3I30X

Proteinase k by classical hanging drop method after high x-ray dose on id14-2 beamline at esrf
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title Atomic structure and radiation resistance of Langmuir-Blodgett protein crystals
rcsb
molecule tags Hydrolase
total genus 97
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3i30X00
4LVOA 1WMEA 4KPGA 4FONA 2SNIE 3I34X 1VSBA 3EIFA 1SBIA 2PWBA 1SIBE 1SN7A 1XF1A 4DZTA 4JP8A 1GNSA 3F7MA 1AQNA 1CNMA 4OV6B 4K8RB 5AVJA 2ZRQA 3AFGA 3DVSX 1ST2A 4AKTA 3VTAA 2XRMA 1BFUA 1OYOA 1T1GA 2ST1A 4NE7A 5FBZA 1KDZA 3F49S 1UBNA 4WOBA 1TK2A 1AU9A 3DVRX 1S02A 1BFKA 1DBIA 2PKCA 3L1KA 1GTG1 3DE4X 3TI9A 3CNQS 5JXIA 1S2NA 3DE7X 3H42B 1P7VA 3DYBA 2W2QA 1TECE 1EGQA 1T1EA 4Z2AA 4H6WA 4KG7A 2Z56A 2WUVA 5AMXA 5AQEA 1WMDA 2Z57A 1AH2A 3DE0X 1OYVA 3AJ8A 2WUWE 3PRKE 2SICE 1IAVA 2V8BA 3DE5X 1SCNE 3I37X 2PYZA 5B1DA 1PFGA 3A3PA 4H6XA 3LPAA 1WVMA 1Y34E 1Y3BE 3D9QX 4HX2A 4OMCA 1MPTA 4DWWA 2W2NA 3GT4A 2Z2ZA 1TM3E 1DUIA 2X8JB 1ZVKA 1SUAA 1SUPA 4CFZA 2PWAA 1KE1A 3DE1X 5ARBA 2Z2XA 1BE6A 1Y48E 2IXTA 2DP4E 4NMXB 1R6VA 2ID8A 1SH7A 1Y3DE 3A3OA 1GCIA 5JXHA 1NDQA 5SICE 4HVLA 1SBHA 1SBCA 3DVQX 1Q5PA 1TO1E 1GTL1 1THMA 4C3VA 3DDZX 3DW1X 3WIUA 2Z30A 1LW6E 1BJRE 1SBTA 4DJ5X 1JEAA 1KDVA 3WQBA 1SELA 3OSZA 5JMOA 1SVNA 3LXUX 4KB5A 4NE9A 1YU6A 1KDYA 1SCDA 4LVNA 1YJBA 3VV2A 1SBNE 1SUBA 2TECE 3WIVA 2Z2YA 1TM7E 1KE2A 1PEKE 3AJ9A 2Z58A 4BWGA 5FFNA 3D43A 4MZDA 1A2QA 1V6CA 4C3UA 3BPSA 1AVTA 3BGOS 4I0WB 4ZARA 4M1ZA 5B1EA 3DWEX 2QTWB 2XTJA 3WHIA 1GA1A 1Y4AE 3DE2X 2ZWPA 3PTLA 3VYVA 2W2PA 1TM5E 1Y3CE 1PTKA 4H6VA 3GCWA 3TECE 1PJ8A 5ARDA 2WV7A 5K7SA 1C3LA 2PRKA 3HJRA 3T41A 1AV7A 1TM1E 3DW3X 2IY9A 3VV3A 3Q5GA 5I9SA 3LPCA 1BH6A 3A3NA 1GNVA 1WMFA 2W2OA 1C9JA 3ZXYA 1P7WA 1Y4DE 1SIUA 3ZXXA 2ID4A 1C9NA 1EA7A 4YN3A 2PQ2A 3DE3X 1YJCA 3I30X 1GA4A 2PMWB 1C9MA 4J94A 1GTJ1 2SECE 2SBTA 3QFHA 1Y1KE 1SUDA 5ARCA 5AVKA 3Q40A 1TMGE 1ZVJA 3SQOA 4GI3A 3F7OA 1AK9A 1BE8A 1Y3FE 3VSBA 1S01A 1TO2E 3SICE 4CG0A 3GCXA 4OMDA 3VHQA 1CSEE 2GKOA 1SIOA 4WOCA 3TI7A 2DQKA 3QMPA 3GT3A 3UNXA 3BX1A 3P5BA 1MEEA 3EDYA 1GT91 2B6NA 4RYDA 1IC6A 4CFYA 2HD4A 1YJAA 5JXJA 1NDUA 1WSDA 3LPDA 1Y33E 1GA6A 2HPZA 5JXGA 1SCAA 2W2MA 1OT5A 2G4VA 1SPBS 2DUJA 2ZWOA 2E1PA 4ZOQI 1NLUA 1SCJA 1SUCA 1Y9ZA 3EE6A 3DE6X 3QTLA 1V5IA 4AKSA 1AF4A 1ST3A 3CO0S 5FAXA 1SUEA 2P4EA 2WWTA 5CW1A 1TM4E 1HT3A 4B5LA 1SCBA 3I2YX 1P8JA 2X8JA 1R0RE 1T1IA 1R64A
chains in the Genus database with same CATH superfamily
4Q3BA 3QU9A 1CUDA 1LI4A 1M2JA 1P44A 3R9WA 3T5TA 4WI1A 1LF5A 1M2KA 1LRKA 1VG8A 1QDEA 3URKA 4FONA 5CFRA 3BSWA 1SMKA 1QIDA 1U8UA 3DEKA 1PJLA 4JUAA 3OM0A 4TTTS 5C3MA 2I87A 3BXOA 3MAGA 2BZ0A 3A06A 1M34E 4E2XA 1DT5A 2HUNA 4OBBA 4Q00A 3AG6A 3UUGA 1SIBE 3B6ZA 1T5IA 3OE4A 3LIIA 4WEQA 2OXIA 2ZBUA 5DN9A 2JGEA 4AURA 3WDSA 3ECCA 1A95A 3I9FA 4ZYTA 3LDAA 1OBFO 3FFWA 3UJ8A 4LQDA 5JAZA 3GOHA 3O8LA 5DHUA 4EUSA 2ECOA 2IDMA 2BD0A 3L0SA 5IAGA 2WLTA 5AI6A 1EX1A 1G42A 3FOBA 4BX3A 3FB4A 2CKMA 1UPCA 1UDBA 3OPYI 1FYWA 4A0RA 1GSOA 3T0GA 2GB4A 4X54A 4HWTA 5K6AA 4HY3A 4JJ8A 3SX2A 1VHWA 2CL5A 4L6AA 4C5AA 4LF6B 1O87A 1T6ZA 4MVJF 3AUSA 2GCIA 2KB0A 4OMUA 4CQMD 4N5DA 2NVOA 6REQB 4NEQA 1NX6A 1KMHB 1PI3A 3JQFC 1EFRA 5ALOA 2PGDA 4OGWA 5EP4A 3C5HA 4HNRA 1T1GA 2JFNA 4OQZA 2VJOA 1B2LA 4NS4A 2QZZA 2C0QA 4IHJA 1AKEA 4M76B 1J8YF 3ZU4A 5KNLA 1JTVA 1NBIA 1B8VA 1FP2A 1FUIA 2CUTA 4B3XA 3Q8XB 3RVKA 5DX1A 5KVQA 1S4QA 1NJ5A 3EEBA 4E3ZA 1Y63A 2W6CX 4QXPA 2IF0A 4PSKA 3RYFA 5JAMA 2XCRB 121PA 1H65A 1RADA 3FOFC 3QA9A 1ESMA 1U0OC 4AJ2A 1BCSB 2QUHA 4KYVA 3HJUA 4D4KA 1T9GR 4QU0A 1VCHA 1JKXA 2HRRA 2Q1WA 3KJHA 5EEHA 1GQFA 4FVTA 5FFFA 1Z26A 4EUHA 3UHOA 5C81A 2HSGA 3IQZA 1TTHA 4HMQA 4QPJC 1QYVA 2H1RA 3ZU5A 1ODSA 4CCYB 2DQYA 2YVUA 1SHUX 1QGZA 4IIHA 3RS2A 3CLUD 3BE6A 1LTKA 1UM9B 2DBRA 2Q5FA 4P81A 3CVUA 3D8TA 3H5TA 3KVOA 4ZCMA 1KJQA 2BMAA 2C82A 3HJCA 1WUHS 3BN3A 3OPNA 5H82A 1FXWF 2HCBA 3CUKA 2JEOA 1L5GB 3PEYA 1W25A 3K8ZA 1EGAA 1RC8A 3X2FA 4MI6A 3T4EA 4ERNA 1J25A 2G76A 4D8TA 4XSGA 4ZO4A 3REOA 3DV0B 3D6HA 3AKDA 1IHUA 5DOVA 1V9CA 2YWGA 1H4SA 6CHYA 1ZP6A 4EVSA 3LWNA 3TUIC 5K0FA 4HOYA 2BM1A 4Q7KA 421PA 3TGPA 1TFRA 1FFWA 1I1OA 3U40A 3U60B 2NT4A 2LIVA 4JX8A 5ICCA 1EG7A 4XJXA 1YRBA 4DT1A 2IS2A 5L6MB 1YB6A 4C0LA 3DKKA 4ZEMA 1AQUA 4HHEA 4ND1A 4CKYA 4JWKA 3W06A 1Q1ZA 4JOBA 2EFHB 4U6NA 4X8OA 2WUWE 1SCIA 3U16A 1Z0UA 4LNUA 3MF4A 5BNZA 3B1XA 3GT7A 4QEDA 2FPKA 4Y6LA 1OZAA 2FE1A 5HFAA 1ZOPA 1GLVA 3ZHOA 2Y1XA 5JBIA 1JDUA 1XK6A 4HUTA 2WIJA 1CY2A 2O23A 2D7CA 4MJ3A 3I1IA 1E2DA 2MSKA 4FYMA 3IX7A 4IJQA 4J7XA 1KYIA 5FYDA 2BEVB 3PQ4A 4CM9D 1AUPA 1K6MA 2HF9A 3INTA 5BURA 1ZR4A 3IKLA 5AFSA 1GZDA 2QQ0A 2FFBA 4TRRA 1QO0D 1RYEA 3FUCA 3C3EA 4MIOA 4WKCA 5D8DA 3V48A 3ZC3A 4RXMA 3TZBA 4EG3A 4M8LA 1DQRA 2ZUTA 3V2UA 1E3QA 4BECA 1L1QA 3PPXA 4MCHA 3N8NA 3P4YA 3BD9A 3M7IA 4M9ZA 4O2AF 2RHDA 1CRLA 1OXUA 1UC8A 1KMQA 2JLSA 1G16A 3QWBA 4WKBA 3SKYA 4IIGA 3ZZMA 1I3NA 4CHTA 3VYRB 1C41A 4W5RA 2IS6A 4BO4A 4PC6A 3K0SA 4ZGWA 2AHRA 4KE6A 3GJRA 3SX4A 3I12A 5K4GA 1T4CB 2Q7XA 1FTYA 1I8TA 4IIXA 3VR2D 5ARBA 4ZO8A 3GLFB 2J7PA 3ACDA 3P7MA 4B8YA 4C7BA 4CLHA 4EVIA 3ZW9A 4BLRA 1DIBA 2OM2A 2QHXA 2EP7A 3BB4A 1W49A 2EAUA 3JPYA 2C4WA 3LUDA 4M2LA 1GU0A 3VAZA 2X1HA 4DCVA 3DNPA 2CDAA 3AINA 4ZN6A 1Q44A 2NV6A 3EEFA 3ZZ1A 3K0AA 3TUZC 5TPZD 4JB8A 2OGUA 4YJDA 3G8DA 2WMOB 4L9AA 1DKRA 3FYHA 3SKXA 1K27A 3A05A 1E32A 1IMJA 3PRHA 4AJNA 1NN1A 2ZOSA 4O4LF 1O58A 3MJTA 4ZOAA 3GEBA 3GJ0A 1WXWA 3DBLB 5SICE 1SBCA 3B6IA 3SR4A 4YRKA 1G66A 4F8YA 3Q3HA 4K87A 5T8KC 1MO2A 2EWWA 2V7GA 4G2TA 2B8EA 2AXPA 2QZPA 4ZQBA 5FNZA 4DNFA 1XEWX 4OLFA 1COWD 3AB8A 1P2BA 1L1RA 5DBIA 1Q74A 3WA7A 4LYGA 3AR6A 2J9FA 2QSJA 1T9HA 2JHAA 2Q0SA 1U28C 3CONA 3FLAA 3H9UA 2GZRA 4L6CA 4ZT3A 2NU8B 4NZ9A 5JQGA 4S24A 5CXXA 3AERA 2D59A 4QATA 3JQRA 2QN9A 2VXBA 4MWTA 1QG2A 3LQFA 1TDJA 3L0BA 3M6XA 3AYXB 3IB6A 3IFSA 1WB6A 1CDOA 2GLTA 3PQDA 2Q1YA 1KDVA 4CM6A 3HO6A 1X7YB 4D02A 1TYBE 2HXGA 2FJUA 2DZDA 2ZUUA 1QOZA 1O4WA 2C07A 2PGJA 3M3PA 3SAJA 3ZWCA 3V1TC 3E7XA 2ECQA 1YS7A 2I6QA 3G6WA 1Y8RB 4MR8A 1YOVB 2BGTA 3LX8A 1C5KA 3OFNA 4OQMA 1PDVA 3ZD7A 3G1UA 3W7BA 1KMNA 2QK4A 3CNNA 3MB8A 5ILOA 1GUDA 4MKGA 3FMVA 5HS6A 4L3WA 3OF3A 4TQAA 5CH5A 5KDLA 1T1SA 2VJBA 3MMNA 2QUIA 2I54A 4L07A 2KLHA 1ETUA 5F9FA 2WWWA 1ECFA 1SUBA 3BMCB 4JAVC 3KJZA 4EFMA 3HA5A 1KY5A 3PNPA 1Y1LA 1Y5NA 1NMXA 4FFDA 4IUYA 1KE2A 6ABPA 3A25A 3PFBA 4JYBA 3ZI4A 4DSOA 4TUYF 1P3Y1 4DEYA 1FW8A 5BV2P 3FNQA 4UAUA 5K8TA 3E81A 2AZTA 2P9BA 1MQ9A 3LDUA 3MBIA 1K4MA 2HQBA 1VPWA 3WNQA 1JDBB 1L4LA 1TEVA 3EDRA 4ZREA 4G5YA 3SR0A 4ANFA 1UPFA 4GBED 4RVGA 4BLPA 4BEBA 4UE3S 5G0TA 1V6CA 2E0IA 5HCUA 1IJFA 5LP1A 1G9XA 4DG8A 3W77A 3BFXA 4DLBA 6Q21A 3RTBA 5KNCH 1NUSA 1C2TA 4Y9UA 4E31A 5K8CA 5EJ8A 1AXRA 4X1YB 1J0EA 3VFDA 4C5BA 2ZXUA 1VZ2A 3CUSA 5DEOA 3RUCA 3QPUA 1IHDA 2ACWA 2NUPA 4QSHA 1N75A 1W93A 3EVBA 5IARA 3TRKA 3GRYA 5C80A 1DARA 1DFHA 4HGRA 4HWRA 3E2PA 4A73A 1DT3A 5ALFA 1E5DA 1PRYA 1DXYA 2B4KA 3H8VA 1DKNA 5G0VA 3M1LA 1EWKA 2JD1A 4GZMA 2VEOA 2Q0XA 3QSYA 1SXJE 1CRPA 3DKIA 3PTLA 4BRUA 2WJWA 1Z8FA 1XPUA 1QX3A 1T8UA 2H4JA 5CURA 3GCWA 1N5JA 1MAUA 3U13A 2BH2A 1L5YA 2LP4Y 2VDMB 1J0BA 1UK8A 3F8TA 3WOVA 2J5KA 1Y0BA 5TS2A 4W82A 5JS6A 3W34A 1OLUA 4HQFA 2FXVA 3KZOA 4DDMA 2EX0A 4I1OA 1PZGA 3WE7A 3CR3C 4Q7LA 2C94A 1T0HB 3SKVA 1OU0A 4MKXA 1KK3A 2CE2X 3JD3A 5CVJA 5HUJA 4BDSA 4ARVA 1ZN9A 4CV0A 1BA3A 4BBJA 4AMUA 1ENOA 3L8HA 1H94A 4OA8A 3MK31 1G2IA 4TV9F 3WGTA 3TF5A 2O8FB 4OJTA 4UNNA 1ZM4A 3ZKWA 5BSHA 5IDXA 4OYHA 4Z6KA 4UNIA 2Z3ZA 1WB4A 4RD1A 1QH8B 1NOKA 2PJUA 4UULA 4RFSB 4RHUA 3LPCA 4NYMQ 2FRDA 2R47A 3UJAA 4EW6A 5B3KA 1EB9A 1LLUA 4MGIR 4XB6B 5BNTA 4PZEA 2Z9CA 4D6YA 1QUFA 3TQIA 3WL3A 3GG2A 1MLDA 1IY0A 2FFAA 5JZBA 1JKJB 2O7NA 1R0SA 3NB0A 4Z4QA 2X3FA 3TDNA 1L4HA 3ZVNA 1CEEA 4BEVA 1CCWA 4HTAA 4I5FA 3IDOA 4KXUA 1SVIA 3OCCA 5EESA 4X95A 5T64A 4DKXA 1P5JA 1QV7A 2BWJA 3FGNA 3QKWA 4ZD6A 4EB6B 3ZJUA 2YFHA 3G0OA 2XUJA 5YASA 4QT4A 2Q6LA 5K99A 2CK3D 4BVGA 3V2IA 2R6GA 1M1XB 2MYPA 3CS3A 4HZUA 4RDXA 1H0KA 3EA0A 3SSNA 2DHEA 3AL3A 5LP6C 1XEWY 1ZM2A 2JBAA 5EMLA 4CLRA 3PGKA 2JANA 5BWOA 4YQEA 3WWOA 4XOIA 3D4LA 1JAZA 3NLLA 5KYWB 1G8JA 4BN4A 3ACBA 4KNWA 4UQPA 5AKZA 2R44A 4PZPA 5HDQA 4ER0A 3IUBA 4UXIA 5KQSA 2Q1TA 4YJ2A 3BB3A 5AVKA 3WRYC 3BWEA 4MITA 1RJ9B 5C46F 2GLUA 5AVXA 3PD1A 3S2IA 1H93A 2M2IA 3VMFA 4D8UA 4B3RB 3GWGA 3Q4GA 4URXR 3V7YA 5A4KA 1KO1A 1N6PA 4HPWA 4K3VA 2Z6QA 3OMWA 1ZHHA 2ZYWX 3IDFA 2JATA 3RC2A 2YXLA 3IQFA 3QA3E 3SY8A 3PNMA 4PEVA 4GU5A 3R3VA 1YB2A 5I45A 2ONJA 1D2MA 2AC4A 4BFZA 4U7DA 2ZWMA 1HDGO 2G1UA 1PKEA 2QXTA 3Q3EA 2AMVA 3MQFA 3TQHA 2JGAA 5EWMB 4FHCA 1GZSA 4U2KA 3WDMA 3KKEA 2B7LA 3LKVA 5DGIA 5JD4A 3TE6A 5ISMA 1QDUA 3OPXA 2J9XB 2UXDB 1IXZA 5AJUA 1CZLA 1ZH2A 2W8BB 2C29D 1VI2A 3BRWD 3SI7A 3E3AA 3JR3A 3EWAA 3SXUA 3ORRA 4ZOLB 2ZE5A 4M55A 3OFSA 2YYSA 5EQFA 3WC4A 2X8AA 4ZZ2A 3WV5A 3TTVA 1EX6A 1RKBA 4QBTA 4MGHA 2A94A 5BWLA 5C5EA 5KVVA 2ZAIA 5KOHA 3OWOA 4M0LA 3V7UA 4Q5IA 3ZBQA 4MR7A 1PBNA 2GF2A 2MYNA 5IHXA 1KRWA 2ERYA 3O91A 3OJLA 1UBEA 3K1AA 3OVMA 5E1MA 4MPDA 1NBOA 3KD2A 3VH1A 4YYZA 1D2NA 3K9LA 3TX2A 1HNZB 4DMKA 5EJFA 4XEHA 4K05A 5EXEA 1G9SA 1HDZA 2WUGA 4G0YA 2CNKA 4QRHA 5GJWC 3TBKA 3ZXSA 4AX8A 4BTEA 1D2RA 3ZVKA 4B3TB 3EZ2A 3WGUA 3W1WA 2JJQA 2I3GA 3QE2A 4Q9JA 1JAIA 5K0EA 1MFPA 3VPFA 5B3LA 4YAOA 4MRNA 2H4WA 2HZBA 1NT4A 2DB3A 3TVTA 1T36A 2JAXA 3UWSA 5HM8A 5IDWA 3GX1A 2DPHA 4DA6A 4MVJD 2W4QA 3ANXA 1RXCA 5TF4A 1R0KA 2QZJA 2CNLA 1DDGA 2JCGA 1GQYA 3Q0IA 1KO4A 4TTRA 4X1OA 3AKYA 3U3XA 4HDSB 3MJSA 4HGYA 5GVRA 3UPTA 2C8KA 2VPWA 4OUDB 3D4IA 2HK8A 2BSAA 2A78A 1GILA 1O0CA 3OWXA 2L17A 4RPIA 2B20A 4ARBA 1ZH8A 2Q62A 3KDAA 4MOWA 1XA4A 3M4JA 5K8IA 3ZE0B 1KPHA 2IX3A 2I03A 1TMOA 1L3BA 1E79D 2C2YA 2Q4BA 1F38A 4OGFA 5KTNA 4XEUA 2HHHB 4ENRA 3DWGA 2LDXA 1L2TA 3ROXA 4LXUA 5I4BA 1GUYA 2QS9A 2PFKA 1UEJA 3G2QA 4NR0A 4WFIA 1OLXB 2WKSA 2ZB7A 3NU1A 4FQ5A 4C87A 1R4AA 4G1VA 1XLWA 3KKOA 3OZSA 3PFCA 1Y7HA 2E85A 1UADA 2H63A 1VE5A 4E3WA 1TC1A 1CUVA 1R64A 3JY6A 3BXHA 1FLDA 3UJHA 2A67A 1U0HC 2QD4A 3F9CA 3OAAA 4KNVA 3RYCA 1QMPA 1G3MA 3ICOA 2A9OA 1C30B 3OEEA 4EGCB 2V0GA 1H3EA 2G70A 4KWCA 1ZPDA 3EIFA 4RUKA 4CG3A 4R71A 4MINA 3OE1A 3T15A 4QBKA 3ZEAA 3VA7A 4MQ5A 1O03A 2WVGA 1PZHA 3H5IA 4L5CA 4CQJA 3P4UA 4DCOA 5L7YA 2HR1A 1GXSB 4PYLA 2GTIA 3LYHA 3MHPA 4ZYVA 2VJDA 1RRKA 1ZXLA 1X87A 5TMEA 5L4SA 3HMQA 5EUQB 4PPGA 1OAKA 5H3CA 5JI3E 3KEGA 2QDXA 3THYA 2YC4C 4NSNA 4O4IA 1GRCA 3HE3A 4C2UA 2YHIA 1I30A 2WFZA 4IIVA 4RPLA 3IBFA 4Q16A 3X1KA 1S7CA 4EZBA 4Q05A 2VRNA 3EPRA 2ZE8A 3GGGA 3C5EA 3KOWA 3RRYA 3VO8A 4Z9BA 4CDMA 4AZWA 4R1LA 4R8RA 1VL1A 1U0LA 2ZRFA 1RZRA 1FFHA 2VHEA 1MG5A 3UK6A 3NHRA 1TLTA 4OYRA 4P80A 4TS4A 5L3RA 1N6KA 1XE3A 1UQRA 3NBYC 2W93A 3MT7A 4IFTA 4M1EA 1ZIDA 3WKAA 4LECA 4NE7A 4Q7MB 1LSSA 1SKBA 2Y2UA 4WIAA 3RWBA 1N78A 4E32A 5KWSA 4Q4AA 4IZHA 1U7DA 1GWNA 4J7UA 1K1EA 1C81A 4H08A 1NF8A 3FCEA 1M3SA 1PWZA 3GZNA 5E9JA 1YQUA 2I3ZA 1TK2A 3QLVC 4RGQA 3KFLA 5D85A 3T7RA 4P6VF 3CKLA 1S6YA 4L8LA 3PJEA 3MS7A 4FB4A 1VPEA 2WM2A 4HLUC 4RVCA 3WAGA 3AKZA 2CV1A 2PO5A 4Q1EA 3T5PA 2JCXA 4A6XA 1A0OA 2VF4X 4EZEA 1E1CA 1M5UA 2H8GA 4QYSA 4TKLA 2V5AA 4U2DA 3TLBA 2W00A 1SXHA 3HYTA 5EZ6B 3WWCA 1XV5A 3FSGA 4GOND 3M1YA 1KZHA 2YMLA 2BI4A 4OHOA 4UUAA 3N2KA 3S2ZA 5B5SA 4BO0A 1T5DX 3IPRA 5DYNA 3GT0A 1RJDA 4L72A 2D2IA 5JCPA 4TL8A 5LWQA 3T52A 2OUKA 5F51A 5DNDA 3OPYA 5MHTA 1XZMA 4EB8A 3ESZA 1BGXT 2OM6A 3EDQA 2ZQZA 3W6UA 4LX8A 1JSZA 3HNOA 3NG1A 2VF5X 2PKQP 3CRMA 3GA0A 2IYSA 3DBHB 2PUHA 1Z17A 3B5JA 3MQ2A 3C2QA 2AW5A 4RD3A 4KSYA 1KJZA 4I55A 4XJSA 1ONNA 1YA4A 4GOJA 4FMDB 5AMXA 4RKQA 2JCVA 3OUZA 1XZIA 1JWAB 3A2MA 2CMKA 4G09A 3UWMA 2ZZMA 1UDAA 2EZTA 3INYA 2DCMA 3QHQA 3V42A 1K7CA 1RI3A 2A86A 1WHSA 1TEHA 4M6WB 3KJQA 3IKVA 1RLUA 3RQIA 1BCRB 2D2VA 1ZD8A 1W0JA 3MZ0A 2ISSD 3NM6B 4EPTA 3LIPA 5C7YA 1P19A 3NEAA 2LBPA 2OYRA 4JR0A 4L75A 4OSPA 1YB5A 3IAFA 1IXYA 2IHNA 4W1PA 4NJOA 3ELBA 4AKGA 5CB8A 5C4GB 2GO7A 1EI9A 3TTSA 4TS3A 4XWYA 5B7PA 5KMGB 1YQXA 1H8ED 1SJ9A 4I1IA 4PXYA 3SXJA 1IBKB 5TQVA 4M88A 3MRSA 3PUXA 3RIGA 3QI7A 4LXGA 4M1TA 4K3UA 1QHNA 5H0IA 1DEAA 1RPJA 3ICVA 4RNCA 4DPKA 2I4IA 1M6VB 3FNGA 3H0KA 4LDRA 5IKPA 2O1XA 5AVTA 2V45A 4RVUA 2MYUA 4G89A 3OCYA 4M37A 1AMNA 2V55B 5TMDA 2FSIA 1Y82A 5TVKA 3HHPA 2XV1A 5KHLB 4A0HA 2D1FA 5H9WA 2ZP1A 3TW6A 1MT3A 3CXRA 3LGSA 1PHRA 3C3AA 3QV2A 4GMKA 4MKRA 4F4JA 2OWDA 3GT4A 2P8SA 4OATA 1O9GA 4IMJB 5B7NA 3RPEA 4S05A 2Z2ZA 1GN8A 2G9ZA 3KPWA 2YFKA 3W05A 5HX7A 1FS5A 4MPTA 3BH0A 2INGX 5DMHA 4W7HA 2OG1A 4OHFA 3S1LA 3UW1A 4BKQA 4QUJA 2APJA 4I4TF 3I6IA 3QVOA 5FWDA 3DE1X 2YXDA 5C5IA 2AKAB 5KTRA 1FX0B 4M87A 4P3XA 1KFJB 2XXJA 1DELA 5DIZA 2AZ4A 2O3SA 2WW8A 4R9SA 4R5HA 1N5OX 4YQZA 3HUUA 1EK2A 4D8YA 5MGBA 2M32A 2JA2A 4DWOA 1K5DA 2CJWA 2Y0DA 4NMXB 2RONA 4HV4A 1WB9A 3OMXA 4OKSA 3RVOA 1X14A 5ALQA 2ANBA 1Q0PA 3C6ZA 3QNMA 4DCJA 4AJIA 4P0QB 4G1CA 3VOTA 5IFLA 3N6RA 2O19A 3PNSA 1EJ0A 1ULSA 1AUQA 1XA3A 2RAFA 3K0FB 2WYUA 3C7CB 4QAQA 4QRDA 4CR7A 4DMRA 3EFBA 4YRLA 2JGDA 2C5BA 2Y66A 4O4JF 3ZDDA 1V3VA 3KALA 4CIAA 4X71A 2XOXA 1K0UA 1Q5PA 4J0HA 2GEVA 2JEYA 4W5QA 3EGWA 3HJGA 4YI5A 4L7VA 3UAWA 2PEYA 1M2VA 4YWJA 4YYEA 2VRCA 2C0CA 4V0QA 4HT3B 4ZTZB 3O21A 3B52X 4GKJB 4YECA 1B0PA 1RHRA 2WBLC 4TVOA 4Y2JA 1AGYA 1P1IA 2QROA 4OB6A 3ENZA 2ZFUA 5TEWA 4DM7A 4EB3A 3ZQ4A 1Z39A 3JVVA 1JEEA 5DSZA 1JJAA 1EWTA 2FW8A 3R7WB 4A7PA 4HCJA 2C7OA 3BTVA 2EBWA 3KTDA 3IILA 4DV3B 2O8BA 2Q6OA 2WUDA 2KJQA 4ZWNA 1PJRA 2FW7A 1I9CA 1KETA 3C45A 2PLNA 3PCTA 3RUFA 4DRXA 4ZKDA 1E8MA 3DEZA 4AS1A 3AEUA 2PT7A 4I9HA 2HJRA 3STXA 1SG6A 2NVBA 1UH5A 1EG2A 1K86A 4KGZA 1I2AA 3NS7A 2C7RA 4MIEA 3RS7A 1M54A 5CLLA 4BPRA 4NJMB 3R5KA 4NKRA 1NONA 5A1TA 5AM3A 1GZ3A 5J2UB 3QU5A 1SQ0A 2IIBA 1P72A 4ZRNA 3HV2A 1G8FA 3W04A 4DA0A 2EWMA 1VGVA 4QDUA 5KHAA 4DV7B 2P3QA 2GXQA 1ZD4A 4A8JA 4QXRA 3LKDA 1R18A 5LZ5A 4RPCA 4MKZA 3COZA 1KJ8A 3DXZA 4IR7A 3BXEA 2DWOA 3AIOA 4M7RA 4R1QA 1WZCA 5B2EA 3R9IA 4CQNA 2PKXA 1MEOA 1L5MA 2YWHA 3D5QA 3ZE2B 1UANA 2X2PA 1AHIA 1F8YA 1YR2A 3C6MA 5SZJA 1NXSA 5DBEX 3K16A 4CLXA 1T9KA 4IDDA 1T2CA 4DYVA 4MXDA 1Z29A 1Z3CA 4MJXA 2AE1A 5JU6A 4EVRA 5G40A 4XIYA 4FFPA 4F6CA 2QU7A 1XZCA 4PYNA 2HDOA 3TZKA 3J80A 3OURA 1CK4A 1OFTA 2IPXA 2R5NA 1U9ZA 5SZKB 3S68A 1ZAYA 1G60A 5FXMA 3AQ4A 4G1UC 3RU9A 5FBQB 4BIMA 1UDRA 2YIDA 4B3IA 5LXTA 2DF8A 2ROQA 3IDAA 2HPAA 2J08A 3HRKA 4RGBA 4XAQA 3MGGA 4XJTA 3KQLA 3GW8A 2RC6A 2CEAA 2D62A 3HA3A 2RK3A 3NUGA 2XZPA 4II7A 2TMKA 2W37A 1RRFA 1EVYA 1TJYA 3KXLA 4P31A 5HILA 4MSUA 4NK4A 4WCFC 5KVCA 1AKYA 5ES3A 5LD2B 4AP9A 4B3DA 5KINB 4UZEA 3KQNA 4LYFA 3L7KA 3L4EA 2XDQA 3TECE 2HRBA 2PFSA 4GWKA 3WBFA 2GUGA 2GHIA 1TT7A 3HJNA 2WZCA 3VKFA 1IEWA 5CLFA 5TIIA 4RYLA 2OQ2A 1T2DA 1WVGA 5TMBA 5A9SB 3VR5D 3HJRA 5B1YA 5CDFA 2FPOA 4TYPA 3I1JA 4UW9A 3KBBA 4RQUA 3ICEA 4LJ4A 5BYKA 1ID8A 4ML3A 3P2OA 2VDNB 5DDIP 5IDVA 2F1JA 2PH1A 4PG5A 2NO9A 5FDFA 1GPMA 2ZRCA 2IHTA 3DZHA 4UMFA 3D2BA 4Q4DA 1ZW1A 2XHEA 1B6GA 1O95D 1RMQA 3IOMA 5B1IA 3SC2B 2PBZA 5HRAA 5K0BA 3SOZA 2ZIUB 3NHUA 3HYCA 3KEFA 4ZYYA 3G88A 4OHVA 5B6PA 1GFZA 1E1RA 3WL5A 3WWDA 1M83A 2AQ8A 4PPYA 3V8EA 3OECA 5FPQA 1LU9A 2AV6A 4B83A 4N41A 3SBDA 3VR4H 2C2MA 4YMWA 1DQPA 2ATCA 2ZU0C 3RLFA 1A96A 1YQQA 3GDGA 3O9ZA 1GPDG 3MWDB 4MLCA 3MOGA 3TEJA 2H0AA 2P0YA 4GOOD 1CQPA 3BM5A 4IM7A 2DPMA 4CG1A 1FDWA 4EK9A 5L4NA 3DLHA 1DO2A 1V3UA 2IA5A 2HK7A 5EJ2A 3LW8A 3VUEA 3MMZA 2XUDA 4IUDS 4NMLA 1Q1GA 1XTSA 5FEMA 1D1PA 2W8ZA 1C1HA 1CFZA 2G40A 3DM5A 3S2UA 3UA3A 1GCGA 1AF7A 4J76A 3ZXXA 1EFVB 1OV4A 3OBIA 5FTJA 3DOHA 3ETEA 3B7WA 2CD7A 3LKZA 2ORED 3I9NA 1VHTA 3HCNA 2QTGA 4HUJA 5IUNC 2DLCX 1IL0A 3CLTD 3PKIA 3OO0A 3EZLA 1AKRA 3GLHE 2H52A 4J1QA 3V6LA 1ADYA 4JUIA 1HWYA 1BWPA 2WP8J 5JBNA 3UJ9A 1PVVA 2P1RA 3VR0A 1IN1A 1QHSA 2WTUA 2NQ2C 4LZJA 4NX2A 1NJGA 2V7UA 3FJ1A 2E82A 2HK9A 3ZU6A 4F7WA 4FJ1A 2QV7A 4TN5A 1KS9A 2FPUA 3T3HA 1VJTA 5DCWA 2CE7A 4FB5A 1FRFS 2F64A 1YAJA 3GJ7A 4JK3A 5FCDA 3NONA 3LQKA 1V11B 2ZJZA 1MDBA 1VE6A 3E4CA 5H68A 2WD7A 2JW5A 3RWOA 1BXGB 1TA0A 3G2NA 4EO9A 1ZRMA 3ETJA 4TLMB 1BCSA 3RARA 1G3IA 1YNOA 3AF1A 3MMXA 4BBPA 3AR4A 4I99A 2Y9PB 4QGAA 1UBUS 4W1SA 2GX6A 4R9UC 4FOLA 4IKPA 5B53A 4G4SO 3VKVA 2LXNA 1OI4A 1E9DA 5G0UA 2X76A 2F1RA 2FMHA 3B53X 3RT9A 1ZG3A 4I4CA 3FOAA 1CY0A 4NAHA 3RVQA 3CX7A 2P2LA 1PJQA 3T4XA 4ZMBA 1IWBB 2HO4A 1E2GA 2RAVA 2NZYA 2VUHB 3BX1A 3N76A 4UEJA 3V1KA 3KQQA 3CIOA 2VVTA 5E1BA 3ZGZA 1DKUA 5CFNA 4NU5A 2XCIA 3CFYA 2IPAB 1N36B 4PX3A 1PZXA 4WQMA 3PD7A 2JB9A 1PR4A 5A3VA 3WYNA 3PUKA 2WD9A 1ZUNA 4WVLA 5DGHA 3ICQB 1X42A 1GT91 2J9ZB 2VPYA 3HG7A 4ECAA 1Z6AA 2Y77A 1XJ0A 1LY1A 1QGYA 3HNRA 3ZBPA 5KYTA 3PJFA 2GN8A 3BWCA 5FUMA 5BN3B 2IS1A 1KF0A 1XA0A 3HO8A 5DH9A 1KBQA 5BQPA 5BW6B 4BKOA 2GFIA 4HO1X 4R51A 4CTJA 4FM9A 4Z9AA 3RKUA 1PFYA 2BKXA 2JBHA 1QP4A 221PA 4HGZA 5CAEB 3FF1A 1GA6A 2QD5A 1MAAA 3ZD9A 1QF9A 4EJSC 4RQAA 3QMMA 4DKJA 1K63A 3FPGA 4HDAA 4C0QC 3ZYZA 5FD8A 2I65A 2RBGA 4LBVA 1L4FA 3PNBA 3UJ3X 3K1TA 1QIEA 4V1CB 5FV4A 4AF7A 1ARZA 3RYHB 2VQEB 2FG5A 1W2WB 1BVHA 1R5JA 4L5BA 1SCJA 2QX9A 4WRRA 3M5DA 1XAGA 2FQQA 1KSHA 1CXZA 3JYHA 1I4LD 3U7QB 4ZI3A 4PGGA 3IUYA 4HKTA 1IB0A 1ZGZA 4MAMA 4Z7NB 5FF9A 3ZQ6A 3S2GA 4A26A 1A5AB 4UKDA 4ZTBA 3AESA 2P6MA 4GQBA 1KP9A 1IUKA 2ODPA 2XOKD 2G9QA 1QSGA 1V5IA 4N4AA 4FQ7A 5FJJA 1X70A 4JUDX 4BMCA 4D9IA 5JBQA 2QMQA 5BNFA 2BBOA 5IKEA 3BBLA 3MTJA 4R8SA 3FCAA 5DNUA 4FYHA 4F3RA 2XLBA 4QE3A 2QPTA 2V6JA 1C9DB 4JT4A 5FEUA 4UASA 2C2WA 3ROMA 2P4EA 3G59A 3NJ4A 1WDLA 4EUNA 1CQJB 5E3IA 2UVDA 4AROA 4EJ0A 2VAXA 3JD2A 3L8CA 3DMDA 3FJYA 1L3IA 5F5XA 5H3HA 3QPAA 1A2KC 5I6DA 1CF9A 1EMDA 4RCVA 3NALA 5EP1A 4LVOA 4EVQA 3ONNA 4YCJA 4DIBA 3CZ4A 3HV0A 2Q8PA 3IGFA 3C39A 3HCPA 4DPMA 3GLFA 1GKKA 1UF9A 4Q12A 3VZPA 3WYFA 4EP1A 1F9EA 2QXYA 2QI9C 4ZU1X 4B6QA 4FE7A 2EJCA 3OLCX 4Y9TA 2O59A 2O2ZA 2QVZX 2OZEA 4N39A 3STTA 3VQTA 6PFKA 1SN7A 2JDID 3IAHA 5DEIA 1JWLA 2N1MA 1HF3A 3GRAA 4IXNA 4GWLA 2HBQA 3ZDFA 4ZI7B 5IVKA 4R1PA 4RANA 2J6HA 1KARA 5HIAA 1KFBB 4RTPA 4WH0A 1E2QA 2QMUA 2R86A 4GBJA 4AXBA 2H1LA 1V5WA 3DBLA 4LGMA 4LRTB 3PHGA 5HKLA 1W34A 3NFYA 1JI3A 4X20B 2QYHA 5BSUA 4KFSA 3AFGA 3WJAA 4HH0A 3VU3A 3K5HA 3AQIA 3N39C 5AR1A 3QU7A 4CDRA 3LXRA 2QM8A 1O95C 1V5EA 1FUKA 2RI0A 2V9CA 3MWLA 4HTFB 4TMYA 4XJVA 2NU8A 3WK7A 3PHLA 4C4AA 2IUFA 1DU4A 1ZJWA 1C2YA 3V9PA 3G82C 1IM8A 4RJ2A 2L2QA 3OX2A 2YV3A 4GECA 1Q95A 3UV7A 3U56A 1G41A 2VDLB 3TYXA 2QVCA 4CTKA 1CS0B 1X7YA 4Y7DA 4COKA 4B33A 1A04A 2V96A 4ONEA 2H5JA 4Q01A 3GRFA 5JCJA 4K9KA 4G6ZA 3ZHRA 5E1OA 2QRHA 3OQIB 1V35A 1N2GA 4MB6A 2JFVA 2XZTA 3MAAC 4Q1FA 3REGA 1Y7PA 4K6CA 2VUIB 2O0LA 1LK0A 1N9GA 3HC7A 3FYTA 1SKUA 3RVRA 1P7VA 1YI8A 1MGPA 3M33A 3NETA 3QUBA 4QUBA 3DYBA 3FKSD 2Q8NA 1DAHA 3P9CA 2IHUA 4QBHA 4TMVA 1JA1A 5G3YA 3CLTC 1C0PA 5AKJA 4BO9A 2J6IA 4E5VA 2CLLB 4A8TA 2IYUA 4CBVA 2Q45A 3I45A 3MN1A 5AVYA 3FOZA 1UFVA 1DQZA 2W6JD 4C88A 3EQ2A 1N2IA 1OFHA 2YHAA 4LCEA 1NWHA 5IANA 2AYZA 2AFIE 3TH5A 1PFKA 5DMXA 4AZ0B 3ROQA 5DI3B 3ENQA 4EY7A 5AQEA 4JYZA 5CCXA 3T5CA 4A2CA 4O08A 4F4IA 4DDHA 4MVJG 5FNVB 5BSFA 1TQ6A 1XNJA 2BZGA 5CCEA 2FUCA 3GYBA 2PSSA 3VPSA 1I6KA 4JL5A 2WWXA 4DA7A 3LLMA 1UBOS 2GN2A 1OCEA 3IT0A 2ZM5A 4NCBA 3A9RA 3C8DA 3IXLA 1AQYA 1YZUA 1Z37A 4LV6A 4RMNA 4XVQA 4YAEA 3DCYA 5AKIA 4BX2A 2JZCA 4MRMB 3TMYA 5TMPA 1Y3AA 1P1RA 3S1SA 3ZGLA 4EM6A 2C2BA 2NU6B 1XZHA 5EHGA 3DQZA 3RC1A 4Z7QB 4PPNA 5TPWB 1ULAA 4RKYA 1LBEA 3EQ9A 3HSKA 3NH6A 3BE4A 1NV8A 1EJBA 4H6XA 1NURA 1KY2A 2BFDB 2WIKA 3FB1A 1FOEB 2DUWA 5C0OE 1MUUA 3V97A 4E15A 5C1OA 2ZIEA 1KAMA 4ZCPA 2R7LA 5A5GA 2BJVA 3DMNA 2O0MA 4HDKB 1PWHA 4CM1A 1E7SA 4HLCA 5T6MA 4LY3A 1Y5RA 4KYIB 4G8BA 2Y1CA 3RFXA 4G0XA 4KJXA 4YQFA 2V5UA 1Q2XA 4FDTA 4ZCRA 2JC3A 3DL4A 4DWWA 5AW2A 1USGA 4YTEA 1TOAA 1UXOA 1Z5GA 2JFXA 2J3DA 3NTRA 1V26A 4A0FA 2YC2C 4XWAA 4EOGA 1ZONA 1E98A 1NXXA 4WK2B 2BKEA 1F0KA 2VZ9A 3QE3A 2A9RA 1K3FA 3OTHA 5F73A 1MW9X 3LLVA 3MT8A 1V7CA 3VYSB 2NNLD 5JOQA 3PXCX 2X8JB 4KQ1A 3NM5A 4F3CA 3DEFA 4BZQA 3L49A 1ZD3A 1ZK4A 3M4NA 1ESCA 1SUPA 1GCUA 4ZZIA 2HMYB 3DNFA 3PXAA 5D84A 2VI5A 2O8FA 2H4XA 2G5CA 1V96A 5ECYA 3TR6A 5LM3A 5A5VA 2CDRA 3MB5A 1E1DA 1QH8A 4J16A 4KU4A 1G4HA 4NG5A 2G1JA 4RFSA 1ULZA 5C8XA 3IKTA 2EG5A 3MYRA 4B6EA 4I9NA 3U49A 2X7JA 3PWZA 3S8MA 3WLRA 4BASA 1N77A 1M9NA 4G0UA 1UPUA 3A6KA 3EQ6A 4RMGA 3HSSA 4YX9A 1YRHA 3BE8A 3BDIA 1K7SN 1ZJZA 3D5EA 4FHZA 3NNSA 5JXWA 4J75A 1U1EA 1J2YA 3PRYA 4DV5B 1YDWA 4DLZA 3SR3A 2H48A 1UMDA 3PR2B 4DJJA 2OCAA 1NDQA 3L7IA 4JGIA 3U48A 4D3SA 4QPPA 3KLBA 2PUGA 1AE1A 2VDRB 3BICA 2HUPA 3PEFA 1KI2A 2PD4A 3NI2A 4IIDA 1GTZA 4FR5A 4Y2QA 4UUMA 2QZ9A 4TVKA 2H9YA 1WSWA 5ABPA 2I78A 3KWMA 3L9WA 3PB3A 4WXYB 4TRJA 2OBBA 1RQ2A 3E70C 4M7PA 3SPXA 3H9JA 5CLQA 3PX3A 4D92A 4MMZB 3ADCA 1FRNA 1TQ8A 3F5DA 4UPEA 4OXYA 5EJMA 3VISA 2H29A 4Y7CA 1LV8A 2BKVA 1QP8A 2PD3A 4I3GA 5ALWA 1DQSA 1V37A 1LLCA 2BF4A 3SJBA 4XRGA 4RM2A 4BP1A 5FUXA 4N6NA 1NVEA 1W4ZA 4RF5A 1BXRB 2ABWA 3LY7A 3GARA 1I7NA 1TW2A 2QGFA 3PE4A 2OXFA 2YJ4A 2QL9A 1TD1A 2Q99A 4J8PA 2DWCA 4PGHA 4GDMA 4JLAA 4GLLA 4WJZA 4HL6A 3EXG1 2XVAA 3CKKA 1MO3A 2VSFA 2NSJA 2QE6A 4BNYA 4UFNA 3K4PA 2NO0A 4NCHA 3P9NA 4I14A 3R2JA 4LVNA 3VSEA 4S1TA 1IN7A 3CMCO 3PR3A 4V1CI 1Q17A 1J8DA 3O5AA 2GSDA 2HDWA 5FYQA 4O2LA 1HT1E 5EWMA 3GIWA 3Q15C 1X38A 1W0KD 3EQ8A 1JQJC 4IJUA 1A8SA 4QOSA 2QQGA 3FF4A 4YLGA 4IZOA 3HXPA 5IK2A 3RJMA 1VL6A 4A3SA 4Y9DA 2J3MA 4PAMA 3JWHA 4R0VA 2XQFA 5FWYA 5HPYB 2W8BA 2H1FA 3NP9A 3OOJA 1XMQB 5CX1A 2CJPA 1I0IA 3ORSA 2Q6IA 5FUBA 2W4MA 2YNMD 1F4VA 1FQOA 3C4QA 2OHJA 1ORIA 3D43A 3D7MA 4FWIB 3E8SA 1Q16A 2HMWA 3K05A 5J5AA 1FFSA 2GSWA 2I2DA 4S0XA 4ETIA 4EZIA 4JLNA 2I3DA 3KYDB 4F04A 5C8DA 4IH4A 5J5CA 4LC1A 1X9GA 4AIIA 1PJCA 3C6XA 3RTAA 2H7CA 1LDYA 4CKCB 5EZYF 2JD0A 3WWEA 3MC1A 2IBMA 2XGMA 3BA6A 3IVGA 4J4BA 5ALJA 3L6OO 3UAGA 5LLDA 3N59A 4JH0A 1FPQA 4GGPA 1PT6A 4RTSA 3U7FB 3SQWA 3BTUA 5J23A 2BGJA 2MSEB 5DI9A 4WNIA 2A5LA 3EPHA 3V4OA 3JV7A 1E92A 1QF7A 2W4IA 3Q9UA 1J2UA 4R40A 3C7AA 1K06A 1J0CA 2PX5A 3FYCA 1E3MA 5DGCA 2XNCA 3D7NA 4AP6A 1XN4A 1GT6A 4BE9A 4BP8A 4L8WB 4J1NA 1M0EA 1H1DA 3C14C 2RAUA 1C9YA 5EUMA 3WR5A 3WGIA 3JQGB 1M2NA 4OSOA 1ZIOA 3THSA 2V1UA 1BVRA 2DSTA 4RY9A 4IQ8A 3OOHA 4E4RA 2BFOA 2QVYX 2KS6A 1CUUA 5IJZA 1YCFA 4DBLC 1L7QA 2XMCA 2P1DA 3LBIA 1FYXA 2GKGA 2PTGA 4G3XA 4LXIA 4NVRA 5EQDA 4AW9A 2Q29A 2L42A 4EI7A 4YRNA 2JS7A 3HBMA 4PINA 3HI6A 2P9YA 4HEHA 8LDHA 5J63A 1M73E 4PZYA 5LA6F 3QBVA 3MELA 2X0NA 2BSXA 3SZ3A 1CR4A 1XZDA 5F2EA 3WICA 2O8EB 1WR8A 2BHRA 4FGSA 5JAQA 3PC8A 3UANA 3M6LA 5GMOA 4LOAA 3BXXA 1WMAA 3NDBB 4J2TA 2J7KA 3T1TA 2C98A 1Y4ZA 1XRQA 3A1VA 1K6JA 3Q5GA 2UYGA 4RQBA 3NTUA 3SMQA 4D4MA 3GPCA 4ZQCB 4F2WA 3PIIA 4RIHA 4RTRA 1DJLA 4WDQA 1GN9A 5BOSA 1XRPA 1AQ6A 5AM1A 1J97A 1P7WA 2AFHE 4MUYA 2RI1A 4S12A 1DV2A 1E5TA 1KYXA 3OZTA 5CH8A 1J8MF 4R2XA 4G4JA 1UIMA 1ZDMA 4JXJA 1GXSA 3BGVA 3INRA 1SIUA 4KEAA 2AG6A 1NVGA 2BKUA 2FVXA 3NYRA 4OFBA 4WBXC 3EAGA 2Y1LA 2OHIA 4G5RA 2FX5A 1B2RA 2ID4A 4RLFA 1CHNA 1DOHA 3EFEA 3PC6A 1FFCA 2A1UB 2ZUDA 4FILA 4R1UA 1L5QA 3WXMA 2D13A 3EIEA 3FR7A 2OV3A 4IDBA 4G9BA 3OQVA 2F8SA 1E6LA 3OCJA 4V39A 3RREA 5LP6B 4ITUA 4Q39A 3QQ5A 4BXOA 1MNAA 3KP1A 3M6AA 4RTLA 1ULHA 4JQSA 4TTJA 1ZESA 2CLDX 2RH4A 3A4YA 2PUCA 2AEFA 3DCNA 3IOCA 3DONA 4X64B 5DTEA 3V4PB 4FUQA 1P29A 2HU8A 1TVCA 2ZRPA 1CQIB 2HF8A 4KR0A 3B2QA 1YRYE 4P93A 5H16A 4XFJA 3VR6A 5J4LA 2ZBGA 2M1ZA 4ZMSA 5BQ3A 2FQWA 2G08A 3E15A 4B4DA 1HYQA 3PQFA 3UV6A 4C21A 2HMSA 1E63A 1UAYA 4ZVOA 4XLZA 5BSVA 1SC4A 1CDDA 3TSWA 3U9SA 4DR3B 1UJ2A 2HGSA 3PF8A 2CNDA 1RXUA 4Z99A 1DHRA 1J7JA 4WV3A 2O6HA 4DQXA 2X4DA 3HKEA 4OQYA 1VYTA 1FC0A 2FN4A 2BFCB 1L6RA 1F2VA 2ISCA 2X42A 2Z1DA 1H2XA 1CSEE 3CPSA 3EMVA 3IS3A 4Q9HA 4AS3A 5E9AA 5LOVF 3HBJA 4BFTA 1SGWA 3UG7A 4DY6A 2G82A 5KTOA 3K94A 4LQLA 4MYTA 1NF2A 4WY5A 5GY7A 4MWZA 3L1HA 2PLWA 3GUVA 3TFWA 3JASB 2RHHA 4RCYA 4XXHA 3ILYA 1NNSA 2VAPA 4W9RA 3RVPA 5F33A 3S2EA 2ATXA 3OZ7A 3P5BA 4BO1A 3FUWA 4GC9A 1CZRA 3HJHA 1ZJYA 3TQCA 1BA2A 1VG0B 4DMCA 4HWGA 1XN1A 2OOKA 3LUKA 4EYOA 3I83A 1U5BA 2ECKA 1R6TA 2VTKA 2Y76A 3EDYA 1DQNA 3HN7A 4FHGA 2HIGA 3EOZA 2D1YA 3GEEA 3QOWA 4BQRA 4ZCTA 2BMFA 4Y2RA 2E6KA 4QODA 3TPFA 1D2CA 1AZLA 1SC6A 4G1EB 3RNLA 4D4JA 3DH0A 3HHEA 3UMRA 1Q3HA 2Q5CA 2HFKA 1BCRA 1P2VA 4DQ0A 2AXQA 4H1VA 5TEVA 5AW7A 1DUSA 5CX4A 5D3MA 2Q5HA 2AJDA 3DDOA 2WF5A 3U3JA 5GONB 3T34A 3L8FA 3WGLA 4PYJA 2W2MA 4RE5A 5KMGA 3LI2A 4D4LA 7ADHA 2OCIA 4G81A 2ZULA 3IT2A 3U6KA 2JJMA 3PT9A 4FEEA 1Z7GA 2P1ZA 4W6QA 1FYFA 3CG4A 1GV0A 2IIQA 4JOSA 1SUCA 3IPXA 4LDAA 3OJOA 1NVKA 4U39A 4YRDA 5EL0A 3WWYA 3KOMA 1WMBA 2QQ5A 3HDQA 3ZD8A 2XUAA 1FFBA 1HQDA 2YNMC 2UKDA 4IV8A 2ZBEA 4QOFA 1IY1A 1QLHA 1V2GA 1W4BA 3JVIA 1MHPA 1Q84A 1ICEA 3L6UA 4R81A 5T3UA 3UZUA 4LZNA 1AF4A 1MTOA 2QM3A 4GX5A 3RU3A 5JHGB 1D7OA 1Y6QA 4QASA 2E87A 5KU1A 1WPXA 3KKNA 4GYJA 1QYCA 1NM5A 3OU6A 5DM70 3NBZC 2FFRA 1XJQA 4BZPA 2WWHA 1MBZA 4AJOA 3K0EA 3AK4A 4E1AA 3ADBA 4HS4A 1TQ4A 1EZZA 1ISPA 3U4MA 1F2DA 1U6KA 3AM5A 1EK6A 4KK4A 4XLTA 1IHYA 2GHQA 2XYPA 3HCWA 4HRAA 4PBTA 3TTTA 1I94B 2HSEA 4G97A 4KIUA 4P1ZA 1RYNA 3AO0B 4LOIA 2EQBA 5C7LO 1WMEA 1I3LA 2CUKA 4PLYA 3KZXA 4CMIA 1LRJA 4V0KA 4NPCA 2IXDA 2QRMA 4PYIA 1NU8A 2ONKA 2QTHA 2CL7X 4L3OA 1JFVA 4OU4A 4AWBA 1L5ZA 3AVOA 4IILA 3VHXB 4FGZA 4EFNA 4YRZA 4DB2A 1GKYA 1N2EA 2XR1A 3IT3A 4B4OA 2I99A 1TPZA 3DJYA 5EKDA 4AUEA 4OKNA 1THTA 1XD2B 3FE2A 2C2XA 4X61A 3W2GA 3WSVA 3O73A 1SG9A 3KQYA 4X0EA 2XXAB 3DHVA 3IMGA 1KPGA 3OE7D 2B4QA 4KRGA 4LXXA 1WABA 3MUEA 1G17A 1T8SA 1DXQA 3OFND 4RDCA 3SHOA 5DNEA 3LC7O 2PEZA 3IJEB 2VZEA 5HTKA 2NPIA 3EBPA 4JBIA 4W8OA 4FDMA 3UO8B 4MVJE 3K0FA 4DQUA 4YRMA 5KNCD 3I5AA 3ABIA 3LUCA 2AMYA 4J7AA 5F4BA 5EE9A 3SC3A 1U80A 4P3NA 2WYOA 3EDOA 3T3MB 3U4GA 5GZ6A 3BZBA 3K20A 3KAKA 1AUVA 1HYBA 1YWGO 2XCTB 1JLKA 5H1YA 2FMKA 2V7PA 2H54A 1W19A 2Z8YM 3JQQA 3KPVA 3QF4B 1BDJA 4IIUA 2OPHA 1PGOA 3CUTA 2PKWA 3IHKA 1FDIA 1XQYA 3B20A 3EMBA 3AOEA 4QXQA 5COBA 4MP8A 3NTVA 4Y2YA 2Z2IA 1CP2A 3IP9A 4KMSA 4UVIA 3H4VA 5ALMA 2D7JA 3NTOA 3TG8A 3UCEA 1RYFA 3QKRA 4D0RA 1UFQA 1LGYA 1Z33A 3R7WA 3H2YA 3DUWA 3H6GA 2H5EA 3IEIA 2VQSA 1FLAA 4LJ5A 4DUZB 1DBIA 3Q2OA 4P4NA 1VIDA 1W48A 5IVPA 2RGBA 5EINA 4FOOA 2O1SA 3DMGA 3KJNA 1VP3A 1X7GA 3AEKB 3SDZA 5HHTA 1LWNA 4HLNA 4JP2A 4MYCA 1IHXA 4W9NC 1HY3A 3U4IA 5IXSA 1QH1A 2NYAA 1AKTA 2NSDA 3Q1LA 1LS1A 2EFDB 2FAXA 3P9KA 2D2FA 1JZQA 2OTCA 3DE7X 4N47A 1D03A 3PA6A 2Q0QA 4AG5A 4PNHA 5B57C 4MHTA 4Z1MD 1FSPA 3QBJA 1JFSA 2J3QA 2PR2A 1G21B 3H16A 4LYDA 4X45A 1F7VA 1VCMA 2FPPB 2IY8A 2JEZA 4YRQA 5DNAA 4S1OA 3IO5A 2FUG6 3PUIA 4MUXA 1X7WB 5TXGA 1M2EA 1T1EA 3IOEA 4EHHA 3JAWA 5TQ2A 4RK1A 5G02A 4EA6A 5IBPA 1C4WA 2H92A 1F60A 3CX4A 3G7NA 3P2JA 3T1YB 4TXHA 3WGGA 1Z7BA 5G4KA 1H1LB 1SRRA 3BMOB 4PZ0A 1A9SA 2IXAA 4WNAA 4LJRA 4TQUS 5EVCA 1W85B 5IJ0B 2ZRGA 2YXNA 1DX4A 3DL0A 5AKYA 3TLYA 4MRAA 2VUUA 3KT8A 4HUQA 1QAQA 1WD5A 2F3TA 5H59A 4YRBA 3A31A 1PT5A 4MLZA 5CXQA 5LYYA 1ZISA 4YCDA 5KJ1A 3AFOA 1XMIA 1XTZA 1QJ4A 5DNWA 4QQRA 5AVRA 3CR7A 4PW0A 3BWBA 5TV2A 1J2JA 2R9VA 1EXMA 1Z75A 2D5LA 2II6A 1N2SA 2OWEA 3TQTA 3B1JA 3B3JA 3PYLA 4PYKA 3ZU2A 1DTSA 1ONBA 4KWTA 1JAYA 5E7IA 3DE5X 1A2OA 4FYXA 3NWJA 4NMMA 3GNLA 2PYZA 5I9NA 3FG9A 3JYNA 5CXSA 4CV2A 4LJ6A 2BUBA 2ZUFA 3CEMA 3VZQA 4Z51A 3UM9A 4YJKA 3VH3A 4RZQA 2ZRJA 2PLRA 1Y3BE 2WJJA 1T3GA 1LJ8A 2BEJA 3L6RA 2WJGA 3C8HA 3MCAA 3RE1A 1L5NA 4UAGA 1NJ8A 4U6QA 1YGYA 1ZNXA 4GPIB 1IIRA 3ZDBA 1JR3D 1X1EA 1XFAA 3EY9A 3BK7A 3GRVA 2AD1A 5GP1A 4LZAA 4NOJA 1VRCA 2IYTA 1TT5A 3DBRB 4KN8A 5ILQA 4TTIA 5G2OA 5EQTA 1OX4B 1OH8A 2XT6A 4HC4A 2ILVA 2Q4TA 2CFOA 2QY6A 4X3OA 3DZ8A 3GFVA 2WJYA 3VVMA 4E0BA 4YCCA 5KVAA 1A8IA 3TDMA 1Z0KA 2F59A 2YIVX 1DKLA 3GUHA 3M4ZA 4TWZA 1DUIA 1NPYA 2A1IA 3KJEA 4YHHB 3VJRA 1SUAA 3NHAA 1ZUHA 3N2NA 4DV0B 5SY9A 1ORRA 4TV8B 4BJ1A 4OQPA 3R7BA 2WT8A 4BL5A 1R0WA 4TTVA 5DPMA 3MOSA 2Z43A 3EZXA 1Y8AA 1VSVA 3BILA 2ZI5A 4TZ6A 4YC7A 3RO7A 4DLYA 4CLEA 4IO1A 3H8SA 2G67A 4LYEA 4PANA 3CX6A 5JH7B 3WKEA 4OHZA 4XR9A 1XEFA 1Z73A 1ZMBA 1QP0A 5E1DA 3VKUA 1F4PA 3IVAA 3L7NA 4PO9A 3O6VA 2PLFA 1MABB 3KK0A 1Z2OX 2WQZA 4UMEA 4LZPA 3G5LA 3PZRA 1DC8A 2FVYA 4Q03A 2XUKA 5JLAA 1U8CB 3G13A 2O06A 3G79A 4I1YA 5K20A 1NVBA 2YY5A 4B46A 2POCA 2EX1A 4WA8A 2B5VA 4ZO6A 2EX4A 2PMBA 2OV1A 4E09A 1QGED 5L8VA 4H27A 3EJ6A 4GS5A 1SZPA 2MSLA 3CGGA 1UKZA 3A1WA 4AN1A 4B84A 1RAEA 3PJDA 1M10A 2O8DB 1S2DA 3N2GA 2FN9A 1XU9A 1ZOOA 1E7YA 1MMFB 1TVMA 3F71A 3BXGA 3HFGA 4IQGA 2XBMA 3GRZA 3DAOA 4WZAE 5LN1A 1ZWLA 3R0IA 5BMVB 1NXWA 5A5DA 4HDMB 1YMVA 1TI7A 1VE3A 2JHGA 3JTMA 2PSJA 3K1ZA 3IDQA 2G9RA 2O48X 3GDWA 1ISIA 2KYRA 3H4IA 4XRRA 4IH9A 4RTNA 5JCZA 3FHOA 4C5CA 5CVUA 1J2TA 1H3NA 1YCDA 2PL1A 1VZ3A 4LISA 3RF7A 2RH9B 1D7AA 2YVQA 1FMJA 2B2NA 3PITA 4KLAA 1J1ZA 5ITVA 1CQXA 4MUEA 1A97A 2GPYA 2I8AA 3P0JA 4UHDA 4O3MA 4PGFA 1GLNA 4FEYA 1QB8A 1CYDA 1XLUA 3G7SA 3WLPA 1SPXA 2QLFA 5IVHA 1JIVA 2GJ9A 2XXBA 3H1TA 3FTDA 1QWOA 4YAKA 1X1BA 1QIHA 2A84A 4JEHA 4K9SA 1KZGB 1A76A 3JAKB 1D6MA 3BHIA 2IHJA 4LRUA 2ETVA 2GAJA 2G25A 1C7JA 3TSZA 2EZ4A 2W2KB 5BUQA 1YS9A 4NNOA 2RBKA 5GM1A 1XL1A 3GMSA 4QSMA 2FZCA 1IJBA 1TCBA 3GELA 4L28A 4C30A 1CE8A 1OR8A 4UVDA 1B6TA 4YP5A 5E4YA 4EO7A 3GPBA 3BSYA 3EX7C 2JHPA 3STUA 2IVZA 2PMDA 1CVRA 1WY7A 2XCQA 4JB2A 5AJWA 1Q0QA 3WB2A 3KWLA 4TS9A 3R5HA 2ZIGA 2PRIA 4KPYA 2FK7A 2WK1A 2P40A 1JTEA 3H8WA 5FPPA 4YRJA 3ZWQA 2RARA 4RAOA 3W5CA 2IRWA 4MVXA 3E9EA 5BN3A 1PS9A 2B1IA 2UAGA 1GNLA 1OKKD 3FVRA 4UTRA 1HNXB 5IJXA 2YMQA 3FCSB 1OF1A 1HOXA 4M1ZA 3RYIB 3EZ7A 3W8EA 1Y4UA 1R15A 2QLMA 5L45A 4JIGA 1QHXA 4R83A 4ZEVA 2EFGA 1Y6JA 2PLAA 1QS0A 2GD0A 2VYFA 3GQBB 3L41A 3JRNA 4G8DA 4K1LA 5IU6A 1NMQA 2VDOB 2X9QA 4UCFA 4TVSA 3HN6A 4JKOA 1RP1A 4KIWA 2CVPA 4PRKA 4V38A 4YFYA 2F7SA 3WHIA 3OAAD 5HRUA 5HSGA 2WHPB 1MC4A 1UODA 3FTNA 3OEED 4ND8A 4ZYZA 4ARUA 1L7EA 3RYHA 2O5VA 4LWQA 3DQPA 2FWRA 3KEOA 3H1GA 1ZGCA 4NCXA 3FHLA 1OAOC 3WNDA 5KPDA 1Z5ZA 4WCFB 2ZWPA 2NPFA 4KMOA 1GD1O 2HA2A 3OY7A 2W2PA 3SSAA 1TM5E 2Y8EA 4GOKA 3U7QA 3ZW7A 1SVLA 3QFSA 1N0IA 2ZUWA 3W3ZB 5DYWA 1FDSA 2IYAA 2FEMA 3N8HA 4FGJA 3OBBA 4IHKA 4TXMA 3NIGB 5ARDA 5A7FA 4MDEA 2GM9A 2DBZA 3VO9A 4QNMA 4YUWA 1WOYA 4KSBA 1L4KA 2NU7A 2D4AA 2OFFA 1VOTA 1GNTA 4OJMX 3PGXA 5C1IA 2FUG1 1JDVA 4F4UA 3W5BA 1WDKA 2Z09A 1XTKA 3GO4A 3JQ6A 4RAQA 3DP9A 3HVIA 3BFJA 3K1YA 9MHTA 1XTRA 3KPUA 1EP2B 1QTRA 3BXZA 2WHQA 1RZRD 3K8OE 1CQJA 3ER8A 2JCSA 2JIQA 1BWQA 1LTQA 5C35A 3X1YA 1T3SA 3JQAA 4BCDA 1MRSA 4YDSA 5EMKA 3OH8A 3AC0A 1U5AA 2KBFA 3ESCA 2X1VA 3X1XA 1N1DA 3VPXA 3I5YA 3JQEA 1WMFA 2CJYA 2YJNA 5CK4A 3VX4A 1GITA 3UJNA 2FRDC 3I64A 3ETGA 2IF2A 4N3GA 3OQHA 5ALUA 5IC5A 5T4EA 2HLDA 2ZLBA 3IAEA 3M6FA 4QXAA 4DCTA 1QO7A 3S8EA 1KOFA 1V6AA 4PWZA 5ALDA 3WQSB 1U3TA 1L4GA 3DQQA 4F6RB 2WICA 1JDSA 3D1JA 3L7OA 1KHTA 4O59O 4QWMA 3RD5A 1MIOB 4NULA 4KRYA 2P3LA 1VPTA 2YQZA 3ZVRA 1UOOA 2BFEA 3ASVA 4PO1A 3WFIA 4MI1A 2PG3A 4I3HA 1PW7A 3WJ1A 1JTFA 4QQKA 4XPZA 2PV0A 1C9NA 3QU4A 1HTTA 3GUUA 1S1MA 4ZI7A 2PSFA 3E5RA 4CQLB 1XZAA 1NVVQ 1NXOA 5FLYA 4YN3A 4FLMA 5EXSA 4DSUA 5BVHB 5KYYB 3FUXA 4GPAA 2XMBA 1VMKA 4DEXA 4JDPA 4O1HA 5IYZA 1R8JA 3PKZA 4Q93A 5JYCA 5I8WA 2WF9A 1ECBA 3AV0B 1ANKA 1ZXBA 3VXKA 4WZZA 1Z06A 5AUQA 1GUAA 3D7SA 2ZIXB 5I5GA 2FPIA 2O6LA 1BOOA 1TJ5A 2R7KA 2CCKA 4ABTA 4UHCA 4AX4A 5COAA 4EHJA 1S2MA 1UBHS 4JBXA 2VH5R 5KIAA 3V1YA 4TGLA 4F1KA 1C4XA 3SQOA 1E2NA 4EY3A 2RHBA 4NYJQ 3V00A 1UAAA 5DP1A 3L8GA 1EDOA 2ZYTX 1NHWA 1W0JD 1OYYA 2XA9A 1A9RA 3EZFA 4Y2SA 2P5TB 3GCXA 4DYDA 3OA2A 1OIWA 3WB9A 3DZGA 4YUAA 5JNLA 1Y9DA 3OQIA 1YS2X 4KXQA 4PZUA 1X13A 2C5GA 4R8MA 3WSWA 4CL0A 2HV8A 1O6GA 3K9WA 3OD5A 3EWIA 1TU0A 1QFSA 2FR1A 2K4MA 5K4HA 2OBLA 1KK1A 1OTHA 2J32A 4Z3DA 2WTBA 5AVQA 2PU7A 2XMDA 3KHKA 3WADA 1L5HB 2IYNA 2JKZA 4Y6QA 3WRVA 3B70A 4GOXA 5L7TA 1RZUA 3G17A 4XGIA 1PD0A 3TSYA 4YMUA 2IV3A 1SXQA 4BFSA 1KYQA 4LVUA 2IOHA 4R54A 1KQNA 721PA 4P5EA 4XB1A 2I67A 3ED1A 4EG1A 3HDVA 1WM1A 3JYLA 2CJXA 5A0VA 4K2AA 3K5IA 4WINA 3EISA 4EYKA 4M1WA 3G23A 4ND2A 2PNJA 3T5GA 1SOVA 4EH1A 3H1AA 1NDUA 3RVNA 2HTEA 3R4VA 4WLEA 4NOMA 3LPDA 5LIPA 4Z9XA 1G8SA 4R9NA 4B6SA 1N5MA 1TL7C 2WA2A 4MV1A 3K71B 1Y33E 1M8GA 4DQDA 2C2HA 3UQYS 2PJDA 4QYWA 2Y4OA 4POAA 3U80A 2PA0A 3JZIA 4EMTA 4IIJB 7GPBA 1WMSA 2J48A 1YZQA 3K0KA 3B85A 2FMUA 3MBOA 2VH1A 4KN6A 4US0R 2YDXA 2EJWA 2YYAA 3IKJA 3NAGA 2DFKB 3VTZA 2C9BA 5IZCA 1N6LA 1QXSA 3VMMA 4F9GA 2B8TA 5TPWA 1M8JA 3X1JA 1J9GA 1YB4A 2ZI4A 4PZ9A 3VVCA 2HHLA 4L2IA 2DT5A 3NRJA 1NBWB 3W9YA 3ZKAA 2H31A 3GFBA 5DXFA 3CW8X 3KXIA 3MRVA 4WXEA 3LYLA 5GPBA 5FUWA 5KU7A 3DCIA 4CGZA 1L7BA 3KKKA 2O3RA 1FY2A 1QPGA 1U2DA 2ZJFA 1F1JA 2I2CA 3I5MA 3R5JA 4NOLA 3ROEA 3L4KA 1U1GA 2HJSA 3OQ1A 3E23A 3QVVA 1NVVR 4QLOA 4ZFNA 1JWBB 4M0UA 2QTCA 3HKDB 4PC3A 2RAPA 4HWOA 4A10A 1UKYA 2X2OA 3HDTA 1LV7A 3L84A 4ENUA 2Q3MA 4LMRA 3S8YA 5H8WA 2VDVE 4KIJA 4WW0A 4BVEA 4NFLA 1PGQA 4BB9A 4JBWA 2VP6A 3WDLA 1URPA 1GG2A 2X8JA 4Q4JB 1DPFA 1HTBA 1LF0A 2VRCD 3SVLA 2PVSA 1OAAA 2FG7C 2R6DA 3IAXA 3LC1O 4RXTA 3ESRA 4CEHA 1O6BA 3OM9A 4ZOCA 5GGXA 4F6LA 5HJEA 1CQZA 2YRWA 3OU2A 2WIBA 3T1OA 3GLIE 4CKWB 4QJIA 4E2YA 3L3BA 3ZPXA 1PX2A 2YMMA 2ORIA 3Q2KA 4HQ0A 3BRQA 1SBIA 2V6GA 3A6JA 3CF2A 3CEAA 3T0IA 1B16A 5CEFA 1AKWA 4NYJR 3QKUA 4YP7A 3S2SA 3SJZA 3VO2A 4B7XA 2P2GA 2XMPA 2ZKLA 1CQWA 2B4RO 2C20A 5FOSA 1W36B 1KORA 3I1YA 4JFAA 1T2AA 1OMOA 2V6MA 3OZUA 1RT9A 5DSTA 3VR3D 3EFHA 4AF6A 3V4FA 3AWDA 3HVRA 4KI7A 3UK0A 4MVJH 4NV0A 1TXGA 2QJWA 4EKYA 2J3HA 2Z5FA 4FFSA 3SBOA 3S0JA 4E51A 1L1EA 5IF3A 2H51A 2BV3A 4JT8A 2HA0A 2JGNA 1PLKA 2X13A 3VSDA 4OQDA 2AWNA 3VI3B 4QDJA 1BYIA 3O3NB 4H4DA 4BNDA 1QB7A 1Q92A 1MC5A 1XXHA 1W9MA 2NZVG 3K8YA 4WKPA 4E5SA 5KX5F 2GEJA 4KBFA 3VYTB 2Y0CA 4F84A 4ZI2A 1ZGGA 1W4CA 5CA1A 2FSHA 3EOAI 4PO3X 1BVUA 5EN4A 2QTBA 1JQ5A 1QQ6A 2C9DA 2QRZA 3QRWA 4HFJA 1HZZA 4NJEA 2O2HA 2C9OA 5DB4A 3WFJA 2HT1A 1MOQA 2W2VA 4RHEA 4FCVA 3WZMA 3GFPA 3E9ZA 1RWQA 1VCOA 1RU3A 5LBIA 4DREA 1ZFNA 2G28A 2XQVA 1RP7A 2OC9A 3GJ8A 4AZVA 4YRAA 4QDTA 5AK4A 2X58A 3VNAA 2Q5LA 4LY0A 4XCVA 5SY6A 4AC9A 5A02A 1QKKA 5CYGA 1V4BA 1Q11A 1QG0A 1DRUA 2XUIA 3O8CA 4QREA 1CW2B 1ZZEA 2XTAA 4XB2A 1G20E 3TI9A 5DNCA 3BIXA 2PWPA 3CNQS 4WBNB 3VM6A 2IH4A 3EULA 1QYRA 3OUUA 5FUQA 4QBFA 2FOXA 2WE7A 1UFKA 4W99A 5D2CA 3L7CA 1ZM3A 3SD7A 5AVUA 5DYIA 2CHEA 1L4UA 1PLLA 1JFFB 4ZP1A 4J0CA 1HH4A 4WLOA 4GZLA 2GK7A 3FOCA 4JGGA 4G63A 1ADCA 4DM4A 5MDHA 4KWIA 2AKYA 1UJ5A 2BISA 3CNOA 2AOUA 3UMVA 4DANA 5DK6A 1NVUQ 1XI2A 3IUSA 3FKJA 4KFRA 3D8SA 2EW8A 1RPTA 4L8VA 2QQFA 4PRYA 2O7VA 1RBMA 4M0KA 3ECSA 1FBTA 3KTAB 5JWOA 1V16B 2R6JA 2XA1A 1XTTA 2A0FA 4EYEA 1UJBA 4F3TA 4JYCA 3DTVB 3PQ7A 1QH9A 2YJ6A 4KXNA 2FPGB 1PF7E 4RC9A 1YQGA 2NXJA 3EGCA 3AU9A 4EA8A 1GZUA 3CNHA 1N0WA 3GEIA 3N75A 2YWFA 1SQ6A 3NYQA 4JC4A 4CKCA 5ICGA 5KREA 2H1OA 2GESA 1W0CA 3ZWKA 3RSQA 1SY7A 4X90A 4W5NA 4RHXA 2W98A 4U9HS 1PJ4A 4F46A 3A14A 2OORA 1M8FA 3TW8A 3FVVA 2C3MA 3DMTA 4KO8A 4HJXA 3UMGA 1XAHA 5K0CA 1E1RD 3C98A 4MTCA 4L5AA 2C5FA 4QTUB 2EL7A 5CRIA 3UA4A 2CVZA 2RH8A 3LYAA 4ZOLF 3OP1A 4JJZA 1PKXA 5AVZA 3OD1A 4X62B 3KFVA 1D6NA 1QDLB 3E82A 3G0HA 2WIFA 2ZR9A 4JGBA 4KIGA 3ONDA 3TMKA 4PLHA 4D0LB 2CVHA 1P1HA 1WDWB 2XD9A 5BWCA 1KNQA 3AM3A 1CLEA 2XSZA 4IYJA 4H6PA 4N6OA 4NATA 1JKMA 1IY9A 3P2YA 3V8NA 4CKEB 4ZIRB 1E6CA 5DGTA 1ZCAA 1G291 2A7QA 3BEDA 3TOXA 3SDBA 3UJPA 4BVBA 1N7GA 5A6VA 5KWVA 3SEZA 1T5LA 1X8XA 1EWVA 1P2GA 2YVLA 2P0AA 1DMSA 1I33A 1T8RA 3OUTA 3SFVA 2XKBA 1XWWA 4DCCA 1I1QB 2PHZA 3H99A 4AKIA 4AF8A 2BGIA 2BGKA 3T9DA 1OGIA 1QE0A 2P9QA 4R1TA 3AWIA 4MV3A 4D9EA 1VMEA 4DBLE 3L7YA 3OWHA 1J5EB 1XKXA 4JJEA 4MHOA 4YUYA 2I4NA 2ZBQA 5FR2A 3SZLA 5HP4A 3PDCA 1RTKA 2R00A 4FZ5A 4NU6A 4M38A 5TARA 3E03A 5CLIA 2PGIA 3R5TA 5SZIA 2OCPA 4X91A 1VRWA 2NZJA 4H3VA 1CY7A 1MB4A 1AS2A 1T8PA 5AW8A 1XRSB 2Q4RA 1VBMA 4CL8A 4LDNA 5IASA 3TOZA 4BFYA 3VDMA 2XIJA 1KIAA 3BMNB 1SKQA 2LKCA 1GPWB 2C9ZA 1Z36A 5DTRA 1NFFA 1QKIA 3PSAA 4MUHA 4C78A 2X6QA 1UBMS 4BHTA 4XUDA 3KJXA 2QX6A 3CWQA 1IB6A 1VLHA 1ADGA 3QY0A 2VPPA 4YJHA 1YT5A 2A1UA 1LLDA 4RIEA 5EZSA 3N5CA 2YV1A 4MQMA 1NJSA 4KRFA 4RPJA 1XZLA 4ZCIA 4DMLA 4XVRA 2BH9A 1E3TA 4MVJM 2R6ZA 3WLEA 1THZA 4B3CA 5AI4A 3GVIA 1ABBA 3ULKA 3PU6A 3EXHB 3ET5A 4H3SA 4A2PA 3THWB 4RK6A 1ML3A 4K88A 4Y2XA 4PF1A 5AKKA 4NU0A 1LW6E 3AHHA 1ID1A 3OQJA 4E03A 4EFDA 2CLSA 2AOTB 4QVKA 3UAYA 5HKBA 1SVUA 3GUCA 1OLSB 3NEPX 5B7GA 2Y0PA 3BZUA 3ZYCA 5JZ9A 1T3HA 1J33A 1WW3A 3PTAA 1E2BA 1D0VA 4FI3F 2ONYA 3GJQA 3IR5A 4BEJA 5FWXB 2VCHA 2JIOA 3B51X 3H2HA 4EYSA 1H4TA 1W4RA 2JL1A 5CDSA 1YC5A 3OZWA 4QG3A 5DW0A 2G7ZA 3KKPA 1GL9B 2BFCA 2AW3A 5HCNA 4GI2A 1H42A 2IXGA 1YJBA 4FXOA 1M6EX 2X5KO 3PVZA 4YP1A 1BGWA 1T0JB 2DKNA 4LHZA 4ZC8A 5JO0A 3AFIA 1SCKA 3D3WA 1D4FA 4HB3A 1X1DA 3OJFA 4HQ6A 2IU0A 1EU1A 1TM7E 1VM6A 1HE8B 2OKCA 1TIBA 1PQ4A 3RLIA 3C6KA 4W5TA 3OPQA 1WHTA 4WLUA 5FPYA 3V1NA 2R8ZA 3WSTA 1ZLXA 1ZK0A 4QDKA 1PWXA 3NDIA 1TTQB 1YIAA 4XPIA 1H5NA 4A8JC 1LK7A 1ZOLA 1NXTA 3K5PA 1VA5A 1HC7A 2YQ5A 1CS4C 3LWZA 4GWGA 4L3VA 3TM5A 2ATIA 1OA1A 4ZXFA 1JA0A 2JGFA 3BJIC 2ZATA 3LP8A 3MEQA 2A0XA 5K3SA 4Z9YA 2F55A 1M2GA 4KDFA 5JZSA 1ULBA 3E9CA 2YXEA 1ZMXA 5B4UA 2AXNA 4D0SA 3MT9A 1B41A 3ONEA 1W35A 2B7BA 3P2EA 4O2BA 5D00A 4KTTE 5CW2A 3GEGA 1P2DA 1XDSA 5DHRA 2NADA 4ARZA 4QOJA 1M6YA 5IC6A 4AJJA 2VXYA 1NXQA 2E48A 1VKZA 4MMXB 5SYNA 1NNI1 2H18A 4IDQA 4CEIB 4C0XA 1RAFA 2AIRA 3TO5A 1HSOA 2FUEA 3IVRA 3UOWA 2P2ZA 4N3NA 4FYKA 4LRXA 4L9WA 3DS8A 2ZR0A 1XU7A 1JHMA 4H7HA 4WFQA 2G07A 1OXXK 3OG9A 3KKMA 1I9GA 1N33B 1W47A 1AUXA 2PX8A 3FJOA 2Q27A 2ZR8A 5JARA 2XUHA 2G09A 3LK6A 2YS7A 1WWKA 3AI3A 4BE4A 4FMDF 4UPVA 4HDOB 1XYYA 1DNPA 3AHDA 2E37A 2AG8A 3DXFA 5F9HA 1L7VC 1MAVA 1PJ8A 3UW3A 4J0KA 5F2KA 3MWEB 2O2IA 3E1SA 1M34A 1RWPA 4Q9NA 3BEOA 3Q87B 3U81A 2C4KA 3BF7A 2PM8A 2GEUA 2VKQA 4U3JA 3F6RA 5KSZA 5FLXA 1G64A 5T4HA 5ERGB 2XB9A 4MZXA 2CV0A 2VUSA 2I29A 2XCOA 3O7WA 1Z63A 1TIKA 5HK9A 4GXRA 4YT8A 3DFFA 3L2OB 4FDAA 2C04A 4I6JA 5DCUA 2YBDA 3CA8A 1DZ3A 1A7AA 1LPBB 3E3NA 1Z47A 3P0HA 1KDRA 2GD2A 5BQFA 5CB4A 2RDMA 4M60A 1R16A 2OHVA 3IT1A 1HYEA 2WSSD 1IOZA 5B30A 2C5HA 5KYXA 1GDTA 3LCVB 4B79A 3C1UA 3WRWA 4TL6A 5FA6A 2QRUA 3FFAA 1UMBB 1BH6A 1XDBA 2B6HA 1GNVA 3K32A 4BATA 3F7NA 5KYVA 1E9VA 4B3BA 3HYSA 4GC5A 3IMCA 1Y9AA 1L4NA 4NZOA 1UQUA 4U02A 4MJ7A 2YIJA 1XR3A 4P4LA 4HGOA 1VB3A 1XD2A 2BTQB 2NZ8A 2ZBPA 3GP3A 5CGZA 5JCJD 2EBUA 2LW7A 4JQZA 5KBYA 4G5GA 2XXAA 3KZNA 2W6IA 4JLPA 1TQDA 5E4JA 3NO4A 1TW3A 3IUNA 3LCMA 5K3DA 5I7OA 5JAIA 4ND4A 1H2RS 2XWBF 5JS8A 4UNQA 1SCUA 3FRHA 4JR1A 4CUKA 2VJLA 1H69A 3IKMB 1Z0DA 2RD2A 1AS0A 1ZN7A 3DE3X 4V0LA 4MEJA 4BIIA 1YJCA 4LQ4A 5ESXA 1DCFA 3GJ3A 3PQ6A 4A23A 3FVTA 4E11A 1DC5A 5B4VA 5F23A 5CYFA 2QPLA 1UBFA 4JLKA 3M1AA 4ZHQA 2OBFA 3ILSA 1TEZA 1WCIA 2V7BA 4LMAA 4HAVA 3S2YA 1B73A 1AQLA 1OYWA 4LCBA 3R24A 3RB8A 1WQ1R 4WE3A 4WGFA 3ZK7A 4AS2A 3VR5H 3PUYA 4M9QA 4BGDA 1BDMA 3N28A 2IUTA 1SUWA 3LZ6A 5BWNA 4XM0A 2C4MA 2C7VA 4GI3A 1RLJA 1W5BA 2X9VA 2FTKE 3ZH2A 2OKGA 3QYAA 3F7OA 5B1HA 4RZSA 3MCWA 4OAOA 1VIMA 3K09A 4QLBA 3AVQA 2VBFA 4NBUA 4CG0A 5JW6A 3AVYA 4P4SB 1N2ZA 2DFVA 3COSA 1D4OA 3AEKA 4REQA 3GJTA 5J2TB 3BBPA 3V9AA 1EXVA 2XE8A 4CN9A 3Q98A 5LQNA 5K45A 4MQUA 2YUIA 2Q7OE 2UUOA 1P0QA 1X3SA 1UBJS 4H60A 1JR6A 2RG7A 2R8OA 1KI4A 1MXHA 1XTUA 4L8YA 4WX2B 1JKIA 3INGA 1JU3A 3L4BA 1NW9B 2ODNA 3VC1A 4E94A 5KWJA 1DEXA 3CU5A 2VWHA 5B3JC 1O7JA 4M89A 2AVDA 3D6JA 3LW7A 2X19A 2QRQA 3HLYA 2IE8A 4ZYWA 4KR3A 1WA5A 2HA6A 3Q9NA 2WAOA 3I23A 1V3TA 4PYOA 2ATVA 1Q91A 1JQ3A 2GZAA 2NZXA 4EMUA 4ON9A 3UQZA 5HJ2A 3BMXA 3ZZUA 4LIPD 4RSGA 1VKOA 2CFRA 4YI3A 1GYRA 2GEBA 1H1LA 3LT5A 3PTZA 1NDHA 4CFYA 4JODA 3E35A 4I5IA 3QXSA 3HGMA 5IJ0A 4EDFA 1KIFA 2FWPA 4MTLA 1ZNYA 4Z4FA 4G0QA 3I04M 1MP0A 5LFAA 2CB9A 2A9FA 5JZOA 1PQUA 2QEQA 2CVFA 2H1VA 4JU8A 2VSYA 2BRUA 4CODB 4KKXB 3R3ZA 4G8CA 4RLQA 1ECJA 5JR3A 3Q2IA 5J2UF 4Q7QA 3K96A 5E2AA 3ZGVA 3C3YA 5LPNA 4G0NA 2OAQ1 3TPZA 3VPGA 1EVEA 3O3CA 2I4RA 1PK8A 4GI1A 1Z3IX 3CB4A 3ZHQA 4C0HA 3BKXA 2FB9A 1NLUA 4H16A 2MJLA 1QRAA 5IVDA 4QNNA 4C4ZA 1NI3A 2Z1MA 3DMYA 3C1AA 3I4LA 4TYNA 4KHPB 3G7UA 1WCYA 3T3DA 1JJBA 1EXWA 2G9UA 3IIJA 3PUHA 4X7MA 2HSZA 5HS4A 4CCWA 2RC5A 1EK5A 1IY2A 2R7NA 1BW9B 1JX6A 4EQ6A 1YKFA 4WXPA 3SC6A 2XRYA 1NC1A 3A58B 3B5EA 4WXHA 4YRTA 4BMZA 4DR4B 1YS6A 1QZUA 4ZC1A 2JIMA 5HVNA 1H9AA 3GNSA 4R1NA 1XZJA 3MERA 1PG5A 4C4SA 5FWNA 1JB9A 2FR8A 2J1LA 2J3KA 3IO3A 3MGKA 4Y6OA 2NUAB 1F6DA 1LVHA 4DY4A 5IKOA 1F3LA 1NP6A 2QAGA 5DFAA 3ENKA 1O8CA 1U8AA 4BKRA 4MW5A 4UBLA 3DVAB 4EKDA 3WO0A 2GCOB 3FWHA 2OHOA 3EF3A 2VTBA 1SD5A 1JG6A 3D0KA 3GV0A 4CU2A 4PZLA 3HY3A 5BYBA 4LZZA 4LJAA 4KQ9A 1YE3A 3W2FA 1UDCA 1YHNA 1GGJA 1G5QA 2P2NA 2Q5EA 2XAAA 4TV8A 5JAUA 1M72A 2PGNA 3C41J 4HRVA 3C43A 2HK6A 3CMMA 2C84A 2NSYA 4Q4HA 4AWAA 3FDZA 4L50A 4OK3A 2EW2A 4YACA 4RO0A 4RU1A 3ZWVA 3Q3IA 4G1FA 1VSTA 3G9QA 1A8PA 2JFYA 2VK8A 2DT8A 5GJBA 1C7RA 1CZHA 2GZ3A 5JH7A 3F9RA 4N8EA 4B8WA 3KZKA 2O14A 1DCTA 1PR3A 2ORYA 4D25A 3FXAA 1ISFA 1NULA 3LPNA 2WWYA 1CP3A 3OQBA 3BK2A 5LB4A 2V97A 3GEDA 4FX2A 3EXAA 3ZH9B 3KVNA 5JS2A 1X2BA 3JPWA 2J5XA 1RVDA 4HNAA 2IV7A 5IJ9B 4BO3A 1ACMA