3U7RA

Ferb - flavoenzyme nad(p)h:(acceptor) oxidoreductase (ferb) from paracoccus denitrificans
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
182
structure length
182
Chain Sequence
VKTVAVMVGSLRKDSLNHKLMKVLQKLAEGRLEFHLLHIGDLPHYNDDLWADAPESVLRLKDRIEHSDAVLAITPEYNRSYPGMIKNAIDWATRPYGQNSWKGKPAAVIGTSPGVIGAALAQARLKNDLLHVGTVMMSMPEAYIQWHAEAYAADGSVTDEKTAKFLQGFVDAFVDWIEKHGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NADPH-dependent FMN reductase
publication title The Structural and Functional Basis of Catalysis Mediated by NAD(P)H:acceptor Oxidoreductase (FerB) of Paracoccus denitrificans.
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 63
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3u7rA00
3N39C 4YAOA 1NNI1 2QMYA 4CF6A 2D5IA 2B3DA 3JSXA 3W77A 2QX4A 5TGZA 4GR9A 5B3LA 3K1YA 4QOGA 1ZWLA 1OFVA 2N1MA 3W79A 1E5DA 2W5UA 2MOKA 4DIKA 2QR2A 2R96A 5LJLA 1CZUA 1X77A 1BVYF 3U7RA 3F6SA 2M6RA 3N3AC 2BF4A 3B6MA 3ESZA 3RPEA 3GFRA 4Y9UA 1XI2A 1DXOA 4YAWA 3OWHA 2BZSA 2X2OA 1FLNA 3L9WA 4ZVKA 3NFRA 1GG5A 1FTGA 1T5BA 2QWXA 5LVAA 3UXHA 3F6RA 3OJWA 1V4BA 3G5MA 3QFCA 1AKQA 1C7EA 3O73A 1SG0A 3HA2A 1RLJA 2Q62A 1AHNA 1XYYA 3W78A 2M6SA 4QOJA 4OXXA 2QMZA 3LT5A 1QR2A 4D02A 5BUCA 1TIKA 1QHEA 4YAUA 1CZRA 2AMJA 1SQSA 4NULA 1KBQA 4C76A 3KAQA 4U7FA 2V5VA 1JA0A 4Y7CA 5NULA 4R81A 2WC1A 2FZVA 1YCFA 1DXQA 4FGJA 6NULA 1OBOA 1YCGA 2ZKIA 5FX2A 3FW1A 2Q9UA 1I1OA 4QOFA 4ESEA 1T0IA 1C7FA 3OX3A 3FJOA 3KEGA 2ARKA 3ESXA 1WSBA 5F51A 2FX2A 1XYVA 2HNBA 2Z9BA 3ES9A 1AKRA 3S2YA 1RCFA 1AG9A 5LJIA 4C14A 4YQEA 2MTBA 2QX9A 3LCMA 2MWMA 3NHYA 3HR4A 4ZVNA 4LTNA 1FLVA 4XDGA 4Y9RA 1D03A 5NLLA 3D7NA 5ULLA 3OWXA 5JROA 4LA4A 3EDOA 3OJXA 4N9QA 4CETA 3OVMA 4HS4A 4J8PA 2BMVA 1CZLA 4QODA 5EA2A 4DILA 1J9GA 3NHSA 5FA6A 1FLAA 1YRHA 5EMNA 4PTYA 2OHHA 4F8YA 4PU0A 1D04A 3FVWA 1RLIA 3NHLA 4HEQA 3QE2A 3GFQA 4BMPB 2F1OA 3NHJA 5B3KA 4GI5A 4U7GA 1ZWKA 2KQUA 2GSWA 3GAMA 1FVXA 3OX2A 1KBOA 4C0XA 1CZOA 3N3BC 1YOBA 3ESYA 1YDGA 3FX2A 3HLYA 4S24A 3P0RA 2FDXA 1FUEA 2FLVA 2Z9CA 2HNAA 4N65A 2OHIA 4GQIA 1H69A 4YAFA 2FZ5A 1TLLA 2KLBA 4ZVMA 5LBUA 3OX1A 1AKVA 1H66A 3O2NA 1F4PA 2HPVA 2BN4A 1DX9A 3EYWA 4PTZA 2V5UA 2Z98A 4FGKA 4ICIA 3NHFA 2XODA 4H2DA 3F90A 4N82A 4M0CA 1AKUA 1FX1A 1AMOA 1CZKA 1J9ZA 2QX8A 2X2PA 3KLBA 1J9EA 4NLLA 3NHUA 1AZLA 4LTMA 1CZNA 1WSWA 4YALA 1D4AA 2FAXA 3L9XA 3GFSA 2RG1A 5EAIA 2BPOA 1ZX1A 4QOEA 1JA1A 5LMCA 1BU5A 3KAPA 2FVXA 4QOIA 3TE7A 3W7AA 2FOXA 3SVLA 5F4BA 2XOEA 1YCHA 4C0WA 2OYSA 2V9CA 2R97A 1QBGA 3K20A 1AKTA 5F12A 3UXEA 3FNIA 5LBTA 1XT6A 3NHWA 3NLLA 4XDHA 3R6WA 5A4KA 4ZVLA 4U7HA 5FUQA 3QFRA 4FGLA 4LAFA 2FCRA 3B6JA 4H6PA 1FLDA 3TEMA 2QX6A 1VMEA 3NHPA 1J8QA 2A5LA 3ZHOA 4QOHA 2Z9DA 4FX2A 5LLDA 3NHRA 4DY4A 2MT9A 4LTDA 1CZHA 1B1CA 1QRDA 3B6KA 4BMOB 3NHKA 1RTTA 3TZBA 3F2VA 1AKWA 3U7IA 1YKGA 3B6IA 1OBVA 2OHJA
chains in the Genus database with same CATH superfamily
2PMFA 2G63A 3EVZA 4R1MA 1N3LA 1ZC3A 1RP7A 3KKLA 3STTA 4GR4A 1GYRA 1VHTA 3N39C 4O2BA 3Q3JB 2VAPA 2YW9A 1K2VN 4X95A 7MHTA 3A37A 2KBEA 3F9IA 4K2AA 4URZR 4ZVUA 2ZWOA 2CHGA 4MLDA 4PS1A 3HKCA 5JCJD 2BEWA 3DFIA 1FBTA 3JZIA 3R0VA 5D01A 4HH4A 2O06A 3DEYX 5IM4A 3DPUA 4NICA 3EOAI 2XQGA 5DNUA 2BVNA 1YI8A 3CXRA 2JIBA 3GD5A 3QWFA 1B8UA 2EG9A 2IY9A 4NVRA 1X7ZB 4PIVA 1JQKA 2DT8A 4CM7A 3IR5A 5LP1A 2VUIB 3FPBA 2IVFA 5DOVA 3LA8A 3LY9A 2OV2A 4NJOA 4P86A 3HM2A 1AF7A 1NBHA 4YJ3B 1P4GA 2R96A 2FMTA 2FQWA 1BJTA 1MO4A 2ISSD 3L7LA 4I1UA 2WHXA 4WZAB 1JHQA 4M60A 1XQWA 3CZ9A 3PGXA 3ND9A 4JIMA 2PGJA 4BQRA 2VYNA 4IG9A 3KTOA 4FYVA 5B7PA 1E61A 4LOJA 3QVGA 3F6SA 4RESA 4WZAA 5KTYA 1UEJA 4W5JA 5DWVA 1F17A 1SFRA 2PUAA 3TZQA 2VF5X 1K92A 3JWHA 3L4EA 4CQMB 3KOOA 5E0OA 4BYGA 1UBJS 3CNNA 2Y66A 1SHLA 4WPGA 5M7EA 1VMAA 2HDHA 3H0KA 1PWZA 3L6BA 3OM8A 4OMDA 4AL4A 3D4IA 4J90A 2C5SA 2Z1MA 3K32A 4XYMA 4O29A 3CUUA 3FWHA 5IK2A 1KE1A 4TM7A 1IULA 3GLHE 3OWHA 1AS2A 1WDKA 2X2OA 3GEDA 4EKYA 4K5QA 3UWDA 1J09A 4ANFA 2LCFA 1T15A 2FMHA 1G8GA 1L1RA 1NLFA 3D6UA 3KDSE 4FMCF 4EB6A 2WWXA 3T54A 2C20A 3GCZA 2MYUA 3MERA 4GD3Q 5AKJA 3W8RA 1EFVA 5JISA 2AA3A 1J7KA 4DCSA 4EZBA 5JOQA 1OFUA 5J5VA 3UC9A 4LOKA 2GYUA 3QKRB 1XZMA 1DEKA 3I6ZA 4U7DA 3ADCA 8ABPA 1PR4A 1XRQA 3DBHA 3CRQA 2X0KA 3ZWPA 1BXKA 4BVJA 4LDRA 1N5DA 3HYCA 1CS4C 2QL9A 3HL0A 4V2IA 1N2SA 3CLRD 4KN9S 1IY0A 3EY4A 3R7FA 4CM5A 2QRUA 4AZWA 5JPIA 3T4EA 1TEXA 1TMGE 5CT9A 2CVOA 4KQ6A 1Z8HA 2H29A 4YLGA 5DTRA 4DL9A 1I5EA 1W2WB 5IN4A 3T7SA 3VOAA 1K5HA 1NRXA 4KK4A 4WCFC 2I7DA 3W5VA 2XMBA 5CAEA 3E48A 4A91A 1R0RE 3P0HA 5SICE 4CCSA 4JJEA 3EQZA 3L8YA 3JQFA 3Q40A 1UZUA 1UZAA 2NXCA 2UXBB 1BFKA 2YYZA 1KC1A 4EFKA 1CNEA 3I4FA 2ZPAA 5GIPE 3CF2A 2ECQA 5IVKA 1Y42X 3LQYA 1SQ5A 2R6CA 2KSQA 3A36A 5DLEA 5J59A 3M1LA 3QW4B 4CGYA 5BSEA 4YAUA 3P9QA 3WLLA 1UC5B 1WCYA 2OAQ1 2VT7A 2VPXA 4GKKB 5BN4A 1SVKA 5EINA 4AUMA 2QTVA 1JLLB 4ZDWA 4DDWA 1B2RA 3RC1A 2AOUA 4LBVA 2XMSA 3RFCA 3IOMA 3CF4A 1UT5A 4CMEC 1FIUA 2C5BA 1T2CA 5ED4A 3UUEA 1WLSA 1LZLA 1R6XA 4ZT5A 4FDMA 3PEEA 4TT3A 1NBOA 3CG0A 1HDGO 4IIVA 1J70A 4C21A 3CW2A 4JI6B 5H68A 1EWQA 2C5GA 1JS1X 4OG2A 3PUYA 1CUHA 1GR1A 3MINB 1RWVA 1YS1X 3A9VA 221PA 1HM5A 4IOLA 4B7XA 3ZXUB 5B4UA 1WP4A 4O4JA 4BZXA 2BZ0A 2R2AA 1DXHA 1D9ZA 4W5WA 1P33A 3AQ4A 1N6NA 4JJZA 4M2LA 3OE7A 1RAFA 3PR1A 1U7HA 5JTTA 3DXYA 3E5HA 2HYDA 3OCJA 3IJEB 5KTTA 4OSPA 5A1TA 5FOQA 1KC3A 1F8UA 3EW7A 4FB4A 5ADHA 3N53A 1K3FA 4QGGA 1HR0B 1NRIA 4H7PA 2P9QA 3RF7A 5G2OA 2XBUA 1OE0A 1WA5A 1N1GA 2WWFA 4Q1CA 1XC7A 4LECA 1RJGA 3ETHA 4MZDA 5JZOA 3OM1A 2IXAA 1C7JA 3FAKA 3QXSA 3DT9A 4EHBA 1HWYA 1OWOA 3FJOA 4FJ0A 4XKJA 3UCXA 1Q0UA 3Q8WA 4ZGBA 3SD7A 1J20A 4PY2A 3WIUA 4RY0A 1MOSA 1Y6RA 1E6MA 1IRXA 5E4TA 4YV7A 3MGAA 1T24A 4H9GA 5F33A 5TGDA 2DC1A 4H7JA 3I9LA 4NNPA 5B58T 1L5FA 1Y8QB 1V6SA 2PX8A 3DOCA 1MB0A 1POXA 4Y0AA 1QJ4A 4C4ZA 2VRCD 4KXNA 3CH7A 2RHJA 4TYQA 2JFPA 4E03A 4EYQA 1LF5A 4F3TA 3THYB 5ALZA 1DOZA 3L1KA 5HQ3B 5JI2E 2CMDA 2YVKA 1KAMA 4KGZA 3NKLA 1AHPA 4ENVA 2CNBA 3PJEA 1R9MA 3LBFA 1Q3TA 4W8OA 4ZVSA 3AU8A 3TX2A 5EI5A 1YR7A 1Z08A 3UKDA 2ZJOA 2OB2A 1RZUA 1EGQA 2QX9A 2XZLA 3LCMA 3MMPA 3KKQA 4OY3A 4G5FA 1VHQA 3CF0A 3TFOA 3P27A 4R8VA 4B6OA 2P9ZA 4L0MA 3V42A 3KUUA 5J4LA 3TG8A 3V2IA 2FEPA 2V58A 5BNZA 4W99A 2J4DA 1R6UA 4EO4A 1HDEA 2GZAA 2JAQA 1PKEA 2V7XA 3KHKA 4H7IA 1T9GR 4WFQA 2IY7A 1E18A 1H5QA 3HHEA 1M1NB 2E7ZA 1U65A 1EGHA 3GCDA 1N77A 5IUJC 5IF9A 4TTPA 3L1VA 3OCVA 1FSGA 2BEJA 1AXRA 4RV9A 1N1DA 1N5OX 3WZMA 1KH2A 1TCUA 3HRKA 3OZEA 3A6DA 4MDYA 5CLQA 5EPOA 5HE8A 1VJ0A 4ZYUA 4RLFA 5BP7A 3CXUA 1VYUA 1Y82A 1SGWA 3PDIB 1NJ2A 2VPIA 2XNKA 1T13A 2FR0A 2ZEJA 4WX2B 3DL0A 1NBIA 1T9KA 1VPDA 2FWAA 3MCAA 3OIUA 1O95D 3OFNA 3IODA 4AB1A 4BLRA 3QELB 5FI5A 1DQSA 1WB6A 3TLKA 1ULZA 4G36A 4FIDA 2PZLA 5LZ8A 3WYAA 4L02A 4F60A 3FB1A 1D09A 1FX0A 4XSGA 1MO6A 1ND5A 2HXSA 4PLVA 4RHCA 1T3ZA 5EMNA 2IPXA 1DFGA 4HNUA 5IHPA 1YQTA 1O5IA 3V8VA 4G63A 4YP5A 3QEJA 1FUIA 3BE4A 4ALLA 5LMNB 2C3OA 2A0FA 1L1EA 1OAAA 3QTTA 1CDDA 2D8AA 2Z8ZA 5FJJA 1I30A 2FN9A 3GIWA 3QUTA 1NVKA 3MD9A 2WJJA 3GRKA 3QE2A 4C87A 2ECOA 5FLKA 3MUFA 4KR9A 3HCWA 1WCIA 2RKOA 4RDIA 3V8RA 4DCVA 5M29A 4NFHA 1FP4B 2JGKA 3PDJA 5AKHA 1HI9A 4F93B 3EEIA 4LZPA 4M98A 3T95A 4U7GA 1CJVC 1ZWKA 2PSDA 2ZSBA 1JLMA 1FP4A 2E4ZA 2GD2A 2OHVA 2QL5A 3I45A 3R9IA 4BV9A 4CHTA 5B5SA 3G9TA 4L3WA 1I1QB 3QVXA 2FR1A 2X23A 4Q9DA 2ZK7A 3ZHBA 1X92A 3ZHUA 2E6UX 2VUTA 3VC3A 4EHNA 3GPIA 1F6WA 3SS8A 2XCTB 3GMTA 2O05A 1T9DA 1U2GA 3TGLA 2HWXA 4KIFA 4Q9KA 1GP2A 2M6KA 4BUZA 5IN5A 1S2NA 2GEFA 4Y2PA 1EP9A 2VDPB 3ESYA 1AURA 2P35A 3HLTA 1T35A 2H1IA 3PHBE 4H18A 3WLTA 5ECDA 2ZAGA 3OF5A 3K05A 3LUFA 4FFPA 5IXYA 1WE2A 3H9QA 3KJXA 4ABTA 2ZJFA 1HBJA 2BMDA 3V46A 1B14A 5EVCA 4BKMA 2QPAA 3GBPA 4RE5A 4RHFA 1SC4A 3T5DA 3PGKA 5IBCA 4CF3A 1J0EA 3HWWA 4B83A 4TLBA 1QHHA 1NX9A 2HNAA 1DJQA 2OHIA 1FYXA 1SA0A 5KTMA 1ZUD1 2GN9A 1G4UR 1EUCB 2AC4A 1ZK4A 2O20A 2RBEA 1B73A 3HU2A 1T3LA 3D4LA 3LCJA 3QVWA 1PNTA 3N6XA 4XIYA 3QLTA 2VUHB 1F2TA 3TJRA 1BXGA 1J4AA 1JJAA 1EVQA 1P2DA 2PWPA 3QKSA 3WHIA 5EJMA 1FNSA 2RHOA 3C3AA 1UXGA 3U19A 2Q5LA 4KMMA 2X6QA 1RM3A 3GAZA 1VE6A 4OX9Y 1NVAA 3LUKA 4K8OA 4MR8A 1XJ0A 4WLEA 4X90A 5JT1A 4ARSA 4RQAA 3DVAB 3EPJA 4P7JA 4IDPA 1Y3BE 2I8CA 2QI9F 1Z56C 3BE6A 4IJVA 2D7DA 2R5FA 2W48A 3DVAA 3WE7A 4RY8A 3R9XB 1F0KA 4RZUA 2BGGA 5M04A 2JIZD 4TS1A 4XDZA 3SIXA 1WDMA 1NG1A 4X97A 1UP7A 2F7SA 4RGBA 3IB6A 4IJUA 5K0JA 2JAUA 1N1MA 1SB8A 4O2BF 3N70A 4GP7A 2YY5A 3Q87B 3GWZA 3IH5A 4MA0A 4V38A 4J43A 4C0BA 1BX0A 1IWOA 1TKRA 2ILVA 3C3MA 2E9SA 1UPTA 1QK3A 1XZNA 2GJ9A 4GNKA 2X22A 3G3EA 5ALUA 4MQUA 1YT5A 4IDHA 5IM4F 2J9YB 5BT9A 2H18A 2Q1YA 2G9RA 2BFDA 3E4DA 1WTAA 2QE7D 3RNOA 4CKWB 3FDFA 4DIMA 3K70B 3CHYA 1YR9A 3JQCA 3VHRA 2Q8QA 4Z49A 5REQA 4G1EB 4Q9JA 3AGPA 1H2RS 4QD3A 3UEOA 3VZRA 1GR0A 5BR7A 1MVLA 3GN2A 4WK6A 3KXPA 3U5ZB 1Y5MA 1CZNA 1G7RA 3MWJA 4FI3C 3WWZA 3OZGA 1IE3A 5FCDA 4ZXPA 2XDWA 2R4QA 5G41A 1ML4A 1JJFA 1XLTC 1XROA 4N8SA 2B4AA 4ZMBA 1JP7A 3UMJA 2R00C 3JAWA 3MNFA 3MYYA 4H6XA 2DERA 3A9TA 1QK5A 4U5XA 4DLWA 3OU7A 1Z13A 2COKA 5ECWA 1AN9A 4BO2A 4CKCB 5ER6A 4RVUA 4F04A 3VH3A 5E6UA 4ZHQB 1PX2A 3IIIA 3DV2A 4DBZA 1T0UA 4M55A 1L1QA 1NN1A 1Q0RA 2I7TA 4R3NA 3SBXA 4CKCA 2CKDA 1KK2A 1MH9A 3MCVA 5L6MB 3DSRA 2MSWA 4EI2A 2X14A 4QL3A 4ER3A 4GLOA 3B6EA 1NX6A 2PGIA 1VCHA 3NVAA 2RGAA 4KUHA 3W2TA 1P6QA 3FMFA 1JZTA 4DKXA 4I1YA 4N48A 3B1YA 1S7GA 3LL4A 1VG1A 1VIAA 3SZGA 4D4LA 5AVUA 1FZQA 4EW2A 1SCIA 3LF1A 4NATA 5C8VA 2H1RA 3WSVA 5ESDA 2H9AA 3G85A 4UNQA 4L16A 1PDVA 4UBMA 1TJ3A 2IYPA 4GLBA 1R1DA 1Y7HA 3OU6A 2XKJE 4PO8A 5A03A 5A4DA 5F9HA 4HLNA 1CFJA 5EE0A 5GOTA 2ZE6A 4E6PA 4G1UC 4E2YA 3V4SA 3ZHYA 4D4GA 1ZSVA 3OURA 5CP8A 1Y7LA 2A5LA 3GZ4A 4LMBA 4P34A 5BRNA 1VBFA 2QIPA 3DWEX 4PF1A 1CT9A 4GVLA 4TLAA 4UBIA 1WD5A 3ZLVA 4IVRA 3MWDA 2BHRA 1CIJA 1R74A 1EZ4A 1A8IA 4PR3A 2E18A 4JD5A 3HHPA 1AF4A 3LK6A 4O6VA 2GXQA 4G0QA 4HNGA 3TL2A 1BH2A 4QUKA 1G7CA 4UNNA 3QE3A 3PVCA 2UUCB 3M3PA 3AV0B 4ARZA 4LPSA 1YOVB 2XWPA 3QG5A 5TDHA 5GPBA 3ZZUA 3GG2A 3NVKI 1YOVA 4HQ0A 4DSTA 2N0SA 3ZY4A 1B1CA 3Q7QA 3VC7A 2IXFA 4P6VF 1UODA 2ATXA 2JLWA 3JR3A 4QBKA 1P44A 4RVDA 5A02A 1KI3A 2YYAA 4FZVA 3QEOA 3OLVA 3DOFA 4W8GA 5IJAA 3K2IA 4X60A 4AMUA 3PUHA 2HRCA 3SLRA 2ZJ1A 5DKFA 4L08A 2KLHA 2IDMA 5GTDA 3BWEA 3GFOA 1KEEB 3C2QA 3VBEA 3LCVB 3FPSA 1AGYA 4R7TA 4JH0A 5AKKA 4FVTA 5I8ZA 1C1XB 1BDMA 2B2NA 1QPZA 1KEEA 1FC0A 3SQWA 2EVWX 3NBYC 1HNNA 1OY1A 2PMCA 4GR5A 3IPLA 1V4VA 1NBAA 4URYR 2NO4A 4FFOA 4ZRMA 2RAFA 2HRRA 5AM5A 3JSXA 1OTXA 5AJXA 4AZVA 4L8GA 3BA1A 4LYJA 1GZ5A 1P9LA 2GH1A 4IEFB 4O4JF 5AVRA 1T4CB 2JD0A 1NKVA 4DTCA 1OF1A 3L4JA 4QQFA 3BCRA 3IUBA 1KKUA 4I6EA 2BGKA 4ERXA 3KQKA 4WOPA 3ZBUA 1R15A 1JLSA 1VIVA 2JVJA 2X0JA 4IH4A 3PHLA 3NASA 5E1OA 4KFSA 1JHMA 2P40A 1U4SA 3FA2A 1PJLA 2GPNA 4JC0A 2GZ2A 1E2HA 4YCLA 1LSOA 3TRIA 3IRUA 3R8FA 4NXNB 4AYWA 4BZWA 2M6RA 2VPYA 1MA0A 2XIQA 4R8RA 5JLAA 4BO7A 3T7CA 3FDZB 4W1SA 1GKKA 2YHBA 4M6WB 2GSDA 4HRYA 3QJGA 3DNMA 2GEKA 2NYUA 3FDZA 3H2ZA 2BFEB 3M4XA 3GHYA 5IJ9A 3ZE0B 3T5TA 2J9GA 4BU1A 3I53A 3IVRA 3ZN2A 1H6AA 3NWJA 1U28C 1W29A 3ZCVA 1D1SA 2I1LA 3D5EA 1RQ7A 1XTRA 1MR3F 3QUCA 4IOMA 2VJBA 4NZPA 1M6HA 2IHTA 3EQ7A 1CY0A 1G5HA 1TT5B 3P4YA 4WESB 1DTEA 2YKGA 4Q7EA 1XJWA 5JRJA 4GPAA 3ISJA 3IBSA 1TM3E 2P2ZA 2VTVA 3JQPA 5ER9A 1UDRA 3MT9A 4RHXA 1E2QA 2II6A 2D0DA 3X1ZA 5LU9A 4D26A 4AQDA 4BQQA 3H1FA 1QHYA 2ZT5A 1V4BA 1TK3A 2YNMC 1BEEA 3O73A 4F8JA 3RRZA 1M75A 4Y30A 4TVKA 2WJ6A 1E2DA 4RJ2A 1K6IA 3E9EA 5CGZA 1M1YE 1SBIA 3CU5A 1YGPA 3F47A 3ESCA 1WXHA 4WZZA 2H1FA 1C80A 5JCZA 2R8RA 2YQ5A 2Y05A 3FKJA 2RHHA 1YHNA 2QSUA 4QOJA 1XRPA 3DBOB 4FZRA 2ON6A 3MSCA 1M1UA 2C92A 2X77A 3ILVA 2M32A 1E4VA 4KQWA 1O9BA 3K8QA 5FUBA 3ELYA 1DTWA 1WR8A 3ZPXA 3PFBA 1EH5A 2I6XA 4FS3A 3HS3A 4I1OA 2FZ4A 1E5XA 2I91A 2H9YA 2I4RA 2BFCA 5EZYA 5ILQA 1TZJA 1WZCA 3AJRA 3FYUC 4CI9A 2IE8A 2AL7A 2WG2A 2QAGA 4BE4A 4FXOA 3U3KA 3S1SA 3OEEA 1N3IA 1TQ2A 4BLOA 3GNQA 4CL2A 4HQNA 2GJAA 4L85A 3DAGA 3WLEA 4NOKA 1DKNA 1RPTA 1G2OA 1WNTA 3I2FA 5FBZA 1P0CA 4DCOA 4PNHA 2HC9A 4CQLB 5KZMB 1ULTA 4E31A 3IPRA 1LLQA 5KYVA 2WJWA 1G3UA 3NAZA 3HB7A 4FDLA 1DXQA 1QMGA 1GG2A 2R7AA 1TD9A 3MQ2A 4TTIA 4CQLA 5L40A 4XLLA 1KQGA 3KTFA 1XNRB 1O95A 2M1XA 3ORYA 1QHXA 1OXBB 1JDZA 1XZIA 4PR0A 3TKYA 4IGAA 3NJRA 4WLOA 1WB4A 3DEFA 5E3JA 5LLTA 5CH8A 1A04A 4GGMX 4MGYR 1YDMA 3MGGA 1TUBA 3WYGA 1IBKB 1UAAA 4F2HA 2XB4A 1RC0A 2UZ0A 3H5AA 1PG0A 3H2IA 1EHIA 4Y2QA 2PGAA 1U7OA 3FYHA 4LHYA 4O4HA 1V37A 4MQLA 3TLAA 4C1NA 1USGA 1WKVA 4C3OB 4L7QA 4IXTA 5HKLA 3K73O 2YC2C 2WFLA 3WFZA 4CKBA 3NEAA 1G60A 4H3HB 1L7VC 5ITSA 1P3Y1 2BY4A 1RJEA 3IBTA 4NX2A 4B40A 1ECCA 4KXQA 2FVYA 3R3HA 5A0FA 1DG3A 1NVXQ 1VECA 1YJ8A 1CUSA 3KIPA 3OQVA 1KP2A 1SAYA 3QKTA 1C7ZA 2D1TA 2PS0A 4JT9A 4Q3DA 2X5OA 1KVQA 1M6NA 2ZRGA 1JR3E 1Q15A 1OPXA 3N05A 3OHSX 1ZJYA 4BNGA 2Q3DA 3BQ9A 1SVLA 1UM9A 2DX7A 3JPWA 3PA8A 4U2FA 2VWGA 5GONB 5T67A 2RHTA 2WJ4A 3EWNA 3HDYA 3T1NA 3ENZA 3GGSA 4Q9AA 5DGTA 2HK8A 4DIUA 2HKIA 2Z1NA 4C14A 5C80A 1ZBQA 1JDVA 2JCYA 1T1IA 4YQEA 3UJDA 1FUYB 1Z35A 3T7EA 4NR0A 3WWEA 1PCXA 4YJDA 1GAWA 1YZGA 3JATB 4B35A 1QZTA 3BIFA 1ZQ9A 2ZANA 3OAAA 3QMVA 1BMFA 3I73A 3K1ZA 3RTDA 2BI7A 3QPCA 4D8TA 1JEYB 3KPWA 3O6VA 2B4TO 3JATA 2BYTA 1KH1A 4M86A 4TKVA 5AW6A 2OORA 4NDAA 1LLFA 2OEPA 3U49A 2W98A 4D0SA 1RU3A 1Q17A 2H7CA 3M6AA 1DRWA 3R4CA 4Z3KA 1RSZA 1WXWA 2IYVA 3IOEA 1IOVA 3MWEA 1LW6E 3O3OB 4WKBA 4LFAB 4Y9RA 4M7OA 3OUTA 5AHKA 4JJGA 1E4EB 3AF0A 1QFXA 3IT2A 3Q7IA 1KF0A 4RJLA 2FR8C 3ZDQA 1U2ZA 5ULLA 3W2FA 4YPOA 1PGQA 1Q95A 2C9MA 4Q18A 4DRYA 1NSYA 3F74A 3ZY2A 5D84A 3ABQB 1PEDA 2ZYUX 3U7QA 4FDVA 3W6PA 1LTQA 2JHAA 3LC7O 3C97A 3SR3A 2DRIA 3T3GA 1HEUA 2G5CA 2Y1WA 3T94A 5JVDA 5HHTA 1MUUA 1R8XA 2CL6X 2PQMA 2VDLB 5T57A 1CJBA 4X41A 4IZ6A 1SN7A 2DULA 2OAP1 2FK7A 2PUVA 2O7SA 1ABBA 4DILA 1IDOA 1GJRA 1RXEA 4B4DA 4CT4B 5K20A 1SUIA 3PC4A 3PVZA 4MKZA 1MG5A 5EIBC 1M0WA 2DFVA 5FPPA 2Q3EA 2A1IA 4KQFA 5IFKA 3M5WA 3TPFA 1YI1A 2OM6A 2QS9A 3GX1A 3OTQA 1IK6A 1IEXA 4ECAA 2BUAA 4JBLA 1XWFA 1ENZA 4V0OA 3KR1A 3CZ5A 4EA7A 3ZI0A 2NU7B 4AICA 3QVJA 3ZNNA 4HEQA 4BO0A 1IZ8A 5ENVA 3VKVA 4ARAA 3NDBB 5I4KA 1RKQA 4B71A 5HGXA 3H86A 4GP9A 3G0HA 2VP6A 1N7JA 2XTZA 3TLXA 4M8KA 4C0AC 4RIHA 5KYTA 2A5JA 4XRRA 1MA3A 1KU0A 4OB6A 1ZCFA 2AXNA 4JDPA 2FPLA 3MTIA 3I5XA 1HLFA 3GAMA 2GESA 4UVDA 1Z4QA 4HY3A 4PFJA 3RIMA 1G98A 4X71A 2C2HA 3OX2A 2RCYA 3QLJA 3BCHA 4JVOA 4UBJA 4RQBA 4LRQA 5G1OA 3D31A 4EELA 5K0EA 2GKOA 5HR5A 4P4SB 3RLIA 4RO0A 3U7GA 5CM2Z 1VSTA 4BVEA 5HZHA 4M9RA 2NZ2A 4EYSA 5K0CA 2B92A 1P8AA 2Q41A 3DZGA 3PITA 4P4SA 3ZEAA 4Z53A 3RVBA 3G9ZA 3B2EA 3QQPA 1BE6A 3GBVA 2ETVA 2QLMA 3IULA 4OI2A 5A4MS 5LD2C 5E3IA 1Z83A 5T6BA 2E5WA 3M7IA 5F77A 3O83A 1P29A 5HXAA 4RVNA 1J0XO 2XD4A 4LMRA 2C7RA 1GAJA 2PXCA 2JKYA 1N2GA 2YUIA 3MRXA 4MPDA 4RNDB 5JZVA 1E3SA 3JQ9A 4QEDA 3MB5A 2B8JA 4GQIA 4DYHA 5LQUA 3RSLA 2J1LA 1Z12A 4GUDA 2FFHA 4RHEA 3CVUA 1Y6QA 3JVIA 3G7SA 1A8HA 3QGMA 2GBGA 2CXOA 5D3MA 4JBXA 2O54A 2PFKA 2BP7B 1JKFA 4QQKA 3EAGA 1JDTA 4IJWA 2B1QA 4JJ4A 5ALRA 1M34A 1SXJE 3FGZA 4IEEA 4LOIA 3QU2A 2FX3A 2JFFA 3QVLA 1LJLA 1IZ9A 2EW8A 2I2DA 1QHNA 2MDTA 4YP7A 1ZXBA 3S2IA 3SXPA 3M3HA 2P67A 3NWPA 4D3YA 2JAHA 3IVGA 4LRSB 3LUJA 4LG1A 3AY3A 4RHUA 4XYBA 4FLFA 3S5UA 2O8DB 5EIFA 1PJ8A 3BL6A 2ODTX 4BB6A 4DCCA 1SU8A 1DO8A 2RHMA 3U4MA 1UQUA 4JN6B 2CDRA 1MF7A 2XODA 3INGA 1RDFA 1L5GB 4C5CA 1NBME 2Q6LA 3BXXA 1ZNYA 4ATNA 1JHVA 1GZSA 1O03A 1U7TA 2X5NA 4AX4A 2X1LA 3BQMB 1RACA 2WHQA 2A0XA 2PRYA 2LCIA 3MD0A 4X1KA 3O3CA 1WXIA 7REQB 1ZR2A 1XMPA 3OZUA 2UYHA 1L8LA 3UA4A 4G1CA 1RIFA 1LDMA 4HYEA 1PWHA 1JHRA 5JXJA 2ERXA 1SUEA 4K3VA 4DUPA 1YWGO 2L42A 1V6CA 5EJEA 4YCMA 1SU6A 4WBNA 4UXHA 2B3TA 1W4CA 2GTHA 3P2JA 4CKXA 1Q1NA 1ULUA 4PSDA 2PBZA 2ZTUA 1VXRA 2WWYA 2IITA 1WDTA 3I1YA 1DIHA 4RABA 3U7EB 4AYXA 4GYKA 3WJ7A 1ZIDA 5CDTA 5THXA 3W0LB 2X0EA 1Y6FA 2RBKA 1RT9A 4Y2XA 5FORA 4PO9A 4YROA 3AVTA 4YR9A 3W7BA 2HB6A 2I54A 3JVEA 1NNSA 2G4VA 3IMKA 1ZD5A 3HB0A 4YCDA 4E12A 2B69A 2QUAA 2AWOA 3L7OA 1C0KA 2FETA 2HWKA 3H2JA 3MAAC 3G0OA 5LPNA 2JAOA 4ROTA 4I5IA 3T0FA 3SMQA 1DEOA 3O4GA 5JNUA 4RHTA 4EJSC 3IXLA 4ZRNA 2FGKA 3WMXA 3SEZA 4LX8A 4KAJA 3FI9A 4A36A 2PQ6A 3Q1KA 1PDOA 1SXGA 1UKEA 1WU8A 5HZMA 2O4CA 2XSZD 5E9AA 3AOGA 3MA0A 2JIMA 5FBKA 5J4HA 1IY9A 3KAPA 4G07A 5FTLA 1Y3CE 3CURA 1JALA 1U0OC 3JD4A 3LUBA 5F64A 3UWSA 4A82A 4DSUA 2XWJI 2NXWA 3VR3D 1OTHA 1ADFA 4NNJA 1OWMA 1O6CA 1Z2CA 1ZJ4A 3AVVA 2DQKA 1ZOIA 3W5IA 1N36B 4G4SO 3WWYA 4H1WA 3FNIA 2JKZA 2JCGA 3FKSA 4MVCA 1F0PA 4CQJA 5CYOA 4ND4A 6REQB 3FGNA 1GPYA 3ETDA 3GNSA 2CJWB 3NHWA 3PG5A 2B5WA 4U0KA 1G21E 2DLDA 5DM4A 4EY4A 1J21A 2W6IA 1A9PA 2XMZA 4GBGA 4U7HA 5A3VA 3SKVA 2FPXA 3TBKA 1VLVA 4DEXA 3KZCA 5K0FA 1MW8X 4FGLA 2FI1A 1IXZA 3B6JA 4QVGA 5ALNA 1EFRD 1PFGA 1PVDA 3ANTA 5DHTA 1PJAA 1O97D 1EXNA 2ZXFA 2FRDC 4NBVA 1Y3IA 4RFVA 2J7PD 3DNPA 3WGYA 1V9CA 5CCDA 3LFTA 3FHJA 4KN5A 4NS4A 1BYIA 1J25A 2R68A 4DREA 3U39A 1YVDA 3QW2A 3H97A 2LD4A 3NXKA 3L40A 3WGZA 1T9GS 1UXHA 4OQEA 2DF8A 2Y1KA 2QHXA 3MCZA 3PKJA 3O7MA 4UFOA 5SV2A 2DBQA 3L7CA 1NC1A 2CD9A 3UIEA 2HJSA 3A6LA 3TCXB 4JT4A 1MJNA 3DFUA 4HNVA 1W59A 2P9BA 5IH3A 3OCCA 2CCJA 5E4FA 1W8IA 1D0SA 2VK2A 5LXTB 2P6RA 3CINA 4UAVA 5SY6A 1CEYA 1IOLA 3OM0A 5EUMA 5IM5A 4U02A 2VNAA 1PR1A 2LE0A 3W6OA 2O5CA 2ZAMA 1NW6A 4PGMA 3SHOA 5EZYF 2XNJA 4MVJP 3P9ZA 2H4XA 2BH9A 5FH9A 4AJPA 2EU8A 2PS1A 1ELOA 1WW3A 5KQGA 5F23A 1DWQA 3R23A 2A1TR 2JRCA 4FQ8A 3QPAA 1YRBA 4DLUA 2QXYA 1GSAA 4GGPA 2PCLA 4PXSA 1Z68A 2DR3A 2ZB7A 5BMVA 1YGYA 3RQSA 3PGVA 4XM1A 4F5YA 2A9PA 3AW9A 3PHHA 1O5OA 4OHUA 4HWGA 2BLNA 2X7JA 2BCEA 2Z3VA 4X9XA 3ED5A 1M2HA 1M0EA 3RHZA 4C0LA 5JS1A 1ID1A 2QX4A 2YZGA 1KNQA 4XVHA 1KJJA 3SKXA 2QMOA 1V43A 2WF5A 2PNJA 3LQ4A 3DGFC 1P19A 3AX6A 3DM9B 1NU6A 3FFTA 1H0KA 2XCQA 2Y6VA 3QUSA 3HBFA 3VSBA 5BUZA 2ZSDA 2CHFA 5C3MA 1D0VA 1T2UA 1VCIA 4FINA 1EINA 1BWQA 1ISHA 2DVMA 3WADA 3KE8A 4DIDA 3EIWA 3F4LA 4BN5A 3G0IA 3QWBA 1MEEA 5G3ZA 2R1TA 3CPHA 5JZBA 2YUTA 3C45A 2EKBA 2FOIA 4PLTA 1I9GA 2VR1A 2X0DA 3RKRA 4O4HF 1WD7A 3TFWA 4AWXA 3T3EA 1IHUA 1ST3A 3CPSA 4X62B 4R8LA 5CFPA 1NHGA 3N2EA 4FR0A 1U6KA 1IXYA 1AZSC 4A1OA 4A3SA 4ZXFA 3ESZA 4J2HA 4MUBA 3RPEA 1DIAA 4UCFA 1Y1RA 4G81A 5JC8A 2I0FA 1YNOA 1C1DB 5JMWA 2CK3A 1THGA 1W0KD 2B1RA 3H0EA 4BMZA 2TMDA 2YJ6A 4LNUB 2YFHA 3AY7A 5CNMA 4BC1A 3WGUA 3EZ6A 1QB8A 3HSKA 1C1DA 2Z4SA 1E9EA 4YUWA 3B3GA 4M22A 3CBQA 2NU8B 2YZ2A 2UXDB 2V3VA 4K6KA 3LY8A 3S2SA 1T4DA 3OQIA 1DXOA 3EJWA 3L0CA 2ZIGA 2R4TA 3L5OA 2HHLA 2ZCVA 1K8RA 1FXUA 4ZWNA 4IHQA 3AHGA 3EUEA 4TN5A 4EGAA 4OB8A 2CLOB 1KQNA 4KBGA 2BR4A 2IUEA 3NFRA 4PZEA 1CR4A 2UYYA 3DZKA 2PUHA 3L8FA 4K9QA 2OBXA 3KUXA 3T3HA 1E3WB 4J76A 2QB5A 4BO6A 2JBWA 1NULA 1O6BA 4MR9B 1YU9A 1Y9EA 2BDTA 4A0FA 5DNCA 4MP8A 1QH0A 2W6QA 5EERA 3JQAD 3AFOA 3I3OA 1LKZA 2A57A 2FV8A 4GMDA 4QU5A 4UDNA 3TMKA 3H7AA 3PGMA 1BN7A 5HF8A 3MUOA 2ZJ6A 3E03A 4ZOLB 4F2GA 1XMXA 2OBFA 4E5MA 5G02A 1H3EA 3G9QA 4NY1A 1ECLA 5F35A 3WNQA 1H9AA 1QZZA 1P1HA 2XCUA 1TVKA 4IGKA 1OXUA 4KH0A 4QXQA 3DO8A 2BOVA 2ZCJA 1UBFA 2VF8A 3M6XA 4YJGB 1JEQA 3ZCSA 1YBHA 3L79A 4FDAA 1RLJA 1UDWA 4NWIA 2HU7A 5A3JA 3UMFA 1HZZA 3IQDB 4XD2A 1AHNA 2WAOA 3ND6A 1E32A 4B8YA 3HYSA 4F4FA 5C37A 5LB4A 4R31A 4KP7A 3U37A 1WULS 4DPLA 5K2MA 4QFCA 5JVDF 1U1EA 5EP3A 3GRVA 5IJXA 1E7WA 2M2IA 2QN8A 1Q22A 4GKBA 4RADA 5F1OA 1DBPA 4BBZA 3SBOA 3CFYA 4HDNA 2R751 1T10A 2OFOA 5AK4A 4CCYB 2F3UA 1HE2A 2I2WA 4KI7A 3VU1A 3P4XA 2UZAA 1WHSA 2O2ZA 4EGCB 1XPRA 4PCUA 4OHKA 3COJA 5JCPA 1P0PA 4LMAA 1GPDG 1FNNA 3LBAA 4NCNA 5FTKA 2Z09A 1J22A 2Q99A 3NDJA 4BVGA 1E2PA 1RVDA 2V5VA 3DOJA 3NBKA 5DNAA 5BPHA 1F38A 2D3TA 2TMYA 3H5OA 4CMKA 5FBWB 4U6QA 2BHNA 5GINE 1VI5A 3CO0S 3JY6A 3ZHSA 3P2KA 3PCTA 1YMVA 3LBYA 2QSZA 2QENA 3D6VA 1YRAA 2AEJA 4ZANA 5AKZA 1V8ZA 5C4IA 3A11A 3FOWA 3AR3A 3STUA 3UZUA 1ZUNA 1VL6A 2D7CA 2AFHA 5DPMA 2YHAA 4LUCA 2PZMA 1TC2A 2VDJA 1K9SA 2FW1A 1ADBA 3EA5A 5C4GB 5D1NA 3U0BA 2HCRA 5IZ4A 4WKOA 4XM0A 3LGAA 1ZN8A 3ETLA 1XTQA 2DQ4A 3C85A 3FW1A 4HZIA 5CVEA 5T8KA 5GV7A 4YUAA 1EWKA 2PX6A 1UKZA 1JU9A 2BMEA 2D00A 1EFPA 3W6ZA 3ZEIA 4PZDA 4JFRA 4FM9A 3C24A 4BCCA 3MJFA 4IR7A 3TSYA 4IDBA 4MITA 1PJBA 2OCXA 2ASVA 5CVDA 4JBGA 4GL4A 1ZGAA 1UH5A 1OOEA 3JRXA 4AJOA 2OGZA 3OF3A 3CVVA 3KYJB 3DOUA 3G2JA 4HQLA 4YDQA 2YHUA 4C7JA 4V24A 4MGIR 1KFCB 1UBTS 2HBQA 2HI0A 2QE6A 3VPCA 3BT7A 5BRAA 3I05A 3B60A 3GT4A 3OP1A 4LXHA 4UQPA 3VTZA 3ZK9A 1HEIA 1I0IA 3ZU2A 1RCFA 3BAFA 2JJYA 3BHIA 1W73A 3CY6A 3V7YA 5BV2P 2D5AA 3D6MA 1Y1PA 3ZCTA 4EG7A 2ZWVA 3IILA 5K3AA 4DUZB 1U63A 2ZDGA 2WU3A 3IP6A 5H4HA 3RG8A 1W25A 2DWCA 2HF8A 3HYTA 4ARUA 1E0KA 4KWCA 3O2SB 4F4DA 3OQJA 3SJZA 4CIVA 1CQWA 1OWNA 1YB6A 2C0PA 2LV8A 3EDMA 1ZU5A 1V2GA 5GAJA 1U3VA 3H3XA 1RMQA 4B7AA 2ZIVB 3H2BA 5E7MA 1ZMXA 1DJLA 1U99A 1CQIB 2PS3A 4MP3A 5BQFA 5F98A 3QBVA 1TTPB 2G9QA 1F20A 3MC1A 2HA4A 3OPMA 1BE8A 2OC9A 4PSUA 2Y3IA 3PT5A 1UOEA 5A3QA 4IH1A 1P1IA 1JIVA 4E5YA 1E9CA 4W9NA 2HW8A 2YDXA 5I7AA 2BI4A 4MS4B 2ZJ0A 3AVOA 5THKA 2LW7A 1O94A 4IQ0A 2AYXA 2HZ7A 5F3WB 1U1IA 2WZQA 1JQJC 2FHPA 3D02A 1D03A 3F71A 3PF9A 1C7RA 5IUNC 4UD6A 1SURA 5JEEA 4U3JB 1QH9A 1P9RA 4RJKA 1KJYA 4RA9A 4CFZA 2FZEA 4ZODA 4WBNF 3D4NA 1RWKA 5HGJA 3DQQA 1X86B 5KC8A 5KPJA 1HE1C 1YE5A 4U3JA 5MF6A 1N2XA 1U3WA 3ACBA 1SULA 1MD9A 1C4OA 3CM0A 1BROA 2C96A 4I4NA 4NESA 5FOUA 3OT4A 3AGQA 4JODA 5H3HA 3CZ4A 5K9ZA 2XTAA 3DYVA 2BEUB 1HG0A 3Q7SA 5LCXA 3IOBA 4GZ6A 1KSJA 3U3OA 3NPAA 4D0GA 1ECGA 1LW7A 3HZOA 3IEUA 5ITVA 3R5KA 3D7MA 1QH8A 4QDZA 1L5LA 5FA6A 2Z5VA 2IODA 4QU8A 3RROA 1UFQA 1F2VA 1YRHA 3L0ZA 3C3BA 4NHEA 5EKUA 1FE8A 3C4VA 1LPAB 1EU1A 2JFXA 3VR5D 1JJVA 2ZSUA 5DRTA 3ACCA 3HDHA 4RH3A 1ZMOA 1GQSA 2ZAOA 3EVNA 3NHLA 4TTTS 1GPMA 1U3UA 2GAFA 3UWMA 4PGGA 3ZWNA 1IVNA 1OU0A 5FL7D 3N2ZB 4BMPB 3QF4A 5AD1A 4OXKA 4R8MA 3N7TA 2J4FA 3ZCXA 4Z0NA 2NX2A 3DUFB 4TSRA 2AFRA 3AG5A 1PT9A 2YR0A 2P4UA 4R98A 3SDSA 4CDMA 1DJPA 2YXEA 1CUAA 1UKBA 3WKDA 4CXMA 2KQUA 5T64A 4AO8A 3FJ1A 2P91A 4FZJA 1B1AA 5D51S 5H3LA 1EUQA 3BXOA 3M33A 4J0EA 3UN1A 4EOGA 4ZOQI 1QO0A 3ZU4A 5BSVA 2QRGA 1FF9A 2NZUG 3AHJA 4P8RA 4D8VA 2I2BA 3ORRA 5C7LO 3ICOA 5KSWB 5CHYA 1NASA 1B15A 1U7UA 5JAPA 4H77A 1OLOA 1F8XA 2YQZA 3WTBA 4ZEVA 3V1MA 5L3ZA 2YHIB 4NBNA 4S24A 5D2CA 2NTVA 4YMGA 5JWHA 2XSZA 1YAHA 1X7HA 4PLGA 3R5JA 1B6TA 2E48A 3WV4A 3TH5A 5JNTA 5LUAA 2K2WA 1GDDA 3GDHA 4UOQA 5KO2A 3QM1A 4J6FA 4N65A 5BN5B 4KRXA 3SHVA 3I12A 4DA0A 2PUWA 4D6XA 4J0DA 4YNBA 6LDHA 2VHEA 1E2FA 3H5TA 4EUFA 3AC0A 2PX5A 3AETB 3OZIA 4CCWA 2CFIA 3X1JA 3IDFA 3HY3A 3E9NA 3PV0A 4C04A 1DCTA 3DEAA 2ZAYA 3CR3C 4BJ1A 2IOFK 4BFTA 4HUTA 4TMTA 4YAIA 5KQRA 4KWIA 3K4PA 4D3ZA 4D41A 1J33A 1T0BA 3ENQA 4ZAWA 4WEOA 4ARIA 1AQIA 1T8RA 4YV1A 5DTEA 1YE8A 1Q0LA 3H9CA 3C5HA 5BSMA 3X1MA 3BG5A 1NLMA 2Q0QA 4DM7A 2GO1A 4JS0A 4C4TA 1GDTA 3GRAA 1R4ZA 4PTZA 2Y92A 2NU9B 3GWGA 3WDLA 4DZRA 5LSAA 5KOYA 3HZHA 2ZI9A 1M8GA 4JGGA 1DBIA 3R7NA 3RAPR 5C9ZA 1T6XA 1ZRHA 4OQQA 4FSXA 1LSSA 5BMVF 4Q12A 1VLJA 4B4WA 1DJNA 3WC4A 3B9RA 3OCYA 3GELA 2E4VA 5D6OA 2GARA 3S68A 4M1QA 2X0RA 2E0IA 1CRPA 3BWMA 3WMEA 5HUJA 3D0KA 5I7FA 1GOTA 4AUNA 1XDBA 1TW3A 4K40A 3W5DA 5IZCA 1J9ZA 1BCRB 1J1ZA 3CGGA 3TJMA 2X2PA 2QRVB 5C1BA 3IPCA 4V0LA 1OKKD 2VYCA 4O59O 1CUEA 4BQFA 2EP8A 4HRAA 4LTMA 5CD9A 3E9DA 3WRWA 1CY4A 3KL2A 2X9GA 2E55A 1C3XA 1CKEA 2JLSA 3WHPA 3C39A 4NNOA 4E09A 1AH2A 2I7XA 3IURA 4MB6A 4N6NA 4IIUA 2HFKA 3G2HA 1QVAA 3DP7A 3E5NA 4KV7A 2AZTA 2D0PB 3U7HB 1NF9A 4LGMA 4B4OA 1JDSA 4H4DA 1UT6A 3Q88A 2VDUE 3L0BA 3LLMA 2NQ8A 1GNRA 1DAOA 3C8DA 1V7CA 3QYFA 5CDFA 4EY8A 3H6HA 1FU8A 1NFRA 1GGHA 3OPYI 3HVUA 3P5SA 5GZ6A 4YDRA 2CVFA 4OJNA 4GF5A 4EUSA 3KOZA 1Q16A 5LMCA 5TV2A 5F7OA 2IZ1A 3N8IA 4DRXB 1LV7A 6ADHA 1N2IA 2CVQA 4QDJA 4YCBA 2G0NA 4JQYA 3SVLA 1A7JA 1BN6A 1QWOA 1YCHA 2XOEA 3R44A 5IUKC 1A2KC 4DRXA 5AUPB 3OM9A 5EXDA 1QBGA 3CF4G 4QBHA 1LFDB 4B3IA 4ZYZA 1ENPA 1JT2A 1BRTA 1HQKA 5AK3A 1EA5A 2WVHA 2HA3A 3SYLA 2PU7A 4J2OA 3ZXSA 5CB6A 3GFPA 2XJ9A 1JMVA 1R8QA 4QYTA 4RCVA 4D9NA 1A9OA 3HJCA 1W35A 1W47A 2IFTA 4ILEA 3UGKA 4BO8A 3ZU5A 2Y71A 1MC4A 5AW5A 4LHVA 4NH4A 4Q1EA 2QN1A 4Z7JA 2Z8XA 4HQOA 1IHDA 1QHGA 1Y4DE 4FC7A 5BW6B 3TEMA 2Z08A 2N47A 1GPUA 4A6EA 5DM0A 1UBOS 2REQA 3PNSA 2ACKA 2OKCA 4QFBA 2EV9A 2Q5JA 1Z17A 1JEEA 3OTGA 2C88A 1QIKA 4TS3A 3TVDA 3U9TA 5DDIP 3KDAA 2NO6A 2XQJA 1MFZA 4ZAZA 3IMFA 2QU7A 3KSMA 1YUMA 4OQFA 1RYNA 1OA1A 4FFRA 3O3NB 1UDAA 3DHWC 3A1WA 3FIJA 1IVSA 3EZFA 3GUHA 4WT7A 4E2ZA 1FNBA 1KPGA 2QNIA 3TD6A 1YJCA 4TMWA 3RVSA 4GVXA 1W5SA 2Z0MA 3UFBA 3JYLA 1TRKA 1QZXA 2OXFA 4LYFA 1H6BA 4AY6A 4EYOA 1L3BA 3JQAB 2XRZA 3HB9A 3B6KA 3H1PA 4M1MA 4MV6A 4BMOB 4RFLA 4RS3A 2E4YA 4GO1A 2WJVA 3GA0A 1I4TD 3VPDA 1RM5A 3KB8A 3KJIA 1J39A 5CGQB 4NYIR 1ADJA 3C48A 4AMYA 5JS7A 5GM1A 3WS7A 5CLHA 2M1ZA 2PR7A 4RJJA 3E9RA 3WBFA 1Q1BA 4HAYA 4PC2A 1NN5A 3GNLA 4FEAA 3BGVA 4AIIA 1V9SA 3EJ6A 2QYOA 2IDZA 3D6AA 3WY9A 1P1CA 2OQRA 3CV3A 1GFZA 2HIMA 1V0JA 1T1GA 3HGMA 4XIFA 5ALKA 4E1AA 2Z56A 1D2MA 2O52A 3HBNA 4TV8A 4DYDA 5CEFA 4NE2A 1MLDA 3I9MA 4L57A 3UMSA 5AJVB 1OC4A 5KINB 4X5OA 5KTPA 4U5QA 2FXIA 5EPEA 2B8TA 1DDGA 1VGRA 4QEZA 2PTHA 3FFBA 3R7LA 4KXXA 2H0RA 2RH5A 1WS6A 4PPNA 3LCUA 4MULA 5I7HA 2D54A 1TE2A 4WNIA 4E5VA 4XX1A 1DAEA 2GDJA 2QPLA 4MAFA 5DNEA 3MMSA 2ZVPX 4QPNA 1YR6A 5DLDA 2H7XA 1YQXA 3ICVA 2R2GA 2LZ0A 3KWMA 5JY1A 2OGTA 5EMHA 2BGTA 3F67A 2R87A 1H2XA 1A69A 3NCHA 5IKXA 2V7QA 1RYYA 3P9XA 5AJYA 3BILA 3I09A 2LP4Y 3RS8A 3S2ZA 3X2FA 1D2NA 1M2KA 1NLUA 3IE0A 2QMHA 2XB2A 1BX3A 5HDBB 2DHCA 4M9ZA 2C4MA 1XHFA 1IWPB 5SY9A 3AUYA 4BKRA 4Y6QA 4DJJA 4YUZA 2PSJA 3PZBA 2R7MA 2XUAA 3H5LA 4Y9SA 3CWQA 4YS6A 3MS2A 4RZQA 1SXQA 1VCMA 3UOGA 2QLNA 1E1LA 1XK7A 4GOJA 3F7OA 4KFTA 4CR6A 4LCEA 3ER8A 4G5QA 3H4MA 1T1RA 3HCDA 4WZAE 3D43A 4MGHA 4XWWA 2E87A 2FEAA 1L5HA 2QSJA 5T3UA 3AY6A 1XZBA 2WJGA 3N6RA 4JL6A 3EUAA 3COPA 1PHRA 3IE2A 1UC4B 4YRCA 3X3HA 3L9WA 1X1RA 4ZVKA 4CW7A 5IANA 3UGJA 1ICEA 2IP2A 4W9MC 2A2ZA 4EW3A 1GXSB 5K2OA 4BGVA 1KS9A 4GU5A 1BD3A 2POCA 3RASA 5BY2A 3ETEA 1GG5A 1GXSA 4DG5A 1CU1A 3D6NB 1UR5A 2WSIA 3SP1A 3GQBB 2A4MA 2O9JA 4HYTA 1EDZA 2ZU6A 3R5HA 5LL6P 5J9FA 2O2YA 2FPPB 4XFDA 2EGUA 1BVHA 1UPXA 2RAPA 4C5AA 2VEOA 2D1SA 2X8JA 1H85A 3F1KA 3FNGA 2Q4BA 5SYMA 4I55B 3VJKA 2E1PA 3KSAC 4IYJA 4Q01A 4R0MA 3WIEA 3DYBA 4Z4GA 1NXPA 2OD2A 3PFGA 5ENDA 2RJOA 3EVGA 1C7EA 2P3QA 3H9EO 3OEHD 1NQXA 2X3YA 2IZ7A 3QLEA 4JAVC 3R8XA 4K03A 4P36A 2PPVA 1U1DA 1V7PC 1V8OA 1AK1A 5JAQA 2CZCA 3R5SA 3GW8A 4J7UA 4Q4CA 2Q62A 1P91A 1M1ZA 2TSYB 1N75A 1ZA2A 4PYQA 1X74A 3G7NA 3SQNA 3T3IA 4WNAA 2GAOA 1V41E 2B83A 3G9UA 1XF1A 3OQHA 3LYUA 2WY2D 4MMZB 3HN6A 1F8GA 4TXJA 5B57C 3ZZNA 5JH7B 4OXXA 1UMCA 4GQBA 1DLIA 3IIJA 1XQ6A 4IHJB 1KK3A 1LQUA 1SOAA 1VIMA 2OMKA 1JF8A 2P77A 2VYFA 3BRWD 1I6KA 4MRSA 3PGLA 1Z0IA 4U9IS 1MT3A 4AUEA 3KS9A 3SI7A 4H60A 4LSGA 2P9FA 1XHEA 2HLNA 3PIRA 4EAAA 1E0SA 5L4SA 3NG1A 5HCIA 3GDOA 1Z15A 4DJDC 1WPGA 5L3QA 1E2BA 3H9UA 3CRMA 4C4RA 4FE3A 4D3SA 5JAIA 4DV1B 2W6CX 2GWHA 1HPLA 2ZWAA 4X8LA 2FLKA 2AX4A 2CNKA 3E35A 4Y1RB 1I2AA 4Q1DA 2WTAA 3N5KA 3F5MA 2F4NA 5BYJA 3KTAB 3V5NA 4J6EA 1SVNA 2NO0A 4FBMA 4Y1RA 3G68A 4R81A 1Z63A 1CEEA 1XQ1A 2ZUWA 2CDCA 2QYTA 3FYCA 4PRYA 2G3YA 2WB4A 2W58A 3UG7A 4FFSA 4XIGS 3UPDA 2WAAA 1NFFA 1TAQA 1UXKA 3FOBA 3R7WB 4L4YA 3EEQA 3NOVA 4E15A 5BSFA 3ZGLA 4HPJB 3HUDA 5D7BA 4QT4A 2EFJA 2Z2IA 3HWX1 2EOAA 1B6SA 3EXHC 4ZQGA 3R7WA 1KO1A 2BMAA 2O7VA 2AN4A 2PGXA 2R8XA 3IBCA 521PA 3ZDEA 4D4JA 3QKUA 4OHOA 2FH5B 4YXWD 1EUDB 3U2QA 3HABA 4MKGA 1X1QA 4G97A 2E1RA 4YN3A 4I4TB 2VHCA 3DR3A 4RH1A 3WYNA 4C22A 4DABA 2PKCA 3TI7A 1G8FA 4EVRA 4FFNA 4XWGA 5LYJA 4AWAA 4NE7A 1UMDB 3TVYA 3I04M 2GNPA 4I4TA 3VR5A 3FG9A 1OZ0A 2GEDA 2W0MA 3H5VA 5CFQA 5DSTA 3OZWA 5EXSA 3INYA 2PVPA 1QFSA 3OWOA 1XCMA 5HFNA 5FL7A 1IBCA 4D92A 2XH8A 1S02A 4YRMA 3MWFA 5AKEA 2BKAA 4N12A 1RYZA 4RTKA 2O3RA 5L45A 4NKRA 1KMHB 4TWBA 3IKJA 5ERGB 3ES9A 2EKPA 3AIOA 3NYIA 3G2PA 1H5UA 1S96A 3S8EA 1KMHA 4HXEB 3RYTC 4H7HA 3UICA 4TTSA 3H1AA 5ETJA 3OPNA 1HEYA 1V95A 2RC5A 3EIQA 3EXFB 5LQKA 1AG9A 4I8DA 4CHGA 3DZJA 2IP1A 2JEYA 3P0JA 3TAXA 2I62A 2IXBA 1G6OA 1FYWA 1SOVA 2FMFA 1AJEA 3U1BA 1XZ8A 1ZL2A 1AKYA 2MTBA 2YVAA 2I3GA 2AMLA 2FWMX 3PFKA 3DJFA 4PW0A 1LPPA 5LZ7A 1ITZA 3S3TA 5LQJA 4HX5A 4TT8A 2CFCA 1R4NB 3EK2A 4Q03A 1QDLB 4NZMA 1ZH8A 2B2CA 3WBKA 4BVAA 5LKAA 2GPWA 3GT3A 1NKSA 5EIEA 2JGRA 1V16B 4R3WA 4ZA2A 2OENG 1UMBB 3AM5A 5KYYA 5H59A 2A1TS 1JHDA 3C1TA 3WB0A 4DZTA 1TTQB 1RWOA 3O5AA 3OQNA 2HN9A 4HWKA 5EP4A 2ZYIA 5K01A 1JJIA 1TQ8A 2ZQZA 2ZU0C 2QYSA 4XQ9A 4WW0A 4PLZA 1VJRA 3W5AA 2B99A 5ES3A 3G0BA 1VCNA 3G0DA 3JASA 4EQZA 4MW2A 3L1UA 4KO8A 4KQ9A 1ESDA 4URWR 3F6PA 1AQ6A 1BKDR 1V9LA 2B98A 2XTNA 4PYMA 4B79A 1Z29A 1ZOOA 4XARA 3K0FB 4CV2A 4RIFA 1FJHA 1G5PA 4RELA 1N5JA 3LLVA 4OHPA 1XZGA 3K0FA 3BCUA 2EKDA 3PWTA 2ZIAA 4KVFA 1WF6A 1GPWB 2WUWE 4K9DA 5K3FA 1JVSA 5FT9A 4DLSA 1P2TA 3IELA 1I7DA 1UJ6A 3BIOA 3OE1A 4BJ5A 2IP4A 5AXBA 4BLTA 1NNEA 4X65B 1GILA 1Z5VA 3JD3A 1PJQA 1EGMB 1I2DA 3FCUB 3H2HA 3MIIA 4DN6A 4XUCA 5ALMA 2EWMA 4IXMA 2VJMB 3IR7A 4RDXA 5DM2A 1HH4A 4MYSA 3E2PA 3R5FA 3TCKA 5IKPA 2IXDA 4WOBA 2DHRA 4L78A 2HBZA 5B7QA 5FD8A 1DJOA 1EQ2A 1SXJC 1HE5A 1OLXA 2ZETA 3DBIA 4EPTA 1QF6A 2DP4E 1KZ6A 1W2HA 2C2MA 3DFKA 4OHWA 4MYUA 5DE3A 3IEXA 4YI3A 5TJ9A 1H2HA 1ZVKA 2JIDA 3DPIA 2GLTA 4RKFA 1T4BA 4DCPA 3KQVA 4PTLA 3WLAA 2EQ5A 3NBMA 1PBTA 2A0UA 2B9VA 2G80A 4BBPA 3QUQA 1YJBA 4XLZA 1NOJA 4RF4A 2WICA 1YJXA 2GSWA 3EEYA 3PHJA 4NU5A 4Y2JA 4WXMA 1T0PA 3G2MA 3T1QA 3NVDA 3AOEA 1Q1AA 1XVLA 3MM4A 1Z7EA 4HGRA 4IQ8A 3DFFA 3PIIA 4DLAA 1D7OA 2XA2A 3ESQA 3L7MA 2QRQA 1FFHA 1YOBA 1V8PA 3WSTA 1ODKA 2QV7A 4N4AA 4P84A 4YTEA 2CV1A 1NDHA 4C7VA 3DOHA 4I99A 1DMSA 1KYTA 1WKCA 2VSNA 3IUQA 3ANYB 1XEFA 3WB9A 3P8ZA 3P0RA 4CIAA 2W2PA 3NB0A 2Y76A 2RDMA 3MTAA 5E6RA 1R6BX 4O25A 5L3VA 1WCV1 3M6MD 3RVLA 4E21A 4EX6A 1JI3A 2VNIA 2PH3A 3FZGA 3IVCA 4YJFA 5EE1A 1A3CA 4LFCB 4YAFA 2WU4A 1JXOA 2JHFA 4C7XA 4S1NA 4KIWA 1T2VA 1YQ9A 3NH6A 4KGXA 4R1UA 1BMQA 4CEIB 1TLLA 1M5RA 5B3JA 1LS1A 3HCCA 3FHTA 4ENUA 2ID9A 3PD7A 1B43A 3V8MA 2I1WA 5DISB 4CEIA 4TMZA 1NNUA 2QIOA 3EF1A 7ABPA 5KHAA 5DHAA 4QTXA 1X1BA 3RTBA 3L4SO 3D5TA 1XP8A 2A94A 1T1EA 3BJEA 4ISCA 3VZQA 4CDRA 2GF0A 1U98A 2ZUTA 2ROQA 1VE1A 4UM5A 5ADVA 1HL3A 4AF8A 3KQUA 3EVCA 3DS8A 4PHCA 2PDAA 2EJBA 3IUJA 4MYTA 3ZJTA 1PJCA 2V5UA 1JB1A 2BEVB 1ZAYA 3UJHA 4UHCA 4WA8A 3OPYA 1JI0A 4ERNA 2IHKA 1A8PA 1QH1B 4GI7A 1ZICA 1WVMA 4ZT2A 1QQ6A 3DH0A 3SIPA 2D4AA 4TV8F 3PWZA 4YWHA 3WV5A 4GZ5A 2W71A 3GEBA 1CS0B 1QH1A 4FYIA 4ILKA 3LYHA 1NPDA 5BVHB 4UUNA 5I5GA 1YRWA 3E5MA 1LI7A 3LX5A 1DIOB 1FRQA 1YC2A 3ASYA 3L6EA 4P92A 2E5LB 3GUVA 5DGCA 5EC8A 5BVHA 3AKZA 1AMOA 2POQX 3JARB 1Y1SA 2VK1A 1XRNA 2NYVA 4RQTA 5DASA 1IXKA 1M73E 4J3NA 3KLBA 2QTRA 2JZCA 5AVWA 1VHDA 3G2IA 1C0LA 1PS9A 3CR7A 3RYFA 2VRNA 2A3RA 3TDMA 4MJ7A 1GZ7A 3ZW8A 1KBZA 2ZYDA 1CF2O 1DCKA 2E82A 2PWBA 1RWQA 1L5WA 3EULA 1WQ1R 3HJTA 2FAXA 1VL1A 3T1VA 1IATA 3I1JA 3TAUA 5EXEA 5KVAA 5FUWA 1O87A 4R1PA 1SEVA 4F45A 4Z7QB 1HDIA 4IRUB 1VKZA 1II0A 1APBA 4KR7A 4KREA 3W1VA 1P39A 1M0TA 3QUBA 2IXTA 4QXMA 3FLMA 4OU5A 2WIDA 5JSHA 1VYHA 3S2GA 5IT5A 2FP4B 1XDUA 4F5DA 2KB0A 4BFWA 3CNHA 1OAOA 1REQB 4PX3A 1XZLA 4PZAA 2YCBA 2GD6A 2CZQA 3HKEA 2JGMA 2W2MA 3BBPA 5LQDA 4EG5A 4LVUA 2H1CA 3C4JA 2D7JA 3LC2O 5TEVA 4EL0A 5DM70 3IUPA 4FTWA 3DW1X 4F5ZA 2X4GA 4BX8A 5BW4A 2VDRB 4OL0A 1ANKA 2V4MA 2XUHA 4V0KA 2OHXA 4OQNA 3ZR4B 3Q5EA 4D6YA 1ZHOA 1FZTA 3CMMA 1EEHA 3MMZA 4L3OA 1E0AA 1T1SA 1E0JA 1FQJA 3I4CA 3NCTA 3AF3A 3FNBA 1UEXC 2PO5A 3GJ5A 1QU2A 5HZKA 1BNCA 1HFWA 4GBED 1SOMA 3DBLA 1JMYA 1RQ2A 2B7BA 1JVBA 3T06B 4I50A 3D4OA 3IIMA 4BE7B 2KWIA 4IX9A 2P78A 4KR3A 1IWBB 1ZOPA 2F4VB 2ZM5A 5J2UA 4C3UA 3VKHA 1FS6A 2AT1A 3M6FA 1GLGA 1BH6A 1JBEA 1Y63A 2FW6A 1GA4A 3NDIA 3X2SA 3ABRB 5HRAA 3LT4A 2NP6A 1E9AA 5D7NA 5CJ2A 1ZVMA 1UJCA 3Q1LA 4JIGA 2GT1A 3WFJA 3H17A 4JJAA 4TMVA 3OLCX 5AOCA 2FFJA 2WP0A 2YYSA 2QRPA 3MILA 4W1RA 5JEDA 2ZXUA 3STYA 3WNCA 2YIMA 4XB2A 2DTEA 1E8MA 1GLNA 3UK0A 2Z30A 3HBLA 2IHNA 3N76A 1NPTO 1QGED 3DHNA 3R1IA 1U1FA 1Z4PX 1WM1A 4EFDA 4CL8A 1D2HA 4OHZA 4P58A 3IDOA 1M2EA 3A4LA 3KPJA 3HCPA 3OLYA 3P19A 5SZJA 3SIWA 1NE7A 1SVSA 5C81A 4NAUA 4DV7B 1ULBA 4XUDA 1U0TA 3S0JA 3SQMA 4QYIB 2QQEA 1UDCA 1MX5A 2G5TA 2VAXA 4AMZA 3PWKA 1G3RA 1X1AA 4ND3A 4ZJZA 2AKAB 2XVMA 1M8JA 2CE7A 1J23A 3MW8A 3OEHA 5D3ZA 4PONA 4KDCA 1DI0A 3EF0A 4UFPA 2NUPB 5ICMA 1GN8A 4Q9IA 3AM1A 2X1HA 3UA3A 3ZKAA 1VPLA 2GB4A 3K96A 4CL3A 3UJPA 4W9RA 1H65A 4W6QA 2QMYA 3IQXA 1E58A 5JMOA 1PF7E 3PE3A 3CLTD 2A92A 2I6UA 1ATIA 2E4WA 4EATA 4Q37A 1M8FA 3TZCA 2J41A 3THWB 5JMPA 1YRYE 4HDRA 1BG6A 3A06A 1YS7A 4XX0B 1US8B 3KJQA 4BRUA 1L4FA 3BB4A 4IHKA 2WD8A 3SY8A 2P90A 2C82A 2PT9A 3HR8A 2YN2A 3L4BA 4K9NA 1US8A 1NI4B 4XX0A 4JP2A 4F96A 1UZNA 2A9OA 4HNQA 3T7TA 2HRZA 2UU9B 2FSSA 1GITA 2C8KA 2IYNA 5LP6A 1NI4A 4J2TA 5DX1A 5ENZA 4IWNA 2P1RA 2ZJZA 1NRWA 5LJLA 1S9DA 1JPVA 2MHCA 4JA2A 4X8OA 3T5AA 4G0VA 4I6GA 4OYYA 5FI1B 3B6ZA 5LYJF 1BOFA 4FQ7A 2C7QA 2GUGA 4FQ5A 4I4TF 3DXXA 4B74A 1SCUA 1KI6A 2HAEA 1L4HA 5DYNA 4KW7A 1JSLA 3P7MA 3WX0A 4CF4A 4JITA 5CU7A 2ID7A 1RHQA 4D46A 3BQNB 5C3UA 2WJIA 3Q8KA 1VFNA 3WMWA 3MRVA 1TUEA 1DO0A 1ESZA 2BGLA 4X6XA 3CKMA 3RBAA 1XI2A 1H8ED 1NJ8A 3GDWA 3R09A 5AI8A 4PSAA 2GPAA 4QHSA 3ZTYA 4B3RB 1K5DA 1GSIA 2P2SA 2BZSA 4CEJA 3NTQA 2WYUA 1KS2A 3R3WA 4XGQA 4EFNA 1BXRB 1N8KA 1AGXA 1GNPA 1QF9A 3UGQA 3E81A 4QUAA 1SM4A 4XVQA 1KO8A 2P2YA 4WXYB 4YP1A 1BKSB 1XQVA 3GJ6A 3AEXA 1BXRA 4Q4DA 5FFNA 5I7OA 1DJMA 3M5PA 1E3TA 4FWTA 4IQFA 5A62A 1MQAA 2OR3A 1DADA 1EJ2A 2Y67A 3AINA 3M83A 1EX6A 4Y1EA 1I7PA 4XVCA 1F14A 1G8JA 4OM7A 4J0JA 2FOLA 3TLEA 1HETA 2P30A 3BRQA 4P38A 3C3EA 2P6MA 1I3MA 4PZYA 4AWBA 3MQ4A 2WKPA 4RF5A 1AMUA 4TZ0A 4N5MA 4AJEA 1ZOSA 2H8KA 5LLSA 5IULC 2ZW9A 3WKBA 4DWOA 3EMKA 1W4AA 1HE3A 1C4KA 2AZXA 1Z18A 2PA0A 4JB2A 2BMWA 2Q21A 5I47A 4Z0HO 3A6ZA 1YDWA 2KE5A 2C2YA 5KSYA 1KDPA 2QP4A 4J91A 3SE7A 4IP0A 1U5AA 1C50A 1IONA 1JHUA 1P1JA 2EFEB 2QTCA 5C4MA 4QRIA 2IIBA 1TVMA 2NSJA 4KDEA 3WJ2A 2D74A 1E5VA 1O6GA 2OZLA 3FSGD 5AOVA 2O8EB 1ONSA 4ZQCB 3KG2A 1ZXLA 4ZCIA 5F76A 1JAIA 1A72A 2ZB8A 4K9SA 1E3JA 3CQ9A 3PEFA 4O02B 4QEKA 5B3AA 4DCJA 1TYZA 2OP1A 4GPZA 1JIUA 1IMJA 3KM0A 4XD7A 5BUCA 1HDRA 1GUAA 4UCWA 5AXAA 2F3QA 4Q7KA 2EX4A 5AK5A 5BSGA 5JDCA 2JFWA 3EGDB 1H94A 3VH1A 4ODIA 4FHEA 3K8YA 4LY9A 5GZ1A 4DAOA 3ORHA 2AMYA 2F1RA 4NMXB 4Z4IA 3GG9A 3LO8A 3B13B 3PRJA 2QLLA 1JJ7A 3DE4X 3BL5A 2O4UX 2V59A 4OQDA 1WCXA 3RTAA 2QRLA 3RUDA 2X9LA 3VZBA 3B82A 3OOJA 2HK7A 2IELA 2IKSA 1FB5A 4Q4HA 4FZ5A 5LNK1 3ZU6A 1T9CA 2WYOA 1X1TA 2FN7A 4CM3A 4ZCQA 1KOLA 1MU0A 3CKKA 3GL9A 5AUNB 2VAVA 1Z9BA 2D4HA 2KX7A 4KWHA 4O4LA 1XZDA 4H17A 3A28A 4R7ZA 4MW9A 3EBLA 4ZOBA 4ALNA 1ESNA 1FUUA 4B09A 4DWJA 1E7RA 2AFVA 4B6FA 1PSDA 1X38A 3O8BA 3KZKA 2NT3A 2YICA 4I2VA 1I94B 1ULHA 2LIPA 3PCRB 5CVCA 3W5BA 5CJPA 3KJZA 2H3EA 2H9IA 4WBXC 4BVBA 3HXMA 5H82A 4KGDA 3PLNA 3A1TA 4CNBA 3FPCA 3S1AB 2O7QA 1GKIA 1WB5A 3E27A 3DEIA 5ALDA 4LFBB 1WBDA 1JJBA 3RU3A 1ZGZA 1TOAA 3U31A 3AP1A 1MOZA 5FFMA 5TVKA 1F2UA 1R2QA 4B8WA 3BDAA 3W2HA 1SBHA 1T91A 2JASA 2OAEA 2PZBA 2CF5A 3KVVA 3R6TA 4KDRA 4NCKA 3U7JA 4L15A 2BTEA 3DBRB 3I6IA 4P98A 1VPWA 3WQSB 4D56A 3S81A 2ZJBA 2NYRA 3GJYA 3HRHA 5ADWA 3IAS1 1G5IA 2SCUB 4IXNA 4AZSA 3NT4A 3QJYA 4D8XA 1W5TA 1I4EB 3BEDA 5HZGA 1KO7A 2P7HA 2SCUA 4AZ0A 3L6UA 3ZQUA 4PSKA 3TNFA 3IEMA 4GKVA 4HGYA 3SHQA 4HLDA 1N9GB 3AL0C 1SCNE 3FBTA 2ZRNA 3QVVA 3H18A 3IMGA 1EZ1A 2I4TA 3LDHA 1L4EA 1ZGCA 1K4KA 1ZGGA 4GX0A 1EWRA 1N9GA 2VP0A 3W04A 4F86A 5JS8A 4BB0A 3BDVA 4YMLA 4D8UA 3ZNPA 3I9V1 5DBIA 3TTVA 4BNVA 1Y3DE 3VPGA 1R0WA 1PR3A 3EGCA 2TYSB 3CLSD 5H5JA 4PX9A 4NRDA 3VA7A 4AROA 3ZWDA 1VKNA 2A9QA 4UDOA 3HVHA 1DX6A 5CTAA 2PUDA 4GPBA 1NMYA 1VHJA 2TRSB 1K0FA 2O5RA 2WUDA 3IQEA 4R9NA 4XCQA 3KOUA 3KBOA 1EE9A 3COSA 4YECA 4DY6A 4XDGA 3ZZ0A 3D6JA 3G89A 2ODPA 1XN4A 4HRVA 4QTYA 1PFVA 4IM7A 2VOJA 3DFZA 3LRXA 3PC6A 3GRCA 3AR7A 1XPUA 2WYWA 1QX4A 4RGVA 3EDOA 3MOSA 4C2TA 2J09A 2PSEA 1YIAA 3COWA 3N74A 4TTAA 1E7MA 2BWJA 5HM6A 1JLKA 3PR2B 4MB0A 1JILA 5ESWA 4S04A 2C3MA 2Y6UA 2ZJYA 1HT0A 5AKYA 1TT7A 1IH8A 4FNMA 3RYIB 4TLEA 1L8OA 2IUYA 1OYVA 3QOYA 2I6GA 1NVEA 1LPSA 2C7VA 4L50A 1E8NA 1RYDA 2RC6A 1U8AA 4RM2A 1ZGBA 4TKLA 3L1IA 5EA2A 4DIOA 3EIFA 3QHAA 1QSGA 2GK3A 1SCKA 4FOTA 4MNTA 3A9CA 1IEWA 4LXQA 4UVHA 4CM1A 1CDEA 5EJ6A 2VJNA 5KYKA 2GLUA 1G1AA 3O8RA 4F1JA 1HV8A 3HBAA 1W5FA 2X4LA 3TTXA 3CB4A 2ZBGA 3G79A 4D43A 3DMTC 2AR9A 4RDHA 1YR8A 2QLFA 3A4YA 1N2EA 4TLLB 1RLIA 2GBIA 1N5LA 1N0IA 4G0UA 3QYAA 3GP5A 2X6RA 4CJXA 2XVXA 1UPAA 3C6QA 5CURA 1GSHA 2QZZA 4JYBA 4N3NA 4S1OA 1OZFA 1P4JA 3DOEA 4XCXA 4TTQA 2C4TA 1V5WA 1ECBA 3IEIA 3R8CA 4CDGA 3IDAA 2IBTA 1ZAKA 3DM5A 4KO2S 3F0TA 1TJ5A 1LDNA 1WUJS 3S8MA 1L8QA 3BS4A 3DO5A 3DO6A 3DZ8A 3VR6D 1LY1A 3GEIA 4PPGA 2BBWA 2WJHA 4YREA 1HF3A 1SO8A 1UMKA 3N5CA 3PDUA 3R0QA 4RDCA 1WUKS 2NXEA 2FP3A 4TKUB 2VZ9A 1RWBA 3QNWA 1C9NA 2DTDA 3SXUA 3IKTA 1R9GA 2VSFA 3TQIA 3IP9A 3GZNB 5JG7A 3VSDA 1OI7A 4FIZA 5T4BA 4B3BA 2DBVO 5JAMA 4I50F 3SE0A 3UFXA 3KQTA 1RTKA 3GZNA 4RIGA 2HA5A 1NUTA 2Y9MB 5J2UF 4WCFA 2Q0XA 1STOA 1WP9A 1V7QA 2FDXA 3GXOA 4Z5XA 1N6KA 4F97A 2BELA 2ZB3A 4I4LA 1D2EA 2H2GA 4M7WA 1O6FA 3QEKA 3TW6A 5CVVA 1V3VA 2AW5A 3IVAA 1UUFA 4IVPA 3T1OA 3TK1A 3ZQ6A 4EKIA 4F92B 1Z2AA 1CULC 1NQ5A 1YTLA 3RRYA 1YK1A 2CHUA 2I3ZA 2P0EA 3NM6B 4OA8A 3V1KA 3WGGA 2BMFA 3PUIA 4YFVA 5JD6A 3GUYA 5JIBA 1PFQA 1R88A 4GRDA 3AY0A 3TI9A 2OM2A 1UJBA 3BB3A 3LSTA 2WVGA 4TPKA 4IICA 2LCQA 2VF4X 3C6BA 4U6SA 3DCJA 4AF6A 1OYOA 1PUIA 4RTQA 1YRLA 4UXIA 4ZVOA 4EJFA 5I4BA 1B0ZA 5FLYA 3IA2A 4N0MA 2AZ4A 3KOXA 4CMEA 1JXAA 3EASA 2ABWA 5KMGA 4KFCA 3GLIB 3T35A 2VWHA 2BJVA 3PQCA 5TQ0A 1DX9A 3KLMX 4D3FA 3BAZA 2FFBA 1BWPA 3GLIA 1HMPA 4BNDA 3DD1A 1J1UA 4FGKA 4BWVA 1DKMA 2WFMA 4EGFA 3VKGA 5KQPA 1ENYA 2A86A 2WAYA 2XQVA 2Y1OA 3SVZA 1FFXB 3F8TA 4MARA 4DOMA 4OI1A 2TMGA 4I66A 4AAYA 2JIQA 2ZRFA 3JALB 2VPPA 3R4VA 4MVJD 3HEBA 4HFNA 4N8DA 2VBCA 4RD1A 5HIIA 3DAFA 1QG2A 2CHEA 3JALA 4P33A 2BI8A 4W8HA 1PV2A 1UAGA 3FN4A 4S1PA 1FX1A 1IMOA 1W0CA 3P9KA 4LDAA 5E7IA 5CFZA 5F7XA 3SQXA 4HH0A 1N5RA 3FBGA 5SY4A 1R3UA 4RZXA 3P9CA 3IR6A 3CIOA 3R3ZA 4RTLA 1YA6A 3ZX4A 1ODJA 3FD8A 3M5CA 3L8HA 1CJSA 4PC3A 4BC0A 3RANA 1YQUA 1AZLA 1FEZA 1ACLA 2E49A 2VP5A 4OFBA 4F85A 3EGEA 3AEUA 3ZDXB 5LP6F 1OYYA 5BQPA 4NEGA 3AONB 3O1IC 4LQLA 4DMHA 3V3TA 3WGHA 4WASA 3TX6A 3B8EA 1P6UA 2H2IA 4G0XA 1QK4A 2ISCA 3PA6A 3DVLA 1P0FA 2GPJA 2YV4A 1N4DA 1RHRA 4MOWA 1E5TA 2J59A 2I8LA 2VOEA 3AYXB 3P26A 1I9CA 3PLAE 1FFSA 4G37A 3FDXA 1JHXA 3MMXA 4IUYA 4CG3A 5FWXB 3GRUA 1O6ZA 2NT4A 2VK4A 5F9MA 1BVRA 2OXTA 4YT4A 2NPOA 3B12A 2EEPA 4LI3X 3T7IA 4E32A 4ITRC 5FWXA 1K88A 4ZOAA 3TE7A 4MRRA 4AZ3A 1DOAA 1ZW6A 2C77A 4BAGA 3FOCA 3SNKA 1JH9A 1CUCA 1QYVA 2FOXA 4M0FA 5ALTA 2X9NA 7ADHA 4TQUS 2NZXA 2Q1UA 4HN9A 5DU2A 5AMXA 5F12A 1QAMA 3ZG6A 3P2YA 2FF7A 1WXFA 2D2FA 2FUG6 1T8SA 3FWPA 4U7WA 4BPRA 5ITWA 3P1JA 1IZ7A 1T2DA 3RBZA 5KKCA 2RG7A 3ENKA 1WO8A 4LOAA 1KIFA 1PHPA 2XYVA 1UANA 1ZM2A 3O4JA 5G1NA 2BKVA 2PH1A 2Q3CA 2ZSEA 4UULA 1KMIY 3OZBA 5EP1A 4F06A 2Z6AA 1JECA 3DC2A 1DSSG 1B42A 1TD1A 3CF6R 1J0BA 1YRQA 3L92A 4KXMA 3TBHA 3L01A 4CMHA 4Z4HA 3U4HA 2VJAA 1YVRA 4TX1A 1D5CA 1RAGA 1RAHA 2FPGB 4N0QA 2C42A 3VU9B 1O96B 1XCGB 3O9MA 4EQ6B 3U4QA 3EGXA 5KYUB 3OG9A 4PYLA 5DI3A 3BMQB 3ITEA 1N5MA 3VU9A 1O96A 1Q6YA 4EQ6A 4FFWA 3I8XA 4BGEA 5F73A 1RPJA 4BFUA 4DB4A 3N2IA 3W06A 4R1TA 4EJMA 1EJ0A 1RLUA 1LD3A 1ZH2A 5DX8A 4F3RA 3DL2A 2QRNA 1OMOA 2MT9A 4I8XA 4RKQA 4YV0A 4LTDA 2UYCA 5IAKA 1MQ8B 2Y1GA 2ZBUA 1P7WA 5FV4A 3CGWA 1YQQA 3PC8C 1IM5A 4QPJC 5CX1B 1G7SA 3RVDA 5FIUA 4CUKA 1J97A 3QTLA 2VYVA 4OJYA 3VR4H 1PLKA 3QXCA 1U3CA 1PBNA 3ZDAA 2WMOB 2X13A 3AFMA 4X20B 3OECA 5ALXA 3QMMA 4J49A 5FRDA 4QQNA 4P83A 4US0R 4AKTA 4UQLA 4S1VA 5EL0A 1JR6A 1FYDA 2PKEA 4D9JA 3LXRA 3CX4A 1SHJA 4Q24A 1RQLA 2JG3A 1Y80A 2G04A 4BQPA 3UXMA 1CJKC 1DBQA 5TSDA 1TGYA 2A5DA 3J7TA 5U9CA 3RVMA 1AO3A 1F0YA 1W0JD 2WE8A 4A92A 2C5AA 5GOZA 4DDKA 1XZQA 5LWQA 2VSOA 4G0MA 1I32A 3ZHTA 4ZZ1A 1CF4A 1KI4A 3SLGA 3KJGA 3L5KA 4YAOA 2EBWA 4RA6B 2AN5A 3E05A 2ZIFA 3F3SA 4MI3A 1BQEA 3NHZA 2H51A 2OCPA 5DB4A 3WYCA 1XMOB 4LY0A 1KYYA 4O4LF 1G66A 1BX1A 4PNZA 4XH9B 3FSGA 5KU1A 2WA2A 2JHPA 4AO6A 3H5RA 3DMYA 3I76A 5JO0A 3T3OA 3DZHA 1XUOA 4GGOA 1XCJA 3ZXYA 4H3VA 1IQRA 1ESEA 2IV2X 4BNIA 4C6TB 4EHAA 2G36A 5H0IA 1RWNA 2XKBA 3F3MA 3WB2A 4DVGA 4E4TA 3HXKA 1HORA 4JJ7A 1V5FA 4ES6A 3R6GA 1PTJC 3JD1A 2H4WA 5D1HA 5DO9A 1LX7A 1C3OB 1KTVA 4J16A 3G5TA 3I34X 3QFTA 4KZPA 4MJ3A 3KAKA 3A3NA 3TZKA 3RTEA 3U7RA 4HP8A 4Z9FA 3KKPA 1C3OA 2D8MA 1DQPA 2J4CA 2CJFA 2GYWA 2ANCA 5EN4A 1ZD8A 4H16A 1NY6A 3IRVA 1Y1LA 5AVVA 4U2EA 2C4WA 1NVGA 4BY9E 3M1YA 3L4KA 5P8WA 2WMYA 1N7HA 3ZCRA 3NHMA 3TS1A 1KJZA 1TEHA 2H2WA 2WV9A 1PZMA 1QIGA 3BK1A 4W4TA 5DRYA 1TZMA 2P5SA 1E0DA 4IWXA 2JB9A 4LSWA 4N40A 2RK6A 3DE6X 1PL0A 3JQFC 2Q5FA 3QTBA 4AKEA 2JF0A 4NZZA 3ZV5A 4EI8A 1FLNA 5JZSA 1JIJA 2VKTA 1J00A 2ZAIA 3PQDA 2IBMA 4OSOA 3HNRA 3V3KA 1HGXA 4C1BA 3R41A 4WN3A 1KSGA 2DB3A 3N8KA 2X8AA 2DSTA 4YT5A 2IS2A 3ZGVA 4DXAA 5ALVA 2O2IA 1ESCA 2G1KA 2WWVD 1XTUA 1BE0A 5EWLA 2Q3JA 2AVNA 1QCCA 1T6ZA 4A0SA 5FPKA 5KOJB 5L7YA 1SB9A 2NXJA 2ZPUA 4NYIQ 1FTQA 4XRGA 1FNDA 1CVRA 3OUZA 2ATEA 1GTVA 1AK9A 2JGDB 4QECA 2WD7B 1CUGA 3U4IA 2QR3A 4BP1A 1EG7A 4ETIA 4OFWA 1XA0A 3VR1A 3VO8A 3AR2A 2KYRA 3EDYA 3MS7A 3PQ7A 2B9EA 1MENA 2PVCA 2ZRIA 2YJGA 5KHOC 1U80A 1JKXA 1CP2A 1ORHA 3LBIA 4GYWA 4ND8B 1G8KA 1W85B 5H1YA 3WTCA