3U7RA

Ferb - flavoenzyme nad(p)h:(acceptor) oxidoreductase (ferb) from paracoccus denitrificans
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
182
structure length
182
Chain Sequence
b'VKTVAVMVGSLRKDSLNHKLMKVLQKLAEGRLEFHLLHIGDLPHYNDDLWADAPESVLRLKDRIEHSDAVLAITPEYNRSYPGMIKNAIDWATRPYGQNSWKGKPAAVIGTSPGVIGAALAQARLKNDLLHVGTVMMSMPEAYIQWHAEAYAADGSVTDEKTAKFLQGFVDAFVDWIEKHGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH-dependent FMN reductase
publication title The Structural and Functional Basis of Catalysis Mediated by NAD(P)H:acceptor Oxidoreductase (FerB) of Paracoccus denitrificans.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase
total genus 63
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3u7rA00
1DXOA 3FVWA 2OHIA 1QHEA 2B3DA 3UXEA 2FCRA 1TLLA 3B6IA 3NHUA 3GFRA 4H6PA 1KBQA 2AMJA 3NHFA 1J9EA 1DX9A 2V5UA 1H69A 4YQEA 2BF4A 1BU5A 1T5BA 4PU0A 4HEQA 4M0CA 3W78A 3N3BC 1FTGA 3HA2A 5F51A 3NFRA 4YAUA 6NULA 3TZBA 4GQIA 2QX6A 2Q62A 1RLJA 1H66A 3F6SA 1CZKA 3KAPA 1FX1A 3OWXA 3FW1A 2N1MA 1C7EA 1ZX1A 3ES9A 4LAFA 3QFRA 5EAIA 4HS4A 2FVXA 1J9GA 3W77A 5TGZA 2FAXA 2BZSA 3ZHOA 4U7GA 3KLBA 5F12A 1AHNA 4N65A 2BN4A 3LT5A 4Y7CA 2BPOA 2R96A 1B1CA 1D03A 2BMVA 2MOKA 1D04A 4QODA 2V9CA 4Y9RA 1YRHA 1T0IA 4FX2A 4DIKA 3HR4A 5LJLA 4QOIA 2FZ5A 4S24A 2MTBA 3OVMA 4YAOA 1CZHA 2A5LA 4U7FA 4R81A 2FZVA 3OJXA 3OX2A 4LTDA 1KBOA 3GAMA 2X2OA 2Z98A 1CZUA 1JA1A 2FLVA 3L9WA 1J9ZA 4PTZA 2ARKA 3NHLA 1AZLA 4LTNA 4C0XA 3NHWA 1YCGA 1V4BA 2HNBA 2Z9BA 1GG5A 3B6JA 5B3KA 3R6WA 3ESYA 5NULA 3G5MA 4FGKA 4YALA 2Q9UA 3F6RA 3KAQA 5LBTA 1C7FA 1AKVA 1FLVA 4H2DA 5B3LA 4J8PA 4DILA 1SQSA 1DXQA 5LJIA 5LLDA 1RCFA 2R97A 2FOXA 3NHKA 5EMNA 4QOFA 1OBVA 1CZRA 2M6SA 3LCMA 2KQUA 2KLBA 4N9QA 4YAFA 4C76A 1D4AA 4QOJA 4D02A 3NHPA 3OX3A 2MWMA 3F90A 3K1YA 5EA2A 1WSBA 5A4KA 3TEMA 1XYVA 3NLLA 2HPVA 5JROA 3EYWA 3FJOA 1CZNA 5BUCA 5LMCA 3JSXA 1OBOA 1AKRA 2V5VA 3ESXA 3NHRA 4GI5A 3B6MA 2HNAA 1AKWA 2FX2A 1OFVA 2QMZA 1BVYF 1AMOA 1ZWKA 5FUQA 2QWXA 3KEGA 4C14A 1E5DA 2RG1A 1XT6A 3GFSA 5FX2A 3NHJA 1WSWA 1FLDA 3L9XA 3N39C 4ZVLA 3FX2A 3U7RA 1YKGA 3EDOA 2WC1A 4CF6A 3U7IA 5F4BA 2OYSA 2GSWA 1YDGA 4NLLA 2Z9CA 5LBUA 4LA4A 3O73A 4FGLA 3RPEA 2FDXA 4CETA 1I1OA 1FLAA 1RLIA 4XDHA 3OJWA 5ULLA 2ZKIA 3S2YA 1YCHA 4Y9UA 3P0RA 4QOHA 1TIKA 2QX4A 1VMEA 4PTYA 3W79A 4ESEA 2QX9A 1AKQA 4YAWA 3OX1A 1CZLA 3UXHA 1X77A 4XDGA 2Z9DA 4ICIA 1CZOA 4C0WA 1XYYA 3SVLA 3K20A 3OWHA 4BMOB 4QOGA 3F2VA 1QR2A 3W7AA 4BMPB 2F1OA 2W5UA 2QR2A 4GR9A 1XI2A 1NNI1 1FLNA 2MT9A 3B6KA 4ZVMA 4ZVNA 1AG9A 4LTMA 1AKTA 4OXXA 2QMYA 1ZWLA 4ZVKA 3FNIA 3NHYA 1SG0A 2QX8A 2OHJA 1FUEA 1YOBA 5FA6A 3QE2A 2X2PA 2D5IA 4DY4A 3D7NA 5NLLA 2OHHA 1QRDA 2M6RA 1F4PA 4U7HA 3TE7A 4N82A 3ESZA 5LVAA 1AKUA 1YCFA 3NHSA 1JA0A 3HLYA 4QOEA 3GFQA 4NULA 1QBGA 1J8QA 2XOEA 3QFCA 1FVXA 1RTTA 4F8YA 4FGJA 3O2NA 3N3AC 2XODA
chains in the Genus database with same CATH superfamily
3ELDA 1GRNA 4HFRA 1D2NA 2IEYA 2C57A 3SYMA 5BRAA 4U9UA 5A0VA 1NUQA 1SVWA 3LUAA 4P4UA 2VLBA 3RROA 1RWBA 3VR1A 1VRVA 5G53C 1C3OB 2VPQA 1U2SA 3B20A 1F6BA 2Q8NA 2OVFA 3LPLA 5EPEA 1RPZA 2CJFA 1H6DA 2ZSHA 3F3SA 3NO4A 3P5SA 4RDHA 5EZQA 1XNQB 1M9NA 1XF9A 3OA2A 1U11A 4P7BA 4AMVA 3N58A 2O8FA 3HDVA 3UMFA 4HTFB 2C2OA 1LSOA 3LFHA 3NHFA 3KL2A 2ODQA 3OZEA 4AVYA 2GZ1A 5IAGA 5DTMA 4RTKA 4WN9B 4CIYA 1DU4A 4IZHA 2X2EA 3C7CB 4GKAA 2GCOA 2VXBA 3EIUA 3NKLA 4LDQA 4NOLA 3C6MA 4X6LA 3FMVA 2DG2A 2W6OA 3JVDA 3VR3D 3HWWA 4WLFA 3DKKA 3CYFA 4GMHA 4DVJA 3A9CA 5C5IA 1NRIA 1T8PA 2JFBA 1CR6A 1CY0A 1L7QA 2YJ6A 1QYWA 4IGFA 1FPQA 5JUWA 4RIIA 2WWTA 2O2EA 1B16A 4NWIA 5A2GA 2ZI7A 2ZYUX 1MO6A 3GA5A 3DCNA 3O8OA 1PHRA 4HG2A 3SM3A 4CRWB 5BXYA 2QN9A 1VBNA 3PGA1 3R3XA 4G8BA 1NNLA 4EUHA 2JLVA 2VBIA 3RM3A 1N33B 3ANSA 2VYNA 1WXHA 5FCDA 2R7NA 1ORWA 1DHRA 1XQ9A 3DWGA 5JAZA 9ABPA 3I28A 5J1SB 3HK2A 4K9QA 1XZFA 2OBYA 5FOXA 1PJ2A 1R5BA 1W34A 5HPYB 2IHTA 1I2CA 2HMVA 1DIOB 3O9ZA 4ISBA 5AP9A 4DCSA 4R0NA 5IUJC 4FR5A 3WLJA 3HFSA 2YWCA 3GP3A 3JASA 3FW1A 3MBIA 4YO8A 1AMUA 1U0EA 3ZLJA 1JXMA 3RF7A 4DM4A 2WIJA 1VL8A 1HQCA 5JVDB 2J5XA 1NVAA 5IJAA 1O6FA 1E1MA 2RC6A 4DQ0A 3UV7A 4DG8A 2QS9A 3JQ7A 5G0TA 3O0TA 4TLLB 4JJFA 5CEJA 1SBQA 3IUSA 5I7OA 1ZSNA 3MGKA 5DYIA 1UT5A 4D4LA 3A14A 4B87A 3OKPA 2YY5A 5BRJA 1W59A 3PD7A 1Z2AA 3CG4A 2BDEA 5EGSA 5BSVA 5JAHA 1SC3A 1WUKS 4EG6A 1VFPA 721PA 3L7IA 4GOLD 1IBCA 2NSYA 4ZARA 4Q66C 3F8SA 1L4MA 2J5KA 3FPGA 1WMEA 4XX0B 3R9IA 3T3NA 4WLNA 1AHNA 1Q83A 2NPOA 3DYIA 1YQGA 5CJJA 4XVUA 3MM4A 1Q5PA 4EGAA 1YE3A 1WL8A 1ZITA 2PMBA 3TL3A 3FOWA 1ACJA 1PR6A 5T3YA 1EINA 2IU3A 5FUWA 3RG8A 2JIPA 2ONJA 4AZ0A 2I4IA 4LZAA 1UM9B 1JDTA 4PSDA 2G1AA 3LT2A 4UBIA 5F7OA 1HX7A 2MOKA 2R86A 3MTGA 1G5IA 4XPIA 5I9LA 4HLUC 1GD1O 2PMEA 1GKLA 1G2OA 2OR3A 4H16A 3Q0EA 4OY3A 4P5EA 5DX1A 3A25A 1R6XA 4KR6A 2HSWA 2AFHA 2QI9C 1VLHA 3EQ7A 3SBEA 2C42A 1S7GA 3U13A 5LP6A 1TZBA 2B5OA 4KXVA 4NBSA 4PBSA 5BSTA 2IPXA 4JBIA 3W06A 1EDZA 4LFCB 2V96A 4HWKA 2UXDB 3RRFA 1I5OA 3PC4A 1SURA 3HXOA 1EWRA 1C2YA 1KP2A 1YDHA 3HVUA 5HTOA 4Y0NA 3PL5A 2Q6KA 3RJTA 1AX9A 5B6IA 5IG2A 5GZ1A 2ZUTA 1PJAA 5LOVB 4IO0A 4GWLA 1BDJA 5FO1A 3U7GA 2EEPA 4DIKA 1QGZA 2FMKA 1SZCA 2GZHA 2BTEA 5CVUA 2BFBA 2F17A 2GEVA 2X9GA 2E4ZA 5TMBA 2IRWA 4OG2A 2R6DA 4AN1A 1JXOA 2QN8A 4KE8A 3IA2A 4BGEA 3KG2A 4GC5A 4B45A 2DH5A 1X8KA 1QHFA 2HRRA 2CNNA 2R62A 2RJ3A 3LT0A 2F4NA 1SELA 1P4SA 3ZEIA 1GG8A 3PGLA 3DMGA 5ITZA 3KQHA 1CZHA 4N7BA 1EEHA 3AB7A 3D0RA 2RHHA 4KYUA 4F93B 3OJXA 3RREA 1OAAA 2A4MA 3VM6A 5J1TB 5BV7A 4FP9A 4NEHB 3TW0A 1X6VA 3BWXA 1RXEA 4JYMA 1N6NA 2BI4A 4QVKA 4RE6A 4UNPA 5AR1A 4EX6A 1VA5A 4C29A 4ZOAA 4MUJA 1VKHA 2RGUA 1GU7A 1M73E 5BT8A 1TCCA 1T6BY 1YMQA 4RGVA 3PWSA 4D56A 2L0XA 3RAJA 3UMGA 4JBWA 1AK1A 4QLOA 5HIJA 1SK9A 1VMIA 3VGJA 3WHKA 1N57A 4YLEA 1B00A 2ZLBA 1DL5A 3OPQA 3KSBC 1BHJA 1J25A 4EW6A 2JI8A 2WFMA 3DL4A 1JDSA 4NDAA 4N8DA 1T3SA 1P5ZB 5CH3A 2OQRA 3IOYA 3TDKA 1U8CB 4C2UA 2B34A 2AQ8A 2GKOA 2MYPA 4JB2A 2D13A 4MITA 2ORVA 4O4HB 4G0MA 5DGCA 1K7EB 2J8ZA 5EHNA 5HUJA 3NHBA 1F3OA 1OXBB 4UJ5A 4ZVQA 3ASVA 2IK8A 2BM8A 2H7CA 3CISA 1RZUA 3KV3O 3VAAA 1OVMA 3UT5B 5AK3A 3H8WA 4KE7A 1XKTA 4RETA 2FQ1A 4BLTA 3GB9A 4XX1A 2YBDA 1T1IA 4HEHA 2GUGA 1MNAA 3KCNA 1L1EA 1Q2UA 1GNRA 3A6GA 3O2JA 4AZWA 5BXQC 4C07A 5CA1A 1BFDA 1FSGA 2P1DA 5FBRB 8MHTA 2ZI5A 1PKXA 1IB6A 4EUEA 1OLOA 1WULS 3UGQA 3H17A 1YDMA 2XWBF 4PC1A 1HYQA 4NDNE 7MHTA 4JODA 3WDSA 3FE2A 1QG2A 1GFZA 1YUNA 2V6FA 5CT8A 4OQDA 1FNSA 5LMUB 2G1UA 4H7EA 1IWBB 4KBFA 5CBPB 2W8BB 4W1QA 2LW7A 1KK0A 2BCGY 4Q9IA 5JC8A 2J85A 1L6IA 4KFUA 2PZEA 4YMHA 1F0YA 1TTPB 1JQDA 2FFHA 2QM8A 4WXEA 5C37A 2HY7A 4E2YA 1CDDA 3AJ8A 1E3LA 2BFDB 3KAKA 1ILWA 2ZE5A 1XTSA 4YMWA 1GEGA 2VPXA 3DZ8A 1F1JA 3PC3A 4J0CA 5IMSA 3S5UA 4YK7A 4HAVA 3ZZTA 4DXHA 2E6UX 3IVRA 1DWOA 4LSZA 2PXAA 3PA6A 3BTVA 4B5KA 1KXZA 1YKSA 3C3DA 4NYMR 3HFGA 4MJLA 4LRQA 4CNBA 1K7XB 3I1IA 3FDZA 3L0ZA 5EIBD 4LYGA 5BMVB 5EVCA 4XXHA 1CZRA 2CXNA 4IGEA 4AS3A 5DNYB 3ABOB 3W2EA 5I5GA 3FJ1A 2JRCA 3AR4A 2C4KA 2WT4A 2KB0A 2PVCA 3CB2A 5FLKA 1UXOA 4N9QA 1QHHB 4E5SA 1XPUA 3WJ1A 1DWPA 1E79D 2R6FA 4HV4A 1JIVA 2QDXA 1FJHA 4KN5A 2D7DA 1E9RA 4M7RA 5HRAA 2IDZA 4OPMA 4PG8A 3WGGA 1KS9A 4LHEA 1CIJA 3K1YA 3G85A 1JPJA 2O3JA 2QLFA 3ON5A 3GLVA 1ORVA 4JQOA 4DGQA 3H2KA 1PZGA 3ROZA 2QU8A 5JROA 2PUVA 3GLKA 4HAXA 4M0UA 4IV8A 2P0EA 3HR8A 1FTNA 2A9PA 1ZZGA 1II9A 3S2UA 3TCNA 3DTNA 3FZYA 2EIHA 1GZDA 3KSDO 5GADl 1P19A 3JVVA 2EC5A 4E31A 2Z5VA 4G0XA 3IPLA 3O47A 2QSUA 3B2NA 1E6KA 2XA9A 3D2AA 1A76A 4PQEA 1Y48E 2C8JA 2WAMA 2EV9A 2ZOSA 4PTLA 1R9GA 3GRRA 1PG0A 4PYIA 4ZO7A 3ZQ6A 1NT4A 2RAPA 3FNFA 4Z9FA 4NARA 4BO2A 2XV1A 4D0SA 2J0SA 3WLIA 3C7AA 1Q74A 4DM7A 3WB9A 3HVHA 4ND7A 4NBUA 3FMPB 3LM8A 5EXDA 3DEIA 4E5NA 5E4FA 1O5IA 5E8JA 1S6YA 1Y5NA 4ZK2A 4PRLA 3BQMB 5AJZA 2ACEA 4V0LA 3E3OA 3Q8WA 2I9PA 1AHPA 1WB5A 4F91B 4J1TC 1N2CB 4D44A 1CULC 5FX2A 1L0BA 1PL6A 3H1GA 1SXHA 2G09A 2WY2D 5JS2A 2CHFA 4DPMA 4XDZA 3R8CA 5L4NA 4YROA 4M1SA 2RHGB 1U9JA 1KFJB 1PFQA 4C05A 3T1HB 2PU7A 3MTEA 4MKFA 3NGLA 4TRJA 3U7RA 1RWXA 1WZUA 2CXOA 4OLAA 2ZIWB 4M0EA 4OL9A 4YRNA 1RHKA 5EXEA 2C96A 3EDOA 3WVNA 3T7RA 1GO2A 5AW1A 1H23A 2H11A 5T3UA 4LYAA 2FB9A 4N5HX 2CSXA 3QOFA 3LXXA 3PR3A 4X61A 1A9PA 3HRHA 3FY4A 4I5GA 4KXWA 4U3JB 1CQJB 3ET4A 3L7MA 3VH3A 3VHXA 1ADCA 4IIUA 1HGXA 3JAMA 1NF9A 2H3EA 4GEKA 3ZHCA 3MBOA 4PZLA 1SFRA 3IPXA 5E6SB 5EIFA 3IE2A 4LUCA 4JC8A 4N40A 5EHQA 5HM6A 1KSJA 3JQAB 5LIPA 4IMIB 4URHA 3DKIA 1JILA 3GLIB 3PSHA 1M34B 1RD4A 1E1NA 3S0JA 3FVRA 2J5BA 1V71A 1FS4A 4AI6A 4BX0A 1TJNA 4KWCA 4X71A 4N5DA 2A1UB 3SEZA 3TSZA 4AO7A 2ONYA 4Q3OA 3WDKA 2A3RA 4Y9UA 2XPCA 2BFWA 3P0RA 5KAMA 1XZIA 3AOEC 1JIKA 1LKZA 2PR2A 3A04A 3G0OA 4IX1A 4PYQA 3VI4B 2IU6A 5E7MA 5U1PA 3QPWA 1VGRA 1N7IA 1D9ZA 2XVXA 1DG9A 1NBME 3BBPA 4IJ6A 2BELA 4KPFC 1QLWA 3V8RA 2QRKA 1CVIA 4RZ2A 4TXNA 1USWA 3E2MA 3JD3A 3T5BA 3OPNA 2ZIFA 5HA5A 3DTYA 5BQ3A 2WD7B 3SX2A 3OX1A 1N5DA 5DCUA 3UXHA 1M67A 1JHQA 1X7ZB 2W71A 3CWQA 4EI9A 4IH4A 1QWSA 2HOQA 3QMMA 3BTOA 1WZEA 1KE2A 1EJ0A 4IHJB 1JMKC 5BNFA 3UBMA 2A5DA 4WOBA 2ZIZA 4EFDA 2NU6B 4MMYB 1AUVA 2IW3A 4CEJB 3CB4A 1LX7A 1YGPA 4KWEA 2GDJA 3GD5A 3L5KA 3R7SA 1Y1RA 1P1FA 4RKRA 3AVPA 5CFLA 3OECA 3TW8B 1QK4A 4FMPA 4QARA 1P44A 2W48A 4Q9DA 1CY8A 1LPOA 5DMHA 3EHDA 1QE5A 5JMPA 4A6EA 1EFTA 1XGKA 3QLVA 3GJ0A 3IQIX 1KC3A 4GOJA 5JSZB 3N2ZB 4FSHA 3LYHA 1R15A 1SEVA 3LNCA 4R41A 1GZUA 1U8UA 3M33A 4YJ2B 1VPVA 3UKDA 2ERCA 3ZWNA 1KYVA 3DUFA 3GOHA 4C6SA 1MX9A 1WX1A 2G25A 2RK3A 2XMBA 3B3FA 4G89A 4LYFA 1NBIA 4UUPA 4B33A 3VOTA 2NMVA 4ZO6A 2PLFA 1LGYA 2MT9A 3LDFA 2HC9A 2HV8A 1Q0UA 1X1DA 1XKQA 5FWNA 5JRZA 2HCTA 3IJ5A 1BYIA 3H0EA 3W5DA 1H4VB 2JCGA 2VHTA 2VDNB 1MV5A 2O3QA 4ZKEA 3BYZA 4RNDB 1VL2A 2OZVA 3NUZA 2OCIA 4MQEA 4OXQA 4Y1GA 1T1EA 1XD2A 3TL2A 4LF4B 3TLMA 2VUTA 2J1LA 1Y9ZA 3G5LA 5EQTA 3RRBA 3CUVA 1VTKA 1P45A 3GEIA 5FPYA 5SY9A 2B1GA 4KQCA 3NZEA 4L8LA 3AUSA 3IDZA 3PQ4A 1EG7A 1MT0A 1YOBA 2CDAA 4NECA 4WUVA 3Q7TA 3EDMA 5FP0A 4KV9A 4FE7A 1CUBA 1Y8CA 1RJ9B 1WHTB 4QZVA 4DV2B 4L9RA 3L8CA 3BKXA 4Q3EA 3ND9A 3WWYA 1NULA 4IR7A 5EE1A 5EMMA 2IT1A 2YFQA 3DA8A 3ZWVA 2P6UA 1BFKA 2Y92A 4WKOA 3TEFA 3TXYA 1XJQA 1YQQA 4Q9NA 4BQRA 3ZDFA 3RNOA 5LNK1 4KFTA 2VH1A 4GI3A 4BVHA 5JO0A 1SRRA 2WG1A 5MN6A 4O2AF 1OB5A 4MH0R 1YTUA 1LRLA 1S2DA 4P1ZA 1XMJA 1HKHA 1QX3A 3KYIB 2Z4TA 2ECKA 2ZDQA 1P1CA 3D8HA 3EXHA 3TN7A 5BUQA 4OMCA 2OQVA 4NE7A 4PO3X 2BDTA 2LKDA 4TRRA 3C5WP 3QITA 1JR3A 2W2NA 4CKBB 4RYLA 4EGQA 3THYA 5DM70 1PNQA 2WJJA 1CUAA 4R2IA 3UENA 3HJHA 1NAIA 2JCXA 4BVAA 4WJLA 4JVSB 4W9RA 3UAZA 4O4JA 2O2IA 2VP6A 3G2LA 4RIEA 3NIGB 5E2IA 4FB4A 2ACVA 2RARA 2CEAA 3VOBA 1MAAA 4WDRA 5J2TA 4D3XA 2CV2A 3P9QA 1X7HA 4I2NA 3ZKAA 2H4FA 1KMQA 3FTEA 4IRXA 5E1OA 3VR6A 3RYCA 4UVDA 5LZ2A 2KWIA 2XYGA 1YQEA 3PICA 1WP9A 4RFSA 1JLKA 3RI3A 2VK1A 4YDHB 2ZT6A 3R5FA 1Q1GA 3A9TA 1YJ8A 2BM9A 2B37A 1J97A 1GUDA 1ML3A 1O58A 4RU1A 3D54D 1RP7A 2XITA 1E20A 5ESWA 1T0JB 2OWEA 4V0MA 4KXMA 3AM5A 4MEAA 4R9VA 1YZHA 4ND8B 1ZK0A 2VDLB 3DBOB 4D45A 2XADA 3MT7A 5FEMA 2HNKA 1BH2A 4FNGA 4RL4A 2R8EA 3E3AA 5FBLB 1RRPA 1N3BA 2ZIAA 3NH9A 4YLGA 1U1GA 2P2ZA 3IUJA 1NQUA 1NM5C 4FMDF 1NRWA 4MWEA 1K6MA 2XVYA 3EVCA 1YCDA 2JH3A 4E88A 2PYZA 3I2KA 3K0KA 4KV7A 3TDMA 3GFPA 4LK2A 3GCWA 1J09A 1PJQA 3RVDA 5C4GB 3BHMA 4DNQA 5JHGB 4KBYA 4KQIA 5ISMA 5CIQA 1FP4A 3ZWBA 5JS7A 4Z9BA 3KM0A 5CVEA 3ZCPA 4X93A 3L6CA 4YMSA 1XZCA 3GLSA 3GPBA 3DOHA 1IFXA 2KE5A 4Y9DA 1Y4ZA 1TEHA 2ISQA 4NZPA 3A9WA 5EWLB 4D2IA 3T95A 4URVR 4GLOA 3NFRA 2QIOA 1SPXA 2ZRGA 4Q39A 3VISA 3W3AH 4AX8A 3QFHA 4PX3A 5ICGA 1CUDA 1L7RA 1XCOA 1HUQA 1PFWA 2A33A 4FYKA 3NBXX 4QT0A 4BMZA 3UFXB 1ID8A 2OB2A 5EWMA 3PENA 1TTQB 4AO6A 3OZCA 5CFQA 2Q62A 2VSQA 3FB4A 3D9QX 2PVPA 4RA9A 1CJSA 4UHJA 4LCBA 2O0LA 4D4JA 1WBDA 1VG9B 3O1IC 4JBXA 1WMAA 3EVZA 3ZZ1A 5KYYA 1YL7A 2AS0A 2WVAA 1ZC4A 4HADA 4HEJA 4P3YA 1VB3A 4P8RA 2IQ5A 2N1MA 2MSNA 2Q2NA 2Z4RA 4ZU3A 1CF9A 5BR1A 1L4UA 5BN5A 3MC1A 2BRUC 4MPTA 5AESA 4I50B 1R4NB 2CMKA 2HCBA 2JGJA 4G5FA 4WNIA 4XEHA 4CQLA 3D3WB 2AFHE 3C70A 4RA6B 2ENWA 4LZWA 2HQRA 2ZDHA 4YA6A 5CTAA 1RXSA 5DYGA 3D6TB 5THXA 4LDNA 2UVPB 4CT5A 1J42A 4I2VA 4V2UA 2FAXA 4P0TA 1Z2NX 4XUDA 3WSVA 2NU9A 3CLUD 1OH8A 4JOBA 2FLWA 1YU6A 1ZH0A 1PV4A 1K97A 1RM5A 5LQSA 1TLTA 5CK5A 1PR9A 1V2HE 4XFDA 1DQYA 5D1NA 2Q7DA 2WHRA 3ZY6A 3CGGA 4L75A 4B8WA 1HFKA 1YB1A 3HFJA 4EHJA 2IHBA 3BRQA 1CY4A 4WFIA 4FLMA 4JUFA 2O7SA 1FUYB 1V16B 1Z6GA 2CHUA 2H2FA 1W8IA 5KX5F 3ZD7A 1C3VA 1SWWA 4OO3A 2QYTA 3CSDA 3NW9A 1HOTA 1SOWA 3ZDQA 1N1MA 4B2LA 2QW0X 3EWIA 3I45A 2ASVA 1KYWA 3FGPA 2C9CA 2BMVA 3HB1A 4M60A 4XCQA 4B6EA 3VNVA 4CM4B 3RTCA 2DMRA 3G6WA 3P2MA 1W0KA 4GWKA 3VR4D 3GJ6A 3WJ7A 5IJXA 2NO0A 3BGWA 1T4CA 4HBGA 5FLXA 1UC4B 3REOA 2PV7A 3OJLA 4LY9A 4XRRA 1G5TA 1YO6A 4N8EA 3MS7A 4CMCA 1JEYB 1Q84A 2CJYA 3D0QA 4MVJI 1OAOC 3PC7A 1QPGA 5CMLA 2IU4A 3S28A 2AXNA 4W8HA 4QVIA 4XAQA 4Y9RA 3NOVA 4D0NA 1SIBE 4OX9B 2BLLA 4GX1A 1U3UA 2F1RA 5GQSA 3FIJA 2GBLA 4CL3A 5BVHB 4YNBA 4ZYXA 1Z4QA 1JWBB 1OXXK 4POAA 3A4VA 4B6SA 3BS4A 1CFZA 2ZYWX 5C52B 3VHQA 2EKZA 2HRZA 1GL6A 1P7CA 3UMVA 5JW6A 3NT5A 2RE8A 4E4TA 3ZTWA 1T5OA 1BMFA 3HDYA 1E89A 4FEAA 2BGRA 3VR2A 5FPSA 2C31A 2CHVA 1IEXA 3B1WA 4RLQA 2VNSA 4R3UC 1O9HA 3KYDA 4LTDA 2R00C 3HU5A 4WE3A 2AG8A 1E6UA 1OW3B 2BH9A 1KBOA 2C2KA 3PL1A 4ZI3A 3PHJA 3ZCTA 4LFAB 3GLFB 3EFHA 3A3OA 3L1HA 4WECA 5ALTA 3SF0A 4LSWA 4OUKX 3PHHA 1WNTA 1E92A 1O9BA 1U1CA 1CC1S 1XFDA 3F47A 4MS1A 4Z86A 5DNVA 3WE7A 3BGOS 3GG9A 1MZVA 1J0EA 2VJKA 4RF5A 4IDPA 4FK8A 2WF8A 3LUHA 1NLFA 4TRNA 1U7OA 3K0FA 4PX9A 3NHLA 4DAOA 5AXCA 2WJVA 3LSTA 4FDMA 4MP8A 1EBUA 2I7TA 3AFIA 3FDIA 4Q7JB 3EPKA 5MFZA 2JGEA 4FBMA 4HN4B 4GSKA 2RK6A 1W1UA 3K53A 2I78A 3C6ZA 2VQSA 3G8AA 2RAFA 2WPDD 1DTWA 2CCJA 3KPVA 5FWXB 1ECGA 1OCEA 1SC4A 1XTZA 3FWHA 3QXGA 4LNUB 3DQPA 2PJRA 2AN5A 3HEAA 3LPMA 4MRSA 1MXFA 1NMSA 2QRHA 5AQEA 1Q0HA 1TW3A 3TS1A 1YHNA 1GNSA 4EKIA 2V7XA 3AHJA 1MJGA 1U7PA 2YCBA 4V24A 3L84A 4GXRA 1D5WA 1I4WA 3K6SA 4Y98A 1TYZA 2HJHA 5E4YA 1Q1BA 1NP7A 3EVAA 4DC0A 2D0PB 4DMGA 4PPGA 4GYYA 2R7MA 5I5EA 3AR2A 2HHCA 2CD9A 3QGMA 4M55A 5AW0A 5AM4A 1UJBA 2JFVA 5CVJA 1T9AA 2VS1A 3F49S 4E4RA 3EDCA 3QNUA 2CK3D 4F06A 2JATA 5CA0B 2A88A 2BBOA 1ZK2A 3IT3A 3W5UA 1EJ6A 5BV1A 4MKHA 4KPEC 3HBJA 4DLAA 3UJ6A 1W85B 1RXWA 4FZRA 1DXYA 2C78A 2GEBA 4RMIA 4MUGA 3RH0A 4HB4A 4QYIA 2NG1A 3KE8A 4R1NA 3QX9A 1Y7IA 1ZVJA 1VMKA 3I3SR 1Y8RB 2R60A 3G2JA 2HWKA 2WICA 5BVGB 4FMCB 4BNIA 2X5NA 3WKCA 4ZICA 1BKYA 1JYFA 3VTZA 4TQ9A 4U39A 2CLLB 5JNUA 3K71B 4Y6PA 3NG1A 3IRUA 2RI0A 4PM4A 3FLMA 3K8YA 5AK4A 3RS4A 3VSAA 3HH8A 4D9CA 1L4NA 4PSUA 1RM3A 1Z2CA 1PGOA 3NHKA 4BC0A 2H0AA 2WFLB 1LZLA 1ZOSA 1TC1A 1KR5A 3KFXA 4CUZA 2LGJA 1N25A 3CUWA 4RKFA 5FWYA 1IXRC 5C1IA 3OCVA 1P33A 1T2NA 5K8TA 4XM1A 4Z4IA 2O07A 3O1JC 1QTIA 3MXTA 2QLMA 1KPIA 3M83A 1N5LA 2HEIA 2O0JA 5J23A 5ALNA 3AM3A 1E3MA 1G8FA 3QH4A 4KIUA 2JFQA 1SB8A 4Q1FA 2XUJA 2I3BA 3G7NA 1XROA 2DGDA 1EK5A 1KNQA 1O94D 2L69A 3CUUA 2QPTA 4OLJA 3O4IA 5EA2A 4DSTA 1HDRA 4KO8A 4D7AA 2P9CA 4KUGA 1L4EA 5KNCH 1NF2A 1H8HD 4WK4B 1DKRA 1YI1A 1WAMA 2HPVA 3KZKA 1CZNA 1T3TA 2ZDGA 3PT9A 1GLNA 2A67A 3ZS9A 2QN6A 4GPEA 5E3JA 5IDYA 2GXAA 1X87A 3JSXA 1Y3AA 2J9ZB 1NHGA 5E3IA 3V4OA 4BFLA 5G0SA 4I55B 1KPGA 3WO0A 1I1NA 1KK3A 1C0PA 1QP8A 3M9WA 1H2FA 5B3AA 3ZC3A 1JDJA 3SDBA 1KMIY 4DABA 1ZKDA 4QBHA 3EVEA 4F4HA 4ZHQA 2IC5A 1M1YE 1OXVA 4V0OA 3BXGA 5SYMA 1JHDA 4P82A 2ODEA 5AUQA 2JK0A 3C4JA 1O96A 3U40A 3RGWS 4MO9A 4OHFA 4N3GA 5L6MB 5DHFA 1Y3DE 4GX0A 2B20A 3DGFC 1BJTA 1TQ6A 3C6BA 2RG1A 3HI6A 1GTJ1 2OM2A 3GRKA 5K0TA 1A9XA 1CQIB 4HVCA 4AB1A 3UF0A 2VTBB 1VL1A 3BMQB 1SQ6A 2Q6IA 3OLQA 5ICSA 2WWRA 4NMXB 4QUDA 4R9UC 5F9MA 3I5MA 2NVUA 3HHEA 3OH8A 1NLYA 4IQGA 4U2FA 4P84A 5J4KA 1QDEA 5IRCD 2CVFA 1URPA 3NFYA 1JTEA 1C0EA 4IX9A 4J7AA 4XE5A 5CXXA 5FOQA 1W44A 4DLTA 4G0WA 2IUUA 3FGNA 1DEAA 1TX4B 1LDEA 2XD9A 3ELBA 4B48A 4ZAXA 4OKNA 4LF7B 1AO0A 4GBED 1KIAA 3OT4A 4B0PA 2OO3A 1L1QA 4I1UA 4Q4DA 4DCJA 1TD1A 2AUMA 4FW8A 1MLDA 4KQMA 5F4BA 3ZX5A 4ZEVA 1OI7A 3I05A 1NJ6A 2NXJA 2REOA 3ASYA 3T9BA 3WO1A 4WJKB 2JJ8A 4EATA 2QN3A 5JARA 3JQRA 3DHEA 1D6MA 1RM4A 3UOWA 2Y4OA 3DE4X 4UCQA 1RAFA 3OLWA 4FBGA 4R8SA 3EZ2A 1R18A 3GVIA 3FSEA 3L46A 3DWEX 1HTBA 3BDAA 3HSSA 4K9OA 4RD1A 3TBKA 4ARCA 4NABA 4YDQA 1NOIA 3LGAA 2O2JA 5A7FA 2H1SA 4FDTA 1XLVA 1SD5A 1QXSA 2JFWA 1DEHA 1QZUA 3F67A 1GDDA 4LJ5A 1SHLA 2R8PA 4OL0A 5IT9A 1I6LA 4RDIA 2QBYA 2DR0A 5ES4B 5KHLB 1DUVG 1G3RA 1XJ0A 4IIVA 4WFJA 4EHHA 1ADFA 1T9KA 4RC9A 3T0GA 4ZMSA 2WHQA 1ULAA 3KC2A 3BXHA 3GHHA 3UCFA 1PRYA 2EOAA 3B36A 1PT9A 3L1JA 1RADA 1J06A 5I9TA 1C4WA 3NIDB 3ILSA 4A10A 2HQOA 2P7HA 5KNBD 2YJ3A 4PEVA 2FN8A 1P3DA 2X42A 2A59A 2AOUA 2Y3IA 4W7IA 5KS2A 2VUSA 3OQHA 2C7OA 2WSMA 1KJIA 1GKYA 3A6KA 1U31A 1YR8A 4LJKA 3M0EA 4UULA 3ROEA 1VIVA 1JSZA 2VP2A 3U5ZB 3V34A 2GZ2A 3K9NA 3K9WA 4FS8A 4O2AB 2XCQA 3CVOA 2G0NA 2Q5EA 2R1UA 4LXUA 1IMOA 3H6HA 5HGXA 1CZOA 2IYQA 4NCIA 1G3IA 4TXMA 1A7JA 2GPWA 1ZIYA 2FSIA 5EQJB 4Q7MB 3U3RA 1D1PA 2DUNA 2Q4OA 4GQAA 5A6VA 4AQYB 3T3MB 4EB6A 4O08A 2PWZA 1EA5A 4L27A 4ESVA 4P38A 1JJFA 3WQRA 5IABA 3X43A 3QLVC 1KR2A 2RGGA 4X20A 2AEJA 1MC5A 2WABA 3A28A 5C31A 5AKHA 1CUEA 2PXCA 3UHFA 3L7CA 3O3MB 6LDHA 1LH0A 1UMKA 3C3MA 1XVVA 3NBFA 4IHAA 3BHIA 3NT2A 2XCRB 4PQRA 1ISHA 3WB2A 1F9EA 3A7DA 1UJCA 5DX8A 5CFMA 2J9GA 1ZNXA 1OXTA 2CXQA 2EJVA 3H4MA 4MCJA 5TGTA 3ZS8A 1DXHA 2XUDA 4F84A 4YCCA 9LDTA 1NNI1 1V48A 2JBWA 2P90A 5CH5A 4YCBA 2BFCB 4ZOBA 5D87A 3JAKB 5ALYA 4YJ3A 5IWAB 4AY2A 4L76A 3V1MA 4NZOA 1TM1E 2Q3EA 3DOEA 3VZSA 2DXIA 2AZ4A 1L4LA 4TMVA 2DEUA 1JR3E 3SMQA 4CM6A 3FWPA 1TYBE 3K0HA 4PG7A 3JQAD 2W2KA 4G5SA 4CMBA 3STWA 3D3JA 1LQTA 3NHYA 1JQAA 4D92A 5AK5A 4GAEA 2NU8A 3AJEA 3AI1A 4HQRA 2BP7B 2FP3A 4RIGA 5TPZA 5A5FA 2OUKA 2BMEA 2WEKA 4AY6A 3AR3A 1ZIXA 5FULA 4AU1A 4B3CA 3OZUA 5JBIA 5LWQA 4UEWA 1Y33E 3QE2A 2IJGX 1MJ5A 3TJZA 2D5IA 2Y1OA 1QONA 4DLSA 4F7DA 1JHMA 3GOQA 1PT8A 1TGVA 1YFLA 1OH6A 4H1UA 1E2IA 2RGWA 1IN4A 3HJBA 1P9LA 1SB9A 3QF4B 4U9IS 2W2OA 1L5HA 1N1DA 4FYYA 2O0HA 3TBFA 2E5FA 4RESA 2CY0A 1G3QA 1KDPA 1WR8A 1Y4SA 4V0KA 4BNHA 3TE7A 2XRMA 1QDUA 2EJCA 4V0ME 3BHNA 1IOLA 2XCOA 3OEHD 3RC2A 4C0JA 4RVUA 1AKUA 5JVDF 2HQSA 1RPAA 1MX1A 2JJ1A 2PEZA 2UKDA 1QIMA 3Q15C 2CUNA 2VIIA 1QBGA 1YJQA 5JWOA 2F3PA 3Q3VA 1XOIA 3I73A 2B1JA 2H1VA 1AB5A 3STVA 3WWCA 5TMPA 1QVWA 2B2CA 1HNNA 2QRNA 2IHNA 5ALRA 5K9ZA 3NI2A 2BFAA 1UINA 4FJ0A 1QORA 4FQ5A 4Q4LA 5LA6F 3FZGA 2YVKA 3LRXA 3N53A 4XM2A 2OGWA 4O4IB 2XODA 3CEMA 1CHNA 2JFHA 1CS4C 1IC6A 2WV7A 4AMYA 4QFMA 2V7EA 4Z1MD 5A4DA 5B58C 4GZLA 4NX2A 2NYVA 1UZMA 3TNFA 3SBDA 2FN3A 1YAHA 4HAIA 1QGDA 1G6KA 1DOZA 1S7CA 3N6VA 4PZCA 4YRAA 3AI7A 4LE1A 3PUHA 3AETA 1X13A 2XNJA 3GJQA 4UTZA 4L3WA 2V58A 1VG1A 3I64A 2RHJA 3FKSD 1P1RA 3ONFA 5DCYA 5KTPA 3ZD6A 4GI2A 3H65A 3B85A 4WNCA 4OM7A 1FTWA 4FVTA 1GAEO 3NGXA 1KFKB 1R7RA 3LDAA 1NE7A 3EIQA 2PIDA 3KQNA 3TDNA 3IC5A 2GEUA 1CIVA 4PZPA 2IEBA 3B8HA 3EVDA 4UASA 1GTL1 1LBSA 1L8AA 3TPCA 1P17A 3ZU3A 3CLHA 3OQMA 2V9PA 4DNOA 5IJ0A 3OAAD 1PLKA 2NZVG 3CR8A 3HJUA 2EATA 1RW4A 3EH1A 4LJ9A 2ZYSA 4OP2A 3UQZA 4RWZA 1RC1A 2YVUA 2I62A 1I0IA 3AH8A 2W83A 3RUHA 3GU3A 3Q5GA 1Y1QA 4IV0A 3KJZA 2ECQA 4TTVA 4YBZA 3P2KA 4ZCQA 1PJ4A 1QAMA 3UJHA 1AH2A 1ILEA 3DBHB 3HKBA 1I3OA 3TLXA 3F96A 2YHIB 3COZA 4X91A 2H59A 4RK1A 1T5TA 4Q7EA 1Z6PA 5ANRB 1DC7A 3QKSA 4HDKB 3T7IA 3U4AA 1YZFA 5U4QA 3SLKA 2JCSA 5KTMA 1QU3A 1KC1A 3M2TA 4YRMA 1Y6GA 4RFLA 2I4MA 3I9FA 2WTMA 4GE0A 2BE9A 1XZGA 3UJAA 4QTXA 3OCXA 1GQQA 2PGDA 4IYJA 3AEQB 4O2LA 4ZRDA 1QDLB 3AVUA 2XUHA 3PE4A 2F1JA 2XB9A 1FX1A 3T5AA 3O8RA 4ZEMA 1QTQA 3QTTA 5JQGF 4EF6A 1FDUA 2MINA 5JI2E 1II0A 4X5OA 4NMWA 1XJCA 1EUCA 1C7EA 4HX5A 3BB3A 3O4RA 3FDFA 4MK4A 4F1KA 4NCBA 1ZX1A 4IM7A 4KIJA 2EEZA 2SHKA 4W5TA 4C87A 3KOUA 3ENVA 1M6VA 3EODA 2CD7A 2OSVA 3I6BA 1M5TA 5EIEA 1MOPA 4BGDA 1LV8A 1X19A 2M9MA 4U6NA 2I7XA 4HCJA 1K3FA 1U3FA 4MGYR 3TM5A 4YP5A 1FYVA 4LECA 5KKCA 3M34A 3NHAA 2N1BA 5CHEA 3P32A 2OBMA 3G9TA 2XCIA 5K3BA 5TJ9A 1E9FA 4QM6A 4JLBA 3ZHOA 1F0KA 1WCXA 2EDAA 3TIVA 4EO4A 4QYMA 5DGTA 4C3ZA 3MTDA 2OV6A 2CBZA 1T8RA 1U2GA 2Q9AA 4DLUA 4N65A 4B5LA 4F6CA 4YT2A 2OILA 4BQOA 4QU0A 2O8FB 3WK7A 1E2JA 1G9SA 2A9JA 1SUAA 2INGX 2OCDA 3G2MA 3NR2A 4UUBA 3LECA 3AFOA 3QBVA 2P9GA 3RKUA 4N6OA 5L53A 1QH9A 1ZUIA 3BOSA 3GJZA 2ESRA 3LPAA 4DR2B 4FFLA 4V2IA 2GCOB 3HZZA 2PQ2A 9LDBA 3EGIA 3S3TA 4P58A 2AUNA 3LW7A 4HB3A 5JE8A 3IHTA 5GINE 1KETA 1D04A 1QYRA 4EPVA 1KU6A 1STOA 1VI6A 3A37A 4TS3A 5H4HA 4KAJA 4DNXA 3HJRA 1G0NA 3ZDDA 4C4XA 4CTOA 5JFOA 3BB1A 2WQZA 1HYEA 4M1MA 1VKOA 2PX5A 3B13B 2JARA 3RYHA 2GBLC 3U4DA 2WV9A 3O8OB 3O4VA 4EH1A 4F71A 1X8XA 1EE1A 4C30A 4YLYA 2ADOA 3O8LA 1KYQA 4DQLA 3VPXA 2B83A 5KSZA 4ZAGA 5C1PA 3BJZA 3EIEA 1X38A 1UDAA 2QTGA 3BFJA 3QQPA 1V0JA 1G7SA 4L7VA 4JASB 1F20A 4OB7A 3T9CA 4U2GA 3PTLA 3CEJA 3MWKA 3WYBA 3IR5A 3N5CA 1EZ1A 3OZGA 3UAOA 4KH1A 5AI0A 4IWNA 5BMVF 2HLDA 3JASB 1ZISA 4NSNA 1B4DA 4M9UA 1LBTA 1YDEA 5L7WA 5JXWA 1NW7A 3KPUA 4BKOA 4ESHA 2FZEA 5JPCA 4M4SA 1L7NA 3JPWA 2FMTA 1LJLA 1NASA 3FUWA 2ZUSA 3JQ7B 4TT3D 1EDEA 2HO4A 1A2OA 2O0KA 1D6JA 1LV7A 4YX9A 2O8VA 4BLUA 1GFSA 1XZDA 4H27A 4PTZA 5BN3A 4ZMBA 5ITVA 4MUEA 3ABSB 3Q72A 2PE5A 4KOEC 1IOVA 1B14A 3FFAA 1S3IA 1ZS9A 4LTNA 2GYYA 4HNHA 1EEXB 4UFOA 1QIKA 5CVVA 4CQMA 1E9SA 1SKYB 1WJGA 2RHBA 3NHWA 1GZ5A 2I2DA 2Z3VA 1W5SA 3CRMA 4MIKA 5FXMA 3V8VA 4NXNB 1KI2A 4UEJA 4ALLA 1PGQA 1RAAA 3E5HA 5AOAA 5ERGB 1JIJA 1PZXA 3MFQA 1P6QA 4IVRA 3GA7A 4S1VA 3WP0A 4E15A 2Y1XA 2XRFA 1YASA 3T7SA 2JAXA 3LCCA 3VVCA 1T2CA 2NZXA 1EHYA 3HU1A 2BM0A 5AJUA 1SQ5A 3GRYA 3ZHSA 5M3BA 4AZ0B 4KP7A 1WPXA 3KB2A 4G07A 4NEQA 1ZGJA 5DLDA 4B6QA 2Q9UA 4AKIA 3N0RA 1NWHA 4XPIB 5F98A 4D4HA 4I5FA 3EXAA 4IEEA 3ROMA 3QPBA 4FN4A 3WL5A 1I3MA 2AFHB 4KU4A 3SQMA 3UO8B 4DSAA 4GICA 2WA1A 2PYIA 3WMFA 5LP6B 3LT1A 3RGGA 4GP9A 3K16A 4GNRA 4RY2A 5FOWA 3UUWA 2B35A 1EIZA 4WSOA 5C7IO 3KZCA 5EPOA 3GWGA 4Y6LA 1QFZA 4HVLA 1GT6A 4JR2A 3M5DA 1G21A 2ATEA 2XYPA 4FZ5A 3M3PA 1DUSA 1LJUA 3PI7A 3I9MA 3LDUA 4RQTA 821PA 3U2QA 3T3OA 1JU3A 2BFBB 3AIKA 3WLSA 1P6XA 4NFLA 1XA0A 2C7GA 2VJOA 3EK2A 4G67A 2VJPA 2GZMA 1HQKA 3H9UA 2V4MA 5HF6A 3W6NA 5JADA 1VP3A 2PEYA 3E3NA 4WX2B 1KOGA 5ITZB 5EY5B 3DC7A 3UMSA 3FPSA 3W5VA 2I3GA 2PWAA 1P9NA 2Z5FA 2OYRA 4H08A 2X14A 3OOJA 4D4GA 4NEGA 3AWDA 1C3EA 1N1EA 3BVPA 4JT2A 4OK5A 4R1SA 5JD5A 3X1DA 4Q7LA 2A5YB 3GAZA 4EMTA 3QWBA 2E6KA 2WU0A 4M9RA 1T5LA 5I9BA 4NOJA 5THQA 2AA3A 1H2RS 1P77A 2ERYA 5E9JA 2YJ5A 4ZU1X 1U2DA 1O6GA 4MZXA 5CM8B 1S8NA 4EENA 4ZAWA 2GM9A 2VCEA 3N74A 3IXQA 4DR1B 1H2BA 3CXUA 4F45A 3L49A 3TQHA 4EW2A 1WD7A 3AR5A 3KOZA 3PPIA 1VXRA 4N18A 2CNKA 5JCJD 4W5JA 5A4KA 2DWOA 5BWOA 1F8XA 5D3MA 2XECA 4Z7OB 1BEUB 3ZUGA 3PNPA 4F4FA 2Z83A 3ETEA 1M83A 3CWZA 3E7WA 2Q1TA 4FGWA 2GN6A 4K3UA 3FG9A 3KQUA 3H5VA 2C7PA 5AVKA 1CJKC 1HORA 4G1MB 1UBUS 5CA1B 2WPNA 1P7YA 2X5XA 2H00A 4LDJA 1NJ5A 3ADBA 2Q1WA 2B7LA 3GIWA 3SIXA 4OHXA 4IHJF 3WV5A 5AKJA 3G0BA 3JYOA 1NP3A 4JWTA 3RFCA 1U63A 1TYEB 2WMNB 4S1OA 1M66A 2Z6AA 5ITSA 1XL0A 1GPBA 5C2JB 5HUQA 3OZSA 1XU4A 3DO5A 4KUEA 4JGIA 4H4EA 1PJTA 1COWD 2B1QA 2KJQA 3WA6A 4IGAA 2FPMA 3VOAA 3ZGYA 2OQIA 2ZK7A 3MOIA 1QS0A 4ZAYA 2QVZX 3TO5A 3KD2A 5EINA 3WSWA 2VSNA 3PDWA 4Q3BA 5FL7A 4BP3A 3A1CA 4QXRA 1NMEA 2PH1A 4QLBA 4TSFD 3URKA 4J0HA 1UJ2A 4K40A 1KK2A 1QO0A 3O91A 4QRIA 4UHKA 2IUYA 5HBGA 3K70B 4WLOA 1YBHA 4YJ2F 1BH6A 4WLUA 1BQ3A 1QIHA 1MG0A 1NUSA 5TT0A 4B81A 3C7TA 3FDZB 3RQIA 1MUUA 1YDGA 1QMPA 2CLSA 2H4HA 2VRWA 3OHMA 1GCIA 2C3YA 2HFKA 3H16A 5LBUA 3VKVA 2DPYA 4P0PB 3EOAI 4DC9A 4NS4A 3IAAA 3H2BA 3JQFA 4Y2YA 3V00A 3OFVA 5HRCA 1PWXA 1R00A 3ETJA 4CI0B 4F86A 1A96A 2BTOA 4P4LA 4IJMA 2ZSBA 4L6AA 2JFYA 4TWAA 2PKQP 1TM3E 4HZGA 3T5CA 5KQSA 2NUTA 1Q57A 1Z0JA 3WS7A 1R8YA 3UMCA 2FPPA 2OKCA 3MWFA 2ZKIA 3ELUA 3I42A 1EUQA 4QBGB 1BEZA 1GKUB 1ZU4A 4GBJA 1ZJJA 3LQQA 3UPTA 3DHWC 1B8VA 4Y1RA 2ORYA 4F4DA 1CBUA 1T9ZA 2VRCA 3HN2A 5CT6A 4ZGWA 2D06A 2GJ8A 2ZSIA 1TIKA 3VOSA 1WVMA 3AHDA 2GXSA 1YV9A 2PX8A 3QVGA 1SOVA 2QE7A 1F0NA 4L2IA 2ZCVA 1H5QA 3EGWA 2QMHA 3C3EA 4OOEA 3D0OA 4BO1A 4RPKA 4GZ6A 3FHOA 1UJMA 2OD2A 4E70A 3N8IA 4PQGA 3RWBA 2C20A 2XHZA 4HRVA 3U9TA 5LQMA 5BORA 2IPMA 1J56A 5DM60 4DA6A 2W0MA 2OAQ1 3KXLA 3UEOA 1WVGA 4JENA 4KXLA 2R6R1 4G4GA 2YXDA 2HK7A 1DQPA 1T5IA 4G5OA 2QYOA 3A4YA 4JCCA 5CGQB 8LDHA 1G38A 1ZMRA 3SSAA 4A36A 3IKTA 2Y77A 2J4CA 2IH5A 1KNXA 2XAAA 3WL4A 1VCHA 2X1VA 4L3OA 4EKGA 5DNWA 1U04A 1QQAA 2I5PO 1DAGA 4XEUA 5EQDA 5BT9A 2PX4A 1G8HA 1ZW6A 2ADFA 1JLLA 1TRHA 2DC1A 1QR2A 3SD7A 4F3TA 2F6RA 4R16A 1GNTA 1I2MA 4U02A 3TAXA 2W5UA 2R5WA 2B78A 2IODA 3Q3GE 4R2MA 5CNMA 1IHXA 3LT4A 1W73A 1O08A 5CG1A 3Q3HA 4ABTA 1I3LA 5I9IA 1JG3A 2P4SA 3IPRA 1M1YB 4I4TA 1EB9A 2CWDA 3IQWA 3U39A 4BNDA 1ZVQA 3VHXB 4D4IA 2ZAGA 2DM6A 5H02A 2NNWB 4UD2A 2C8VA 4AP5A 2UVQA 1HC7A 3L2OB 4J16A 1TF2A 1AQIA 3MYYA 1S96A 3F0TA 4NU0A 2GJKA 3BFPA 3IAS1 3OE7D 2RHOA 4PSKA 1YS7A 3VUEA 3LLCA 3VJKA 4KACA 2D5AA 3GELA 4OXXA 4XLTA 5IP5A 1JN0A 2QPAA 2RGAA 2ZBFA 3NCTA 4LJ4A 3CVVA 2FSVA 1SUDA 1XIVA 4M1TA 1FIUA 1PVOA 4PFKA 3BWMA 1RXUA 2YY7A 2ZBGA 3TZLA 2PX3A 4Y2PA 2XNCA 2ZXEA 1QQ5A 3QA3E 4AJ4A 1D1SA 1QO9A 2H5IA 4C5CA 1KDRA 3LA6A 3R20A 3IOCA 3T7JA 4E3WA 1N8SA 4U2CA 4ERXA 2JLXA 1S1MA 1WTCA 1X8LA 4S1TA 5HDBB 5IH3A 4FC7A 4DS3A 4EW3A 4KWHA 1PTJA 2HXYA 4AJNA 3RAPR 1NN1A 4Q4JA 4XYBA 3WC4A 3ISTA 2ZYGA 4WNAA 4BIIA 4M7OA 3OEEA 2YNMC 3ZXSA 4M1EA 5KTRA 2AL7A 5CDSA 4M22A 3FLAA 2UZ1A 1NZJA 1UWCA 4RPIA 2IHVA 6AT1A 1P1IA 1JKMA 3GJXC 4NAHA 2PZJA 4JEUA 1RQ7A 1RYFA 5KYUA 2GH1A 3HUFA 3YASA 5K4HA 3KKMA 4IDGA 2DRIA 2PJZA 3MS2A 4UEQA 3ZH2A 2WNHA 3PB3A 3DE7X 2C7BA 2FZCA 3N6RA 2X8JB 1HYGA 4HH3C 3QFCA 4LYYA 2W2MA 1XTPA 1D9XA 1P4HA 1PZFA 2OLKA 2W2PA 3IIJA 3JR7A 1RYBA 3KWFA 4V1CA 2D0IA 2XXAA 4JU8A 4P53A 2CHGA 3EBOA 3H5OA 4FHDA 4LYEA 4LJYA 2EQBA 2V03A 1A9SA 3E8SA 5TIIA 4RH3A 1GEEA 1Q15A 1N8NA 2ZQZA 3M3HA 4KLZA 2W58A 1Z7EA 2VQ6A 2IEAA 3O9VA 1A5AB 2D2VA 2W6JA 4RVCA 4A8HA 4QEKA 1TQ4A 2BFMA 4WKCA 2P5SA 2PY6A 4KXQA 2GF9A 3DUFB 3KT0A 2WI8A 4WEOA 3JZFA 5LBIA 1UBCA 1U02A 2IP1A 3PHGA 5BOSA 3UMMA 5AM2A 3C7KA 2ZBPA 3GFRA 1IYZA 3QVUA 1DRVA 4X66B 4LDZA 5DKFA 3TKLA 4EGCB 2OG2A 1IK6A 2Q7OE 3WQHA 1KEEA 2V5UA 5JR3A 3TK1A 1Z5PA 4A8JA 4MQEB 4BIMA 2G63A 1C9YA 1PW7A 5EIOA 1XD2B 3T1YB 1I8TA 1C1HA 4KW7A 4M49A 4N54A 5DYYA 2D2IA 2BYTA 2ATCA 1PNRA 2GFQA 1VXOA 1UZAA 3CT6A 3LG2A 2R4TA 4OQNA 4Q47A 4IXDA 3GDOA 1LFAA 3D6UA 2R751 1KO7A 1SZPA 3LO8A 2YZGA 1J2YA 3L4SO 3FTNA 2QRVA 2W93A 4JK3A 1LDBA 2O2YA 3GYBA 4LWZA 3N8DA 2IU0A 1UC8A 3EQ6A 2OY0A 1W2GA 4NCHA 4UU7A 3WG9A 2QW1A 4RPHA 4X1IA 4RULA 1D7AA 4PFSA 3PQFA 1V11A 5WRFA 5AQ1A 3VKUA 4Y2SA 4ROSA 4GDFA 3KWLA 2EG5A 5C1OA 2JJ2D 2V55B 2FEAA 3EXHB 4TUYB 1P4JA 3VX4A 3ZJUA 1IXKA 1ZPDA 2V7PA 2ZSAA 4JH0A 3SQWA 3HE3A 5K3DA 4JXJA 4L73A 4ARSA 3QOYA 3THYB 2JLSA 4K1XA 1IQPA 2D1YA 3VYRB 2C2WA 3L1IA 2HRDA 1A7AA 1O97D 1VGVA 2E4WA 1QQBA 5TSDA 1TPYA 1JSRA 4O4JB 4G37A 5SZKB 3SZ3A 4YPFA 3F5DA 1H2ZA 1UZNA 4W7HA 3N2NA 4Q1AA 5J2TB 1VIDA 3FB1A 4QPJC 4URXR 4Q15A 2Y8EA 3G9UA 2B7CA 3RVMA 3ZHXA 3I9NA 1G60A 4JFAA 5DCLA 3RYCB 1HKUA 4G86A 4K9LA 2Q8QA 2BMAA 3FUXA 3PZRA 4RFSB 4ZC8A 4E03A 2VQFB 4EF4A 1N2IA 2Y1GA 2UDPA 1P2TA 4PYOA 3B38A 2IVFA 5ALSA 4BRZA 2CDRA 2VQDA 2NGRA 2W70A 1QKKA 3B5JA 3NNNA 2DBZA 4B80A 2X58A 4HUQA 2IFTA 1BVRA 3FOCA 3ZGVA 3IT0A 4NH4A 1E18A 2C2ZA 2K5UA 1E5XA 5E1MA 2P27A 4NS1A 3PCTA 1D2CA 5EIHA 2FEPA 1N75A 1NTOA 4EG0A 3DE3X 1ZLYA 1E61A 2J67A 1DIAA 5GM1A 5AVSA 1TKAA 5ALGA 2YX1A 2R8XA 2AVDA 1JG1A 3VKHA 2RIRA 1SZDA 2JAQA 2IOHA 2VDOB 4H1HA 1LXCA 5F52A 3LXUX 2JASA 2QI9F 1G1MA 4ER6A 2H16A 1VPWA 2C2BA 5CRIA 1CPYA 4WA8A 2LUOA 2ZUBA 1Y37A 1NW8A 3EGVA 1FP4B 3K09C 4NTZA 4G5RA 4N39A 5ICCA 1PFUA 4ER3A 1LVHA 4K8OA 3OZTA 1L9XA 1R8QA 1UPXA 1GFWA 1I1HA 4FWTA 4AROA 4J7UA 3QMVA 2RH5A 3L0YA 3OPYA 1U2TA 5AJVB 4BPRA 4FMCF 3DF7A 3DYBA 2Z08A 5K6AC 1YWGO 4C06A 3OIDA 1G98A 3QU4A 4MCAA 4LVNA 4OREX 4QREA 4YI3A 5EWMB 4IJVA 5J5CA 3UQYS 1XCGB 1ADGA 2DWCA 4O33A 4G97A 4X60A 4N3NA 3DM9B 4TVKA 5AICA 2P2CA 3SZMA 2RBGA 4XGQA 4YAOA 3AF6A 1NMZA 4L1KA 2F9MA 5IZCA 3LP5A 1QJCA 2RD2A 2VSXA 2VPWA 1BRTA 4E2FA 1ODLA 1EJBA 4FFVA 3RABA 2Q3FA 5BN5B 3ZIAD 1YJBA 1HE3A 2VRBA 1F06A 1VLJA 3NVKI 4CQLB 5HZMA 1NIPA 2XXBA 2B8EA 1USVA 2RMKA 4KR7A 1EIWA 1SVLA 1JQ5A 1PWEA 1PZEA 3A2NA 2ZIXA 1VPTA 2JGIA 3BXPA 3DMHA 1I3CA 2Z04A 4PSVA 1KMNA 4CTJA 3ILVA 2TS1A 1QG4A 4TVOA 2RK4A 1OXKB 2ZRQA 4U9HS 1EGVB 4YV2A 1COZA 3FR8A 4QHYA 1W4CA 1BKSB 2WUEA 3P9YA 1TCAA 6YASA 1QOQB 4OI1A 5FB3A 4CMEC 2ZKLA 4MAFA 1XDSA 1VJRA 1JWAB 3THRA 4AUEA 5LYYA 5A02A 3DE2X 3L6UA 5IF3A 4CI9A 4DCPA 1YNOA 1M1UA 2XGOA 2GO7A 5DYNA 3ORHA 2UVDA 3EF1A 1J6UA 1LS6A 3NJ4A 4I55F 4JOQA 4HUJA 3U9SA 3T0FA 3M6XA 4B7UA 4BNZA 1PUJA 2HZ7A 2JVJA 5HKKA 1G3MA 2PL3A 1MGOA 2HRQA 3MWDA 4JLNA 4WPGA 4RK7A 3EOBI 2OO5C 2JGFA 4ZI5A 4ZAZA 5JG7A 4L4YA 2CFIA 5F7XA 5DHPA 5C7LO 4DCNA 5EIAA 4YWHA 2H92A 1T4CB 1FDVA 4N9WA 3V1TC 3ETCA 4MS3A 2I29A 2QTTA 2CF6A 4X1YA 3IAHA 4BVBA 1QP7A 3RDPA 4QDXA 3IP9A 3EXG1 4BAGA 1R8JA 1JDNA 1NVUQ 4EHAA 3ZCUA 4EGSA 3ZQKA 3R3WA 4BB6A 4L6IA 1SXGA 4ZJZA 1AK9A 4G36A 5D2CA 4YN3A 2ADMA 4QQFA 4YAEA 1VPLA 3WRVA 5EUBA 1VM6A 1HO3A 4OSOA 5EP2A 1NBHA 2F7SA 1B6TA 2P4QA 3I8SA 4HGRA 4HDNA 4S1WA 5BNIA 3DQZA 2VYND 3CH6A 4RUKA 4M88A 2WSIA 1OXSC 1TFUA 3HCBA 4S3MA 5AVYA 4IPTA 4GRDA 4PZDA 1EFAA 2AR0A 1IZ0A 2XRZA 3MT8A 4CR7A 4KR0A 2P40A 4KNYA 3KYDB 2C5BA 3LOUA 1FFBA 5JS8A 1YRWA 5K7SA 5KVCA 2DLDA 1UBEA 3EPRA 1Z0IA 3LTEA 3FMIA 2HIGA 3NAQA 3TI7A 3DUWA 1MAWA 2VJAA 4G09A 1JHVA 5GM2A 3SC4A 3CIOA 4MS1B 5JZMA 2NO5A 4R0VA 4K86A 2CJPA 4TKMA 3AL3A 3T5TA 2M32A 1W6RA 4XOIA 4LQCA 2HCJB 4J0EA 2B61A 1Y1SA 3AXTA 4BWFB 4C76A 1ID1A 3NEYA 1EDBA 2R1TA 4DRXA 5MN5A 3EW7A 3QUAA 1T0BA 2GGSA 2RB4A 1SC9A 1UDCA 3C6KA 5F1KA 2Y68A 4ZT4A 3TKAA 1QCZA 1RWOA 3BXOA 2OECA 5LFAA 4MUXA 1NW5A 3ZGNA 1DTWB 5GP1A 4A23A 2UU9B 2XA2A 4J3NA 4IDCA 1IUPA 1FYFA 3THOA 4G63A 2EJUA 3KSUA 1LLCA 4B7ZA 4BU1A 4IRUB 2IOFA 1D2HA 3FPKA 2VO1A 5DEOA 3UTCA 1C0IA 1NJ2A 2APJA 3IDQA 1CNEA 2A0XA 2Q4TA 3R4VA 4YCSA 4GI7A 3G2KA 3RJMA 4MS4A 5T4BA 4AD8A 5AVVA 4DYVA 4R2HA 3K6SB 3GEDA 1KY2A 2HTFA 3BGVA 4NYMQ 3EWAA 3LLSA 5AMXA 3TUJC 4W5QA 1K5GA 3GUHA 2EF0A 1A5BB 1SXJA 2FX2A 2IYZA 5AKIA 3VDRA 2J33A 2VF2A 5DJ5A 3HNRA 3RSGA 1U9IC 5HFAA 1W5FA 4EJSA 1VA4A 5FUQA 3GDGA 2XT0A 3I04A 3KEGA 4M1KA 1KAQA 4B6RA 3O3CA 2N9UA 4Z49A 4RTJA 2XNDA 4ON9A 4QYIB 2IXDA 3RHFA 3UGKA 2AQIA 4BO8A 4CLRA 4FHEA 1U9ZA 2Q07A 2VCYA 4WZ6A 5B37A 3SU8A 3QBEA 3HYLA 4ZWNA 1W4AA 4PZ0A 3BIFA 2LXNA 5ILOA 1OLUA 3BK1A 2RHRA 4O2AA 4W1SA 4KR2A 3D4PA 2DLNA 4LGYA 5F4ZA 2VLIA 2JAHA 2OGZA 4CIDA 4Z7JA 3O8DA 3QVKA 4FONA 2CLCX 1MO5A 2DR2A 1VJGA 2P2DA 4PPNA 3THSA 1JDVA 1UDWA 3DJFA 5BSMA 2NUPA 2PK3A 3N76A 2GSWA 4S12A 1I01A 2Y27A 3P52A 1T1RA 2ZRIA 5FWYB 1NN5A 3JQFC 5BRNA 2QXUA 1GU0A 1G1AA 2QV0A 2Z9CA 5LNK6 1WKVA 2C4MA 3PNSA 4NU6A 3F4BA 4UHCA 1JFSA 5ED0A 4FGLA 1JEOA 3JQ9A 2FK7A 4LMBA 1P2BA 4Q93A 4HQOA 4TLAA 3TR5A 3BULA 3UOAB 3UWKA 2IHJA 2GDZA 4CW7A 4C7MA 2A4KA 4BFVA 3OETA 2EFHB 3QRWA 1LVGA 1O0SA 3V8QA 1F2VA 1FLAA 3OTHA 3RSZA 3P0IA 2C9ZA 4XDHA 2R6HA 2R3SA 4TYYA 1TI7A 1M6EX 2M1XA 3R3VA 3PQ3A 5DFAA 4YMTA 1UJ4A 1OGJA 1MJNA 3QKIA 4GUAA 4OHBA 1SCNE 2A78A 1CUGA 1CJBA 3U3KA 1YFZA 1FQJA 5H7XA 3FTPA 3IP8A 1VE6A 3NH6A 1DDIA 2DQSA 2GBFA 3ODPA 3BD6A 1E0DA 4Z5XA 8ATCA 2FI1A 1RKVA 3PI6A 4K28A 2BKEA 3U1BA 4MQ6A 2IY8A 1FVFA 1CYEA 3W79A 4AM8A 1B74A 1ML4A 1L7EA 1P8JA 2H4WA 2F8SA 5C3UA 2AQHA 3IIKA 3EHEA 1YRYE 2IYNA 2WYHA 3EASA 4GOXA 4MHSA 4UU0A 4AN4A 4B6OA 4UPEA 2QL7A 4ZCRA 3AY0A 1R6AA 4DMHA 1U0NA 3E7DA 2QZ9A 4PO1A 4PWYA 1XO1A 4ANFA 1UOEA 2PA3A 5EP4A 1O96B 1IQUA 4FUQA 4EFKA 2Y1FA 3K72B 1KSHA 1P5FA 1ZH2A 4MV9A 2E49A 3WMRA 4DSOA 4LVOA 3H4VA 1K5PA 1UPTA 5FUYA 4RTLA 1A9XB 3MG9A 1KI8A 2JI4A 2Q99A 4IUCS 2B5WA 4G65A 4MEBA 1UZUA 1T6XA 1EBFA 3EQ8A 4I3GA 4MJ7A 5HM8A 3TECE 1UFOA 2HK6A 1WXEA 2QM7A 3BSYA 4HB2A 1IWPB 4NBVA 4WL0A 1RC8A 1UADA 3URMA 4EG7A 1EXMA 1PNOA 2YCLA 3NWEA 1SULA 2W42A 1X0VA 4PHHA 2A9QA 2ORWA 4INZA 4MP6A 1DG1G 3NIWA 1KI6A 1K98A 3BD9A 5JAIA 3DP9A 1MB3A 1NF8A 3IGFA 1JHRA 3D43A 4D3ZA 3K70D 3NTQA 3DKVA 3GRAA 4IZIA 5G4LA 4CIVA 4QM7A 3DZCA 2FSPA 1EVIA 4RKWA 5HZKA 3QJYA 2W6ID 3HM2A 2WYVA 4KFSA 5AK6A 2CVZA 4KXFB 4TLBA 5EE5B 1P74A 3B6KA 4ZRMA 5EC8A 4LQ4A 1PD0A 1AG9A 1W9HA 3KSMA 4HQLA 1OI3A 4OHKA 4DA9A 4OGWA 5IZ4A 5JJLA 3O84A 1Z0KA 3C45A 4LI0A 4I9NA 4J0JA 5AM5A 1KEZA 3V4PB 4F72A 3FOAA 2HJGA 1F8GA 3OFJA 1G5QA 2HYDA 3LTNC 2XQIA 4HX2A 5TMEA 3SNKA 3U60B 3CZCA 4TLMB 4BLPA 4CV1A 1H9AA 2JVIA 3T5GA 5DSZA 2GERA 2R84A 3RTGA 3BSSA 3R3HA 3V9PA 3PNLA 1W9MA 3K9BA 3SOPA 1V43A 5F9HA 4HVTA 4NU5A 4ZQHA 1T4BA 4BMCA 3T15A 2X2PA 5JTTA 4DB4A 4A6PA 3JQQA 2DPHA 2RB5A 1R66A 4AZTA 2XQFA 1MP0A 1RWKA 2IHYA 4FE3A 2H5LA 4HFNA 4EELA 3PG5A 4CFSA 1UAAA 4B3MB 4ZCTA 4Q1DA 1G5RA 4KRYA 4OGGA 1CUFA 1YBVA 1CB7A 4I9HA 4K9RA 3A06A 3K2IA 3GYGA 1C9NA 1ACMA 1ZL2A 3ANXA 4NR0A 1JWLA 4II2A 4D9FA 4C2AA 5BSEA 1XALA 1QPBA 4D80A 4PLFA 4O5OA 3UJBA 2HXGA 4FDUA 1WLSA 2PQMA 3NBYC 3GNSA 1DE0A 1M2OA 2JI6A 1RI1A 1CF4A 4HDSA 2ZR7A 1PK8A 4Q01A 3MTBA 1EUDA 5D5PA 4ZQEA 2FQQA 5CK4A 2FZWA 4EB6B 3AVWA 4CG1A 4ZK6A 4DANA 4X20B 3ZZMA 2IP4A 2C98A 3TSWA 2QLLA 5CPBA 3GRZA 5G1PA 5EZYF 3S2IA 1OB2A 1F7UA 4ZJUA 4RELA 3VMMA 3OFKA 4RGYA 1W5AA 2YYZA 3IR6A 3WWDA 1QU2A 2R6JA 4BE9A 2PG3A 2DKNA 1XCLA 4NPCA 2YVAA 3PUVA 1C4XA 1E58A 1Z6AA 2IE8A 1MJGM 1WUYA 4XB1A 2TMKA 1KZ6A 4NMLA 1TMOA 4I9UA 2OAEA 5FI3A 2H1FA 1X1SA 1U3TA 4Y0AA 4LSGA 3KQTA 4YJ3B 1F9AA 1ZESA 1IOWA 1SR8A 3EMVA 4A7PA 4BJ6A 2EZ8A 4A8JC 3R3SA 2RSLA 1QHSA 1J9EA 1B0PA 1M6NA 3BBLA 1VSBA 1LDYA 2FDRA 1YJXA 3DXFA 3FYDA 3G8CA 2CDCA 3T99A 4QTYA 4GKKB 5KU1A 1ZVVA 1C0LA 1PJSA 3RRYA 4HQNA 4YMGA 5ITWA 1OILA 1GY8A 1A4RA 2BF4A 3V46A 4XJTA 3NTRA 3VJRA 3PLNA 5BUZA 1XE3A 2W2KB 3GQBB 4N0DA 5DW0A 3KFLA 5EZSA 1ZK3A 3A2LA 4L3VA 4XB6B 1KAEA 1A7UA 5DGIA 2KLHA 4AJ1A 1IULA 2NU8B 3CLSC 5FBKA 1QZ3A 4QG7A 3ZWKA 4DDUA 4WGGA 4YV7A 2AMLA 2NUBA 4DZTA 1HBJA 1KVTA 1GIAA 1NQ5A 2CUKA 2ETVA 2FU5C 3N3BC 4TMFA 1PL0A 1E8DA 4UHHA 5HJ2A 3GHYA 1CR0A 2X41A 3B6ZA 2PSSA 2I8LA 1L5HB 4S2EA 1V95A 1ZN9A 4H6XA 1C3LA 4U2EA 1TOAA 4NBTA 4JOSA 2IF0A 3I6QA 3PITA 2QRGA 4QE3A 1I33A 4GQIA 1V9CA 2ZSUA 4K6HA 1UK8A 1NW3A 1AKMA 2ZBUA 5DGXA 1JB9A 2WHXA 1KOLA 4EJMA 4MQLA 3NTLA 3F6SA 3ZI7A 2WYWA 4BASA 4KQEA 2QG9A 1OASA 4D9KA 3N7TA 1R4ZA 5DEIA 3ZVNA 5I4BA 1JMYA 1OX4A 4IIBA 1F2DA 4OJTA 4Z7QB 2HMUA 4MVCA 1ZCBA 4I81A 4BO5A 1QFMA 1RWWA 3DEAA 1WUTA 2QZJA 2PANA 3OIWA 2AB0A 2AZMA 2DE0X 4BV8A 1OC2A 3F5QA 4LAFA 1MNQA 1W88B 4G23A 4H7KA 3M6VA 3KLPX 1GA4A 1G5PA 3OF2A 3AU9A 4WINA 5I7UA 3DLIA 4OBWA 3W77A 4KXXA 4L16A 3K9FC 1TO6A 4X6YA 3TRFA 1SCBA 3ZU2A 4NZMA 4F11A 1BIFA 1G4AE 2YQZA 3FFXA 4Z4QA 1O95A 1WA5A 3M3DA 5DSTA 3AETB 4K0KB 2FR0A 3GNLA 3WYCA 3RVLA 4ND4A 3L5OA 3O1LA 4OGKA 3TNYA 4D8VA 4PFQA 5I7WA 4QUEA 2C5FA 2HSJA 3PEYA 1QG0A 3OBBA 1HL7A 1L8OA 1ORIA 3Q0IA 4HGPA 4ALIA 1DDGA 1EVLA 4RHUA 4KPGA 4IMRA 2IWHA 3WWEA 2BN4A 3HFRA 4Y7CA 4DV7B 2BGUA 4WCVA 4KWTA 1XK6A 2D0DA 4QXQA 4ZOLF 1XRLA 4KEAA 1I2AA 1MO2A 1VSUA 2D4HA 4J07A 4X24A 3JXEA 1C1XA 1QLJA 3TFQA 1PJRA 1SK8A 1J0BA 2FEMA 4TPKA 1HT1E 4LRWA 4F97A 3EDYA 3WLNA 5IJ0B 5EEGA 1Q3HA 1DJQA 2QSZA 2J7PA 2CB0A 4RHFA 4UQPA 4X6UA 1SHKA 1N6RA 2WKSA 3DB2A 3AR7A 4GX2A 1TUBB 2NTJA 2XQJA 2B8TA 2F1KA 2IIQA 3K1AA 3PXEA 3QELA 4Q3AA 2NV2B 4FT2A 4QICA 4BO3A 4CHTA 1NXPA 3L8ZA 2FN7A 2XQGA 1KMCA 4JJ7A 2N0SA 4KAXA 3HKBB 3TYXA 4G0UA 1SNYA 3BJIC 2BE7A 1K1EA 2GN8A 2FMHA 2VK8A 5IAOA 2NZ8A 2RBKA 3VBCA 3CO0S 3QKSB 4LBWA 4WBNF 4ZREA 5K2MA 2IUFA 4G26A 1S01A 2GZDA 2MSWA 3L0SA 3P26A 2FZ4A 3EQZA 3MOGA 4UAJA 4NCNA 4WK0B 5AYVA 5LJLA 1M10A 2VAPA 3AC0A 3I1YA 2HT1A 5DTIA 1T2AA 4IS3A 2GK6A 2Q49A 2JANA 2V74B 1CUCA 4J29A 4BDSA 1KP9A 4ZVRA 5I8ZA 3PXAA 4ZOEA 2WUVA 2NO6A 4D9IA 2PUDA 5JECA 4UNSA 4U7FA 4I6EA 4PHTA 5TE9A 4EHFA 1Z6TA 2C88A 2MINB 3R7BA 1IJEA 3RVRA 5I6DA 1SXPA 1EUCB 3RT9A 5HP4A 1YHZA 2Y1DA 2AC2A 2JPDA 3BRCA 3OMLA 4B2PA 2WQ7A 4AZ3A 1F8FA 1JR3D 1M6VB 1V3TA 1AZTA 2H1RA 2XYRA 3LY5A 5JJIA 4QUBA 1UBTS 3QX7A 1GQYA 3AU8A 1D2AA 4J0FA 3T3GA 3LY9A 3ZHTA 4C6TA 2A35A 4ENQA 4EEXA 3F78A 4JYCA 2W8ZA 3ST7A 5DLQC 1RWVA 4CEIA 4J0GA 2G71A 2C54A 3H8SA 1GG9A 4F1WA 3HTXA 3JTMA 1ODSA 2J3KA 5H3CA 5KVQA 1L5ZA 3KLMX 5DU2A 5FI5A 3VR6D 4B4KA 2UUCB 4QIHA 4L5CA 2JCYA 4PYJA 2GASA 1PF7E 3TTSA 2EX0A 5KKAA 3SN6A 5LYJF 2RHWA 2FV8A 2QMUA 1NYTA 4JVLA 1HI9A 2YYAA 2H1OA 3SZLA 3FMOB 2WJHA 3FOBA 1EVEA 3I6IA 5GV7A 4FFPA 3TLKA 1AQYA 5CA1F 1B0ZA 2JLRA 2XMRA 4WLVA 2OCYC 1UWKA 1ZD2P 3KR2A 3F6RA 3KAQA 1X42A 4M1OA 3DNMA 5AKEA 5LBTA 4ZYUA 5FUMA 1QYDA 3P5BA 4PLCA 1A50B 4YTEA 2X0KA 1W5TA 3X1MA 3TMAA 4NFHA 2A7QA 3R3YA 4KLAA 3W4IA 3WK4A 2FRDA 1IHYA 4KK3A 5T41A 1OFTA 1RVV1 5ELMA 3VYVA 3LSYA 4ECEA 3ECAA 4CTMA 4DDWA 2DTXA 3NXSA 3SQNA 3RYHB 1VC2A 1E2DA 1HURA 1ZD8A 1OZGA 5CP8A 3RD5A 4F3NA 2GM4A 4FWIB 1PBNA 1MC1A 1N3IA 1YA6A 1LPSA 3EVBA 1HYBA 1WZIA 4NBRA 5C80A 3A6EA 3HXPA 5AOBA 4COOA 5K0JA 1OLXA 2FPRA 1XAHA 2X1LA 3P71T 1KJNA 3CNBA 4INOA 4J0KA 4W7SA 3QEMA 5L3SA 4WXRA 1UQUA 3L6BA 1TM7E 3O90A 5HG0A 3DMTA 3UWSA 3LH5A 1X7XA 1Z22A 2IZ1A 5EWJA 3W9BA 2GPNA 4AUNA 2WHEA 1DXQA 1A1VA 4UXJA 1BJKA 2YXEA 2ZVDA 3KR1A 4FE4A 4MMXB 2R97A 4ZT2A 2F8TA 1R4MA 4ND5A 2GTHA 2OXFA 1W36C 4RIFA 3AFNA 1L3BA 4DJDC 3IAUA 2PNJA 4AIRA 1W6UA 2Q6OA 2XMQA 1SXJE 1OZFA 2HCRA 2MIIA 3I9V6 4V1CB 4UDNA 3PVSA 4JAVC 3TCXB 3UOGA 3DOIA 4LJSA 2QRJA 2ZP1A 5BN3B 1KI3A 4OX9Y 1CHDA 2EF1A 2ROQA 1JAZA 3R5SA 5DTQA 4KFRA 1N5MA 1VIYA 4CQMB 3N2EA 1X80A 3R6LA 3SEFA 4DAEA 5BYKA 3Q9SA 3G23A 2CXTA 3TKYA 1HR0B 3Q7QA 2OCAA 1FVOA 1T36A 3BAZA 3CLVA 1Z7WA 4HNAA 3AZOA 4BNNA 1KJZA 1CF2O 2XCSB 5T64A 1FA9A 2CE2X 2GNPA 2D62A 3TEMA 1U0BB 5K4GA 4EX7A 3CN7A 4Z53A 4YRTA 3GO4A 3QVLA 2A5GA 5HCNA 4DOMA 1R8XA 5AT1A 3CF0A 3WK8A 3GIDA 4N3AA 1FW6A 4DQKA 3MMZA 1YBFA 1D5CA 1KU0A 1PJ8A 1SXJC 3I3OA 3JALA 3ADCA 3MJTA 3MZ0A 3ZW7A 5A3QA 3EMBA 3WGKA 1GNLA 4A16A 1XXHA 1YZTA 3IOMA 5G3YA 2IQIA 3EBLA 1ZIOA 4Y9TA 2GPJA 4EZBA 2R8RA 2O8EA 3A1TA 1W0KD 4LV5B 2JFGA 5A05A 3VNQA 1Y8QA 4Y2JA 5FYQA 1Z8HA 4GWGA 4DLNA 1C8KA 2VJCA 1G8GA 2C92A 1GR0A 3MW8A 1NBAA 4EYGA 5DNUA 4TKLA 5GOTA 4JL8A 1ZA2A 2COKA 3JX9A 3RU9A 2Y6VA 5BR8B 2C59A 5FOSA 4WKBA 3HNPA 3CO5A 1Z68A 3O8CA 3RFFA 2HA3A 2ZS8A 3CKKA 1KI4A 3DBLA 3FUVA 4MGZR 5KDLA 3UHAA 3ZWDA 1Y1TA 4CMIA 5I51A 2YV1A 3FX2A 3E6AA 4M37A 4AJHA 1G2IA 3HYRA 3H1AA 4U8HA 1PFVA 1E32A 5CDFE 5JVDA 3L07A 4FJ1A 1AK2A 4EA7A 5BN1A 2C0QA 5C4IA 2ORED 3BORA 4TKVB 1SVOA 1BMFD 3U7IA 3NYRA 4OYRA 4ZI7F 4WFKA 3VR2D 1JNXX 1DCMA 2GZRA 2V6MA 2VDVE 2WKPA 5LDGA 4JI5B 1XX6A 1JI3A 2WUGA 3HCPA 1LS1A 2PKQO 5CHYA 2C1ZA 4JR1A 2PMWB 5LA6A 5BOVA 1P6UA 4LF8B 1G6Q1 3ICQB 4QPPA 1YS1X 3S2EA 3TW4A 2IUTA 2ODPA 4WK6A 3SIWA 4ARUA 3JYPA 1E8MA 1ZCJA 4ZDKA 3EAGA 3ND8A 1FK8A 2M6KA 1U7XA 4ZVTA 5KWJA 3D31A 1T1JA 1HDYA 1EK1A 1ZXLA 2I7VA 4RSHA 3ZXXA 3NAMA 3K0EA 4BKMA 5LR6A 3UTDA 2LTAA 1IXSB 5AVQA 5JOQA 4L5AA 5D3MB 4AYWA 2ZRHA 4WY5A 3Q88A 5GMOA 3M1IA 1EESA 1NW6A 2POQX 4CGYA 9MHTA 3S2GA 2BIFA 3SJ7A 4CF4A 3PWTA 1T29A 2XUPA 4FCTA 3R7LA 1WMFA 2DHQA 1YC5A 2P69A 2ZUWA 4ZI2A 4OVKA 3CRQA 3LGXA 1D7OA 3RU2A 2NO4A 4Q9HA 4PQFA 2QOEA 1J24A 3DONA 5MF6A 1GSOA 1W47A 1CZLA 3BJEA 2K6GA 1JHAA 3ANTA 3TRKA 1AOXA 2CXSA 3U1TA 5DLYA 2NLOA 4YR9A 1XCMA 3FUUA 4ENPA 2FEKA 3FVVA 4O0MA 1HE5A 4HOYA 4OI4A 4XIYA 4AS2A 1WKCA 1DLIA 1GTG1 1PR2A 3MJCA 2OUIA 1V7QA 1VLLA 3FNGA 1HOXA 1Z35A 3AILA 3IJEB 4FCVA 4JUDX 4TL6A 3AKYA 3DNPA 4LRYA 1SUIA 1H05A 2GVDC 1UC9A 3IALA 4GG1A 4Q82A 5AJWA 5JCOC 1VI5A 1BDHA 4J3FA 1QS0B 1A4XA 2RHTA 4EZEA 2VDQB 4N5IX 4JVMA 1E6EA 3TZ6A 1O9GA 3GJ3A 2O1EA 3W6PA 4OA8A 1HE1C 2QK4A 2P2NA 4YRZA 3QSYA 3GVXA 2JF0A 3SPXA 2AOVA 4R8KA 4JI1B 4FGZA 5HQ3A 4CG2A 5JQGA 2VK4A 3KTOA 3A1FA 1RWMA 3L7OA 5IJZA 2Q2OA 1CEYA 4CG3A 2A9FA 4DLVA 3K2QA 3EVGA 5P21A 3OPMA 5C7OO 1G8MA 1O94A 3AYXB 2G4LA 4NOMA 3B3GA 4HDOB 4X8MA 4XR9A 5TEWA 5GTDA 4PGFA 2FGKA 1SY7A 3ANMA 4C9BA 4MWSA 5DULA 1UBGA 4UBLA 3E5NA 3GGDA 4WK2B 4K6KA 4OQ4A 3W2IA 4ZVNA 1YDWA 4H0CA 1W5EA 1UCFA 3HCRA 1Z26A 5JFTA 4AYTA 3WGJA 3NP9A 1KARA 2NUTB 1EPUA 3LP6A 3DOJA 2XOXA 3P1JA 1A8UA 1IDOA 2FPPB 3TVTA 3IKJA 3SXPA 5A4IS 4LQLA 4L8GA 1ONSA 2R66A 2KBEA 4Y1RB 1PYDA 2VJLA 1NKSA 2J6IA 4GGOA 1QANA 3D3EA 3E1SA 3WFIA 3JD4A 3AFGA 1RQ2A 1SZJG 2NYUA 3IDSA 3QVGB 4L2IB 5KOYA 4D4KA 3ZVKA 1AM4D 3BD7A 1DADA 1VDZA 4FZ3A 4EARA 4KPYA 2V7TA 4DHWA 1FTQA 1YR2A 2VCHA 4M86A 4QAQA 1L9KA 4MRMA 5EZ6B 4LBYA 3B3AA 5CM9C 1JHUA 2BMWA 1XHLA 2B9VA 4UZFA 3EPPA 3HVKA 3MPUA 3G0GA 4TUYF 4U5QA 1U90A 4FOPA 4RMNA 3FWZA 3GMTA 5E2AA 1XB2A 1YRQA 3KJEA 3EGDB 1NX6A 3AUXA 3CE6A 1K7FB 4E11A 5DHTA 3AJ9A 4KAFA 4FYXA 4TVBA 2DSNA 3GAFA 3WGIA 3N2YA 3ZQJA 4JKIA 5CT9A 1ZO8A 2WM3A 1UDRA 4O4JF 1NXOA 5IK2A 2GFHA 2P68A 7ABPA 4LC9A 4MEJA 3UJPA 4X3CA 4F6LA 5HIIA 1QHGA 3DOOA 5KTTA 1I4DD 2C99A 3DOUA 3LFTA 5J2TF 1GPUA 1EH5A 3LQ2A 2Q3LA 3GZ4A 1I5RA 2MMGA 1TRKA 4ZOCA 3JATA 3ZH9B 2ZT5A 3Q0TA 4Y2GA 4DIMA 1PJ3A 4YASA 2QDKA 1FJGB 5IULC 3RT1A 1E4EA 4U6QA 5KTSA 3LL4A 1J1ZA 1T35A 1Z08A 2EQAA 4NZ9A 4UMFA 2YRWA 3QXJA 4UBOA 3TRDA 4J49A 4H3KB 5BO5A 3HMQA 2IIPA 4DY6A 1QHHA 3LQ1A 4DGSA 1CVLA 4RJTA 4I4TB 2YASA 4BNDB 1WDKA 2WIBA 4KYVA 4WCFC 4XSGA 4GVPA 3L7NA 2C29D 4Y3UA 2SCUA 1B93A 3H83A 4UMVA 3ZE8A 3FPFA 2RJOA 3FCXA 2QRZA 3EY9A 1DX9A 3G9XA 2RONA 3OZBA 4IDOA 4J7CA 2DUUA 3OKCA 2E89A 3ER9A 3L8HA 3W04A 2QTHA 3FWYA 5EI5A 3L40A 3WNBA 4GGMX 4OI2A 4Y2XA 5EXTA 4OSPA 1T26A 1T5BA 4BRWA 3V4SA 3TGLA 1ENPA 3S8YA