3I30X

Proteinase k by classical hanging drop method after high x-ray dose on id14-2 beamline at esrf
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Proteinase K
publication title Atomic structure and radiation resistance of Langmuir-Blodgett protein crystals
rcsb
total genus 97
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3i30X00
5FFNA 1NDUA 1TM4E 3VV2A 3QMPA 3SQOA 1PFGA 1SCJA 3LPCA 4JP8A 3DE7X 4H6XA 4OV6B 1BE8A 2DUJA 1KE2A 4CG0A 2PYZA 3DVQX 1R64A 1R6VA 1SBCA 2Z57A 1S2NA 3L1KA 2V8BA 5SICE 3DE1X 1IAVA 5ARDA 5AMXA 1GCIA 1GA4A 2G4VA 5B1DA 5JMOA 1V6CA 4M1ZA 1GTL1 1TK2A 1ZVJA 1Y3DE 5FAXA 2W2MA 3T41A 3GT4A 1WMFA 1AQNA 1PEKE 1AVTA 1GNVA 3AJ9A 1SUEA 3DE2X 2Z2ZA 4WOCA 2PWBA 2X8JA 3TI9A 1AH2A 1OYVA 1Y4AE 5I9SA 3ZXXA 3DWEX 3PRKE 3I34X 3DW1X 1DBIA 1DUIA 1Q5PA 3CO0S 3AFGA 5JXGA 2Z2XA 5ARCA 1BJRE 1SCBA 1VSBA 1AU9A 1HT3A 2P4EA 1TM1E 3A3PA 1KE1A 2SICE 3CNQS 1WMEA 2ZWPA 1C3LA 1TO1E 3LPDA 4K8RB 4C3VA 1SBNE 2ID4A 2W2NA 1Y9ZA 1GA1A 1TM5E 1SBHA 1Y4DE 3BGOS 2Z58A 3VSBA 3Q5GA 1C9MA 2Z56A 2WWTA 3F49S 1YU6A 1SBTA 2PMWB 5CW1A 3HJRA 2DP4E 4HX2A 1TM7E 4FONA 1BFUA 4C3UA 3VHQA 1SUCA 2WUWE 4NE9A 3A3OA 3P5BA 3LXUX 3VV3A 1P8JA 1R0RE 5ARBA 2W2OA 3SICE 1P7VA 3F7MA 5B1EA 3EDYA 1BE6A 1BFKA 2QTWB 2SNIE 1T1GA 4MZDA 3QTLA 2TECE 2WV7A 4B5LA 3D43A 1P7WA 4OMCA 2W2PA 5AVKA 2E1PA 4ZARA 2ZWOA 3WIUA 1SIBE 3DDZX 4AKSA 1Y3BE 5FBZA 1AK9A 2ID8A 1GNSA 3BX1A 3DE4X 3DVRX 3WIVA 1GTJ1 3GCWA 4KG7A 3EIFA 3VTAA 1TMGE 1SBIA 1AV7A 1T1EA 2B6NA 1Y1KE 3H42B 1SIOA 1KDZA 5K7SA 2PKCA 1GTG1 3DE3X 2Z30A 1TECE 1V5IA 4H6VA 4I0WB 1NLUA 1XF1A 1SCNE 4WOBA 4LVOA 1Y3CE 4ZOQI 4BWGA 2DQKA 3F7OA 1CNMA 1NDQA 1TM3E 3DE6X 2XTJA 5AVJA 1MEEA 3Q40A 3BPSA 1SCDA 5AQEA 3I30X 1MPTA 1YJAA 1KDYA 2PWAA 2ZRQA 1TO2E 1IC6A 1LW6E 1ZVKA 3A3NA 1JEAA 3EE6A 1SUDA 1SCAA 1AF4A 2ST1A 3LPAA 4Z2AA 1YJBA 3WQBA 1C9NA 2SBTA 1Y33E 3QFHA 3VYVA 4DZTA 4LVNA 1SUAA 3D9QX 3GCXA 5JXIA 2SECE 2Z2YA 1PTKA 1UBNA 4RYDA 1ST2A 1S02A 2HD4A 1BH6A 2WUVA 3DYBA 3I2YX 2IXTA 1SUPA 1Y34E 1SN7A 3TI7A 4DJ5X 1A2QA 3GT3A 2PRKA 2X8JB 1YJCA 4NE7A 2GKOA 1EA7A 4GI3A 1GT91 4HVLA 3AJ8A 2HPZA 3PTLA 1WMDA 1CSEE 1SUBA 4NMXB 4DWWA 4H6WA 3DVSX 2IY9A 1Y48E 2W2QA 4OMDA 3DE0X 4KB5A 1KDVA 3TECE 4J94A 2XRMA 1ST3A 1EGQA 1WVMA 2PQ2A 4CFYA 1PJ8A 1C9JA 4YN3A 1T1IA 1GA6A 3ZXYA 5JXJA 4CFZA 1SH7A 1OYOA 1Y3FE 3WHIA 3UNXA 1SVNA 1WSDA 3OSZA 5JXHA 1SELA 1THMA 3I37X 1S01A 4KPGA 1SIUA 1SPBS 1OT5A 3DE5X 3DW3X 4AKTA
chains in the Genus database with same CATH superfamily
4COKA 1MO6A 4L76A 1ORIA 1H8HD 2A9RA 4NATA 2WT9A 3GGJA 3WZMA 1R10A 2UAGA 3AIOA 3F7TA 3Q3HA 4MVXA 3TM4A 4BX2A 4TTVA 5JNTA 4JP1A 3C24A 1DQPA 1CJBA 5HFAA 1TTTA 5DTIA 3FCCA 1X15A 1UFQA 3I73A 4WKNA 5G1PA 3NHYA 3SHFA 4LC9A 4TWZA 2OBLA 1VLMA 4DR6B 4BNYA 4J2HA 2PU7A 5AO9A 2GEVA 4Z9BA 4R71A 1KI4A 1XMVA 2HADA 3RC2A 5LXTA 2ZIAA 5D8DA 3TJMA 1MIHA 1ZUD1 4Q3AA 1KK0A 3R24A 1GZVA 4D8XA 1E2BA 2JVJA 3JYPA 3KKZA 4DV3B 1R6VA 3KALA 2J31A 2ZRNA 1US8A 3F74A 1Q7GA 3KC2A 1JKFA 2NV0A 4UREA 3L4JA 3I8OA 2GPJA 3QXJA 3L1KA 2B0JA 2Q62A 4B17A 1Q50A 3K6RA 3T34A 1GTSA 1S4MA 4D7AA 1M66A 4LKRA 3OM1A 1WETA 1Y8AA 2PE5A 4RJJA 5EIFA 1U1GA 3WSWA 1NXVA 1YR8A 2P62A 4PLPA 4F8EA 1GA4A 5AW4A 1NBMA 3CZRA 4HB0A 5HMLA 5U4QA 3RHSA 1DKOA 3GT0A 3KKLA 2AB0A 1C0PA 3CSUA 2GUWA 3HEBA 4Q12A 2D5AA 1Z6QA 3R8XA 4QAQA 4Z7JA 1SBQA 1QF9A 1R8YA 1BN6A 2OM2A 2B1QA 5B1DA 1C3EA 4M38A 4NQZA 3H97A 5JFTA 2ZXEA 3IHTA 3JZMA 3VMMA 2ZJBA 3KSZO 4JBHA 1QU2A 1K4MA 3GRRA 4ZAXA 4K9OA 1S8NA 5K3SA 3HV0A 3VNAA 1CEXA 1PYDA 3F67A 4KQKA 4UU7A 2AYXA 4Q3CA 4LF9B 1QH0A 4IJKA 1WZNA 4IRXA 3SP1A 4CR8A 2BFDA 4Z7NB 3AI7A 4CV0A 5JYCA 1VL8A 5KVAA 3QVOA 3EF0A 3VDRA 4YMHA 2HLNA 3L41A 4D3DA 2P2DA 5HPYB 1ZQ9A 4G8BA 5D7NA 5IEJA 1P4HA 4MNTA 1WEKA 4Q1BA 3WYAA 2BGLA 4UU8A 3W04A 3OEYA 3VDXA 1J2JA 5AIAA 2G76A 1G42A 1SUEA 3WHLA 2PWZA 4FYWA 4WOCA 1WM1A 2XUAA 4JBIA 5DIFA 4DC1A 3O83A 1DEOA 2WWRA 4KP7A 4QECA 3CURA 3PPYA 3QUSA 2FTKE 3TRHA 3WLFA 5F1PA 1Y4AE 1EFHA 4KQGA 3ZE7A 1ZG3A 1NIPA 4MARA 3RFFA 4IUCS 4EGFA 4M99A 5K5EA 4GLLA 3B36A 1Q22A 3KB6A 1SKUA 5AJYA 2N42A 1J09A 3NVKI 5B1IA 4IDFA 1Q91A 1E96A 1U1DA 3H7IA 2VXBA 3ECAA 3ICWA 3UXYA 5P21A 5MDHA 4ZWNA 3DFZA 3AXTA 1KFBB 2KMLA 3FKJA 3KS9A 4TXJA 4PSCA 2PL1A 3K6KA 3NFYA 2LV8A 1ZU4A 5I3CA 4JB8A 2QSYA 1QPZA 3TNJA 4NXNB 2AR7A 2ID9A 3TLGB 1L5SA 3O2SB 4B2IA 1KI2A 4X1IA 3LLUA 3GDFA 3RIEA 3DZFA 3U7QA 2XUQA 4H3VA 4LZZA 5FWAA 4KAJA 4OH1A 1U5BB 1CR6A 2ILVA 3GFRA 1LRKA 3QF7A 4D79A 2PGNA 1RI4A 2F9FA 1SUSA 2Y1CA 1UWVA 1OFIA 4FOPA 4JT4A 4W82A 3HYLA 1V39A 1L3BA 2FW1A 2SICE 3HXTA 3NEJA 4RF2A 3NHFA 4XQ9A 2PD3A 2WNHA 1UJ2A 2PBFA 3C1OA 2EXXA 3PENA 3O8NA 5AT1A 3VZPA 3CUUA 5KYWB 4P53A 3WDSA 1NQAO 1EVYA 1QIJA 4ITVA 5LOVB 1ZZEA 4ZQIA 2H51A 1O9BA 4WOKA 1TYDE 4CLDA 1P7PA 1AKWA 1QHEA 3Q4GA 4QXPA 3MWKA 2JLXA 2ONZA 4NABA 3I5AA 1N3BA 2Q50A 2XWJI 4NV0A 1E1QA 1UXJA 4R8RA 4NBLA 3SYNA 3A1FA 4NICA 2DFNA 3I3OA 1XCBA 1Z2EA 6Q21A 1MAUA 1LQUA 2O2HA 3O1IC 1VZ3A 3PCRB 1L7PA 5TX7A 2I2XB 3QKSA 5B7PA 3JATB 1CU1A 1STOA 5AOVA 4TXHA 1RXVA 3PEWA 1UMDB 1G8YA 5JCOA 5FTWA 1LLQA 1OVGA 3NEPX 3L1JA 1WWKA 2GQ0A 1TQHA 4CL8A 1XCMA 3I2KA 1H8HA 2PFSA 1CC1S 3LC0A 3KWJA 3MMNA 3QLUC 4JXJA 3TPCA 4MIEA 2Y27A 3WGGA 5KTKA 1IXSB 5E3IA 1DJMA 4XVQA 1X1EA 3ZHSA 5JNWA 3RH0A 1XRRA 4YRFA 5DNDA 4CEIB 1C0IA 4DQLA 3SC2B 2WT8A 4II2A 1LDNA 2A4MA 4DLSA 2HYDA 1FVFA 1SBTA 5D87A 3TQSA 4CF6A 4DUPA 4GAEA 3CEJA 3KHTA 3A25A 3OICA 4PGFA 4IO0A 4UBOA 3OF5A 4DMRA 1AQNA 4W1RA 1EQUA 5ALDA 1ZEJA 3O8RA 1HKUA 3MWDA 2GB4A 3RSFA 4QGAA 5K3DA 2OCBA 1LF5A 3U3MA 1JVBA 1EWKA 1IULA 4PLYA 5I9MA 1I33A 5B4VA 3I1JA 1C3XA 1W581 4JN6B 2PTGA 2ATXA 3SAJA 4RM2A 1B00A 1T0JB 3AU9A 3E15A 3KPYA 1U11A 3A3OA 3I4LA 2Y8EA 2PLWA 5KQPA 2O3JA 4JI3B 4MK4A 2AOWA 1EB8A 4OHZA 1KPGA 2XUKA 3T12A 3DWFA 3VKFA 4CCAA 4YT2A 3LXRA 1KVSA 4A3SA 4I1PA 3G79A 1DAOA 3KXDA 5JD5A 3UGTA 1SXQA 1L7MA 4QXQA 3NALA 2PS9A 4REOA 4ZN6A 1P1FA 2DWUA 2Y0PA 3PDWA 1UBEA 2WEKA 2FV8A 4BP1A 5AWFC 1MQSA 1M75A 2QVCA 1WSBA 2DTDA 4BQIA 3KAPA 4EVRA 1T1GA 4QM6A 1OMOA 1HMYA 3DWIA 4NXMB 3QU4A 3OPNA 3GFSA 2TECE 4KPUA 4YWJA 5H83A 4CT4B 2C7QA 1MAVA 1VIAA 4N40A 3QIVA 3JWIA 3U80A 3DNMA 1KO7A 3VR0A 4XD7D 4ZCSA 5GZ1A 1WQ1R 1TK3A 3A1TA 3ZDQA 2OEPA 4B5LA 3ZW7A 4DLBA 3NBMA 1FDRA 3PR1A 5BSKA 4B43A 4E88A 4OL0A 3D6MA 6REQA 1P9RA 2P9HA 4X92A 5BVHB 1TCUA 4M89A 4RD1A 2R68A 1QDUA 5HE9A 3VR5H 3WIUA 5KKNB 3MJEA 3EAQA 3TOZA 4AJPA 2PCJA 4KUHA 1B8PA 2ODWA 3W5VA 1YJ5A 4JLWA 1JKMA 2FOIA 2IS2A 3AUFA 2C9OA 1EK1A 5JHHB 3IE2A 3TGWA 3DHVA 3HLYA 2V1XA 3W5CA 1RPJA 3S2SA 1IUNA 1BTOA 4NMHA 4XJTA 3ZWMA 2A9KA 3PKZA 3U13A 3FGPA 3TZKA 1Z2OX 3EZ2A 1U0SY 2AFVA 4OFWA 5AUNB 4BQEA 5CFLA 3Q7QA 1C7IA 2B4RO 1A95A 1HTBA 1IIRA 1QZZA 3IQIX 3CF4A 2QYSA 1EP3B 3S8MA 1KJIA 3IBYA 4PCVA 2RGXA 2BFAA 3O8BA 4Y2GA 3FYSA 1K66A 1A1VA 2A8YA 1FA9A 5EKDA 2XZTA 4X7MA 1EE2A 2WAYA 1DUSA 1JNXX 1H3FA 1W49A 4GDFA 1TMGE 2X19A 3C48A 1AV7A 3H2SA 4EQZA 3TQHA 4EPXA 1H9CA 4MS1A 5K9ZA 3K0SA 1TT5B 4KXUA 4ERNA 3FVWA 4PGAA 4BNLA 4IQGA 4J7XA 4DV6B 2VJNA 2VI5A 1SBYA 4H7DA 3IEKA 4HYQA 1CIVA 3DE3X 3L5KA 4LJ6A 1P19A 3G5TA 4B3FX 3HA7A 1MVLA 1LC3A 1QHYA 1U8EA 2I4IA 5TXGA 2ODAA 3ABSB 1WEHA 3BVPA 1Y3CE 4BP3A 4QYSA 2R6FA 1QWSA 3GCGA 1E6UA 3PNPA 1OFVA 3WB0A 1W85B 4KPEC 4G5HA 4GL4A 3DGEC 2W5UA 5JJBA 4QATA 5LQAA 1ZOSA 2Y6VA 3GOHA 3JX9A 3T5DA 3AINA 3IMEA 4JLDA 1UOOA 4BU0A 1L5YA 3NDJA 4PRLA 2XTJA 1R27A 3L2OB 5AVJA 4LMAA 5JFOA 3IAS1 2EF1A 5JH7F 1JMYA 2R79A 2MDTA 3RT7A 1U02A 4BAZA 3N6XA 4GGMX 5KX5B 4KN8A 1YJXA 2OMEA 1RYZA 2H2DA 4QSMA 3C0KA 3RRYA 3KYDA 5FORA 3CBQA 5IARA 1BKYA 3TMAA 2J7KA 4BE9A 1G8JA 2AK2A 4LYAA 2D1FA 1Q6YA 4X3CA 2LGJA 2IZ6A 2JFFA 2XWBF 3O0DA 1L7AA 1FJHA 2QPTA 3BGSA 3V55A 1JSLA 1Y80A 3WNBA 4MVJG 3AF6A 3K2QA 5I47A 2EJCA 4IZ6A 3X1MA 3GWZA 1SU4A 3SSMA 3EEBA 1XBTA 5DLDA 1Z4KA 3W79A 3LHIA 2YJZA 2NYAA 4PR0A 3TLCA 2E49A 1GZSA 4X66B 1I5RA 3NTOA 5HKLA 2IPAB 1T13A 2NU7B 4CL2A 2GEDA 3A2MA 5FTKA 1QRAA 3NBQA 3H04A 1FY2A 4NEHB 1N5JA 3GUHA 3B20A 4CDNA 4OQNA 1ZWLA 1PZEA 2JIRA 1IPEA 2Q3DA 3NAQA 4Q21A 4QBKA 1C9NA 1PR9A 1UKCA 3R23A 2HHJA 4XJSA 5TPZD 5ECYA 3IA2A 2I65A 5DM0A 2BTQB 4URYR 4E15A 1GUDA 4O2BB 1W44A 4UM5A 4V03A 5HG0A 2YVAA 3NONA 2BKUA 3KCQA 1V48A 3ZTTA 3C4QA 3OZFA 4JV5B 4CEHB 3EOZA 3JSXA 4JIGA 4MPRA 4DBZA 5CPFA 3WAJA 1MOZA 5L3QA 5CDFA 4MS4A 4BX9A 3OBBA 4JBGA 3JASB 3S2YA 1BMFD 2I2BA 4YUZA 3TW8B 3EXFA 2H9YA 4PX2A 1FVXA 5BPFA 4ZQHA 3U3RA 1G0OA 1PEYA 4J76A 1WHSA 3RS2A 4AAYA 3ZE6A 2HCTA 2JRLA 1DIOB 1N33B 2DCUA 3T9EA 2ZAIA 2YWCA 1UPXA 1BQ3A 4ZOLB 4FXOA 3U3KA 2LKDA 5C3UA 4ENVA 4FYMA 1W9HA 1GZ6A 2BVNA 3ESBA 4H0FA 4IFEA 5DTEA 3FAKA 3KJHA 3RARA 4UVEA 4Z6KA 3R7LA 2GYYA 5KOJA 1KJNA 4LC1A 1C14A 3QV2A 3SVLA 3K15A 5SV2A 1WXIA 1AKNA 3L4SO 3BGIA 3RUCA 5D1HA 4WWHA 4IVNA 2ZBGA 2BL4A 4JOBA 3QBEA 4JASB 3K70B 1JLLB 4QEKA 4BX0A 5GTDA 3DUFA 4O4LB 3IMGA 4ZQEA 1EFDN 3NRBA 2O8FB 4FLFA 2X8JB 3F9CA 3UTDA 4WN9B 4DSAA 3FAZA 3HBNA 3NYIA 2GKSA 2FPRA 3AI1A 5F3DA 2QG9A 3K5HA 1RIFA 2NU9B 4MGZR 5JJCA 1CQXA 3M4YA 5JH7A 3GZTB 3AJ8A 3CVWA 3T7IA 3PFNA 1CY1A 4LJSA 4G5GA 3EB9A 4HNQA 4M9ZA 2X15A 3PZBA 2W8BA 4P7JA 4NP6A 2EKPA 4FYYA 5A3SA 3V3TA 3FF1A 3M7IA 4LYEA 2SHKA 4WUTA 2EKQA 2H9IA 4E09A 5CVCA 2V9PA 4IMIB 3OFJA 5A03A 3I32A 2VPXA 2WYWA 3AIIA 4FWTA 3VJMA 4GRIA 2YIVX 1JHOA 3C3PA 2QN7A 1S2MA 2WTAA 4KO1S 4ARBA 4I4IA 4RKEA 1HY3A 2VQSA 3KYCA 4CDRA 4NZOA 4IAOA 2KYRA 2EJUA 3NAMA 3WJ2A 1EFKA 3JTEA 3DEJA 1K7CA 2D3WA 3ZHYA 3WFZA 4OGKA 2I7XA 3ESAA 1V7PC 4GX2A 3H11A 4D82A 3ABQB 1I9GA 2OYCA 1Z6YA 2JFYA 4OREX 3G1TA 5SY9A 5TQ2B 1M67A 2V6MA 2PMCA 4JVOA 2E1RA 4UULA 1SHLA 3UWSA 3FNHA 4KIFA 3RLFA 4KFCA 3E1KA 3L7YA 1FS6A 4CQMB 1DQYA 1Y6ZA 1I36A 3TMKA 4EAQA 3HK2A 3LWNA 2ZVDA 1LV7A 5DBHX 3BAFA 1GQRA 2NADA 3GA0A 4U3JB 4G1UC 4Y6OA 3IP1A 5L9AA 1IN6A 2HRCA 1BCSB 3TIFA 3P9ZA 2O5RA 4ZO9A 1AMNA 4HGZA 5IBQA 3LI2A 1GN9A 3GG2A 3LUGA 4FJ1A 2DZDA 2CHEA 4U2FA 4X6LA 1TKRA 5DDIP 3SHVA 4CIVA 1KQGA 1VP9A 2GAAA 2ZPAA 1A8QA 3X2EA 1CR4A 2JAXA 3L1IA 1TUEA 2LPMA 2VBFA 1L7QA 1SC4A 1I9CA 2G1UA 2PWYA 4C03A 3FMOB 4B8ZA 4YP5A 1TO6A 4FN4A 2I9PA 4LS3A 5BXQC 1FYVA 1JR3E 2CHFA 1YOBA 3I28A 4N0QA 3M82A 2G5CA 3QSYA 2YXDA 2FZKA 1U6JA 2IXGA 3KZKA 1SIUA 5JROA 2A9JA 1J07A 1P72A 1GGFA 2DPMA 2P2YA 2PMDA 4GEKA 3U26A 1M0SA 6NULA 4ZYVA 4BFWA 2PJRA 5DK4A 3AY7A 2HZ7A 4HVCA 4HJRA 3VYWA 2J3LA 2MYTA 1L8AA 3VKVA 3CLRC 3T3HA 3DHYA 3PRYA 3KWFA 2J6BA 5HRUA 2XWSA 5DBOA 5HP4A 1EB9A 5J1SB 2XA1A 5IRCD 4XIYA 4HWPA 1JHPA 1I4LD 1O0SA 3OHPA 1R0LA 3K0AB 1YDMA 4O33A 3SG0A 1AS0A 4B2LA 5DFAA 3MINA 2Q6LA 3CR3C 2R47A 3B3GA 1Z8FA 1E2GA 2CUKA 2VJKA 3FMFA 4NENA 5TPZA 1KY3A 4CMIB 4XVCA 5CFQA 5BWNA 1PTJA 3ZDFA 4TXLA 3UT5B 1L5FA 1L7BA 4GXTA 5IANA 1E2EA 1EQAA 1R64A 4W6QA 3RYCA 4IDDA 3DVAB 4LHWA 5F23A 4AKGA 1RXWA 1KK1A 4OQEA 4LTDA 2CKDA 4RDHA 4JNCA 4E7PA 1I32A 3CH6A 1BMFA 3TOSA 1AKQA 3W7BA 5DOZA 5GGYA 3E84A 1EM6A 2OGTA 4FCVA 1E32A 4P34A 3WV4A 1I0LA 3R41A 4WEQA 1DB3A 3R09A 4TS3A 1V0JA 1C41A 1XZDA 4QHSA 5IZ4A 2I76A 2VAXA 1P33A 3AUAA 1JT9A 1D0VA 5I9NA 4MPPA 4B6GA 2MU1A 2C5EA 3P0FA 2VHXA 3TCKA 4JCCA 1BXZA 5J2TF 4P31A 4DIOA 4TYYA 3PL5A 4BRZA 3UJNA 3RIYA 2C3MA 1T4MA 1FCJA 2A1IA 1WUKS 3MJHA 2FEMA 4AJ1A 4U4AA 4HWKA 4EB6A 2O0LA 1G6OA 5K20A 1XTQA 4KR3A 3Q72A 4Q3LA 2MR5A 4TZTA 3AI2A 3K92A 1X94A 3T15A 2BD0A 1N57A 1ABBA 3AFOA 2WUFA 2DT5A 2JFWA 4FOOA 3H13A 3GJQA 4ZCPA 3V8BA 3IAXA 3IEVA 3NUQA 1WMFA 2GLTA 4AJNA 1I2DA 3NWPA 3TPZA 1AUPA 4DWOA 3EXIA 1DG1G 2BBTA 3BIJA 1EGVB 3FYDA 5MFZA 4MVWA 2WM8A 3AJ9A 4IV5A 4KYVA 3OLCX 2Y77A 2AQ8A 1ENPA 2OAQ1 3HJCA 3PC8C 3UJHA 2K5UA 4D6XA 4JUDX 4YQFA 3T1HB 2PGAA 1L4EA 4DIFA 3AVUA 3HV2A 1K6JA 1XVVA 1IQUA 1Z29A 3GFTA 2RHJA 2FPXA 1VKJA 4ZOAA 4F9FA 2JKZA 2FN9A 1P77A 2XWPA 2VVTA 2C07A 2XE7A 3BSSA 4L2IB 1YOVA 2QGZA 3WWPA 3R7WB 3ZDEA 2P5YA 4G5FA 3Q3CA 5HQJA 2LNDA 1H0RA 1RZRD 3ETCA 1T3LA 4IX9A 1P7YA 3MIIA 2CE7A 3UWMA 4Q34A 1SHZA 3VYRB 1D1QA 1F38A 3NS7A 4CIBA 2JLBA 3V9PA 1CYEA 1XKLA 3INYA 2X42A 3NDRA 2ZPUA 2H17A 3EJ6A 3T3GA 2RH9B 3GQVA 5BN3B 1RXCA 3T35A 2XQIA 4YV7A 1HDXA 3EQ9A 2CLOB 3T3EA 3V4VB 4BEJA 1H1LB 4LXTA 3EDOA 4P0PB 2IYZA 4MA5A 1AU9A 3G8CA 3OIWA 3TN7A 2P4EA 3MOGA 4WT7A 1NW5A 2IV7A 1VL5A 2QMZA 3A6DA 3WK8A 2XE4A 2AK3A 4Z1OA 1YQDA 3BRCA 4KXVA 1PVOA 4OHMA 3CE6A 1E2QA 4UU0A 2YH2A 1RQLA 3W9UA 1BW9A 1GJRA 2NTJA 1KI6A 4KL8S 1NI5A 2YL2A 1MOPA 3FLEA 3LQ4A 5EESA 4HDSA 3PXCX 4JJ6A 1ZK1A 1DFHA 3O0TA 4O5OA 5GGXA 4BMOB 5K0SA 5M29A 3U4CA 1PNRA 2HSZA 1JHVA 3DPIA 4FE7A 1SBZA 4NWIA 3WYBA 4C3VA 1XD8A 5CH5A 4BGUA 1XCPA 2VDNB 5D5HA 4Z0NA 1TQ2A 2DHQA 4PWYA 4HDQB 5E95A 4QU8A 3TUJC 4I1UA 1TM5E 1PL7A 2WHRA 2IYOA 1Q84A 2O8EA 2A57A 5DW3A 4HZUB 4FGSA 4ZDIA 4EJ2A 5DLQC 3O74A 1QYWA 1E7YA 1Y4DE 3RC1A 4WDQA 3H2IA 1H4VB 5LWHA 1RYDA 1A04A 3O5AA 1Y9AA 3GYGA 3QKUA 5C3MA 5A6SB 1H3EA 5TMBA 2RG1A 5FUXA 3P7MA 3TOCA 4R7GA 3ROXA 5JUWA 4Y7DA 4ZHQA 4ZCLA 3RWOA 5LMZA 3RRMA 1WSWA 4ALMA 4PF1A 2G0AA 3IUEA 2PMWB 1W6UA 4XPZA 3SF0A 4AUKA 3Q1LA 4BZWA 5JLJA 5JZBA 2JG3A 2K7FA 4WLOA 9GPBA 2HMUA 3FOZA 1PDOA 2I3ZA 2O0KA 2DQYA 3MRTA 4FX5A 4PZPA 2OPHA 3UO8B 3MD9A 5H70A 3Q8LA 1N2SA 4TWAA 3I0NA 3L92A 5LQMA 1LSUA 3JWJA 4L50A 4Z49A 3INNA 4RTSA 4I5GA 1DAMA 2GBLC 2IEBA 3VHQA 1U7OA 1ZW6A 5C18A 5KMGB 2WUWE 1D5CA 1S5PA 4TRRA 2B4QA 4YBZA 3LUJA 3P5BA 4ZVMA 2MSKA 2V7PA 3D0OA 1RAEA 1L6RA 3TLMA 1REQA 1LLDA 1MQ9A 5CLLA 4BC1A 1KOGA 2ZT5A 4MYRA 3NXKA 4A8HA 1R0RE 4C2BA 2GO7A 2RHOA 3FNEA 2OOSA 3RM3A 2L69A 4EHAA 5K6RA 5D7BA 3H18A 4N7MA 1B4DA 1ZCFA 3LHDA 3ST7A 4YEDA 1P1JA 3W90A 2XF2A 2EWVA 1YB6A 1QO7A 4YLYA 3TGPA 3S2ZA 4BFYA 4DMGA 5L40A 3SDZA 2CV2A 3UK1A 4BX3A 1IY1A 2YUTA 2BUCA 4RK4A 1CE8A 3G7SA 4ZV7A 5ELXA 2AL7A 3JQAD 3AOEA 1NULA 1SUIA 1N2CA 3LFHA 4UZFA 2O7NA 3F47A 4D56A 3HWX1 5CB0A 1NRIA 3BGVA 3TAXA 5KQMA 5THKA 1O89A 4KFRA 4AZWA 3S7TA 1PWYE 4QU0A 2IL1A 3I9NA 2DSNA 1LJ8A 4WK2B 2O8NA 1G6Q1 2WF6A 3QTLA 3G2MA 1GSOA 9ATCA 1E6LA 2QG6A 2ESRA 4Q05A 4URZR 2ZCVA 4C6SA 5L3SB 3AW9A 4ZO7A 1RLMA 1RPZA 4LF8B 2DKFA 1J0DA 3UPUA 4UUNA 1T8RA 4MQUA 4EPWA 2DOKA 1ULHA 3LUKA 5JS6A 1ZZGA 1L6IA 2FEWB 1QF6A 3W6NA 4YFVA 3AF2A 2R8XA 1E0JA 3WP0A 2O23A 1B3BA 3P94A 1CF2O 2JEZA 1CQZA 3REQB 4S05A 1CNFA 4KNYA 1J8MF 2RAUA 5DCWA 4X45A 5AJZA 4YLEA 3WNDA 3B7WA 3UANA 3AB7A 1KQ3A 1B0PA 1RLUA 3B6MA 3CNNA 1N1MA 5FQNA 5K8UA 1XAIA 1P5FA 1K63A 4WZZA 2G3YA 2Q5FA 3G8YA 4PQGA 2RHRA 2R8OA 2QP4A 3SM9A 4ROSA 3Q3GE 3BX1A 4CGZA 3TS1A 3VOSA 2BIFA 3CPSA 4Q37A 1PV1A 2WK1A 2DLNA 3M89A 3DVRX 4B85A 2COUA 1RZRA 2YX1A 2OCAA 4MJLA 1QS0B 1ZA2A 3AG6A 2OV2A 2IBSA 3LU1A 4UFNA 1PR2A 3F6SA 1KYYA 2XUDA 4I1IA 1O08A 2MSWA 3ZCSA 4EJFA 5BV0A 3ND6A 4LOHA 5DO9A 4MW9A 3RRFA 3RWMB 3UCXA 1JEDA 4IIUA 2V5VA 1EK0A 4MW2A 3SKYA 2CZGA 1JMVA 1FQWA 1S2OA 1VCNA 3E1GA 5CT6A 2C5LA 1BMQA 3GLQA 1V6SA 4FHEA 3ESRA 5HDBB 5T4BA 2HRQA 3KHKA 1BH2A 4MKIA 2BUBA 4ND2A 4YJGB 3SEZA 2M98A 2ZI5A 3IAFA 1E7WA 3LGAA 4X6YA 1RVV1 4UTVA 1XD2B 2NGRA 1NLUA 4IQ4A 5CEJA 1M2GA 3WQRA 1SD5A 2O5CA 3UA4A 3DZHA 4QT0A 1DWOA 4LVOA 4YALA 1WXHA 4J43A 3U44A 4RM3A 2DQKA 2M6LA 1FS4A 4UMVA 3P2MA 2ERCA 3HLKA 2Z1MA 3KKPA 1TM3E 3WAKA 4LNUA 5DHTA 3GCZA 1YI1A 2Y4NA 3PFWO 4NBWA 4R8LA 1VJRA 4WOPA 4ASUD 3FBWA 1KZHA 4EY8A 5CDGA 1Z5NA 2UV8A 1GPUA 4M9RA 1B1AA 3O4IA 4DZZA 4LF7B 1DAKA 2Q07A 4M7OA 2VLBA 4Z0PA 3AONB 4R1OA 3DLIA 2DG2A 3TLKA 5AW3A 2CDNA 1EUDB 2I2WA 4Q1AA 4TTPA 2P1RA 5HWSA 2OGUA 2QBYA 1UXGA 2NSHA 3G0GA 1H5QA 1SA0B 3V7FA 1P5ZB 2B99A 4EHJA 1M1YA 1H2EA 3IAAA 4TTSA 3U7GA 5AI6A 1N8TA 3A4LA 3LDFA 1T2DA 4HRVA 3GLIE 2FPMA 4PC7A 2H8GA 2R60A 3ZQ6A 3BT7A 3JQ9C 4QZVA 3H2JA 3AW8A 5AM5A 1JU3A 3FVVA 4XR4A 2PX2A 3IB6A 2IHZA 2QB5A 1JG1A 4HZGA 4QVKA 4N7BA 1YJBA 3WQBA 4Z2AA 4ML3A 1RBQA 1S7CA 3W5UA 1WD5A 2AMYA 3QITA 2SBTA 4E1VA 1U8FO 4EY5A 1SOUA 5LYJF 4HAOA 3Q9LA 3E03A 1U8YA 2B83A 1HSOA 4IZOA 2J41A 4HNRA 3U7FB 1JDJA 3I92A 1K1EA 3TIIA 3RS8A 4C4ZA 4XLTA 2WG1A 4GBGA 5EE5B 5EQTA 2K6GA 3QMMA 3CJTA 1KYZA 4HQLA 4ALIA 4YJDA 4FQ5A 2F62A 3E35A 2WHQA 5GONF 4C0HA 3R9XB 1NUTA 3H5VA 1GSAA 4NBUA 5HIMA 2IS4A 4LW8A 1J20A 4A7PA 2EP5A 1G5TA 2ZSJA 3A2LA 4HN2A 3A6FA 3KKNA 1M3SA 3WLKX 3EA5A 2R2AA 2C59A 4ZVTA 2BMWA 2DBVO 2I8AA 3FBTA 4GO1A 5DI9A 5A9RA 1AKRA 3OWOA 1I2CA 4MJ3A 4XGQA 3RAGA 4DM3A 1YSCA 1VPWA 3JQAA 4RNDB 3ZGXA 3L7JA 2Z8YA 4WBXC 3ZE2B 4ZZ1A 4MW6A 1J90A 1CG6A 3UMRA 1OF1A 3MS7A 1P2BA 4B9EA 4DMUB 3P9RA 3I2YX 1M83A 2GCOA 3IEPA 1TJPB 2HDOA 1SB9A 1E0KA 3AEUB 2FXIA 4RPLA 5FT9A 4TV9F 3OAAD 4K3VA 2OP0A 5I7SA 3GUVA 2XDQA 4ARUA 3HCPA 5EZYF 2XEDA 3V9AA 4B4KA 1KR2A 2IELA 1M34B 3HNOA 2GD1O 4R0VA 4UEKA 4EUFA 3SFVA 2Q99A 3N75A 3QUCA 1XRJA 2OC4A 3OFSA 3IQFA 4PGMA 3UMFA 1Y1TA 4KSYA 4U5QA 4NE7A 1U94A 2BR3A 3E2IA 2GF0A 3QMWA 4F8YA 4CLRB 1XTVA 4RA6A 2F1IA 4DANA 1NQXA 3AX6A 4B75A 4CV2A 1I6KA 1HFJA 2VWGA 1BYIA 3PNVA 1DOZA 1DJQA 4DLYA 3K35A 2G5GX 3DEKA 3AVWA 1CNEA 2WJZB 1BVHA 1JQLB 1QE0A 1ZAKA 5BSWA 1VYTA 3F3SA 4D26A 1NLYA 5CIYA 4MW5A 4DNQA 2FYTA 5KNBD 1XXHB 1J99A 2R4UA 5DT2A 4KGZA 4DL9A 4ZYUA 3BDIA 5KJ6A 5KNCH 1U3DA 5KREA 2XKKA 1WBJB 1NUHA 5COBA 1II8A 2K2QB 3LWZA 2CVZA 1IIBA 3PUHA 1F0PA 1HYQA 1ZGJA 1P44A 2O14A 2JGAA 2ORIA 3BFPA 3WS7A 4FSXA 5ALUA 1U6KA 3WNCA 2H08A 2DYKA 4R2LA 4FE4A 4B8YA 5BNIA 2CFCA 3I04M 3PSAA 3AYZB 3ZY3A 4BO5A 4OP3A 5TS3A 2BDUA 4D9MA 2IE8A 3IFSA 4WXHA 1D07A 5DBIA 4CMAA 5JXJA 3N2LA 1FYEA 1M6VB 3FUTA 5FPKA 5ALQA 1Q7EA 4D42A 2GMWA 1FFSA 2GZ1A 2Q7XA 3OU6A 1SXPA 1XU7A 2DBYA 4OGWA 3PUKA 1YS4A 3N0TA 4CETA 2DLDA 2R11A 2O6HA 4LWPA 4XUGB 4JA0A 3SYLA 3V4SA 4L73A 3HP7A 5JZMA 1VTKA 4GVPA 1GUAA 4WXEA 3O2NA 5T67A 4UOQA 5LDGA 2ACKA 3CXRA 4TS1A 1GGMA 5FB3A 5KCZA 3V4OA 5B7NA 2DQ4A 2UYQA 4H27A 1DOAA 4ASUA 2GARA 2DU8A 3DBOB 5J63A 2C0QA 3L0PA 4Q7KA 4Q4CA 3K70C 3FOAA 1L5KA 1OXBB 4YMUA 1GPLA 5A02A 5BMVA 1IN5A 3GLFB 5K0TA 1RRKA 2BAGA 2DKOA 4J4HA 1WNFA 4KK3A 3NHLA 2XA2A 2WP0A 1DMRA 3NHRA 1HL3A 2BV3A 5ILQA 2ZIWB 4S35A 4HLDA 4HOYA 4PE5B 1RYMA 4HDRB 3T5MA 4US2R 1OT3A 2G77B 3LVFO 3IP7A 2G6TA 3IKVA 3IUNA 5FFNA 1VLLA 3QYFA 5FOVA 1DLIA 4QAJA 5E8RA 2CJWA 4NJEA 2R3SA 3CN7A 4AG6A 2GNAA 3DL7A 1JA9A 1WZEA 2VHJA 5C1PA 1V26A 1VGQA 3G1UA 2NZ8A 5JZOA 2GZDA 4Y6QA 4YV2A 7YASA 1M6EX 2WTNA 1XG5A 5B3LA 2FX2A 2G08A 4D8WA 5KNLA 5JY1A 4BP8A 3EEOA 1ZM3A 1K5PA 2A0YA 1ZOOA 2A7QA 2Y1KA 4PSKA 2DUMA 4XWYA 4C76A 3RAPR 1KYVA 2ZVPX 3K8QA 4UZEA 5E4JA 2CF5A 1R9JA 4AW9A 5KU7A 2I0FA 2J7PD 3NB0A 2FY8A 1S0UA 3W9YA 1IM2A 4JKOA 4C7MA 5HRCA 1X7WA 4S1NA 1P39A 3IQXA 4QOEA 4G1MB 2PMEA 5F1OA 4OQLA 4QJ3A 3ICQB 1I0ZA 1O96B 2L17A 2YVQA 2YS7A 3B53X 3PKIA 4HDMA 3QOYA 1Y3IA 4X3OA 3B7PA 1TIBA 1U2GC 1WA5A 3MTDA 1GZ5A 4ER0A 6AT1A 5T8KC 3BK7A 4J1TC 5J2TB 4UCQA 3WDMA 3ITEA 1Q11A 2X3YA 4L8VA 5CK5A 3CLUC 4YRJA 3HABA 1D1TA 1P60A 3NPAA 1VPLA 1V7ZA 3KDAA 4BMZA 1CDDA 1Z25A 3I42A 1T2UA 4QPCA 5JMOA 4RH0A 1FP2A 2JFNA 2VSQA 2ZUCA 4B3CA 5KPDA 1UF9A 3HCNA 2FE4A 2YYSA 4K9MA 3S1LA 1R00A 5LKRA 4EFLA 1UDXA 3FG9A 1QHHB 1YDFA 3OAAA 4DB2A 3RHTA 4BFLA 1ZVJA 3TH5A 4JC4A 1VE1A 2ONCA 4WRRA 2L42A 2RI0A 3RU3A 3T3PB 4UFPA 2W2MA 3BRSA 3NLLA 1TLLA 1XRNA 4MV9A 4W9MC 5TIIA 2XYGA 1K6XA 2IA5A 3EOBI 4BVGA 2Y3IA 3TEFA 3AUKA 2Q0SA 2HPAA 4DRXB 3QBJA 1KARA 5CVVA 3LF1A 3J7TA 5EXDA 4DIKA 2IY8A 2NUTB 2QGNA 3L7OA 4H7IA 4KPFC 3TNDA 3LYLA 4LFAB 1BXGA 2WQZA 1M6NA 3I6BA 1Q3KA 1AH2A 5L3ZA 1D1PA 1N0IA 5IBCA 1U0FA 1IJEA 3H1EA 2OFWA 4AS1A 1DIHA 1AC5A 4Y2XA 2ZE8A 5KNBA 1II0A 4KXFB 4YJHA 1WTAA 1WF3A 1P74A 4PLVA 1P73A 2HLPA 5KYNA 3CTMA 3BMNA 3KOZA 2PSDA 1ULBA 1JEYB 4OXRA 3AL2A 4QUDA 1TU3A 1HUQA 2B20A 3QLUA 2Y67A 5KAPA 2I55A 2PBZA 3DC2A 4U2EA 2Q5CA 3TKAA 3EXAA 3T4UA 3T95A 3A9SA 3KSUA 4BNXA 4DR7B 4FDTA 1CUJA 1JDZA 4WBSA 2Q4EA 2X6QA 3P0IA 2GHQA 4UBNA 4BPBA 1BHSA 2C4NA 2AOUB 4RGVA 5J5CA 2DPGA 3TTSA 3FLBA 3X44A 2ZRDA 4PZDA 4B6OA 4YP9A 3AQ4A 1X7ZA 1RI5A 3Q3IA 1LSSA 4X8HA 1IB0A 3D8RA 1YR7A 1VIMA 4FZJA 5JNRA 2CD9A 3ETGA 5CA1A 2AW3A 2PX0A 4CKCB 2V9ZA 5LDHA 2X23A 1VMIA 1PKEA 3W5SA 2ENUA 1U90A 1EFPA 4JODA 1MQAA 2G7MC 4Q16A 1V5WA 4ID3A 1WULS 5K0FA 2NZJA 4PC6A 4RV4A 4YECA 2ZJFA 1YZ3A 3F2IA 2DQZA 4LJ5A 3H5OA 4MQEA 5DI3A 3JTMA 4KGXA 1PZXA 2GWRA 1JPVA 1T34A 2OUKA 2ZWPA 5G0VA 4B2PA 4G24A 1C3LA 4AYXA 2H85A 4RVNA 5E2AA 2O3QA 2YBEA 1YDGA 3QFFA 5FOQA 2W58A 5JE8A 2A14A 4NSNA 4PRZA 2OORC 4CTNA 1Z3IX 3HB4X 4GP9A 1Y6JA 2JAQA 3PICA 3PIRA 3H6GA 3BEDA 3FD8A 1HDRA 2BR4A 2G7ZA 2GBPA 2HSGA 2VQFB 4WJZA 2JGNA 2NVBA 4CTJA 1M0WA 1CIJA 3OFKA 3LGSA 1JG4A 1B43A 1K0UA 3HJFA 2VBCA 1KOFA 2O2DA 2F1RA 4N5MA 3BK1A 4UAGA 1IY9A 2IYEA 5BSEA 1IUKA 2RB4A 1MOQA 4DR1B 1KC1A 4Q9DA 4HK4A 4EEKA 1X9HA 3N8NA 4N65A 4PONA 2ZJ7A 1TCBA 4MP6A 5PGMA 2WU3A 2ZAMA 4HS9A 1SVKA 3U4DA 2EOAA 4US0R 2Z9BA 2UVPB 2XGSA 2GF9A 2XMGA 2RJNA 2WA2A 1P4GA 1QZUA 2ZFUA 3HJRA 4NCIA 4C9BA 1U63A 2A35A 1OE0A 1V8PA 5IKPA 4DC9A 5M5BA 1L8LA 1P0IA 1RFLA 3A70A 3B9RA 3ISTA 1A5SB 1YI8A 4J91A 4QQKA 4HLUC 5FO0A 3ZIDA 3HBAA 5EUBA 3V1TC 2QUKA 2ZZMA 4J0IA 3WV5A 2J7PA 1AKEA 1NJ2A 1ORTA 2ADMA 5EE9A 3CSDA 5AICA 1RZ3A 4D0NA 3E81A 5ENDA 3D8BA 3QFRA 3BCUA 2B1JA 5I7WA 1Y7HA 2O0MA 3ZNQA 2NSDA 4RTNA 2NTYC 2VYND 1OBCA 1TCCA 2PZMA 2GYUA 3SXJA 1JBEA 1NN1A 2JLRA 5SZJA 2YCBA 1U0EA 1IHXA 4G01B 3UB2A 3REFA 1FUIA 4AJKA 5P8WA 2I6QA 5ALMA 1Y7LA 2HC9A 2Q2OA 4QDZA 2DR3A 2OV4A 4QOHA 4YROA 3JVDA 1L5OA 3QEKA 3MJSA 5KSPA 3PDCA 3VXKA 2QX7A 1MF7A 3OMXA 4FGJA 5CBPB 1H2XA 2XXAA 2SNIE 1HYHA 1XL0A 3IDAA 4HNSA 1F0YA 4C08A 3X3HA 1SXJB 1Z36A 2IOHA 3JQ8B 5EXEA 3EAGA 4RTLA 2RAFA 3NC1C 4QA9A 1KAMA 1UBRS 4JEIA 4FIDA 3AWIA 4DMKA 3I5YA 1PW7A 2F9LA 4Z0HO 4EHHA 4FDAA 2JAWA 4A8JB 4YAOA 5DGTA 4B3GA 3DMTC 4XFDA 1MJHA 3V6MA 3DHWC 5FWYB 4R9UC 2DBQA 2JHPA 2YOHA 1R4MA 3FUXA 4M22A 4N3NA 4C43A 3EYAA 1XDWA 5JWOA 2H2IA 1BAPA 2BFFA 3MJDA 5AVKA 1YCFA 2ZWOA 4PG4A 1LDYA 4MRRA 4BCDA 4FMDB 4OMFG 3PXGA 2EZ4A 4LRTB 3WZLA 3WMRA 1N0VC 2CMKA 4EYGA 4EZIA 2AZXA 1B8VA 4RXTA 3IV7A 5KYYA 4D46A 1GFSA 3MAJA 1JKJA 2A84A 2AZMA 1SG6A 1D5WA 1W8IA 2QUBA 4DR3B 2HXSA 4QBGB 9MHTA 5HOEA 5DYGA 2WUEA 1URPA 1E6CA 4X61A 4ED9A 4JH0A 1XEFA 3ZS8A 2V9CA 3GZ4A 3H16A 1KJJA 4YXFA 1ZI6A 5HBGA 4R2JA 4XSVA 5A7GA 2QNRA 2PUJA 2FU5C 3VO1A 3DPSA 5HSGA 5LP6B 3BZUA 4AROA 3DV2A 3V5NA 4D45A 1A5BB 1R8XA 4GOOD 2A78A 4KHPB 3TDNA 2WNIA 1T9ZA 1X7YB 2B6NA 1D03A 3HP4A 3JVUA 3N7AA 4MV8A 5M3BA 4EDFA 2CEAA 2FX5A 8GPBA 4IG9A 4IG4A 4HMQA 1KSGA 4ETMA 2O5VA 1OI2A 4K03A 1GYRA 2JFZA 3WE7A 2QP3A 5LDDC 4HDCA 4YMLA 3WICA 1LK5A 4JJ7A 2OUIA 1JJ7A 3KPWA 4MXDA 2MWMA 4LY3A 1IUPA 4H6VA 5DK6A 3RREA 4DSOA 2KHZA 1GQFA 4O4IF 2YDYA 5BSGA 1PR5A 2PXXA 4QARA 5J23A 1EVEA 3IAM6 3SNKA 3ZWXA 4BWGA 9LDBA 4D0SA 3JQ6A 3AJAA 4JK3A 1BROA 1G4AE 2IODA 4CN9A 2VP5A 4YYZA 2WB4A 1CQJA 3I2IA 3R5TA 4FILA 4MQ5A 2CLMB 3K2BA 5LCXA 3VVCA 4B44A 2R0QC 4TKLA 2G71A 3G6KA 2HJVA 1EJ2A 1Z0ZA 1T3HA 2BKEA 3ICCA 4JLUA 1J0AA 2TYSB 2P9QA 5JVDB 3T5BA 1A9TA 2BGTA 5CM2Z 4IXWA 1TD1A 3TM5A 1QRDA 2BJWA 2J09A 3RVBA 7MHTA 1BCRB 1QFZA 1X77A 1XVTA 2IYWA 4ZVUA 5LBUA 1AQUA 4DDHA 4DSTA 2GZRA 2JJQA 2JK0A 4H3SA 3X1DA 4TLMB 3DONA 4CODB 3ND5A 2QTBA 1JSCA 5BMOA 3MT0A 2JGJA 5DYTA 2P79A 3QOWA 2XB6A 3ZI7A 3WGKA 1ZVKA 1IRXA 4CGYA 3I1FA 4L85A 4MPDA 4QQNA 2Q8NA 1GNPA 2AA3A 3L02A 1NFFA 3ESYA 5ALYA 4CJXA 3LBIA 3HKDB 4NPAA 2GA8A 2DFVA 1HO3A 2V54A 3FFBA 3NM5A 5JRZA 5LYJB 1E3EA 5L45A 1CUSA 16PKA 4MWSA 4PFJA 4GI5A 2R1TA 2X0NA 3Q2OA 4PRYA 1Y1SA 2JZNA 4PNEA 2XVXA 3TAHA 1YZVA 1DC6A 1GRNA 2WJJA 1OUMA 5TT1A 4DVGA 4E5KA 4TMZA 5KWEA 5EMMA 1AB5A 1NSYA 3D0RA 2W11A 2XNJA 2JBAA 4HQRA 2O7VA 4P1ZA 3G59A 3SPXA 3FYUC 1E2NA 1XEAA 1Z4NA 1K7FB 1ECPA 5LXTF 3UAYA 1IVYA 1DDGA 3AP3A 1Q3TA 1R0SA 3IDQA 3BCHA 3JALA 4IMJB 4NCXA 4QDOA 1ZC4A 4U7FA 4CKZA 3O92A 2NSLA 4Q7LA 1RWQA 1GFIA 2BBWA 1C3OB 3EBPA 3HGMA 4MV6A 5F4ZA 1DEKA 2VYNA 2A1UB 5H59A 1Z88A 2N1BA 3RVNA 2ORYA 5B3KA 2AI3A 3FCEA 3ORQA 4OY3A 3FI0A 3KJIA 5F5LA 4XVUA 3FCXA 4F56A 1V6AA 3WLLA 3FJ1A 4NZZA 3ONFA 5HILA 4OBXA 4FZVA 4IS3A 4Q5IA 4P83A 3RVKA 3GLKA 2AZTA 5A1TA 4NTZA 4C29A 3DKKA 4CM8A 1NI3A 4RWZA 5CNJA 1CVRA 2C98A 3P0EA 4OJKA 1RFGE 3LY7A 4OUKX 4QJ5A 1MRZA 2Z5VA 4E5UA 3R9KA 3ZJVA 3ENZA 4R16A 4I8XA 1C8BA 1LPBB 3N9IA 4UQOA 2ZSDA 1N9GB 3ZCVA 5LQDA 1DNPA 4DWJA 5DISB 4J4TA 5A9TA 4BKRA 3D4BA 5BSVA 4C7VA 3NAZA 1SN7A 2Q2NA 4IF4A 3R0QA 1CFZA 2OGWA 2UYGA 2QMYA 1A2QA 2A5JA 2LZ0A 2ZRCA 3EN0A 3PUJA 2A9FA 1FW8A 1AM4D 4WKBA 3UWKA 3VDNB 4H4EA 4QPNA 1CRQA 2ZJZA 3CW2A 4I46A 1CB7A 3Q9UA 4OHVA 3U4QB 2YFQA 1VECA 1Z75A 1J9EA 4ZDKA 1QKKA 2GKOA 3AJDA 5F7ZA 3MMPA 4R01A 3OUZA 3ZK7A 1N1DA 3CX4A 4O1MA 3ZK9A 5AVTA 1AGPA 3L93A 2EHJA 2V3WA 2PQ6A 2ZJ5A 3EHEA 5IJ0B 2YV2A 2YXEA 1XXHE 1KNXA 2QLMA 1E5TA 1W52X 4G0ZA 1WU7A 1MZPA 4HDKA 2WLSA 2FFBA 1MAAA 2YJNA 2C2GA 2PH3A 1RSZA 4F6LA 1TVCA 1VIYA 4XWGA 4NCBA 4F7WA 1CB0A 4UTPA 1XR3A 4NMXB 2WJ6A 3VR4D 1MC5A 3DVSX 2XCLA 4EQ6B 2O2JA 2IWRA 4I4LA 1PJ2A 1S1MA 1HDCA 1Z8HA 4QWMA 2WSBA 4ZI5A 3GEGA 4ZYZA 2GPNA 2HEGA 4UEWA 3OX4A 4GOKA 3LC7O 2W2QA 1ULUA 2UZ1A 1TGYA 3BFJA 2GETA 2IYQA 3TRFA 1KMHA 1YMUA 3D5EA 2C2BA 2VP0A 4R68A 3SKXA 1GL6A 2UKDA 1OW3B 1XNJA 4NS4A 5IX8A 1I0IA 4JGGA 1LX7A 1EGAA 3CNLA 4INPA 2J6CA 4RF4A 5CDYA 2B9VA 4ENRA 4JVNA 3VYTB 1AN0A 1ZVQA 2Y1WA 2BCJQ 1UANA 2QN1A 3EBLA 3ZVRA 3RYHB 4D9FA 1I2BA 1N6KA 1C30A 1RXUA 1BQ4A 1OPXA 1TUGA 2VOJA 4FEAA 1EFVA 5AJUA 1P29A 4IRUB 1F51E 3M2PA 4O4JA 5K8LA 3EZ6A 3NGXA 3X1KA 4MI9A 4ESVA 3KG2A 3MBOA 1U99A 1C9JA 1FVOA 2OHGA 4WCFB 1B7GO 3C8ZA 3HB5X 2C88A 4M3NA 2IFTA 2G70A 4XWWA 2ZAYA 3DOJA 3LL7A 1HX7A 2C03A 1GU7A 2FMUA 1SH7A 4D4GA 4RO0A 4OQ4A 1M2OA 5C1OA 1K3UB 1N75A 1Z5WA 3LT5A 1NMZA 3Q3JB 4BO3A 4DTIA 3K9BA 4NFYA 4DWVA 1RPNA 2UU9B 2ZIXB 1L9XA 2JEOA 3RD5A 1A96A 3ZHZA 1SELA 3ICOA 1HT2E 2IH4A 2I9KA 1XZMA 1V9SA 4CIWA 3BQNB 2ASVA 3MPOA 2YQZA 1FDSA 2R7AA 2XYPA 3PHBE 1FFDA 5LBIA 5K0EA 2WFZA 2F8TA 1L4MA 3G9TA 1FDWA 1Q44A 5E7MA 2V7EA 2ZVJA 1LUAA 3ND8A 4WY5A 3GJZA 3CWZA 4JP5A 1M5RA 1TU0A 2J9FA 3I45A 3LPNA 4M55A 3QMPA 4J0KA 4PICA 1W30A 4MI1A 5HFNA 5TB5A 5CJJA 5L51A 1A8SA 3B1VA 4QNRA 3A4IA 2IPOA 2VSFA 4QICA 2HHLA 3OJOA 3H8WA 1XAHA 3OCZA 4NBSA 3THXA 4ABTA 4QDKA 3VSDA 2C7RA 1GTZA 5L3VA 2W00A 5I3ZA 1U2DA 4ENSA 3AHCA 3W5AA 1LPAB 4MW4A 4NK5A 3PC8A 1T6NA 4D4MA 1NBWB 2VNAA 1W2WB 4EM6A 4UHDA 2PN1A 5ALTA 1FXSA 4PIMA 2L0XA 1MEJA 1SHJA 4BGDA 3RNOA 4RAQA 2FSGA 1V8BA 2X76A 4BFXA 1FNCA 1U7HA 3B3JA 4IMPA 1OVMA 4O29A 5B3JC 5FYDA 1Y7IA 4BFUA 5HK9A 2C4TA 3PC4A 3T3MB 1L2TA 4IUBS 3FIJA 3GUYA 4FZ5A 3VRHA 1JXOA 5LFAA 4LWQA 2B37A 3IR5A 3FZYA 3PS9A 3SXUB 4O4HA 1DEHA 1FXWA 4HWTA 3WWCA 1ECJA 1GZ3A 1I6MA 4U9HS 4JUAA 2BZ0A 2B8NA 5D5PA 1D8TA 2HRRA 4YI3A 3VPGA 3FCAA 1NI4B 2BY4A 3GJ0A 2PT5A 4GBED 4WESA 4IGFA 3FFAA 1IBMB 3F6RA 3NT4A 1CQIA 4JVMA 1RKBA 2DKNA 2YW2A 3BEOA 3IVMA 4UNSA 3RLIA 3KUUA 5JNUA 3NTVA 5AJXA 3F6BX 5JADA 2F4NA 5GP1A 1YDHA 3JWEA 3OETA 1IEWA 3PI6A 5B58T 2Q4RA 2Q7OE 3FUCA 3ILVA 2FK7A 2WWFA 4L3OA 1R5BA 3FOBA 2VDRB 4MUEA 2OD2A 3FRHA 3M81A 5JEEA 3QVVA 4Z3OA 3IBSA 1EXMA 4J0EA 1X1AA 5EIXA 2ZSHA 1FLDA 1TA0A 2R48A 5FOWA 2GYWA 1M6YA 4XQGA 5KYGA 3TTVA 4RSMA 3W4KA 2ZWIA 2DH6A 4GLFA 4E2YA 1SQFA 1HDGO 5C80A 2FQWA 1ADFA 2H4JA 1Z83A 2OO5A 3DE2X 5AQ1A 2AFIA 2PKQP 3INGA 3TI9A 4FINA 4WNCA 1VHTA 4EI7A 1HE5A 1HH4A 4E94A 4EX6A 1FU8A 1LWOA 3HRHA 2XNSA 3DO6A 1QCCA 3BD9A 3P9CA 2NW6A 2LW7A 1CJTC 1H66A 1KA9H 1G5RA 2PJDA 4PAMA 1BS9A 1KJZA 1YB4A 3CG0A 1D2RA 1ADGA 1W5BA 1YNSA 4IHJB 2Q29A 5GV7A 3RRXA 1Q5PA 4AN4A 4Q7MB 4CCSA 1ZEMA 4G5OA 1V16B 2Q8PA 2RKOA 3C87A 1DBPA 2CV1A 5HA5A 3G1WA 5IDQA 3DBHA 2PJZA 4PS1A 1GXSB 4K40A 2WJWA 4OQPA 5KSYA 2IEDA 3QRWA 1ESZA 4K9LA 5BR1A 3AETA 5BWLA 1QQAA 1UK7A 2J59A 1O8CA 2DMRA 2EF0A 1FJ2A 4NNOA 2VJMB 3D6UA 1VSBA 3VVMA 3QK7A 2J3QA 3HO1A 1MDBA 1V1JA 3UMBA 1VA4A 3IURA 5EFZA 1GGJA 4I8DA 3Q41A 1PK9A 2RI6A 2XITA 4D6YA 5HZKA 4JDPA 3AHDA 1EKXA 3K7EA 1PEAA 2X2OA 1SOWA 2GBLA 2OBBA 3FPCA 4GQAA 4KO4S 2YRWA 1Z37A 3SHQA 3P8ZA 3TZQA 1RQXA 2VN8A 3D2AA 4KI7A 1EX7A 1WMEA 1L3CA 3I4CA 2FN3A 3NXSA 4E4YA 2FZCA 3K8YA 4H7FA 3M3DA 3DP7A 3R3XA 2WG2A 2C83A 1RRPA 1U7XA 2I6SA 1V5EA 2VWHA 4YRCA 3MC1A 1XU9A 3ZLVA 2VJAA 4U7JA 3DTVB 4PM4A 1ZKMA 5KYWA 2NZVG 3EVCA 1E9RA 2OE2A 2XW6A 3C15C 4YP0A 1J9ZA 2VDPB 4G0XA 4MP3A 1BHQ1 1T5TA 4RC9A 5TSDA 3NYRA 1L5NA 4QTYA 1GA1A 4AYTA 4N76A 1LJUA 1B0ZA 1PG5A 5IVKA 3H8JA 3L6EA 3IUBA 4ALLA 3PX7A 1P61B 1Z74A 1ODJA 1J1ZA 2CL6X 4JI7B 3Q7TA 1YI0A 2O2SA 1RS0A 2B21A 4TXMA 1DCFA 5CVJA 5H82A 2WIFA 5JNVA 1BU8A 4BNNA 3PGJA 2WA1A 2YRFA 3MB8A 4AUNA 1OXUA 1Z6AA 3AWDA 3ITNA 3S40A 2NP7A 4QE3A 3UJ7A 2F64A 2VK2A 3PNLA 5K0NA 4UAUA 3VC7A 4ARZA 5BYKA 4QM7A 2PAAA 5AXDA 1XQ9A 3LY5A 4WMLA 1LY1A 2G9QA 1UMDA 2OR3A 3EZYA 1Z47A 3B3FA 4CQJA 3FOEC 2ANBA 3JQDA 2IXFA 3I2GA 4B48A 2PA0A 8AT1A 3GMSA 4S1PA 4LRXA 2OBNA 3HWSA 1X80A 3BBPA 2P6OA 4G1CA 3NBUA 1G6HA 4E03A 1WE2A 3EPLA 5JMPA 2VUUA 1QO9A 5AXCA 3VNRA 4GL2A 4K2HA 4J49A 3GGSA 1YK1A 4MVJH 4JDUA 5F1YA 2IUFA 4WNYA 4KYIB 4CQLB 3DEIA 4CEIA 3FTEA 2QMHA 1QE5A 2YFKA 2A5GA 1IOWA 2AQKA 3CBGA 1JI3A 3O03A 2PK3A 2YVUA 3ACCA 3PPIA 1S9HA 3W8EA 4DPLA 3CVVA 1M73E 3CONA 2Q5OA 1SOMA 1ZUHA 1LDBA 3HZHA 4ZCIA 1BDHA 1ZIPA 3B1FA 2OHIA 5E9QA 3VR1A 2B2CA 1NQWA 2A9OA 4YJFB 5DHRA 1R3DA 1N5RA 1SXJE 2CNWD 2QRVB 3HS3A 4M6WB 1Y5NA 5ALXA 3ASYA 1DAIA 1GUZA 5DULA 3W7VA 5JTTA 2AXPA 4EPYA 1YBFA 4M1EA 4C30A 1Z26A 4NOKA 1NAHA 1KVTA 4MB0A 2HGZA 3KK0A 2ET6A 2PKXA 3ZXIA 4EARA 2OFXA 4BZQA 2NP6A 2W7TA 3I4FA 3CRW1 4I4TB 3ZU4A 3AR5A 2C00A 4IDBA 2QX8A 4CHGA 2RH4A 2NLOA 3QKTA 4YP7A 4NBRA 2ZRLA 3A6EA 3C98A 1GPBA 5CVTA 2C8JA 5AXAA 3CRQA 5EQFA 1MOSA 3O26A 1E63A 3THWB 2UXDB 1MW8X 3A2KA 4M37A 1LK7A 5JYDA 1PWEA 2C2ZA 3TGLA 1F2UA 1XVLA 2L82A 4RLSA 4DPKA 3LOPA 2XUJA 1UFOA 3VZRA 1AXEA 3QPVA 4HQNA 1I2AA 1PV4A 3TVTA 1QCYA 1XZPA 5LM3A 1I1NA 1OX4B 1CUGA 5HF6A 3ZD6A 2CT8A 4RKQA 2XDWA 1HRDA 2F3PA 1YIDA 3D3QA 3OKFA 3QW4B 2R62A 3I8XA 4RH3A 3SHOA 3VKWA 4J2TA 1J33A 1DFIA 3AV3A 3OLZA 1XEWY 1MN6A 1NXWA 1F5NA 2PS0A 2VH2A 5TNXA 1QGZA 5FUWA 4PX5A 3DF9A 4CKEB 3OZ7A 4L3VA 3UJDA 2WQ7A 3DEZA 1X92A 4QG7A 3IOBA 2IQIA 2CWWA 3NRCA 2XGGA 3U7EB 1VOTA 1Q0PA 5FBKA 1G2QA 4KFTA 3KQOA 4KBYA 5CFPA 1XRQA 1JHAA 1TUBB 3HDGA 3NBXX 4DN6A 4LDNA 1A9XA 1VA5A 1E3TA 1KDTA 1IXKA 3PTZA 4KQXA 3JQ9A 5FR2A 5CK4A 4EJSB 2C7PA 1KTIA 2GM3A 3LQFA 1NBIA 5CG1A 1TZ2A 1TXGA 1X70A 4POAA 5ER6A 5GM2A 4HATA 5IDVA 3ZHOA 3U3OA 4AZ3A 4O4IB 2HMYB 2VDVE 1Q74A 2BGRA 4RDCA 4YCDA 3D8UA 2AJCA 4OXKA 2BEKA 3WRXA 3PXEA 1GUYA 3R6WA 1RQGA 5DEIA 3UK7A 3CPHA 5B7GA 4HVAA 1KEEA 4XIGS 1XF1A 5I5GA 2Y1EA 4NCKA 5JDIC 2RBEA 5BV2P 2VK8A 3KQWA 4TVBA 2CEKA 1EU1A 1GQOA 1SXJC 1UIMA 3VHXA 5M2QA 4JI4B 1ZUNA 3MTIA 5EYPB 4B7AA 3H1TA 1GNLA 3WLMA 421PA 4D2IA 4LBVA 3WY9A 3G5UA 2VF8A 3JCZA 3KX2A 1NC3A 3V00A 3RS0A 4A8JC 1Q77A 4IIBA 3QSGA 4LXUA 2J4CA 2JCXA 1R8QA 3W05A 1WZUA 2JA1A 3CLUD 1HNZB 3T3IA 1WL8A 4LBWA 4P5PA 5KWSA 1EH5A 2JIBA 4N3CA 4C5CA 1CJMA 1XC7A 3LNTA 4UTZA 1DLJA 4YUAA 1HA3A 3RSOA 1XU4A 1YQQA 2OV6A 1XMIA 2YJGA 4B40A 2FVXA 2A88A 4MUMA 3DMHA 2GDZA 2QTAA 3CKYA 4QODA 5FFMA 1WZ2A 1LW6E 4JT8A 1JHZA 5KX5A 3FOFC 3RK0A 3R7BA 3UHAA 3S5UA 5JJKA 3AOGA 1Z5ZA 5A0FA 5ITWA 1TVMA 3R0JA 3T4EA 5BQOA 1S3GA 1PJBA 2XODA 3NWOA 4ES6A 4PRKA 3VYUB 5LXTB 3EZXA 3DAHA 4CF7A 1XDZA 3W9BA 3KIPA 4OM7A 4TLEA 5GWXA 5H1YA 2R5NA 1UINA 3COWA 1US8B 4ZEXA 4IGIA 1RQ2A 1FSSA 3MRXA 4ITRC 4PPFA 5LP6C 3O3OB 3N74A 2YUIA 3GLRA 1E18A 4QXOA 4C4YA 1NL3A 3I2HA 1KQPA 4M36A 1Z62A 4MRPA 2QRLA 2NU7A 1Z2PX 2AMJA 4CMEC 4JEHA 3B1XA 1CUBA 2I6TA 3RIHA 4AMGA 2PSFA 3FDJA 4R51A 2YWRA 4EB8A 3W6UA 3ET4A 3LT2A 3O8OA 3OLVA 2SECE 3EPHA 2VF5X 1UPTA 2Y0BA 3KQPA 3Q7EA 2QN2A 1L7VC 1U8CB 2CNWA 3NM4A 1EJ0A 4IIVA 1JHDA 1OAAA 1S02A 5IMSA 1X7HA 2CLCX 4M83A 3QVMA 1WMAA 1ZAYA 3F6YA 4GSYA 4R8SA 3ZTYA 4KFSA 2Y1LA 3LO8A 4PXYA 1WG8A 4BKOA 2Q1UA 3BK2A 4V2IA 3KVNA 2FWMX 4FMPA 4TXNA 1G20A 4XFKA 4WZAA 3S2GA 2GNPA 4US1R 4MCJA 5K4AA 2BFDB 3U3DA 4QD3A 2IIPA 3IC5A 3VJKA 3OI7A 3AP2A 4MKRA 1M8KA 1VSVA 4RYLA 1N7JA 3GGOA 2WMDA 4RFSA 2Q21A 4KUGA 2BMEA 4ZOLA 4C0QC 5DSTA 3NNNA 2HF7A 4JOQA 3GGCA 1VKRA 2NUPB 3ADKA 1J39A 2KSQA 2BSAA 2C7BA 2F3QA 3CCFA 3ZR4B 4JR1A 4B3XA 4EOGA 4R9VA 2PUCA 2P8JA 4LZJA 5FTJA 1V3VA 4CCYA 1XPRA 2VHZA 1ZL2A 2FLWA 1YRBA 2C0CA 2COKA 1W0JD 1YUNA 4NV3A 5BMVF 3EMDA 3TIXB 5K51A 1DPGA 2FN8A 4G4IA 5I9TA 5T64A 2PXHA 1IM5A 4HS4A 2YDXA 4O4LA 4UOEA 2O8FA 4M7WA 2OXFA 3TQTA 3W6PA 4V2UA 3OJLA 2IYFA 2CVHA 4WAUA 4UOZA 3CUTA 3PT9A 4DYDA 3AB3A 3HY4A 4DIUA 4RK0A 4DWWA 2NU9A 3IVXA 1GR1A 1GL9B 1GZ7A 3TLYA 1F8YA 3TQQA 3ZCQA 4KXXA 3TQFA 1BVRA 3Q7RA 2VRNA 3QYAA 4NH4A 5K99A 2E6KA 2C2WA 2YMQA 2GD2A 2DWPA 2NAPA 3PXXA 4JZYA 1DC3A 4WV3A 4X1IB 4XIJA 2QN3A 1Q7CA 3U7QB 2ZUDA 4EKDA 4YIHA 4K6CA 1KP3A 4MUFA 3W6ZA 4A2QA 1WKCA 2X9VA 4I8IA 3P2YA 2XRMA 4KQ9A 1KC3A 4Q7EA 1ZFNA 4RSHA 5KI6A 1T9AA 2QMOA 3G23A 4XDHA 2VTBB 2NXNA 2YS6A 1P9OA 2DUWA 2AF3C 2HA3A 4GGPA 1I4EB 4G65A 4QPPA 2Q1WA 1NKTA 1PAUA 121PA 2OG1A 1BHJA 1OIWA 2O52A 1FNNA 4HRXA 1MJFA 4YRBA 3PV0A 1J49A 1SOVA 3M9XA 3O21A 3H84A 1IN8A 2WZBA 3CNBA 4F5WA 2EFYA 4MDYA 4UEOA 1FTSA 3OTWA 4E11A 5E1MA 1PSZA 1QVVA 4TUYB 5IHXA 1TVEA 1KHTA 3SFZA 2J3EA 5ALOA 4UQLA 2OB1A 4OBWA 4BZPA 1U2GA 1JG6A 2OVFA 4U3JA 4QOJA 4KO2S 4FSDA 4J1TA 2O1EA 4LCBA 1G17A 4N6NA 1BCSA 3C5EA 5JPCA 4QHTA 3OZBA 1RM4A 4KUEA 4OTZA 3RHFA 3TEMA 4RIIA 4XR9A 3ZDZB 1OHHD 3CX3A 1WSDA 3OSZA 2RGUA 3SLGA 4DLXA 1S01A 3ZCRA 2Z8YM 1ADYA 2A33A 1I5EA 1P1RA 1N2JA 3OD5A 4HFJA 1SQSA 4ZVVA 4TTQA 3A1DA 4E1BA 4V1CI 1QZTA 4J4BA 5DT9A 2ALJA 3AYXB 1RWPA 3HCFA 1DKRA 3VTFA 1I3LA 3VV2A 4DMMA 1A72A 1AGRA 4XWTA 3CLVA 1WW8A 4OQZA 2F3UA 4KMRA 4QT4A 1J7KA 3KUKA 1YVRA 1KI8A 3BSWA 2DH5A 5FPQA 4ZHQF 1JDTA 5B12A 4BNJA 2VKTA 5IHPA 2HQSA 3GHYA 4AM8A 2WTMA 2WOJA 3BRQA 1DC4A 3LCRA 1Z15A 2ZUVA 4EG8A 2I7TA 3DDOA 3QUBA 1F2TA 1T3TA 2C82A 3L8MA 1XFDA 3PF8A 1DWQA 4D80A 2V03A 3FRJA 4J03A 3A7EA 4QO7A 4UUPA 2GVZC 2KBFA 1YAJA 2VWPA 2CXHA 1E62A 2AE1A 3DQPA 3IVRA 4ENTA 3ABZA 4P7GA 5HIAA 5KSZA 2J3JA 2MT9A 3EAFA 4OXNA 3MJCA 4CL0A 4FLMA 3UJBA 2B7LA 3H65A 1QIKA 2IY7A 4G0MA 5AK3A 5JS8A 2KBEA 4RD3A 4MCAA 1QE3A 4Z9FA 5K0LA 4YT4A 1RKUA 1GGKA 1DZIA 1TOAA 2FB9A 3KOYA 3T7EA 2PX5A 1U3UA 3CLTD 1OAOC 1ODFA 3KOXA 5JISA 1NXTA 1JECA 1VB5A 3FSEA 4GOLD 5ISMA 1E2MA 1D9XA 2ADOA 2XCQA 4MEAA 3MSCA 4C0JA 4KPUB 5KJEA 5I7HA 3EEFA 3RTAA 1K2VN 1NJFA 1WW3A 3GHHA 3LW8A 4RABA 3KSBC 1OFGA 2VPWA 2LIPA 3ADOA 4EKIA 5TGTA 2RB5A 3IQHX 3LDHA 3RU2A 4AK9A 1WCWA 1PUIA 2WVHA 4JFAA 4QUKA 4X5OA 5EINA 2WILA 2HIAA 1PW5A 4LC0A 3R3SA 3AEQB 3T41A 1PBTA 4JR2A 3OM0A 3A37A 4N8DA 1G2OA 1Y89A 2NUBA 1A9OA 3AJEA 3NG1A 3EOAI 5FPTA 4HDAA 1KOLA 2CXSA 1PR1A 2W6MA 3SZMA 3UFXA 2FFHA 3ZTWA 4ESHA 2GGSA 2X2EA 3RVMA 1MVOA 4FBGA 1LRLA 4IIYA 3Q8KA 3RBZA 1W0JA 1NBHA 3TQOA 3ZH9B 2D1SA 2JD0A 2PYIA 5EZ6B 5FF9A 2QYOA 2V4MA 4BP9A 3IVGA 1FFWA 1QRSA 5EP3A 5KOYA 1DBWA 3VO9A 1PZHA 2JKVA 2ODEA 2VH5R 3KBBA 4FBLA 4W99A 1MAHA 3AJRA 3CUWA 2P3LA 1TW2A 1CP3A 3A32A 4BNVA 5EE3A 4DA9A 2AOTA 1X86B 2HPHA 1ENZA 2R97A 4LHYA 3E0XA 4UHBA 5D2CA 1I4DD 1M2EA 4TM8A 1YFLA 2Z2XA 4MS1B 1Y8ZA 3GC6A 4URFA 2C92A 3CB2A 1ZCZA 3HHEA 4A2WA 4PXAA 2RGGA 2Z1DA 4X41A 1BJRE 2IC5A 3CGGA 3ZKWA 2ZR8A 2CZQA 1QHXA 2GD0A 2F8LA 5THXA 1PSWA 3RRJA 2K7ZA 3NRJA 1GG8A 3BN3A 1ZRMA 5MGBA 4UD2A 2XKBA 4I50F 2Q3EA 1YU9A 4D3FA 4DIEA 4HLUA 1NJSA 3RS9A 3R6GA 2YY5A 4KR9A 4XYLA 3TIVA 3M33A 2TSYB 1MZVA 2V6IA 3DO8A 4NKRA 4QELA 4MGHA 4GKKB 1ES9A 1L0BA 1RAGA 2XDYA 3CRZA 2XD9A 2IZ7A 3OCVA 4FHZA 3F0TA 3H9CA 3OJXA 4IX1A 4L07A 3SX2A 4G41A 2PFGA 4EJMA 5C5CA 4RU1A 2HBYA 2QL6A 4JJKA 2QTNA 1Z5GA 3JPWA 3C4JA 1J42A 3CN9A 4PFSA 5LMUB 2XYHA 3R40A 3UJ9A 3JRNA 1BEZA 2R8YA 2L18A 4ND7A 5FA8A 3KYDB 3LPDA 5HF9A 5HNKA 2RGWA 2GN1A 2IYSA 3NJ8A 5DRYA 1OHHA 1QPBA 4FGZA 2WW8A 3FVTA 2H4HA 2OCGA 1E9BA 2OB2A 4O8CA 1K08A 4PTZA 5DM2A 4D43A 2BMFA 1K06A 2WJPA 3M6IA 2WICA 4FCWA 4MMXB 1YDEA 4WADA 3OZDA 4NECA 4I9NA 4Q9IA 4OD0A 1HDEA 3DL2A 1AKMA 4JL6A 3TAUA 4C0WA 3TRKA 3CKLA 3DTTA 4P38A 5H9VA 1V3QE 5C34B 3VSBA 4J1SA 1PG0A 2PH7A 3CT6A 2QTLA 1RCUA 2BELA 4MYUA 4AF8A 4R9SA 1C9MA 3DMTA 3IMKA 3NH9A 4FKZA 3DM5A 4RPKA 4JXZA 2FWAA 2IDJA 3VI4B 1KJ9A 3HWWA 3TSAA 2UYYA 2GAIA 5F51A 3O1HB 4HZUA 2C99A 4A8PA 2Q4BA 3M6FA 4DYHA 3WJ7A 1UBMS 1CR2A 3WDKA 2H4FA 2FQQA 3OHMA 4ONEA 1VP3A 1AUXA 1TYBE 2H92A 4XGRA 4GF5A 1VHJA 2OL4A 3FMPB 3GFOA 1YAHA 1EHYA 1ZD8A 2J30A 1QJ4A 1QTNA 3PA8A 3UHFA 1BFUA 4MS4B 5TLSA 4IQ8A 2F90A 3D3EA 3CUKA 4QUEA 5KHLB 1YNOA 2PSHA 2ES4A 3EXFB 5FL3A 1UEJA 2FCAA 1OWLA 1WLYA 3IIKA 1WHSB 4ZTBA 5EJGA 3ZHQA 2MSLA 3FTDA 4OBBA 4BRUA 4XB6B 5I7VA 3ADCA 2V0GA 1Q1ZA 3CO5A 2QSJA 1U9JA 1QG4A 1R15A 1TPZA 3TUIC 1Y6RA 5KYTA 2X8BA 4OHXA 1X39A 4ETIA 1I4TD 3GGGA 4MV4A 5I9LA 2ZJOA 3WSVA 4KTTE 4A1FA 5KOJB 2RONA 3A1WA 4P98A 2DFTA 1LS6A 1AXGA 1U9IC 2HY7A 3BFXA 5TRTA 4B74A 2HHHB 2OZLB 4WA7A 3UUGA 5KDDA 4OOFA 3VTZA 1RHRA 3GN1A 1FZQA 4I1VA 1TA9A 2WV7A 3P4UA 4KAFA 3TF5A 3DUFB 1N1EA 2RG7A 3LUBA 3OKCA 4R9RA 4K5QA 3M6VA 4H1VA 4E33A 3PJDA 5FTMA 1NR7A 4B34A 2NZUG 3JAMA 2IEIA 1WV1A 1W36D 4DCGA 4M60A 1NGSA 2V97A 3IODA 4QO8A 2H65A 5IAKA 1AGYA 1NPYA 4IKPA 3VR4A 2X4IA 4I7EA 5AVYA 4ZO8A 5JH7B 3I6IA 4RY2A 4P3OA 3JD3A 2GTHA 4BNMA 5L3SA 1ZGAA 2CDRA 1THZA 4W1PA 5J3JA 4B6SA 2R751 1NF8A 3OLWA 4AULA 3ZBPA 4EYQA 5LLDA 4Q7JB 3ZWYA 1Z22A 3HZOA 4X3PA 5EMHA 3O4HA 4RGQA 1Y0BA 2R6AA 4KXNA 3B9PA 4M8SA 1DDIA 2B3DA 4R1TA 2JI7A 4BDTA 4AX4A 2QUAA 2FW6A 2H8KA 2WM9B 4LRWA 4E21A 2H5LA 1KVUA 1QG0A 4YRZA 3V7UA 2AUNA 2IGTA 4L4ZA 5AYVA 4BCCA 2R96A 1MJNA 4G1FA 4J3JA 2PGDA 3EBOA 2O50A 1SG0A 2VP2A 4KZPA 2EHDA 1I80A 4MR9B 1N2HA 3BJEA 1Y8CA 4HLNA 1K4YA 1HKHA 1J4AA 2ZJ4A 5LZ7A 1SBIA 1KQNA 2FGKA 3TRIA 4QX6A 1EM8A 4J6EA 1M8JA 1T43A 1E94E 2QUIA 2Q9AA 4JQSA 4JUBA 3SEAA 1XTTA 2P2NA 1JLMA 2V7XA 2JIMA 1DARA 5FPPA 4DLWA 3C3CA 5K7SA 3NOXA 1W5SA 2PNJA 1N8SA 4B6QA 3FYUA 3DAOA 1K5DA 2Y71A 3Q98A 2Y0EA 5KHAA 1L5WA 1T5OA 1UADA 4LUCA 3RUIA 4BE7B 1YO6A 3ZQ4A 2BKXA 1X3LA 2XNCA 1TD9A 3O4VA 4HVTA 4NAUA 5JARA 3UA3A 2IHNA 5GJVC 1FEZA 2ZETA 4NNPA 2PXCA 5FV4A 4RHFA 2AJBA 4KNVA 1AKUA 1HQKA 3KTAA 2Y6UA 4FVTA 3WL4A 5A5EA 2OVBA 3O9MA 3U16A 2FF5A 1I1HA 1NV8A 2QT0A 4TQ9A 4XYBA 1IXZA 3C5WP 1G38A 4HBGA 5FXMA 1PNQA 1QLJA 4DIDA 3MCTA 1DAFA 1A9QA 1GOTA 2FWBA 2HMTA 2BFWA 5J9FA 3VGJA 3IQEA 4HWGA 1ZX1A 4XYMA 1P6XA 3LK7A 4KRGA 3CG4A 3DCNA 3DZ8A 3D64A 3IQGX 4RMNA 2GM9A 1OA0A 5CHEA 1G64A 2YC2C 4FGUA 4DABA 3EY9A 3TW6A 3JQRA 3HM9A 1E3JA 3QVTA 1VPEA 1YKSA 2WSIA 2N9UA 4PLHA 3RDPA 3UJAA 4IICA 4UNRA 3BE5A 2MINA 1ORHA 3A3NA 4Z1MD 3AF3A 1Y9DA 3A0UA 4G4JA 4BZZA 1Z13A 2WMYA 2PVPA 1B15A 4PTLA 4DKXA 1JJBA 1MEOA 1NFQA 1ETHA 4NENB 5B4TA 1GAQA 2Y76A 3C6BA 3LWBA 3OCWA 3PBKA 1IK4A 2Q3HA 1GZ4A 3HFRA 4A10A 4LXXA 1EUDA 2BCEA 5L95A 2FMKA 1MO5A 3P52A 2JL1A 3WFIA 4FNAA 1NE7A 1AGNA 1L4GA 2XT6A 4JX8A 1DKUA 2Z0MA 2HDNB 4P80A 3UMJA 1G8FA 1YE3A 1NBME 4H0NA 4MMYB 1X2BA 2IIQA 4G0PA 3VSCA 4EO4A 2XVAA 4NAVA 4H7JA 5F1KA 3KO8A 4KV9A 2WDPA 4ZOCA 4KQMA 2PZFA 2NZYA 1HC7A 1PZFA 4YH1A 2C2XA 3UEOA 4QJBA 1LNQA 1AOXA 3LCUA 2PLFA 2PZEA 2WYOA 4HH3C 5A1JA 1E4VA 4JGIA 4M1TA 4GXRA 4QJIA 5F3WB 5DNVA 1ZH2A 3U1VA 1R6BX 1Y4SA 1NURA 5CBKA 1WPXA 2D2VA 4TMXA 5JT1A 3MTBA 1ND6A 1S2LA 4FT2A 4REQB 4CZ2A 5CDSA 3BL6A 3W3AD 5BOSA 1ESCA 3EQZA 4HY3A 3ZVKA 4MROA 5CDTA 4WX2B 1G5QA 2JH9A 4PSDA 1PWHA 2JJYA 2XRYA 5F9MA 2NO9A 2VSXA 1E8DA 1H2YA 2KW5A 3Q3EA 4M7RA 4U5XA 3R9XA 1CEQA 3ZE9A 5CAEA 2CD7A 3QE9Y 2AR0A 3V8NA 4DGQA 4BKUA 1MQ8B 4NRDA 2DHDA 3K94A 3RUAA 1KIMA 3K0CC 1CXZA 1PHPA 4OB7A 1UKBA 1YR1A 1SUPA 3I5UA 2VNSA 3D0QA 3OEED 3R3UA 3GPIA 4Q4JA 4UKDA 5IKOA 3T7SA 4E70A 4GHWA 2HT1A 2AW5A 3QNUA 3EXIB 1SQGA 3NOQA 4IW3B 1IL0A 5AVXA 4X60A 1T1RA 3RASA 1PQYA 5EWJA 1PR4A 4Q03A 4V1CA 1EK2A 4MHTA 3KXIA 1YZUA 1EE9A 4IM7A 1UPUA 4X20A 3S44A 2B25A 2PQMA 2VP9A 1P4AA 1Q0SA 5AR1A 1EA7A 1W9MA 1E2JA 1G8GA 1TAHA 2C31A 1S8OA 2ZYRA 3FPAA 3QBTA 5D01A 5EE0A 4CM6A 4D9BA 1M34A 4I99A 4E51A 4FTWA 3N5KA 1R6AA 4EA9A 2ZYIA 3ODPA 4HAYA 1YOVB 4IDNA 3R5SA 1YTLA 5DOVA 3K6SA 1F5SA 3C7KA 3FLAA 4IVRA 4Z0TA 1BXRB 1IN7A 2WVGA 3SQMA 4W7SA 3MAAC 4GRDA 3AHGA 1WVGA 2VDMB 2GSWA 4BMNA 4BUJA 2H06A 3A31A 3G8BA 1XCOA 3LH5A 4I1SA 4OJYA 4FGKA 3HBMA 1ZK3A 5ABPA 1ZD9A 1R4AA 2LBPA 3CY6A 5AHKA 1ISIA 1ENYA 1Z35A 2WYIA 5A7HA 5JNSA 1ECCA 1XUOA 1XXHA 3COVA 3GFGA 2DUNA 3KYBA 3F4LA 4QDJA 1GCGA 1FMCA 5DVZA 4LECA 1W47A 1OU0A 3BXXA 5HM8A 2B92A 4LK2A 1KI6B 1YD7A 1KEUA 4IL5A 1VXRA 4IJMA 3UAGA 2CUZA 3EGEA 3MQ4A 1OH5A 5CA1F 2HGSA 4FYJA 4HDSB 4FW8A 2OSBA 4ZAVA 1JEJA 2G67A 2X1MA 5BUQA 2WPDD 5JNLA 2R4TA 5L4NA 4QUJA 1KDPA 3NCTA 4LE1A 1JXAA 3WMXA 2CNKA 5A4KA 5KVSA 1ISFA 1MP0A 1GA6A 3M1AA 1M6VA 2X5OA 3FNRA 4GSLA 4CLXA 1MB2A 4LZPA 2DFPA 3B6ZA 3ELWA 3HVJA 1RWXA 3OCUA 2GI4A 2QVLA 3M1IA 4XLZA 3UCFA 3CISA 3WWZA 3UNXA 1P80A 1ZW1A 4DEVA 3WMFA 3OTIA 1P91A 3UC5A 5EZSA 4BWVA 1NTOA 3KEMA 5CMLA 4E2XA 1PYOA 1HDIA 5DCLA 3LT4A 3RC9A 4UUAA 1IK6A 4EKYA 1OT5A 1QAQA 1ORVA 3NIDB 4WEOA 3DBVO 2RCYA 1UBJS 1ESNA 2X8LA 3CM0A 1JQJC 2JFQA 3EXEA 5HVNA 4AKTA 2GFQA 4Z1MA 2PX8A 5FNVA 3MOIA 4ZHQB 1CJCA 4WCVA 2Z09A 1NDUA 2QJTA 1DRJA 4JVLA 3W8DA 3CF2A 1NRWA 1K89A 3SQOA 3GLFA 2Q5JA 3PEEA 2PPVA 3N58A 4ZC8A 2L2QA 3ONNA 3U48A 1JHQA 3KTFA 3A1UA 4MWDA 4NMLA 4XDYA 1YRWA 3E18A 2HBZA 2HMSA 1RCTE 4JXKA 1ZHOA 3F3YA 1J23A 2ONYA 1QMPA 3QY0A 3R5XA 4HDRA 3NKLA 3TW4A 4DF3A 1R2QA 2OQRA 3JRXA 5DX8A 4YRQA 1RJDA 4MUXA 2VF7A 2ZUBA 3TB4A