4QXRA

Crystal structure of hsting(s162a/g230i/q266i) in complex with dmxaa
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
182
structure length
182
Chain Sequence
SVAHGLAWAYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTIDRAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLITLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding-Pocket and Lid-Region Substitutions Render Human STING Sensitive to the Species-Specific Drug DMXAA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Stimulator of interferon genes protein
total genus 51
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qxrA02
4LOLA 4EF5A 4YP1A 4F5EA 4LOHA 4F9EA 4F5DA 4EMUA 5CFLA 4KC0A 4QXQA 4LOJA 5CFRA 4QXOA 4F5YA 5CFNA 4KBYA 4KSYA 4LOKA 4LOIA 4QXRA 4JC5A 4F5WA 5CFMA 4EMTA 5BQXA 5CFPA 5CFOA 5CFQA 4EF4A 4QXPA 4F9GA
chains in the Genus database with same CATH superfamily
1ZK0A 5J43A 5HVNA 1XR3A 1O6FA 4FGUA 1GILA 5FPPA 1XOIA 2OBYA 4TL7A 1M2OB 4X8OA 2QWXA 1RJEA 1TMOA 3EW9A 3U17A 3UY4A 1A8SA 3VISA 4EEZA 4DUZB 2HZBA 1Y6GA 1PW5A 4KQXA 3AR4A 1BS2A 3VU9A 3SIPA 1YU9A 3YASA 3I3OA 3LCMA 4L4ZA 4I4CA 4ND6A 2AJBA 4WXPA 5CLIA 5J47A 3EIXA 5HFNA 4I2NA 4ZVMA 1TO6A 1EHIA 3OHMA 1MAVA 3ANTA 6LDHA 3E15A 3BFKA 4J0IA 2X8JB 1CYDA 4ZZ2A 3CH5A 3K9NA 4XPIA 3RTEA 1I2ZA 5GAJA 1ITZA 3IJEB 4PLWA 3QWAA 1RLIA 1VIMA 1GLGA 5GADl 3L6CA 4FVTA 2ZE8A 3H2IA 1F2UB 3ICWA 3LUHA 3MLBA 4KVAA 3GJYA 3SZ3A 3GMDA 4JLKA 1JIUA 3C87A 3LBYA 5G0WA 4BPRA 4C7KA 2QBYB 4L6AA 3B1YA 1LUAA 3HGTA 3ETNA 3ZJVA 2RK4A 3UMJA 2Y66A 2PKWA 3DNMA 1KU0A 3BE4A 4IUBS 4OQPA 2F17A 2EP8A 2F2TA 4G5HA 5B3KA 1D2HA 1LLDA 2Q2WA 2O8BB 3K0EA 3E7WA 4A8TA 4DM7A 3A25A 4PLCA 2NUPA 3N2IA 4ZODA 4PSUA 4CMIB 3DE0X 5EIAA 1KQGA 4NZOA 3UAWA 1TT5B 4V38A 4EUFA 2PRIA 3CVYA 4NCJA 4RHFA 4DCOA 3NIGB 3DR3A 3KYJB 4RPCA 3JALA 5C1PA 4CT4B 3D7NA 3GNTA 4C6HA 5ALZA 3I52A 1A9YA 1LPBB 3FNRA 4HDRA 1G59A 3ILVA 2J3MA 3IPAA 3KKEA 5I8ZA 3CVXA 3UJHA 4BO9A 4BO4A 5KTMA 3AZPA 1BD3A 4MV4A 3A04A 1BHO1 3ZWXA 3K2BA 5C1DA 3AIMA 5HRUA 4MI1A 2FUEA 1GPWB 2KMLA 4IIHA 1LSUA 1M72A 2DZDA 2H85A 2ZTUA 4PTYA 4X3CA 5C8VA 4FX2A 3GP5A 1CP3A 3AUAA 2NSYA 2YNMD 4IDOA 3HKCA 1ORWA 4C03A 1MA0A 4MR9A 1J9EA 3DBHA 2ZLBA 2HADA 3D3JA 1M8GA 4OA8A 3VVCA 1T25A 2MU1A 4GW3A 3WLEA 4OXKA 3A0RB 4V03A 3WGUA 1ZR4A 3OPXA 1XX6A 3D9QX 4YASA 4MHSA 3T1HB 3WZ2A 4EHLA 1P0FA 3BM5A 3S2FA 2G9ZA 2ZS9A 3DP9A 3FPCA 2PUFA 4XQCA 5K8TA 2RBKA 2Q4OA 3CPEA 4I9UA 5IJZA 2DH5A 4ARZA 1CR1A 3CUWA 1KHTA 4LSZA 3TQIA 4UNRA 3FHTA 1O9GA 1BDMA 1Z6PA 4FYXA 5DMXA 3RBZA 3OX1A 4URZR 1W94A 4D56A 3PPIA 1RM0A 1V45E 2BEWB 3KAPA 4B3TB 5AI9A 2OQ2A 4GQAA 2F55A 3AEQB 4W5QA 1F6WA 3DVLA 2OORC 4DIMA 4L4UA 3ND8A 2D2EA 4L07A 4JY7A 3SBOA 1ZP6A 4QECA 4FOPA 2ZRMA 4L7VA 2WTAA 2IZ1A 3UOWA 4MITA 4PN3A 3NM6B 1RCUA 2X0RA 1P91A 3U44B 2ZTHA 2A5YB 1DTWA 3QLEA 5KYGA 2GR9A 1RZRD 2X1HA 4V0KA 2PSHA 4NTZA 2OAQ1 5TR9A 1QFJA 1O57A 1KFJB 3OCVA 1L4HA 3ZK8A 1Q3TA 4JJ7A 4JEUA 1SBIA 2PMEA 4O1IA 5H80A 4YJ3A 5CB4B 4N76A 1F2TB 4JYAB 1N7JA 1WCWA 5BPHA 4GDFA 1K2WA 3RUPA 1NBME 4UHJA 3LS2A 1LPMA 4GLBA 4RD2A 1P6XA 2N47A 5KVSA 5LZ9A 4RDIA 2GBGA 3G79A 1UKBA 4R9VA 5H9WA 3GVIA 2TRSB 1RWVA 4IIDA 4KYVA 3UAGA 1G9TA 3PEYA 1R6DA 1FDWA 4R3NA 2Y4NA 5M5BA 1RYFA 4DBVO 4DR5B 4I1IA 4FFSA 3CUUA 1LJ8A 5GIOE 5AM2A 1I30A 2H1WA 4AWXA 3PLAE 4DV0B 3SR3A 4DIFA 1K6EA 1KVRA 4DDHA 3V6MA 5C81A 3DH0A 5LOVA 4AKIA 1BDIA 5HPYB 4YRLA 1EK2A 3DLTA 1SPBS 4CV1A 1TUBA 1HG0A 2C83A 3EY4A 1OOEA 2JLSA 1ZX1A 3I6YA 1IZ8A 3ECSA 1DC3A 4R1OA 1G8KA 5DNVA 4KIWA 4C0QC 4AICA 4IXNA 5LZ7A 1V5GA 4M1TA 1VSVA 1X6VA 3Q0TA 5C5CA 4ZU3A 1PZGA 1G8YA 3T7KA 3VR4H 3QFTA 5IJXA 3T9CA 2FAXA 4K9NA 3DZDA 2W6JD 1PFVA 2RGYA 1A9PA 2RG7A 2X13A 5D5PA 3O92A 2R87A 4NFHA 2AQIA 5DM4A 4FMBB 3FYUB 2ZR0A 1T2EA 3S70A 4GI5A 1K5PA 4NE7A 2QZJA 2GPAA 3KU4A 5K09A 3P9ZA 1GT91 4HLCA 4NNPA 2PH1A 5FDFA 1Z6QA 4H3KB 3AJ8A 4RXTA 4BO7A 4M0CA 4D8XA 1MX5A 2PZLA 1ADYA 3HDGA 1PQYA 2WHYA 3K0FB 3NEAA 4DCVA 1T15A 4ZCTA 1N7IA 2EFJA 4FSXA 4WFJA 4CDNA 1WUHS 3BSWA 4IHAA 3ZUGA 1XAIA 2VT6A 5DLYA 2WVAA 4IFIA 4DILA 4R05A 3ZI0A 3K31A 4PG4A 2OORA 1XTVA 3BYZA 1RI5A 3K8OE 3PJDA 5T64A 4P33A 4XVUA 2RGNA 4G0XA 1J8MF 2FRXA 5FTNA 2FXIA 5C5EA 1OHHD 3TDKA 4QT4A 1SULA 2EF1A 2HPAA 2GN8A 4MK4A 4BGUA 4DNXA 1ISGA 3BDVA 2I22A 4LNUA 4PX9A 1NPDA 1P4JA 1FX0A 4L28A 5TPZD 2AQHA 2HLDA 3JAMA 3ACBA 4OQXA 5COAA 2IU0A 3TXYA 2VJAA 3E1SA 2EQBA 3UB2A 1EA7A 2PGDA 1L5QA 1JHOA 1H2ZA 3AL3A 1RBMA 1YR9A 1DOZA 3F1LA 3LUGA 4RY9A 4LWOA 1JSRA 2FW6A 3Q98A 2FWNA 2Q4TA 4C7VA 4ZI7A 5EP3A 3B70A 2HCTA 4OFXA 4Z9YA 2PT5A 1RRFA 2QN2A 1YOBA 1JDVA 1MTOA 1ONSA 3NKVA 4NENA 1XJWA 4HFJA 4CLHA 1OBOA 2WAMA 1T3GA 1QH9A 2F90A 2O3SA 1LBIA 5JDCA 1MJNA 2IZ0A 2P9BA 4UAJA 1GCUA 2RH8A 4ARCA 1PU2A 2A2ZA 1DKOA 1SWWA 2X5KO 3AEUB 4JASB 5EKUA 4D3DA 1XP8A 4D25A 1KZ4A 3WSTA 3TLYA 1CJSA 1P9NA 1KAGA 2WAYA 5EIBC 3RROA 4XJXA 2PXAA 3TZLA 1R1DA 2B1RA 6REQB 4ZAZA 2XUAA 3I1FA 2JKZA 3AVQA 1XZLA 2AYZA 2G1KA 3JAWA 3OCUA 4DZZA 1YB6A 3CHYA 4CV3A 5JSZA 3UWPA 4B17A 3U3KA 3W9BA 4UZFA 4B8WA 1MFZA 4RVNA 4DEYA 1DIRA 1ODTC 3RUAA 1Y8RA 2D3WA 4GEKA 1C3JA 4E5MA 5AVRA 1OF1A 2DUMA 3A2LA 1JIXA 4B3FX 3KEMA 1BKDR 1J22A 2EF0A 3CX6A 3FPKA 4S1TA 5H02A 3S2UA 4DC0A 1MNQA 1VFPA 4ZCIA 2WAXA 3A58B 1SELA 4FHZA 4OHKA 1QHGA 1XVTA 1VB3A 4V1CB 1UKZA 2Q1SA 1B00A 1WABA 1Z75A 4QJ4A 5K8UA 1PE0A 2C9ZA 5EUQB 1CJVC 2YV3A 3LY9A 5E9WA 3QPDA 3UWMA 1ORIA 3BULA 4IGEA 3HWX1 1H6CA 2C31A 4AJNA 2MJLA 2Q5OA 2REQB 3FZGA 2DTXA 4Y3UA 1GQRA 3QMPA 1PFQA 1OXVA 1THMA 3G2LA 1YQQA 5CW1A 5K0TA 2AFIA 2FZEA 3JZFA 2QR3A 3DKPA 4HAXA 1G20B 4OCZA 3JQCA 4BZXA 1ZSYA 1WBJB 1E92A 4BV3A 4DSTA 4PXAA 5LYYA 1KI7A 2YJ3A 2YV5A 3BCRA 4KNVA 4DN6A 3EDYA 4JYMA 3OJEA 2DRIA 3QG1A 4AS1A 1VQ1A 4TYMA 1D2AA 3TUJC 5BN3B 2QAIA 3PHCA 1SD5A 3EXHB 5AKJA 3P52A 5ELLA 4CXMA 3CZ5A 1O0CA 2WE8A 1A7UA 3MGGA 3V9AA 2JAPA 1Z8DA 1DO0A 4JKYA 4OGFA 1JS1X 3PVZA 4PR3A 2QRGA 5FT9A 3R7FA 1VMIA 4NWIA 5EXPA 2Y1LA 4MYCA 2H4FA 3EDQA 1MO6A 1H2HA 2A1UA 3BICA 3T5GA 3UTCA 2YKGA 5ICCA 4RA9A 4QXOA 5EIEA 4XIFA 3UGJA 3ZWNA 1QRSA 1CERA 2R11A 3EQ2A 3KPWA 1KMCA 4HEA6 4F6RA 4BB6A 2XMRA 1U1CA 2C78A 2DTEA 1SK8A 1X70A 2IGBA 2ZIWB 5T57A 3SFVA 4LYGA 4R2WA 1E1CB 4PBRA 1SCKA 3VSCA 3K0AA 1IM2A 3VYUB 3F4BA 1TM4E 1YHNA 4L8LA 1V8ZA 3AF2A 4TWIA 2IYFA 2YWGA 2PEZA 1TPZA 2D62A 3O1IC 1FX1A 4MWZA 3GJ6A 4YJFA 2GEUA 3WJ2A 1XMIA 2QRPA 3FDIA 3F3KA 3ZNQA 3CZMA 1XVAA 4WK4B 4DW8A 1D07A 3FF1A 3CRNA 3NHJA 1OJ7A 3MMPA 3C0KA 5AUOB 4YI5A 4JV5B 3JRNA 4IGAA 2H00A 2PEYA 3AT1A 3DFZA 1TKAA 2BJHA 3KOUA 3MTIA 1R0WA 3F3SA 2HBYA 4N01A 4DLRA 4AULA 1FPQA 2QPTA 1N77A 2ZITA 1CJTC 3GFQA 1R0CA 4K6HA 3B2QA 1M1ZA 1BJKA 3S2GA 1SKAA 4NBTA 1EFRD 1LNZA 1QS0B 1X7YA 2VS1A 3N0TA 5FA8A 5ITZA 5ESRA 1G2PA 3U49A 1QPGA 1CSEE 2YICA 3BRWD 4UEWA 5AW0A 5K3OA 2IS6A 1FMJA 3A10A 3NP9A 3ESDA 3OP4A 3JVDA 4IINA 3T1NA 3U3MA 1POXA 4BO2A 2I91A 3KSMA 4X93A 3H1AA 4UBJA 2IYLD 1Y5RA 4COKA 3EPLA 3PGVA 1PUXA 2D74A 2JFUA 2ORED 1ONPA 1SKQA 2B99A 1Z18A 2R79A 4HGOA 4RBNA 1U28C 4XPIB 1A1SA 1I2BA 5D5QA 3HDYA 4B4UA 4WDRA 1UPUA 1US8B 4TL9A 2W4MA 1YE5A 2QROA 4UE2A 5E9JA 3OF2A 1E7SA 1Z4KA 2IXEA 1ILWA 2J3KA 3EH1A 2QAJA 2ERCA 1NQVA 3HPQA 5CUQA 4I9GA 4DA8A 1GAWA 2YJ6A 5AKZA 1KDOA 2DFDA 1P17A 1Z6XA 3N0RA 3G0GA 4M55A 4XUCA 2ZM6B 2O5EA 3GEEA 4IM7A 3EWIA 4M0UA 1XRLA 1UEIA 4CLRB 5G4LA 2IXDA 2C8LA 4AJLA 3L4BA 2QGNA 5EWMA 5J63A 1RJGA 2RHWA 3E7DA 4UBMA 1CQJB 1NNEA 4WCDA 2IFTA 2BJWA 2CWDA 2QHXA 2XA2A 2OGWA 4H4DA 3EUWA 4P81A 1FP4B 5G1PA 4L78A 2UUPA 2UVQA 3MJSA 3MMSA 5GJCA 2XY4A 1LI5A 1NV9A 1A27A 4CU5A 2CXOA 3BD9A 5KHAA 5EVCA 3AI3A 4HYTA 4OX9B 3UPDA 5BXYA 5FWNA 1M66A 1UMBB 3QVMA 2XUGA 1NE7A 3KYBA 4R9UC 1QX3A 3LV8A 4U4AA 1U11A 5COQA 5HA5A 2LUOA 1LSSA 2O05A 1EJ0A 2Q9UA 4EYEA 1I01A 1PO7A 1ULHA 1YRLA 4M0DA 4OMCA 1Z8FA 3T5BA 1VGRA 3GUCA 4P3YA 3I8XA 3ITKA 3NM5A 4GX0A 1SB8A 3HA2A 2VBGA 3FBGA 3ROZA 3AL0C 1KMHB 1R9GA 3LQKA 4WGFA 1QVRA 2B8WA 3FKJA 4L5AA 2RHLA 4GGPA 4LRUA 1Y7LA 3H86A 4XGQA 1KJZA 1AKUA 1KNQA 1PR2A 3L7MA 4M0EA 4ZAYA 4KC0A 5JZSA 3IBGA 4AXBA 5I51A 5AIAA 4RZXA 4V0OA 4HXGA 4QASA 4L5IA 4D9BA 1XNJA 3FM9A 4CKZA 4FXOA 2YRXA 4HB2A 1N3IA 4J90A 1RQRA 1Y8RB 1ZS9A 5JWRA 4ND1A 3MWEA 1E0KA 1YZVA 3IO5A 1XDUA 1GZ5A 3OLCX 1OFGA 4JL5A 1DB3A 1UBEA 2VRCA 8MHTA 1HLGA 3MJDA 1Y9EA 1XA3A 2HRBA 3I9LA 2X0EA 2QT0A 3O2SB 3V46A 3RTBA 2ZRAA 3WWPA 3OETA 3AUXA 1Z45A 3FOAA 4X6YA 1NXPA 2EGGA 1M6HA 4U2GA 1VYTA 5ED4A 1PEDA 2WTNA 3KJQA 5CFLA 2LBPA 3L5KA 3CIFA 4JL6A 3WADA 1PJ3A 3LOQA 4EFDA 2JBHA 1DRWA 5IWCA 1DT3A 3WXBA 3PEVA 4JX8A 5DX8A 4AP6A 5CVTA 4XIIA 5JVDB 1N33B 3C3MA 4RE6A 3IDAA 3KLBA 1QP0A 2QYTA 3L07A 4LV8B 3E3NA 3H9UA 4RD0A 4UE3S 4JBIA 5AJWA 3U4CA 3EG9A 1CZRA 1C8LA 1GZ7A 1G20E 2HA0A 2ZBUA 4M38A 2QTZA 3DV0A 2BE7A 2E37A 2BM8A 2QGFA 4PGMA 2QGZA 4PYOA 3X1XA 2PH5A 2JCYA 4JBGA 3BF7A 1ID1A 1TQDA 4KFRA 4O8ZA 2OE2A 2W43A 4B1FA 2AXNA 5JW6A 1EWVA 2OR3A 1V26A 3G8AA 1OH7A 2WJ6A 3K53A 3ZC3A 3L7KA 3UKOA 2IV7A 1C7IA 3M81A 5LWHA 5K8VA 2D0PB 3DM5A 1H2EA 1UMCB 2RK6A 2ZB7A 4XVQA 2IODA 4N48A 2J8ZA 3VOTA 1TVEA 2C2HA 5BSKA 5KYUB 4D4MA 1E5VA 3BB4A 1R0SA 1EJ2A 4WNAA 1A9TA 4ND8B 2ODAA 1NKTA 1U6KA 3HCBA 4A91A 4ZI7F 3EDCA 1U9ZA 4BLVA 2ZCVA 2G1JA 3ENNA 5TY0A 3VC1A 5EINA 1L6RA 4HAYA 4XQGA 4ZJZA 4MUAA 2IPNA 1P81A 2DSNA 3D2BA 4LX0A 3TAUA 3PT5A 3WNQA 1FLDA 3IAM1 1Q22A 3L7IA 4XKJA 3WLOA 4OL0A 4NCNA 1XXLA 1EUCB 3R6TA 3JQGA 1OZ0A 1A8IA 3WWZA 2XOKD 1WEHA 4H59A 3HACA 4ZVQA 1ZM4A 1DKLA 3E9YA 4I4NA 2XMGA 3L8EA 3Q7PA 1EZZA 3G3EA 3HA3A 2WTMA 5BV1A 1CE8B 1X7ZB 3VOSA 1XAJA 3WFIA 1ILEA 3TLKA 4IOMA 3QX3A 5FEMA 1VLQA 4IWNA 3W3ZB 3PA6A 5I7OA 1ZMXA 3EFBA 1YRQA 2C5LA 1CUHA 3QVGA 1JHPA 1NW6A 2I80A 2XUDA 4HNGA 3RHZA 1HEIA 3EULA 4URFA 2JAUA 1A8UA 3B60A 3NAQA 3NX4A 4UNSA 2Q7OE 2DETA 3DA8A 3BHIA 3L7CA 4MW5A 1C7FA 1L7RA 3KHSA 1KI6A 1RR6A 2Z1NA 5EESA 1R74A 1EK6A 2FFHA 2OV2A 5TGDA 1IFXA 1OASA 1T2FA 1T0JB 5JJKA 4ALKA 1ECFA 1DIGA 1FU7A 2Q3BA 5FNZA 3I4LA 1KY5A 2HSGA 1M34E 2GS9A 5DOZA 3K32A 2J3IA 1P45A 3EIWA 3QRWA 4I8XA 4MVCA 2Y0EA 3HUUA 5DCYA 4RHYA 1L7XA 3LU1A 3CRVA 4OP1A 1HYQA 5CEJA 5CBKA 1SBYA 2ECKA 5KAMA 1UWVA 4QYXA 5JS7A 5ADUS 3DDWA 1ZUIA 4LDNA 4BQPA 4ZGGA 1CBUA 3CSUA 2AVNA 1BU8A 3VDMA 2XVMA 1QLHA 3NOQA 4P7BA 3CGWA 4CQNA 3ZDEA 4MO9A 1NVDA 1N2EA 2EG5A 2I2CA 2ORIA 3CF0A 3L0PA 1LB1B 2W22A 4B6JA 1U7TA 4EZIA 3TQTA 5KYXB 2QRNA 3FUTA 1GDHA 4Q9KA 4KR0A 4X1YA 3T3DA 3QNUA 1KRHA 4R1LA 4JLDA 2G8NA 1C81A 1LQUA 1UINA 1NQTA 2P79A 5CJJA 4XH9B 4C7OA 5K0FA 5DX0A 5IJAA 5EIXA 3K0BA 1UBFA 3BJRA 3DMDA 4CQMD 3CR7A 5IVDA 2GPBA 3GC6A 3FMGA 5EG5A 4PLYA 2H1CA 3BL5A 4FMDB 1KQFA 3D8HA 2XHZA 4QJIA 1ORRA 1EXNA 5GWXA 2Z43A 3AESA 3QBEA 4ZQCB 1G21B 4F85A 4AFNA 2QIOA 3P9CA 4DLKA 3DOHA 1R6VA 3FMIA 3OZRA 4UM8B 3V1LA 5FO1A 3UKDA 5DDIP 3EOAI 4IZ6A 3A6LA 3CVVA 1PNOA 1GVNB 1K86A 2JGAA 1OWMA 2VWPA 1EGAA 2UZ0A 3QVWA 1CUVA 4KP7A 4PN7A 2RD2A 2IHJA 3AG5A 4RYDA 4FYPA 4PGHA 5FOQA 4DEXA 5DU2A 3DD5A 3OJCA 4W9RA 5BYJA 4DT1A 5KX5F 1KWGA 4NCKA 2WIJA 4GRAA 1KSHA 4G3XA 3K8ZA 2VDJA 1RSZA 5JCZA 3ANLA 1TU4A 4AL4A 1PLKA 2F3RA 3B9BA 4YUWA 4AI6A 4WZBB 1LFDB 1KDRA 1W29A 2GYVA 3Q9LA 1FUUA 1PR3A 2JFQA 3GPIA 2GAFA 1OLUA 4RSRA 1DV1A 1PF7E 2LIPA 2QOEA 4JJZA 4W5HA 2P1RA 4IIBA 3COYA 5FBKA 3O93A 4OGKA 5CHYA 4RY2A 4B7UA 1GTSA 4WH0A 4RV9A 1ULAA 4IMIB 3WO0A 5H3CA 3CBQA 1C7ZA 2G83A 4QBTA 2JGDB 1GARA 3CEHA 3PKIA 3L2OB 4S1WA 4HSEA 3HEMA 1H0HA 1I3CA 2CZCA 3ZLUA 4DWVA 1PWYE 4FWTA 1RI4A 2CUZA 1I3LA 5LIRA 5LQKA 1KIAA 3AZQA 1RXYA 3G89A 1GUDA 3EIUA 2BEWA 5LKRA 5DE3A 5HJ7A 3W9YA 1SH7A 4PLHA 1UFVA 5LZ2A 5JMTA 3MTQA 4PXSA 5GGXA 5HE9A 3PJGA 1QC5A 1D5CA 1KY3A 2FJUA 5AOBA 4LTNA 5FTJA 5C5DA 4Q34A 5JRDS 5JPCA 1CUDA 4NE2A 3AV0B 4KXVA 3PUXA 1LQ2A 1U5BB 2QTTA 4BE9A 1T5OA 3SQLA 4I1YA 5DYGA 4QDXA 2X5NA 1JH8A 3RRYA 3R44A 4B40A 2R6ZA 3D2LA 1PHPA 1SD2A 3RS0A 2FFJA 4JAVC 5ITSA 3UK2A 1TW2A 1APBA 3ZWMA 3QEKA 4OQDA 1YT5A 2OD2A 2AA3A 2FK7A 2QR2A 2XEDA 1ZPDA 2Z58A 3AOGA 3HU1A 2R96A 2VYNA 4BAGA 1E4YA 4O2BB 4UUAA 3ONDA 4GGMX 1CIJA 3PEUA 4GRIA 1V9SA 4GF5A 4XEHA 4HQLA 4NAHA 3OKCA 3W79A 1ZUWA 2HCBA 4K9DA 2PX2A 2QR5A 4HLNA 1VMDA 4IEFB 3W6ZA 3CTMA 4CR7A 3EGXA 5EJ8A 3EVZA 5F7JA 4W9NC 1R7RA 2W2OA 1QKJA 3C3AA 4HWSA 1NUAA 5T8KC 1YE3A 3GDHA 1PBNA 2IHVA 4WE3A 4B3SB 1JAZA 5CNIA 4AJPA 2IDMA 5FNVA 1NASA 5FI3A 1X7DA 3ANMA 1H9CA 4YDHB 2PJDA 2DC1A 3MT7A 4MVYA 4DC1A 3AW8A 2WWVD 1SVOA 5CURA 1USUA 2I7CA 1Z2PX 3IIEA 1WPGA 4I6JA 2HRRA 4OBEA 1R12A 5K51A 1UDCA 3ZV3A 1EFUA 3I34X 1FQOA 2EFEB 1RXUA 1BQEA 3PQ8A 1BXKA 1CVLA 4INJA 1WUIS 1Q92A 5F78A 5ECWA 4EY5A 4O4LA 3R8FA 1FNBA 1CRZA 4EEKA 1IRXA 1SBCA 2RHBA 1SUCA 1EDZA 2C5HA 2Y6UA 3OZAA 4LVOA 1M2GA 2VSYA 3C43A 4P2GA 1TD9A 3BHNA 3GGOA 2JLZA 5JFTA 3OWHA 2O7VA 3ENWA 4G09A 1NVKA 3T34A 3TDMA 3ZWOA 3OD1A 2DB3A 3ZGYA 1HDIA 3OT1A 3THRA 4EG1A 2BM0A 2V4ZA 4I4TF 5D86A 4GS5A 1WM1A 1W88A 2HUNA 1P80A 3O4RA 4TMXA 4ARSA 4EI2A 2H1LA 2V5VA 2BCEA 2W2PA 1SOMA 3G2HA 4W5JA 2NU8A 4DGSA 3ZCRA 3DUWA 3Q2KA 1BYIA 3PQ3A 1OFUX 2PUCA 2F4VB 2LVBA 3I32A 1D9ZA 3N2GA 3WE7A 1WBBA 4XWKA 1SGWA 1MZVA 1WKBA 3IELA 2GETA 1MJFA 4OXXA 3G9ZA 4TT8A 3L02A 2D7JA 4QWMA 5B1EA 2ZCJA 3IDSA 4TUYB 4Y2TA 2PUTA 1JG7A 3PK0A 2V55B 1OLSB 2YHIA 2R1ZA 2YY5A 5B4VA 2IHUA 3ZCVA 3BTSA 3OLYA 2C7RA 2Z6UA 3GEGA 5EI5A 4EA7A 3QMMA 2OZPA 2MSEB 3K0SA 5DGDA 1Y8QA 4W6QA 1WXDA 2XTMA 3GJ7A 1Z26A 2PYZA 1SPXA 2N3ZA 2FZ5A 3AHIA 2QJFA 3I64A 3RU2A 3JD4A 2Z08A 3ETDA 1PT7A 3GGDA 1E6KA 3KKMA 3BWVA 4L3WA 2OUIA 2D1SA 4B3HA 1ZUNA 4IP0A 3OQPA 4LOLA 1PR1A 2GH1A 4KTTE 5FAKA 3U7HB 3DHVA 3IHLA 5HF8A 3VBEA 1WJGA 4E51A 1WKCA 1Y9ZA 1IK6A 1NJFA 3EJWA 2VCHA 6NULA 4UATA 1YRHA 4U3JB 4AP9A 1GGMA 4BX8A 4B33A 3OY2A 2B30A 2OCGA 5LL6P 3JWJA 3OQ6A 4MWBA 3VDNB 5K05A 4LS3A 3U1VA 2J4DA 3GPCA 4EVQA 1NVGA 1GKIA 2Z6AA 3ZOZA 3VR3A 5B3AA 1XMPA 4MQBA 2PA0A 3K4QA 2WB2A 1YUMA 2ZWAA 3U4GA 2IY7A 2CUTA 5FEUA 2RAPA 2K7ZA 3DT6A 4OTZA 3SXUB 2WSLA 4IIJA 2HAEA 1GL7A 3FH0A 4L4RA 4BFCA 4B46A 2AZ4A 4ZQEA 4DLWA 1N6IA 4YMTA 1UL1X 5JIBA 2QX4A 5C9ZA 1VB5A 1YQTA 1ZGBA 3EXEA 2C0QA 3P1JA 4HS9A 2Q1XA 4LSMA 1NXQA 2MHCA 5EJ2A 2Q46A 2XB8A 4L4YA 5GTDA 3U7FB 4J0GA 2VAVA 3I01A 4XFDA 5AKLA 3GL9A 2FPXA 2QG9A 5ENVA 2C4UA 4Z54A 3ZHCA 2YMPA 4CCYA 2SICE 4YJGA 1SRRA 4QPDA 1BHSA 2IIQA 4QVIA 5GONA 5E6SB 4FR2A 5CLJA 3G0CA 4HFNA 3LCCA 1JQEA 1N2BA 1NXWA 2XDQB 3A9UA 3C97A 1IIBA 1K68A 3ITDA 1D2EA 2J5QA 1Z7YA 2WF6A 3MT9A 4JP8A 2JZCA 4IMPA 1N0UA 2H07A 1LPNA 1JLLA 2WKPA 5E6UB 4KV9A 1E0DA 1I3MA 1O9HA 2PU7A 4FP9A 4AS2A 2ZUWA 2BW0A 1TC2A 2WF8A 3GRZA 1LX7A 4MDHA 1JAIA 2XBLA 4F0JA 1T8RA 3JVIA 2YH2A 4IV8A 3GRCA 3UNXA 2GJSA 3I1YA 1LW6E 3HR4A 4KIGA 2DECA 3I0ZA 1U3VA 5K2MA 1NF2A 5CG1A 5KJEA 4MR8B 4MVJI 7ADHA 2PG3A 1A9OA 3HKEB 3VX3A 2W6ID 3A28A 3GY0A 3ZHXA 4BAZA 3SHQA 4ZHQF 1X1TA 3W8RA 1N25A 1UBHS 3AI7A 3H7AA 4I1VA 4RF3A 2QJRA 4HVLA 2FPPB 5A2QA 1M34A 1V5WA 4EVSA 3K1AB 3Q1LA 5HIMA 4E5SA 3OLVA 2H1VA 3KFVA 3UIEA 4NCBA 1JIVA 4C1NA 4HNUA 1ADGA 4C30A 3N6XA 3SXJA 4CI9A 4NMXB 4LZJA 3P9NA 5IPFA 4HN4B 4N6OA 1Y42X 1SIWA 2VHZA 4POAA 3O03A 3HFJA 4YT8A 4PLFA 1M54A 4FDUA 4PR0A 4ROTA 4GSKA 4ZEOA 4KE9A 3CB4A 4R1SA 1T0PA 1YQDA 4NYIR 4EKYA 4N41A 1UDRA 3HN7A 1YTUA 1H1LA 4MZXA 4WBNB 4FOOA 2WABA 3K1ZA 1TX4B 3AOEC 4ND2A 4XXHA 3RVRA 5GIPE 4RHXA 5IHPA 3U7GA 1T3ZA 1BGVA 4CM4B 1XTZA 5JYDA 5J23A 1AKNA 1E5TA 3L7DA 1AUOA 1C9MA 1NY5A 4FGZA 4S35A 1XDDA 1KZ9A 4WJKB 2WHQA 3IOBA 3HCFA 5I4IA 5LXTB 2X7XA 2IF2A 3EFEA 4LZLA 3MWLA 4JVMA 3MTJA 1O97D 1WW3A 3BERA 3DEFA 4MWSA 4XGKA 5ALIA 5K3DA 4ALIA 2ZUEA 3PU6A 1SHJA 4HNSA 4BTLA 3DB1A 3IESA 3WNDA 1GV1A 3L93A 3QPVA 4EMSA 4D9FA 3PQ6A 4KWEA 3ESBA 3O4FA 4TYYA 1NTRA 5DHQA 2YZ2A 5GINE 2I5PO 4DQUA 1UZNA 4Q15A 2YQ4A 1CS0B 1FFXB 3UFXB 1XDBA 5ALPA 3HB0A 3DAHA 4QREA 5F2OA 3ZVLA 1IDOA 1SXJA 2B7CA 5KO2A 2ZT6A 3KL4A 1XEAA 3KKNA 4K9PA 4QM6A 1EIZA 3H2SA 4B0PA 3PICA 4B4WA 5LFAA 2JFHA 2Y0CA 4GX5A 1XCGB 4WN3A 4YP0A 1CB7A 1L4KA 3I3SR 4C78A 4X20B 5J2TA 1XWFA 1H4VB 2C61A 2ZYSA 3VVLA 4YYZA 3GHYA 3KU1A 3L1HA 4AECA 1VKHA 5BN4B 3WGNA 4CG1A 1ZC4A 2FR8A 2X5JO 5IKEA 3GDWA 5AKEA 3TPZA 1PK8A 4G1BA 4AROA 2IPLA 1JR4A 4WCFB 2QX9A 1RLUA 3RANA 3D54D 5JARA 2VRBA 1ZAKA 2Q3LA 1GEGA 2EFDB 3LI2A 4H1VA 3QFFA 4Q01A 1LLFA 1NTOA 1RQNA 2V65A 4ZVUA 1OXTA 2QVXX 2VNJA 4WXHA 4DKXA 3U7QB 3SZMA 1HKUA 2QPOA 3HDVA 3IODA 1SURA 3NBUA 1G5RA 2WWRA 4CGZA 4YONB 1G19A 4UMDA 4P3XA 3DYIA 2RBGA 2ZG6A 2E9SA 4C29A 4K6GA 3DT8A 3NG1A 2PE5A 3M7IA 4H7IA 3DE6X 2VPZA 2QXYA 2ZB8A 4PX3A 4KU4A 2IRWA 5FFMA 4OK3A 5U4XA 4CIDA 4RMHA 5MN6A 2ZWMA 5H81A 2HO4A 3DXYA 4AUKA 3HHPA 3KEFA 3TZKA 3AETA 1IZYA 4CHTA 4BKQA 5LQUA 4RK1A 4F8EA 1E1KA 1P1IA 2UYYA 2IEYA 3JASB 3BTOA 3X44A 4PYJA 2KBFA 1QPBA 2XYGA 3RPEA 4BVLA 2DEUA 2DFKB 5E9AA 2PYDA 2REOA 1FMCA 1N8TA 3MD0A 1E1RD 1HGXA 1VCNA 3M9WA 3U09A 1EGMB 3DZKA 2CJWB 2BMVA 2W2XA 3KOYA 5AVWA 1MIHA 1LFAA 3HCOA 3IQFA 4JK3A 3T9FA 3EF1A 4EW3A 2Q3DA 4KVZA 3IAUA 2IOHA 2J9FB 1ZZEA 2WU0A 4AYWA 4D9NA 1WBDA 4C4XA 2UKDA 1I24A 2FPGB 1SCNE 2WMOB 1T91A 4I4TB 1ZBDA 4FT4A 4CFZA 1Y63A 2P9GA 2DWPA 1IATA 4PAWA 1H69A 1GLNA 2FG7C 4Q1VA 1KAHA 2GHTA 3OPMA 4QOSA 5EZSA 2JLWA 4IX9A 1VIYA 3P5BA 3CB2A 1KEPA 1PJCA 2JD0A 3NORA 3OBIA 4IDPA 5TGTA 1NW3A 1U8ZA 3FB4A 3PCTA 2QZ4A 3ULKA 1P44A 4BQEA 2RFLA 1RABA 1MEEA 2YBEA 1HE5A 1Q12A 5ES4B 1JHQA 3CCCA 3VHLB 1NL3A 1RLOA 2OHGA 4YJHB 3VR6D 4O5OA 1FE8A 2YL2A 4M0KA 4UM9D 1YB5A 1QLJA 3H99A 4JGGA 3I4CA 5CVCA 3ZCXA 3PQ5A 2PX5A 1I2CA 4R51A 4TSFA 5AQ1A 1B8UA 2RGXA 5A3QA 2YMQA 4KN9S 1ZR2A 3MYRA 3IQXA 4MS3A 2CFRA 4N6GA 4EA6A 1V9CA 2X9LA 2ZTLA 4AKSA 4PONA 3HXLA 3E3AA 4YR9A 5KDDA 1FFYA 4J7UA 1GITA 1RXEA 5EIHA 2BI7A 3JZMA 5JATA 3I5MA 3WB0A 3QEJA 3QP9A 5LBIA 1FLNA 4PYKA 4EQ6B 4QOEA 1A5TA 3TL6A 2YJ5A 1AC5A 1YZLA 1Z5PA 5FBWB 2W6NA 1DEAA 2PHZA 3D59A 4DUYB 2WKSA 4KQMA 1S2MA 4BV9A 4BATA 3FBTA 3Q8WA 1P2TA 3ESYA 4QYSA 4DUPA 4MICA 4YP1A 5JC8A 2ZSKA 3RTAA 4BLQA 3EWAA 2GM3A 3LHKA 1EUCA 3MEQA 1MG0A 2UYCA 3EGWA 1UJBA 4Y6PA 2LKDA 4BBZA 1TUBB 4D4LA 2YINC 3DWGA 5A1JA 2FRDC 4WZ6A 3KQYA 4X5OA 1QGYA 1WG8A 2VH2A 2WWGA 1PJAA 3AIIA 4KTVE 4N3AA 1L5HB 4Y9RA 5LZ8A 2XSZD 3VPHA 5DGIA 1S9HA 1TLLA 4J94A 1VIDA 2NXJA 3MWDA 2DTDA 2I8LA 1NSYA 2H16A 1N3LA 2HD4A 3LRTA 1U8YA 4QYWA 5DCWA 3RIHA 4BO0A 3HC7A 1J0EA 4Q18A 1BOFA 4YPFA 5ALVA 4O1HA 2CBZA 2I62A 4AMBA 4DR1B 4EI7A 1E5XA 1AY0A 3INGA 1EK5A 1KXZA 3P0HA 3UAZA 3IP6A 1X2BA 4BNJA 4G0YA 1KJQA 3O21A 1SEVA 4H15A 2F43B 2PTGA 1XDWA 3HJBA 4CKBB 4YCAA 4RPJA 3RADC 1U7WA 3IPRA 3WQBA 1ESNA 1ZM3A 2V4MA 4Z8YA 5FUMA 2EVWX 4KQCA 1G64A 1GV0A 1S01A 1IG3A 1M10A 1A98A 1BMDA 3G8CA 5T7BA 1JLSA 3M3PA 5AM4A 1OX5A 3VV2A 3B6JA 5IXYA 1M67A 2YFQA 3CC8A 5E38A 3X1JA 1KP3A 2RHJA 3U6KA 4BJHB 3D2AA 2FKAA 1ECGA 1EVLA 3K20A 2W83A 5FCDA 4DMGA 5KNBA 1JU3A 4FCWA 4IQGA 1BYUA 3ICEA 1I51A 2QM0A 1RRGA 3HGMA 1FX0B 3QE2A 4LYJA 4UAUA 4TS3A 1MNAA 2BT4A 2XPCA 1Y98A 3U5TA 3OSZA 3KR9A 1XT6A 3QE0A 1L4NA 4MV8A 3ABIA 1CS4C 3FRIA 1N75A 3LL4A 3N2KA 1KE2A 4JR2A 3EZNA 2GLUA 4CDGA 4CDRA 1DMRA 2PZEA 4O3FA 1G1MA 4RIIA 4IX1A 1JJAA 2BEUA 3PNQA 5HCUA 4D41A 2CVFA 3O3OB 4KNWA 3FGZA 2OESA 4U9HS 1RHRA 4C2UA 1R5JA 1ZXLA 4M21A 1Y8AA 4RJIA 3HVRA 3NXKA 4W1RA 2IEDA 3UCFA 3DOEA 1AK2A 3W2EA 4MPDA 4UTXA 3RC3A 1K9VF 4YMHA 5TNXA 4YMSA 1EP9A 3C98A 2NWQA 2V9PA 2AK3A 4IDFA 4QGBA 6ABPA 1FFSA 5K6AA 5DTJA 3SEZA 1XZJA 2IZ5A 3KDAA 1ZLYA 5KQSA 1EXVA 4D26A 3GLGE 2ACKA 1DZIA 1ECPA 1MJGM 4WZAA 1TC1A 1ZMTA 2VNSA 4IL5A 2UUBB 5B1IA 3UYKA 1JDJA 3O3CA 3W06A 4JVNA 4Y9UA 3ESAA 2TMGA 1PK9A 5JC1A 5IM4A 1OWNA 5BN5A 4RSGA 1G4AE 2GWRA 2GF0A 3SS7X 4CEJB 1B3RA 2VF7A 3IPXA 2XR1A 1MB9A 3OZXA 4LYHA 1UMDB 3RRZA 5EJ5A 1FJXA 3MHTA 3ABZA 1U1IA 4CF6A 2OAP1 3HDJA 1O9BA 1Y5NA 2WSSA 3SQDA 3W5HA 1IM8A 4M53A 1Q77A 1Z06A 3HY3A 3Q3VA 4HS4A 2QD3A 2J41A 4LI0A 4M9ZA 1HC7A 1VPEA 3WGYA 5KC8A 2CLCX 3E5RA 3AOEA 4TTJA 4UBKA 5T4EA 5TQJA 4HNRA 3Q3CA 4BL5A 2C5AA 1AUXA 2B92A 2A9RA 2IXBA 1G55A 2ZSJA 7MDHA 1Y6RA 1WULS 1EDDA 2O7QA 3P32A 3MB8A 4FHCA 3I2IA 1JXQA 2OKGA 3HCCA 4NATA 4Y2YA 5FBRB 3QNWA 3MCAA 4BQNA 2OY0A 4JC0A 1QF6A 4CCAA 3A3KA 4QUKA 1DU4A 2F3UA 2H4JA 4YB8A 3RWBA 4UDXX 2WNHA 5I8PA 2B94A 2FA9A 3QBTA 3NQ41 1L4EA 1ZY2A 2JFXA 1E62A 2PZMA 1HRKA 3L7AA 5AVQA 2PA3A 1DKRA 5REQB 1EFAA 3EAFA 4BQOA 2ZULA 3R6LA 1ZW1A 3SX2A 1I0IA 1U2QA 3IP8A 1KF0A 3S5JA 5HXAA 4DB2A 2HSWA 4Q7JB 3OZ7A 3EXHA 1OW3B 4FZ3A 4K86A 3IJ5A 4RFLA 1DCTA 2DQ4A 4P31A 3IUPA 4XCQA 3MCUA 3ZDBA 4HDKA 3OQ1A 4J16A 4RSHA 3SHWA 1OE0A 1D6JA 2F1HA 2TMYA 2YDYA 3DMYA 4L0QA 3VR1A 1RQPA 4JR1A 4Y2UA 1CUYA 3OMWA 3DAGA 2AG8A 4GC9A 1VFNA 2I3DA 3AUKA 4BWYA 1DKPA 3PCRB 1FNDA 1U9IC 4JOBA 1KERA 2WK1A 3I9OA 1NVVQ 2ZXEA 2P9YA 4CTNA 2ZQ5A 2JHGA 2H51A 5SICE 1PS9A 1XQYA 4MMXB 2Q3EA 4JUFA 3N8HA 5FTWA 4E22A 1KVQA 4EO4A 2IHKA 4C5AA 1WY7A 3PSAA 1JLHA 5EUCA 2JJ1D 2MR6A 2PR7A 1X42A 3PDJA 4AU1A 1UBCA 1C8VB 1J6UA 4XLZA 3E70C 1YB7A 2E18A 2Z98A 1TYCA 4OKSA 1JQAA 1FDRA 2R2AA 3WRYC 4BMZA 2IA5A 1BE8A 1PJRA 3CX8A 3FSJX 3E3LA 4CIAA 1NG9A 1IY2A 2J9GA 5G0UA 5KNBH 3BXXA 4QBKA 2IOYA 1Y80A 3R3VA 1SA0B 5ARDA 1IHUA 3QEMB 2BCJQ 3TW8B 3KC2A 3L8CA 3IQHX 2WJJA 1T8YA 2X2OA 1NR1A 3E1GA 2EKDA 1KYYA 4ERNA 2GAOA 5C8YB 3SHTA 5CFPA 3K16A 4JOQA 3C24A 5TMPA 3V3KA 3V8QA 2FV8A 2EFGA 3P0FA 1RQLA 3EVDA 2A0WA 1U3WA 1V1RB 3LD9A 4DA6A 2VPTA 5AUNB 4H18A 3FB1A 3IV6A 1YI1A 1I4DD 2OLKA 3CZ9A 1P18A 2R25B 3GK3A 3MS4A 1EVIA 5CM8B 3UT5B 2EU8A 3RFFA 4X62B 2XZLA 1JPVA 1K7SN 1ZH8A 1GPNA 2HSJA 4KQ1A 2RGBA 1S2IA 1W8IA 3RW9A 1HYEA 3I9KA 2IYSA 3VC3A 5HKBA 2B69A 3KD2A 5HM8A 2QZ9A 4TTSA 3ZCUA 3FNEA 3JXEA 1OILA 3B5JA 1LWOA 1NHWA 1UM8A 5EUBA 3I72A 4NEHB 4WFKA 5IUJC 1X9IA 3SQMA 3T41A 3HU3A 1F0NA 2FUG1 2RHHA 1NT4A 2NO7A 2PLWA 3PD0A 3LSYA 3NKLA 4H1UA 4QTTB 1B93A 1GUZA 1KHHA 4FOLA 4URYR 3EMDA 4BE7B 5JUWA 5KPJA 1IWBB 2OTCA 2O57A 4X6LA 4EB6B 4MULA 4N3BA 4LGYA 3TNJA 4QRIA 4LJLA 3HKDA 2X3FA 1NXOA 3FHLA 1FXUA 2CFIA 1NF3A 1YO6A 1D1PA 1QIHA 3KV3O 3L77A 3PPWA 1ODKA 1PP4A 5AOAA 3U3XA 1KRXA 5JDIC 1VYUA 3K1JA 2AI1A 3QX9A 1HI9A 2CFCA 1CB0A 4I55B 3LZDA 2B7LA 4NQRA 5ENZA 2ZYAA 5KKNB 2G6TA 2XTZA 4R3WA 3LP6A 3ZVNA 1I9CA 3K92A 2YZNA 4BFWA 4EF4A 2NOAA 4DJEC 3JAWB 5BQ3A 4R3UC 3WL6A 4WZBE 4CM8B 3EVFA 3IXLA 4UU7A 1LV7A 1RYDA 1YCFA 2HQRA 4FSHA 1L8QA 2QRVA 1PKXA 2QUHA 4O2LA 3U5ZB 1IY0A 4D92A 4JJ4A 4XYBA 5BR7A 3ER9A 3WAJA 5H8WA 3SHFA 1G2OA 3EZ7A 3A37A 3QX8A 3BK7A 3HK2A 4Y6QA 2J3JA 1O77A 3ZX4A 2SNIE 1BWQA 3L6OO 4KRGA 4MH0R 4F11A 1FLAA 3ZX5A 5BN5B 3D8RA 4NYJR 3WJ7A 5ICSA 1YZKA 1L5LA 3RQIA 1GL9B 3VNBA 5A5FA 2C77A 3STYA 2OOKA 3WL4A 3NUQA 3A2MA 3GLHB 4IUDS 4Y8VA 1GR0A 1T9AA 3P9YA 5JQWA 5ISMA 1E7YA 4V0ME 2QSYA 4MVWA 2NYVA 4R9SA 4RQTA 1JIJA 3G2MA 1KOLA 4EQZA 2W8ZA 5B1DA 1UPXA 4IIYA 4QTUB 2HT1A 1G5IA 3ADOA 2JLAA 1V2HE 9ATCA 4F21A 1K97A 2O3JA 2ZSAA 2G0NA 3E5HA 3WGQA 1ZD3A 3TNLA 1ZJYA 1OLOA 3F6SA 3RWMB 3CVUA 1J0XO 5B4UA 3ZCPA 3ZJYA 5JR3A 3VBCA 5K6TA 1DL5A 1OQAA 1TMYA 3ZQUA 3C2QA 2Z57A 1ZMOA 1N1MA 1T5LA 1E59A 4RLQA 4UUMA 1XUOA 5EOVA 1E5DA 2X1VA 3GXOA 2G5CA 3TMAA 2A9JA 3EXAA 4AURA 1WCIB 2QW8A 1W4RA 2C1XA 2D0IA 5DFAA 1RIFA 3MT0A 3RVNA 3CG4A 5I7UA 1XD8A 3OCJA 3A4LA 1TU0A 3WNCA 1F8GA 1UK6A 5CDYA 3DW1X 4KQIA 2IEAA 4FCVA 3ZY2A 4B4DA 3PGXA 4FMCF 2E1PA 5B7QA 3P2YA 1FNMA 2IP1A 3FTPA 3MAAC 2H7XA 4I50B 3SKXA 4ZJYA 4CLOA 3S8YA 2WSMA 2YWDA 3HV2A 3K9WA 4L85A 4KWHA 3PHGA 4RMNA 3SR4A 2BD0A 3EGEA 2CUKA 1VKNA 3T6KA 4RENA 1P2DA 3LZ6A 1QRDA 4ZA2A 2JA1A 4REMA 1TEXA 3UN1A 2KJQA 3MAGA 4DNFA 4PNPA 4A8JA 2VSXA 5GVSA 4P22A 2KWIA 4Q37A 2HHJA 3JU3A 1JVSA 1KOGA 1L7NA 1SU6A 4BX3A 1NPTO 4B09A 3RS8A 4YUXA 3IGFA 3MWFA 2WG0A 2WYHA 3LZCA 3PDIA 4G81A 4A03A 3QA9A 3EA5A 8ADHA 2CYBA 4DA4A 1T8TA 3BKWA 1RPJA 1DEOA 2UUOA 3ASYA 3OZEA 1H1DA 3KSBC 1W2GA 3OICA 4U6NA 4EWLA 4DLNA 2ZR9A 4XLTA 6CHYA 4C3ZA 3PVSA 5L6MB 4C4OA 5FUWA 2XUIA 4WEQA 1D6NA 5IZCC 5C35A 3IS3A 1PJ8A 1OH6A 2FY8A 2I8AA 3DULA 3OU7A 5ALTA 1CEEA 2Y1FA 3FWZA 1IXYA 4WKNA 3T94A 4J0JA 4BEJA 1LD3A 4LJSA 4XQEA 5K5EA 1II8A 1YDMA 5BURA 3FMFA 1Z2NX 5EHIA 4I9NA 4QTYA 3L6EA 4E03A 1A9XA 5ICEA 1SCJA 4MAAA 2VNKA 1Y3HA 1NURA 2OILA 3KZKA 5LB4A 2EJCA 4AMGA 3KZ1E 4EARA 2QTLA 1DX6A 2WJ4A 2BFBB 4LISA 2Q8QA 3KWFA 1L9KA 3IMKA 1D4FA 2J31A 4N0EA 5DYWA 3LT5A 5J1TB 4TMVA 5B1HA 5DM70 4NONA 3RGWS 4JI8B 2WV9A 2QQ0A 4DPMA 1K5DA 4YMIA 3QE4A 3T3GA 1C9YA 1GFSA 3SJAA 3STXA 1ML4A 5JZMA 2R8ZA 4GZMA 1P2VA 1ZA2A 1ZCAA 2X9NA 3NBQA 4C06A 5A7FA 3MF4A 2DQSA 2QN6A 1JHYA 2DY0A 1V16B 1UF9A 2H5LA 3GLKA 3NLLA 2P2GA 4PYNA 1TJ4A 4XD2A 1WMBA 4DLZA 4C6TB 1ZOIA 4KQHA 1V43A 1K63A 1PIWA 1ZH2A 2C98A 3F0TA 1QU2A 4W8GA 2FE4A 1N6NA 3B3JA 1DUVG 3ZDXB 1IXRC 1U65A 3HJTA 3Q6MA 4ZAVA 1CQJA 5BWMA 4IIFA 2XADA 3JV7A 5HMLA 3ZU5A 3DBOB 3FLAA 3V97A 4E12A 5BPFA 2Q7XA 4ILEA 3S68A 5J4VA 1AM4D 1QXSA 1QRTA 1MU0A 2Q1WA 1L8AA 3GU3A 3WFJA 3ZV4A 4HUJA 2K4MA 5FORA 4H6VA 2B5WA 3D64A 2BFNA 4XR9A 5CK4A 5IN5A 1L7QA 2WNIA 3KZNA 3DGEC 3TTTA 3ZD9A 1W59A 3QW4B 4DYHA 1CZOA 4IDBA 4IIXA 1DXOA 3BOSA 4P32A 2CT8A 1ANKA 1HR0B 3CNBA 4YWHA 2PUAA 2VOJA 4CLXA 2A9VA 4G01B 3JATB 2JNWA 4I08A 5HWSA 3IE1A 3C1TA 4E33A 4DR3B 4AJ2A 4MLDA 1Y5MA 3EGDB 3KM0A 3SYKA 4DQVA 2XLBA 2OHVA 2AT1A 5IKMA 1F20A 1XB2A 3OQNA 2RAVA 1U8AA 2VZEA 2ZATA 3R09A 4FYIA 5L7WA 2XXAB 1KRWA 3A6JA 4RKQA 3HYLA 1P0IA 2I87A 2CVOA 3N2KB 3Q3EA 3PC8A 3QVVA 4Q3BA 2HA3A 4IJ6A 1OZHA 3UMGA 2FXVA 4PM4A 1OAAA 1YBMA 2O3RA 3CXRA 3ETLA 4GYJA 5DBFA 4M49A 1E4EB 4ALLA 4EJFA 5JQGA 1JZTA 4B3BA 1LDEA 1DDOA 1GGNA 5KOJA 2LDBA 1NVFA 2CLFB 3DAFA 1WAMA 5LC1A 2GD6A 2D7DA 1E9AA 3B1WA 4LBVA 3V32A 4QUAA 4A82A 4HTFB 2EXXA 2BE9A 5AVOA 2BMDA 2I2DA 5D1HA 1RLJA 2HUPA 4NV1A 4HN9A 3HWRA 1PSZA 4DSUA 1Q11A 2XJ9A 3GA7A 3BEDA 2QTAA 2WAOA 5PGMA 3VPXA 1TW3A 1UC4B 2CJYA 2A0XA 3QYPA 4R1PA 4P84A 2OHOA 5IEBA 2DXIA 4PQYA 3I04M 3O6VA 3NEYA 1G7TA 4UU1A 1CUIA 4J76A 5A06A 4OHPA 3HNRA 1R8SA 1WSDA 1HEUA 2WJAA 3SN6A 3ZQJA 1IEQA 4Z4GA 3AXSA 1Z7GA 2LCQA 3RE1A 5KTRA 1B2RA 2VJNA 2J30A 2XCRB 2A9KA 4M3NA 3PVCA 4QXMA 4GAEA 2EZ8A 4GHWA 4QUDA 4ZOLA 2NO0A 5K7SA 2NO9A 3ZHOA 5ALYA 3PXEA 1HDXA 2JI4A 1OI3A 1H2FA 1U4OA 2BY4A 2E1RA 3LFUA 1Y7IA 4UDYX 4DCJA 3PJRA 2PGOA 3CNEA 2Y1DA 1A50B 3EIHA 4Q9LA 5L3QA 2F00A 2ODEA 3DEYX 3PNKA 1L7AA 1M0WA 1N2CE 1ZCBA 3RARA 2ZIXA 3NHSA 3QWIA 2A1TS 4UBOA 3EZFA 1PX2A 3K73O 4L02A 4BP3A 5EERA 5L3SA 3ZVKA 1NUQA 1NX9A 2W2KB 5IJ0B 4K81B 1ZI8A 3CMCO 1KI3A 3QV2A 4Q9AA 4J1QA 2R6FA 3EGVA 4ZDIA 1NVTA 1YZTA 4Q1FA 2MINB 1C7QA 1NYLA 5C8DA 5CA1F 2ZRDA 2PVPA 4M0PA 1Q7TA 1DHTA 4WD3A 2REBA 2IJGX 3KSZO 1EFHA 3N58A 4X7RA 2FFQA 3D0KA 3THXA 3FGOA 4MGZR 4CPDA 2PT9A 2OZEA 2W48A 2MSWA 3KYDB 1E2KA 2ZUBA 4HDSB 4MYSA 4RPLA 3ETCA 4ZQHA 2ZI9A 4WLNA 1MPTA 1BRMA 2OCKA 2X14A 4O2BA 4PWYA 1OC2A 1U9YA 3CZPA 1TAQA 3ZQ6A 7MHTA 5D7BA 1T8PA 1JNXX 2HMYB 4ML3A 3JQGB 4MW4A 5EQJB 5AR1A 4YMVA 5JY1A 4PC2A 3DWFA 3L6DA 4DA9A 4B76A 4EHAA 1RJ9A 1CEYA 4YK7A 1CY0A 3AFMA 1BXZA 2FF5A 2YDXA 4TV8A 1YA6A 5J1SB 3IP5A 2W2LD 3SYTA 1JMVA 2PY6A 3CH4B 1ZGCA 1B0UA 2RC5A 4LF5B 2AJLI 4F6CA 1I1OA 4A5SA 1TCUA 2A35A 2QENA 3CR3C 4TKUA 2HWUA 1IH8A 3WQRA 4O02B 1TYEB 1E9FA 4BO5A 1J2TA 4H7KA 1CY6A 2ZAYA 1B1CA 1QVWA 3OIUA 3T1QA 4X45A 1TM5E 2Z6VA 1G8GA 1AKRA 1XZNA 2J45A 5J5VA 3C4QA 1QR6A 1CRQA 2A5FA 2I6QA 5FH9A 4P54A 3ABRB 3DL2A 3MSCA 4FFLA 4P92A 4WK0B 4DNPA 2PJRA 5CPFA 5SZJA 1WTAA 3H9BA 5AKIA 4N39A 1H1TA 4AF8A 4HZIA 1GM5A 1L4MA 4FMDF 2Z5VA 2I6UA 3W8DA 2B98A 1JDBB 4HDAA 2P5YA 3K9LA 4LKOA 3AW9A 4NDNE 3J81A 4XGRA 5DJ5A 2HHCA 3Q0EA 2VYND 1XTRA 4PZZA 4ZYLA 4TMWA 2Q07A 3TGWA 3TNDA 3JQRA 1UP6A 4GE3A 3BXHA 4YV0A 4Z0HO 3MIIA 4Y6LA 1RVDA 4O0LA 2A4KA 3KQUA 3KAQA 5JJIA 4MB6A 3GUHA 3OLWA 3TBFA 3AIKA 1C29B 4WEOA 3THYB 4TT3A 3T3IA 5CDGA 1F4PA 4ZV9A 5GQSA 1T10A 3C5VA 3PGKA 4L0CA 2NU8B 3ET4A 3EXG2 3UHFA 3H11A 2Z3VA 2W93A 4HB3A 2GN9A 5DI3A 2VJDA 3SJUA 3I30X 4UARA 4B4VA 3JQ8A 3MSXA 4B73A 4Y2GA 5JH7A 4BYGA 4TSFD 1CEXA 1BC5A 3JARA 4WVLA 1KK0A 2BELA 4AJEA 4H08A 1XSEA 3ST7A 1Z6GA 1V8PA 1Q7RA 4MUEA 4RY0A 1VLZA 5E1BA 1BKSB 3AP3A 1V7PC 1WV0A 2OHHA 1QFYA 3BWMA 4MEBA 4CUKA 2QNIA 3JD3A 3O8BA 4N5IX 3W04A 4LPKA 3ZBPA 2JHAA 1SCIA 1DIOB 5BMVF 5JASA 5E6RB 4OB8A 4PZEA 3DLCA 3L06A 4EDHA 1U0RA 3U9SA 1OTHA 2VH1A 5HOQA 3R2JA 3FVTA 4ESOA 5KOHA 1D1SA 2ANCA 4ZU1X 5L4SA 3AXTA 2AFHE 3T38A 4BNHA 1JR6A 2R6R1 1QHHA 4KGXA 1XQ6A 4MQFB 1XRRA 5J4YA 5EPUA 1VL1A 4G67A 3MQ4A 4RLSA 4LBWA 2ASVA 2E4WA 2PJZA 1AUVA 1GD1O 1F7VA 3BDIA 1J8FA 2J87A 1CC1S 1H23A 2IXFA 3SSMA 1GCAA 4XB1A 1COWA 1QHEA 1TJPB 3AEZA 5TQ0B 1QHNA 2V03A 5J4HA 2P4SA 2OCAA 3H2KA 4QUJA 2IH2A 1EBFA 4FKMA 3UGTA 3BGDA 5FOWA 1M2NA 4OQMA 3PPVA 5DNYB 2Q0HA 4MPPA 1DIHA 2DR0A 1DUIA 3KOXA 2C3PA 4KRYA 3PXUA 2V7EA 2ZPUA 2DLDA 3LSTA 1HDYA 1TO2E 4UEJA 5F76A 4L72A 4P5DA 3R75A 4AJOA 2ISQA 5C7IO 3TD6A 1DC6A 1XZCA 3CO5A 4X3OA 5KWSA 3DV2A 4B87A 3KELA 3KQSA 4UHKA 4EPTA 3GJ4A 2C5FA 3FOEC 4R40A 3P2MA 4EPWA 1DBIA 1YOVB 4A1FA 5F52A 4CL2A 5GZ3A 2BTEA 4RTPA 2FZ4A 3GROA 3OJOA 3VR0A 3INRA 1DADA 1AZWA 2X5OA 3AY0A 1PYGA 4XQ9A 5JSHA 1KARA 3V2UA 1TZ2A 5CT4A 4HWTA 3I2FA 4I5EA 3WDMA 3H2YA 1RRVA 3OFND 4QARA 5YASA 2OD9A 3FDZB 4ARZB 6GPBA 3WWYA 3JTEA 3PFNA 3SI7A 3TG8A 1RHQA 2OSBA 1ADCA 2PH7A 1ESMA 4RD6A 4RZHA 5HTOA 1MT3A 2E4UA 4HDCA 2FFBA 1H8ED 1VA5A 4A7PA 1COWD 1P5ZB 1IB0A 4PO9A 1IN1A 1LPOA 1FYXA 1LK5A 1V1MB 3OPNA 3PWKA 3KXDA 3EUFA 2NZYA 4G5QA 3WYBA 5EE5B 2YV2A 3ZWKA 3LOPA 3D81A 2G77B 2NUBA 1H9BA 4I7EA 4JJEA 4A8JB 1OIVA 3FDFA 3MFQA 1SCAA 1DTWB 4C4AA 4HLDA 3P0EA 3Q87B 1EFPB 2XDYA 3EUAA 1IN6A 4E5KA 4KE6A 5JXWA 1JUDA 3VVMA 3JPYA 4FZRA 1CUAA 1MN6A 1QP4A 2OCDA 3SBDA 2PUHA 4QOGA 3LCJA 4DF3A 1A77A 3WVNA 2ABWA 5JH7F 5CLLA 1HDCA 3ZCSA 2IEZA 4FC7A 5CJPA 3CH7A 4QOFA 1VL6A 3R0ZA 1WVMA 4UHDA 3AR5A 5CFZA 1B74A 2ZYTX 4MR8A 3AF1A 1P2UA 4EGQA 3ZVRA 4GNKA 2CL6X 5T4HA 1V47A 5HZKA 2IHNA 1ZNYA 2F67A 4JIGA 3AHHA 2ZEJA 3A1FA 2IXAA 4BJ6A 3RAFC 5JNSA 4HDMA 4V0RA 5DYIA 3LWNA 5T6MA 1U8XX 4F3YA 3FTDA 5H70A 3QELB 3QA3E 4GH5A 4ISBA 2G40A 3TLXA 3WS7A 5EWMB 1PZFA 4ZMBA 2Z2XA 1QQTA 1W36C 4Q93A 4MP8A 2Q4DA 1K3UB 4MUJA 1M5RA 2OXEA 3BIJA 1TEHA 5IBPA 3I2YX 1I32A 5A02A 1AG9A 1KY2A 2C54A 2DFTA 4O4LB 4RGVA 2EGHA 1YXMA 3ZE9A 3J7TA 4RHUA 3ILHA 2ECFA 4F4JA 3RVBA 2IKQA 3BFVA 3EY9A 4FINA 4WHMA 4ZHQA 5C34B 1O5OA 5JZBA 2H4XA 3OKFA 3RTGA 2HMSA 3EQ6A 2UZ1B 3EC2A 2Y1XA 4OLHA 5DLPA 1GTL1 3NHUA 4LC9A 4QU0A 2GEDA 3PX3A 4ENTA 4O63O 1W36B 1UBTS 3LNTA 1EMDA 4PCUA 1IBMB 1Q5PA 1O7JA 1T2NA 2J9YB 1AKEA 2WHPB 4KXMA 3KBOA 4P4GA 4WSOA 3SG0A 4KO8A 4F2HA 4YMUA 2QL5A 4B35A 4DRXB 3QBJA 2ORVA 4RY8A 3VAAA 1HE2A 4AYTA 5JS6A 3IQZA 5T6BA 1RI3A 3KQOA 3T9DA 4QLAA 3IUMA 2Y0BA 3CXUA 1LF0A 3DLAA 2JFZA 3K1TA 3WTBA 2HU2A 3R3JA 3P2IA 2SHKA 3T5PA 2P68A 3LVFO 1L7DA 4W7IA 3N9IA 3U80A 1PGPA 4DIKA 1T43A 2GRAA 4DWOA 1E8NA 2YXNA 2Z3WA 2Y1EA 1JGTA 4L0DA 3WMEA 3FFAA 2NZXA 3PD7A 2C2GA 4LGCA 3V7YA 2FQ1A 1Q83A 4DAOA 3A1NA 3QSGA 5F73A 3X2FA 1F4LA 2XZDA 3LL7A 1JYEA 1W52X 1G5TA 4OJQA 4ZTZB 2DPHA 3GA0A 3AY3A 4O4IF 3NS7A 1CY8A 3OEYA 4WBXC 1Z0ZA 4HV4A 1TAHA 1IXKA 1QK4A 1UBMS 1YD7A 2PL5A 3V4VB 2ZS8A 4C22A 4JB3A 5JVDF 3A6FA 1M8JA 3ZDDA 1FIUA 1UK9A 5KSOA 3COPA 2V7UA 3PUZA 3RI3A 4Z4HA 3IT2A 1WR8A 4CV0A 5MN4A 2CL7X 5AM0A 4IIJF 1MIOB 2HJVA 2PZ8A 4WI1A 2X3UA 2GI4A 4M9XA 1E4OA 4OHXA 4IO1A 3VO8A 1I6LA 4H2DA 1OLSA 2YHIB 3GP3A 3HRIA 4X00A 1ABEA 4WY2A 3EISA 2D0OB 2OK8A 3O2JA 4PS1A 3U31A 1O0BA 4CM1A 3L1VA 2FN8A 1RACA 3LXXA 3FPHA 3I53A 2CK3A 2XBUA 3MYYA 1N92A 1IY1A 4RCYA 6PFKA 5HNKA 2QTVB 4LJ5A 3HTXA 1ZKDA 1W36D 3I45A 3IVAA 4B48A 3K09C 1D0SA 4DSNA 5JEDA 2YYSA 2FOLA 1PTJC 3NT5A 2UU9B 1F60A 1VPLA 3KXKA 1RP7A 3FI9A 4IVRA 4MWDA 3AETB 1L1EA 4Z2YA 3B2EA 3KQWA 3DZJA 2TSYB 3RHFA 4D46A 4JLAA 4EG4A 3AYZB 4GBMA 3QLUA 4TLCA 4WNAB 2Q27A 4HNAA 2DPXA 4GXRA 3WOVA 5I3CA 2C95A 4EG0A 1MHPA 1RM4A 2LKCA 1P0MA 1P6UA 5DBGA 1WB5A 2O3TA 5EXEA 2VDNB 4JI4B 3WBKA 3JPWA 1E3IA 2CNWD 4FGLA 1GKKA 3MJHA 2NZUG 4IUYA 1L5HA 4AY3A 3QKTA 3TIIA 1OGJA 1NF8A 5G3ZA 2IBMA 4JQCA 2JBAB 3EF0A 3TEFA 3UXYA 4E1VA 4F5DA 1GPLA 1E6UA 1ZUHA 3CGGA 5HCIA 1BHJA 3DUFB 3HJRA 3QUQA 3IR7A 1MC5A 3FPGA 2ODTX 4CMAA 3H2ZA 2IYPA 3EXFB 4PC3A 4X6XA 2XE4A 4RJLA 3EMBA 3ESZA 3H2GA 4ZOLB 3RSZA 2FQWA 3V2IA 2ZPAA 3ZXYA 2BKAA 1ACLA 4YALA 5CPBA 3P4UA 1C0PA 1J39A 3QVXA 1U0SY 3I28A 3BMQA 5AJHA 3EZXA 3K6SB 2I7XA 3ZIUA 4E31A 4ZYTA 4HQNA 1FFHA 5AXCA 1KNXA 4TRNA 3UC9A 2V8BA 5IYZA 3VSDA 3KHTA 4L15A 2VJOA 5M34A 4FUQA 3A9SA 2OGZA 2LTAA 2G17A 4FFVA 3ETJA 1OLXB 4OLBA 1SC3A 4BEVA 4LFCB 3VR6A 2IZZA 3MAJA 2BMWA 5IU6A 4AIIA 4CKWA 5ICGA 1D09A 2J67A 2XTNA 1EFCA 3CE9A 2VF8A 1YR3A 1JSXA 3DCIA 3K1AA 4RA6A 4UQOA 2IYOA 4U7HA 1T24A 1GVHA 3G82C 3V4OA 3W0LB 4C20A 3UXHA 3PX2A 5EWJA 1YE8A 1EDOA 1FFEA 3BSFA 3G8BA 3N2EA 4YP7A 3T99A 4M8NE 4DR7B 1OXUA 2MSCB 1L7OA 2PVSA 2XRFA 4E1AA 5F1KA 1M2JA 3GJQA 5LOVB 1A8QA 1D8TA 2H9YA 2ZBQA 5FLXA 2WZQA 3O4JA 5TJHA 1KAEA 3TM5A 1BWPA 3KB2A 4HDQB 3VOAA 1NDUA 5CTAA 2HXGA 4J0HA 4DBLE 4REQB 3E05A 1U2DC 4KR3A 4MEAA 3AJEA 1EGVB 2P9EA 2ZWOA 4B2LA 4PZUA 2HA7A 3E2IA 3WIDA 4DDUA 5BSHA 3AI2A 1E2NA 2WM2A 4NY1A 4Q9JA 2GCOA 1U8TA 1JTVA 5HKOA 3MRXA 2A9QA 3RUHA 1G8MA 1P1FA 2P0EA 2XKJE 3KJGA 1P2FA 2WT9A 1UQTA 3FKSD 1KJ9A 2VDLB 3IUBA 2VAPA 5AQEA 3U81A 1J5PA 2AJCA 2R6DA 3WBFA 1VE1A 4EW6A 4FFPA 5KVAA 2ANBA 3P4XA 1N5LA 3K0CA 1EQUA 3JSAA 4X8HA 1C7RA 4EAQA 4EO9A 5DT2A 4EZEA 4MVJH 5LQRA 3AYXB 3N87A 2VUHB 2W5UA 2X2EA 2VHJA 3JQFC 1X1CA 4YRMA 1U3FA 1P62B 2CNDA 1F8UA 3FR7A 2ISCA 4H1HA 2V3CC 1I3OA 2W00A 4LY3A 5EXTA 4C5CA 4C5BA 5E4FA 1A72A 1EESA 4WBSA 5B4TA 4NG5A 1XN4A 1YGPA 3QYAA 3OO0A 4F9TA 5EJ7A 3K6JA 1BH2A 1KI8A 1HDRA 1B4DA 1Z5ZA 1CZHA 1DC8A 2FPKA 4Y67A 4Z5XA 2XW6A 3T8YA 1W0KD 2RH5A 4BC1A 3AFIA 1T2UA 2XKKA 2P4UA 2YRFA 4S1NA 1Z8NA 2VSNA 4XTRA 5MGBA 4KAJA 1VPWA 2X4IA 4YRBA 4P58A 3PE3A 4R5MA 2IZOA 2BJVA 4EW1A 3LBFA 4AN0A 1NLUA 2Z9CA 1F7UA 3JZIA 4MV7A 4HH4A 3FPEA 3N3AC 2XH8A 4LFAB 1N0VC 1CF9A 2G1AA 4OQEA 5AICA 1XRSB 1PNQA 1CF4A 1RXSA 1B3BA 1G2QA 2NV6A 1TPYA 4YGYA 4C0WA 4U8GA 4BX2A 2YCBA 1I80A 4OYYA 4Q6BA 2CFTA 1TADA 3EVBA 1RW4A 4QLBA 1SY7A 3CKYA 4X20A 1TAGA 4NPAA 3LG2A 1ODFA 2GKGA 1GUAA 2JI6A 4QNNA 3ZZNA 1UMBA 4BNMA 1U3DA 3G85A 4LMAA 1W4AA 4OAOA 4BFXA 4CEIB 3PCXA 2WV7A 4BN0A 1PTKA 1UQRA 1GG5A 1RRPA 4UQLA 5JCPA 2QAGA 3JALB 3KHKA 1AZTA 1J25A 1S2GA 2OXFA 4HDNB 5BOVA 1G8HA 3T3HA 3UWSA 2JS7A 4NOKA 1ZAYA 1W5FA 1J2UA 2J32A 4IG9A 4GXQA 3VHXA 4H60A 2ATEA 1ENZA 4JJFA 4Q19A 1NNLA 1R18A 1TF2A 3WGVA 5H3HA 2DAPA 3NTRA 1IPFA 4DHWA 4EG8A 3N2LA 4KYUA 2BWJA 4ZDWA 2A14A 2M2IA 3C5CA 3H5TA 4GM1A 4HEA1 2CLKB 3FWKA 3NFRA 1L8LA 4DIOA 3M0EA 1AGRA 2VZLA 2R4UA 1ETHA 5KOJB 4EG5A 1W30A 4E3ZA 1J2YA 2CLDX 3ZZMA 2A0UA 2D1TA 2A6PA 4LYEA 4OYHA 4D9CA 5BR8B 4QSHA 5DIZA 1FYWA 1YA4A 3TOXA 1M1YB 1HYHA 2H5IA 3JD1A 3MBOA 2OYCA 2XMDA 4TROA 3TPFA 5IP5A 4CFSA 3OEHA 4QIHA 2WSYB 1E9EA 4AJJA 3EFHA 3VA7A 4GZ6A 3C8MA 3OM8A 3GNLA 3F5FA 3ZS8A 1UCFA 3PS9A 4FFMA 5EZYA 3E84A 4IEIA 4L8GA 3L05A 1J90A 3A1DA 3KVVA 4KFTA 2QVYX 4UNQA 3HHEA 4YROA 3ZBTA 1B8PA 3AVOA 4F3KA 1TNDA 1X7WA 5M7EA 2FPGA 4ENUA 1W93A 3I9V6 2GBFA 4DGQA 4FC6A 1G5HA 3PFFA 3A1TA 3HN6A 3MW8A 3CLUC 5T3YA 2TYSB 4MLPA 1EFLA 1TFUA 1VHDA 4LNAA 4Q4HB 4D9IA 5DTIA 3EASA 1VPVA 3GN2A 5FPKA 3GVCA 2AN9A 1QFZA 5DWQA 4JWKA 3LQYA 2FSVC 1Q2XA 2IC5A 3GT7A 4N0PA 2DMRA 3WXMA 3K1YA 1CJCA 1TA9A 4WOCA 3H75A 3EVNA 3KAJA 4NECA 1T6BY 4JHXA 4N65A 1BDHA 4RIGA 5T3UA 2G0TA 3LVBA 5JHHB 1NM5C 4RLHA 1QKIA 1X7XA 2PMWB 3NYRA 3ZDYB 1NP3A 1NUPA 4JYZA 1GKUB 3N3BC 3PNPA 1XD2A 5IT9A 4MV5A 2I7TA 1QUEA 5K2OA 3GZNB 1E3SA 4LVCA 2R65A 2G4CA 2R7AA 3WNZA 4YCCA 4ZT3A 4WOPA 3Q3JB 2XODA 3WA6A 4TV8B 1EAMA 4POOA 3I2JA 3RVPA 4HAUA 2QRLA 4W7HA 3HKBA 1U90A 1U31A 2EKZA 5KYKA 1OV4A 2VJQA 4B75A 3E2MA 4TUYA 1VKZA 3SEAA 1O89A 1ZK1A 5LP6C 4MEJA 1W5AA 3OLXA 2IQIA 2QTFA 2EW2A 4R8MA 2GYYA 1P5JA 3MOIA 4HRXA 2D7CA 3GAMA 4W63A 1YBFA 5DOVA 3S4YA 3BXOA 3ZE0B 2VWQA 3ZJ5A 3HL0A 4DQKA 4ZEWA 4YRAA 1QQBA 3QWBA 1S7GA 4Q3EA 2HBZA 3HZHA 3LBIA 1A2OA 3I4FA 4EITA 3FFTA 4L8FA 4REOA 4H3SA 4XR4A 1HTTA 5A4FS 3D6JA 1P1RA 2BEKA 4OY3A 3E8SA 1KGDA 2P0YA 1VG1A 2H1IA 3VNVA 1IAQA 1XZGA 3LHFA 3E4CA 1JR3D 1ADBA 1AOXA 2AMYA 5KNBD 2WMDA 3DMFA 1XTPA 2A0YA 2PQ6A 5DP1A 4GUDA 4ZVSA 2VJPA 1DARA 3DVRX 1RHKA 2XUQA 4ALMA 2Q8NA 1AE1A 2RAUA 3SGLA 1EGHA 4DZTA 4YJKA 1XAHA 4WCFC 3DBHB 1DMSA 2RHMA 2XECA 5F33A 1MH1A 1MQAA 1OZFA 3V1TC 2FEWB 3BE6A 5AHKA 1HY3A 3C7AA 1DAMA 1BU5A 2WIAA 4DKJA 1YHYA 2MYTA 4ZJUA 3FBWA 3F9CA 1G17A 3KWJA 3P19A 3QOFA 1XLWA 3IXQA 2YFHA 2XRZA 2AE1A 3IFSA 4KRXA 2JJ2A 2FOIA 4ETMA 1U94A 3WDKA 2PV0A 1DSSG 4UUQA 1LVGA 3HBJA 4XWTA 5ALRA 4BVEA 4BKUA 4JB0A 5J2TB 4M2LA 1ZIDA 1M2FA 1ISHA 1Z0FA 3AF5A 1GG9A 1TM1E 3O8QB 4F2DA 2PAAA 3O1HB 5KUTA 2YS7A 3OIWA 4TLLB 3OZUA 2G9NA 1XDSA 3K6RA 3M6UA 3T5CA 1SUIA 3ZXXA 2CL0X 2QTVA 1S8FA 1UAGA 3F6CA 5AW4A 4JUCA 4DTIA 1U0EA 1BVUA 2XNDD 5LP6A 2ZYRA 4U9UA 2O14A 3REQB 3T5TA 4Q3LA 1YVRA 3BS4A 5EP1A 4WZAB 3RKRA 5CB0A 3E22A 3KAKA 3O90A 4AQ7A 5TC4A 4RWZA 3D8UA 1BN6A 3FPAA 2BZSA 1R9NA 2ZRPA 5AVKA 1IBCA 5BSEA 2ECQA 4JA2A 1BCSA 3Q1KA 4JENA 1DC4A 3DT9A 3TL3A 3EW7A 1ZEMA 4B32A 4DLXA 3NHBA 4PVCA 5H4GA 5IVKA 1C2YA 4RWEA 1MJGA 5LA6F 3LK7A 3INTA 2ZDHA 4G8BA 4IDHA 4US0R 2YCLA 3W9SA 3OHPA 2BM9A 5H83A 3L8FA 4HQKA 4RPKA 1QHYA 1U5CA 1Y6ZA 4Q00A 3WIBA 3FGNA 1CDOA 4DT1B 4W5RA 1KQNA 4A0GA 2EX4A 3S40A 1TUEA 2JCVA 2LDXA 2WG1A 4OFBA 2X1LA 2RI1A 4NBVA 4NJEA 5ALKA 3KFLA 3UJNA 5IJWA 1N32B 1B15A 3ENZA 2CK3D 3TM4A 2QG4A 2QTRA 1F1BA 3ID6C 4UD2A 5CVDA 4DJAA 2WKWA 3O7WA 1M0TA 1TAUA 4FFBB 4B34A 4RZ3A 4XVHA 3BB3A 2PWPA 3GRFA 4MUBA 1GPUA 3RSOA 2PS0A 3UK6A 5JQGF 1Z8HA 4YQYA 1DUSA 3SZOA 1FTYA 4L2IA 1V7CA 1YZYA 1TRHA 2O1WA 4L57A 4LG1A 4Y0AA 4CMEA 1FYDA 2OXRA 3OWOA 3ZE2B 2PU5A 1EX7A 3OTWA 4J29A 2VDPB 2DLCX 3WKCA 5HGXA 1Y1RA 3LLUA 1V8OA 1M7BA 1R0XA 4QFBA 5K4AA 2X15A 1H9AA 3I61A 4QU9A 3GOHA 3S44A 4F5YA 4MRMB 2RH4A 3L41A 3VQTA 2AFIB 2L82A 1FW6A 1JAYA 3ABOB 1GYRA 1N1EA 3NTVA 3L04A 2XUJA 3OTQA 4IMJB 4Y2SA 3UOAB 5HUJA 4FN5A 1UUFA 3D4IA 5ILGA 5DTEA 1JDTA 3X1KA 2H5JA 2C3YA 4MOWA 5JAOA 5KCZA 2PMCA 3PQCA 5B7PA 3NFYA 1F2DA 4FNOA 1OC4A 3LC7O 4YCLA 2HRDA 2QNBA 3IDOA 1QWSA 4MNTA 4YUZA 1YR1A 1QHIA 2ATCA 3PIIA 1DX4A 3LHDA 4HGRA 5KSZA 1SO8A 4P0QB 1VLVA 2OT3B 1KDYA 1R15A 3VPGA 2K7FA 1QIKA 2XYHA 3KE9A 1BJTA 4MUHA 1R0LA 5FLYA 2M1ZA 3PNLA 3LM8A 1E6MA 4LXTA 3TTSA 2BFEB 4M9CA 5IAKA 2YVQA 3INYA 1T1JA 1RQ7A 1YFJA 3Q8XB 2OQIA 1F06A 3COZA 3HB5X 3ZH2A 3GRVA 3T1VA 2Z04A 2CMKA 4EB3A 1IOLA 4EO7A 1YB4A 1X1BA 3GRUA 3OCCA 4JNKA 5DGHA 3OWXA 5F98A 2H48A 3RYFA 2AZMA 2O0LA 1P5RA 3GT3A 5IC6A 5CDFA 4PG8A 1L3CA 3L4EA 3H0KA 1YK0A 2A9FA 2APJA 3RHSA 3GJRA 3HXMA 1NDHA 2H2IA 4KITB 2HCFA 2FUNB 5E2BA 3GWGA 5GPBA 1XA0A 1PJSA 2V7GA 3BHMA 5AKHA 1W35A 2IZ7A 4NZ9A 4OKIA 4KZKA 4ND7A 3ZQ4A 1OI7A 4BDTA 5L95A 2Z9BA 4IAOA 1LW7A 1Y1KE 1A95A 2IP4A 2P2CA 2R44A 2R86A 4M99A 4MA4A 5FAXA 2FDXA 5FOTA 2KE5A 2CZQA 3ES9A 3OPYB 3IAHA 1E1QA 1JBEA 2DVMA 3V55A 1VHLA 2HU7A 3PDWA 3GLHE 2Y99A 3FOZA 1YS2X 1T4BA 4NMMA 3DMTC 4PG6A 5FBQB 4ZMRA 3MHPA 2KI5A 2PT7A 3G9TA 3JQBA 4Z7OB 3E6AA 4Q0MA 3N7AA 5EWLB 1XF9A 2B5VA 1J07A 4GO1A 2OC4A 3HLTA 4W1PA 1BIFA 1RADA 1MOPA 2J3DA 4FWBA 1BZYA 3FN4A 4N3NA 3VHQA 1FJHA 1ADFA 4NARA 4YACA 3WKAA 5HS4A 4QQRA 3HRHA 2X9QA 3DMHA 3GRRA 4B9EA 1X87A 3VPCA 4D9JA 2OGSA 1XQWA 2IT1A 1XMSA 5CB6A 3RVLA 1W4LA 1QAMA 4QO7A 4Q9IA 4B47A 4RH1A 1I7SB 2ADFA 2QUAA 4I1OA 4GIBA 3MQFA 3D4NA 2VAMA 3OEWA 2C04A 2IEBA 3WMWA 2QV0A 1V3UA 2YY6A 2CZGA 2GK6A 3F6PA 2CV2A 2BGGA 2GUWA 2ID4A 4L8WB 1TVMA 2J48A 4GPD1 4B44A 3LYLA 3Q3GE 2IKSA 4XYEA 1OAOA 5I9IA 3EA0A 2DLNA 3FVVA 2WOJA 4JVLA 4Z4CA 4RZSA 2I67A 4FIDA 2C5EA 5EXSA 4Q7LA 4M8SA 1M2VA 3NIFB 3ELYA 2AC2A 1X0XA 4NLLA 3WLJA 2VP2A 2GT1A 2QUJA 4B8YA 1RC8A 4OHCA 2BKXA 1K3TA 1S3GA 3U13A 4CCSA 1XZ8A 5L3ZA 4F4FA 4IJQA 4F1JA 3L0BA 2ZXUA 4EEXA 1TQHA 3GGSA 5CK5A 3UEOA 5CBPB 1E2FA 4DMMA 2E4XA 4ID3A 3CN9A 2NVUA 3RGGA 2FEXA 1MLDA 2R6JA 5F9HA 3FVRA 2E7ZA 3D6HA 2A78A 1TLTA 3BH0A 1TT5A 2H65A 2Y68A 2I3GA 3H5RA 4NH4A 4OHUA 4IDEA 4CCWA 2ODWA 3BWDD 4JI2B 4EY6A 3CINA 2C5GA 3QYFA 3G0IA 3CVJA 3LPAA 3KKPA 4K5QA 4MCJA 4MRVA 1UJ5A 4TLEA 8OHMA 2C96A 2BDTA 2X6RA 3GFSA 3ICCA 5ILQA 3KK0A 4IVQA 4ETIA 2LV8A 3RYIA 4IH1A 3FHCB 2POQX 3CS3A 4BNDB 5C37A 3B53X 3ZIAA 1Q91A 16PKA 3K70B 1GPMA 4DSOA 4MS3B 1XCPA 2HDWA 4FJ0A 3SHOA 2A3RA 4U3JA 5AXBA 3VNQA 5ABPA 1JU4A 5JXIA 4J9UE 3SLGA 2HW8A 1XA4A 4K6CA 2UXBB 2BR3A 3FG9A 4ED9A 3COVA 3OZCA 4YYEA 4G5OA 1AU9A 1CWUA 1YR8A 2BISA 4MR9B 2Z2IA 3GMIA 4XOIA 3HCAA 1A5SB 4U7DA 1VRCA 3AG6A 4KR6A 1GAXA 3LHSA 3IP9A 2WD7B 2VHUA 1EVYA 4LHYA 1AGXA 1QHSA 2QTGA 5D6NA 5CYGA 1P77A 1DQZA 1XVIA 1SG0A 2AHRA 2XD4A 2YW9A 2BDUA 2Y8EA 3FLEA 3L0OA 5TPWA 1O8CA 1QZZA 4G84A 5AM5A 4ZT6A 1RYHA 4G0WA 5JJLA 4RW0A 3UAYA 3D8TA 1Z56C 1IK4A 4UCQA 1UIMA 4MMZB 2ZETA 1JQKA 3B8HA 4LBYA 1YS9A 3F46A 3PHHA 2YIVX 5TVGA 5CCXA 1C9NA 2VATA 4GOLD 4PLGA 4OHZA 4CKEA 3HY4A 2ZJ4A 1RKXA 3UATA 2AH5A 2ZYUX 1T13A 3RASA 2JVJA 3S1AA 2CLEB 1B8VA 1U9CA 4YECA 3OJ0A 3KOOA 5EHZA 1KYVA 1UJCA 1KETA 2CVZA 5DHSA 3DNFA 3OZDA 4QZVA 4JLOA 2R5NA 1Z35A 2NU9B 1FTWA 4AG6A 1T9ZA 4F5WA 1LK0A 4RHTA 3ZWVA 3S7TA 3FGPA 1W75A 4D2IA 4XSVA 2QE7D 1WMSA 5J2TF 3ZV5A 3GJ5A 1AO0A 1C3EA 4JJ6A 3PIDA 1SOAA 4RO0A 2VEDA 4ZRNA 2PQMA 4XVRA 3V1NA 4BKMA 1S89A 1SVLA 3VI4B 2F8LA 3FWHA 4CQLA 1US8A 2YZMA 4YAIA 2GUGA 5AOVA 4NX2A 3F2IA 2XYPA 2CV1A 2R6GA 1N0IA 2BSXA 3C48A 5IX8A 2QRKA 1GOTA 1MVOA 1UJ2A 4FDLA 2FPOA 4C0HA 5IDYA 2G36A 1O08A 2DR3A 2Y0PA 2JJMA 3H8WA 4JN6B 3DCYA 3V8VA 5ERGB 1K08A 5KNDA 5KWEA 2IOQA 4L9RA 2JC3A 1RCTE 4QT0A 1QCYA 1TK2A 1UKAA 1F17A 1FUEA 3NP7A 3SJCA 3IOCA 1Q1EA 1Y33E 1ZJ4A