3U7RA

Ferb - flavoenzyme nad(p)h:(acceptor) oxidoreductase (ferb) from paracoccus denitrificans
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
182
structure length
182
Chain Sequence
b'VKTVAVMVGSLRKDSLNHKLMKVLQKLAEGRLEFHLLHIGDLPHYNDDLWADAPESVLRLKDRIEHSDAVLAITPEYNRSYPGMIKNAIDWATRPYGQNSWKGKPAAVIGTSPGVIGAALAQARLKNDLLHVGTVMMSMPEAYIQWHAEAYAADGSVTDEKTAKFLQGFVDAFVDWIEKHGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH-dependent FMN reductase
molecule tags Oxidoreductase
source organism Paracoccus denitrificans
publication title The Structural and Functional Basis of Catalysis Mediated by NAD(P)H:acceptor Oxidoreductase (FerB) of Paracoccus denitrificans.
pubmed doi rcsb
total genus 63
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3u7rA00
4FX2A 2HNBA 4LTDA 4NLLA 3K20A 1WSWA 2Z98A 1AKUA 2QMYA 3ESZA 1ZWKA 1C7FA 3GFSA 5F12A 4CF6A 4U7GA 1YDGA 1FX1A 3NHWA 3NHRA 3NHLA 3OWXA 2FDXA 2QMZA 2V9CA 1X77A 2V5UA 1OBOA 4FGKA 4ZVNA 3TZBA 1CZOA 3KAQA 3UXEA 4LTMA 5LBTA 4ZVMA 5EMNA 2QX6A 4QOHA 1DX9A 1H69A 1YRHA 2V5VA 4FGLA 4H2DA 2FZVA 3O2NA 1V4BA 2OHJA 3QE2A 2QX8A 4J8PA 3W77A 3FW1A 4BMPB 4OXXA 5NULA 4ESEA 3F6RA 5LLDA 3R6WA 3F6SA 1CZHA 2FZ5A 3FJOA 2ZKIA 4S24A 3RPEA 4GR9A 1AG9A 4C14A 3QFRA 4PTYA 2Z9DA 2FAXA 5LJIA 3QFCA 3L9WA 1KBQA 4PU0A 1XYYA 1FLDA 3TEMA 2BPOA 2BZSA 1J9EA 1CZRA 2HNAA 2HPVA 1WSBA 1YKGA 5FA6A 2KQUA 2MTBA 2W5UA 3EDOA 3W7AA 1ZWLA 4BMOB 4DILA 2AMJA 3B6MA 1ZX1A 3OX3A 1FLAA 1D4AA 1XI2A 4GQIA 4LTNA 4U7HA 2Z9BA 4Y9RA 4YALA 1AKQA 1FTGA 1QRDA 1QHEA 2F1OA 3F2VA 3OJWA 4U7FA 4M0CA 3L9XA 3N39C 2MOKA 1SG0A 1F4PA 3GFQA 4Y7CA 2FCRA 2R96A 2BF4A 1AKWA 5NLLA 4CETA 1D03A 1AKTA 3ESYA 3NHPA 1DXQA 3LCMA 2D5IA 3F90A 1J8QA 2N1MA 3OWHA 2FVXA 1B1CA 1KBOA 2XOEA 2WC1A 2MT9A 5EA2A 1D04A 3G5MA 3OVMA 4H6PA 4YAFA 1OBVA 3P0RA 2QWXA 1AHNA 4DIKA 3S2YA 3NHUA 5JROA 3NHYA 1AMOA 3B6IA 3NFRA 1XT6A 1RCFA 1SQSA 4N9QA 4QOFA 1T5BA 3B6KA 3O73A 1YCGA 4DY4A 5LVAA 1JA1A 3NHJA 1DXOA 1OFVA 2Z9CA 4HS4A 2QX9A 1J9ZA 1FLNA 1YCFA 4GI5A 1QBGA 1AKRA 1J9GA 1FLVA 3GAMA 1GG5A 1T0IA 2X2PA 3NHKA 4PTZA 5F51A 4ZVLA 3SVLA 1RTTA 4LA4A 4QODA 3EYWA 3B6JA 2FX2A 3NLLA 4QOJA 4XDGA 5FX2A 4QOGA 4Y9UA 1BU5A 1QR2A 1AZLA 2A5LA 4C0XA 4XDHA 4F8YA 2X2OA 3W79A 1RLJA 4NULA 2XODA 4LAFA 1RLIA 3N3AC 3NHFA 5LJLA 1YCHA 4ICIA 1FUEA 1AKVA 5F4BA 3D7NA 4N82A 3NHSA 1H66A 5B3KA 1YOBA 2M6RA 2MWMA 2RG1A 3FVWA 3GFRA 5A4KA 5B3LA 3KLBA 1E5DA 3LT5A 1I1OA 3U7IA 4C0WA 3KEGA 1VMEA 4HEQA 2GSWA 2Q62A 1CZNA 3FX2A 6NULA 1TIKA 1CZKA 2Q9UA 4ZVKA 4YAUA 2R97A 4C76A 2OHHA 3HA2A 3K1YA 5EAIA 2OHIA 4YAOA 1BVYF 3TE7A 4D02A 5BUCA 2B3DA 1C7EA 3FNIA 4YQEA 3UXHA 3ZHOA 1CZUA 5TGZA 2FLVA 2QX4A 4FGJA 4QOIA 1TLLA 5FUQA 2ARKA 2KLBA 5LMCA 3OX1A 3KAPA 4R81A 1NNI1 3ESXA 2BMVA 4N65A 4QOEA 2QR2A 1FVXA 3W78A 3N3BC 2M6SA 4YAWA 3OJXA 5LBUA 3OX2A 1XYVA 1JA0A 2OYSA 3HLYA 5ULLA 2FOXA 1CZLA 3U7RA 3JSXA 3HR4A 2BN4A 3ES9A
chains in the Genus database with same CATH superfamily
2JIZA 2ZR8A 5IUKC 5L3QB 1AGPA 2PX5A 4LJAA 2CN1A 1FP4A 1Z8DA 2ZE8A 4M88A 1NPYA 4FFRA 1TYCA 2HQOA 5ICFA 1AS0A 3SBXA 4UC0A 3SEAA 4IWXA 4F45A 1ZICA 2XE8A 5JEEA 2I4NA 1PV4A 1RQRA 2RI6A 4XCXA 3OZBA 4NYMR 3H1TA 4HXEB 3GB9A 3AUKA 2Z6UA 1B23P 5WRFA 1AUPA 5I7WA 4JLMA 3AKZA 4RSRA 3K5PA 1QO0D 3OP4A 2HDOA 1EGVB 4PYLA 3EIQA 3DVLA 2H1LA 1V1MA 2XMSA 3GDHA 3P20A 2A0XA 4MW7A 3QU2A 4TYYA 3QA3E 3VOTA 5C7IO 4Y2JA 4F56A 4HCJA 1FX0B 1GLNA 3ROZA 3PGVA 4BIMA 1W4ZA 1HEIA 3QELA 3NH6A 1MLDA 2AYXA 3IVXA 3NYIA 4OSPA 1HFWA 4U7WA 4YVFA 1LDNA 4HUJA 2GHTA 4BU1A 3O4HA 2G5GX 2J7PA 5KWEA 1YGYA 4TRRA 2JAHA 4DBLE 5LKAA 1KY5A 2WKPA 4GNRA 4Z5XA 4O4JF 2I8AA 3O84A 2DHQA 3TFWA 3ZHQA 1WPRA 4KPYA 3M1IA 3CINA 4CF3A 4HFJA 4PPQA 4WJLA 1IDN1 3UW3A 3QKSB 4M1QA 4MYCA 221PA 3H1GA 3MUEA 4LOJA 3TMYA 3T1TA 4D9KA 1TQDA 2F2TA 2KPOA 3RU3A 3COYA 2BGKA 3DR3A 4CFZA 2A0FA 3P7MA 1M83A 1Q19A 2GF9A 3KZCA 4GICA 4LE2A 1ZOSA 4N0PA 1IZYA 4AN0A 3A2NA 4E30A 1XT6A 4CJXA 5IT9A 5AJVB 1M2VB 2GBFA 4YRJA 1JHVA 4G5QA 4L6CA 4KP7A 4BX3A 1NQ5A 2HWWA 4WBXC 3RU9A 4UHCA 4E21A 1E7MA 4BU0A 3CX4A 3EA0A 3RFFA 4B47A 1YIDA 3DPUA 1CCWA 2LKCA 4F46A 1ZKDA 1C41A 4D3ZA 4JDUA 3QPBA 2WAXA 3FUUA 3L8FA 4LY0A 1NW4A 3BX1A 2FEXA 3EVAA 4D42A 2DBZA 3DL4A 3HACA 2GF0A 4UPDA 3BH6A 5JY1A 2XTAA 4I1IA 5FBRB 4E5DA 2J9YB 1E3WB 4L4YA 4UASA 5BV1A 2V6FA 1FRFS 3TS1A 2OORC 4MYDA 4TPKA 4DDWA 1W2GA 3A1CA 3JATA 4MJLA 4GOJA 1S2NA 1VI6A 1X1QA 3BL8A 5GTDA 3KXLA 1TNDA 1ZG3A 5EXXA 2P6MA 4HLQB 2GESA 1FCJA 1UAGA 3MJSA 4NJOA 1QG0A 2B7LA 2FKNA 1GDDA 2XEDA 3AP2A 3D3NA 3OE7A 5AOCA 3BMNA 3NIBA 3WAKA 4B6OA 1P7PA 2D2VA 4R2LA 5ALQA 4BJ1A 4S05A 2C82A 2A2ZA 3N5KA 5CMLA 1KH3A 3RRFA 4CI0B 3UYKA 3GLIA 4W5NA 2F1HA 1NRXA 2IYNA 2XCQA 3KHTA 4FOPA 2VK2A 2QM8A 1XDWA 3IUNA 3TVTA 1JUDA 2C9BA 1NXOA 3JZAA 3NBXX 1RJ9B 3ESXA 4LK3A 3NTLA 4LRWA 5DWQA 3GJ5A 5BWOA 3C8DA 2C3MA 4OFBA 1E3TA 4DT1B 2FMUA 1PT8A 3O82A 2H1FA 2PKQO 2C0PA 3L7IA 4KQHA 3JSXA 4Q3EA 4AN1A 3A8TA 1WPXA 3HCAA 4QYXA 1KZ4A 2JLZA 5CDTA 4D3FA 2PS0A 2YHSA 1EVZA 4K40A 4V2IA 3R74A 1D9XA 1XTPA 2JBAB 3RIMA 1TMYA 1E62A 2ZYWX 3T38A 3R8XA 1YAJA 2HF9A 1KZ6A 3ZNPA 4AKHA 4GAEA 4EG7A 4NYJR 1YFJA 4H35A 3OOWA 2YYZA 4TWZA 4HWRA 4ESEA 2M32A 4GZMA 1NZDA 2Q4DA 1V8DA 3U3RA 1DFGA 1DT3A 3W2IA 2V6BA 2I87A 3RVLA 2HU5A 4E13A 5DTJA 2WYOA 3QEBZ 4XM1A 1SZJG 2BFEB 2KYRA 4QYSA 2IHZA 2XWPA 1HT0A 1MOQA 3KT6A 6PFKA 1NDHA 3OUZA 3R3UA 2BRUC 1UP6A 3GDGA 4DXDA 3L02A 1DXYA 4ZQEA 5AH0A 4PYOA 1GUAA 2HLNA 3FSRA 2JCVA 3WGVA 4IIYA 5KWSA 4K9DA 3PEEA 2P2DA 4RE6A 4ZU3A 5AVZA 4QDJA 1Q22A 3STTA 3PKJA 2O3UA 5KMGB 3RF6A 1J4AA 4DR6B 4Z4IA 3CEAA 5ICMA 2J0EA 2HZBA 3CCCA 3MPOA 4L6IA 4P7JA 5EIFA 2SHKA 3KJHA 4PHGA 1ULZA 1DIRA 5AJXA 3Q3IA 5TF0A 3TN7A 3DNPA 4HNTA 2IHJA 4JJFA 1OIWA 1W94A 1Z28A 1LCIA 1FXWA 1MQ8B 2Y0PA 1C3JA 3KZ1E 4RKYA 2O06A 3IQGX 3JAMA 3FYCA 3A6GA 4RCZA 5F1OA 3TDKA 1Z4LA 2BTOA 1MJGM 1QV6A 2HU7A 1DUIA 2VATA 1A9XB 1Y4SA 1RLTA 3B70A 3HGQA 2VYFA 4R1PA 5EC8A 3TZLA 5DHRA 4MUYA 4ALMA 5K09A 4RK6A 1NSFA 1P91A 2RH9B 1ZP6A 2EIHA 3BAZA 3KQYA 1O4WA 2DC1A 3KEQA 3D7LA 3TCKA 4BN5A 3SC4A 2W98A 3CR8A 2AKAB 1QV7A 3OSZA 4U3JA 4WD3A 2JAWA 1QHHA 3DEJA 4EGAA 5L7WA 1V2HE 1W30A 3L7AA 1PUJA 1T0HB 1XTJA 1CRLA 4JUBA 3CNEA 3B9PA 3GL9A 1J06A 2P9JA 1JHYA 1U4NA 3AZPA 5JASA 5IBRA 10MHA 5AIAA 2C7RA 5A04A 1YOBA 2ZFUA 2QAJA 4U7JA 2XIJA 1PU2A 4YJDA 2I7CA 1EVYA 4ALIA 3JQ9A 3Q3GE 5G40A 1BYUA 4QE3A 4HDRA 4HDSB 4JZYA 4QU9A 4BUZA 1Y5RA 2EBHX 4LZPA 1TA9A 4G1MB 2BFDA 1EWYA 3AP1A 4GIBA 5EIBD 3DCJA 5IW8A 5IAKA 1PJ2A 1NVDA 2NZXA 4G23A 4O29A 3WOVA 3O8RA 1TB4A 4DTIA 1WHTB 1BDMA 5I3ZA 3KPUA 1DDGA 4HAOA 5CDUA 2AFRA 4O1MA 2VQEB 2Y6UA 1LLCA 3DFMA 4PRZA 3TZEA 4DBVO 1KO8A 2JL1A 3OSUA 4RGBA 2BDTA 2ERYA 4TRMA 4OXIA 4PPFA 2VVTA 4C5AA 4X45A 4PQFA 3HK2A 2BSAA 5FOUA 5TB5A 4DCTA 2PUHA 2WPNA 3KE8A 4IRXA 4M22A 4R5MA 3UCXA 3W6PA 3WIOA 5HGXA 3L1KA 3O8OB 4K46A 3TSWA 3PFHA 2OR3A 2WLSA 3OKFA 2WINI 1EK6A 4DWOA 4YCMA 2WB2A 2DPMA 1WKVA 2F9MA 3A3OA 4PONA 3NC4A 4YAIA 4WK6A 4DV4B 1E9DA 4YUWA 1N75A 4YT8A 4L4RA 4BMDA 4Z1OA 4RMIA 1T5HX 5BW4A 4JB3A 4EY3A 3GZNB 1Y1TA 1YZNA 3WDKA 1N3BA 4WLEA 2W6JD 5DNDA 1OD6A 2DY0A 3IUJA 4UMEA 2ZTVA 3I5MA 3VVMA 3IODA 3K1TA 3X2EA 2MYTA 1JXAA 1R6XA 4Q7EA 3DE3X 1WMEA 4NDZA 4NHEA 1F9EA 4NQRA 1PHRA 4XLZA 4Y7DA 1RYHA 7MDHA 1TF7A 4NPAA 4LYAA 1PWEA 1DLJA 2RHMA 2I6FA 3OZVA 4KPUB 4F5WA 4HYQA 4DIEA 4ETIA 3PE3A 3C43A 4KRFA 4DMUB 2C8KA 3LDHA 5I8PA 3IJRA 3UGQA 3PGJA 4UTOA 2BZGA 3O6VA 2WUEA 3X1JA 3GJYA 4RF4A 2PD4A 4L78A 1SMKA 3BRQA 2NYAA 2PRIA 1LBHA 5D01A 2X8LA 3RFCA 5IABA 1ESDA 4W82A 4KQWA 2B2XA 1CUZA 2YV4A 3HJNA 1Z82A 1U7UA 3AVQA 1V9LA 1G8MA 1Y80A 3Q9UA 3TB4A 2EF0A 5AW3A 4KW7A 5JCPA 1MT3A 2C1EA 4Y6OA 1SHLA 3OZCA 3ZY4A 2O3QA 1TPZA 4LQCA 2RG7A 1DAFA 1VKRA 3BHIA 3CE6A 4NU5A 2IY9A 1GPBA 2VH5R 3M2TA 1NVUQ 4HXFB 4KQIA 4TQGA 4Q9IA 1NVGA 3T41A 1NW9B 5FD8A 1AK9A 3R9KA 3L4KA 3OM8A 4CLRA 2MT9A 4JC0A 4MQEA 5AVOA 1VKOA 3ZXYA 2GK6A 4EHDA 3A6FA 2O8FA 5JHHB 2G77B 2VSFA 3BIXA 3T5CA 1JU3A 2ALJA 2O5CA 1GD1O 1SQSA 2G6TA 3A25A 4A82A 5FF9A 3ILXA 4BL5A 3Q40A 1IL0A 4J6FA 4PGHA 5KNLA 2ABWA 3PRKE 2Q5QA 4QYIA 2DTDA 1NWHA 3OZSA 4K9SA 4MPTA 4QODA 4YUVA 5DN9A 4OLFA 3T7IA 1XMIA 3EZGA 1Z7WA 1UKZA 5BSMA 1G21A 4IUYA 3NYRA 1JG2A 2P9ZA 5HFNA 3SZLA 3TWOA 1YB1A 2BMAA 1K4KA 3N8KA 1CR1A 2CLLB 1SWVA 5ITSA 1H93A 1FFAA 2WJ3A 4OK5A 4LGMA 4G25A 5AK0A 1E1CA 1QV9A 2H11A 3E3AA 1HGXA 3OQMA 3NASA 1NYRA 3VBEA 1Q0QA 4KRYA 4BCCA 4TKLA 5CJPA 5FBQB 2R751 2FEWB 3TXXA 5HOQA 1PL7A 2AQHA 2BI4A 4L15A 3VGPA 2VDRB 4DMKA 4UATA 4LFAB 4JZKA 1O2DA 4BMXA 2Q6TA 3UMGA 2H18A 3NKLA 1W5BA 5UKDA 3FBWA 4KSCA 5KTRA 1JECA 5ALWA 2Z2XA 4EP1A 3U2QA 4LS3A 1J8DA 3KJXA 4FGJA 2O7SA 1U3WA 4Q02A 1UZMA 3FWNA 2YV2A 3K1AA 3RRYA 1ZVQA 2WUFA 1XQWA 4FFPA 4BKUA 4IOJA 3KAPA 1E1NA 3OQBA 4PO9A 1NNI1 4X7BA 5J63A 3THSA 3GUZA 4KQ2A 2GUWA 4KSYA 4E12A 3MS2A 4MB2A 4JEUA 5HE8A 1SXJC 2YNMD 1AS2A 1NVTA 3V1MA 5A7FA 1YR9A 1XXLA 2ON6A 2QJTA 1Q44A 3HR7A 4BP9A 1QYDA 5AM1A 5HJ2A 3FM9A 4G4SP 5ITZA 1RAEA 1L5HA 1XNRB 2JJ1A 5MGBA 3AM4A 1Z4QA 3GFTA 1IPEA 4EUHA 2PUBA 1X9IA 4X65B 1KJIA 2B92A 3LS2A 2AG0A 1E5TA 2MMGA 2OSVA 3M7IA 3QV1A 3WLOA 4HOYA 3RWBA 3UPDA 4TKVB 4R9VA 4X5OA 1FDVA 1REQA 3CONA 1M34E 2CLSA 3MCUA 2IU3A 5B36A 4UNSA 1SUSA 3PEYA 3WGQA 1CZHA 1CDDA 3P2OA 4ZHQB 5AVQA 3BKXA 4YJHB 4JXXA 2WHPA 2G8LA 3ETHA 4PGAA 4IG9A 5DYIA 2AXNA 3E84A 2JGJA 3O03A 3JARB 4WTOA 2IYAA 2PRSA 1FLDA 1PW5A 1I4WA 2ZTLA 5DZSA 5FNVA 2NUAB 1OT3A 4HWSA 2O0MA 4LMRA 5FEUA 3GJQA 4J91A 4EJSA 2AX3A 2ZAMA 1NY6A 1VJTA 2AVDA 3LM8A 5IJ9A 3TKYA 1RYEA 4LISA 2IUYA 4MUGA 5FXMA 3K6SA 1Q14A 2YIJA 4MR8A 2XUJA 4GPEA 5ECGC 2PBLA 821PA 2VJYA 2F1OA 4IKPA 4UNIA 2ECQA 1DIGA 4TSRA 4GL4A 3BREA 1F4PA 4PS1A 4EZBA 3ZLJA 3MRVA 4OMUA 4QGGA 4CMCA 4UM9B 1N3YA 4ZAGA 5B1DA 3KKQA 5DNCA 1KJJA 2IE0A 2AFHB 4IGIA 4ZGBA 5EKXA 3FMGA 4WVFA 5C3UA 1F2DA 4LVNA 4DY6A 1GUYA 2IYRA 3P94A 4YRQA 3FOAA 1SUCA 5IC5A 1E9BA 1UPBA 1UXIA 2QMEA 3L8GA 2R1TA 1GZSA 1W49A 2F43B 1EINA 1TCVA 1AHNA 4IJUA 4MINA 4MRSA 4Z1MD 1EP2B 2YY6A 3IILA 5JROA 1LSUA 2P7IA 1HE1C 2AQKA 4J2OA 1MAUA 1JHDA 2AD5A 3R7DA 1DKNA 3IP9A 2Z6QA 1JA1A 3WY9A 3DBRB 3P2YA 2H8KA 4XYEA 1R3DA 3L7CA 3SD7A 3IERA 5F35A 4MGYR 3TOSA 3TSOA 3SHQA 3C2QA 4CF5A 1JH8A 5BUQA 4J2HA 4NDAA 5JH7B 1U8YA 3PDUA 2A1TS 4AKSA 5IF9A 3IIMA 1ZR4A 3QVWA 1OT5A 2NV2B 2X5KO 1SHTX 5FADA 4EB6A 3AVXA 2IYUA 4JU8A 4IFEA 2DY1A 2QPOA 5TS3A 5T57A 2OSBA 2BBWA 2X77A 1Q2UA 1PO7A 1AHHA 1YVRA 4GX0A 1NYQA 1SCUA 1VPEA 4O5OA 3BWYA 4CL0A 4DV0B 4NABA 4TT8A 3AGPA 4LVCA 1K5PA 3C97A 3DKKA 4C6SA 1UR5A 3K2QA 1Z75A 5BQPA 4BFSA 5BWCA 5M04A 1TEXA 4R8MA 2C4MA 3ZV4A 3JALB 3W5HA 2CLDX 1N25A 4PPNA 3ZZNA 5JD5A 3OX4A 5TPZD 1SD2A 2QVBA 3GUVA 3GAAA 1OILA 2Z57A 4AY2A 2R00A 4DA7A 2EP8A 3SCZA 4ZI5A 3WYGA 3T3NA 4KR9A 3Q3HA 3W2FA 2QR2A 1NR5A 1G9XA 2ZBVA 2JGKA 3RS0A 2B36A 1WAMA 1GSOA 1LBSA 1WNFA 4WLUA 2WY2D 5ADWA 3WR5A 1V26A 4LZWA 2QMYA 3FUWA 5BVHA 1BXZA 2B2CA 3KEFA 3QLTA 4D8UA 5IK2D 2WG2A 4NU6A 1KYVA 1Z9BA 3VR4D 3L5KA 1ZMXA 2WE7A 4L95C 1JHPA 2ZRJA 3LZDA 4WUTA 3VR2A 1TE2A 3LG2A 2F1IA 3L6EA 3TLEA 1B74A 1JJBA 5E6RA 1QUEA 4YRAA 3P2JA 4MKZA 2GASA 3G5TA 1ECLA 3TPCA 5AIBA 1R0CA 3TOCA 3VX4A 1HTWA 4B73A 3WMWA 4KWHA 2WF7A 3LPMA 1P1FA 2X9QA 4EAQA 4EJ6A 3WWYA 4D9BA 2VAXA 1NN5A 3FDFA 1Z5WA 1AB6A 3KC2A 4P58A 4WEOA 1U2DA 5FR2A 3TQIA 4MO9A 4B82A 5C8XA 2ENUA 3OT1B 1CQPA 1K0FA 5FPYA 4HT3B 4HK4A 2X1VA 5G1PA 3SJBA 4GBGA 1QH0A 3FYTA 1KDYA 1MT0A 1EP1B 1TDJA 3S68A 1T8PA 5CIWA 4DIFA 2XSZD 2VLIA 4PC6A 1IK4A 2F9FA 2V54A 4OM8A 4MXDA 2XGSA 1ZD2P 5E9QA 4JYBA 3N2NA 1SKAA 3HP7A 3OQVA 1Q5PA 1LDYA 4KNVA 4K81B 1UK9A 2VUTA 4XGNA 1BX0A 3IEXA 3C5CA 3VU1A 1VSVA 3RADC 2A9PA 1QGAA 1FS6A 1L5VA 2VDNB 3KX2A 4HB4A 4I36A 1W36D 2W43A 1S2IA 4EI9A 1SBYA 3ZDRA 1HEYA 2RFLA 1FS4A 1VKNA 3LSTA 4LXTA 3BB1A 4C9BA 2Q9AA 3LBHA 2IPMA 4RWEA 4Q82A 1IB6A 2AOUB 2BKEA 3BWDD 2OP1A 4LHVA 4ERNA 2EEPA 1A9ZA 3EGVA 4R16A 2WUWE 4NCKA 2O7VA 4PZ9A 1KRHA 3JW8A 1A9TA 2VAMA 3WLQA 2J6HA 3KUUA 4FKMA 3I2YX 1FYWA 2F90A 3LGXA 5F4BA 3KTAB 5FYQA 3U4GA 3FYUC 2CNKA 3Q7EA 3Q0EA 3QLUA 3H11B 3PLNA 1U2TA 3ZKAA 1DV1A 1LPMA 1M6NA 1P2BA 1NJ6A 2W2QA 4LRUA 2EKDA 4OEHA 5AI5A 3OZEA 3ZDEA 4CUKA 3U4QB 4RVUA 5TEVA 1TGYA 3IOEA 4PLFA 2ZTMA 2DH5A 1VI5A 3F3YA 1T24A 3KBOA 3BJMA 3S7TA 1A97A 1LRLA 1E79A 1RWWA 1EX9A 1SWWA 2QZPA 5GV7A 4AZSA 4LHWA 1DWQA 1W88B 1GCUA 1JQLB 2W11A 3JD3A 1CERA 1DBSA 1YMQA 4GM4A 4JA2A 1B6RA 4O4JA 3PHJA 4DGQA 3SJ7A 5CW2A 1NA5A 2WU0A 2ZEJA 2QN7A 1G60A 4KR6A 4Q21A 3I04A 1Q0RA 3HYLA 5TJ9A 4I4TA 4MS4B 1QG6A 1GNSA 1I4OA 1U2PA 1XVVA 2PTHA 2XNHA 4C4SA 3ZWPA 4GNKA 3TB6A 4EMBA 1AGRA 2VCEA 3R20A 3HXTA 1BDIA 1VL1A 3GJZA 2D1FA 1JMYA 5TT0A 1U8FO 2OILA 3CW9A 2RK6A 4XYBA 5H3LA 2VJQA 2IV2X 3LTNC 2CT8A 5JJIA 3DE6X 3QWFA 4OPMA 3IMKA 2QA5A 2PKRA 1ZUNB 3D3JA 4ZVVA 1WZUA 3QEMB 5A4FS 4XD7A 4IYJA 1XZEA 3AOEC 1V4BA 5HXAA 4LJSA 4XX0B 5JVDF 1BWPA 2Q1XA 5PNTA 3CUYA 1YTLA 3QENA 5FPHA 4MRVA 1MD9A 4C4PA 1C7ZA 3W34A 3VJRA 3S28A 5JNUA 1IY9A 1A88A 4IICA 1OLXA 5DMXA 2ZKIA 3W5DA 3SJCA 1M1XB 3S8YA 3AEQA 1DG9A 3NM5A 3H1FA 5K3OA 4MKHA 2I22A 2ATVA 3EY9A 5C4GB 3IKJA 4BV2A 4D8XA 1KHTA 1IOZA 5J3JA 3TEMA 4DCGA 2JK0A 3HI6A 1GPYA 2RB4A 3F7TA 2WT4A 4DSTA 3NAZA 1VYTA 4JSTA 1SVUA 2PS9A 3UHPA 1ZX1A 4H1HA 3M2PA 4JP1A 4YALA 5CFNA 2FKAA 2ISSD 2OUIA 3S99A 4CG0A 5I7FA 2GEFA 2ORWA 3II6X 2QTVA 3MJ4A 4YUAA 5FLXA 5C52B 3CRRA 2C2OA 1VP9A 2PE5A 1LPAB 2R8RA 3PIRA 2EOAA 3HY4A 3TLCA 2JJYA 2EKQA 2XYQA 2O0KA 2WKSA 3TL6A 1MABB 2C98A 4HYTA 1Z18A 1C4XA 1SG9A 3PGLA 1VJ5A 2UDPA 4ZALA 4XGQA 3ZY6A 1ZD9A 1HWYA 4NHOA 4B3DA 4DIKA 1XAJA 1AMOA 3F73A 4A8JB 4AJ4A 2WE8A 1VB5A 5E2AA 5DTQA 4E15A 4MQFB 4JIGA 1AZTA 4YX9A 2HNKA 3UA3A 4BX9A 5BMVA 3VDRA 4ZQCB 1NC1A 5KVQA 1FLVA 2OESA 3UT5A 2KHZA 1P74A 1VLQA 3E03A 3ZHTA 3ZDBA 1NX6A 4HSEA 5JXHA 3O4FA 3GLQA 1ICEA 2HUNA 3PQ6A 1VRVA 2XMRA 2P8JA 1Q1AA 2UUPA 2W2VA 3NWEA 3BMXA 4XKJA 2DWCA 5A7GA 2PV7A 4MRMB 1G66A 1RJGA 1RYDA 3KHUA 4JHXA 1VA5A 1LWNA 1BYIA 2IYYA 2OZPA 2PGXA 1AKVA 3ZV5A 5LA6A 1OFUX 4JGBA 3MT0A 4UMDA 1BGWA 1JEQB 2PR7A 4UHJA 3PGA1 4R05A 1TLTA 4QRIA 3AK4A 2WTAA 1Z5ZA 3FH0A 3G1WA 4GZ6A 2GYVA 1T2FA 1BMDA 1F5SA 5DOZA 3HM9A 1P4AA 2BGNA 3C3BA 1ULBA 3BM5A 3G2IA 2Y0DA 4NECA 1KPGA 2FH5B 3OMWA 2OP0A 3VR6D 1MW9X 2DH6A 4G1CA 5D5PA 1TYZA 4N0QA 3RC1A 3TXAA 3WGGA 3HJFA 5L3RA 1VE1A 1J70A 4TYPA 1WM1A 4ZAFA 4BRSA 3OZ7A 4IGAA 3RT7A 1YD7A 4EUEA 2M6SA 3WGZA 1XFAA 2ZB2A 1VLHA 2BBOA 3W79A 2PH3A 1PLKA 4RAOA 2YY5A 2W2MA 1H0HA 1J2YA 1NVBA 2RJ3A 1E3EA 3F9RA 4NLLA 1OXUA 5HMMA 3ZNNA 2WIGA 2CB0A 2Q3CA 2GS9A 5BOSB 4OX9B 1KJZA 1NN3A 1P5RA 2OV4A 5JSHA 5LZ2A 3QFHA 2ZQ5A 3IJEB 2DR3A 3LPDA 2IIVA 4CLOB 3MGBA 5HX7A 1AE1A 1U8UA 1GGNA 2WZDA 3DEAA 3TTWA 1YS2X 3QUBA 2OFOA 3O91A 3AUXA 5DPMA 3HZOA 3BHNA 1J2EA 4J0EA 3SVZA 5EMKA 3VU8A 1XA0A 3N59A 4O2BF 3OJLA 1T3HA 4G5GA 5K0EA 5TQ0A 3DOEA 2WIFA 3T12A 3S8EA 3U61B 3I8SA 4G97A 1GHTA 4ITRC 1JIKA 3TSYA 4R1UA 4MV1A 2G9QA 4WI1A 4AICA 3B60A 4NMLA 2Q6VA 1VXOA 4WCDA 4GC5A 1FP1D 1I4EB 3PD0A 1TEZA 3RS9A 2BPOA 3ETCA 4G0PA 4IAOA 1WS6A 2D06A 1JHOA 3A6EA 1LBTA 5BN1A 2FMFA 2O2EA 4BNDA 4XM0A 2IP1A 4GUDA 3R7SA 4BMNA 2YXLA 1C8KA 1E92A 1CUXA 1J90A 3QF4A 3HRIA 3UFXA 2D1YA 2A0KA 3E2MA 1HY3A 1V41E 3MAGA 4TMKA 3G59A 1QAMA 4BWVA 3O8CA 3PJDA 4O0LA 3GCXA 4DIBA 4LVUA 3UK6A 4LDNA 5I9LA 2JD1A 5KQRA 4DB4A 4UU1A 3DBIA 1MXHA 1WUIS 2WSSD 4QUGA 2HRCA 3DZKA 3SYTA 5I8WA 2GRJA 1GTVA 1V6CA 3GCWA 4EBBA 1A2OA 1FFSA 1M0SA 1EX1A 1W4BA 3DMTC 1C8LA 4QBFA 5ALYA 4AO8A 4CIXA 1WUHS 2YOGA 1U8TA 5KYUA 4D43A 5T8KA 3E3OA 2GBGA 3H9UA 2ZYSA 4BVHA 1P0IA 3BMQA 2R4QA 4E08A 1A3CA 1NMQA 2YW9A 4QL3A 4TQ9A 4YJ2A 2MMCA 4CDMA 1GQFA 2WTUA 5AVSA 2FX2A 4KPGA 4WOJA 5D3MB 1MGPA 2JLBA 3UC9A 4G6ZA 3NVDA 2ID9A 1UXHA 3U7JA 5C7LO 1N92A 2AQ8A 2HK9A 4WL0A 4C0WA 4RL6A 1L7QA 4N82A 3I6IA 1FFCA 3QE4A 2N3ZA 1ZK1A 2EP7A 2C00A 2MIIA 3HCRA 4RHCA 5B6IA 1GGFA 2QN3A 3ND8A 3IFSA 1Y33E 4EHIA 5F23A 2HWUA 4PYRA 4FCTA 1QPBA 5FULA 2WF6A 1OXSC 4KVZA 3D8SA 5EAIA 3QPVA 3H5NA 3ROMA 2RJOA 3FNIA 5EJ9A 5F64A 3S8MA 4P33A 2XYGA 2ZJ2A 4ZCIA 2G0AA 3JWHA 4FJ2A 3V6LA 3VU9A 3FGZA 1ZCZA 3B36A 1L9XA 1PTJA 2AR9A 3EC1A 4CCYB 2PMDA 3ZDZB 3RVRA 1FSSA 4ETWA 2P2ZA 2B8NA 3TCNA 1KF0A 4HNRA 1LFDB 2VDUE 1RKVA 3N2IA 6LDHA 4HR7A 5IPFA 1YRWA 1ENPA 5LDHA 4BLOA 1N57A 4KFCA 5FOVA 3KIPA 1O97D 2HH9A 2PQMA 4URUR 5IMBA 3UWMA 2ESRA 4A23A 3ZN2A 1YACA 4ND5A 5KUTA 1DI0A 2B35A 3Q5GA 3TQTA 2Q46A 2X15A 3G88A 1OAOA 5KQGA 3ASZA 1M8JA 3ANNA 2IYLD 3NDJA 1WXGA 4JR2A 4XIJA 3UKDA 2RB5A 3S2GA 3V9PA 5B5SA 1JMKC 3DXXA 3OFSA 4ZVMA 1S8OA 1PAUA 4Q03A 2GETA 4M9SA 2C8LA 1DDOA 2XZPA 3GQBA 4YAEA 4X94A 2I4MA 4E0BA 3WGHA 3TL2A 4KXLA 1PSZA 1X19A 4ANFA 3A9TA 3PD1A 1YGPA 1Q83A 2H06A 2R8OA 1GUBA 2XE4A 5EIHA 2EKPA 3HO8A 3RRBA 5DLEA 3X1KA 4A6PA 3ZCQA 2VNHA 1DAEA 1OI7A 2QN9A 3I37X 3Q5DA 4MNTA 1Z6QA 5ALGA 3REFA 5A2GA 1HUQA 1YBMA 1YZKA 2ROQA 4AO7A 2XMDA 1MOZA 4S04A 1CVLA 2BLNA 1TUBB 2KI5A 2RGDA 3OJEA 1N5IA 1MX5A 5ESWA 1Y5NA 3DL2A 3KEMA 3RK4A 4GW3A 9ABPA 2Y66A 2VPTA 2H2AA 3VMMA 1KRWA 1I6KA 3HJBA 2PPVA 4N6NA 5BQOA 2IE8A 1MX3A 4MULA 1JWAB 3L07A 4OHCA 3MILA 3WZMA 5B3JC 2O19A 5JXIA 4JP5A 1VRCA 3FCAA 3K9NA 1WDTA 4EUFA 1XDUA 3EARA 3R9XB 1YMUA 1J0EA 4DLYA 3K72B 4M4SA 1UBNA 1UCFA 1C3LA 2VP6A 1ECJA 2QD4A 3KT8A 2JLQA 5K0SA 2Q21A 2D0PB 2ZAIA 1M76A 3JRWA 3GEMA 4HB0A 2MYUA 3MN1A 2WV9A 1KI4A 1EFKA 1QZXA 2R4TA 1UMKA 2PR2A 2DF8A 1KEEA 1H0KA 3DDWA 4FGUA 4FUQA 1OSNA 1COWA 1UAYA 4PLVA 2QQFA 1C4KA 1R0XA 4TXJA 3DMNA 1CR6A 4FCCA 4HXGA 4LJRA 1WB6A 2F55A 4NCAA 3FROA 1Z47A 4EX7A 3ZU4A 2HV8A 1OZAA 3NGMA 4N8EA 3AUYA 4RPIA 1CV2A 2P2SA 3NTQA 4IFTA 5CD9A 3KL4A 3NANA 2ECOA 4MSUA 4WA8A 3VR3A 2ZXUA 2CXTA 1BOOA 4L5YA 1L4HA 3L4EA 1AY0A 3CVUA 4NULA 1Q91A 3H5OA 1GVNB 4NV0A 3ZTYA 1NW6A 1H6BA 2C5GA 4MV5A 2JLSA 1QC5A 1U04A 1FPQA 2RG1A 3DDUA 3KR0A 2CKMA 3RUCA 4A0SA 1YZVA 3RYHB 3W8DA 1R66A 3LQ2A 2GPJA 1JG4A 2O9JA 3EXIA 4LSWA 2CGEA 4C7JA 4RMJA 5D84A 4LZNA 3LZ6A 1XPUA 1SAYA 1CZKA 3T35A 5FI5A 3M6XA 4X8HA 4JA0A 2ODPA 2LTAA 3JWJA 2VUUA 2WAOA 3SHWA 4BNZA 1ZAKA 4HH1A 4ZXPA 4QOIA 4N0EA 5DM0A 3BXPA 5KWIA 2FRVA 2VBCA 2G1AA 1AKYA 2JPDA 1PKEA 3AHCA 3G0CA 4PG7A 1IIBA 3VAYA 3GO4A 5A03A 1KYWA 5FBWB 4YDQA 2VUHB 4IDAA 3IV7A 1S6YA 3FNQA 1VJGA 2HA6A 3VR5H 3V7YA 2G40A 5AUQA 4UCQA 2RDMA 3DD1A 3A31A 3EEBA 4QU0A 5DX1A 2NACA 3KDSE 2GZSA 1O6ZA 1U8ZA 1W6UA 4D9HA 5U9CA 4OKNA 1V25A 2NU9A 2AG8A 2R8EA 2BMFA 5TE9A 4LF8B 1K4YA 2RH5A 2YXNA 5JEDA 4UW9A 1GEEA 3KFXA 4L74A 4OH1A 5SZJA 4D98A 4YCLA 4NNOA 1WY5A 2AWNA 2NQTA 4YBZA 2R86A 5CIYA 5AW6A 1XPOA 4FOLA 3GOQA 4XE5A 3Q9LA 2FSFA 3L4BA 2YL2A 1XTTA 1E20A 2MSNA 4GU5A 1QTNA 1E4EA 4LYJA 1C7IA 3PEUA 4RX1A 1DAOA 1YRQA 5AHWA 4KVGA 3TZ6A 3CKLA 2CD9A 4ZOLF 5EUBA 3NB0A 2C4HA 4COKA 1ISJA 9ATCA 5F7XA 4L51A 4NCNA 3DUFB 4DLTA 2J6IA 4E4TA 1D6MA 1UJCA 4PS0A 4YMTA 1XZHA 3KYCB 1TMKA 4FR0A 2ZRIA 1DVRA 3DEHA 3PC6A 3KXIA 4KE9A 5EP2A 1JJIA 3NIFB 2X0NA 3OEYA 2G9NA 3RFVA 3UAYA 3DV2A 3U7HB 1Y6JA 2ZUUA 4XGKA 4YA6A 3K16A 3SX2A 2A30A 3BULA 4TLAA 2HHHB 4WZBE 1ZJYA 3WWEA 2CMHA 4PFQA 1M8GA 5FTWA 3ET4A 2XB9A 3AIOA 1TCUA 2ETXA 1DC8A 1Z2AA 3F6PA 3OJWA 1FF9A 2R00C 3D8HA 4M1TA 3OZAA 3G1TA 3DF9A 4B6EA 3DKIA 4F86A 4OYLA 1RT9A 2W22A 3HKBB 2REQB 3H5RA 4Q1FA 2FI1A 4XWYA 3S55A 1YI0A 4NZNA 3TRFA 1RIFA 1F6BA 4BIIA 2FZEA 2Z83A 3B8EA 3KLPX 4GWKA 4N3BA 1Z0FA 3FPAA 5LU9A 1TM5E 7MHTA 1QIMA 1U8XX 2CB9A 3CZQA 4HX2A 4M6WA 1QAQA 2IELA 3WAJA 1A5AB 1XCMA 1Y6ZA 3FTDA 3MM4A 4Q9HA 2QY6A 3CF0A 1M1YA 3DMTA 3K9HA 4N3CA 1QKJA 2XAAA 2C2HA 1RI5A 4QGHA 5E38A 4GLFA 2QMOA 2PNJA 3G0IA 5K8LA 1XOIA 1WZCA 3IHWA 1MJFA 1N33B 3GAMA 1L5FA 1EGQA 2YXBA 3AB8A 1VHJA 4JI1B 1OH5A 3LCVB 4BKOA 1L5MA 5F76A 1ZRNA 1G2PA 1FVFA 5A3RA 2C5AA 3FGNA 4BAUA 5DHPA 4OA5A 3UJAA 2FPLA 3CEHA 1D6SA 3NHFA 1P17A 2PIAA 3TLGA 3RNOA 1OWPA 3X1MA 4RJKA 5KTPA 5KNDH 1OH7A 1QG2A 1BHO1 1K97A 1KE1A 3RDPA 4BNKA 4C2TA 3LE8A 3TIFA 1NG1A 2QDXA 1JHZA 2RARA 1SD5A 2NZ2A 3OZXA 4PC3A 2UXDB 1G20E 2CK3A 4KWTA 1U0GA 5CGQB 3X2FA 5KC8A 3L92A 4B17A 1EFPA 4H7EA 4EABA 3N2GB 4RIHA 3IUPA 3G6KA 4BV3A 4QAQA 5B55A 5A5VA 1T1IA 2B30A 3K1YA 4M60A 3BEDA 3VV2A 3L1IA 4MR7A 1VHLA 4TLBA 5CYPA 5GM2A 1VE5A 1XF9A 2H4FA 3R09A 3RTBA 4DADA 2JJ8A 2X14A 2X8JB 4G8BA 1S89A 4U8GA 4D7AA 3AFHA 3LK7A 4X0EA 1TJ5A 3QPWA 4M49A 5DYYA 2PGIA 4LYHA 4IUBS 5JAZA 1IAVA 4ZO8A 2OYSA 4ZN6A 1RAFA 3QKWA 1X13A 3KUKA 1SPBS 2ORED 1OPRA 2LRHA 3HA3A 3M9XA 1NUPA 4Z86A 1C1DA 3RT1A 2HW8A 3Q0TA 4R71A 2QD5A 2ZT6A 3HKCA 1K3TA 3D0QA 1DKOA 2WB4A 3QK7A 4UUQA 3IURA 5KYVA 3VC1A 3ZYZA 2JHGA 3OPYA 3PVCA 4LDAA 1CJSA 1HNZB 2W2KA 1UM9B 4FGKA 5H4GA 2V9PA 4BO6A 2OXRA 2VQSA 2C7OA 4JI8B 2CWDA 2HK6A 4I55F 2ATCA 4W8HA 2J3KA 5LQCA 5AW7A 2KLHA 2VSYA 3OIWA 1QPZA 3R6WA 4C7MA 1QS0B 3JQFA 2NXCA 5E3HA 1N4DA 1CRZA 3F7OA 1XTQA 4RV9A 1IHDA 1H2ZA 1XF1A 1LLFA 5AXCA 4PFJA 5CGZA 4BNMA 3AHHA 1JPUA 2XJ9A 3OMXA 4LC0A 4X00A 3C0KA 4B4UA 2H54A 1JIVA 3KM0A 3KZXA 4YMGA 2HQRA 1R4AA 4HH0A 2NYUA 5CFOA 3TUZC 4K9RA 4C03A 3ZD7A 1IPFA 3ZLUA 4YXWA 3T7SA 3UGKA 1BWSA 1I24A 1JWBB 1CK4A 1OXMA 2D3TA 2ORIA 3KXKA 2C4NA 4NPHA 1IBRA 4RVGA 2UZ4A 2YJ3A 3IP6A 4GOXA 4DPLA 2F8SA 1NBIA 2BH9A 3RTCA 1NMSA 3GGSA 4N3NA 5DGHA 1S96A 3ROEA 4ZI7A 2DTEA 4G0MA 5CFMA 3CCFA 3C7CB 1ZVVA 5DISB 4B3XA 3FDIA 1IRXA 3N2ZB 1AKWA 4TL8A 1NP3A 2N9UA 3O8QA 3PQ8A 4YS6A 3MWFA 3RAGA 4E5KA 3KZOA 5K03A 4U7DA 1UBKS 3BXHA 1IMOA 1RWVA 3NT2A 4PY2A 5HIKA 3EPJA 1MEOA 1RC0A 3QPCA 2XMGA 3HBLA 1X15A 3H97A 5A9SB 1U0BB 3A4MA 3GD5A 4Z9XA 1DARA 2YCLA 3JQPA 1GSHA 1EX6A 4UHHA 1X14A 3RABA 5EZYA 3U40A 3UYLA 5JJBA 3X2SA 4D4LA 3D7MA 4XVCA 4TV8B 2NZ8A 2RGBA 1J25A 4U2KA 3REQA 4F0JA 3DDNA 1XTZA 1P2FA 1IXSB 1ZQ9A 1GFSA 2HO5A 1E6MA 3DGFC 4DMGA 1TVMA 3HBNA 3H84A 4MCIA 3ZJTA 1AF7A 1G16A 4XLTA 3SU8A 4K3VA 2I1QA 3CZRA 4B46A 4YAKA 1ZK2A 2YDXA 4OAPA 3I2FA 2DPHA 3KQQA 4HLUC 4V0ME 3AI1A 1QRAA 1UPFA 3SQNA 4BWYA 4AMGA 4F4JA 5BYAA 4F4FA 4RD4A 2IPLA 2V6MA 3GFRA 3M3HA 4NFYA 1I7DA 4OJTA 2CMFA 5HG0A 3LDUA 3QTTA 1PR4A 3QUSA 4EG8A 1Z56C 1IQ0A 2F1RA 2GERA 5CIQA 4YT2A 3OTWA 4I1VA 3JR3A 4HAUA 6AT1A 1Q1QA 2ZANA 2ZYGA 4FDUA 4KCGA 4U6SA 1G291 2BGTA 4B32A 1VJCA 1OYVA 2VPZA 3KUDA 1WX1A 1L6IA 1SUDA 1JH9A 2QV7A 4LRSB 3AF6A 2EATA 4C0HA 2HX1A 1KU0A 2Y1WA 3NUQA 3QKIA 1SEPA 1FPMA 3UUEA 5BVGA 2B1GA 1R64A 2QXTA 3G9ZA 3G0DA 2IVFA 2E0IA 2B5OA 1HK7A 3AOEA 3MAJA 3QLVA 3WQRA 4E14A 1C1XB 5A02A 1LS1A 3T5AA 3KQWA 3AGQA 3EDMA 3C1OA 2O3TA 3D6JA 1L1FA 1W7AA 1B6GA 1UMDA 2ZI3A 3O4JA 5ILOA 1MB3A 3DM5A 4H6XA 1BMFD 1IBKB 3TRHA 1JQEA 1QTQA 4YRBA 2QMZA 2IXFA 1KO7A 3H3JA 3EIFA 1U2RA 3VPCA 3MLBA 2WTEA 3QSYA 1HMYA 1PVDA 1W0KD 2O0LA 3WIUA 2IXAA 4UHKA 3ZW7A 1USGA 4ZI3A 3I9OA 4JXJA 1V35A 2QTGA 3ECAA 5BSRA 1AA9A 3L4JA 4HQ0A 4FHCA 4QRHA 2PUJA 4LYEA 2ZZKA 1T1SA 4F3YA 2Z09A 1JS1X 4JBNA 1IBMB 5C18A 1ADJA 3H8SA 1NKTA 1SK8A 3R4CA 4EJFA 5LYJF 1A5SB 1CKEA 1L5NA 3V80A 4HJRA 1SIBE 1NVVR 1U3FA 1WNTA 4JBYA 1RXSA 1T5LA 5EZYF 1MIOB 2Q6LA 4J94A 1LC0A 4FXPA 4XYGA 3ZDAA 4BYMA 1B3BA 4ND8B 4CIBA 4CV2A 4G2NA 4DC9A 4BPRA 3ERCA 3DAYA 1Z0AA 3AG6A 3HN6A 3L0OA 2I8LA 3P0HA 3TQCA 1BS2A 2Y77A 3FFBA 4I2VA 5EPOA 1DLIA 3H17A 4I4LA 3OJCA 1GZ5A 4BMOB 4IX1A 3FMFA 4DILA 2H7YA 1FLAA 4M1EA 3T7KA 3UK7A 4EEKA 4RJ2A 3THOA 1XUOA 1N2OA 4KIUA 3JQQA 1H4TA 3HCCA 1K88A 1B14A 3EXHB 4PSKA 3RVPA 5E9WA 3CUKA 3GLFA 1A8SA 4QPJC 2WQ6A 4UUMA 3MGCA 3OZUA 4F8JA 1BW9B 1SKUA 3GNLA 1F7VA 1G4AE 2C2WA 1G5IA 1KQOA 1Y6QA 3DNMA 4JENA 2YC2C 5GIOE 1EJ0A 4C06A 3EZ6A 1MTZA 1NW7A 1XMQB 1U94A 5C80A 3K1JA 2H4YA 4P54A 3PX7A 3FCSB 4UHDA 4DV6B 1NW3A 5DW3A 5JCOA 1ZDMA 3VSBA 1CBUA 1KAQA 3KKMA 4IKOA 4RZIA 2UYCA 2HADA 3UMRA 4LSGA 3CLTC 4OYRA 4WFKA 1YKFA 4DDUA 3COVA 4KAFA 2HSJA 2IK8A 2JVJA 3C3EA 1UBUS 3UATA 2WZBA 3HYNA 3SQOA 2GNPA 2YZMA 5AVJA 1A8IA 4CTJA 3GP5A 4Q48A 3AMVA 4Q00A 4HVCA 3FSJX 9LDBA 3AR8A 2A92A 2OV3A 4OP2A 5ALOA 4J1SA 3TPZA 5CT5A 1QLHA 4BQSA 5SZIA 1QQ6A 5LD2C 4XVRA 1YI8A 3CKMA 1DIAA 4ARCA 2B8WA 5CEJA 3H6HA 4OLBA 2O2JA 4RYDA 1OREA 3WMXA 3F3SA 3UG6A 2M98A 2Q0HA 5JZMA 4L0MA 1DJNA 1FDRA 1RXYA 1JKXA 4BZZA 4EG4A 3QU7A 1E5LA 1JHUA 2O5RA 5I4CA 5GADl 8AT1A 1M2OA 2D5CA 1VQ1A 3IT3A 4IQ4A 3WIVA 1TCBA 2LZ0A 2BVNA 3MT9A 3Q87B 4P9NA 5I9TA 3RS7A 4EGFA 4AT1A 2NYRA 3OIGA 1CYEA 3CB4A 2F3UA 2ISQA 1E1KA 1O3YA 4FIDA 3E5NA 1FYVA 4Q15A 1YJCA 1RWQA 3C4VA 1L7VC 3B7PA 5H83A 1BQ3A 3IR6A 4EK9A 2B37A 3ROQA 3P8ZA 2ZWVA 1Z2OX 4JT4A 8MHTA 1P9NA 1X2EA 1ZGCA 4LGVA 4IIEA 3FWHA 4QQNA 2HCRA 1ZSYA 5GGYA 5H68A 3T5DA 5IN4A 1NAHA 4MA5A 4Z0NA 4B7UA 4IINA 4UOZA 3LA8A 4DDVA 5CB4A 1YJQA 3A1TA 2HYDA 4E5PA 2AEJA 5F12A 3JPYA 2Q2OA 5LMNB 2XUZA 4YRGA 5JPCA 1G5TA 3A04A 1I0ZA 1YQGA 1UBOS 1T0BA 1TTTA 4KE8A 1JMVA 3S3TA 2O0HA 4CMKA 1SCAA 4WZAE 1SU4A 1SC4A 3CEPB 3OURA 1E3DA 1XEWY 5EWMB 2EEZA 5CNMA 3DOIA 5IMSA 3LF1A 2RHLA 4E09A 1R0WA 2O2HA 1KVSA 2GBCA 1RADA 1VZ2A 1PR3A 2I29A 1H3NA 4XJSA 1U4SA 1QO9A 3EXHC 3IAFA 3H6KA 1IN1A 4QWWA 1B8UA 3RE1A 3FCOA 3PSAA 4FFNA 3WX0A 2OZVA 4E2FA 4R4JA 1W59A 5BRAA 2ETVA 2TMDA 3KVNA 5CM2Z 5EP3A 3X1YA 4F4HA 4PG8A 1L7NA 1X92A 3O2QB 4INOA 4B4DA 3KUCA 4R8SA 4Y18A 4F3CA 5KOIA 1ID8A 5EQFA 1YBFA 4JBWA 1N7IA 1R0SA 3JQGB 1QSGA 3ZGLA 1R27A 2AMJA 5E2BA 3G5LA 1PTJC 2BEJA 2VJLA 1ADGA 3LCJA 3O38A 3S2UA 5CVDA 2YRWA 4TS3A 1Q1NA 4DIMA 1T5SA 4EKDA 3TOZA 5DK6A 2CJWA 4KKXB 6REQA 4C07A 3OLVA 5ANRB 2WYHA 4YI5A 5B6PA 4RULA 1N77A 2AOTA 2QORA 3C45A 4G0ZA 1X3SA 3PVZA 1WMDA 2ZETA 3LNTA 5JHGB 1YJ5A 2QRNA 2ONZA 2PVSA 1IY8A 1M0EA 2RCNA 1DIHA 4BC1A 4TTPA 3ADPA 2O23A 1XZGA 3FR8A 3TI9A 4ZT6A 1QRRA 2YDYA 1U0LA 1QVRA 1JDBC 2OLJA 4BXOA 1H6CA 4RLQA 4W8GA 2EFCB 2FFJA 4QQ8A 5LB2A 2W2OA 4XJVA 1U7HA 4NV1A 1G5HA 3E1SA 1DFHA 4O08A 4XDGA 4G3XA 4QPDA 1AZLA 1BDBA 1DBRA 1BNCA 4UUBA 4KQKA 1CYDA 4R6WA 3IBCA 1VM6A 1IONA 2ZATA 2ZQZA 4MDEA 1SCNE 2IODA 1GRVA 4MPRA 3EZ7A 2O6LA 4N1AA 5BV0A 4Z53A 1DQPA 1NMYA 2JFUA 4QXQA 3Q6NA 2IKQA 1SQ0A 1WHSA 3WOHA 4PYQA 4L8WB 5C34B 1U0RA 5FPTA 3TFOA 2Y4OA 5JIBA 1T8WA 1A9XA 1I2BA 2D3WA 4OQLA 4ED9A 5CLFA 2YBDA 1PV1A 1WSDA 3DKVA 3PDJA 5JCJA 3MOSA 3K9GA 4ITUA 1KPIA 5LR6A 1CQWA 1EWKA 4MQ4A 1AHPA 1E3QA 1GPLA 3IPXA 2G5PA 4ENTA 3W04A 3QE9Y 4PYMA 1G98A 2WHEA 2HA3A 2RGEA 4X1KA 1PDVA 2JB9A 3ZCSA 4G1EB 2UYYA 3KXPA 3W9YA 3B1JA 3L6OO 4HEHA 4IYRA 1OPXA 1CUIA 1V37A 2ZJBA 2DJ5A 3ONFA 4X6LA 5IAEA 3UMJA 3W8EA 1ZI9A 2HN9A 4BKRA 1EA7A 2FEMA 3I9KA 1G18A 1YR2A 2D2XA 3AQ4A 5K8CA 4N65A 3AUSA 4ZDKA 1DBPA 4PG4A 5EEGA 1SNYA 3DZCA 3GFSA 1U2SA 5I9IA 3U5TA 3FBTA 5JZBA 2HA4A 3FCCA 4LGCA 1UADA 5FUBA 3KOMA 1M2HA 2FWAA 3OC6A 4UBMA 5BOVA 3F8WA 4GS5A 4R6XA 2WA1A 1F48A 2BKXA 1JDSA 1M5TA 3SC6A 3T9DA 1D8AA 1RAIA 1K7YA 3ESDA 5LZ5A 3RI3A 1OKKA 1H2HA 1IZ8A 1DC3A 2A94A 2GYWA 4XEUA 3RHFA 3B3FA 1PT9A 4TWAA 3U7EB 3PXBA 3EFOA 1R0KA 1JKIA 2I3AA 5JMOA 3OT5A 1PJAA 3HG7A 3S2IA 4LV6A 1HZZC 3EUAA 1AUXA 1D0VA 4DNQA 4EMTA 4PG5A 3MQ4A 1E3LA 1WA5A 4WESB 5ESRA 1NN0A 1VCIA 3E48A 4WVLA 1FMCA 2C3PA 4RKFA 4B6FA 4UU7A 5E7QA 2WU4A 5E3IA 4DA8A 1Z38A 4KNWA 4F1WA 1EUYA 4MVJP 1FYDA 4PIMA 4A36A 4EHHA 4EFLA 3K9QO 3OT4A 3VJMA 3MJCA 1S0UA 1WMBA 4DVGA 4RTOA 1XI2A 1U1EA 4IBOA 4BQOA 2N75A 4FLFA 1Y9JA 4B3TB 2I3GA 5DBFA 4DDTA 3ZQKA 1FW6A 4ZMSA 2F8MA 1MJNA 1KU6A 4LY3A 2VG8A 4HNSA 3N6VA 4MP6A 3UCFA 4OHPA 4NZMA 2NSDA 4ND1A 1KH2A 2VI5A 3C98A 4A0HA 2V4ZA 3EDRA 4L8LA 1M67A 3DCNA 5JC1A 3QHQA 2OYRA 5J4LA 1DBWA 1W8DA 1XNQB 2ORVA 3I23A 4DEVA 3E82A 3AXTA 2WQ7A 3AVVA 1TXGA 3CH7A 4IFIA 2P62A 1SXJA 1D4OA 1MOPA 2FK8A 3D6TB 1CHNA 3L7DA 4WMLA 4CKZA 2AK3A 4FM9A 5AVKA 2HSDA 4KR0A 2FRXA 1L1EA 2ZIAA 1CUYA 2N0SA 4ZK2A 3IUMA 2J31A 2IW1A 2OGWA 2WM3A 3GEIA 3HKDA 3HP1A 3I09A 1XN1A 2IHVA 4O1HA 4B31A 3AM5A 5FB3A 2DWPA 3VISA 4OBXA 2ZSJA 1DSSG 4ID3A 3I6BA 3UAZA 5D2CA 3ETEA 4MQ6A 2EL7A 2ATIA 2OZLA 1N0HA 4LHYA 1WD7A 1VG1A 3M5WA 4DCOA 3IQDB 2FNAA 4GLOA 2ACEA 2GYUA 4RU1A 3EMKA 4K5QA 1JIJA 2G7MC 1OC4A 4BX0A 4Y3UA 2ASVA 2XJ4A 3I6MA 4Q9NA 3WRYC 4ARVA 3EH2A 3NR2A 3C1AA 5EJ4A 3EW9A 1TO1E 4BX2A 1P1CA 4U2CA 2GM3A 2JF0A 2O8BA 2IYVA 3AX6A 2FW0A 2Q5IA 5M5BA 1JEEA 1E60A 1PL6A 2G72A 5L3SB 4I50F 2HXGA 3SF0A 4IHAA 3DOHA 1D6JA 2PGAA 4DYDA 3H65A 2B1IA 1NBWB 3HDYA 3HUTA 4XVUA 2X86A 1U9JA 1FVXA 2LCFA 5JWHA 5LZ8A 1N78A 4X93A 2FPSA 2IP4A 3BHMA 4MV4A 3HR4A 3GP8A 3TQHA 4BATA 4ZO6A 2UU9B 1LSOA 1HDYA 4DR3B 2D62A 2OA0A 1P0PA 4TZTA 3NDBB 1T3ZA 3E7PA 2J5KA 2BR3A 1WBJB 4CQJA 4CKWA 3DSRA 1PWXA 3PFNA 3Q1KA 1C1HA 1RJEA 1R9NA 4EFMA 3SFTA 1K6IA 1NHWA 1RZRD 2XQIA 1NI4A 4OM7A 3EQ6A 3MUFA 5EVCA 3KG2A 4GOLD 3TLYA 1LSJA 3KOWA 5IXSA 2ZR7A 4ZCLA 3TTUA 2QMQA 4GM0A 1J0CA 4O8ZA 3VUEA 3N87A 3SOPA 2OUKA 1MUUA 1CU1A 1U0SY 2BFFB 1IJKA 2AG6A 4K0KB 4KN8A 3A4VA 4OHFA 4XUCA 2AFHE 4B4OA 4DLAA 1SG6A 5J2TA 4HRAA 3BXEA 3D4IA 1Y89A 1GL7A 1N1DA 1YDFA 4MI9A 3ZE0B 3K0AB 1FDIA 3PJFA 5LMUB 4TMWA 3SLGA 3ODPA 1DL5A 1TCCA 1Z0UA 2B25A 1GRCA 2GWHA 3K0BA 4W6QA 4XB1A 5DDIP 1JVSA 1NJGA 3W9UA 4AJPA 4KIWA 4RCVA 1J49A 2AE2A 2YV1A 3E9MA 4J76A 4KVFA 2PU5A 4Y9RA 1LF5A 2QI9C 2QP4A 1B00A 1F60A 1JG1A 1QH8A 3N76A 3GX1A 1UBGA 4YTEA 1FL9A 5NLLA 2OWDA 3LQQA 1C9JA 2XAUA 2ZJOA 2ZRNA 1GN9A 2EQBA 4OJKA 1T4GA 5TGTA 1JG7A 4EUKA 4LF6B 2H57A 1XBTA 2J3LA 3QKUA 4BHTA 1M54A 1KI8A 4FTWA 2WMNB 4IDEA 5JECA 1ND6A 2Z2KA 3KJFA 4DG5A 2XA9A 1J8VA 5MN5A 3R6DA 3UPTA 1R1DA 4UXHA 3ZDDA 4B4WA 2M6LA 5G41A 2GQ0A 3EAQA 4WECA 4L75A 4CM1A 4CVNA 3R40A 4M0KA 3SG0A 2C9ZA 1RKQA 2JK1A 5I4IA 1SQFA 3O3NB 4WZAB 4YK7A 2BKVA 1SUEA 4FHGA 4KQ1A 4I5EA 1XTIA 2QX7A 4QREA 5DWDA 1NZJA 5CXSA 3IEPA 1PWZA 1JQDA 4LI0A 1NTOA 1YASA 1BE1A 3PJEA 4W9NC 4HUQA 2CL0X 2X1HA 1N2CB 1F2UA 1ULTA 2EW8A 2UYGA 2Z3VA 4G5SA 4HWTA 4RA9B 4ER0A 3O5AA 1OWOA 4YONB 4LHSA 3TYXA 5ENDA 3PRJA 4W7HA 1LRJA 2PXHA 2BELA 3LRXA 4BTVA 2YN4A 1FRQA 5G2OA 5HYVA 2COKA 2FF7A 5DT2A 4B3IA 2XMQA 1GQRA 3OO1A 4C4YA 2R1TB 3SF8B 4JB8A 3TGPA 1CDOA 4Q1AA 2XCOA 2XKKA 3UGJA 1P45A 2NUPB 3IVCA 5AKYA 3KB6A 4FOSA 2IWHA 4R31A 2GKSA 2I1WA 2DBQA 3WA7A 1WLSA 4H4CA 2AQIA 1B8VA 3STWA 4D9MA 4F3TA 2CYAA 1GU1A 4A2CA 2WM9B 1PJTA 3OQJA 5GIPE 1B3RA 1PZFA 1PCXA 4FNAA 5KNBA 5EUCA 2AF4C 3ANXA 5JAHA 4RHYA 3F46A 2BDUA 1SVKA 4UMFA 5FJJA 3GY0A 3SR4A 5ER6A 3QI7A 1TIPA 2AHOA 1LW6E 3GUCA 5U1PA 3L79A 4OO3A 521PA 4MEJA 3ZJ5A 1QOPB 2W7TA 5BY2A 5KU1A 2BN4A 1JHXA 1GAEO 1JFLA 3EHDA 2FEAA 3U3XA 2QR5A 2A9OA 3HLKA 4YCJA 2RGNA 3RSGA 4IDFA 1S02A 5KYWB 3WL6A 3EVNA 1X94A 6GPBA 1CVRA 1HTTA 2CMGA 5CLQA 3B1YA 1Q0ZA 1WB9A 2E89A 1UL1X 5C4MA 4CW7A 5I5EA 1BS9A 1SUIA 3JQ8B 3DGEC 3I83A 3P9CA 5JAMA 5BUZA 1MRSA 1PBTA 2Z2JA 4R1OA 1H5QA 1UBRS 3RLFA 2BCJQ 4RK0A 4PYKA 5ALKA 1JR3E 4MPPA 3ITDA 3ONEA 1AURA 2PKQP 3DMFA 4GWLA 1GV0A 1ACLA 2BEVA 3CWQA 2RKBA 4UEQA 3RREA 5CLJA 3EG9A 2LE0A 2PX3A 5BNWA 2HA2A 4Q7MB 3MWGA 1HQYE 1CZRA 4JUFA 5ELLA 2G1PA 1W6RA 1P0CA 2TYSB 2IEAA 4TN1A 1T9AA 1N6HA 1TRKA 2ZBPA 3HJUA 5LN1A 2UYQA 4BNVA 3DL7A 1ZVKA 4BFLA 3OKPA 2EQ5A 3TW6A 4EYOA 1XPRA 5D3QA 1DAIA 3MHTA 1X74A 1QHSA 4GQIA 4OK6A 1NL3A 1L4EA 2VNSA 4RKQA 1A69A 1BG6A 1E2NA 4MYTA 4QUIA 1BVRA 4DQVA 2WFAA 3ANMA 4LBVA 5H9WA 3IVMA 5DBOA 2WSLA 4E03A 3R3ZA 3B1ZA 1IK6A 2OO3A 3CXUA 3TJMA 2V6JA 2D5IA 3E7WA 3WKDA 4MZXA 3U4AA 2FWJA 2OT3B 2XDWA 1CUSA 4KH1A 2OBFA 3N2KB 4QNMA 1OH6A 2O8EB 1KBOA 3ZGVA 3P9PA 4Z4EA 1CHDA 1WG8A 3I32A 5ALZA 1OFTA 3UH1A 8OHMA 3R0JA 1OXBB 3OQPA 4JEHA 4RSMA 3BN3A 2C2XA 3C6KA 2G76A 2PFSA 1MR3F 2PZMA 2Y68A 2Q45A 1T5BA 3K9WA 1FSPA 1CQXA 3HVIA 3OT1A 1MHPA 4RXUA 5KNDD 2P6NA 2XBLA 5B7GA 4HEA1 4G5XA 2YFYA 3KPJA 1V9CA 3NHKA 4MOWA 1T3TA 2DUUA 2HT6A 1RTTA 3H0CA 4XCVA 4DHWA 4MVJG 2G82A 3EYWA 5H8WA 1CDEA 2I4TA 4E5SA 4LJKA 1Q3KA 3IESA 4REQA 3ICEA 3PTZA 3NEJA 5JE8A 3H2YA 3A37A 2V4MA 2VF4X 2X0KA 3PPXA 1ZIOA 5CPFA 3UMBA 2B5VA 1LJ8A 3AP3A 5FYDA 1D1PA 4M55A 3ESRA 2WWFA 3RRZA 3TBFA 1FU7A 1U3VA 2V03A 5JG7A 1XZQA 1PZNA 3ONNA 3FPFA 1OOEA 1QJCA 4HDNA 4C7XA 2B4KA 3AERB 1TK9A 2LBPA 3BDVA 4YMLA 5D6OA 3SS9X 2I0FA 2Q62A 2NO0A 1YR3A 4KL8S 2WOOA 1F14A 4N5IX 3UGTA 2Q9UA 1YOVB 4A5OA 4Z7QB 1AO0A 2A58A 2QZJA 1CLEA 1SKBA 1UKAA 1UZUA 4IIBA 3WYNA 4X85A 7ADHA 4D9CA 1F0KA 1NUTA 3EIHA 3BD7A 1J23A 3EWSA 2ZWMA 5I7VA 4L3WA 2E87A 3L8DA 1TTHA 1L0BA 3HU3A 2WA2A 3IIJA 4TUYB 1ZEMA 4G65A 4OA8A 4PZ0A 3M49A 2C3UA 5F21A 1A98A 2BV3A 4J7CA 4JWKA 3WP1B 4MR9B 2Q4BA 3NOOA 4GWGA 4BO2A 2JFPA 4BFVA 4UVGA 4W99A 1Y9DA 1NU6A 3AEKB 3JYNA 2V7QA 1AKUA 1CJCA 1HBJA 1X7GA 4K1XA 1M1NA 2B5WA 4U39A 5A9RA 1Q17A 3QLEA 4LOIA 4YJFA 5DJ5A 3ZGNA 5B4UA 2V5UA 4ARIA 4DLUA 4LBYA 4RHEA 2X0FA 1C2YA 3AESA 3BIJA 3MCZA 5EE5B 4CM9D 4ENVA 3SJUA 4DREA 3MG9A 4EFDA 2QDKA 3EA4A 1E2QA 3ICWA 4C3VA 2N47A 3AR9A 3HWX1 3PQFA 1HEUA 3FGPA 1ORDA 1PD1A 4LXHA 4UXJA 1KWGA 1EFDN 4C21A 1SELA 1O8CA 3DQZA 1GGVA 1MRNA 1T2AA 1WULS 1PTKA 3F6EX 1L7BA 1DCFA 3HNOA 3PKIA 3PD7A 4KN6A 3RG2A 4MIEA 4C0AC 2QZ9A 4WNAB 3OD5A 3TMKA 1QRSA 4BVAA 1WCV1 2BMDA 1UP4A 3A7DA 2FPGA 3O21A 1V8PA 2JI8A 1GG2A 4HDMB 4LWQA 5IKXA 5CM9C 2J7PD 2WFLB 4OKSA 3EOAI 2ONKA 1U1CA 2PUWA 1ICIA 4J0IA 4KK4A 4P3YA 1OX4A 2K2QB 4ALKA 2WTBA 3GJXC 3UZUA 3QNUA 3OICA 3X43A 1ECBA 3D4NA 4JYZA 3M4YA 1YB4A 2I54A 3OEWA 4XX0A 5TMEA 4BZXA 1N6PA 4GHWA 2H1OA 2BF4A 4B3FX 1E0AA 1CUDA 1ZH8A 4HWGA 4PXSA 2FHPA 5CDGA 1PJRA 3ORSA 4ITVA 1ZRMA 1GCGA 2J4DA 3QMPA 4HF7A 4M0DA 2E49A 4OGGA 4WCVA 4ZVTA 3CNNA 1JJVA 1ITZA 4QT0A 3T15A 1X7ZB 1RM3A 2Y1CA 1WVMA 2C83A 2HBYA 3EZYA 1IWBB 3DMYA 3JAWA 3ZV7A 4EUSA 1J8FA 1Z73A 5DNAA 4ZYZA 1GPMA 5K6RA 2CEKA 4ZQGA 3GRAA 4KI0A 4CFSA 2Y1EA 5FUQA 4A91A 2QTBA 1FDOA 1PKXA 3CYFA 3T3IA 2P75A 2VRWA 3ELUA 4RPGA 4X20B 4BECA 4F8EA 4IDPA 1WXEA 3SICE 5KYXB 5GMOA 4QGBA 2X0JA 3EDYA 1YC5A 3GK3A 1E1MA 3L8ZA 1Y42X 3L0IB 2PQ2A 4MS1B 1PF7E 4UAUA 4WKPA 3V3KA 3ZQ6A 4IFBA 4Q4AA 1KFCB 3MMPA 4ARUA 4R51A 4DLSA 2ZWOA 4WFJA 1Q2XA 3IO3A 4Q7JB 3QTLA 3X44A 3WKEA 1BFDA 3VR4H 4RPJA 1G38A 5HIJA 4GLBA 4J4TA 1QP8A 5SZKB 1WXWA 2GZ1A 2H4HA 2R1VB 4OI1A 3QEAZ 2RONA 3OPNA 1FW8A 3GP3A 4IZ6A 4QLAA 4XZ3A 4MQFA 4AJOA 2QUJA 1DUVG 3GVCA 3TNDA 5KAPA 4RXMA 1QFSA 3U7QB 2IPNA 4EDFA 2EWVA 4I7EA 2VP0A 4WIAA 1JDUA 3TTSA 1IJFA 2O4CA 2ZSKA 3EIXA 4NNPA 3D4PA 2NU6B 2J3IA 1BQEA 3BB3A 3T9CA 2V0GA 1L3IA 5FWDA 1DRVA 4RVCA 2OCKA 5ETJA 4Z1MA 3UW1A 1KSFX 5H4HA 1NUHA 4W8OA 4MQBA 1KJQA 3W2GA 2E6KA 5JNWA 2RAVA 4G8CA 2PL3A 5IJXA 4EGQA 2VK4A 1VMAA 4U9IS 1YVPA 5ULLA 3WGUA 1RZVA 2V6GA 3ZXUB 1T91A 1I6MA 3SC3A 3WB9A 3FCEA 4RCYA 4GRIA 1FNMA 1W2HA 2HO4A 2QN8A 2VHZA 3DFZA 2FX3A 4WNYA 3ENNA 1FFBA 3V9AA 2FDXA 5IDXA 1YR6A 4Q3DA 3JQAD 1LC3A 4PCAA 1IIRA 2P67A 3TNLA 1TJPB 2ZT5A 3N8GA 3OY7A 4YFYA 4BOYA 5FH9A 1NC3A 2X9GA 3I4FA 4GPIB 3NI2A 5DO9A 2XOKA 2J5XA 4QTTB 4LRQA 3OP1A 4FPXA 4MCHA 4UEOA 2Z2IA 4B0PA 3DZBA 2BOVA 3A6DA 2HOQA 1AOXA 5KJFA 2A84A 3EH1A 1Q15A 2E21A 2V55B 4R7ZA 5HFAA 2J4FA 4C4OA 1SOAA 3H0KA 4QRDA 3MA0A 3THWA 1TM2A 3U1TA 3O90A 4GC9A 1Q1GA 3BDAA 1A82A 1FFHA 3EQ7A 3KO8A 3PDIA 4JNCA 4WWHA 3WBKA 2QZSA 3QY0A 1OXXK 5JJLA 1E2FA 5C8YF 2ZP1A 3CO5A 3SYKA 5KSZA 2XLBA 4C6TA 3QIAA 1J5XA 1OLUA 4HO1X 4LY9A 2Y1XA 2BM8A 4LMPA 4KYTA 4UTZA 4HLCA 3R7WB 4AM8A 3KETA 1XC7A 1CUBA 3RUEA 2Y8EA 5FCDA 1THTA 4MI3A 1O54A 4M0CA 1J0BA 1E59A 3QUTA 3UV6A 1GDTA 1R12A 3I05A 4R2WA 1NASA 4G5FA 4BE4A 4ENPA 3BEOA 1YULA 4OMDA 3F90A 1TKAA 5EHIA 2DTXA 2YWEA 5ENZA 2PA3A 3VH1A 2G7ZA 2D59A 4G8JA 4PZUA 5DXAA 4M0EA 5JBIA 1M0TA 1ODJA 1RJDA 2PZLA 1P62B 1Z06A 1LDMA 2OY0A 3UJ6A 1CX9B 3EE6A 4FYXA 3ROKA 2ODQA 3WYEA 3C5EA 1L8QA 4BCDA 2WHQA 1L4YA 1HLGA 1XRPA 1X8KA 2ZVQX 3VOAA 5EIBC 1ZCAA 5F5XA 3DT8A 2FEPA 2YJNA 4DIDA 4FB4A 4D0SA 1WXQA 1T0IA 2XUGA 3IIEA 3RGGA 3WHIA 2CD7A 3E70C 2W58A 2YJTD 3SXJA 5CDFE 2RD2A 2IBSA 1F9AA 2HQ1A 2VPYA 1Y8QA 2J9XB 1ZISA 2ACVA 2X2OA 4V3CA 1Y7IA 1DHTA 2C0CA 3AFOA 1AU9A 3LKDA 4L0QA 5F98A 2QSUA 3RK0A 4DCPA 2NSHA 3ONWA 3SGLA 4C89A 4B8ZA 4PSUA 1JB9A 1NMZA 3NETA 5AO9A 4M54A 1BXGA 3RTEA 4A15A 3U49A 2X41A 3VX3A 1IOVA 3ZG6A 1S4QA 4KV7A 2PT6A 2IHBA 1QYXA 5A4IS 2A9KA 1M2VA 3WAGA 3ROFA 4UOEA 4JIMA 4NCHA 3OCCA 4KUHA 3BMCA 4WJZA 1Y6GA 1MHTA 3PQEA 2OHIA 1HI9A 2R44A 5EJAA 3CX8A 3VH2A 4EW6A 2ZJ8A 3RSZA 1V43A 4NESA 3THYA 3H13A 3EPRA 3FWPA 2WT9A 5DGIA 4QAJA 1I2MA 1KFJB 4Q5IA 1UC8A 4BO0A 2CL5A 3OE4A 4UREA 3VPHA 2P77A 5B3JA 3ZIUA 1NONA 2WICA 2C2GA 4L4SA 3OTGA 5EJGA 4ENUA 5LOVA 3HLYA 2XVXA 3RYFA 5ABPA 3AETA 1PL8A 1Y8CA 3HB5X 4JUIA 4BO7A 4EHNA 2DERA 1DDIA 2OBYA 4FONA 4IJKA 4N39A 4ZVLA 5AYVA 3VHQA 4CBVA 4EJ2A 1KP2A 1OTYA 1ZW1A 4IOKA 4WFIA 2E2WA 3ZYCA 1UOQA 3P4XA 3AVOA 2BC9A 4ROTA 3OQIA 4KIGA 3NMUF 1Q7CA 4EYKA 1L5KA 4B9EA 5TPWA 3ZGZA 1QR6A 3A2MA 4YCNA 3BTVA 1BXRB 3AG5A 4L85A 4TXMA 3JCZA 1HDOA 2VBIA 5TVGA 4UU8A 3S4YA 4KHPB 3UUFA 2J59A 4JR0A 5CBPA 4W9MC 1CUAA 3NBYC 5D3MA 2XUDA 3I6QA 4M8KA 1RJ9A 5H3CA 1XELA 3DE7X 3HVHA 5LDGA 2P9YA 4DN6A 3B5EA 1AZWA 3F67A 3NO4A 1MX1A 1HDEA 3PUWA 1J2JA 2XX3A 1JV2B 3LC2O 3P0JA 7ABPA 1QGZA 4FSXA 2I76A 3BE4A 2O05A 2RGCA 2O2CA 3DLTA 1OKKD 1DRWA 1XSEA 3MINB 4LKOA 5GM1A 3UAWA 1USVA 4YLEA 4QXMA 5AQEA 1ABEA 4MGKR 2FN4A 3HPQA 1D4AA 2V7VA 1RNLA 4D57A 1E64A 4DLNA 2BI8A 3DXYA 4A8PA 1MAVA 4EEXA 2F1KA 5E0OA 4V39A 3N39C 5G4KB 5KSYA 2GCNA 1ZS9A 3L49A 2QRPA 3KZNA 1YHYA 621PA 4GKJB 2VF5X 3I76A 1R8QA 3L6CA 2I3BA 1HV8A 3DYIA 4E3ZA 2Y99A 1U7TA 5G3YA 2XOXA 4B40A 4CV0A 1TUBA 4ALLA 3FF4A 1R0RE 5EYPB 1JI3A 1XZLA 3R4VA 4YWHA 2ODNA 1RLMA 3CT4A 4OSOA 2XPCA 3E81A 1AGYA 4ND6A 4D6PA 2ZUCA 1NJSA 2QX9A 1YBHA 1CUCA 1A9OA 2P41A 4BAZA 2H08A 2H16A 5AKXA 2QV0A 2A1UA 1D1QA 1G9TA 4RO0A 3R5XA 1RC8A 3GR6A 2I2FA 5K0JA 4UARA 4YAGA 5HKBA 4R40A 1SIUA 2VK8A 1QH1B 2DMRA 3HCPA 3QXJA 3D0KA 2VHUA 3A1DA 1FIUA 3DNFA 2VHTA 1L5WA 2O1XA 1QRUA 1YQXA 3V4OA 1H85A 2QB5A 1MEJA 1H2XA 3WXMA 2NVOA 4BQIA 1U63A 5DHTA 2DWOA 4EDHA 1ZMTA 1M2KA 1QUFA 3PDCA 5KNCA 2REXB 4J1TC 1DEHA 1E69A 4P4GA 3S5JA 2OCGA 2J3MA 3KSRA 3NUGA 4BMCA 1HE4A 1IAQA 2RHBA 2WFMA 1LDGA 2R87A 3H9GA 3PQDA 5KJEA 2ZRKA 1YB7A 1V5FA 1I7LA 1ZMBA 3E9CA 3IQXA 1G2IA 3K5IA 4ZD6A 4F85A 2CDRA 4ZDJA 2W0MA 3DDOA 5A0FA 3HB4X 3M4ZA 4P0QB 1T1RA 2QRGA 1K08A 1SCQA 5JFOA 3UXYA 4HZGA 1ZK3A 2XDYA 4IG4A 5TARA 3ZNQA 1QC5B 4UVDA 5JZSA 1WXFA 2ZI4A 2COEA 1H8HD 4FK8A 5CA0F 1G7TA 3U81A 2Z43A 1QU3A 3AI7A 3R3YA 2R65A 4D4KA 2JIZD 4FJ0A 5EGSA 5D86A 2AEEA 3K4HA 3TQQA 1TC2A 3ZIAA 1M9NA 1K3FA 3CE9A 5AKIA 3GLHE 4C0QC 1J7JA 3DHNA 1Z2CA 5HIMA 4H31A 4B7CA 5E9JA 1MB4A 2WYIA 4KGDA 1IUKA 2NTJA 2BMEA 1DJPA 1ZGBA 1AN0A 4O3MA 4CM8B 1UEIA 2YW2A 5GJBA 3D31A 4FYPA 4BUJA 1U6IA 1NBEA 3D0RA 4EO7A 2ZBFA 3HMKA 2AZDA 4NFSA 5E9AA 3RHSA 3UJPA 1ZPDA 3IAS1 1RXCA 2Q7XA 2WJ6A 4QTZA 3FUCA 3JASA 2XNCA 1XU7A 1QX3A 4D9NA 4EELA 2QTZA 4E31A 4WK4B 2XD9A 2IOFA 3O1HB 4TMZA 2QU7A 2C95A 1MGOA 3TOXA 1UJ6A 4EFKA 3LQYA 1PIWA 3M89A 4H3KB 4TN5A 5J5AA 2XRFA 4Y1RB 4AX8A 3IAHA 4BNYA 1QRTA 2FP3A 5K3AA 2IPOA 3IULA 1MDFA 3WFJA 2WYUA 4RADA 4ENRA 1BE8A 2B99A 2BKAA 2HMYB 1T8SA 4II3A 4QHSA 3WLLA 1SVLA 2QD3A 4OQFA 2JFQA 1JG6A 1HFJA 1GY8A 3T5BA 4F8YA 2B7BA 5JUWA 1I32A 4PNZA 3S1AB 4BV9A 4IOLA 4MV8A 4KPUA 4HAZA 1NX9A 5HRAA 1TD9A 2FGJA 3DC7A 3AKCA 3WADA 1YL5A 1KQ3A 2PRYA 2F9LA 2QPTA 2ZUBA 4P53A 4V24A 5EPEA 1JTFA 1ZN8A 5DNWA 3GPBA 1II8B 1QM5A 4OKIA 3USZA 4D46A 1YFLA 4L16A 4MVJI 1N34B 1TJNA 1GL3A 1RM4A 3IV6A 5LWHA 3SBDA 4ZYWA 4D82A 3E3MA 4C78A 2B9VA 3DEKA 3RU7A 3VNRA 5A0VA 1EK0A 2EDAA 3EGXA 4LF4B 4JL6A 4Q9KA 4EX6A 3PYLA 4IV5A 4EJ0A 5B3KA 3USES 5DHFA 5SY4A 4X3OA 2QGFA 3LVRE 4MVJM 5IVKA 2BHRA 3ZCUA 1KH1A 2HV9A 2K7ZA 1W9MA 1BWQA 1HKUA 1PJBA 4WXMA 1J1ZA 2R8XA 3FX2A 4HH3C 3V5NA 2CFSA 2TS1A 3ZGOA 4CM9A 3IUSA 4EGCB 3TLZA 1W4LA 4DJFC 4EOGA 3HDTA 5JOQA 1DC5A 4EB3A 1VIMA 2E3JA 4MX8A 5FPKA 2QX4A 1ZJWA 2NT3A 4BNWA 1N8KA 1GPWB 3E9YA 4HBGA 1VBMA 4RD1A 2POQX 4BMVA 5ALUA 3LUBA 3H2BA 1LDEA 2AKYA 3GGCA 4QOEA 3WG9A 1I51A 4LC1A 4FU0A 4P3KA 1IB0A 2XEXA 4B3GA 5DM2A 4UE6A 3DE2X 1J0AA 3QVTA 3V1TC 4QM7A 1J6UA 1PI3A 4YCCA 5AFSA 4I9HA 1R8SA 1O95C 3UAXA 4ZV9A 5LNK6 4TL6A 2P9FA 2DUNA 2ANBA 3T5PA 3QBJA 3KJIA 5AOVA 2R7NA 2JAUA 3B82A 2GN0A 3KK0A 3R1IA 2RIPA 1IN5A 1BHJA 4LXGA 4NSNA 5HCIA 2BGIA 1YDHA 2EFHB 1W34A 1I1NA 3FHTA 4IO0A 1QGUA 2RHJA 2DRIA 3LY9A 1G8AA 1XDBA 1ORVA 5J1SB 1JNXX 2SICE 3R3XA 4A0GA 4L2IB 3A9VA 3ACCA 4TZKA 2IXDA 3GN2A 1RYZA 1W46A 3A3YA 1P5HA 3L8MA 4O3FA 4JOCA 5T6MA 3H2KA 4CMBA 3J7AC 3ER9A 2I3ZA 2BY4A 2YWGA 4WKNA 1RU3A 5AESA 2VO1A 3KSAC 2I4IA 2KBEA 4RFSA 4OB8A 2OEPA 4PLYA 4LOAA 4BO3A 1MKYA 4FZ3A 5K0FA 5H5JA 4AF6A 2FQXA 5HM6A 5LZ7A 1GM5A 3FNHA 1ZNYA 2HLDD 3BERA 1KMMA 2P2CA 4NJEB 1G6HA 1VGVA 3AFMA 4K28A 1XMVA 3KR1A 3GPIA 3KT0A 2GZRA 1UM9A 1YZLA 3DXFA 4RF5A 1ZWLA 3Q8KA 4AQ7A 2DUJA 4ASUD 3GNQA 1V3VA 4YRTA 1KI6A 3U3JA 2JFOA 3MCAA 3WBFA 1DG1G 4GT1A 3AY7A 3QIVA 4YPOA 3W4IA 4QC2A 5DSXA 3O3CA 4OUDA 2OGSA 1Q0HA 4BVLA 1EM8A 3C3DA 2YQ4A 4P80A 3OZGA 2A6PA 1EA5A 3TAHA 5A6VA 2Y1LA 4E3WA 4F9EA 4AMVA 2ZS8A 3CZ9A 3UJ9A 4DJEC 3FOWA 2XDQB 2D7CA 3IJPA 4RFVA 3TZHA 4YV2A 1CNEA 4LZLA 1VPTA 2D74A 2GZAA 4GP7A 5HF6A 2V7EA 4DRXA 3INTA 2CFOA 1IG3A 2Q9CA 1IN4A 1U0FA 3CLUC 2JH9A 4A10A 1HDXA 4HGOA 4PAOA 4CMGA 4F6CA 3AVYA 4TLMB 4MO2A 4ZCQA 3JVEA 4XOIA 1MAWA 2E4UA 4AKEA 1IQUA 1XG5A 2RBKA 3IMEA 3LBYA 1NYLA 1E18A 3HSYA 2PRKA 4QM6A 1K86A 2FUEA 4M7PA 1ORRA 5AKEA 3UAVA 1Z3IX 3UUWA 4HFNA 5I7UA 5JXJA 4MGHA 3M6WA 1T6XA 3NEPX 2OQIA 2O48X 3BIOA 3VO2A 1AM4D 5DTEA 4DZZA 1T34A 4FT4A 4TTQA 5I9MA 5H80A 2Y6VA 1XRRA 3GW8A 1F4LA 5ISMA 4Q6WA 5EMLA 4EF6A 1F1JA 3A9SA 2FE4A 2ID7A 2A59A 3H9JA 1SUBA 2OHHA 1J1IA 1IVNA 2R6R1 3HSKA 4PG6A 4FGZA 1PEDA 3GT7A 3WRVA 4D41A 3PUZA 4IEEA 3F71A 1DJQA 1G20B 3ND5A 4YRFA 3HR8A 3V1UA 1I0IA 1OFIA 3IKMB 3NVAA 4QARA 4WOCA 2P4HX 4JYCA 1CSEE 1QU2A 3F5SA 4ZQHA 3H3FA 3HUDA 5H1YA 3UT0A 4BQRA 3LUFA 1P33A 1VCOA 2P4EA 3P19A 4TV9A 1BFUA 3NAMA 3OQHA 2DWUA 3PC8A 3UJCA 3EXEA 3RVMA 3H5IA 4KI7A 1G55A 1K63A 1U3GA 2UAGA 1Z08A 3MWYW 3IDAA 4R1NA 4B44A 4C0SA 5KYYB 1JVNA 1SXHA