYSA 2NU9B 1U7PA 4DCCA 2YS7A 3BHMA 5J5VA 1QYDA 1KYXA 1ZOPA 4JBHA 2VDPB 3SC4A 3HA3A 1JPNA 5LA6A 1W5SA 1GQ2A 1Z0SA 5C7YA 2V7EA 3EEOA 1UMBB 1JBEA 3WGKA 4DWWA 4YAFA 1XEWY 1X87A 1BEEA 3TGPA 2G04A 3NWPA 3KWLA 4B71A 1B2RA 3DZIA 4FKZA 3KXDA 1M6NA 1W4BA 10MHA 3ANXA 2B7BA 1Z3CA 3ZW9A 3WGJA 1X13A 1XZNA 3DVAB 5HIKA 3K1AA 1W76A 5C7IO 4CL2A 3D5QA 5IUKC 4OK6A 4G0UA 1T8WA 4MR8B 2YYSA 4H60A 5JDCC 3VOAA 4BLWA 1JAIA 5KKNB 4D9NA 1N2CB 5KKAA 3RKUA 8MHTA 1FP6A 4ZV9A 4CIDA 3NFRA 2V1UA 5BVHA 1NI4B 3WLRA 5C1OA 2VAPA 4Z7QB 5AUQA 5C31A 1TT7A 4GRIA 2ONJA 1U4OA 3F3YA 3DMRA 1WDTA 2XGJA 1TJYA 5DYWA 3SQWA 1NBMD 2ACKA 1FUKA 1PWZA 2IIBA 1M10A 5CCDA 5K20A 5L6LB 3ENZA 1QRSA 5CEJA 4WKCA 1MOZA 1Y4AE 3V32A 3H5LA 4LZPA 1YV9A 4EO9A 2BI4A 4G4GA 4DUGD 1M6VB 2NVWA 1TX4B 2PEZA 2QGZA 2P11A 4CQLA 1XZDA 2GYYA 1BH6A 2EIXA 4HJXA 1IXYA 1JBKA 1R6XA 5DSXA 4J9UE 2ALJA 4U3JB 4DSUA 1TC2A 4LVNA 1GL9B 4MJLA 3IODA 3GLGE 3TVTA 3RU2A 3X1DA 3MTJA 1Z22A 4ID3A 4TLBA 3N3AC 3VOTA 1LJ8A 3C8HA 4K9PA 2PNJA 2PKCA 5JNWA 2I29A 2DZDA 2LE0A 1W36B 4JA0A 2ZJBA 4RL6A 2QSYA 1GG8A 2C0CA 4R9VA 3X2EA 3UJNA 3PB3A 2C1XA 4A8JB 2WWTA 3EC2A 4U9UA 3QXJA 2WHRA 1WXXA 1KI3A 3ZC3A 4RVUA 4N49A 1QOPB 1VPTA 2Q9CA 2R8PA 2EZTA 1E4EB 3UOGA 3ZDZB 4L8FA 4QPCA 3JWHA 4M38A 1C2YA 2A2ZA 3A2NA 3P2EA 4YRTA 3WWPA 3HWRA 3GNQA 4P4TA 4YUZA 6YASA 1JEDA 4YI3A 1BKSB 4MUMA 1V25A 3B9BA 2WINI 1E2PA 3MTAA 5CA0F 3ICWA 2XMDA 2XUJA 3LKZA 4PZZA 4OEHA 1O6FA 2P9HA 5HRCA 2A0WA 4EG8A 1KY5A 1M66A 1UMKA 2PH5A 3W7VA 3IQHX 2FHSA 5M5BA 3C3BA 3HRIA 3VBEA 5JPDA 3SOZA 5BWNA 3CF4A 1IJKA 4B3FX 1L7MA 3EZFA 2WD7A 2Y0EA 1Z34A 2P65A 4AMBA 4PBRA 1TA4A 3GJ7A 1NIJA 1MT0A 4B75A 4Q3DA 1GOTA 3U80A 4C0BA 1BWQA 2QY6A 3WRYC 1Z6PA 3FB1A 3RJZA 1JDBB 2EKLA 1LI7A 3HS3A 2L17A 2ZT5A 4URXR 1NQUA 1A4XA 5D51S 2QUHA 1TMKA 1HV8A 3IQGX 3SBDA 1BXRA 3CZ5A 4L4RA 3OC0A 3T7IA 3U4CA 1KL7A 3S8MA 5AW8A 1N2JA 5CPFA 2FJPA 5KTSA 2QSUA 3O4JA 1VSBA 4WCVA 2WSLA 1WXIA 3WBKA 1YB4A 2FKAA 3BRSA 1UAAA 2WM2A 1R3UA 4OHCA 4ZARA 4LKRA 1YA4A 3EOZA 2J08A 1ZD1A 1K6MA 1A9ZA 1G21B 3FOAA 3AEQB 1GNRA 1X74A 3F7MA 3CWQA 3OT5A 4XUCA 5JS2A 3VZPA 3D4IA 2PFGA 1ONBA 1SKQA 2RBGA 4A92A 1Y4DE 1UBCA 3BRCA 3BCRA 1JDNA 3F5FA 3HKBB 1R8YA 2GERA 4U2BA 5DEOA 4AROA 3V9PA 1A9PA 4WE3A 2H4FA 4LMPA 4EHBA 7AT1A 5JCZA 2M6KA 2BM9A 3U3MA 4ZP1A 5BSWA 2AS0A 1W75A 2W2VA 3PR3A 4YY3B 3SEFA 4R9SA 4H6VA 4W5TA 3LCJA 1K5GA 5BN5A 1RW4A 3A6HA 2ZRCA 1Y98A 1QSGA 4G63A 4UM8B 4AJ1A 4DIUA 3OZCA 3HU3A 5BUSA 1JWAB 3P9IA 3QPVA 4U9HS 1KJ9A 4U7HA 3F6YA 3NDJA 1W25A 1DKQA 3NNSA 4XYGA 1LDEA 1G5QA 3F97A 3K32A 6AT1A 4CIAA 2R96A 1U9IC 3KJFA 2QROA 5AM1A 3MRVA 5L3ZA 3LPDA 1E3JA 4JLPA 5HF6A 2Q62A 2HOQA 1VG9B 3LW7A 4MYRA 1KXJA 2AOUA 3L7NA 3PNMA 5KWSA 4GKBA 1QRTA 3N0XA 5K8LA 3TSOA 4IEEA 3GQVA 1JG1A 3R40A 3ABSB 4ZO8A 3EOAI 1A2BA 1VIYA 3JRXA 1ZWLA 5KVQA 3MRSA 2BKLA 1I7NA 1Y8ZA 1XHFA 4AMYA 3DOOA 4F06A 4MDEA 3QKIA 1AUPA 1MDFA 1UBNA 4GECA 3S1LA 4OY3A 1AKTA 2G4LA 2XNHA 4L3OA 5KWIA 4P3NA 4UUAA 2FWIA 3OIUA 3VU1A 1C1XB 3MT7A 5K4GA 1CRQA 1K6JA 1OZ0A 2W83A 5BNIA 3V9AA 5J2UA 1U8UA 1E4OA 1U2DC 2JBHA 5DGDA 1GPYA 1TZMA 1ZK4A 4J94A 1MH9A 4NZMA 3VR3A 3O8QA 1ZK0A 2KLHA 4NECA 3E9YA 3VOBA 1EVLA 5E6SB 3UGQA 1W30A 4RC9A 1BE8A 2C1EA 4TSFA 4BNNA 1TRKA 2VXCA 1HA3A 1Z2NX 2A0UA 3OSZA 3LF2A 4HQFA 5CHYA 5EKTA 1GDTA 3L8EA 3IDSA 3Q98A 3U3KA 1WY5A 3AJ8A 3BKXA 2MYUA 3OPQA 4M1EA 3QEMA 4RKFA 3X1YA 3GDOA 3HU1A 1J23A 1A9SA 3B3JA 5CK5A 4EY5A 2ST1A 1K8RA 2V59A 2WU4A 2WLTA 2YZKA 4DCSA 2JD1A 4S1NA 4UVHA 4AMZA 1XNGA 2AOTA 2HQ1A 2QUIA 4HGRA 2IA5A 2CXPA 1OFGA 3DC2A 3OZGA 3EIWA 1ZLYA 5CVVA 2W70A 4E6PA 2Q5OA 4FYKA 5D1HA 3HWSA 1W1UA 3GCZA 4IHJA 2NV2B 1MXFA 2LR0A 3EW7A 4R2JA 2WU3A 4UEJA 4X1YA 1AQJA 2G09A 1NZJA 2CYBA 1G6OA 2F1RA 3MZ0A 3WG9A 1G9SA 2ZSIA 3AUTA 3C3XA 4H16A 2PWPA 1KJIA 3MCTA 3Q5DA 2J5QA 4NZYA 3ZK9A 1TYAE 1T0UA 3SF8B 2JRCA 2FKNA 2GCIA 3FPHA 1H0HA 1ADJA 2CFIA 5FWYA 4PAMA 3DZKA 3AY7A 4HTFB 2P9GA 2ZWOA 4ND4A 3FUWA 5EP3A 3W9BA 3N2YA 4KH1A 4DABA 4PYQA 4CDNA 7MDHA 4UNIA 4IIXA 4QG3A 2CXOA 1CIVA 2O6HA 1QV7A 3WNCA 1SC4A 3ZNPA 1FRNA 1Z28A 4L9AA 1FZTA 5FAXA 1NOIA 3ELBA 2FG7C 2QYHA 8AT1A 1SUBA 3TNYA 3UMBA 2VEOA 5LPNA 4RVNA 1A1VA 1ZCFA 1UDCA 1OXTA 1U8XX 3PTZA 1Z8NA 1W2WB 2Y1OA 1EK5A 4O4HF 1OX4A 1UKCA 1I3NA 1S2NA 4NLLA 4NVRA 1HGXA 3LNCA 1Z7EA 2BEVB 3UUGA 2R7NA 3VZRA 2A9OA 4Z0PA 2CE7A 4FX2A 4S05A 4UBOA 3OCUA 2F4VB 1TJ5A 3HY3A 3QLVC 4GOND 1RQPA 2Y4NA 2DPMA 3F7NA 4CODB 1W0JD 2EF1A 1WEKA 1NV9A 1WSAA 1E6MA 2EGGA 2QD3A 3OU2A 4QUIA 5AQEA 2G1KA 2W2OA 1Q0TA 1KSJA 2DH5A 3TQSA 2ZSFA 3JVIA 2LPMA 4GMDA 3L1KA 1S2LA 1Y3AA 2H5IA 1VL5A 4K6MA 2AI2A 4M22A 4JR0A 2HF2A 3JXEA 4K9SA 3LDAA 4YRIA 3NGMA 5DCWA 1ZU4A 2HV8A 2XJ4A 3SI7A 4BMZA 1WJGA 2R87A 1OXKB 1J7KA 4RZHA 2GF0A 2EC5A 2HRRA 5JLAA 5AW2A 1Y5IA 2RIPA 4JROA 4Q7JB 4QEKA 1V16B 1VHLA 1Z0KA 4PGMA 5TQVA 5CDFE 2PH3A 4OCZA 3U9LA 4CR7A 1T9AA 4LHXA 4Q9KA 4DQDA 3ADCA 4CM5A 3QW2A 4NJOA 4D41A 3SHFA 4AWAA 1I51A 1EFPB 1XDBA 2P5TB 3WLQA 1SD2A 3UWPA 3E4CA 1E7YA 1UFVA 2HZ7A 1N77A 1OIVA 1YZ3A 2GASA 4KVFA 4XH9B 4XTCS 4IHQA 1HK7A 1ACJA 1ECFA 3PNQA 4P2BA 2QLBA 3AB7A 3CLUD 3R3VA 2CXXA 3GT4A 5BN4B 1E1CB 3R7DA 4C20A 3QYAA 4DLNA 4US2R 5AW3A 3URMA 1G20A 4ER6A 3H8SA 3P94A 4JQZA 2Q5CA 3V5NA 3IVMA 4OB8A 1BHSA 2WJHA 4QUJA 4HLUC 2VT3A 1O94A 2G1UA 3JU3A 3PEYA 2WVAA 3OJWA 1RJFA 4OQDA 1XJQA 1RM3A 2JDIA 1D6SA 3ZKWA 4JOSA 4ROTA 3GF4A 3UANA 3EUWA 4RK1A 3WL5A 2R4QA 2QVLA 3SE7A 5I7RA 3LHKA 2VRWA 1CDOA 2Y1GA 4UDNA 1O03A 4FMPA 2N0SA 4HNTA 2PMKA 5EINA 1T36A 4XWKA 3D6NB 3MELA 5ELMA 3WLJA 2C82A 7ADHA 4LXHA 3AMVA 4XGIA 1IY9A 3PXGA 3U6BA 3W05A 2VATA 5AM4A 4KZPA 4ZVUA 1FUUA 1UDRA 2X86A 2X0EA 2I33A 2PR2A 1XVLA 2IYZA 2V5AA 4J2OA 3EZNA 1POXA 1YAJA 1J09A 1WR8A 4LMBA 2D1RA 1RSZA 2HU8A 2OGTA 4OGWA 4P3YA 3V4ZA 3TKLA 2R86A 1A8IA 1N36B 4YMGA 2C7RA 4RKWA 1I2CA 1O9BA 1W48A 2OSBA 3WWEA 5C4IA 1JSXA 1VJ0A 1G2QA 2NU7B 2Z4RA 1QGZA 3PC8C 4NATA 2O2DA 3K70B 3R7WB 1DJOA 3A25A 3WKCA 1ZH4A 4OXYA 1X77A 4YP1A 1TJ3A 2ODWA 2QLJA 3SVTA 4HQRA 4JQYA 2EBWA 1KFEB 2MSEB 1GAJA 3CRMA 1H5NA 3IP9A 2B36A 1D5WA 2XYQA 1Z0IA 4J0JA 1L5YA 4OYLA 4QGHA 1MB4A 3PGLA 4WLFA 5DISB 3S5UA 3WFJA 4O5OA 3L93A 3KSMA 1X1RA 1J25A 1THMA 3FY4A 2ZFUA 1AF7A 3K7EA 2OMKA 4WADA 5D1NA 4BVJA 1RRCA 1OT3A 4IIGA 2BR5A 1VMIA 1REQB 1U9JA 3DJYA 3JR3A 1SK9A 3QYJA 4R69A 3U7HB 4PHCA 3JY6A 4XSVA 4OGKA 5ARCA 2F3PA 121PA 2IW1A 1CD5A 4NZZA 5DTMA 1C7IA 3TJRA 3PV0A 5JYBA 3W5DA 2WHYA 4PRZA 1RQ7A 2GCOB 1CF4A 4W1PA 2AV6A 1NBEA 3L7JA 2C61A 4ZI2A 4NU8X 4RA6A 2YS6A 5AVTA 1BWPA 3E8XA 1FYVA 2Q0XA 3DLIA 3M5PA 1A5SB 1U28C 1X14A 2W6PA 2X7JA 3I0MA 3A4LA 3LQ1A 2ETXA 3VVMA 3KSUA 4GM4A 1PO7A 1HZZC 3KB8A 1JHOA 1LZKA 1XDZA 2CVHA 3BMQB 1DKMA 3ZD9A 2DFNA 4AJHA 1OT5A 3O93A 5IVKA 2RKWA 3UMRA 3S70A 5JIBA 1BW9A 3P9PA 3IRUA 4JXZA 4EPVA 4BQQA 3NBXX 1OLSA 3ZI4A 2YJ3A 1HQCA 3KKLA 3LXUX 4D6PA 2R8YA 1UXOA 1OBOA 1PNTA 2IHTA 5AVUA 3E3MA 3ZHYA 1OE0A 3P27A 5EOVA 4AB1A 1DQSA 3BZUA 5LA6F 5F5XA 1ULSA 2C2HA 4P3KA 4YGYA 2NYRA 1YS4A 1WLSA 1DRJA 1XYVA 2H9YA 3T1TA 1QIFA 1JECA 1SB8A 1WXHA 2JA2A 3T5AA 3QP9A 4TV8B 1WMEA 1P1FA 4F8YA 1V8FA 5LOVB 3X1MA 5IT4A 4PY2A 3EH2A 1ND6A 1T6ZA 5EYPA 2G9NA 1P45A 4DLZA 3COZA 4OYHA 4M87A 1AN0A 3HHPA 3RNOA 2I3AA 1CEYA 1JFSA 3PX7A 4L4SA 5DYGA 5JDIC 1XMOB 5HSGA 2PX5A 1ORHA 1XK6A 2QPOA 1WB9A 4NXMB 5KYNA 4HX9A 1JE1A 4G97A 1B4DA 3I8OA 4UHJA 1KI8A 1U9CA 5AK3A 2HR1A 4B3SB 1M6YA 1JKXA 3QEKA 3RF7A 4FYYA 4ZV4A 3ZXYA 1RYEA 1Y3IA 1J1UA 3N2KB 3KXLA 2HRDA 4XR9A 3EBOA 4HAYA 1GD1O 4HFMA 4KG7A 4O33A 5EQDA 5JNRA 1XXHB 2FTKE 1P18A 2AKAB 2F3SA 3NOXA 1D09A 1X3SA 3O4RA 4RTJA 4LJAA 4V0RA 4RY8A 1T5SA 4W5JA 1VLHA 2DKFA 1E2NA 4PQEA 5JWHA 2NXNA 3AO0B 1ZESA 3EA5A 3EMDA 1ZVMA 1YSCA 5CTJA 4E88A 1ZRSA 4LZJA 2HGZA 3L7LA 3L4JA 5MHTA 1ONPA 3HJGA 4DDWA 5EIWA 2JFOA 1JJVA 1QZTA 4ENSA 2AYZA 5FPQA 4Y9SA 3W5VA 1OLOA 4DW8A 1E18A 2I1VB 5FUQA 1LSJA 2CLMB 3UK6A 4KX3A 1HFWA 4G41A 1ACMA 3DDNA 3GN1A 4YNBA 1VGVA 3SSAA 3W0LB 1GRCA 1H0KA 1QO0D 5KSYA 3EXHC 5GZ1A 2Y1DA 2XRZA 1Y8QB 2JCYA 3I5UA 2XXBA 1EFAA 4B76A 3H0EA 2VPTA 1GYQA 2V7QD 3HJBA 1JA1A 3U7GA 3UF0A 1K4YA 2GAAA 1T9HA 2JASA 1KIAA 3UXHA 1FTNA 3GJSA 1OLXA 4KWCA 3P2JA 3STHA 2Q21A 2QIOA 4OHFA 3L4EA 1T0HB 3W3AA 4H0FA 3KVRA 3CLRD 4XYMA 5DJ5A 1J2RA 2ERYA 3LQRA 4PINA 1E6UA 1QK5A 1EBFA 1WM1A 5CM2Z 4L8GA 5FHRA 4B6SA 2GKOA 5REQB 3JVDA 4JBNA 2X76A 3PVCA 1ESZA 5HDQA 1M2JA 3UKJA 4AUKA 3L7MA 1Q3TA 1ZEJA 3DV0A 4RVDA 3D7MA 1HSZA 3P7MA 5HQ3A 2C95A 4HLQB 1QB7A 2PUHA 1GAWA 1HF3A 1MRZA 2Z1NA 1DRUA 2G5GX 3O2QB 4ZVMA 1G9TA 4CTOA 1XMJA 1ZOIA 4DYHA 2NPIA 2M6RA 5AXCA 4Q24A 4PTLA 1E1RD 4AUMA 4RPJA 3QY9A 4MHSA 2FMKA 3U37A 2YJGA 4L16A 4FEEA 3M5WA 3AXSA 2XKAA 5DT2A 4AG3A 4UFPA 1PEKE 2VTDA 2HRBA 4OKIA 3ZU3A 1HDIA 3UPDA 4FXOA 2DSTA 3ZS9A 4FI3F 4URUR 4UATA 4F46A 4FDMA 4LV5B 3B3QA 2HFKA 4Z3KA 5HS6A 3C70A 2C4HA 3ICEA 2WPDA 3VYWA 1FF9A 4EI7A 1MEOA 1CC1S 2Z2XA 4NBWA 3H9CA 1J70A 4OL9A 2H4YA 4WERA 1KU6A 5BO5A 3RYTC 2XZDA 2G06A 3GLTA 5H4GA 1ECGA 5KDDA 2UYCA 2B1GA 2CCKA 4GWGA 5EWLA 1Z82A 3N28A 4RSMA 4BO6A 4C4AA 2NZUG 5IZ4A 1MR3F 3PPYA 4B8YA 4CETA 4Z4FA 3N5CA 2JI7A 2G25A 3FKSD 4GU5A 3VYSB 2V0NA 6Q21A 4F4IA 4INAA 1TM4E 1DBQA 1T1JA 3SHWA 3UJ7A 2OB2A 2D06A 4G81A 1Z4PX 1J97A 1PAUA 4X8MA 2BM0A 1C3LA 4FWIB 4LRTB 3E27A 4DQ0A 4DMKA 3VR4D 2PU7A 4IIEA 4UFOA 4XIJA 1FNBA 3NHMA 2GARA 2YMPA 3P19A 4C0HA 1XTRA 3I2JA 3KT0A 3W4IA 1JHAA 2ZIXB 2F48A 3SY8A 2GPWA 4DMRA 1SD5A 1X80B 4QPDA 4X6UA 1L5LA 5FWXA 1PV2A 2Z57A 4QGSA 3DT9A 1M8FA 3TO5A 1K2WA 3EAQA 5CNMA 3GVPA 5FH9A 3E7XA 1KI9A 1NATA 4CEIB 3C41J 3OQIB 5DYNA 3UV6A 4DHWA 5B4TA 2QE7A 1CVIA 4BQNA 4IZ6A 4R4JA 5AVOA 3P2YA 2QPLA 3I8XA 1BOOA 1X7WB 3U7IA 1SPXA 3AR3A 4IDOA 2BF4A 2KB0A 3ZOZA 1XDDA 2CLFB 2W2KB 1HDOA 5HRAA 1QC5A 1U8FO 2G0AA 1CEXA 3SHVA 2Q2OA 2QU7A 2QL5A 2QRMA 2YBDA 1ZOOA 2W7TA 3DYBA 4JOQA 5DBEX 5ANRB 1JX6A 4P33A 3SQDA 1ZC3A 4JVSB 4E1BA 1T8UA 2DPHA 1YULA 3V7NA 4YXWD 1KAHA 5SY6A 5K6AA 5JROA 4QU0A 3W6ZA 4D26A 4QASA 2RH4A 3OCCA 1F2DA 1TYEB 4MKHA 1MP0A 3LC0A 3U1TA 1K3FA 1X9GA 3PWTA 4G84A 2P1ZA 3T7SA 3GCXA 4US0R 4QXMA 3QXXA 4HNSA 4LFAB 2C97A 1MVLA 2O7NA 4KE7A 1GZDA 2DGDA 2GJ4A 4OQPA 3VC2A 1FSGA 5DNCA 1B41A 3BWYA 2VZ8A 1YRAA 3AIMA 4KZKA 4XQGA 4IIYA 2NO5A 4GOJA 1NXVA 4Z7NB 3KKMA 5IH7A 3MS4A 4CLRB 4X6YA 3WLSA 5KSWB 1YGPA 1J4AA 4R01A 3HCBA 2PGXA 2AT1A 1YF3A 4BQRA 3MQ2A 4UTOA 5HWSA 4JA2A 3K20A 3A6ZA 3PP8A 4FFLA 4P4SB 4NQRA 4ETNA 1SCJA 3GH1A 1E8MA 1FL9A 3DNFA 1QH1A 3R9KA 4QT4A 4D9GA 4GAEA 4IOMA 3EIHA 1Z5WA 2PANA 2YY6A 3M83A 1DJLA 2EKPA 4FE7A 3ZJ4A 1TVKA 4IHJF 4DM7A 1XCJA 4F0JA 1LTHR 2N42A 1UM9A 2WJ4A 4YRQA 5EKXA 2ZRQA 1NUPA 1ESDA 2Z4SA 3W79A 5IPFA 1TIBA 4V1CI 2VP9A 2I4TA 3IV7A 4E7PA 3TLAA 2C7VA 3T7CA 1WUJS 3MB8A 3IDAA 3HM9A 1Z33A 2ZJFA 1TA0A 2D5IA 2ZETA 3KEGA 3QQ5A 4TQUS 1DHTA 1ODTC 4UARA 2A59A 1P7CA 1LQUA 2R7AA 1TFRA 3N3BC 2ZKIA 4A6DA 2Z3VA 1Y8RB 2RI6A 3L6EA 1WNFA 2JLBA 2C5SA 1G8PA 3QOXA 4Q48A 3ZZNA 4E7OA 4B45A 2ZTMA 1PSZA 2JI6A 2H1FA 2RGEA 3B2NA 3LOUA 1LWNA 4ZU1X 2UV8A 3WWOA 4MCJA 5ADHA 1TCVA 3NTRA 2O3QA 3U31A 1XNRB 1G1MA 2ZVDA 4PICA 5FBRB 3WA6A 4LDQA 4BKMA 1YU6A 3PX3A 2FRDA 1OX6A 1V2HE 4ZT7A 4UUPA 1AY0A 1DBSA 4EH1A 4ZYLA 1RBQA 3PBKA 2P8SA 2VHEA 3DMNA 4HUJA 3VU0A 4ZIRB 5FQOA 2Q3JA 5HZKA 1KO1A 3Q8XB 1GEEA 3IHTA 3VDNB 3F5DA 5GV8A 4R9RA 5AT1A 7MHTA 1F5NA 4RIEA 1SM4A 1VIDA 2DHRA 3ORSA 5SICE 4WDRA 2JATA 3UA4A 3FMPB 3EGOA 1P5JA 1X1QA 2IIVA 2QGFA 4LZWA 3GBSA 4PFSA 4XIIA 2Z5VA 5AH0A 1YR8A 4MI6A 4ZDIA 3IDZA 3MD9A 1NVWQ 2IXTA 3MTGA 8ATCA 4KNYA 1JDUA 5JYDA 2CGEA 3N2ZB 1S7CA 4LQDA 4M1SA 1YJ8A 2QP3A 5AVSA 1H2YA 4LDJA 4LHYA 4WZZA 2QYSA 3NHAA 1BGWA 4Z86A 5ENVA 1HNWB 2RGUA 2YXDA 3K0AA 2G0TA 4R2XA 1N1DA 4BLPA 1EUCB 3OEWA 2OVFA 4ZYZA 1VHQA 3RK4A 3G2IA 5KTMA 1W88A 3G2HA 3HY6A 4G0ZA 3N7TA 1AXGA 3LDGA 3NTVA 3T15A 1YJXA 5C9ZA 2IF0A 1I2BA 1O96B 5DCLA 1PR3A 3CC8A 1ZUHA 2CDBA 2QMHA 2WAOA 4TRJA 2YN4A 5I7FA 1SCNE 4U8GA 5FIUA 4ZOAA 3SEZA 1L5QA 2O54A 2FSIA 2H4WA 2YN2A 1VG0B 3I12A 4CNQA 2VP2A 3O9VA 4DBLC 2ZUSA 2ISSD 3RWBA 3SIXA 3QZUA 1TKCA 4UJ3A 1V11A 1EEXB 4ZQCB 3AHEA 1MABA 3Q1KA 5A2QA 3ADPA 2XJ9A 2BGWA 1NLFA 2H8KA 5E7QA 2P4SA 3Q9NA 3SJ7A 2NO6A 5H0IA 3MOIA 3F90A 1VPLA 2Z5LA 3S2IA 3T3IA 1O5OA 2NUTB 3IT1A 1NR5A 4W5HA 2QQEA 1I7SB 3TW0A 3PNKA 1DX4A 4DQKA 1V26A 4UVEA 4Q9JA 1VBNA 4HADA 1GTRA 3C98A 3IIKA 1DC8A 3LT4A 1YKFA 3B6JA 5FR1A 3BWVA 3ZKAA 3CLUC 4QBHA 4A8TA 4S1TA 1QG6A 4PRKA 3CNBA 4TYMA 4BQFA 1Z0ZA 3WWCA 1MJGA 2ZXFA 4H1WA 3I9OA 2ATEA 3GLGA 4Z7JA 4I8XA 4PHGA 3MJCA 1N1GA 1JDZA 4U7PB 1RPZA 2QW1A 5D3KA 4YQZA 2OORA 1OCEA 3SCZA 1SZCA 3B36A 1A69A 3GX1A 2HQOA 3PJGA 3UK1A 2O2CA 4XRRA 4CF6A 2D5BA 4A9AA 2RGWA 3ND5A 3VRHA 1XVIA 2W6MA 4O4JB 4ZYXA 3VXKA 4COOA 3D4OA 4ARBA 1R9JA 1GN9A 3D0KA 4OYYA 1D2HA 1UPUA 2GJ9A 3F6EX 3PE4A 4WXHA 4Q4DA 1YQEA 4KAXA 3DEYX 4E08A 5BW4A 4YREA 4BB9A 1TUBB 5A1JA 3OTGA 1C4OA 1QP0A 3N0RA 5DBGA 5HCIA 4R2KA 2FK7A 1I2DA 3NVAA 2UYQA 3HJNA 3QEOA 1ZJ6A 1BJTA 2XZOA 2GI4A 3HUEA 5LBTA 3Q9LA 1E1YA 1JXOA 1P9RA 1GGFA 2IITA 3BGDA 3EMVA 1UJ2A 3HBAA 2Z3ZA 3PQDA 5J5AA 2CHVA 3VR2D 3FUTA 1NE2A 1QMPA 1WMFA 3BH7A 3H2GA 1FDIA 1AQ6A 4EL5A 1GTMA 3AUKA 2QN9A 2PBZA 3TDKA 3DWFA 3EXFB 5HQTA 5EGNA 4NNJA 5LDGA 3T34A 4DIFA 2GBGA 4I50B 3A32A 5IKXA 3U7RA 3UJAA 2WIAA 3AUJB 4RYLA 3LKBA 3MT9A 2C03A 2I65A 1T9KA 4M1TA 3BICA 4B31A 4WA8A 1BFKA 1IZZA 1JIQA 3K0FB 3N59A 2DR0A 4B3HA 1R5BA 2XQKA 4MH0R 3GQBB 4IMIB 1NXXA 2VPWA 1J1ZA 1RWOA 4HX2A 5T4FA 4DWOA 2VSNA 4WK4B 5LZ4A 3DF9A 5LNK6 2V7TA 3QE4A 1OX5A 2YV4A 1UDXA 3RKRA 3RYIB 4AQ7A 5JJLA 1U7HA 2WABA 5CBPA 1RVV1 3PQ8A 5AI6A 4IRUB 1KTIA 4Q4JA 3ZIAD 3FDXA 3H2HA 2PLFA 3QPUA 1PQPA 2XMQA 1YD7A 3JQFA 3L7KA 4Z4HA 1HTTA 3HY4A 3NDRA 3RTBA 1VJ5A 4BMSA 3GGDA 4BQSA 1TZJA 2JIQA 2XKKA 3L8MA 3QWBA 3QYPA 2RKOA 3GO4A 4X92A 1K5PA 2BF7A 2PDAA 2HHHB 4BTEA 1ATIA 3L0BA 1RQXA 1X1CA 4YN3A 2QT9A 4PYRA 1W7AA 4N7JA 1ESCA 5CFRA 4EJ0A 2YR0A 2ODPA 4IQFA 2H9AA 2XBUA 3R3UA 2A88A 4ALIA 5CVEA 4LI0A 4S04A 2IHBA 4FZRA 5ITZB 3S2ZA 1E5DA 3JZAA 3L4BA 2UUAB 4KB5A 1N2CE 1MD9A 3QPCA 1H05A 1T5DX 4XJVA 3SLRA 4RF3A 3IAUA 2RAFA 1NXWA 1X1BA 1XTPA 3FHCB 1UMCA 4FYMA 3SPXA 2D4HA 2PTHA 1YTUA 5J63A 3RABA 1P4RA 2G82A 3E82A 3Q3GE 3LOQA 1CUYA 4ZCRA 4BNXA 4AURA 4Q5IA 4G25A 4B3GA 2IS6A 1U2PA 5IC5A 5BQOA 1D03A 2CLOB 5KJCA 2P0AA 2VP4A 2BHTA 1NOKA 3PXXA 3ACDA 2WMOB 2BMWA 1WUHS 5LLTA 1V4VA 3GVCA 3UK0A 4TYNA 5TF4A 3JQAA 1FDWA 2DKNA 4LSGA 5IVPA 2B2CA 1SBNE 2IEBA 3LW8A 1N3YA 2JDID 3GJQA 2V3VA 1JFVA 4TMTA 3IJRA 4H08A 1E9AA 4AKEA 4DA6A 3FBGA 3KUKA 5IAEA 1QM5A 5HKLA 2QSZA 3ROEA 1HLGA 1NPYA 3LVBA 2FN4A 4UE2A 3R9WA 1YQDA 4Z4IA 4YRFA 2ZM6B 1DELA 4RD3A 3OZIA 3IBTA 1NXSA 4RK7A 1ETUA 4QQNA 4F3KA 3WXMA 2WJWA 4IUCS 3HP7A 4B3MB 3WISA 2O7VA 1G8JA 2BHSA 3AM3A 3T1HB 2GPAA 2FPOA 4D5GA 4MVJG 3L43A 4J3NA 3ZD7A 5AKXA 3UNXA 2VHXA 4I1UA 1CUCA 1IEXA 2OQVA 4I08A 4BP1A 4IP0A 2QF7A 1NXPA 4EY6A 2Z08A 3DL4A 1XMXA 3DKPA 1WPGA 2FN9A 3DMHA 2GZ2A 4PZUA 3SZGA 4DZZA 1JG6A 2P0EA 4LHZA 4QVGA 3DVSX 4KFUA 5HM6A 3FWPA 4BLVA 4DCTA 4R8LA 2ZYTX 4ED9A 1U3UA 4H1HA 4K3UA 3Q88A 3TMAA 5KZMB 4N47A 3HBNA 4DA8A 1UZLA 3T7RA 1N9KA 3VTAA 1A76A 1L0BA 2OO5C 3O94A 4ZTZB 4ZOEA 3BG5A 3ZDEA 2AZTA 2AOVA 3UK2A 4N5LA 3BQNB 3CLRC 1C0LA 4BRSA 5AW4A 1Z2EA 2J9RA 1N7IA 3IE0A 1JDPA 4DV2B 3TGWA 3B53X 3IX7A 1MB2A 1RABA 1ZSYA 2FEWB 4MGKR 3LG2A 5CT4A 3DAHA 1GKIA 2L18A 3MGBA 5C1DA 5LDDC 1G21E 2H7CA 4KLRA 1S96A 1Q7RA 2CLCX 2KS6A 1T3GA 1UDAA 4IFTA 1EFRA 2YFQA 1XALA 1S0UA 1GRQA 2JK1A 2OFWA 3LT5A 4ZAVA 3RVRA 3JQRA 3ZWNA 4JOCA 5J4KA 3N8NA 4JENA 3TEMA 1EWYA 1QXSA 1N5RA 4Q1FA 2O3SA 1T91A 5K99A 2GFIA 3FPSA 3K16A 5FV4A 5DM0A 2X8BA 5HXAA 3U7QA 5EQFA 2D7CA 3KTAA 3MW8A 1E58A 1WU7A 5K45A 3QRWA 1RYHA 5CVJA 2XGGA 3RI3A 1P73A 2GUWA 3WIUA 2HREA 4HNUA 5IARA 2MCFA 5L6MB 3H05A 2G0NA 4UNQA 2C3OA 2O3TA 3PYMA 3BORA 4R68A 5B2ZA 3H9JA 4EFNA 2ZTLA 2WNSA 1PLJA 3AEXA 1BX0A 2QJWA 3DTYA 1HOTA 3GZNB 2FGJA 1UJCA 1A9XB 2C2WA 4YRSA 1S01A 1VIVA 4B7XA 5JOQA 3PJDA 3UHFA 4UHEA 1GCIA 4BDTA 1EK1A 1QQ7A 1QWSA 4WBNB 1W0CA 3QUBA 3KP1A 3Q6MA 5FL3A 5TS3A 3VTZA 3D8SA 3H5NA 4EK9A 4D8WA 1MQ8B 3PF9A 2JBAA 3UUFA 3DA8A 3VI4B 4PCAA 1L6IA 1D0IA 1RM4A 3ZQ4A 2WWFA 3QE3A 2UZAA 1NVGA 4KE6A 3ZZ0A 1RM0A 4BB0A 2J41A 2C2BA 1EU1A 3DZDA 1HO3A 5B2FA 3IOYA 3ZDFA 4QJ3A 5JTUA 5BURA 4RTRA 1H6AA 2NQ2C 4BVLA 1GQOA 4ZT3A 4KWHA 3R3HA 5IKOA 4EAAA 1CY6A 2BFBB 2G77B 2JJ8A 3GT7A 2WOJA 5CDFA 5K9ZA 2Q49A 1XTUA 3O8BA 1Z37A 3OIDA 4C89A 3MCUA 2QTCA 2WE8A 1BTOA 2XZPA 3HDVA 1IMJA 4ZAWA 2C29D 2FMUA 1SU4A 2V6JA 3I1JA 1KOGA 3HSYA 2I2XB 4MLDA 4UNRA 3TZHA 4GL4A 2GEFA 1LNSA 3QM1A 4X54A 3E48A 2JGNA 1RM5A 2FJ0A 4F3NA 2G4VA 3D2LA 1T2FA 2H6EA 2YNMA 3GVXA 1XP5A 3PQ2A 2DBRA 4L74A 2HJRA 5JMPA 1R27A 2R7LA 1UBEA 3AYZB 1MOQA 3D6VA 3NHFA 2B37A 4QHTA 1I4LD 5FWAA 3FNBA 2HO4A 3ITDA 4D3ZA 2GPBA 4YRKA 4MTCA 4N9QA 2ZK7A 1CFJA 1VPDA 2I76A 4RO0A 4I1YA 1NUAA 2R6CA 4XI9A 3RB8A 2GM9A 2A1UA 3M6LA 4MUGA 4Q1AA 4U39A 4BWYA 4YPFA 2MOKA 4C3UA 3OEEA 2HJVA 4EJSA 4AFNA 3WB0A 1BH2A 3I5AA 1CVLA 2EJWA 3ITEA 3EIOA 4BVBA 6REQB 4QM7A 4EGFA 1P0IA 4ZO7A 3DXXA 1XB2A 2JIOA 1E3WB 1C30B 2BCGY 2GK4A 4G4JA 5KYTA 1HRDA 3DBRA 1JR2A 2EEZA 5DH9A 1O6BA 4HZGA 3FZYA 5HE9A 5H82A 1EUQA 1IMOA 2D6FA 4BNKA 2H4JA 1KZGB 4MQ6A 3QKSA 3U3ZA 2YZ2A 2C4VA 2FPUA 5K0LA 4IXNA 2QG9A 3FYTA 4LXQA 3ZWCA 1FNMA 4HP8A 4QOSA 3H16A 4TTQA 2X2EA 4X1IA 4AX8A 4Z2AA 5G1NA 4BKQA 3OQNA 3QEJA 1S3IA 5A7GA 5A0FA 5KINB 4ZO9A 1BMFA 1C9YA 1O2DA 3SSMA 2I6SA 2C04A 4RFSB 3HA7A 1BMTA 1NQ5A 2OFPA 2VBGA 4N8SA 2O52A 3H04A 3EG5A 1Z4MA 3HXKA 4I1VA 3H1BA 4OD0A 4B2LA 4MLZA 1C9NA 3HXPA 3KALA 3CXUA 2BFFB 5DWDA 1N33B 4ZVQA 3E1KA 4YO7A 1FLDA 4NR0A 1NIPA 1YRYE 1V5WA 1L7VC 3O21A 1RKXA 3TL6A 1C7FA 4HH0A 3IUYA 2WPNA 1JG7A 2WPDD 1P9OA 4BNHA 5ICMA 2E5WA 2RHCA 1OH7A 1Y8CA 4QDZA 4E3WA 5J2TF 3T9DA 2BMVA 2IELA 2OESA 3KPJA 4O08A 1U3CA 3PNSA 3F96A 3A9RA 3GRYA 4FI3C 1HR0B 2PUVA 5FOWA 2H2AA 2JCXA 2P5YA 4CBVA 4ARCA 1JA0A 5IJXA 2ZUUA 3EQ8A 4PYOA 4RD2A 1FVOA 1NY5A 2G76A 4YJKA 4CFSA 4HVCA 2GEKA 3FDZB 2EGHA 2LIVA 3HLTA 3NONA 3WMFA 4RV9A 4P2GA 4ZKDA 1NQXA 1S1CA 2JFXA 4DIBA 2PX2A 4TV9A 4D0GA 3IP3A 1BD4A 1AUVA 3KYCB 5LZ8A 4B3IA 1EFVB 1RQRA 3NKLA 4XEHA 5IJWA 4X1KB 4X8HA 1OY1A 4JK3A 2E1PA 1DINA 5IDVA 3M1IA 2RBEA 4ZODA 5EHNA 3V55A 3PNLA 4ABYA 2PLWA 4PIVA 5CXQA 2NZYA 3H1GA 3AIKA 2O7QA 3GT0A 4L9RA 5JZBA 4X65B 3TIVA 1MB0A 3CHYA 1QRRA 5EZYB 4F5WA 2FSHA 3CRVA 1G60A 4W8HA 4JI7B 2XUQA 2NP7A 4I4LA 3GUHA 1Y82A 1T25A 2RJNA 3BDVA 2I03A 3KDAA 1K1EA 1ISJA 4Q6WA 4JBLA 2QJRA 5LKRA 1KH1A 1QR2A 2HDOA 1DKRA 4YMSA 5ALFA 5E95A 5K1ZA 4ESVA 1RQNA 2B3DA 1P81A 3GEBA 3PEVA 4QTXA 4LXXA 3GD5A 2PO7A 3ELWA 2GB4A 3AONB 1IQRA 4G9BA 4KPEC 1DT5A 5DI3B 4WEOA 4G37A 3V4LA 3CO5A 2X0RA 4ZGWA 5C8DA 4BZZA 3W2IA 4NCHA 4OJYA 2WWVD 4PO9A 1E2EA 3WSVA 2O2XA 3OFKA 2XOKD 3ZE7A 4HHEA 2PGAA 2DFVA 3CIFA 4I14A 1X9HA 1Z7YA 4YACA 1HYHA 4KQ9A 2IPAB 1UJ6A 4JP2A 1BA2A 4N3CA 5E9WA 4M8IA 4NS1A 4YTEA 4G5SA 2OGZA 1H1DA 3LUKA 4YJ2B 3K6SB 3S27A 3I92A 3KZKA 3SD7A 5KYGA 3NCHA 4X97A 2OCPA 3GGGA 4KPUA 3NEYA 2JVIA 1COWD 4UCWA 1U8TA 5FOVA 5JQGB 2XITA 4E03A 3UZUA 3D6UA 5CXSA 1QIDA 4D9HA 2YWJA 4G9GA 1NF8A 3BCHA 3R3JA 1UJ5A 3EWNA 4UJ5A 2EYUA 1BHO1 2G70A 1OLUA 3ONWA 4DV4B 3HZOA 2HYDA 3CGGA 1VKJA 1B6RA 5KOHB 1DCTA 1XDUA 1SCIA 1BGVA 5A9SA 4JJ4A 1VG8A 3ABQB 3STUA 1YQ9A 2AFHB 4C9BA 3EFOA 3E2IA 2EWWA 1C8VB 3R5SA 4YQEA 1ZITA 4N1AA 2CNLA 2IHUA 1S3FA 4B7UA 2ZI4A 4AD8A 1ST2A 3UV7A 1NNEA 4M4SA 3BJEA 1VZ3A 3RGGA 3L0PA 3G1WA 4HDSB 3WGLA 4CR8A 1ISGA 4Q02A 2IVZA 3QWAA 4LY3A 3QWHA 3GNSA 4UBLA 4BE4A 2D74A 3LZCA 3PDWA 4AP6A 4IINA 3JQ9A 5EP4A 3U7EB 3INRA 2AB0A 4WD3A 1ZOLA 1XTVA 1IWPB 2VVTA 1UP4A 3L5KA 3D0OA 2DUWA 3Q7RA 4G1MB 1KMQA 2CVQA 3ID6C 1R6AA 4DJTA 3QVMA 2FPWA 1P39A 3JASB 4PYMA 5A4JA 3R75A 4KRYA 5I7HA 4PWYA 2I6UA 1D2CA 2Y0PA 4D42A 4B6PA 2YJNA 1F2TA 2YVQA 1W0KA 4FFNA 3VO9A 3ZHTA 4XYLA 3OQVA 5EJ2A 4F2WA 3RARA 4MV1A 3AB8A 3VFDA 1ARZA 2FP3A 2NOAA 4ZZ2A 1NHWA 2BTEA 4XWOA 3FCOA 2OHFA 3EIFA 4L51A 4YV0A 1TZCA 3DAFA 5A0VA 4C6TB 4AL4A 1F2UA 3B1KA 4XJXA 1KI7A 3GG2A 3W1WA 4CKBB 5JASA 4EY7A 5K3DA 1J8MF 3C8MA 3HI4A 4BJ6A 4A0QA 2BPOA 5HZGA 2YASA 3DFKA 4IKOA 3NHZA 5F4ZA 3F1LA 3OFVA 4TUYB 1EA5A 1UPTA 1XK7A 4PPQA 1JZQA 4BNDA 5D00A 4EMBA 5LP6A 3FGZA 1T2VA 3R74A 2PN1A 4IHAA 4HWGA 3AETA 4YV1A 3QELB 3G0OA 2O8DA 1SKBA 3R8XA 3SC3A 1ODJA 4BKRA 4N7BA 4TTPA 3TEJA 1WUTA 2Y1KA 1V39A 5E4YA 1AS2A 1IHYA 1SVMA 3OT1A 3E35A 3ZV6A 1S8NA 3IOBA 2IW3A 3MS7A 2WHPB 3THYA 1BVHA 1QG2A 3WHLA 4RHCA 4OFXA 1QFYA 4ZEXA 2XWQA 1J24A 3MVEA 3DP7A 4Q21A 5HF8A 1T2CA 1T0IA 2PUJA 1W4ZA 2OCBA 1S2DA 1Y5MA 2HEGA 5EWJA 4GO1A 1SRRA 4TZTA 1ZK3A 4NCBA 2WAXA 4FONA 5C18A 1SUEA 3KM0A 1W5FA 2NSJA 1XXHE 3UQZA 4A82A 3ZH2A 1XSEA 5BN1A 3SR4A 3FPEA 1CUAA 4DN6A 4WKOA 3RC2A 4UTVA 3VA7A 2B78A 1I32A 1KYWA 2WILA 2NWQA 1NSFA 2IXFA 2BHRA 2RHDA 3LSYA 1TM7E 2O2YA 2O20A 1OF1A 3EEBA 4CF3A 3OX4A 2B98A 5EE1A 4EO4A 5LIPA 1ONSA 3Q7EA 4C04A 4QU9A 2QL9A 3VNQA 1JLLA 5AW9A 3G2NA 4ASUD 3DBOB 4EL0A 3ZGZA 4BGDA 3DLAA 4JT2A 4IMRA 1UK9A 1T6YA 2J3MA 4RTQA 3L0DA 2CVOA 3BEDA 4JH0A 3SXPA 4KMMA 5EEGA 3J80A 1Z07A 4FSHA 4AICA 3UT0A 1BQEA 2Q45A 3IEUA 3K72B 1IAVA 4PHHA 4DA0A 1OSNA 4YUWA 3PPIA 3SN6A 1A4IA 4UU0A 2H2IA 4BWFB 5ELXA 3LGSA 3E9MA 4BHTA 3MK31 1RBYA 1WUKS 1SA0A 1LGYA 1GJRA 3A6JA 4FR2A 1GVHA 4KOEC 4HDRA 1YFJA 2ZBUA 5D5QA 4LQ4A 3RJMA 2A9PA 3HJCA 3I6MA 5G4KA 3UMVA 1Z2OX 3CSUA 3KLMX 3NLLA 3TXAA 2QUKA 3KOOA 4JN6B 4IQGA 1QLHA 3I4FA 1FUYB 1O4VA 1JHUA 1YR6A 2PUWA 3DZBA 4HNVA 1RWXA 3KIPA 1EFDN 1LCIA 3D1JA 2WYHA 4X6LA 3UA3A 2X2PA 4BMXA 1RI3A 2V65A 1WZNA 2QSJA 4PXSA 4R1OA 3RS4A 1WX1A 5FX2A 2I8CA 2GT1A 3TLXA 3LT1A 1Z47A 1IXRC 1R5JA 4YP0A 4OQMA 1SCUA 2X77A 3L1UA 2X41A 1C0PA 3KB1A 3GWZA 4N6NA 1KVQA 1IIRA 3EXEA 5CIYA 3CEPB 2BFDB 4D97A 3AF2A 4LJ8A 1SFRA 1HWYA 3KELA 3QHPA 3RD5A 3FOBA 1NJ2A 4OP3A 5JD5A 5FBQB 4XWGA 3TW8B 3IV9A 3LUGA 1HFEL 3II6X 1XHLA 2FEAA 3UMGA 1U0TA 3AKEA 3REGA 4LYYA 2CHGA 3KVNA 3DWGA 1Q11A 1KR5A 4JC4A 1FDOA 5CMLA 3ZU4A 4EKYA 2QGNA 4M9UA 1VIAA 1WV1A 2JS7A 3EF1A 4IJKA 1QG4A 5KNLA 3ADKA 2P7HA 1O7JA 3PVZA 5A4IS 3O8CA 1STOA 4UNPA 4BFZA 3IVCA 5JO9A 4UQLA 1AIPA 2YIDA 1P6UA 5C0OE 1S2GA 2P77A 3IIJA 2K7FA 3AJ9A 4XDGA 5JH7B 4JQOA 1PKXA 1IXKA 3FWKA 5CJ2A 3R7SA 2R79A 3A7DA 1VB5A 2PR7A 1DCKA 3TFOA 4OLHA 4X8OA 4KAJA 4RJIA 1QGDA 4ZT6A 4NYIR 1PX2A 2GILA 1GU7A 3DT8A 1DJQA 4XYBA 2QAJA 2QVBA 3IAM1 4P84A 4DUZB 2CFSA 2ZYGA 2P2LA 2OCXA 4CIVA 4CJXA 1NJ6A 1RMQA 2YWEA 3TNLA 5C80A 5JEDA 4GH5A 4QULA 2P68A 3HR4A 2OBXA 2NAFA 4TSKA 3V8BA 5AKLA 4M1ZA 3ZWMA 3NXKA 2HA7A 4AULA 4JVOA 7YASA 3FWNA 3ZTTA 3KAKA 1ZD8A 2QK4A 5BUZA 2E87A 1FJHA 4L5JA 5GVSA 5IT5A 1NHGA 2RONA 2VN8A 3QJ5A 4ILEA 3ZJYA 3QBVA 3T5PA 4LJKA 3BWDD 5DNUA 3A6DA 1W44A 2NW6A 4EKEA 1DKNA 2PMCA 4CM4B 3AR6A 4WPGA 2GA8A 5IYZB 3R8FA 2XUGA 2XLBA 2FWNA 1Z5OA 1T4BA 3KZCA 4TLCA 4CT5A 1SXGA 5YASA 2AMJA 4XA8A 1T4MA 3Q0IA 3DLCA 5CD9A 1KO5A 3IH5A 2I8AA 3PJFA 4P7JA 2I2WA 2Z3WA 4BGIA 5JFGA 3IILA 4IDNA 3D3KA 4G5XA 4AZVA 1CJBA 4JR2A 3V2IA 4L5AA 3M82A 1EAYA 2AD5A 4H18A 4WZ6A 1SUPA 5LR6A 3U4QB 2FOLA 1JHZA 2NU6A 2ZRFA 4GLFA 1WKBA 3NHLA 621PA 4K5QA 3CR7A 1RJWA 3IUQA 3RVQA 3GN2A 8ADHA 3DPUA 3G02A 3HV0A 4A36A 1D7AA 4RYDA 2EFCB 1KYIA 4DNXA 5JMWA 3EC1A 1P2FA 4HNAA 3WZMA 3TR0A 1G9XA 3FRHA 3T7EA 1Q16A 2JBWA 1WHSB 5SY4A 5I48A 5FWDA 5ESRA 1ULBA 4G65A 4IQ4A 1AKVA 2OBYA 4MW1A 2ZBDA 2CSXA 2X4LA 3LQ4A 1YK0A 2E85A 4CL0A 4OLBA 1FLVA 1SHTX 4Y6OA 3CH7A 3Q40A 5JCOC 3RVLA 1LLCA 2C7OA 4F4FA 1QYRA 4GI1A 1F8UA 3AGPA 2JZNA 3SM9A 5A2GA 1PUJA 4MRMA 3C6YA 4U4AA 3FSGA 1P9WA 5TMPA 4OTZA 2F67A 3H13A 1F0KA 3OPYA 4EG6A 4QPPA 3I6ZA 4MYHA 2NYVA 1E1DA 1HPLA 4Y3UA 2HHAA 2X42A 3OKFA 4LJ9A 4JUCA 1IUNA 5FBKA 4DLPA 5JS7A 4EB6A 3UMCA 1I10A 1QBGA 4YUVA 3VPSA 4HZIA 3CNOA 3VTFA 3FRJA 2HF7A 2VA8A 1H22A 2EP5A 4WXPA 2PL9A 4JVNA 4RVFA 5LZ2A 1XAJA 4BNTA 3E5MA 3QOFA 4MW2A 5TJHA 5AFSA 2YVLA 1H3NA 3C43A 1R0WA 2DLCX 1B0ZA 4L2IA 3USZA 3AILA 9MHTA 3QG1A 4L08A 1NW4A 4YMLA 2IZZA 1LW6E 1XZGA 4LVUA 5IASA 4MIEA 4DXAA 3MWYW 1IBRA 4HPJB 1FS5A 4XD7D 1ZGHA 1WCYA 1PCXA 3QLUA 3W4KA 3CVVA 3G0DA 4JU8A 3F71A 1Y3CE 2XCQA 4PLZA 1H0SA 1MLDA 3NANA 4HMOA 4C0AC 5JCPA 2NUPA 3NDIA 3B38A 3BMCB 3W8FA 2GN0A 5JR3A 3W5UA 4MVJI 4NBSA 1R64A 2R48A 5F2NA 4GMHA 1VL8A 4OREX 3K1ZA 2IYUA 4INPA 1KVRA 4YRCA 2BMDA 3KAQA 3VVLA 4LMRA 3DE4X 2XIJA 3BBPA 2AYXA 1DOZA 4V1CB 3A2KA 3WDLA 3OZRA 2FFJA 2WJYA 1N0UA 3EF0A 2ID8A 2IKQA 4MKFA 4TM7A 2QI9F 3HLYA 1Z4QA 2FWRA 2NU9A 2OG1A 3AFHA 1I7QB 4UM5A 4C2UA 2DFTA 2QD4A 2WD8A 3RIHA 3CNLA 2X6RA 3AH8A 4JP1A 1NR7A 1SU8A 2RHLA 4HXFB 4JUDX 4BLSA 1SQFA 1UMBA 1O1YA 1KWGA 4WLVA 1VGQA 2OY0A 3JAKA 3E9NA 3X2FA 1AQUA 1NUTA 1ZNYA 3BE8A 4TV9F 3MEQA 1Z2CA 4FDVA 4PO1A 1TTPB 1Q0QA 3GA0A 4GMGA 2Q29A 4RWEA 4KDEA 4P7FA 4CUKA 3NBQA 2TMKA 4UBNA 1WW2A 4IGEA 2VZ0A 2O5CA 5K3FB 3DVAA 4HFNA 1HDZA 3M9WA 3M6UA 4ZYVA 5JXJA 3CF4G 3ZQJA 1P6QA 1V41E 3G8AA 1F51E 3G9ZA 3QHAA 5TMEA 2CXQA 3EXG1 3TDMA 3D7RA 3GLHB 3PWZA 4MR8A 4XPZA 1DTWB 1H9AA 4AAYA 4LF5B 1N2CA 2CXUA 1Y9AA 2YZGA 3H2BA 3LT2A 1YBAA 4WBXC 2PLNA 2RHJA 4K9KA 3WKAA 2EAUA 3Q0TA 1NI4A 4DUYB 2JEZA 3OECA 1TW2A 4QBTA 2CCGA 2GN8A 4MWCA 2IY9A 2J5RA 2WUVA 3ZW7A 4TLMB 2VWGA 3MD0A 4BV8A 5I9TA 1Z06A 3ZVKA 1FW8A 1U6IA 2A67A 4MUJA 1XRSB 2P2CA 4JLUA 4ZGBA 5CB6A 1V96A 1XO1A 2C00A 4N5IX 4X41A 1ZO8A 1M6VA 2DMRA 4I6EA 1FU8A 1H2AS 3L8CA 1LY1A 2VYQA 4C4ZA 2RI1A 3HKCB 4J75A 2OILA 2XYHA 5B7QA 3DOEA 1MV5A 1P7YA 1K89A 2XUDA 4G89A 2H7YA 4MEAA 3TQRA 2P41A 3ZDBA 2ID4A 5F7OA 4KKVA 4Z54A 4ND5A 1OFUA 2ZS7A 4KWIA 1RIFA 2A5LA 4EPYA 4GX1A 3PXBA 4RACA 5HKBA 1KQ3A 3PC7A 2IZ1A 2Q3HA 1LH0A 3I9LA 4A8JA 3VNBA 3H65A 1UBKS 2FN3A 4K8RB 4R16A 1E4EA 1X7YB 2BRUC 3OM0A 2PX3A 3BREA 3REOA 3BL8A 4C7JA 3EE6A 2JGLA 1BCRB 4G1VA 3CKMA 1N0WA 1Q0SA 4XLTA 1ENPA 1NBAA 4HQNA 2D1SA 4MRNA 1NLYA 3PC2A 1GA4A 5JCJD 4BNWA 3NX4A 5FBVB 3GLIE 1KP9A 1OAAA 3MLEA 4AZSA 3ZBQA 4CQJA 1QO7A 2EFJA 1DC7A 3OLCX 3GFQA 4TRRA 5L4SA 2KQUA 4JXKA 3ICQB 2I6TA 3L01A 2CVPA 2WJZB 2HKIA 4HGOA 1YL7A 1K3TA 1RPNA 4KC0A 2XECA 1A97A 4F5EA 1FFAA 2JJ1A 3A9SA 1KMIY 3D6AA 3F74A 3IE2A 4ZU6X 4YCNA 1YZNA 1TRHA 1GZ5A 1XRPA 1J5PA 2OV4A 1AKUA 3AP3A 3B51X 4WSOA 1QGAA 3GI1A 2OCAA 3ILVA 3N7UA 4EABA 1NW8A 2XCSB 1ABFA 1LS6A 1PVDA 3M89A 1DC3A 1I3KA 3I6BA 3TD2A 1BMFD 1U6JA 2QZZA 2Z30A 2RG7A 2ZYSA 3HRKA 3RU7A 5KJ6A 2B69A 5BSVA 1Q21A 3LQFA 4R3NA 2XLCA 3FF1A 1G21A 3ESZA 3PA6A 1SU7A 1WKVA 3AEQA 3HYTA 2JFPA 3VH4A 3ELUA 2C2GA 3MJDA 4FC7A 2CB9A 5I9SA 1USVA 3ZXSA 4V38A 1ENYA 1RZVA 1NLZA 2NZVG 2YHIB 4U7GA 3WBJA 4AJ2A 1E2JA 4ZCLA 3ZBPA 1WZCA 2UUOA 4FYIA 4AJNA 1LWOA 5EZ5A 3NJ8A 5EJ7A 4Y0VA 4OM8A 3W7AA 2XW6A 3C1OA 3GNLA 1S3SA 4U7FA 1QTIA 5AJUA 1YCHA 5F1PA 3G3EA 4AMGA 3T0IA 1L7BA 1D4ZA 5AR1A 3AQIA 2VXYA 4ER5A 3SFVA 2K7ZA 3K0CA 1UC8A 2XVZA 4JKYA 2M98A 1SR8A 5CTAA 3CG0A 1L4EA 1VLQA 1YASA 4V2IA 1V3UA 2RHWA 1RQ2A 2OG2A 4X62B 1ZZEA 4YT5A 1XPJA 3HGTA 4E2FA 1ANKA 4IJMA 2Z09A 4UULA 2VDLB 5LP6F 3HK2A 2H06A 3H9GA 4C6RA 1JF8A 1GPLA 2Q1SA 1ILEA 1QP4A 4LGVA 1Y37A 1GL7A 3GLFB 1E3SA 2HHLA 1EBUA 4EYQA 3PA8A 3N0VA 1Q7TA 1TYBE 3CLTD 5MGNA 3MOGA 1EFCA 1KORA 4KRXA 4CQMD 1TAQA 2WQZA 4YDQA 1JDSA 5ADWA 2A9FA 5L4LA 1SCQA 5DOZA 4KXQA 2REBA 4I1PA 1XCLA 4TMKA 5DPMA 3S3TA 2K6GA 4U2EA 2ZUVA 5EL0A 5BWCA 4GYWA 2XMSA 4JUBA 1ZVVA 2HBRA 3WNZA 4TRNA 5DIFA 3V8RA 1KZ9A 4QBKA 2AJ8A 2WUFA 4FYWA 1C1XA 4MVWA 3A0UA 4ZCTA 2A1IA 4ZJPA 1H9CA 4PF1A 2IYQA 3LWNA 3AM1A 2ZQYA 2P40A 5C8ZA 4OH1A 1YMUA 5EJMA 1DKOA 5JPIA 5F1YA 4AN1A 1W6UA 1EFLA 1J0BA 2DP4E 2W2NA 2WTEA 3QIVA 4H3KB 4IW3B 2Z4TA 2FYTA 1LB1B 2IUEA 2Z9BA 3D4NA 3GFGA 2INGX 1K4KA 3HCEA 3BK1A 3K5IA 3TZ6A 4UEQA 1W4RA 4LI3X 2Q3LA 3ABZA 1DQNA 4DA9A 1H2ZA 2LRHA 3NQ41 5E6SA 3FYCA 4BNFA 2XB9A 4LISA 3W8DA 2JCVA 4IVNA 3MB5A 2VQDA 1X1EA 2QTGA 1L5SA 1YB1A 3K4HA 3KQLA 3MXTA 3ZY2A 1RS0A 2PS9A 2FMHA 2RFLA 2K87A 2D7JA 2F43B 5IAKA 2PVCA 3TRJA 2XRMA 4PLGA 3G17A 5JBQA 1VSVA 2RGAA 1TEHA 1XVAA 1MO2A 5IT9A 1R9MA 1YB7A 2CHEA 1OUMA 5FHQA 5CX1B 2ONCA 2OD2A 4OKSA 4ENVA 5KNBA 4HS4A 1VMKA 2CNWA 5DP1A 2FX5A 2DBYA 5DWVA 3LLSA 2VRCA 4TMVA 4G8DA 4ZAYA 1XHEA 4V0QA 1N6LA 1L5HB 4R0NA 3VSEA 3VJLA 1LC0A 2I1LA 2CFCA 3GAFA 3UW3A 3RTEA 1FSSA 1L5OA 2GHTA 1AO0A 3HFRA 2HJ9A 1GGJA 5K8CA 3CV3A 2OORC 2WWRA 3QG5A 2A9RA 5H4HA 1M0TA 4GUAA 1X42A 1P60A 4TXLA 4Q9IA 3SF8A 5JEEA 1WBJB 4ERXA 1KMMA 2NZJA 4CTNA 3A3KA 4NPHA 1EB9A 1L1FA 1UIRA 3ON5A 4HTFA 5TC4A 1JWLA 2JLVA 2I2DA 3PI7A 4EKGA 1ZH8A 1MOPA 2CZCA 2JHCA 1JHYA 1DB3A 2O2GA 3G8BA 3ICVA 4YMWA 3T3MB 4E5UA 4F8JA 2I4OA 2V4ZA 2FJUA 3FWHA 3G68A 4KU4A 2PEYA 5AJHA 1G18A 2BI8A 2H5EA 2UUPA 1G3UA 4ZQGA 5FL7A 3OOSA 2IV7A 4EJFA 1WULS 2DHCA 3GRKA 2XVMA 3P4YA 3OIWA 2WM8A 1LBEA 1N2IA 2B83A 1M1NB 3MFYA 2XOXA 4FYHA 1DT3A 4BNJA 1JLRA 1ICIA 1ZN7A 5KAPA 5LXTB 4QLOA 4ZTBA 4Q3EA 1MU0A 4YR9A 1L7XA 5E9AA 1Z3IX 3ENNA 2F4NA 3PGKA 3G89A 4E4TA 5BW8A 5KHLB 2TMGA 1TU3A 4CGYA 1UADA 3FYSA 2XQGA 5L7TA 3NBZC 4F85A 1KH2A 1JALA 2QQ0A 1R6BX 1I6MA 1ZMRA 2R84A 1GIAA 5GOTA 2PPVA 4LZNA 4DV1B 1SQ5A 5AM0A 5DGCA 3JWGA 3A3YA 3ZUGA 1NDHA 2B9VA 3NAMA 4R9UC 1YNOA 3LBHA 1XEXA 1NJ5A 4RULA 5H7XA 5KBYA 1FSZA 1IB6A 3KL2A 2Z6AA 3NIFB 1XEWX 4M1YA 4MMZB 1M33A 1GGHA 2C77A 3CF0A 2ODQA 1Z74A 3BSYA 1ZGJA 4PTZA 5CYGA 3PPWA 3CNHA 4K3VA 2O4CA 1IBKB 1P4SA 4B3CA 2BELA 2CB0A 1JHRA 1ZRNA 3MMSA 1XZBA 2NPOA 4GX0A 4UTNA 3V8VA 1W2GA 4QA9A 3LKDA 4UEKA 3RSGA 4QXPA 4DJFC 4KXFB 4JVMA 5GV7A 4WVFA 1V16A 4FFSA 4MS3B 4MWSA 5HCNA 2BH2A 1GGNA 4KSYA 2P6RA 3A06A 3VR4H 1BS9A 4PC1A 1KS9A 4RMNA 3SWWA 4FFMA 3TZKA 4TTSA 5C34B 1FP7A 1OH8A 3CONA 4R3UC 4TLEA 3SLKA 2VNIA 4EBBA 1BKDR 1EFPA 4S2EA 1Q15A 2H2HA 1P0FA 2RCNA 4IH1A 4OHKA 4JB8A 3QBJA 3B8HA 4GLOA 1NJSA 1S7GA 2A0FA 5KQMA 2O05A 1JIUA 3PGJA 1ZCBA 1S4MA 1E1CA 5BN4A 1I13A 3MCWA 1FVFA 4BJ5A 4AG5A 1NUQA 2DHEA 1ND5A 4FHZA 1Z6TA 2JANA 1JMYA 4O2BB 5JRZA 1YBMA 1E2HA 2CXNA 2MSWA 5BWLA 3RFUA 3OIFA 3RDPA 1NQAO 1P2GA 1T3LA 1XRRA 1CTQA 4CLHA 1AV7A 1XWFA 3I76A 4X60A 5TQ0B 5JMTA 1TM5E 2HLDD 2I34A 1NV8A 3AL3A 2ZIVB 1QZ3A 4DDHA 1RHMA 4Y6LA 4F93B 4NHOA 4GEKA 5ALQA 3UFBA 4ND7A 2JFFA 5IBQA 2YTZA 1VBMA 4W4TA 1P4JA 1RRVA 3ZJ5A 4L3WA 3Q85A 5AHRA 5HFNA 2J3QA 2CMHA 4EMTA 1I0ZA 2OQIA 2PTGA 4TGLA 1FOEB 4JLDA 1IN8A 5AHWA 5CFPA 2O8EA 2H1VA 1YFZA 4IIVA 1YBHA 4J1SA 1AC5A 2AG6A 2QZJA 2NVOA 3QUCA 2GOYA 3DDUA 2WYVA 4TQGA 1RKQA 1FA9A 1HY3A 1NN5A 1U31A 5EJ5A 4GLJA 1NOJA 5KIAA 3DYIA 1G17A 3GHHA 4YAWA 5JXIA 3PNPA 5K3EA 1USWA 3T3EA 1EEHA 1MX5A 1SOVA 3KPUA 1BVUA 3O5AA 3TNDA 4P6VF 3FOWA 1UFOA 2YBEA 4Y67A 1HXHA 4I8DA 1YDHA 1I0IA 5EERA 3S8YA 3FPLA 2QPTA 5TIIA 4R84A 3LTNC 1JHQA 1REQA 1XKXA 4AKTA 4RK6A 5EA2A 4H7EA 1JFFB 3ZHBA 3TGLA 1NT2A 1SC6A 3M9XA 4TS9A 3ZI0A 4AU1A 1Q1NA 3QVGB 2GCOA 5HK8A 3GFPA 1M2KA 1Z12A 4RJTA 3L49A 2IS4A 3H8JA 1AG9A 5G40A 3O0DA 4GE0A 1Y1SA 2AFIB 2HXSA 2R1UA 1IC6A 1ISFA 1QLWA 2HDNB 3AI3A 2R8RA 3RASA 2J30A 4XIYA 3T95A 4RE6A 4XPIB 1F5SA 3IPXA 3GLRA 4QT0A 1GFIA 5I4IA 1EXVA 1HMPA 4CLOB 3A6LA 4MW7A 1I1OA 2G63A 3BMQA 2BZ1A 2GPTA 1PNOA 4L5IA 4C08A 4OHMA 1X38A 5H1YA 4KFRA 3PZBA 1UOEA 4CKYA 3IEIA 3EN0A 4JYAB 3CGWA 4Q16A 4A5SA 1XKQA 3IR6A 3RHZA 3HJUA 4NP6A 1GUYA 2BV3A 3ZQKA 5D85A 2QEQA 3SX4A 2B8NA 16PKA 3RSZA 1UPAA 3SICE 1AKMA 2QX9A 5CDTA 3V8NA 4C7VA 3NAGA 3L4KA 4L28A 5G0VA 4BO5A 5A4AA 5B7PA 1SBIA 4DMLA 2F3QA 1HE3A 1JU9A 3SS7X 4DG9A 3D8UA 3QVWA 4YROA 1ECLA 4FCVA 3MPUA 3ZW8A 2JLXA 3A3OA 3TE7A 4V0NA 3U4IA 5B36A 1GO2A 1UXJA 2OCKA 3F9RA 4FVTA 4CV0A 1IWBB 2PZ8A 5LOVA 3TTVA 1T13A 5ICEA 3AG6A 5DX8A 1RQLA 2WB2A 2J5KA 2V7PA 2HA6A 2WUGA 4AJKA 1P72A 3I6YA 2DKOA 1XZFA 5LBUA 3DEZA 4R2IA 5H81A 1JTEA 3I58A 1LSSA 2D0OB 3ONVA 2CXTA 3TL3A 4IJVA 1NBME 4OQYA 5FAKA 1EE2A 2A5FA 4EF5A 5I6DA 1JJBA 2BSAA 3I05A 1Q1AA 3RW9A 2QDXA 1PJBA 3PEEA 4BN5A 3N2KA 1GAXA 5LSAA 2Q2WA 2D2IA 3WP1B 3UKOA 2RCYA 3WHIA 1CNMA 3ZIDA 1J8QA 4GICA 3GLKA 1UH5A 1GTSA 4GXQA 2FPMA 2BUBA 3OJOA 3KZVA 1XN4A 1DV1A 2YWGA 3NP7A 3QWIA 4QZVA 2I3DA 3FN4A 3AL2A 4U00A 2IXDA 3R7AA 2FQ1A 4EF6A 3R1IA 3M6FA 3D59A 2OV1A 1QHSA 3TIFA 3OTOB 5KOYA 3BXGA 8GPBA 2B1QA 3U17A 1QRUA 5F3RA 1TD1A 4D5EA 3IL2A 1KYVA 1FTWA 3CKKA 2NTJA 2PMWB 3DKKA 3NBMA 2YV2A 1U5BB 3D4PA 4DEYA 5LIRA 3SBOA 2OM2A 2YQ5A 2FG5A 2ZAGA 5G4LA 1J2TA 1WS6A 4E1AA 2GXAA 1Y8QA 2PBFA 2YZMA 3FETA 4RENA 1GY8A 2A5YB 3CNNA 4QKQA 5JI2E 3DD1A 4L4YA 4FIZA 3VR0A 1M5UA 3I61A 3W9SA 1SG0A 4H7PA 5BPFA 4ALKA 4NYIQ 4D7AA 5K8JB 5KMGB 2PUBA 1HEUA 1Q6ZA 2Z8YM 4YUXA 1EWVA 2AFHE 4RGYA 2R8OA 4WACA 1N6IA 5BPHA 3C97A 4LY9A 5DN6A 2HPAA 3O31A 4G86A 2CF6A 4X9XA 4YR7A 2PCJA 3R0ZA 2WIBA 3DXYA 1AK1A 5REQA 2GZDA 3WTCA 1F4LA 1QDUA 3WLNA 3PXUA 1PWXA 2NTYC 3WNBA 1FX1A 1U7XA 3F4BA 5DNVA 4QYXA 2Y8EA 2ICAA 3H5RA 3T5DA 1I7LA 4C4OA 1WD5A 3ND8A 1M2VB 4JSTA 4TYWA 2QVXX 3LUDA 5DF1A 2BFMA 4ZQBA 1J33A 2XNSA 2A6PA 2ESRA 5B3JA 4ZCIA 1VPVA 2W0SA 3I30X 1D6MA 4XE5A 3L9XA 4EBFA 3DDHA 3T0FA 3S44A 5HK9A 4ZJZA 1P9LA 3CYFA 4R6WA 2XCUA 3I9NA 3T1QA 3MT8A 3GLSA 2OCIA 1W93A 1HDEA 2C2YA 5CJJA 3KB2A 2Y92A 3ZX5A 4P5EA 4LHVA 3SDSA 4UVIA 1G4UR 1JH9A 1MJFA 1UIMA 4DCPA 1ZLXA 4DLBA 2XF2A 1VMEA 2J3JA 1XTZA 2AQHA 2PY6A 3AP2A 4W7SA 3UB3A 2C8LA 3UJ9A 3M2PA 2YW9A 1DXOA 2DETA 3I5YA 2QRVB 3A1NA 2X1VA 3GJYA 1LS1A 3BGSA 2WG2A 3HSKA 5KOIA 3J81k 3PWKA 4GL2A 1WCXA 3V1LA 4F2PA 1KDOA 2FA9A 1ESEA 3QBEA 1E2LA 2H1RA 3EJWA 3Q7PA 4Q9LA 2WWYA 2XYGA 3OU7A 2BKVA 4LF4B 1N0IA 1LF5A 2VYNA 3DFMA 1XTSA 4D1YA 1J8VA 4D57A 3H4TA 1YVEI 3LCMA 1W29A 3ZHQA 3ZVLA 1SHZA 3JQ7B 2QVCA 5WRFA 2IWHA 4AWXA 1U63A 2Q4EA 4FE3A 1SUSA 1BO6A 3BXPA 5IDYA 2FUG6 2ZIXA 1V9SA 1Q0PA 3GJTA 1X80A 1G8HA 4HOYA 4NE7A 1BFDA 5D7BA 5I4CA 2RGRA 1ORWA 5H80A 3ZCXA 4G1FA 4HTAA 3GP3A 2Q4OA 4WECA 1XZHA 3C6ZA 3J81A 3RS5A 3OQIA 1GKUB 4MMXB 2RGBA 4HRYA 1NP6A 5ICCA 4HGZA 3H9EO 4ZT5A 1X7WA 1EGHA 3HCNA 2W2KA 4N3AA 3D02A 3GRUA 1M1XB 5CDYA 3CLTC 1UDWA 2UYYA 2Y93A 3C2QA 1JPUA 1P61B 4B48A 3LA8A 1A8QA 1L9XA 2DPYA 5ALWA 4J91A 2V54A 4XVRA 3ZWVA 4JELA 1Y9JA 4EHLA 3RV3A 4HVLA 5JJ5A 2AXQA 3V48A 1CF2O 4QLAA 2LWIA 3OZWA 2X4GA 2AYYA 2G67A 1RCUA 1HUQA 2O7RA 1KJ8A 1AA6A 1V45E 3LO8A 1MAUA 2OXFA 1H0RA 4RABA 3WB9A 1H94A 1U2EA 3V1UA 1AX9A 3BD6A 1XYGA 1DXYA 4J4TA 2PRJA 4GG1A 1JQLB 2OSVA 4KDCA 1K8QA 4OAOA 4QPNA 5I8WA 2MINB 4E09A 2LDXA 4J0CA 1HQYE 2V4MA 5ALDA 4CLRA 3FSRA 1K7CA 4TTIA 5DMXA 1GCUA 1IFXA 3FXAA 3MCZA 1ZISA 4IS2A 3FPAA 2FUNB 1DFHA 2GJKA 4GXRA 4Z9XA 3OX3A 4BO9A 4US1R 4P4SA 2AWOA 2C9YA 1NDQA 1NDUA 4RZQA 2VPIA 2ID9A 2ZUWA 1GUBA 2ATVA 2BE9A 4X3PA 1BRMA 1LXCA 4G0MA 3ESRA 4YJHB 1FTSA 4MNTA 5J23A 4WOBA 4BFTA 4KIJA 3MUNA 4CXMA 2ODBA 1AT1A 3E53A 4YMHA 2KJQA 4TKLA 2BUCA 3WNQA 5I5EA 1AV6A 5FADA 1KJWA 1ZI9A 1E5LA 1AKWA 4G4SO 3UCFA 5HTKA 1M1ZA 3CUTA 4UEOA 1DAOA 5F52A 1AH2A 4X71A 3S7TA 4FHDA 1EM8B 2F9FA 5EZSA 3TH5A 4O02B 2I4MA 1E1QD 1CG6A 3OSUA 4L50A 3UAWA 2VF2A 1L3IA 1Y8RA 4ZICA 1TF7A 2HU5A 4O8CA 4UAJA 3LIIA 2OO7A 2R85A 5T67A 1U3VA 4Q4LA 1R15A 4K6FA 4KQJA 3SS9X 3H19A 5AQ1A 4RVOA 3PK0A 5JMOA 1XGKA 4HDMB 4ROSA 2J67A 1IL0A 1L5KA 1EWTA 2JHAA 3DTVD 2ZTUA 2D3TA 2EKDA 3DFUA 1NFQA 5H16A 2PD6A 4IR7A 5TQ2B 2QAIA 3AUXA 4FIDA 2HWUA 3HBLA 2MDTA 4YPVA 1LX6A 3E22B 4RD4A 4ZIRA 3AG5A 2NTEA 3E9DA 2ISQA 4E30A 4Q19A 3FNIA 2D2FA 2WFMA 1NUUA 2I22A 2JGAA 1Q17A 4B6GA 4KXVA 4Y9RA 3RAJA 2J8ZA 4PSUA 1K06A 4GBGA 2J7PD 1C9EA 1PQYA 1SCDA 3IUBA 4IJQA 3JATB 4TKMA 2I9KA 5DW0A 1WIWA 1YI1A 4GP7A 1E6LA 1X7ZB 4YCDA 1UM8A 3Q5EA 1Y6QA 2PGJA 2HSEA 2V7UA 4KGDA 2BJVA 3BFKA 1EUCA 4ZT4A 4DBLE 3PJRA 5CGZA 4WN3A 5GZ3A 1IONA 1JQ5A 1QZZA 4HK4A 2I99A 4L6AA 5JDCA 4MARA 2WV9A 1O96A 4QYIB 3BUSA 4IMJB 2XRYA 3S99A 1R3DA 2WAAA 2I7CA 2WRZA 2Y71A 4JASB 3WL3A 2IIQA 3C3CA 5IDQA 4NCAA 2WT9A 3H86A 1UJBA 7REQB 4ZJUA 4GOXA 2Z2JA 5HKKD 3NHBA 4ETIA 2DT8A 1HORA 3ZU2A 1RYFA 4PFQA 2OD9A 3D43A 4ML3A 4LJRA 4B81A 1R37A 3K0SA 4FYJA 1FP2A 3R9XA 2B6NA 1QP8A 1RYZA 3RVJA 4QGBA 3ZE8A 5CM9C 3AWIA 1AGNA 3FWZA 4UUNA 2B8WA 4K26A 4QYMA 1V8BA 4UDOA <