3I30X

Proteinase k by classical hanging drop method after high x-ray dose on id14-2 beamline at esrf
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title Atomic structure and radiation resistance of Langmuir-Blodgett protein crystals
rcsb
molecule tags Hydrolase
total genus 97
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3i30X00
1GA1A 4J94A 1CNMA 1SIUA 1SBTA 1SUDA 2PMWB 3Q40A 3BGOS 4CFZA 3VV3A 3AFGA 3HJRA 2E1PA 2Z2ZA 2W2MA 1HT3A 4H6XA 3DE3X 2X8JA 4JP8A 2XRMA 4ZOQI 5JXHA 1IAVA 2WUVA 3VTAA 3DW3X 2QTWB 3AJ8A 1SCAA 1Y1KE 3DYBA 1Y9ZA 4OV6B 1DBIA 3GCXA 4FONA 1ZVKA 1GTL1 1LW6E 1R64A 1SIOA 3TI9A 1AF4A 1BFUA 2DUJA 2G4VA 3L1KA 2PYZA 3VYVA 1AH2A 3DE1X 2PRKA 3A3NA 1AVTA 1SUBA 3BX1A 1XF1A 1TMGE 3DE5X 5AMXA 2GKOA 2V8BA 1WMFA 1SPBS 2WUWE 4KG7A 1GA4A 3SQOA 3Q5GA 1Y48E 2P4EA 3EE6A 5AVKA 4NE9A 4NMXB 2SICE 2PKCA 1GNVA 4NE7A 3UNXA 1UBNA 1BH6A 1TECE 4WOBA 3VHQA 2IY9A 5ARDA 3TI7A 2PQ2A 1R6VA 5AQEA 4H6VA 2HPZA 3EDYA 1TK2A 1ST2A 3AJ9A 4C3UA 1SBIA 1GA6A 3CO0S 5FBZA 1KDYA 4CG0A 1YU6A 2W2PA 5FAXA 1IC6A 3GT4A 1GTG1 4DWWA 1AU9A 3DDZX 4RYDA 1V5IA 3QMPA 1GCIA 2ID4A 2ZWPA 2ID8A 1BFKA 1OT5A 2HD4A 3I2YX 1Y3FE 1NDQA 1WMDA 1A2QA 1TM1E 3I37X 3LPCA 2PWBA 1PJ8A 5JMOA 1PEKE 4WOCA 2DQKA 3T41A 4H6WA 1P7VA 1PFGA 1WMEA 1BE6A 3GT3A 2ZRQA 2Z2YA 1ST3A 3I34X 2B6NA 4DZTA 4M1ZA 1S2NA 3WQBA 1C3LA 1S01A 4HX2A 1Y33E 3H42B 1EA7A 2SBTA 1CSEE 5CW1A 3WIVA 3LXUX 1S02A 4OMDA 3VSBA 1AV7A 4C3VA 1BJRE 1GNSA 5B1EA 1AK9A 3P5BA 2SECE 2Z56A 1SUAA 1NDUA 1WSDA 4AKSA 5JXJA 1OYOA 5ARCA 4KB5A 1Y3BE 1C9MA 3DE4X 3F7MA 1Y34E 3A3PA 1Y3CE 1OYVA 1SIBE 2WV7A 2Z2XA 1MEEA 1P7WA 2W2QA 3F49S 3F7OA 2SNIE 1SN7A 1BE8A 3I30X 1Y4DE 1SUPA 3DVQX 3SICE 4KPGA 1MPTA 1TM7E 3GCWA 5I9SA 1VSBA 1Y4AE 2DP4E 1GTJ1 5JXGA 2W2NA 1T1IA 2TECE 1WVMA 5FFNA 1KDVA 3ZXXA 1GT91 1SCJA 1YJAA 3DWEX 1TM5E 4K8RB 1KDZA 2Z57A 1R0RE 1SH7A 1EGQA 3OSZA 3DW1X 2W2OA 4LVOA 3WIUA 1SCNE 1JEAA 1KE2A 3DVSX 1T1EA 4YN3A 2X8JB 3WHIA 4OMCA 1P8JA 2XTJA 4HVLA 5AVJA 1YJBA 3ZXYA 5SICE 4GI3A 1SBNE 1TO2E 5ARBA 1SELA 2Z58A 4MZDA 1C9JA 5B1DA 4I0WB 4B5LA 1TO1E 1SUEA 5JXIA 3DE6X 3EIFA 3DE0X 4ZARA 3DVRX 3PTLA 1C9NA 1PTKA 3TECE 1YJCA 1TM3E 2WWTA 3D43A 3DE2X 1T1GA 1SUCA 3CNQS 1SCBA 1TM4E 4CFYA 3VV2A 1Y3DE 2IXTA 4Z2AA 1ZVJA 3D9QX 1SCDA 2ST1A 2ZWOA 1SBHA 1SVNA 5K7SA 4BWGA 1SBCA 3LPAA 4DJ5X 4LVNA 3QTLA 3DE7X 2Z30A 3BPSA 1Q5PA 1V6CA 3PRKE 1NLUA 3LPDA 3QFHA 1THMA 3A3OA 4AKTA 1KE1A 2PWAA 1DUIA 1AQNA
chains in the Genus database with same CATH superfamily
1VFPA 2QTTA 2PZAA 1DPFA 4ZYUA 5C1DA 4J94A 2XZTA 5D5HA 3PDJA 2KJQA 2REQB 1GL3A 4DXHA 1VB5A 1ZGJA 4YRJA 4AJPA 3HB5X 3DHEA 3GC6A 4R9RA 4LK3A 1XXHA 3WICA 1FYFA 3MT7A 2OQVA 3FYSA 1WNFA 3DPUA 1PJSA 1KA9H 2YNMC 1XZFA 2WV9A 2RHRA 3K4PA 3O31A 4RSMA 5TJ9A 3TX2A 5L53A 1G5FA 2CY0A 2FRDA 3ZHTA 4NEHB 3UENA 4R7ZA 1VPLA 4HX5A 4JT4A 2AOUA 4KL8S 4PYKA 2AE2A 2Y1OA 3G9TA 4OOEA 5EQFA 2F1HA 3EEYA 3HB4X 1EAYA 2XCQA 1EU1A 2R4QA 2X8JA 1LJLA 1VDZA 3CQ9A 2E4YA 4IPTA 4JP8A 3A6EA 3OOJA 3BKWA 5FV7A 1Y4ZA 2QT9A 4ALMA 5HTOA 4C1NA 2WUDA 3ET4A 4QOSA 1Q0TA 3VJRA 2GZ2A 3PR3A 2WP8J 3QEMB 4L28A 4E51A 5BXYA 3PUIA 1KR2A 1RD4A 3RHZA 5A0VA 4C20A 3FPGA 2YZ7A 1PLLA 3ZD6A 3SQDA 1JBQA 3WK6A 1D4AA 2WA1A 4AUNA 1JA0A 3GRPA 2RK4A 5DNUA 1ZR2A 1LBTA 3NM6B 1CR1A 1SXJA 1KZGB 4TV8F 1EJBA 1JBEA 2PJUA 2ZSJA 3OJWA 3W1WA 4DAEA 3TUZC 1M1YB 1ETUA 2ZROA 2C77A 3G5MA 3O1IC 4AMGA 1VECA 3IO3A 3C48A 1PKEA 1JHVA 3SLGA 4MQMA 4RPGA 3OZCA 1NSTA 5H9VA 4E11A 4FP9A 2COUA 5JYCA 1ZVKA 3BL8A 4F5DA 2CXXA 4HXGA 2FPPA 4GNRA 5B37A 4IOJA 1LBEA 1GLVA 3T34A 4WASA 2VCYA 2JKYA 3OM0A 3QGMA 4DCOA 3MJHA 1Y5RA 2H7CA 1M0WA 1K4MA 2H7VA 2I5PO 5AOBA 4AC9A 3HPQA 3OAAA 2F1RA 3TEMA 2OG2A 4C78A 3FPKA 1ZRHA 3TK1A 2A9FA 1JVBA 1PT8A 1L7DA 2HU2A 2QAGA 4HDKA 4RHXA 3GPDG 4YBZA 2ZU6A 4KRYA 3WMEA 1GG5A 1GPLA 3ICWA 1P4HA 4A6EA 4ZN6A 3ORQA 1CUYA 1ENPA 1G9SA 3MINB 4WXPA 2R5NA 4IR7A 4X1KA 3E7PA 1NWCA 2WYOA 3H1AA 5SZJA 1USVA 1N2ZA 4Y9UA 2DT5A 4EUSA 4U1RA 4RXMA 3ED5A 3P45A 3W3ZB 4WXYB 3PU6A 3P2JA 4C05A 5KOYA 5KB3A 1IEXA 1YB2A 2QT1A 2X15A 2YQ4A 3G13A 1FFCA 3MS7A 1Z38A 3OT4A 1RLOA 2TSYB 5L3ZA 3FZQA 3UANA 4IUDS 3VDXA 4X6YA 8ADHA 5DYTA 1IQUA 3L05A 5F2KA 3IALA 4FQ8A 4QJIA 4PYLA 1I3OA 2RGNA 4R9UC 5C4GB 5BT9A 5DTIA 3A9WA 5KYWA 3RU3A 5B2FA 2WIGA 5HKKD 3RAFC 2H2FA 2W6OA 2ZJ3A 4NE7A 4EAAA 1NUUA 5I47A 1HF3A 2JKVA 1U2SA 3L5KA 3R8XA 6LDHA 2C7GA 2E4UA 2PV7A 5KVQA 4BNIA 1XPRA 3BFXA 2HHHB 3AUJB 3C74A 3HKDB 3EG9B 4ZAVA 1TRHA 4O08A 2GK4A 4X45A 2VT3A 5E1DA 1GSIA 5LOVF 2DHCA 3ENWA 1XAIA 3C7TA 1IH8A 3QI7A 2P9FA 4YREA 3UBTA 1O0CA 2YY7A 1YL5A 1ZYUA 5D87A 3DDOA 5L6LB 2GVDC 3K9FC 3RREA 5JO9A 4DSZA 2IU4A 5CCXA 2I3AA 5EOVA 3JVIA 2ZIWB 3H4IA 4CF3A 5CFMA 4UTOA 3O4JA 5IDWA 2XE7A 3GG9A 1FY2A 2FLVA 3LY7A 4PR0A 4AD8A 5ELXA 4PXYA 1F5SA 1NSFA 2EL9A 1WDKA 2FPOA 2I71A 4WA7A 4LJ4A 1XU4A 4ZRMA 3I61A 1JH9A 3JQ6A 2ZBDA 3KJZA 3L0YA 4GDMA 4LZPA 4D46A 4W7HA 1O2DA 2NSDA 1LPAB 1NL3A 4N5HX 1XZAA 2ZRIA 4B32A 1UKZA 2YICA 3L8MA 2ZXUA 2FG7C 1QANA 1SO8A 2BR3A 2VKQA 3HVUA 4RYDA 4B74A 5AI9A 5CXXA 5I4IA 1X39A 2MSWA 3T9AA 4RTNA 3U1TA 2WUFA 2FUNB 4OOFA 1DFGA 2VOEA 3CIFA 3H05A 3HRKA 1U7WA 5FQNA 4QLOA 4WZAE 5F1PA 2VWPA 4ZAGA 2RK3A 4PX9A 2FW8A 5AKGA 2HRZA 3SSNA 1G20A 2QB5A 1WEHA 4JI0B 3JVEA 4YI3A 1EP2B 3WGYA 3QEMA 1YK1A 2NUPB 2PWBA 2ZRJA 1O3YA 1Z0SA 2F43A 4QELA 3IA7A 1PEYA 5KSZA 5IKOA 2VHTA 3TKLA 4H0FA 5JY1A 2QL5A 4ND5A 1L9XA 1AUPA 4B2YA 2OT3B 2JD2A 1C3XA 4N6OA 4UUBA 3D4BA 2VUTA 4XYBA 5AW5A 4G0VA 2ZSAA 1QV6A 1TA0A 3NWBA 4RD4A 5IVDA 1CRZA 4CPDA 4XYLA 2X14A 1DO8A 5K09A 1LNSA 4PO1A 4RKQA 3GT3A 1T91A 2GTIA 4C4OA 2AEMA 3VPCA 4MB2A 4E5VA 1W36B 1QLHA 1ST3A 2V65A 4TMTA 5FA8A 1IMOA 2J9GA 1YQ9A 4JOSA 4NBTA 3SX0A 3X1KA 2YRWA 1YVUA 4XIIA 5FX2A 4HYQA 2QRLA 4ZQHA 2F8TA 2FP4B 5J43A 4DCUA 3SDZA 4DLSA 4IX1A 3IKJA 1Y81A 5AFSA 2WTUA 4OQDA 1A76A 1D2EA 4CEHA 1PWHA 5A9SB 4G0QA 1MJGM 2OBNA 1X1RA 3AUXA 4P92A 4PU0A 2B34A 3GXOA 2NNLD 3NYIA 3GLHE 4BFYA 4FDVA 5KNDA 2XXAB 3V8NA 3KTAA 1HE4A 4BB6A 3RANA 3WC4A 5C8DA 3GEPA 4L08A 4L07A 4JU8A 3OT5A 4M89A 2NU8A 3O1LA 4FGKA 1BU5A 3HXQA 2ZJ8A 4G65A 3AEUB 2FG5A 3LHSA 2PA3A 1H2XA 3ZIUA 4D43A 2GH1A 3LXUX 5KNCA 4WLEA 3MJDA 2WINI 1EIZA 1XCBA 5CT5A 3BXPA 3L0DA 4DYHA 2Q9CA 5BY2A 1F20A 1FFBA 1YK0A 2A0KA 3ID6C 3PUZA 2HSWA 5K0NA 4LSMA 4EPXA 1PK8A 1E7RA 2OV8A 1FUEA 3DAFA 3VVMA 5IXYA 3HFJA 5BSHA 1A8PA 5BMVA 1CLUA 2HQRA 2IDZA 2FWMX 2K4MA 4LA4A 4WCDA 1CJKC 2B4KA 4KQWA 4Y2GA 4F2PA 4NNJA 2F1IA 1NNEA 3ZDBA 3EIHA 4RE6A 1IB6A 1CR6A 1QYCA 4K9OA 5KYUB 3RFCA 1DJPA 4YWJA 2BSXA 3NNSA 4UXIA 2MSNA 5JJLA 1CIVA 1VSVA 1SWVA 3PFCA 1FA9A 4IDHA 4RLFA 2QRUA 3S2GA 4YRBA 2OLJA 2B4YA 6PFKA 1BXRB 4CIYA 1WXHA 2P40A 3CJQA 3HKDA 3EG9A 5CR9A 2Z9BA 4UNPA 3G2LA 4D8UA 1XC7A 5LCXA 1MB3A 4P93A 5CNMA 1A7KA 1G3IA 1KY3A 3D0RA 3OEHD 5C1IA 4RTRA 4AJHA 4OFWA 3BWMA 3NHBA 4XEUA 3MJTA 5IJXA 2Y68A 3T94A 5SV2A 3WGTA 4BNNA 5B2EA 3NVAA 4UC0A 4GPIB 1ZD4A 4Z53A 3NJ8A 1SWWA 2FN8A 2XYQA 4GI5A 2JAWA 2CFTA 1JYEA 1SQGA 4GVLA 4BZPA 5KTYA 5BSUA 1JEYB 3P9SA 5EP2A 3A3PA 3K35A 3OQHA 5HUHA 5EVCA 4M98A 4QC2A 2H08A 4BQEA 3ACCA 2Z2JA 1TFUA 3HXOA 4WSOA 4Z54A 3GN1A 2IYYA 2J3EA 5E2IA 3HUUA 1BE1A 1T9GS 2CUTA 4HEA1 3USZA 1H9CA 4JSYA 3WMGA 1E1RD 1Z5ZA 1MGPA 5B1HA 5FR1A 2A67A 3X2EA 4F5ZA 1RMTA 2ZT5A 4Q4JB 2HOQA 5MFPA 1JFFB 3B1YA 2XYVA 3KTOA 3BUSA 4Y9RA 4TVKA 5HGXA 4BIMA 2I55A 4EI7A 3O8CA 3VSAA 1PFQA 4EGQA 4LF8B 3NG1A 4X97A 1WW2A 1CUZA 5KNDH 3W04A 2YIDA 4WUVA 2ODNA 4K86A 2PKXA 1PW7A 1ZZEA 3L6DA 3X1YA 1IL0A 4YVFA 2D1TA 3NKFA 3W5JA 1HA3A 3GUHA 2NUPA 3MQ4A 4J7XA 4W9RA 3GK3A 1DC8A 5KNCH 5JLAA 3RAEC 3RIXA 3V55A 1O8BA 2ZUBA 4TYMA 1YRWA 3LVBA 3BH6A 2VDOB 3DT8A 5AJUA 2X8WA 3MM4A 3BMNB 4G1FA 4I5DA 5FFNA 4BJ1A 4BLWA 1MHTA 3FDZB 4EHHA 1I3CA 3I9MA 4FFVA 4QTZA 1OBOA 3RU9A 4M9RA 4DCSA 1VMAA 5HZKA 4X00A 3K0CC 1XFAA 1KP9A 4OHWA 3AZQA 4LNAA 4XSVA 4XVQA 1TCAA 1OI2A 2EIHA 2Z57A 1NFFA 4DLNA 1YVPA 1YNOA 2UYOA 5F12A 4IINA 2FP4A 3CO5A 3OUUA 1SURA 4QOHA 5KQSA 1UANA 4KNWA 3WWYA 5EXEA 4ND4A 3GCGA 1MT3A 4Y0NA 3DLBA 3ZIAA 4S04A 1LWNA 1DKLA 4DS3A 1SXJC 4Q1CA 3L1UA 1UK7A 4G2NA 1U2EA 1UP6A 2I3DA 2XXAA 2XZLA 1HGXA 3CKMA 2GPTA 4OM7A 3EQ8A 4DLXA 3ZGVA 2OKCA 4K6OA 4OU4A 2BDEA 1YDWA 5E8JA 4TQ9A 1VIYA 3THXB 1U3DA 2J4FA 3AEUA 1AN0A 1GFZA 2IYLD 4X93A 1G2IA 3F6EX 2GA9A 1RHRA 2AGVA 2WNIA 5AJXA 1DC7A 3P27A 5CFRA 4QUDA 2VRNA 3JSXA 1MIOA 3NOOA 4WUTA 1L1FA 1RC8A 1W0KA 3I5AA 4LPSA 1WF6A 3L6BA 1E1CB 4JGIA 5GM1A 3GLGB 2WWXA 3OQMA 4Y30A 3MTQA 2PUCA 1BOFA 5D51S 4B9EA 2B4QA 3PE6A 4MVJI 4NYIR 5TGDA 5T8KA 2IHBA 1C9JA 2OPBA 1QQ5A 2Y71A 3TRIA 4EKDA 3TF5A 4HGNA 5KYUA 1PT5A 3THRA 2DWCA 3L04A 1ML3A 2P1RA 2XMZA 2I62A 3K5WA 2LDBA 3N2GB 2BOVA 1JSXA 4HFMA 2PLRA 4INJA 4KXNA 3H9GA 5JSHA 3EG5A 3PQ8A 2FW1A 4JC8A 4JUFA 1V8OA 4JHXA 4A36A 4ARAA 5TVGA 4MLDA 1M73E 1EQ2A 2IITA 1LK7A 1P44A 3GYBA 4ZO6A 4MEAA 1FFGA 1QVZA 2FOLA 3HPRA 3JQRA 4MRAA 4ZK6A 1SCBA 4CVNA 2X2OA 2FHPA 4LDZA 4ZMBA 1DJOA 4WWHA 2FVXA 2IPOA 4N01A 3LS2A 1SHJA 4BE4A 1I7PA 2OCDA 2ZTUA 3FFBA 4RA6A 5DV9A 5HM6A 1Y5LA 1K4KA 1XWIA 2VHYA 4OK3A 4YDHB 3ZV6A 4BYGA 1P5JA 4JJ6A 4WECA 1L5MA 4JV5B 2WEKA 1C8LA 3HBAA 1GUFA 5CX1B 2XUPA 3C1AA 4I8IA 3RUAA 2OO3A 3EH1A 4J0EA 4Q39A 4P6VF 2UUBB 1G98A 1YKFA 4Q3EA 2NXJA 3L0ZA 4XI9A 3U17A 1OV4A 1P1BA 1RNLA 2ZJOA 3K9GA 4LRTB 4X8MA 5J5VA 2EARA 2VYFA 4X90A 5TDHA 3SOZA 3UMGA 1N8TA 3KG2A 4Z7JA 2WHXA 5BRAA 3ISTA 4AKHA 3VR3D 2JFHA 1ZX1A 5B7PA 2V03A 4DJ5X 2X22A 1A2BA 3HLTA 5I9IA 1YZ3A 4OHKA 3T1OA 5JYBA 4GP9A 4XFDA 3N8IA 3PFWO 5K0SA 3KAQA 4FI3C 3WK9A 1U4SA 3HVKA 1Q7EA 5K0FA 3HUDA 1Q5PA 1V6CA 2F3TA 3DOFA 4JZKA 1OVGA 4D9MA 3V8RA 4OXYA 3V8EA 4YLYA 3P7MA 3RIMA 2A0XA 3MRXA 2I80A 2IODA 2W6PA 2XE8A 4K6MA 4NBKA 4TROA 4F93B 3DAOA 3L7OA 4WN9B 4NQZA 3JTMA 1D0IA 1FNNA 1PJBA 1Z2OX 2BFAA 1NRWA 2FEWB 3A6ZA 3NHUA 4ND8A 3AFMA 3NC4A 3KD2A 3LX6A 3F0TA 4XB2A 1UPXA 2CUNA 3QH4A 1MFZA 3WKCA 4TGLA 4ZTUB 3BMNA 3CF6R 3P2YA 4TQAA 4C01A 5BNTA 4W99A 3OKCA 4L8YA 3SF0A 1UK6A 3D1JA 4U2EA 4YFVA 4JYZA 3S2EA 3F9CA 2QGNA 1K08A 3CUKA 1NWHA 5CDFA 3RAJA 3SMVA 4K9RA 4MIOA 4QGFA 4F5YA 1K0FA 4JQOA 4OQFA 4YUYA 3T9DA 5AP9A 1MBZA 1CNMA 3WLPA 1LSOA 1XEXB 3R5XA 5GPBA 2PXCA 3GVCA 4LZNA 1O0SA 3HZRA 3P1JA 4G84A 4IDEA 1X86B 1SUDA 2QLMA 3B7GA 3PQEA 3OPVA 1O6FA 1U7XA 3DWGA 1OY1A 1GQYA 4MULA 2QQFA 1IDN1 1W4RA 4B7UA 1VGQA 1BMTA 1J0AA 1RHKA 3PHJA 3X2SA 4EVQA 3WQRA 1NXVA 4G4SO 3C6XA 1IN7A 1RTKA 2C0CA 2Z2ZA 3EULA 4FIZA 2EAUA 4LY6A 7ABPA 3A2KA 2GJ9A 5AJHA 1HT3A 2YR0A 2CHEA 5I7VA 3BTVA 3D6MA 4L5AA 5IC6A 5KZMB 1YQUA 2ONJA 3T7TA 1C8KA 5F2EA 4WY8A 9MHTA 5ETJA 2NUAB 1Z39A 4DGSA 1UXGA 4Q3DA 2BI8A 2Q3HA 3NC0C 1KIFA 1Z3CA 4PLZA 3IQIX 1YTUA 3FTDA 3VTAA 3K0HA 3MWEA 4ZYYA 1ZNZA 2RSLA 5BVHA 4NX2A 1OTYA 1PN3A 2VF5X 2M6KA 1Z5GA 2UZ0A 4PIVA 1E1CA 3AJ8A 1X0XA 4AL4A 5AKKA 3G0CA 3R5JA 5B3LA 4CDGA 3H86A 4FFBB 4DAOA 5CFNA 2YQZA 4JXKA 4I9UA 4PS1A 3WTCA 4WACA 2QR3A 1MA3A 1CF9A 1GZHB 1YIDA 2O0HA 3A11A 3E1KA 4B6FA 2J87A 2JAHA 2BBTA 1JIXA 3O4FA 2Z6QA 1E9DA 1HKUA 2UVDA 3LRPA 3UAXA 4AZ3B 5BSFA 2P30A 3DEAA 4K7JA 5I7RA 5C7OO 1R64A 3DYVA 1XNJA 4LQLA 3RNOA 4IILA 4DVJA 5HIKA 5CFPA 1DBVO 4RE5A 4AECA 3TI9A 4GZMA 1RJWA 1UQTA 3FNIA 4FSHA 4ZVPA 2HBRA 2ODAA 2ZUWA 3F9RA 4U7PB 3K70D 2IH4A 1M6EX 4H1WA 2HW8A 2A3RA 5DMXA 1L4KA 1N2IA 3I4CA 4Q7EA 2WG1A 4JL5A 3EVBA 1RYBA 2RGUA 2CW5A 4EJMA 2PLFA 4YX9A 2LKCA 2I7CA 1F1BA 3A4LA 1MN6A 3EZLA 4ITUA 5TC4A 5JDIA 3O92A 2GN1A 2AC4A 4DW8A 1GQRA 1H2HA 1B6GA 2YFYA 3ZXUB 1OB2A 3EA0A 4MUBA 3WDSA 3H5OA 2HNAA 2QU8A 3RVRA 4GPBA 5TMDA 3GGDA 4REQB 3JQAA 2O4CA 5D6OA 3ZX4A 1JA1A 1XA3A 1C30B 2IHTA 4P36A 2O19A 4TT3A 1JJBA 4QFBA 4X3OA 3DUFA 1IBMB 3SDSA 3R3UA 3G5AA 1SOWA 1CUSA 2QM0A 1AURA 1WTAA 3GPBA 4M0LA 2O3UA 1R5OA 4QFMA 4DQXA 5JO0A 3C3MA 4PCUA 3HADA 2CL7X 2JLWA 3JAMA 2AQ8A 3IOCA 3E7WA 3R3YA 5J40A 2FAXA 4FKZA 4AKSA 3UH1A 1LNZA 3GAMA 1REQA 2HJVA 1EBUA 1OLUB 4CU2A 2BHRA 4D4MA 2W22A 1S6YA 2W6MA 3GOHA 3MTBA 4JY7A 4K9SA 4NE9A 4N82A 4NMXB 2NO5A 1YKSA 2A1TR 1DRKA 4BASA 2CHFA 3HB1A 3FVWA 2EWVA 4F06A 4MQBA 2XUJA 1BH6A 2JDIA 2BSQA 4HS4A 4WVLA 3WLTA 4CRWB 3U4GA 1RLMA 5LP1A 1GG2A 3V7FA 4TLEA 2D8MA 5DNAA 5GZ6A 4Z3DA 2OXRA 2IDKA 4X92A 3SM9A 4BBZA 1MUUA 4BE9A 5L4SA 4R6XA 2FSUA 1EPUA 3AGPA 3LP5A 2YZ2A 4WN9A 3KVYA 4ZEXA 3L0SA 3DLIA 2QDXA 3EAGA 2C97A 1S9HA 2QV7A 1F7VA 5TF4A 4CM7A 4ZGWA 3RFUA 5CIYA 3TTXA 4Z4CA 4TYPA 5HF8A 2PRSA 2VJMA 4OFXA 5LZ4A 3D3KA 2Q27A 3BH0A 2OQRA 4P3XA 4K40A 4RAQA 4MX8A 1A1VA 3O91A 1YQDA 3PLRA 5FXMA 3R8CA 4B2LA 5SZIA 1JXMA 5LBIA 1RJEA 3OZSA 1A9ZA 4RK7A 4Z51A 4POAA 4QQFA 5E8RA 1XEXA 4MGHA 3GA0A 3TLYA 4Z0HO 3QFTA 4CLRA 3L4SO 1FW8A 3GBSA 3PXCX 4QEZA 1T2VA 2JFUA 3NP9A 3QG1A 4G4JA 3VJLA 1W4BA 3TIGA 1Q3TA 3BKXA 1JIJA 3JTEA 1ZI9A 3OEYA 4F6CA 4ZYZA 2O8BA 1PX0A 2O1EA 3CF2A 3PB3A 4R3UC 1QDUA 3A10A 3CNEA 1CUCA 1WXXA 2VSFA 3O8OB 3L8ZA 4B83A 1W75A 3H75A 5TT0A 2ZRPA 1ATZA 3ASYA 1UDCA 4B45A 3ROQA 4F04A 2O4UX 4MYCA 4W9NA 3NAGA 5L7WA 2CCKA 5EGNA 4HBGA 1UDBA 2V6JA 2IV3A 3CR7A 4R98A 4B87A 4C21A 4C14A 2BH9A 4EHBA 1FP7A 1V4NA 2ZFUA 1HY3A 1LH0A 5E9AA 2CMGA 1H3NA 4U02A 3UA3A 1LQ2A 4JJGA 5DPMA 1A5SB 5JPIA 3QMWA 1XDDA 1G8YA 2DQKA 1XMQB 4DA6A 1DX4A 3FVTA 2ZK7A 4IHJA 3VR2A 5C5IA 5F51A 1BRMA 1S0UA 2J6CA 1VRWA 3BFKA 3DONA 1AE1A 5IXSA 3CCFA 4MB0A 4N8DA 1QQTA 4DCNA 1UBSB 4O6VA 2DTEA 1G5QA 1PDWA 2WPDD 3M6FA 4C7OA 4CLEA 1ZCBA 3P9KA 1NNSA 1OZHA 2IE8A 5E4YA 1NLYA 2HREA 1SCUB 4TN1A 1DIGA 1X7WB 4KR6A 2R6CA 3V97A 5JYDA 4CQMB 1MT0A 4D3XA 2QT0A 2AQKA 4K9NA 3I6MA 4HDSB 2AX4A 3NTXA 3CVJA 5SYNA 1M0TA 2C0QA 3FVRA 2GUWA 4NBSA 4QJ3A 2TRSB 2I6GA 1A88A 3AIKA 1QIFA 4ZKDA 1MB0A 1SRRA 5FTWA 1H2YA 4MVJE 2LCIA 3W78A 3VU1A 2V3WA 4ZPJA 3LWDA 2R1UA 1R15A 4A6DA 1GNLA 4E6EA 2P2NA 3LBYA 3TZLA 2XGJA 3DOIA 2B98A 4ZC1A 1J5EB 3V1KA 3OTQA 1F48A 4RVGA 1NJGA 4OMDA 5KREA 3PHLA 2NZXA 3H2KA 1C30A 2B2CA 2PT7A 1Z7WA 2HX1A 3HA3A 1EUCB 3DKIA 1BJRE 3ELWA 4M7RA 4P5EA 2JS7A 2CXPA 2R62A 4HEQA 3CZQA 4N6GA 1LBHA 4NU5A 4KO3S 3G6KA 5ALHA 4G3XA 2PWZA 3TVYA 4AIIA 1KJNA 1AXGA 2WR8A 2GDJA 2VRCD 3DAHA 1X80A 1PR1A 3FPHA 3GF4A 3O3MB 4AG3A 2QWXA 3K0SA 4YCBA 2IZ5A 2I2AA 4Z7NB 1Z63A 5ICCA 5HZGA 3OTIA 4OJNA 2IVZA 1J8QA 2OGUA 3EQ2A 1U8CB 1U1FA 3P5BA 4M53A 2ZI3A 2OP0A 1JTVA 1OFUX 3QPBA 4HRXA 2ONYA 3FGNA 3KOWA 1KZ1A 3KZNA 3ZWOA 2ORWA 3B20A 3BIJA 2WG2A 3NHPA 5FFFA 4P08A 5SY9A 3UB4A 4TPKA 4OSPA 5ICMA 3LFHA 2R00A 5HJ2A 2ILVA 4MUXA 2E0IA 3K0FA 1BIFA 4U8GA 3BSWA 3TE7A 3ESBA 4HNAB 5E9JA 3MCTA 4DDUA 1MV5A 3MJEA 5A7HA 2JLBA 3UIEA 2P6RA 2P5YA 3ZHQA 5KCMA 4LJ6A 3T4PA 3KP1A 3S1LA 1HT2E 3IELA 4TKVB 4B6OA 4PN3A 5A06A 4NTZA 4REOA 5DBFA 2YVQA 2XHZA 5CVTA 3ZUGA 4X1OA 4DM3A 5C5CA 1I24A 3ADCA 1FX1A 5KO2A 5AI4A 3MA0A 2D2XA 1ZVMA 3KK0A 2QUIA 3D4LA 3NRCA 1E3MA 1ONNA 1FMCA 3ACDA 5ESRA 2RJ3A 4CKBB 1CVRA 1QOZA 1T9CA 4H7JA 3TZCA 4IJKA 2Q2WA 2L0XA 3JSAA 5CDUA 4GLJA 1QO7A 3ZE8A 1OLXB 2J9FB 5KWJA 2AT1A 2PANA 1N7JA 1HUQA 3KQMA 4AY4A 4DR4B 1AGXA 4ARBA 2GSWA 4OPMA 5CBPB 1N8KA 1CTQA 3PDUA 3ROMA 5KMGB 1TYAE 2B0CA 3SC2A 4ETMA 2W4QA 1RBYA 2MSCB 3UGJA 3P97A 4KPGA 4MJ7A 3U3RA 1O96A 2DBYA 2GXSA 4MLZA 4BUCA 3IPLA 2V0GA 3O8OA 1ZP6A 1VYUA 3JAKA 2VJOA 3K31A 4TTJA 1KMMA 3TCKA 4DCPA 2ACKA 4C0WA 5LDHA 5DRYA 5BWBA 4RTMA 4HAOA 2HPHA 2HO5A 3ISVA 3LGSA 4X6UA 2WSBA 4HYEA 1KO4A 2X86A 1PGJA 3C98A 2NZUG 3M5DA 4NMMA 5CJPA 5HYVA 1QMPA 4ARIA 2HA5A 1T1IA 3Q3EA 3BBPA 4LQCA 4MVJD 5DI3A 1P9LA 1QVWA 3BF7A 4HWRA 4LF7B 3IPAA 1N2GA 5CFOA 5KBYA 2YXEA 5EVJA 5AVVA 3S2SA 1Q17A 2OR3A 4U7TB 3KT6A 2BHSA 1N6RA 3PWTA 3RFXA 2IYXA 4B4VA 4HY3A 4RH0A 4US1R 5DO9A 5FWNA 2LUOA 2RB4A 2XOEA 4EB8A 1DRWA 1KO7A 2I3GA 1KO8A 4QBFA 4U7GA 4G5RA 4WINA 3H04A 4EP1A 1Y9DA 4CL0A 4KWCA 2D0PB 3OX2A 2WSMA 2B8EA 1WY7A 2CUZA 1AQIA 4IEFB 3HBMA 3UJ8A 3W05A 4HJRA 1UPBA 1OT3A 1Y6ZA 3RYHB 1CZOA 2H1HA 3N2IA 3DTYA 4YTEA 5M5BA 3AXTA 3QMVA 4BP8A 3U5ZB 4PZ9A 1ZWKA 3OZGA 3R5HA 3CUWA 4KWIA 4RDIA 2Q5EA 1EGQA 4JL8A 2HM7A 4L8WB 4PG6A 1XAHA 4PGMA 4QECA 2EGHA 3USES 3GHHA 1LLDA 3U7QB 3O95A 4DC9A 3C6MA 4TS4A 4AK9A 5KYYB 4AJ9A 1GDDA 1Q1GA 1BWQA 2A9OA 3ONEA 4V02A 4EL0A 2ZUFA 1WCXA 5K4HA 1OC2A 8MHTA 1VYTA 3ZBPA 3ZD8A 1ISMA 3MQFA 3PD0A 2JIZA 4WW0A 3WWCA 5EZ6B 3ZHYA 2H06A 4E2YA 5HFAA 1LSJA 5IZCA 2CJPA 3TMYA 3HCWA 4PPGA 4AJNA 4PPYA 2W4IA 2C9ZA 1FMLA 4GC9A 1JLMA 2QJWA 3GRVA 1YA8A 2JB9A 4HPWA 1C0LA 3HBNA 1DBQA 1NYTA 3LFTA 4OQYA 5EWLA 1EUCA 3NPAA 4XIFA 3ZWYA 4N7JA 4HT3B 4GPTA 2WZCA 2X19A 4Z49A 3QVTA 1V48A 3T7CA 1TO2E 2P8JA 3OPXA 4B73A 1IUOA 3A1FA 1V11A 1PT6A 2PRZA 4L4RA 4YAFA 3WYAA 1T3TA 4Q3NA 1QM5A 1S7GA 4TV9B 3U6KA 1CYEA 3AF2A 1APBA 2VAXA 3LYUA 3FUXA 4B5LA 5H8WA 2YZGA 3ETCA 3DR3A 3ZKWB 2RCNA 1TO1E 1C7JA 3FIJA 3IV7A 4J0CA 1SUEA 1FTSA 3JQFC 1PQWA 1N3BA 3E5MA 3S40A 3IGFA 1JHUA 1EH5A 1ILEA 1YR8A 1NXQA 3HVIA 5U9CA 2B3TA 1E8NA 1M67A 2ZEJA 4WJKB 4JA0A 3E7XA 3E9NA 3QX7A 4LHEA 2H07A 1UT8A 3SQLA 1ZWLA 4IQFA 4ZAWA 3UJ6A 4DREA 1K8XB 3EGOA 2ONCA 3ST7A 4D3SA 4XM0A 2X2EA 2NU9B 3QA9A 5A6VA 2FEKA 4GPD1 1FXSA 1E3QA 4F11A 1TYZA 1KEEA 2RHGB 3NTVA 4QOJA 3H6KA 3QLJA 2I4IA 1TM4E 3OC6A 7YASA 2RHWA 4KQCA 4DR7B 4UTPA 4R01A 4IRXA 3Q0TA 1CJTC 2BM1A 3EQ7A 2E9SA 2G8NA 3IP8A 3KO8A 3SHVA 2DR2A 3LO8A 2O7QA 4IIJB 1K3UB 5H16A 1UOQA 1QO9A 2EWMA 5E3JA 4M99A 4LSZA 4FFOA 1XALA 4BQSA 3LD9A 4D97A 3U4QA 1E6LA 1HM5A 2V74B 4CKBA 3ITEA 4J90A 4ND2A 2FSSA 4BMVA 3S3TA 1UOEA 4H2DA 1J0EA 3GFTA 2NT4A 2BMAA 4M1TA 1UUFA 3U3ZA 1R5NA 1TJNA 1XZMA 2J9FA 3EY9A 4Y7CA 1UJBA 3ZZNA 4A27A 1TPZA 1U5AA 3HYNA 3O21A 4QJ5A 3VGPA 2IS6A 3JQEA 3NETA 3Q2IA 2QS9A 3W3AH 2WQZA 4QFDA 5ER6A 4NFSA 1K5HA 4RQBA 1MFPA 2O05A 4Y2TA 2HLHA 2UV8A 2WLSA 4Z0PA 1AKYA 2V54A 3KETA 2JBWA 4DLWA 4ZOCA 4JOQA 3C3XA 4DE5A 5CPBA 1ODCA 2IOYA 1C0IA 3IHTA 1EJ0A 3F2VA 4FE7A 1JUDA 1Q7CA 3KELA 4WOJA 3SE0A 3HO1A 3SSMA 5AHXA 1W49A 1U2RA 4GS5A 1G3QA 2H0QA 2VYND 3E18A 5F2OA 1A98A 3R7LA 5HZMA 5KC9A 1ND5A 1B43A 2J0UB 5DP2A 3TTWA 3IP9A 1H65A 3AR3A 1NKSA 1EQUA 1U0JA 2OHHA 3BHMA 4KP7A 4DNPA 4EKYA 5JH7B 1ISJA 1Z26A 2VBFA 4XGIA 5C81A 2Q3FA 5FLKA 3KU4A 3MYYA 5HCUA 1HE8B 3QVLA 1DAPA 4IZOA 3SZOA 4UMFA 3DAGA 1KZ4A 4XX0A 4Q3LA 5FI5A 1U3FA 3TQFA 4ZMRA 4HGOA 2X6TA 4ZT3A 3EODA 3OCZA 1D4ZA 2DFPA 2I4OA 2IPAB 1N9KA 4TOIA 1AZTA 1JDZA 3QYAA 1D09A 4GMKA 5JSYA 4JB8A 4TQGA 2WAXA 3B85A 3N0RA 3FX2A 3HXKA 4Z9YA 4BRZA 4J91A 4OQEA 4JBXA 2JARA 2C92A 2HF9A 1UBOS 4FW8A 4KAFA 4QD3A 5KAMA 3UUGA 4FCWA 5JQWA 1PJAA 4CFZA 3BWDD 5EUBA 3WJAA 5IUJC 4KJZA 4E2FA 2I2XB 2WZDA 3HN2A 3FLMA 5AVZA 2A1IA 1WZIA 4NE2A 1RXUA 4HV4A 5JHHB 3RYCA 1E20A 3GJZA 1I7LA 4AWXA 1R74A 5KYXB 1RYMA 4GT1A 4LWPA 1ZNWA 4X44A 4G4GA 4QUEA 5BR8B 4DSNA 3WAKA 1AM4D 1VKHA 3KYJB 2WG0A 2G8LA 4GGMX 4HMQA 3FOEC 2ZJ1A 4R8RA 3V7NA 2A84A 4CF4A 2Y1LA 3OCYA 4PBTA 4KX3A 3R0ZA 2QYSA 3JWPA 5MN4A 1Q20A 1OPRA 3HUTA 1Q16A 4KGXA 5FR2A 2PJDA 3FJ1A 3Q11A 1Y9ZA 1ZZGA 3Q7RA 4OAOA 4TV9A 3RVPA 1ETHA 1MXFA 2DQYA 2DMRA 2VDQB 1VMDA 1XRSB 3AUYA 1SNYA 3PITA 5H3LA 3U3XA 4EPWA 3PGLA 3ZKWA 5H1YA 4YRAA 4JI7B 1X1DA 3FWPA 1XDGA 2RI6A 3H3JA 3IR7A 3RWMB 2WUEA 4MW6A 3W5AA 1V37A 2PUJA 3GJYA 1X2BA 3E61A 3OPNA 2QN3A 1OD6A 3A1DA 3TO5A 3UZUA 2OWEA 3VVLA 3U16A 2CMKA 2F8LA 2FPLA 2V9ZA 2QE7A 4TTVA 1Q15A 4BMDA 4F3TA 2PGXA 3N1UA 8ABPA 1EBBA 4D9IA 1OREA 1W85B 2I8AA 2WAMA 1C14A 4R1PA 4ME6A 1RW4A 1PFYA 3DVAB 3AOGA 4NJOA 4TZTA 4N8SA 1ZUHA 2LCFA 2RH4A 5AUNB 1M1UA 3N2YA 4C0BA 3EVCA 4OB6A 5JS7A 1CS0B 2PBLA 1XZNA 1E7MA 4AO7A 4IM7A 3J80A 1L5OA 2MINB 4RMGA 4OHZA 1A27A 4UUQA 4YT5A 4QBTA 2O3QA 2N75A 4ENUA 4A2QA 2Q0XA 3D7LA 1P3Y1 1BMFD 3IQHX 5HUQA 2EP7A 3GLIB 1XPJA 4GPAA 5AJZA 4INZA 2IYNA 1X8LA 2HA7A 2R00C 4RF2A 4B7CA 3EJ6A 1E8MA 1JHXA 4JODA 4CKYA 1OTHA 5DT9A 1GSAA 1JIQA 1JILA 2J0VA 4MYUA 1BHSA 1NI3A 3RTGA 1M76A 2Z5LA 1KP3A 3ELBA 1YQGA 3IT2A 4DLVA 2QZSA 5F64A 2H18A 4JS0A 4RK4A 4N41A 2AYYA 5ENDA 1XMSA 3SY8A 1WD5A 4OA5A 1DUVG 2CLEB 4IQ8A 2X5OA 2G04A 3I76A 3OPMA 3E0XA 2FF5A 1T5IA 2ZVPX 4TTTS 1G21A 4KIWA 2XB2A 4FSDA 5FO0A 3UJHA 5AK5A 4LVUA 1JEQB 1WVIA 1WCWA 4WZBE 1H05A 3I5XA 3NXKA 2CHQA 2QTCA 3CRNA 3KJEA 2H1FA 3DC7A 1XEWX 4Y6SA 3J81k 4M6WA 1T9GR 3T1HB 3WDKA 5ALPA 3BJRA 2JCVA 3CGWA 3EDCA 5DASA 4GGPA 3BMXA 3S27A 6REQB 1MQAA 2ZPAA 3R3SA 4ZV4A 2ZT7A 5ED0A 2C5HA 1YOVA 1LKZA 3AHIA 4I3HA 4GSLA 4LV8B 3K2IA 5ALWA 1DX6A 4FWIB 4S05A 1HDZA 1O95A 1SB8A 2BUBA 2QL9A 5EMNA 5J9FA 3OETA 1LY1A 3DFIA 3S2YA 3WNCA 1S8OA 2EERA 4YHBA 3I8SA 2ETXA 1J42A 3RRMA 4PZZA 1FJGB 3PGA1 4WEQA 5JMTA 4A15A 1FQWA 2WU0A 1EFAA 5LYJB 3DDZX 1R00A 1XRMA 2WJZB 4BJ3A 4R2WA 2JAOA 3B82A 3E3MA 4LOAA 1QHYA 5EIXA 3W1VA 2Z04A 4I5EA 2ID4A 2WB2A 1FFAA 3GY0A 4YI5A 1T0HB 1BYIA 1V8DA 1LX7A 2EBWA 2X2FA 2ZT6A 2VSOA 3C41J 3KQTA 4G5XA 4GKBA 4MWGA 3K0AA 5EWMB 5JARA 4QOIA 4JD5A 4EJFA 5LFAA 3NHJA 3PCXA 2HK9A 1FYXA 4TLBA 4M37A 1K9VF 3FA2A 3LDAA 4ZRDA 3ZLJA 5H0IA 2JJ8A 4N18A 3I37X 3X1ZA 1KKLA 3BE5A 3D4PA 3G8YA 1CUGA 3CX3A 4O5OA 4UHHA 3LECA 4C0KA 4JR0A 1VTKA 1EUDB 4QQNA 2EGUA 4PG5A 4D74A 3VTFA 4B40A 5CVDA 3QEOA 1YIOA 2QY6A 3V7YA 3PPWA 3HKEB 2VP3A 1A9RA 3GI1A 4M21A 3IVCA 3D6NB 5P8WA 3THOA 3ZE9A 4DKJA 4D4GA 2IGTA 3T3NA 5KEIA 4DADA 4B6PA 2Q3BA 1BD4A 1ZONA 4QATA 1P7VA 4I6GA 4GOJA 4ACAA 1KXJA 3MB8A 2AR9A 2DKNA 3O7WA 4YCDA 5IZCC 4TYQA 2C07A 3KOMA 1SKYE 4JENA 4P34A 5DNDA 3ZJ5A 5FULA 2QVXX 1ZW1A 2XMGA 2DY0A 3E5NA 4IGEA 1XROA 4Y2PA 5AK3A 5DX1A 5HQJA 3VZSA 3OTHA 4Y9TA 5B4VA 3Q3HA 4LDAA 2B1RA 2QENA 3PFKA 2XMSA 4KSBA 3DHWC 3TQOA 4XQ0A 4INOA 5JC8A 3C5EA 1CUBA 2PG3A 2GF9A 2YNMD 3AERB 2WMOB 1RT9A 1YAJA 1ZC4A 3EQZA 2AMJA 4JMLA 2D4HA 2F90A 2SKEA 1X7YB 4L5JA 3WGIA 1EA7A 2CZCA 1GDHA 2SBTA 5DXJA 1GGVA 3ZDZB 3BZWA 4TL6A 1DAGA 4DOMA 3ON5A 2GZSA 3DBLB 4LF6B 3G49A 1YBAA 5LLDA 3FGZA 5DNCA 1EAMA 2WJ3A 2HMWA 2O2GA 4AIRA 2M32A 2PN1A 4V39A 3FB1A 3TRDA 5KYKA 2H7YA 3I9NA 2YXLA 3PC7A 3IAAA 4FLFA 4WJZA 4EYKA 4KQXA 3IVRA 9LDTA 3EGEA 1IBRA 4IJQA 1VJCA 4NESA 1Y8RA 3H5WA 2X8LA 4MJLA 5L3RA 1T8YA 3HCFA 1IDOA 5CA0B 2B61A 1NMXA 3YASA 5E3HA 3KLMX 5FDFA 3UWOA 4PR3A 4BZQA 1ZDMA 5HEKA 4HJXA 4YQZA 1F2TA 2ZYRA 1T10A 3E2MA 1TF5A 4MVXA 4AMUA 4P7BA 4UAVA 2P9GA 3MD9A 1IHUA 4AROA 4ENQA 2ZM5A 1AG9A 4HH3C 5CYOA 3UAGA 1JEQA 3QXGA 2ZZMA 5FLEX 2OSBA 3GBPA 2IFTA 4NP6A 1G7SA 2QD2A 1H0RA 1VLVA 1WY5A 2XB4A 2NU7B 4Z5XA 5JEEA 3UJBA 3SEZA 1XMVA 4A3SA 1KHHA 2FPMA 4HWSA 3B60A 3AQ4A 5IEJA 5LMZA 2ZI9A 2FSVA 3DEFA 1Y3BE 1NLMA 4BVAA 1L4LA 3OOYA 2Q3JA 5GJBA 2ZJFA 1C9MA 1IY1A 2V1XA 3OO1A 1JGTA 6REQA 1L5LA 1U2TA 2AXPA 3HYTA 3D1LA 2QW8A 3O6VA 1KAOA 1A04A 3QOWA 3TCXB 4Q93A 1GNTA 5GOZA 4ENSA 1EVJA 1DRUA 1W44A 1MDFA 3GA5A 4LX8A 4P83A 3LCMA 1XTJA 2QMOA 4H08A 3RU2A 1S3IA 1TL7C 3GEBA 3CVXA 1UKBA 1MNAA 1COZA 4Q9AA 1KC3A 5TT1A 2IXEA 2D5AA 2ZIVB 3F4LA 1ORRA 3IUMA 4OCZA 2IZOA 5KTNA 1T36B 3TR6A 1ZVVA 1ZRSA 4XVCA 2H4HA 4YAKA 3R3XA 2B9EA 2WHEA 3DGEC 2BGLA 1NVVQ 2BJWA 3H6GA 2GA8A 821PA 1E63A 1DKNA 4O4HB 1OVMA 3ABZA 3BH7A 3PWKA 5A9RA 5M04A 3ZGYA 3FWNA 1FOEB 1QKKA 3A9TA 1NR7A 2VA8A 3PZRA 4WKOA 4Z6KA 3ITDA 4H35A 4IIUA 4MRVA 4FX5A 4BO0A 1RCFA 5EWMA 5KKNB 3IVGA 3QVJA 2CV2A 2C58A 3M5PA 1VPEA 2E82A 3IEVA 2CL0X 3K8YA 3AI3A 4D9EA 4FE4A 1PTJA 5JFGA 5ALJA 3ZYZA 2VDPB 1VIDA 1PSWA 2CL5A 3SEAA 1ZUWA 3WJ7A 4EYOA 1Z0AA 4EGAA 3E9ZA 4LFCB 4MQ6A 3E58A 2GBLC 4RZXA 2YYZA 2C4KA 3RTEA 3IBGA 2O8NA 2ZBUA 5FIUA 3OLQA 4MQ5A 1WVMA 3T0GA 1MEOA 2P5UA 3DT9A 4HVAA 3T6KA 4LE0A 1JE0A 2A94A 1GGEA 2WFLB 3O47A 1O03A 2JFXA 4YRLA 4AMYA 2CNWA 4YIHA 4Z3OA 2R8EA 1R0YA 2Y8EA 2UZIR 2ZVDA 3QE3A 3WYGA 9LDBA 1AOXA 1M7BA 4HKTA 4MVJM 4V0SA 4BVKA 3DHYA 2HK6A 1FRVA 4WKGA 4HFRA 1Z4PX 4OLBA 1RPJA 3IR6A 2YZMA 1EUZA 3ECSA 4ND7A 5IC5A 4Q1BA 4JJ8A 1YC2A 2JHFA 4TMYA 2V7XA 2M9MA 4H7PA 1SVSA 1IJKA 1FFSA 1SH7A 1TPYA 2QPOA 2FYTA 4P33A 3M9XA 4BPRA 4E09A 5LJLA 3S0JA 4LXGA 5C52B 2EATA 1UDWA 3COJA 1AMOA 2ZPTX 2YHSA 3STHA 1UFOA 3WLMA 4M0CA 3N59A 2WJ4A 1NQVA 1ISIA 1RDFA 3AZOA 4ARUA 2ZRNA 1PU2A 2P9EA 3EXFB 3EVFA 4NYJR 3SHQA 4PLPA 3KFVA 2VAPA 2CVQA 1J2UA 4KXQA 3I52A 4Y6GB 1RHQA 3N2ZB 4HEA6 4V1CB 3DBLA 1S8AA 3LRXA 3AF6A 4RX1A 5IM4F 4BV8A 2I2WA 5FB3A 5JXIA 4Q9NA 3THYB 2JIDA 4QJ4A 4R8VA 2RE8A 4OQXA 1DEHA 3ZXYA 1XMPA 1T15A 1V16B 2ABWA 2IIVA 5KDLA 3I6BA 1G63A 3TBKA 4F12A 3F47A 3V33A 4ZI2A 4DLZA 1NM5A 4XSHA 5JWOA 1STOA 1TO6A 1SXHA 3GJ3A 3Q7PA 4XFKA 3HJFA 2H1SA 1ZGCA 2XNJA 1HDXA 3N8HA 1KRHA 3RCBA 4Z99A 1G8PA 2IP4A 3HE3A 4E30A 1TTHA 3U5TA 1EP9A 4JP3A 1W94A 3CH6A 4Q9KA 5CLQA 4HB0A 3VPGA 1OZGA 3W9BA 1ZM2A 4Q9LA 1NYRA 3ZLVA 4NMHA 1T2FA 3IODA 2XUKA 4QPZA 2ZB7A 5LZ5A 5JDCA 5LWHA 2C4MA 2INGX 3VO8A 4UHEA 5DNWA 2H85A 3PUXA 1NJ8A 4IJMA 3K6SB 4WVFA 2O8DB 1PR5A 2ZSFA 3A8TA 3L4JA 1QIKA 4M49A 1OBHA 4QUKA 2XT0A 5LB2A 3U4CA 3HJGA 4J29A 4UTRA 4IH4A 3OY2A 4I2VA 3MWGA 1IXZA 3HWSA 4JYMA 1WP4A 3VKWA 1WSAA 3CZPA 4OGGA 4PLYA 3VX3A 4YRDA 3TSAA 4KQEA 1GZ7A 2XT9A 4C6HA 2NWQA 1KAMA 1UT5A 3FD8A 1T9AA 3BB3A 4KV7A 1QH8A 2EZUA 2Q9AA 1TFRA 3R44A 3UJAA 5JAPA 2ZP1A 3B9QA 3E9CA 4HH1A 2JFNA 1FSZA 5EC8A 4KEAA 1DCMA 1H5UA 3EFEA 4NBWA 2AL7A 3B53X 3GJ0A 2BHLA 2AYXA 1LDEA 2Q5HA 1H5QA 1C3EA 1U1CA 5I7UA 1PV1A 4A6XA 3AMVA 3FFWA 4EHNA 1WUIS 4A16A 3QA3E 2NXCA 1SBZA 1GR0A 1YR1A 2DCUA 1QV9A 4LZAA 5DSTA 1GXSA 3JQ7A 1FBTA 3KZVA 4POOA 1SUFA 4KLAA 2PMEA 1IEVA 1QE5A 4F2HA 4EFLA 4MV4A 4BVLA 3S2IA 3IESA 3GIWA 3DE7X 5HS6A 4LWOA 2BR4A 1B8UA 1IIRA 3AFHA 4FGSA 2P3LA 4XX1A 1J20A 1E79D 1Z4MA 4HNRA 3QUSA 1SPXA 2X7JA 1MXHA 4EL5A 4YAGA 1T8TA 4HG2A 4O1HA 1NNI1 1OU0A 1NLUA 3LC1O 1SC9A 2B83A 2E6UX 2VIIA 3GLFA 3Q7TA 1JWAB 3KIPA 5HF6A 3A9SA 2OFWA 5BSMA 3VR5D 2V6BA 3HVRA 2RK6A 2IUUA 4IJ5A 3JQBC 3MUEA 4TV9F 1EDZA 3JD3A 1JAXA 4HB4A 4BNFA 4DC0A 2XAUA 5AI8A 5ALYA 4BQQA 2GAOA 4UFNA 2DLCX 1N2CA 2WFLA 4HH0A 2XWQA 3O8DA 2GBPA 4L50A 5K3SA 5DM2A 5T4EA 3RVKA 4ENRA 1ZMRA 3LW7A 4GXTA 3ABSB 3B1KA 1ZESA 2PR7A 4JKYA 1PE0A 3GH1A 3Q7SA 1IVYA 1PZGA 1QB7A 4PC2A 3T5AA 4RDHA 1L9KA 2B1GA 2BFBA 3A1CA 3HV2A 1FP4B 3MN1A 4LY9A 1SOVA 1CV2A 2RC6A 3I72A 2E55A 1XN1A 2R84A 3COPA 1RYHA 4BS9A 3REOA 4F21A 2CZQA 3FKSD 1E64A 3D54D 1T6XA 3HCPA 1RWMA 1E3LA 4E0BA 2IUSA 2H1WA 4LX0A 4MJXA 1E2FA 4II7A 5JZOA 5D00A 2QP9X 3GVHA 4HOYA 5ALOA 3UQZA 2P0AA 3IP6A 2OENG 1H8HA 2WOOA 1P4RA 3ZHVA 5A0TA 4F56A 3HJRA 3KJHA 3BWCA 3IULA 4U0JA 1PWEA 3LHFA 4BZWA 1E0AA 1SR8A 3B9BA 4IIJF 2KI5A 3V2IA 4EZBA 1F4LA 3EXFA 4MZXA 3E4CA 2X41A 4V38A 3VR4A 2R8PA 1MJGA 4U0KA 2FQXA 5BYAA 1NE2A 3CZCA 1LRLA 1VJGA 4AF8A 5B4TA 3TXAA 5KS2A 5J2TA 1KU6A 3M3PA 4ZODA 2PZFA 1JG1A 1TB4A 3TJMA 5AKIA 3UHFA 1JSRA 4R2IA 1O54A 3LJKA 4KIJA 3SX4A 1UWLA 3H5RA 1A82A 1TRKA 3L7KA 3T5BA 2XKJE 3PVZA 1ISHA 4RM2A 4URFA 1QQBA 1ZMBA 2P9ZA 2JJ1A 2QRGA 4U5QA 1XZKA 3DYBA 4A2WA 4CHGA 1KF0A 1B42A 1JQ5A 4R83A 3MGAA 3D31A 3WNZA 4JUBA 3NIGB 1TJPB 3R41A 4D9KA 1ODSA 4NU0A 1GL9B 3GZNA 1WU8A 1BN6A 5DHFA 3C39A 2QUJA 4IVRA 3ZJ4A 5I9NA 5EXXA 5FPYA 2QN8A 1T5HX 3O0TA 1YZNA 1MW9X 4BNTA 3FOCA 4R8LA 5K4GA 2GVNA 3I9LA 2R1TA 5ECYA 3GNSA 5LMNB 4YQFA 3HGTA 1X7ZB 2MMGA 3DV0B 2IS4A 5E7QA 1C7EA 4MTLA 2DF8A 2JGLA 2O8DA 2BGUA 2F55A 2D1RA 3VPXA 1QCYA 4HSEA 1DOZA 1UZUA 1RAIA 2OFFA 5JS2A 4HO1X 3I0NA 1ENYA 3UC9A 3L40A 3C3PA 3ZHBA 5IFKA 4EO9A 1XEAA 3R3JA 3ZUPA 2QX9A 4XOIA 2K2WA 4QXPA 2C98A 3IIJA 4ZREA 3PYMA 4IKEA 5CJ2A 5EMKA 3ROGA 2JF0A 3C6ZA 3I1IA 4NZYA 4ZRNA 4KG7A 3LG2A 2P41A 2QYTA 1OZAA 2BZSA 3EASA 3UXEA 4L8VA 3D64A 3MXTA 5BV7A 2Q21A 3I6ZA 3NDJA 3LPMA 2DGDA 4J16A 4HCJA 3GPIA 3K1AB 3SQOA 4EYEA 3WKDA 3EZ2A 3GUUA 2HCRA 4MOWA 5JJ5A 2Y77A 5AW4A 1I33A 3N87A 4KXVA 4PX2A 3SJUA 5IT0A 4UPEA 1E6MA 3ASVA 3FTNA 5K01A 2GCOA 4MCAA 2YWFA 3OCWA 3UWSA 4B46A 2FNAA 2KQUA 3CXRA 3ORYA 2WU3A 5BV2P 2A9KA 2J4CA 4JBYA 2DY1A 3UA4A 2JGEA 1Q57A 1W1UA 2VXCA 1QVVA 1UMCB 1E4EB 3MTGA 3OIUA 4YUVA 2Y66A 1DB3A 5FADA 5T6MA 3WIEA 3SBOA 4BV2A 4DILA 4UAGA 4BO2A 3VR4H 3WAJA 4HDAA 2O7SA 1EFVA 1I0LA 1B76A 2CFRA 1USUA 2XWJI 4RF3A 4MPPA 1ZH0A 3CZAA 5CNIA 1TLLA 1IRIA 2HPZA 4MAMA 5CK4A 1B93A 3VR6A 1TK2A 1NI4B 2NIPA 3WYBA 3UK7A 1RHMA 2VXOA 2QP4A 5CUQA 3EBOA 1CJMA 1CP3A 1YJ5A 3PUVA 3ZDEA 2Q2QA 3RIEA 2Z1NA 4EUEA 2VT2A 3NS7A 4D0NA 2R4UA 5TGTA 1FP4A 2FK8A 4MR9B 5EIHA 2YYAA 5JCJA 1ADJA 4L51A 2PNJA 1XZJA 2HSGA 1C80A 1RYFA 2DM6A 1UP4A 9GPBA 3OICA 1JDSA 3KXIA 2DFLA 2EX0A 1KJZA 2C78A 1O5OA 1I10A 2CVZA 3E81A 3PSHA 4FDAA 3TZHA 4OAQA 3U3DA 3LGXA 1TTPB 1SC6A 2YDYA 4ZEVA 5EGSA 4DZZA 3JALB 1Y98A 2ZUTA 1ULBA 3OIGA 4ZCQA 1XD9A 3TFOA 4LFAB 4K28A 3F90A 1B1CA 4R1QA 3E82A 3R1IA 1XZIA 1H0KA 1MO2A 1FL9A 5J59A 3D0KA 4QLBA 2QROA 5CVCA 2ZYVX 2F4NA 3FCAA 1LQUA 1BX0A 1RS0A 2ODWA 2YDXA 5JISA 3FYTA 4LRWA 1KEZA 1M2OA 4G63A 4TS1A 3AP3A 1Z7GA 5FTMA 4MI3A 3CLHA 1FC0A 4BAGA 2WIBA 4YXWA 2A5YB 1RKUA 4F8YA 1WCV1 4MAAA 4OEHA 1U0RA 1X42A 2C83A 2V5VA 2VVTA 3RBVA 1E2QA 1Q0UA 2QRQA 4UBOA 1T4GA 3D5EA 5ER9A 1JXOA 1C1XB 3VGJA 3VYWA 1EDDA 4UNIA 1M2FA 3BC1A 4BNVA 1JHDA 1DG9A 1UXJA 2NV0A 4MVJP 4G2TA 1TKRA 5E4TA 1XFDA 2IHYA 2QAJA 4PIPA 2AFHA 1R0WA 3RGGA 3T41A 4RYLA 5A1TA 5CAEA 1T4BA 2IL1A 5LVAA 2P2GA 1L5HB 4PTLA 5DMHA 4IIHA 2D5LA 1IQPA 3I34X 1X70A 5FPQA 4NPHA 1B14A 4DGQA 1LSUA 2UVQA 4DZTA 4ETNA 3N7UA 2JLYA 3CPHA 5IDYA 4AQ7A 1KYVA 5EUMA 4I55B 1ZK3A 4AX8A 1IZ0A 1X7ZA 3CUSA 3CUEF 4IJUA 5CD1A 1Q50A 1CYDA 3T0FA 4F9GA 5GTDA 5ITZB 2DETA 2P79A 2B5WA 2Z95A 5BWNA 1AMNA 3KWFA 3S2FA 3Q2OA 2WI8A 4FHEA 2X8AA 3LTEA 4BO7A 4GYJA 4D3YA 4KO2S 3OZVA 1CSEE 1OYWA 2FXVA 3CC8A 5G4KA 2HA6A 1PYGA 1Q0ZA 4FYYA 4M38A 1RKXA 2REOA 3UMFA 4B8WA 3LVQE 3A36A 4RTQA 3VR6H 1IEWA 3PJDA 5EXTA 2TS1A 2VJDA 4FFRA 3M4JA 3UT5B 4TXMA 2X1LA 5TPZD 3FCEA 5JDCC 1P4JA 1RLIA 1M34E 3L8DA 5ELLA 3EIUA 1FS5A 1W2GA 1J2RA 5JADA 5LYJF 3U40A 3T8YA 3LI2A 2YWDA 5CJJA 2HH9A 4QPNA 3K1AA 1YULA 2RGRA 1JG4A 2HUPA 2CEAA 2X2PA 2ZJBA 3I6QA 5K8TA 1IOLA 5DI9A 5AQ1A 2E49A 2ORVA 1CRWG 5AM5A 4BQIA 4FGZA 4YRIA 1T3SA 1EFLA 4G1UC 1E5LA 1TVEA 5F4BA 1KQPA 2BEVA 5D3ZA 3OO0A 1YDEA 3PP8A 2EX1A 4QU9A 5JANA 4ALLA 2GJAA 4EHKA 4HWGA 3RFTA 2G7ZA 4O2AA 3JQQA 2ZJ4A 1A96A 3A58B 1UMCA 4RFLA 5FF9A 1E4EA 4I1PA 3FMIA 3FCUB 4CMGA 2IOFA 5CG2A 4CQLA 2EJVA 4XIGS 4MWCA 1ZR4A 4YGXB 3K8OE 4WXEA 1PD1A 3LLVA 4FR5A 4CMEA 1QCZA 1ESMA 1QNLA 1RCUA 1Z4QA 5I48A 2QTBA 3RGWS 3R7WB 3UK2A 4GM1A 2TMKA 1KI4A 1HDRA 3BM5A 1J22A 3MJSA 1NI4A 1R4NB 1IZ9A 1WV0A 2GD6A 2PCJA 2PNFA 4FBMA 5TVKA 1MB9A 1GTMA 3ENNA 1QYIA 1QRTA 2PUEA 3TS1A 4ZYLA 4ABYA 5AOCA 2VF2A 1XZDA 1E1MA 4KQIA 1P2GA 2JLRA 2EJBA 3UJCA 3H0CA 4FDUA 3AJDA 2OK7A 3F49S 4MR9A 4NNPA 4PLTA 4X85A 4D5GA 3U4AA 5C8XA 4RBNA 4C29A 3F7OA 1KQOA 4B0PA 3WYDA 3IP1A 5IJ9A 2PYIA 1INLA 1DIOB 3L49A 1IY0A 4X3PA 1N5KA 3OIFA 4M2LA 4QDJA 2ZAOA 2I76A 2M6LA 1QQAA 4XWAA 1OI7A 2IXFA 4BFXA 3FWHA 4EO4A 2Y4OA 1VRVA 1DXOA 1E5DA 1X0VA 3U60B 3FE2A 1IPHA 1E5VA 3HSKA 2VOJA 1U7OA 4W4TA 3ZY5A 5D3QA 2I3ZA 2G6BA 4JLUA 1M6WA 1XUOA 1TGVA 5IKPA 2D7JA 3IH5A 3TAXA 1LX6A 2YJ3A 4BC1A 5FUYA 1N0WA 5JNWA 4FYPA 4CCAA 2Y1DA 4IIFA 2HJRA 3PYXA 3A6LA 2YH2A 2R6FA 4IWNA 4M83A 3K73O 2J09A 1DQNA 3ORFA 2RAPA 4V2UA 5CA0F 1ZCAA 1NIPA 1RLTA 2VNKA 2Y2UA 4EHLA 1E9AA 3EOAI 3QOYA 3IFSA 1KGSA 3HQ4O 3TR0A 4IFEA 2RG7A 2E2WA 2W8ZA 2ID7A 2PUTA 2BMFA 2ID9A 3AB8A 3MD0A 3QWBA 3ILHA 4B6JA 2R7AA 1OXTA 2JCGA 2RCYA 2WJIA 5AW9A 3AL3A 4HDRA 2VS1A 3ZBQA 3PQFA 4CL8A 2WHYA 2BUCA 2IHNA 2F9MA 1E9SA 2XX3A 1F3OA 3AZPA 5KOIA 4BAUA 4I66A 4I55A 3ER8A 4NBUA 3ZHUA 2VJYA 3L3BA 4O4IB 1L5KA 3M83A 2QY9A 4RJLA 1JKXA 5ITZA 3GZJA 1BN7A 5U4XA 1HMYA 1L1RA 3WL7A 4G26A 5ADUS 3BGIA 3FUVA 1RVDA 1YE5A 3K5IA 1UJ2A 5KKAA 5HP4A 4EJ0A 2G9QA 4RULA 4IUYA 3D4OA 2CHGA 3EZ7A 4QX6A 4BKOA 3DS8A 1LFAA 2IXGA 4O29A 5EPUA 2OM2A 5FWDA 1OXVA 1CZHA 4AF7A 1DTEA 2ANBA 4RMNA 3U4HA 1J23A 2G40A 3QVUA 2YWGA 4ZGBA 5T41A 2O8VA 2XTJA 5GV7A 3UT5A 1TZKA 4PAGA 2VKTA 5H7XA 4C7BA 1DP4A 4PHGA 3T7JA 4WXHA 2UKDA 2I6XA 3SZMA 3BMOB 3GDOA 1NKVA 4FGLA 2QHXA 2Z8YM 3N0VA 1U0HC 3AHDA 4NV1A 4RV5A 2NO0A 4O4HF 1EYZA 3ISJA 5FT9A 3P9CA 3MT8A 1R0ZA 3KLPX 3I73A 4MZDA 1BVYF 1JNXX 4LJ8A 1GZ6A 1CXZA 3KEQA 4LPKA 4XARA 3QY9A 4LHWA 5HK8A 5JSKA 1K3FA 5AJVB 1K86A 3F6SA 4GZ5A 1EFRD 5EHZA 1R4ZA 1UZAA 3IYLW 5AVRA 4EI2A 1FYVA 4UULA 1XVIA 2WM8A 1SK8A 2HEGA 4IGIA 2VH5R 3V7UA 4EIWA 2X5XA 2W48A 4K3UA 4J16C 4EUFA 3U49A 5JAIA 5KWSA 2ZRDA 4J03A 2BUAA 3L07A 1RR6A 4QPCA 4WLNA 2GM4A 2XVYA 4BN0A 4RJTA 5TQ2B 3JQCA 3N5KA 4AUEA 3ZNOA 1WKVA 5BURA 5HKKA 1GAWA 3EF3A 1C8BA 1CP2A 1O5IA 2QMEA 3K5PA 3ETNA 3OHMA 2I1LA 3Q8XB 3UEOA 3W4KA 1U28A 3E22B 3TD2A 1ZY2A 2Z08A 1Y6QA 3PJEA 4HGQA 5AWFC 1AGPA 2HO4A 5KWIA 3DV9A 1Y1QA 2D7CA 1YB4A 4HFJA 5EPEA 4LYEA 4NCXA 4YMHA 1NULA 1PL8A 2ST1A 2ZWOA 2OOKA 3L7AA 1U8TA 3NAMA 1ZI6A 3DMGA 3BWVA 2QUKA 4ODIA 2JLUA 3CWZA 4FHGA 4BQPA 4N7RA 1GR1A 1F0NA 1F2UB 2GZMA 4EF4A 4ZCIA 2KBEA 5EP4A 3ZGOA 1V5GA 2F9LA 3UV6A 2A92A 2VSQA 4ZHSA 1QR2A 2C2XA 3NGMA 3QHPA 3KT3A 2DPGA 2SKDA 1I1NA 4FLEA 5DM0A 2YS6A 3KSBC 4UEOA 3RKSA 2NT3A 3OJCA 5ERGB 4BLQA 5FNVA 2CMDA 1ZEJA 4GEKA 1I6KA 5J2TF 1MB4A 4FYXA 3ABRB 4GYKA 1Z0JA 4NJMB 3LKBA 2Q6OA 2F2TA 3KJGA 4CMCA 4B9AA 4QAQA 3BPSA 1V26A 1CJBA 1MC1A 1Q92A 4K9DA 4GIBA 3VKUA 2O06A 4E5UA 3H6HA 4EMBA 5IAAA 3FWYA 4IFTA 2WSIA 4L73A 4TS9A 1L6RA 2C8VA 4Y1EA 1EHIA 4G67A 5B7NA 3P52A 3ZD7A 4G1MB 5C51B 3R75A 1Z45A 3TMAA 2YJ5A 3SIRA 3AJEA 4OX9Y 3CXUA 3P9RA 1PEDA 3EK2A 2Y6VA 1WPRA 3O75A 1KE1A 3AKCA 5BR1A 5DWVA 2X4DA 1S3GA 2O5EA 4ZVSA 1VLJA 4X1YA 1W36C 1RPTA 3ROTA 1RJ9B 1M83A 2H5EA 1XA4A 4C3ZA 2QI9C 4AMZA 3I09A 4ZEWA 4ZQIA 1G4UR 5DEOA 4DBVO 1I4WA 3WZ2A 2PEYA 4LHXA 4CT4B 4EVRA 3IURA 2RD2A 3PRHA 4R2LA 4LKOA 3H1BA 5JOQA 3U44B 4FGUA 3QOXA 4KQKA 2OB2A 2Z8ZA 2CLLB 1TC1A 2ZBEA 1ESCA 4TVSA 2JJYA 5FAKA 4RIEA 4LIPD 4ZO9A 4D82A 2A88A 1LC0A 2W70A 2B21A 3QELB 1CUHA 2V6MA 3D3EA 4S2UA 5TS2A 2Z6AA 3K5HA 1H1TA 4PZYA 3TFWA 1FSFA 5EUQB 4DJEC 2P3OA 4JX8A 2VLIA 4EH1A 2PUBA 3DDWA 1HDGO 1MTOA 4LOJA 4L5YA 4MMZB 5HMMA 4B35A 5F3WB 3STUA 3FTEA 3OH8A 5DM70 3EEOA 4I4NA 1QFMA 2V58A 2WJPA 1AUXA 4IW3B 4H6XA 4COOA 3JQPA 1LDMA 1YS7A 3D0OA 4L9WA 4FEAA 4MP3A 2XA9A 1E5TA 2OAGA 4R69A 2QRPA 3WX0A 4Y67A 4UKDA 5E38A 5LQDA 4XB6B 1WZEA 2PDAA 2NZJA 4W5OA 4PLCA 3FYCA 4W9MC 1DCTA 1ZJJA 1YMUA 3BL5A 1KJWA 3BMOA 3QFSA 4N03A 5FO1A 3T99A 5FPKA 3T3GA 1ODKA 5L7YA 3QVGB 2JVIA 5FTKA 3R7BA 3ZWNA 1XRNA 3LZ6A 4GKJB 1ISSA 4I08A 1JYSA 3WRYC 1RXYA 2QRVA 1WB9A 3AIMA 4CV1A 3OQNA 2WILA 4H7EA 1DBIA 4YRSA 4W5JA 3MPOA 3HKCB 5LBUA 2X58A 3U3JA 3ZV3A 1E2NA 3IHWA 4E2WA 1CEEA 2GEFA 2PX4A 2ZDQA 3KQYA 4JB2A 4PBSA 3H9JA 4HR7A 5JS1A 1DPGA 2FN3A 5GJCA 3G17A 4C3OB 1XRLA 5CVUA 2GYVA 4D6PA 1VCIA 2UYQA 2E21A 3DBHB 4MKXA 5AH0A 1CQWA 3A6PC 4M88A 5G2OA 3B52X 1RZ3A 3UPDA 1I94B 3DTVB 2P62A 2DUJA 3GOQA 1RIFA 1FVXA 1U8EA 2AHRA 2OGTA 2IUFA 2Q07A 2R1VB 3HCBA 1U2PA 2PYZA 5TQ2A 4MWTA 2IXBA 4ZEOA 1KYQA 1JDJA 2ES4A 2R8OA 3GEGA 3IC5A 1T25A 4G0YA 4CM1A 1CW2B 4ID3A 5I5GA 3BX1A 1HZJA 3TSCA 1TZCA 1Y1SA 1JKFA 2D74A 1HG1A 2R11A 4WH0A 4UTXA 2CXOA 2BFCB 5L8VA 1P7PA 4DBLC 1IZ7A 1Y8QA 1K7CA 2FI1A 1ECJA 4E31A 3K30A 3GYGA 1LPOA 4FSXA 2IYPA 1DXHA 3OEHA 4D2IA 2K7FA 4QSMA 4UCFA 1AKNA 4B0OA 4KIGA 3GFRA 2D5BA 2BGGA 2C4HA 1G2PA 4DLKA 4BKRA 3R8FA 4JSTA 2XCSB 4WZAA 2CHUA 4FQ7A 1OSNA 1YGPA 4M0PA 2D2IA 4MMYB 3D6AA 4RZIA 2NXEA 3KNZA 1CWUA 4HADA 4Q6WA 4DXAA 1QPGA 3W8EA 2O5VA 1RAHA 4HDCA 1MAWA 1OWOA 1YZVA 3GLUA 1P9OA 2IVFA 2X7XA 1X7XA 2GXUA 1LTKA 1N57A 5ADHA 4NJMA 4IQ4A 3RUPA 4D9JA 3VHXB 1TECE 4XXHA 1NRIA 4EJSA 1E1RA 2C2OA 5ARDA 1C8VB 1T9HA 2ACVA 3PC2A 3QUAA 3S4YA 3TI7A 1RWPA 4YECA 4GRAA 3DZHA 4YAOA 5DHTA 1TVCA 1Y4UA 3EFHA 1DOAA 4PC3A 5BQ3A 1ZD1A 4G1CA 5FOVA 4NYMQ 4B31A 3B1FA 5F23A 4N9WA 1R6VA 3CKYA 4RJ2A 4PHHA 3Q8MA 3SG0A 1M7GA 2HY7A 1X8XA 1P7ZA 2G76A 1A7AA 3EWNA 3HB0A 4L8LA 2MCFA 1NW8A 3VO1A 2HHAA 1IUKA 4RGVA 1A71A 3A0UA 2I4RA 4KDEA 1ELOA 5AHWA 2Y1EA 1GA6A 5BV0A 3RVDA 4AJ2A 1J90A 3E5HA 3L4BA 3JAWA 4G85A 4TX1A 1D07A 1EK0A 4X8OA 1OH6A 3GRRA 2I1VB 5FAXA 1IC6A 2DWUA 3HVJA 3EC7A 1R5BA 4UEWA 4D8XA 4DEXA 3PNLA 3QELA 2GPYA 1MX3A 1RABA 1V0JA 3SGLA 1V5IA 3DTTA 3TEFA 4IHAA 2FUG1 1DQZA 2DKOA 4DABA 2VBGA 1X9GA 1T5LA 3E2IA 4LRSB 4OHFA 4EATA 3TOVA 3BZBA 4EITA 3IUPA 2XBLA 4HN9A 2ID8A 3QJYA 4M0UA 5K2MA 1SXGA 4C2TA 1E2DA 2ODPA 3LA6A 4D81A 3ZDCA 3C3WA 1BFKA 3D3WA 1NOKA 2RDMA 2D0DA 2YWJA 1QFJA 4ZTZB 3LLCA 2BCGY 1NDQA 2F4VB 4KQHA 3DNFA 3FCYA 1R8SA 3OJOA 1QDEA 1RYYA 3BJMA 4J8PA 1R4MA 3EF0A 2MHCA 1RXEA 3LPCA 5A03A 1VA4A 2BEUB 4GZ3A 1JFTA 1PQ4A 1USKA 2QSYA 4XH9B 3SMQA 3ZDRA 2RJOA 5IASA 2CXTA 5D3MA 3RJ5A 3QVGA 4YALA 1AIPA 1FTYA 1MOQA 4EW3A 4ZI7A 3E5RA 1ZD2P 5FPPA 4DVGA 1XJCA 621PA 1QIJA 3GDFA 3QKWA 1R50A 5TF0A 4NDNE 1EFDN 2AFIB 3SFVA 2AOTA 5E95A 1Z36A 3TOCA 5KOHB 2I33A 2WM3A 4LECA 2OYCA 1XD8A 5EJ4A 5BN3B 2B6NA 4QREA 1OZ0A 3FRHA 4EA7A 5A05A 1EZZA 1PJRA 2P6NA 4MW2A 2I65A 2LBPA 1LNQA 4EYSA 2FDCA 2AS0A 3H5NA 3IVMA 3T0IA 1AUQA 3R0QA 4FFWA 4IMRA 3KB8A 2PD3A 4ACBA 1NT2A 2ALJA 2XGSA 4PZAA 3KQLA 2OVFA 4Z4FA 1S01A 1NASA 2Q50A 3AOEC 3IEXA 2R1VA 3VC1A 3TZBA 3RS5A 4R1LA 4DA7A 1WDMA 1J1IA 4HNUA 1P1RA 2DBZA 2Q4RA 5JZMA 3OD5A 3RRNA 4DF3A 5T6BA 1NURA 2E6KA 3TLKA 4XQ9A 2BFCA 4CR6A 1ZH2A 1P81A 4RMHA 5DN6D 1NPDA 1IWOA 1UFRA 3KJIA 3KBOA 3KSRA 1EA5A 2AC2A 3VSBA 1M0EA 4DRZA 2WU8A 3WQHA 1FFYA 4Y2XA 3O5AA 1KY4A 2LGJA 2GPAA 4TYYA 1I7SB 2P1ZA 4OB7A 2JH3A 4OLAA 1XMXA 1RWKA 2C1EA 4EHFA 5JCXA 4A8JB 1NF3A 4L7QA 5ILQA 3KQSA 4FYIA 4JIMA 4KODA 4IVQA 1SHLA 4OP3A 4DSOA 4J7UA 4ZOAA 5M34A 5BT8A 2J3JA 3RVBA 1U28C 4Q15A 2J46A 5D3KA 2PGOA 3ZK9A 5JD5A 3TTTA 5DHPA 3ILXA 1QGYA 2X13A 1A5AB 3EXG1 2W93A 3CRVA 1WXIA 1PR3A 3KD3A 5DTJA 1FYEA 4DA8A 3FJYA 2L42A 4QTYA 1T2EA 3DOHA 2OCPA 2OGZA 3WGOA 4NQRA 2YC2C 3ML1A 1ZW6A 2XIJA 1UM9A 1RQ7A 2PSEA 4OMUA 1V3TA 3QZUA 3KSUA 1NXXA 2CBXA 3HDQA 2VQEB 2IU6A 1ZOOA 2OCAA 3PR1A 3BXEA 3V2UA 5KTTA 3VR3A 4WKCA 1TYBE 3DOUA 3UF0A 3HR7A 2FUEA 2QQ5A 1E1QD 3P96A 1GY8A 1JLHA 3D7MA 4L9SA 3UB3A 1S3FA 4EA8A 2EFYA 3R77A 3AVUA 1TYDE 2O5CA 2P5TB 3F7MA 1HPLA 1P0FA 2O0KA 1GPJA 1CD5A 1H23A 1RLUA 2HT6A 1BKDR 1HFKA 1W2WB 2VDWA 3B2QA 5TQ0A 3VKVA 1RI2A 4DARA 1DIRA 1UBFA 3SHTA 4DG5A 2IP1A 2VJLA 1V1MA 3DPSA 3TSOA 2ZETA 3WLOA 3V5NA 3P8ZA 4UE3S 1GP2A 1E7WA 1IXYA 4I9FA 2Q1YA 1P7WA 3QU5A 1VHJA 2HMAA 4I55F 4AZWA 4E2XA 4YC7A 1LF0A 1MA0A 2C9YA 1SZDA 2XADA 2WJWA 1I7DA 2ISQA 1I5OA 1CZUA 3N58A 5HF5A 5LU9A 5EE0A 3PGMA 4FINA 4IVPA 3Q9NA 3H0EA 1L4UA 3LV8A 3QE0A 2QD3A 3ZJTA 1GSOA 4E5DA 1VCOA 2ZWIA 5BV8A 1X1TA 1K88A 3IJRA 3M6VA 2QVZX 2HU7A 3TKYA 3QWIA 4L3WA 4NF2A 3KOYA 3ZZ1A 5IC4A 4MAFA 2VFAA 2HRRA 5DCLA 1JKJA 3L8FA 4J49A 4JLKA 1XZBA 3K96A 3ES9A 3AVQA 4YMTA 5F73A 1HFJA 4LWZA 3PCTA 1LS1A 4OKNA 1P17A 2XYRA 1SKAA 1MGOA 2E85A 2FFJA 3E15A 3GMDA 3GP3A 5HKLA 1AQJA 4NCBA 1NBHA 3LH5A 3D5QA 3QF7A 4FMCB 4GYWA 4Y0AA 3R9IA 4DHEA 3CRW1 3OU7A 121PA 1ZUNB 5B2ZA 1H2WA 1QC5B 1ADBA 2BEUA 1WCYA 5LJIA 1XZLA 3LWZA 1QVAA 3H97A 2HI0A 1NZDA 2H5IA 1ZUD1 3LUPA 3OUTA 3F78A 4KHZA 3VDMA 2JLZA 1Z4OA 4X0EA 2ZLBA 2GN4A 1PNVA 4YJHA 5HKOA 5J4KA 1CQIB 4WN3A 2O2JA 1DAHA 4HUQB 1PZNA 1KYZA 1GUAA 1U2DC 2AFIA 4RHFA 1TK9A 1YDMA 2GD0A 4K8RB 4KZPA 1E92A 5KOHA 4YAEA 5HIIA 1HV8A 2NM0A 1KK3A 4FC7A 1IZZA 2OBBA 3R09A 3EPJA 4B79A 2G3YA 2PH5A 1MDBA 5BN3A 4GGOA 1GL6A 3OA2A 3ZZ0A 3PQ2A 3OKPA 4GBJA 1F60A 2ETVA 2AN4A 4BFTA 1XDWA 1P2UA 3LCRA 3UJ3X 2JATA 2IEDA 1SK9A 4IIBA 1G5PA 2L19A 4QWWA 2G08A 1AMUA 1WMBA 3DW1X 4FN5A 3BA6A 4ZQBA 4V0LA 1I4EB 1J0DA 2GMWA 1EDOA 4Q3CA 5E6UA 3T3PB 5LM3A 3G2QA 3PRYA 3C8DA 4XTCS 1XRJA 1ONOA 1KS9A 3UFXB 4EK9A 4DXDA 3PLAE 2JGMA 3TNFA 3R3ZA 1CUVA 3ME5A 1P62B 2II6A 3OJEA 2ZIZA 4G56A 4DFDA 3EZXA 4KX5A 4ZJYA 5CLLA 4BTLA 4OQPA 2XXJA 4EG1A 1YJBA 2I9KA 4QHTA 1B8PA 2BMJA 2PL5A 3G2MA 4B82A 5B1YA 1YWGO 5IG2A 3ZJUA 1AKRA 3LBHA 2N46A 3D81A 1O4VA 2FWRA 3AINA 5IARA 4CFSA 1YQEA 3QKRA 1SELA 2EFGA 2FMKA 3E4DA 4LRYA 4DJJA 3AB3A 4CL2A 1RQRA 4BVHA 1J70A 1XB2A 2IW1A 2Z4SA 2YFQA 3U6BA 1M2VA 5JSZB 1E0DA 4F2DA 2UZAA 3BIWA 1DFIA 2FLKA 3EGVA 5K0JA 4IJVA 3T7EA 3WMXA 2F8MA 1LDGA 4AAYA 1PS9A 2PS0A 3BK1A 3PFBA 4XYGA 4L9AA 2NO6A 2B30A 3G7SA 1E4YA 1FXWA 1YS1X 2L17A 2MYPA 3TXYA 2JLSA 4ESVA 2BONA 3SQMA 2DPMA 3UKDA 3TECE 1L7VC 1D4OA 5TV2A 1D7AA 4PYRA 1EWYA 4B4KA 3FAZA 2JBAB 2PSJA 3IAS1 3GEEA 5TPWA 5CFLA 3P19A 2BF4A 3FGPA 3HDHA 1X8KA 4Q4AB 4XWGA 5H02A 3RLIA 1HNXB 3QNWA 1U0FA 4TSKA 3O83A 4HAZA 5GMOA 1A8SA 2UYCA 3R5FA 4HB3A 3K4QA 2H31A 2XNSA 4BWYA 3ZN2A 1W46A 2AMLA 3MB5A 3LUCA 3OCUA 1A95A 1VSQA 4LYYA 1T1RA 2ZVJA 1IAQA 2ZB8A 3QBTA 2P2DA 1BKSB 3E35A 3M7IA 4WIAA 2R65A 4EJSC 1GQSA 1NUTA 3OJXA 4XUCA 1SCDA 3WKEA 1M2NA 1SOMA 4O4IF 2Q4TA 5BW6B 4UM9B 1GYPA 3S2ZA 1P0QA 3PCRB 2Q5CA 2HJSA 3IDAA 2BTOA 3ZCTA 1QIIA 5KPJA 5E9WA 3H9QA 2B9VA 5K6RA 5LP6B 1YBVA 1BZYA 1UMBA 2AK2A 3GJXC 3GMTA 2GCPA 2QTVB 3N86A 3OJLA 3OQPA 4Q01A 4Q1FA 2XNDA 4XLTA 5ITWA 3QLEA 1Z4JA 5ICEA 2P9CA 1PAUA 2RGAA 3DMNA 4DA4A 2ICAA 2IF2A 2MYUA 4I4CA 3EX7C 1KEKA 2JBHA 3AVXA 3DHNA 4ZJZA 1R6BX 4YMWA 4LXYA 4N3BA 3VPDA 2IYUA 1UZMA 5DGDA 4M22A 4YV2A 4KYTA 4C0JA 3C14C 5ECDA 3L8GA 4DR6B 5KVVA 4F4HA 2BFDA 3MW8A 5ERXA 4L4XA 4GOMD 3B8EA 3BXOA 3L7DA 2DFKB 3EZNA 2CB0A 4URYR 1T2CA 2FU5C 2VF4X 3OIVA 2QV0A 2W90A 3MCUA 5CP8A 1QC5A 3N2EA 5A5EA 1ULSA 4W1RA 1TYEB 1QXSA 3I0ZA 3VVCA 2ZM6B 1ESZA 2RFLA 3G5LA 3FR7A 2XCRB 1E5XA 1B41A 2E48A 2ZAMA 1YZUA 5THXA 1JZSA 5AVYA 3CVOA 1MX9A 1A9XB 1IY9A 2ORED 1P4AA 4HAIA 4I99A 4RQUA 5CDTA 1SQ5A 2GD1O 3R7SA 3I45A 3KXKA 2O54A 2H2DA 1UK8A 5L3QA 3WGLA 1XRRA 4CG1A 5DHUA 3MWDB 2DBVO 1JEEA 3PUWA 4EHIA 5A1JA 1UKCA 3G7NA