4QXRA

Crystal structure of hsting(s162a/g230i/q266i) in complex with dmxaa
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
182
structure length
182
Chain Sequence
SVAHGLAWAYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTIDRAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLITLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stimulator of interferon genes protein
publication title Binding-Pocket and Lid-Region Substitutions Render Human STING Sensitive to the Species-Specific Drug DMXAA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 51
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qxrA02
4F9GA 5BQXA 4KBYA 4F5DA 4LOJA 4EMTA 4F5YA 5CFQA 4LOHA 4F9EA 5CFMA 4EF4A 4QXQA 4JC5A 4KSYA 4EMUA 4F5WA 5CFLA 4YP1A 5CFOA 4LOLA 4QXPA 4LOIA 4QXRA 5CFNA 4F5EA 4QXOA 4EF5A 5CFPA 5CFRA 4LOKA 4KC0A
chains in the Genus database with same CATH superfamily
3GWGA 5JZSA 1MN6A 3BB1A 1NUHA 4QYXA 5IJXA 2HZ7A 3DP7A 3QVGA 4PAWA 1FFHA 5EL0A 3S1LA 1DQRA 3GY0A 2GK7A 2LXNA 2VDVE 3GRPA 1QYXA 1KK1A 1TM7E 1MX5A 3R8XA 3PX7A 2DU8A 3INGA 2HHAA 4F06A 5KTSA 2OHFA 2MTBA 3I2FA 2WKWA 2IS4A 3NT2A 3V1TC 2ZS7A 1RFGE 1P0IA 1VMEA 3DLIA 4CIBA 4MMZB 2HMVA 1PS8A 4LSMA 1YB2A 4M8SA 3KELA 1WCIA 1X1BA 1Y3FE 3S99A 3ZW8A 1JHMA 3ZCSA 5JARA 1A88A 1PZMA 3HPRA 1HM5A 5CLQA 3TKYA 3OFKA 3ROTA 4HDKB 4K26A 4FSHA 2QMYA 2R60A 3IVXA 3DMNA 3ZIAD 3PE4A 4A6EA 4D26A 5E7MA 3ZY4A 3NU1A 2Z2JA 4AX8A 1Y1QA 1NXWA 3NDJA 4FXPA 2GSWA 3KZVA 5KOYA 1XP8A 2R62A 2X0FA 4HB3A 3TLKA 4MS1A 3VNAA 3WL6A 1B0ZA 2HMAA 4DSZA 1JJBA 4MVXA 1OV6A 3BXOA 1TZ2A 3CIOA 3U61B 1J39A 2GO7A 3F5MA 4KAAA 1P2UA 4HXEB 4YUVA 2AK3A 2D1YA 2OBFA 3E1KA 4HQ0A 4NAHA 4R9RA 5BSKA 1BCRB 1QYWA 1W4BA 1ILWA 4WBNA 1HZZA 3NOQA 2BLNA 1IM5A 2FEKA 3M6VA 3CR3C 5F3RA 5JVDB 4GG1A 1F8FA 2XTNA 1MKYA 3LT4A 2CLHB 5DWQA 4NF2A 4BTLA 4KVZA 4IDAA 5IAKA 3QFRA 4OHRA 3GJSA 3TL3A 4ZZ0A 5JH7F 5DCUA 3OLCX 3CLTD 3VU3A 1QSGA 4G3XA 3NFYA 1XELA 3O38A 4PX3A 3VUEA 1D5WA 3K0BA 3PQFA 2FR8C 4POAA 4UKDA 1AKTA 1G8HA 2FWJA 2PIAA 1PZGA 2HSEA 5BRNA 4YP0A 2ZB2A 5AP9A 4B3DA 3KEOA 1RZUA 3Q40A 4JIGA 2WE7A 1L5NA 3UMCA 4HEQA 3MTGA 4IJ5A 3SS7X 4IJWA 3TTTA 3VR0A 2ZBVA 2ONYA 1L7BA 3ANMA 1Q1ZA 3KQUA 3RSFA 5DTRA 4EFNA 1BJRE 4A8HA 5TB5A 4XGRA 4MUEA 2CUKA 5E7QA 4NH0A 4NECA 1YIAA 5BN5B 4BUCA 1A7JA 2QZPA 3LF1A 4A2PA 2AFRA 1EUYA 1Y9DA 1Z26A 4OJQA 2FMTA 3IUQA 2ZJZA 1EBUA 3P2YA 5HDBB 2CK3D 1IK4A 4ND7A 2RHHA 2XB9A 4YROA 1NBAA 3RUFA 1J25A 2V5UA 3VTAA 1IK6A 5ANRB 3KKOA 5HKAA 4XPIB 3ANTA 4DYHA 1ZRNA 2R79A 1JHDA 1RPAA 3AB3A 3HXQA 1XVTA 3RRZA 5HBRA 4EUNA 1W1UA 2ILTA 1DXQA 1SCDA 4EF4A 3ICVA 3KQWA 1T1RA 4TLAA 2B0CA 5DCWA 2NO0A 3VR6D 3OF3A 3CG0A 3C3BA 1Q2XA 2OD7A 4LRXA 3DAGA 4U5XA 1CLUA 2VDMB 3E84A 3KB2A 2J48A 4HDRB 4HO1X 5FWAA 3DWFA 3WKEA 1J49A 5KQMA 2AD1A 1LTKA 1DIGA 3JU3A 3KT6A 4MMXB 3VR5H 4LBYA 2C3MA 1DAHA 4L27A 4DRZA 3E4DA 2B37A 4OMUA 3NEPX 3DQQA 4KSBA 1O94C 1TKBA 4XQ0A 1SNYA 1WF3A 4JH0A 1RE0A 4RHCA 1G8PA 3RRFA 4Y30A 4E33A 4BVJA 1LB1B 3COWA 3WSTA 3E7FA 3KB1A 1IAVA 1M1YA 1Z74A 4XE5A 4Z2YA 1T25A 4DCNA 4TLEA 2Q0SA 5FWXA 1GPLA 4EEXA 2Y67A 1SBQA 3M5PA 1PQ4A 2IIVA 2PPVA 3ND6A 4GKJB 1H0KA 5BYKA 1SB8A 2WJJA 4MH0R 4DANA 4F0JA 4TLLB 3JRXA 4MDYA 4P33A 4JLOA 4GYYA 4R5MA 4X44A 3N2IA 1YUNA 5B58C 5CXXA 2V7TA 1FFYA 5IYZB 4RGYA 5HIAA 2CSXA 1WMDA 1PKXA 4RORA 4YWHA 3GPDG 4N1AA 4P36A 4ZCPA 3QLEA 4B74A 2RDMA 4UEKA 2HWKA 2XKBA 1UC4B 1TYDE 2PH5A 1OJLA 1ZN2A 4P7KA 5HA5A 4KN8A 5F12A 2B4KA 1UPFA 1WABA 1YDWA 2YIDA 3MJDA 2DY0A 5BSWA 2A1IA 2JBWA 1E1KA 1ZD5A 1DKMA 1O89A 2JIZA 3GD5A 1BVUA 5EEGA 3O21A 4EO4A 1ST2A 2X8JA 4PGGA 1KQPA 1N4DA 3S8EA 3MOGA 3G17A 3HDYA 3AEQB 2ONJA 3IEIA 3SBEA 4E2WA 2X5XA 5AVRA 3CCCA 4QTTB 2ZYWX 4EM6A 1M6YA 3IJ5A 4UJ3A 3LH5A 4Q1EA 4MW2A 1WHSB 4LDJA 3NV9A 5LZ9A 3BXFA 4KO3S 4R9SA 1JR4A 2E4VA 2O52A 1XRLA 2I3GA 3HKBB 3G0CA 2XKJE 1OGIA 1F3OA 3I4LA 3EEOA 2ZPAA 4EG0A 3Q7TA 2BRUC 1EM6A 2RG1A 2ZSUA 4GOLD 3OM8A 2J4DA 3T9FA 5F7JA 2E0IA 3DFUA 1T5BA 2O3TA 1PIWA 1AO3A 2A7XA 4P7JA 1T2AA 2ZIAA 4P8RA 3K0FA 4Y2SA 3BORA 3QE3A 2ZRIA 1F9AA 4GIBA 4KHZA 1B42A 4M3NA 1T3ZA 4NNOA 2H18A 1Z4LA 4NG5A 4B83A 2M9MA 1OBVA 2WJWA 3F49S 3WKAA 1EQ2A 2KW5A 5EWMB 5U1PA 3VH3A 1Z25A 1RI3A 4E1AA 3KHSA 3HJTA 1T3LA 2A4KA 2JGEA 2BTQA 3IQWA 2BD0A 4UEWA 4Z0HO 1GP2A 3LUPA 4EUFA 5C5DA 5HF5A 1XRRA 2FJUA 3HZZA 1LJLA 3ZZTA 3JYOA 1OBCA 2G7ZA 3NP9A 2QTRA 5AW5A 2VT2A 5T67A 1Z39A 4LVOA 3ONVA 4NAVA 4TS1A 3ZDZB 3IXQA 2OQRA 3KOOA 2EJVA 5IJZA 3WZ2A 3CRMA 4B4OA 5EWJB 3ODPA 3PQ7A 5A6VA 4CF7A 3O8CA 3L40A 3PXXA 4ZVRA 4H7FA 4PLWA 4PZZA 4PZPA 3PEFA 3WBKA 1Q20A 3O3CA 5ALKA 4TXHA 2AI1A 2QQ0A 3U7RA 1GGHA 1QKKA 3MBOA 2XCUA 3WYFA 2IEAA 2IU0A 1TAUA 4DZRA 3BXHA 4U7JA 4KXMA 1JPVA 1YHYA 2VDUE 4TROA 3GMDA 5DNAA 1P9OA 1ZCBA 4HB0A 1VPDA 3N39C 4HYEA 3UBTA 1GADO 1BAPA 5K8UA 6ABPA 2RMKA 3U7HB 1Y3DE 3Q3EA 1V5EA 4RY0A 3V97A 2VK8A 3R5TA 2H52A 1T1EA 3AESA 3ENKA 2BE7A 2QP4A 1IC6A 1OLXB 3FCXA 4GM1A 5IJAA 3ITDA 3KJXA 1BOFA 3DBRA 1Y3BE 5FAKA 5JDCA 4UTZA 4E15A 1QPZA 2FLKA 1F8XA 2BR5A 2C29D 1FQOA 3CH6A 2QYTA 4XQ9A 4GZLA 3I2YX 2ZAYA 2OCDA 1RQ7A 1WPGA 1O5IA 4RVDA 5EQJB 1CUFA 5UKDA 5T4HA 5ALSA 3DDOA 2VPTA 4G97A 4KR2A 2N47A 3ONFA 4P4UA 4HXFB 1XRPA 5BUQA 2FB9A 2PANA 2ZS9A 1W52X 4KPUA 1E3JA 4P7FA 1QQ5A 5AVKA 2GM3A 2VLBA 2FW1A 1TM5E 4MR8A 4W6ZA 1NVFA 5AM4A 1CY6A 4BNKA 1GPKA 4AP5A 4UFNA 5MGNA 1QJ4A 4C01A 5T7BA 2XZOA 2DB3A 3QFSA 5DNDA 3K70C 4AZ0A 3E8MA 4MB0A 5JNTA 1JR2A 1XF1A 1G21E 3C3JA 3EIFA 3FDZA 5ECDA 1XCMA 1V9SA 4C4XA 4F4JA 3D0RA 2JASA 1X7YB 2JLBA 1Z7BA 3LKZA 3AL0C 2OAP1 2W2MA 4AX4A 2B1GA 5E1OA 1XAHA 4KGVA 2EARA 4DJEC 4QM6A 1P9NA 4WD3A 2FEWB 3EPPA 1YE5A 2VUSA 4DTCA 4F9FA 3EASA 5MFZA 1EZ1A 3GA0A 3AUYA 3D6UA 1UKAA 4MAMA 1RKBA 5DGXA 3T1TA 1U5AA 3UC5A 4ITUA 4IIGA 2NYAA 1XZCA 2XEXA 3I9OA 1T5SA 1W581 2BP7B 4X8HA 5LA6A 3ZHQA 1SELA 4QU8A 4D3DA 5EGSA 5HM8A 5TNXA 3PB3A 5AIBA 4B87A 3ELDA 1JIKA 1PJAA 2ZW9A 2YJ5A 5F73A 2R7AA 4RO0A 4QG3A 1FSZA 4O33A 5LSAA 2FMFA 2VTEA 2W90A 1XC7A 4EY5A 1QVRA 1MENA 3DXZA 1GCUA 1YK0A 1RYZA 4EFLA 3LFTA 1WKVA 3KT0A 3P2OA 2L69A 1RJGA 5A02A 2IS2A 3SD7A 2VJOA 2PZLA 1P0FA 2H7YA 3ZGZA 4RESA 3HP4A 5FOTA 4YXFA 1KORA 3K5WA 4MKZA 5EJEA 5ICGA 1WBDA 3TQCA 1P1CA 1M2JA 5CR9A 5AVSA 5IP5A 1DOHA 4LC9A 4DB2A 1L7QA 2F62A 3D3KA 1MZPA 1NF2A 4US1R 1H6BA 1YJBA 4J91A 3M3DA 5MDHA 5FHQA 4MKIA 4N3NA 4UULA 2CCGA 3H6HA 2Q3JA 2GFHA 3EPRA 1T1JA 1TZJA 1ZXLA 1RKXA 2YS6A 1X92A 1AKQA 3OIUA 3VPCA 1TRKA 3DHVA 3G8DA 3RIGA 3CBQA 1XR3A 5DHQA 5IM4F 3GLHA 3FUTA 1WSDA 3ZX5A 2EGHA 1SEPA 3CLRC 3NOVA 3PXBA 1I3CA 3PHIA 2Z1MA 1XAJA 2QL9A 4QQFA 2FX5A 3QKUA 1YR7A 1UP7A 3GT0A 4XA8A 5DJ5A 2QAGC 3LGSA 4WAUA 3V46A 3W7AA 4UNSA 5M7EA 1XA4A 5FHRA 1J7KA 3BXGA 2O2CA 1JLHA 2AEJA 2ODTX 2YXPX 1XU9A 4I36A 3AX6A 3QKRB 1QONA 4M0DA 2B7LA 5G3YA 1WLYA 1AQJA 5P8WA 3RUCA 1M6VA 1NQUA 2AWOA 5DTQA 1ZJ5A 4LXUA 1KSHA 3REGA 4CM5A 5D3ZA 3VI3B 3IVRA 4C0BA 1EUCB 4TVKA 5EVJA 3CSDA 2A8YA 3FPGA 1YZLA 3AF4A 4TKMA 2WAOA 3VOSA 1FLNA 2I5PO 2YWCA 3BGVA 4IJKA 3HB0A 3R6LA 2YNMD 3GEPA 1G2IA 2AKEA 1XZPA 4QARA 4RH1A 3REOA 1KEKA 2YFHA 1WCYA 3K0KA 2I6XA 1MAHA 1MEJA 2JBHA 3FFTA 2BDTA 4QSMA 2ZCUA 3TRIA 2R00C 4CUJA 4TKUA 4RPLA 1D7AA 4D3FA 2RH5A 3ITNA 1N8SA 1S3IA 1WPXA 3OZGA 3P45A 1A4XA 4QC2A 5FP0A 3U0BA 4A5OA 1KVTA 4JZKA 5BSEA 5HCUA 3ORSA 3UYKA 4M7WA 3QUTA 1S9HA 1HE2A 3ET4A 4WXYB 3O8DA 4FLEA 1X74A 2ON6A 2XPCA 4ZQFA 1II0A 1LPAB 4JLVA 4ODIA 1XNGA 3EXG1 4X20B 4QXPA 4LA4A 3ORFA 2OZLB 4U2BA 1RI2A 2WLSA 2R7KA 3N2YA 4IIUA 1I0IA 1R27A 2XSZA 5GM1A 3UV6A 1AXGA 3FPEA 3ZLUA 1DI0A 4HWGA 3D1VA 1SPBS 1D9XA 4JGGA 2JB9A 5HVNA 1R2QA 3QF4A 4BMDA 4BOYA 3PYLA 4B7AA 4QOIA 3M70A 1K27A 3P0RA 1T13A 4CKXA 1HV8A 2IBSA 4BU0A 4X64B 1PJ2A 4G5FA 4MV8A 2QR5A 3CO5A 4EG8A 2J09A 3J7TA 4OJTA 3N0TA 1T1GA 3RV3A 2QYHA 3U56A 3AKZA 1D6JA 1TCVA 5C8YA 3UPUA 3CB4A 3G59A 1PVVA 3E05A 4HF7A 1M2NA 4BBPA 4GKKB 4RKEA 5BT9A 5AHOA 4AY2A 3VV3A 3Q1KA 4PYOA 1YKFA 4Z7OB 4IHJF 5FX2A 3GC6A 1ATZA 1LK7A 1PJSA 1ZVJA 2FR1A 3G6WA 1IXYA 3IO5A 4MGKR 3ICQB 1XMPA 3WXMA 2GA8A 5FL7D 4R1MA 2WZBA 4XUCA 3IP7A 3I9KA 4QRDA 4ZOLF 4DCOA 3SEFA 1XZGA 1Y3AA 4GSKA 1PP4A 4LXQA 1G5HA 5GY7A 2QPTA 2A94A 3BWBA 2HF7A 2C04A 1WXGA 1KYWA 3C7CB 3HJHA 3ASYA 1GVNB 1OXKB 1JG2A 3PHJA 4EG6A 3BD9A 2YXBA 3REFA 1E2JA 4OQYA 1C29B 3OPYI 3TR6A 2PA0A 5L51A 1WSBA 5EZSA 3UMSA 3WDSA 4P32A 2CVQA 4FNOA 2XQVA 1B23P 2AOXA 1KO1A 2PRKA 4G8DA 3M6WA 5FYQA 5LBIA 2EATA 5HUHA 4F04A 5JNLA 1QTQA 5HJEA 3BDIA 3SC4A 3MQ4A 3TCNA 1I5OA 1AQUA 3AF0A 4NOJA 4BKUA 4F4HA 4ABTA 1Z7GA 1YFKA 5CDFE 2XA2A 1CCWA 2PCLA 3EZ7A 4IKEA 3BSYA 1H5QA 4GMXA 5COQA 1AVTA 3B1XA 3KKNA 1A69A 2XR1A 4AURA 2J9RA 1FX1A 1ODLA 4B3RB 1UBRS 1KI2A 2ATCA 1XEWX 4AJJA 2AXNA 3NRJA 4B8WA 2QPOA 2B4TO 5BUSA 2VYND 4TPKA 4XOIA 1TEXA 4DWVA 1C8LA 2WWFA 2F48A 4XXHA 4P6VF 4O1MA 4ZK6A 4BNZA 3PTZA 2JIDA 1Y8AA 1JR3A 2KX7A 2PQ0A 1B43A 5DGIA 1P7VA 4L16A 3AFHA 4AXBA 2H4HA 1TMKA 3RSHA 3AHFA 1UFKA 2YWBA 1B0AA 2WDZA 3L02A 2ZPUA 4M0PA 3V8PA 1NQVA 5EP2A 3TI7A 3KL4A 3FM9A 4ZI7B 3DAFA 4S1VA 3KRTA 3PDWA 3IOMA 3V3KA 3FKSA 4QG7A 2COUA 4BX9A 4ZRDA 3CWCA 2HIAA 2FVYA 4IGAA 4DV6B 3H9UA 2RGEA 3CO0S 1U8XX 4V2UA 521PA 4LI3X 1TKRA 2BFDB 2IXEA 2HSWA 3FPJA 4R69A 4C76A 1OVGA 2XUJA 5IHPA 3B3JA 3ICOA 3IPYA 3G7UA 3TD9A 4XDGA 1FP6A 1FXWA 1LLCA 2IY8A 1GDHA 4L72A 3MRXA 4XX0A 2C9YA 2FPPA 2Q1YA 3WK7A 5BSGA 3OMLA 3VKUA 3BMCA 1VSUA 3EWNA 3QVMA 2G9UA 2NZUG 5IFLA 1DPFA 1OASA 1Y7PA 2EFJA 4I14A 5IULC 1VFNA 5JHHB 5BURA 2BJVA 1SCNE 3RJ9A 2JCVA 3NDIA 4YBRA 3T5AA 2D0IA 3CZAA 5A3QA 1RMYA 5KNDA 1XTJA 2R1ZA 4RTJA 5IT9A 3NHSA 1G20E 4WASA 1GGFA 2GJKA 1EFDN 2XA9A 2M2IA 2ASEA 1SUPA 3KAPA 4JDUA 5I7FA 4QO8A 4R7ZA 4FMCB 3Q3JB 5JAMA 1D09A 3TLAA 1E6WA 4JOSA 3VOTA 3IMGA 3AM1A 2QT9A 1H05A 4TMZA 4CMEA 5E1MA 4JNCA 5H0IA 2ZKIA 3HVKA 2RGWA 2X0KA 4X62B 1PYOA 3RCBA 3JXEA 1TO6A 1C50A 1JVSA 3F7OA 7ABPA 3TM5A 4OIMA 3FVTA 3TM4A 3Q7RA 3WJAA 4MW5A 2E9SA 2AJ8A 3VH1A 4AICA 5BN3A 3F73A 1N2BA 3TIXB 1YA4A 1TRHA 2EDAA 3BMOB 2NP6A 4ZCQA 2FSUA 4YJFB 1XQ6A 4Q9AA 5AVTA 2VSFA 5JS7A 3L8DA 5IAJA 3BQMB 1QQ6A 4I9NA 4CDNA 4DR3B 2B9VA 4GT1A 3KLNA 1E32A 4HX2A 4BMZA 3M5DA 4KMMA 4L1KA 4O59O 1RCTE 3V4ZA 1Y1PA 3T5BA 1TCCA 1LPSA 1VPWA 3KJGA 2I91A 2JEOA 1VSBA 1VMKA 5DRTA 4ZVPA 4E08A 4BE9A 4CG2A 2I80A 3E1SA 4IDCA 5LN1A 1EDBA 1G7CA 2JIZD 4PZYA 5ED0A 5T4FA 4DLKA 3KZKA 2DJIA 2R87A 2FZ4A 1ZU5A 5HX7A 3RRYA 2DX7A 1K68A 1BN7A 3X1KA 3U5ZB 1UXGA 4IX1A 4X3CA 3PDHA 2HA6A 1AKRA 2NNLD 1MX1A 4EHHA 4KSCA 4QO7A 1XOIA 1YBAA 2VHJA 3OQPA 1NVWQ 4IDOA 1L5LA 3UM9A 3RTAA 1GGKA 4G4SO 3D6TB 1GEGA 2DBRA 3C24A 5EJ8A 3HYLA 2PD3A 1EVZA 4KHPB 1M34E 3TZHA 1N8KA 3L6DA 1T3TA 2A67A 3ZKWA 1DQPA 3LECA 4FHEA 5KQLA 1KOGA 2DHDA 1BW9A 4ENUA 4RETA 3UCFA 5CEFA 2PZJA 1YVPA 2P41A 1Z5PA 3ZWNA 1EHIA 1OFHA 2XMDA 3NGLA 3FNGA 4QXOA 4FUQA 3RIYA 3VZDA 3SYNA 2DG2A 1AF4A 2W0MA 3UFXB 1XK6A 4QE3A 5J4HA 2L19A 1AS3A 4WZBE 1V2HE 5D87A 4EATA 1S01A 1N0UA 3E9CA 4GP7A 2EKDA 2FSSA 3C1TA 4DA0A 1ISPA 4MS3A 4P5DA 2JLZA 4CCYA 3RVSA 4DR5B 2CVZA 2QTLA 3O8OA 4QTUB 1L5HB 3GEDA 2CWWA 1QOQB 1PVOA 4X66B 1XNHA 2XMCA 1HWYA 4H4EA 1J97A 3LVQE 5JWHA 3AONB 4YRDA 2C95A 4EZEA 3DTVA 3OIYA 2H07A 1NGSA 2JGIA 4M54A 2V55B 1FFCA 4LGVA 4MUNA 1HDGO 4NSNA 4HPJB 1Z88A 4NAUA 3D8NA 1SO8A 2XTZA 4KUEA 4NK5A 1LCIA 3F67A 2QIPA 2QW1A 3K9QO 4I8IA 3WK9A 1QP4A 1OXBB 3WVNA 4MVJG 4XAQA 1NXPA 3G7NA 3NIBA 4JR0A 4Y7DA 1E5TA 2NPIA 2DC1A 3B36A 3NT4A 4FFBB 3O2NA 1N1EA 1O6FA 3Q5EA 4RZUA 4BFZA 2E82A 2JH8A 1CQZA 2WOJA 2XMPA 4DPKA 1BKSB 5AKHA 3GT4A 4RSHA 3QKSA 5TT0A 1ORDA 1Z0SA 4DXDA 1QFXA 1D2NA 3PQCA 3BXEA 4OK6A 4Y98A 5IC4A 1ZIOA 2WD8A 4IZHA 4BXOA 2V7GA 5DRYA 2GJ4A 2BBOA 4R1NA 2QTNA 3CLTC 4C43A 3K3PA 5FNVF 1UOPA 4QOSA 4V1CB 2AEFA 4ZI2A 4A5SA 4IKOA 4IDDA 2ZXEA 2OCYC 3IJPA 3QXCA 4ZXFA 3TVDA 4O0MA 3BB3A 2Q9CA 2OK8A 1JKIA 2XHEA 2P5SA 3IPRA 3OCVA 1MVOA 1NHGA 1FVFA 4YECA 4AT1A 1P75A 2O6LA 1RPNA 1VZ2A 2QRGA 3COPA 2VDKB 3GVIA 3N76A 1NULA 5INTA 3IUJA 1YI0A 5DB4A 1HDCA 4EAQA 4K6HA 1QK5A 2Z1NA 3E3AA 4P82A 4YAFA 4IQGA 4KIWA 1H3FA 4PO3X 3SXUA 5AESA 3WL4A 3ES9A 1GXSA 3B8HA 1T5TA 3H9CA 5CURA 1UBHS 4JLDA 4MSUA 2D2IA 3TJZA 4F9EA 5BSVA 3T4XA 4EVIA 2W6QA 2FZ5A 5LMUB 5KVCA 1SXJB 3LIIA 3SF8B 4KXLA 5IK2A 4LJKA 2Y93A 4FUTA 3VR6H 4HUTA 3LX6A 3SZMA 4DQXA 1U7TA 1WJGA 5JLJA 5JAHA 1RXCA 2PJDA 5LZ2A 1FFGA 1VB5A 4RXTA 4U63A 2QUIA 2D0PB 4R01A 4AJIA 4D6PA 5AVQA 4CDGA 2GPWA 3A1FA 3HV2A 4U7WA 2R1TB 3OD1A 1BD4A 1SOMA 3PUZA 3EY4A 3F97A 3L1UA 3NBKA 3E7WA 1P60A 3KEQA 2MCFA 1N2CE 2ORED 1SBZA 4EWLA 4IV0A 1T8SA 4ZFNA 4EB3A 1QGZA 1SR8A 3L7KA 5BSTA 3D64A 4Q1DA 2OHOA 4HB2A 2HNKA 3KFXA 4PO1A 1BROA 1XDBA 2CF6A 2WWHA 2ZLBA 1ZHFA 2OL4A 2P3LA 1L9XA 3OEEA 4OA5A 2I8LA 2Y1LA 4K03A 4YCLA 5AVJA 4QHTA 3A9VA 5EJ5A 3ZDBA 1E9CA 2WM9B 4JUIA 1J1UA 2AEMA 3BMXA 3F3MA 1CUSA 1IEWA 4HGOA 3ZVMA 2OCAA 3DB1A 3GBSA 2WSSA 3MWLA 1AZWA 3HKEA 4L95C 1GFIA 4JBXA 2P9TA 4WXHA 2A59A 3T5DA 4AWAA 4F2HA 1C1DB 4JCCA 3RH0A 2JD2A 2HRBA 1B1CA 2OV2A 2V4ZA 4X1IA 3CU5A 4JY7A 3AERB 4K0KB 3ORHA 4B47A 4Q34A 4UEQA 2X8AA 4PSCA 2AFHB 2QX8A 3CJTA 1T6YA 1LRKA 2V7EA 1HDEA 5REQB 1YZTA 2C88A 3WWPA 4FWTA 1AA9A 3M6UA 4LXTA 4DMCA 2NVUA 1SVIA 1A2QA 1HDZA 3CLVA 1P3JA 1N6RA 3O26A 1KQ3A 2Q4RA 3OFVA 5ALNA 1ZLYA 1X8KA 1K66A 4BKPA 3OKPA 4ZYLA 3NBMA 3QPCA 4WK0B 5EPEA 2IV3A 2C7OA 3VKHA 1AK2A 3BGWA 5CAEB 3IDSA 2W7TA 1QGUA 5JTUA 5CA1F 2HQ1A 2OAEA 1JT9A 1OLOA 3JVIA 5BQPA 1QC5A 4W5JA 4AC9A 1IL0A 3AHHA 4HAUA 4A4DA 5A9SB 1KHTA 2I6QA 1M6WA 4NRDA 3AR7A 4W5OA 2DFPA 4AXXA 1EA7A 3A4IA 3CJRA 2G7MC 1EVJA 3FHJA 3PC8A 1Z8DA 1GZ3A 4CR8A 4I55F 4L4XA 4ARUA 4ETNA 1CUXA 3CZQA 5TQ0A 1VA5A 2JGNA 2RG7A 3PUKA 4O02B 1T0BA 1LH0A 5A1TA 1F7UA 1G8MA 1K75A 1UJNA 2HQSA 1VMDA 3WGTA 3UATA 5AVVA 2XNSA 4FS8A 5LP6A 5KPJA 4KXVA 2ATVA 4R3WA 4DJTA 3ENWA 3OWHA 3L0YA 1VL2A 4EKYA 2CJWB 1PBTA 2R85A 4H7PA 1JS1X 4RK6A 3L05A 1R8JA 1Z4NA 1DPGA 4CFSA 4OA8A 5JMTA 1RYNA 4E5UA 1OWPA 2XDWA 3H8JA 5CUQA 4EA7A 3G0HA 1GG9A 3Q87B 3RVBA 4A1OA 4GMGA 1OGYA 1CVRA 2B4RO 4O4LB 1GARA 3T3IA 4WBSA 1JSLA 3H2HA 4YN3A 3WTCA 1RJEA 4OHZA 1FZQA 2YKGA 4WFKA 5C35A 3QU7A 4RF2A 1N6KA 4KIUA 2DWUA 3LOPA 1N1MA 4OU5A 3H13A 5E2IA 1SCQA 2J3KA 5JFGA 1CPYA 1G42A 4W63A 3AHJA 4GBJA 5F4BA 1FYEA 3GF4A 3MRTA 4NX2A 1Q14A 2OT3B 3KSRA 1EMDA 1U2EA 3PD0A 5KNCA 2KPOA 4B2IA 1DG9A 2J32A 2P8SA 5JSQA 3VH2A 3CS3A 2C5AA 2IKQA 4KE7A 4MDEA 2X8LA 1JYSA 2POCA 1A0OA 3C98A 3ADCA 3DMPA 1UKZA 3NKFA 5IFKA 1KJIA 1KXJA 1UT6A 4PW0A 4BJ5A 3FFAA 1KOJA 5EZYF 1YRQA 5CDTA 5JAIA 1UK9A 1O4WA 4UVDA 3KB8A 3ST7A 4BZQA 2HLDA 3DAYA 3JALA 5CFZA 1U7UA 1PTJC 1S3GA 4MHOA 4KK4A 4LQLA 5ECYA 1CY2A 2QSJA 3OCXA 1OU0A 2PH3A 4FQ5A 1IY9A 3KV1A 1C14A 2GWRA 5JZBA 1O9HA 4YV1A 4UCXA 4D81A 1FNBA 3ROZA 4D8VA 1J6UA 3PHCA 4FFMA 3NBZC 4E5SA 3BIXA 3T52A 1TCUA 1VSVA 1RI5A 1XA0A 4HWPA 5DBHX 3CTPA 1HMPA 2GERA 4HDKA 4W6QA 5TXGA 3S27A 3M6MD 4X00A 1C9KA 1YVEI 3K0CC 5C3MA 2D3WA 3QTLA 1GRCA 4WKNA 1H3EA 5JI2E 5JYCA 4HDAA 5ERYA 3NCTA 2VWHA 4AJPA 5CDYA 3TQTA 1W96A 4FCCA 4C0XA 2P2DA 3RBVA 1UF9A 3TK1A 1IOWA 3PJEA 4UUOA 3CB2A 1T6NA 1SIWA 4RCYA 4YFYA 4AY4A 2WF9A 3IXMA 4HVAA 2CHQA 1MDBA 1TK3A 1P7WA 5FF9A 5JEDA 4R5HA 1AGYA 5LQKA 3BMNA 1PFUA 3L9WA 3KDAA 4NCBA 3OTGA 5K0SA 3AL3A 4EHKA 1U3UA 4JSRA 2ID4A 5DCYA 1HDOA 2GCIA 2XADA 3RAJA 2Y0DA 4AO6A 4DJAA 4Y6QA 3HBFA 4DJDC 4OQXA 1KI6B 4MVJP 1ZJJA 3E58A 4WDQA 3C3DA 5HCIA 4AUKA 1B73A 1ZGCA 2E4ZA 2JRLA 3U3XA 3PQ3A 2QTHA 4U3JA 4EPYA 4K9NA 4TTPA 3GFPA 5D8DA 1R6VA 2DXIA 4IIYA 3N0WA 1SXIA 4UZSA 5BVHB 1OAKA 4WX2B 2DP4E 1OH7A 2EQ5A 2NU6B 3M1AA 4M0LA 3A58B 4QTXA 1D6NA 1GOTA 3ESZA 5I9BA 3E3LA 3WLQA 1JQ5A 4V0MA 5AJHA 2HHJA 4NEGA 3KJZA 5BN5A 3ZZUA 3D6NB 4G09A 1EP2B 3IPAA 1S96A 2IXAA 1L1QA 1DJNA 1PG2A 3UGTA 3HDVA 2XGGA 2XGSA 3EG5A 1HYQA 1W5TA 2RI0A 1KZ1A 1HGXA 1N2JA 2FUG6 2OAGA 2JFOA 2QTMA 4Q3NA 2PZGA 3X2FA 1PO7A 1Z7EA 3H9EO 1F0NA 4ECAA 5AW0A 1CJMA 1JI3A 4QZVA 2GF0A 4DR1B 4KX3A 3TLGA 3M4JA 1QIJA 4XPIA 5HEKA 1NLMA 2I8CA 4X6XA 5CJ2A 2WUVA 2W6CX 1I14A 1XG5A 1W73A 5C1OA 4XSVA 2JGFA 2DT8A 4C5BA 1DRVA 4CBVA 4H1VA 5DM2A 3TRJA 1J8MF 4AJLA 1PU2A 2DY1A 1KJWA 1BMDA 1KHHA 4G2TA 2RIRA 4PFQA 4QXAA 2IH2A 1J2UA 2BKEA 3RKUA 1BX3A 4ZRMA 3S1AA 1LDBA 2VYCA 1MRNA 4UUQA 2YIJA 3K05A 1J7JA 1GNLA 1VBNA 3FKSD 4RVFA 3H5NA 5D5HA 4B6QA 3AR6A 3O82A 2BYTA 4BQPA 4U7PB 5IABA 4HPXB 1ADFA 2O2DA 3C1OA 1CU1A 1O2DA 5JCJA 2IVFA 2ZG6A 3LM8A 4B2LA 2MR6A 2L42A 3AQIA 3OX2A 2YQ5A 2B8EA 4ZMBA 2HN9A 4F12A 2X0RA 4Z9BA 1PLKA 1VKNA 4TN5A 1OFUX 4AM8A 4MLPA 4MIOA 4AMZA 1L4FA 2Z56A 3I3OA 3LHIA 4OGFA 4YRMA 5JQGF 3CX3A 4JEUA 2X14A 3S2FA 3E7PA 2OXEA 2D62A 4M9RA 5TPWB 2EJCA 1JP7A 3KYBA 4FZVA 1N7GA 1RXSA 3KU1A 5EJ7A 2PZKA 4LDNA 1UPTA 2AC7A 2RAUA 1ICIA 2GBLC 2JFNA 3H8SA 2FPGB 1KMQA 1NAIA 2OR3A 2GZ3A 1INLA 1BWPA 2I7XA 5IYZA 3FUXA 1SD2A 3O1IC 5DWVA 5CNIA 4EHFA 1NBHA 1WV1A 5J4KA 4CIYA 1G60A 4M0CA 4EJSC 4JBLA 3G79A 4UNRA 3C6ZA 4DLPA 2AZTA 3QIVA 4ZJZA 2IX3A 1LSSA 1JV2B 5BN4B 2WKQA 3C6QA 4NBVA 1W4LA 3WR5A 1KGSA 2QG4A 4NFLA 4PC1A 3SNHA 2ZYDA 2D0OB 2GK3A 3DOIA 3ZE7A 2C8KA 4IMPA 4DBLC 2C20A 2DCUA 5LQUA 3I9V6 4UU1A 1RTKA 1NPTO 2VJLA 1P7CA 5TARA 2AMFA 5YASA 1FW6A 4BNYA 4QNRA 3SZ3A 5AHWA 1EK2A 4KH1A 4URVR 4HFMA 5KOHB 3N8HA 1XEAA 2YNMC 1EFAA 1PGNA 3BHMA 1PN3A 4ZCSA 1ULBA 1KDPA 1WHSA 2D4AA 5A03A 5K20A 1NYRA 3SBXA 3CZRA 1NV8A 3QLJA 1OLUA 3HKBA 4WZZA 3FX2A 4ZAGA 3ZE8A 4D57A 4ZYVA 2Z6UA 1DAEA 2C2WA 2W4IA 2ZJ2A 2HSJA 4NONA 2Q45A 4R6XA 1JHYA 2CV0A 2VYFA 1G66A 1ZM4A 4H3HB 4CEHA 3COJA 5DHSA 1L1RA 2GWHA 5D7NA 4BZPA 1OILA 4AJEA 1CE8B 3DOOA 1CVLA 2GVZC 5IN4A 4V0SA 1GEEA 3R75A 3FZEA 3AF1A 4WL0A 4BNUA 1SZDA 1FXSA 1WDWB 2I66A 1DVRA 2IU3A 3H2YA 4K6KA 5LLSA 1FFEA 5EWMA 2AWNA 2E49A 1VHWA 4JCOA 3D02A 2WIKA 4JI1B 1A5BB 1C4OA 3DO6A 2AOUB 5HFJA 3ZIDA 1XK7A 1YRAA 3JY6A 3MD0A 4ZHSA 1RLIA 4F3CA 1UOQA 5K0GA 2Q9AA 3I1JA 3P27A 4NYJQ 3DZBA 2IV2X 2YDYA 4RD1A 1A5AB 1EG2A 4BNNA 5LR6A 1C9YA 1SIUA 4L0CA 3WP1B 2DUUA 4ERXA 1X13A 1PL8A 1BEUB 4EP1A 4QTYA 1YVDA 2Q3MA 2QHXA 3FHLA 4EFMA 4NBLA 5EWJA 5ITVA 1KC3A 2D5BA 2ZTHA 3CWQA 1RRGA 1SRQA 4M9SA 3VHXB 4A6PA 2A0YA 3A10A 4J7AA 3B6EA 5HGXA 2BKXA 4JVNA 4LRUA 2INGX 5JI3E 5ALHA 4AKGA 4PTLA 3I34X 2Q5FA 1K7FB 5FOQA 4Y67A 2BW0A 1E0SA 1ZUNB 4TXLA 4NMLA 1A2KC 5HIIA 1VCHA 1CS0B 1LC3A 5EVCA 3DTVD 4HNHA 4NEHB 3GZTB 1OLXA 3OURA 3K0AB 3KAQA 4DY6A 5C8XA 4S24A 4BX0A 2Y0BA 4JV5B 1Y6JA 3ZDAA 2QE6A 2C2OA 2OC9A 4X3OA 1E3WB 1BJTA 1FX0A 1RAEA 4IZOA 3EVGA 5AM2A 1X3SA 1L4EA 3PRYA 5KNLA 3QWFA 2EZ8A 5L6LB 4EUEA 3UK7A 5SZIA 2Q7XA 2IHZA 4GC5A 1I33A 2M6RA 4GNRA 2GS9A 1V4VA 4EQ6B 4BN4A 3NUZA 2VF8A 1Y1SA 4RD6A 1HZZC 3E2MA 5AKXA 1TVMA 4PYRA 3DD5A 4H35A 5JUWA 2Z8ZA 1QGED 3ID6C 3JARA 1QYRA 3L7JA 1JGTA 4IJVA 4YVFA 1SIOA 4JVLA 4CV3A 4F4FA 4J2HA 3CCFA 3ER6A 2D7CA 4M8LA 2JHGA 4NPHA 4LRWA 5F1PA 4IVRA 4KCGA 1DOAA 1YD7A 1J0DA 2F43B 4ND4A 2FE1A 4PC6A 2GCNA 1KEEB 3AO0B 1Z34A 4ZEXA 2AG6A 3V1KA 3OA2A 2IOYA 4G9GA 1X7YA 2A2ZA 2OMEA 3OHSX 3DBIA 1A4RA 1DAPA 3HU3A 3QEJA 4FONA 3NBFA 1ZY2A 4GKBA 4NE7A 1I3NA 1U94A 4G5GA 4NICA 4UXIA 3VBEA 3HY6A 4EHLA 5TQ2B 2GDJA 5ARCA 1DJPA 2KJQA 1QWSA 3IX7A 4MV0A 3IJRA 5TQVA 3C7DB 1GNRA 2C7QA 3IDZA 3N28A 3WKBA 2ZRBA 3BK1A 3VI4B 3WQBA 3BZWA 1NAHA 2I55A 3FVQA 3CKYA 3LKBA 3R3JA 3WHKA 2BP7A 4GUAA 3E9RA 2O8FB 5IK2D 2ZKLA 4NDAA 4FDAA 4EVRA 4NU0A 1N34B 3U4MA 6CHYA 4I50B 5AQ1A 1NG9A 4OUKX 5E38A 2NLOA 1JJFA 5FL3A 1KEZA 3A6DA 1CB0A 3OCYA 4MRVA 1TF2A 3ENQA 4EW2A 2OFXA 3CEAA 4H08A 2L18A 2FRXA 2Y0EA 2G9ZA 4OM8A 2FG6C 1FOEB 2DSNA 2X19A 1XTZA 2XQGA 3VC7A 2PBZA 2OXFA 2ZJ7A 3CXRA 3HRKA 5DI9A 2JJMA 4UOZA 4PPYA 5CB6A 4O08A 1L3BA 1RRFA 1I2MA 1O0SA 1YUBA 2HA0A 3K1YA 4L9AA 2VT7A 2C9MA 4GPAA 4BWGA 1GITA 1UR5A 1RQNA 4LNUB 3TMKA 3UK6A 4IPTA 1L4LA 3VYVA 4XYLA 4PBSA 3EW9A 1KAHA 3QY0A 2XGOA 5KIAA 1UWLA 2P2NA 3X1YA 5H5JA 5P21A 4F5DA 1JHQA 1TQDA 2D13A 4P5PA 4D74A 2QBYA 1K2WA 3EF3A 1F4LA 1Y48E 2YQZA 3ILVA 4PFSA 4YDSA 4ENQA 5JNWA 1E3MA 1JXMA 4QD3A 2IPNA 1X7XA 1E8MA 1ESZA 2XTAA 2G9NA 1SRRA 1DG1G 2CHVA 2XYVA 3RFXA 4MOWA 5IC6A 1CZNA 4AG3A 2MU1A 1DS6A 1U81A 2AHOA 4LAFA 2A9JA 4R2KA 1KSJA 1XLTA 1U8UA 3PHHA 1X1EA 2EXXA 2B2XA 1PFKA 2PRIA 2O2IA 5AHXA 4JXKA 1Y9JA 4RTSA 1C2TA 2LDBA 3BBPA 1SZJG 3TTVA 4F38A 1DRUA 1W59A 2YYZA 1U4SA 3D8TA 1PF7E 4FEEA 4KE9A 4WA8A 4C06A 4OFXA 3FOAA 5D00A 1ZH0A 4UHFA 1Q7EA 1RS0A 2BEVB 3VVMA 1USWA 4EHNA 3PX3A 4N3GA 2G4VA 4KQIA 1P8AA 2VNKA 3C5CA 2OXIA 4HUJA 1WDKA 2XRFA 2Z09A 3B8EA 1R8YA 3LGAA 4D0LB 1K3UB 2DQKA 1SUFA 2A86A 2HF9A 2R6CA 1H65A 1I4TD 1BHQ1 3NUQA 1HQKA 2JAWA 2ARKA 2FPWA 2H1WA 2RJOA 4J3JA 4RKQA 2O1EA 4U0KA 5EIBD 4NENA 2DR3A 5ER9A 4A36A 4M1QA 4HAOA 4II7A 1IM2A 3ZBTA 4LI0A 4LJ5A 2Q1UA 3KHTA 4JEHA 1NW7A 4UDXX 5LFAA 2RB5A 3CGWA 1WDTA 3AW9A 3B7PA 3OQHA 3WWEA 3F7TA 3KS9A 1W2HA 4M7RA 1OT5A 2XT0A 3FGNA 1HT3A 2VJNA 2DBQA 3IOBA 2PR2A 3MCVA 1DFHA 1MC4A 3BK7A 1XD2B 5LWHA 4AZTA 4KXUA 1FFXB 4X8MA 4ZHQB 2WWTA 3QMMA 2B8TA 3NG1A 2PKWA 2EKPA 1C4KA 1VCNA 4HTAA 4LYYA 5D51S 1Z38A 3IBFA 3UVEA 2OTCA 3I01A 4I3GA 4ZGWA 5B7NA 3AY3A 4MZDA 2CXUA 4ISBA 5DNYB 5IKPA 5J40A 1BDBA 4ER0A 1O6CA 1T0PA 1NLUA 5JR3A 1H2WA 3JQ7B 3H0CA 4NBSA 5JSUA 4HUQA 1R00A 2OZLA 4ARSA 4CQJA 3UGJA 4M7OA 5CCEA 1JVBA 5HNKA 1F0YA 1O9GA 3LSTA 3ZH9B 2NN3C 2VDRB 2I54A 5DI3A 1MEOA 3ZJ4A 1AB5A 1XN4A 1T1SA 5KNCD 2WIAA 3OHPA 3DZKA 4I9FA 4KVFA 3ZTTA 4YAWA 2PKQP 3RRJA 4UM9B 1LDEA 1NLZA 2UV8A 1KRWA 2BE9A 3HL0A 1NXOA 5HRUA 3X1JA 1C3LA 3AR9A 3C5WP 4J07A 3ZU2A 1RJFA 1WVGA 1QO0D 2GTPA 2NZ2A 1QHSA 1CJTC 1G3RA 2HLDD 2Z8YA 4IO1A 1Y1TA 5EMNA 3Q3CA 3C8UA 4GBED 1C8VB 2GEUA 1XQYA 3LY5A 3RVMA 4OHOA 3V32A 2PRSA 4B35A 1XCLA 2ECKA 5KI6A 4DMFA 1N1DA 2HM7A 4CU2A 3I8SA 5FH9A 3FKJA 4DV4B 2ODWA 2NNWB 2Q1SA 1P2SA 1HO3A 3ESYA 5LQMA 1F8YA 4HZUB 1E5VA 4MULA 2V98A 1GKLA 3QM1A 3DZIA 4BNIA 2GJSA 2HW8A 1CX9B 4D99A 4HQKA 2I2DA 1QFJA 1F2UB 4QX6A 1RXIA 1KZ4A 2PH7A 3GFQA 5LC1A 3OCUA 5A6SB 4CL8A 2Y1WA 4LJSA 3BD7A 4PLVA 3VDRA 4I66A 5BY2A 2GM5A 4PX5A 1R6BX 3TYXA 2O2GA 5JDCC 3VPFA 4F6RA 2Z95A 2IYTA 5IVPA 4HI0E 2I4OA 1JSCA 1XQWA 3L6EA 3ZY6A 5KQPA 3T3PB 1J42A 3PS9A 1YR2A 4FDUA 2X58A 1C5KA 3D0QA 1H2HA 3E2IA 5EJGA 5F2KA 4EJ0A 3HK2A 4J1TA 4G0MA 4MROA 3T95A 4H7HA 4GFDA 2ECPA 3N75A 3FJYA 5HBGA 3OZIA 1GPNA 4LOJA 3V9PA 2JAQA 2X8BA 4QAJA 3BJMA 4JODA 2XCIA 4IO0A 3HBAA 2CLKB 2WTXA 3QU9A 1I94B 4YMVA 2LTAA 5CX1B 1CJVC 1V6CA 1ZH4A 4RCVA 2J4FA 3LP6A 5KNBA 4C7JA 4AKEA 1LBQA 4JU9A 4IJQA 1T15A 4Y1RB 1N9GB 4QDUA 3SQXA 1T0UA 4ML3A 1NVVR 2AN9A 1MHTA 2H2DA 4HKTA 3GX1A 4IG9A 2I34A 3WB2A 3CKMA 4DGQA 1N3BA 3P2EA 2JEYA 4TMTA 3N2GA 4HQOA 2WFMA 4K5QA 4XR9A 1MQSA 4BBJA 2GOYA 1UDAA 2WI8A 2F2TA 3BYZA 3WL8A 2VPZA 2VF2A 1GT91 3FF4A 4OBBA 5KINB 2G28A 3DGEC 3EQ8A 3Q85A 1V47A 3E35A 3DAOA 4ATNA 5HKLA 2CNWD 1FS4A 1NY5A 3BF7A 3E27A 3IP1A 3RBAA 4BVLA 3W9SA 3DV9A 5JJ5A 1GAEO 2O20A 1E6KA 4UCFA 2GPAA 4FMDF 4I9HA 5KWIA 3EMBA 2BFDA 4LC1A 1E64A 2DETA 4RXMA 4GQIA 3AM4A 4Z1OA 1XTKA 3GEBA 2X41A 3MCUA 4PINA 2FN4A 3GU3A 1UEJA 1GQOA 1CUGA 1MIHA 1OX5A 2O0KA 4HDNA 4BYMA 3WMFA 5KO2A 4MYCA 4MRMA 2HF2A 1GQQA 3AY7A 3O74A 1SPXA 3UO8B 3ASVA 5D6OA 1QU3A 5GGXA 4BAZA 1ULZA 2W2VA 3TQFA 4YT2A 5CITA 1QIHA 3EVFA 3L1IA 5IKXA 3RNOA 3UJHA 3OD5A 3KT3A 4CETA 2A1UB 2WHPB 2H6EA 2H8GA 4PGHA 1CUBA 1E9BA 1KMMA 2PKCA 2ZSEA 3ECCA 3HYCA 3LRTA 3O4JA 3PR1A 4U7DA 1JSRA 3U09A 3VDXA 3PNVA 1S8AA 3JQCA 1FF9A 1TQ8A 2DVMA 2VOJA 3OPMA 2G8LA 4LHVA 5J63A 2V9ZA 4TSFD 5C0OE 2RCYA 3FYUB 1FCJA 4CCWA 1GSHA 1R4NB 1FB5A 2XRMA 3I01M 3TLYA 2CLDX 4BP9A 5K03A 4NV1A 1GZ7A 2GZ2A 3AIMA 3QVUA 2YJZA 4J1SA 5IEBA 1KI8A 3ZGVA 5F9FA 3BMOA 5KWEA 1Z13A 3FG9A 2BKUA 1CHDA 1N2OA 1HXHA 1P5HA 4ILEA 1C9MA 1FPMA 2H2FA 5J5CA 3TW8B 5FEUA 2FUKA 2YDXA 3H1PA 2FQXA 3AVPA 3BWYA 2GQ0A 4O2BB 2G4LA 2ZWOA 4GX1A 4OYRA 4BVAA 4DDWA 1XP5A 4PYNA 4IF6A 4MYSA 1GPDG 3QLTA 4IDPA 3B1VA 4X7RA 2HADA 3WISA 1JW9B 1RFLA 3HBNA 1BA2A 3EY9A 1SHKA 3RI3A 5FT9A 1G3QA 2P9JA 5CVCA 4BFYA 1HKHA 3FJOA 2NTYC 4JP2A 2W2KB 4W5HA 4FU0A 5H59A 2VHVA 2MIIA 2A0WA 2IYNA 5DNVA 4E21A 3NVKI 3HFJA 5FRDA 2PAAA 3FGZA 4P4LA 1EJ2A 2ZVDA 5DHTA 4FBMA 3C1AA 3AF5A 1Q1EA 2Z8YM 1A9PA 3HWX1 3V4OA 5H70A 3WLJA 1VIDA 5CB8A 5LD2C 1UQRA 2ANCA 3NNNA 5DHPA 4C78A 1NP6A 4CE6A 3CF0A 2VKTA 5H81A 3TUZC 2O5CA 3PI7A 4L2IA 3GL9A 4U2EA 2PX5A 2G71A 5FADA 1PEAA 4KIJA 3PDIB 3U19A 3QI2A 1QUFA 1PBNA 1OV4A 4EG1A 3DHWC 4L76A 3BIWA 4C3ZA 1Z4QA 4KFCA 3QEOA 1Y89A 2DFVA 2WZDA 4RUKA 2PS9A 3B6JA 5HWSA 2QM3A 1H1LA 4G65A 1TCBA 2VP9A 2EC5A 2NUTA 3UFXA 4JBYA 1MZVA 4G81A 2B98A 2GA9A 3OU2A 1UMDA 4OHCA 4C4AA 5CB4F 1TUBB 4R81A 2OENG 2C8LA 3PEUA 3R6DA 2WM3A 3EOAI 3T38A 1UDWA 5JAZA 3HLYA 4FQ7A 4ZU3A 4LSZA 1JH8A 3H97A 3JWJA 3LY9A 5A7HA 1KDYA 2B20A 3ILYA 2ZI4A 1L5HA 3BWEA 2VJPA 2PGXA 6YASA 3HM2A 1R6DA 4G89A 2OBMA 5CT9A 2IODA 2H06A 1WDMA 4DWOA 5CLJA 2IP1A 4N7MA 5AO9A 2VAPA 3GLKA 1FLVA 4GZMA 4FX2A 3EVBA 4EY4A 2HDHA 3ZCVA 1SXHA 1XRJA 3EEIA 1XXHA 2VBGA 4YJGA 3TSYA 4YV7A 1E2NA 3QPUA 4DE5A 3HR8A 5I8PA 2UUCB 3TXAA 1DX4A 1ZNZA 3IGFA 3WYGA 1M0WA 1NRJB 2REQA 1AK1A 2COEA 1YC2A 4O0LA 4WLEA 3TTWA 1EX9A 3LS2A 3UT0A 2NXJA 4UMEA 3IAEA 1R18A 3ROGA 4RK4A 1WUIS 1EXDA 3RADC 1BKDR 3PPIA 5FO0A 1E2LA 3ZYZA 2QT0A 4BV3A 1GUZA 2B21A 4YRZA 3GGDA 2CL5A 5CDUA 2AV6A 4GL4A 3AOEA 4G37A 1JRLA 4C5AA 1Q21A 2LE0A 3K6JA 4FYVA 1YQWA 3I2HA 3HFSA 5E3HA 4PGFA 3ADPA 4IDGA 1S1CA 4V1CA 4P83A 3FIUA 1NBMA 1A9OA 1KH1A 4BU1A 2P77A 3PVSA 3Q1LA 1FSSA 3D7KA 5TRTA 2JG3A 2H4ZA 2G1PA 2O06A 3I42A 3IUBA 4L57A 4ZI7A 2ZJYA 1QR6A 3CPSA 1R37A 2X2OA 2CLEB 4POOA 1EWQA 1CTQA 1LQ2A 2XT6A 1KI7A 3ACCA 3FVWA 3TX2A 2GTIA 3FRJA 1MV8A 1YZHA 3GHYA 1T2UA 3OOJA 2R5NA 2WTNA 1PR5A 4FR0A 1U1CA 1YDGA 3D2LA 1J33A 3L5OA 1BDHA 2P9QA 2BISA 4HN9A 2WU3A 4B4VA 5EP4A 4BFSA 3BGSA 5DN6D 3PFIA 1WNTA 2C7GA 4KIGA 3DP9A 5FD8A 2IS1A 2XW6A 3D6AA 1SXJA 1YKGA 2IUFA 5IF3A 4DC1A 3CNBA 1JDUA 3HEMA 4JASB 1M1YE 4PCLA 5LZ7A 2D06A 3F6EX 4DKXA 2ZI5A 2GFIA 1VLVA 3G89A 2JVJA 2NVOA 3IAS6 4MQFB 5DCLA 1OI2A 2JLSA 3MGCA 3ANSA 4HP8A 4HWRA 1HT2E 3R9XB 1RBMA 2DMRA 4GQBA 1SURA 2R1TA 4JSTA 4OLFA 2V6MA 2WMYA 5ICFA 5JS8A 1UMBB 1KA9H 3FOBA 5AJTA 5J1TB 4UASA 4MUJA 2BFBB 3VAZA 3W8FA 3BD8A 1QHXA 3HSSA 2NZJA 1ODKA 3PFNA 2QUBA 1LDNA 4YRCA 5H83A 2ZTSA 3D3QA 1YBMA 4LBWA 1Y8ZA 4OHPA 4DCJA 4PZAA 4YRPA 1CBUA 2B1IA 4LYEA 1VG8A 5CVJA 4S1PA 3IDAA 1P45A 1U3CA 3W3ZB 1H94A 2NACA 1J06A 1XMXA 1Z5OA 3GLSA 4I4TA 1TPZA 2BZ0A 4J49A 1TX4B 4MWDA 4O8CA 3RIXA 2P1DA 2F3TA 4I5FA 1C1DA 4Y8VA 2AF4C 2HBZA 2OK7A 5ERGB 4F97A 2E4AA 3AERA 1S2DA 4UEJA 3ZV3A 1T8YA 1HETA 1FDRA 4IRMA 1PNVA 4YAKA 3MAAC 4MTLA 3T15A 2FGJA 3NONA 4IGIA 5EIFA 4RFSA 4G0ZA 4P53A 5REQA 3ROFA 5AVOA 3GLGA 2MDTA 2AG8A 2PX8A 3PXAA 1T24A 2ACKA 3AY0A 5IANA 1ZW6A 4GPEA 4CKYA 2C84A 1OLSB 3HJBA 2JF0A 1QB8A 2XE4A 3CKLA 1AOXA 3B12A 3HVRA 2D8MA 2Y6VA 1I80A 1ODCA 1ULTA 4JLPA 1ZSVA 3PNYA 1CV2A 4JLWA 4Q4DA 4U6SA 1E4YA 2F1HA 3B2EA 3R1IA 4XZ3A 3KEMA 5LB4A 4BLRA 3GFGA 4OUDB 3H8VA 4Y9SA 2GZ1A 2KS6A 1PQYA 3A9UA 3ESRA 4N3CA 4X54A 5DT9A 2G04A 5E9WA 5EKXA 5T3YA 3VTKA 4AK9A 4DEYA 4EG4A 4I6EA 4QGFA 2JKZA 4JT2A 4FYIA 5JDIA 3SSNA 2YL2A 3JQ9A 4RY9A 3AKCA 1YGYA 4CMEC 3B85A 1TF7A 4LMPA 3CC8A 3IXLA 1SA0A 2GUGA 3LT5A 3X0DA 4YQEA 2WY2D 4BO6A 1WXHA 3PQEA 2B9EA 2GDZA 1KC1A 5JFTA 1FFBA 5KWVA 2WVHA 4D0RA 3LUDA 2JLVA 4URWR 5L4LA 4G1MB 5JQWA 3N74A 4IYRA 1D2MA 2H48A 2IP4A 4MVJA 5C4GB 3W77A 1W34A 5AUPB 3NLLA 2OLEA 2ZUCA 5LMCA 5I9MA 3FYTA 4MLDA 1ONBA 3LHFA 1E1RD 1J0BA 2IHVA 3D54D 3JQAA 2A9VA 4IXDA 2G09A 4DA9A 1NG1A 1UPBA 4NHEA 3H0KA 4Z86A 2XIQA 3AVWA 1VG1A 1WB4A 1CRPA 2C58A 3QNUA 3L8YA 5JMWA 2RH9B 3EMKA 1M66A 3IBSA 3QVKA 3NEYA 2VNSA 4NBRA 2YXNA 1FP1D 3K15A 3QELB 1RRMA 4UJ5A 3EEYA 3PX2A 5LKRA 2HQRA 3OCCA 3TJRA 1FDOA 1UANA 4KU4A 4ZREA 1GZDA 1SCIA 2WJPA 1EDOA 2BY4A 3C2QA 3ZW9A 4QELA 4O6VA 2AMYA 2OB2A 1BFUA 2YVAA 3NOOA 4GAEA 3A6KA 4X6UA 1JQBA 1ZBQA 3R0VA 5GM2A 2UUBB 3W6NA 1A9ZA 1H5NA 4UTOA 2XYRA 4RF4A 1W36C 3U0VA 1ZPDA 2YZKA 3DZCA 3QA3E 3ZK9A 1E2KA 3E5MA 1ISIA 221PA 4B5KA 2PUAA 4TYWA 1RC1A 2W6NA 4U2KA 1KRXA 1IBCA 3DDWA 4I6GA 4LDAA 5CD1A 3NRBA 4J0IA 4QJBA 1NBIA 1PGOA 1YC5A 3EYWA 4KBGA 1GFWA 2C92A 5G4KA 1XZHA 1HH4A 4OI4A 4KR3A 1E2EA 4HNAA 1ZH6A 2P9ZA 1T9HA 1UL1X 2QX6A 4KKXB 2OQVA 3WNDA 3ZQJA 2HK9A 5AVWA 2PJZA 2BHRA 1XWFA 3BA6A 2ZU6A 1TEVA 5ADVA 2D54A 2GAFA 1E4EB 1MW9X 1XZDA 2IYXA 1XI2A 3K20A 2R8YA 4HNTA 3PJGA 4RTRA 4Q9KA 1XHFA 1FYXA 4H59A 1JX6A 4WNIA 1TZBA 1KMHA 3FDXA 5EHZA 1K8ZB 1KY5A 4E2YA 2O54A 5FULA 3D59A 2CZGA 2IYQA 3IRVA 2WSLA 1FTNA 2OV4A 4E1BA 4MQLA 4OD0A 5K8CA 1ZP6A 2IITA 1X1SA 3IBYA 4ESEA 1LEHA 1EVQA 3C5EA 1EB9A 1J09A 1TYEB 1YR8A 1W47A 1MXHA 4YXWA 2C3PA 3GLRA 2Q5QA 3UOGA 3F9CA 1JDNA 3C6MA 4KSYA 1CQJB 1C3XA 4RSMA 4FOLA 4EBFA 5CB0A 3A9TA 1N5KA 3SS9X 5FBKA 4M98A 4XCXA 3RNLA 1TF5A 3H8WA 4KTVE 1Y6RA 1Z2AA 1XQXA 1DRWA 3PNSA 4TZTA 4RV4A 3BTOA 1DTWA 4UDOA 2P75A 1RRCA 3GDOA 1D1QA 4E5VA 2QUAA 4OI2A 4AS1A 3KALA 2GEBA 2F9FA 1A2BA 1NKTA 2O4CA 3IIJA 2QY6A 3NAQA 1GPUA 5K6TA 3VVBA 5A5EA 1T8UA 4NBKA 1QZTA 1EI9A 1D03A 1M83A 5CEEA 3JPWA 3D6MA 2QW8A 4QASA 3TLBA 1I7PA 2B34A 4U1RA 2HCRA 1JEYB 3ZCPA 2ZAGA 1THMA 3VC3A 1P2BA 1R7RA 3O1JC 3KQQA 4FZ5A 4LJ7A 4R8LA 4EVSA 3DE3X 4PYIA 2E6KA 4W99A 5E95A 5EKUA 5JH7B 4MVWA 1E79A 2UZAA 1B2RA 1JALA 3THWA 1DDGA 1VXOA 1GZ6A 4BTVA 4H1UA 5CTJA 1Q0TA 1W85B 3QZUA 2G3YA 4J0QA 2P6PA 4CMIB 2WTUA 5E4JA 4RWEA 5AHRA 2WKSA 1B6TA 4LOKA 1HNNA 5KNBD 1Z36A 3L1JA 2WU0A 2BKAA 3TTXA 1KQFA 1NF3A 1G8KA 2HEIA 4ZDKA 3LBAA 4UC0A 5FO1A 821PA 3GLHE 1NJ8A 2AA3A 4FJ0A 4ES6A 1JFLA 4CYMA 3MJEA 3OAAA 2AMVA 3DYVA 5BQFA 2PUHA 3GXOA 5FPTA 5HQJA 5KHLB 4WOCA 2LVBA 4IEIA 4RZXA 1N3LA 4QHYA 2R96A 3F47A 1NOIA 4PIMA 3NWBA 3B20A 3OQ1A 4TV9B 3G5LA 5EIHA 5ESWA 5GV8A 4DMLA 3GJ0A 2BEWB 3ZXUB 3NPMA 1EEXB 3U4QB 5JD5A 2GKGA 4JFRA 4IF4A 1L7PA 3LQKA 3OY2A 2C61A 2QQGA 4LWOA 5JFOA 1EGAA 2X3YA 3CUSA 1GIAA 1YL6A 1KQNA 3TX6A 4CF3A 3GJRA 2PFKA 4PX9A 3V8NA 2ZIXB 4IINA 2V9PA 1DMRA 3UGQA 2RONA 4XIGS 3FSEA 3HYTA 1BEZA 2EERA 5F9HA 3PA8A 5AJZA 2IDMA 3F7MA 1NI5A 1EXWA 1E6UA 2GHTA 1LS6A 2OD9A 3Q9UA 1CEXA 5CT5A 5FFMA 1X3LA 5FWDA 3RSOA 3ONWA 2I1LA 2PUJA 3LVBA 4MVJM 1E1CB 5ALFA 2BFEB 5I6DA 4Y1FA 4NR0A 4JB0A 5DGTA 1LZLA 1TYAE 4R8SA 5BV1A 1JEDA 3AIIA 1JJ7A 2F3SA 4HJXA 3GP5A 3UT5A 1YBFA 2VUIB 4LCBA 3WI7A 1NU6A 3OZEA 4BX3A 3G9QA 4OQ4A 2LV8A 3I0MA 1LSOA 1VBKA 2VS1A 4PGMA 4RX1A 5ECWA 1ZITA 5EOVA 2H85A 3ED5A 3LBYA 3TOSA 3ZKAA 2CCKA 3IV9A 5E2AA 3TN7A 3F96A 4BO9A 1U7OA 4Y3UA 5F7ZA 4A91A 5LYJF 4G0UA 3RLFA 3EZXA 1FVHA 1W44A 1E59A 1OFTA 5IBRA 2OO3A 4GECA 2I6GA 3ONNA 4KZKA 1Q1NA 1JAXA 1FVXA 2GZDA 1AD2A 1RC8A 1Q3TA 2XE6A 3BH0A 5TSDA 4K9RA 3WLRA 5EIBC 3Q3HA 3PC8C 5LM3A 1TVCA 4TLDA 2O7NA 5IDYA 1JQEA 1N9KA 3EA4A 2W8ZA 3JZMA 1V96A 4HZGA 5DM1A 3ZD8A 5KOHA 2HZBA 1EP3B 2JGAA 1ZOIA 3RPEA 1EWVA 1PQWA 3GAAA 1Q3HA 5LP6C 3ZWCA 1M8PA 2C4KA 1IOZA 2Y66A 3HJGA 3KZXA 1IHUA 3LPAA 3HXKA 4QULA 4N9WA 1P18A 2A6PA 4DMHA 3FZYA 4JP8A 1U9IA 1ZIDA 5EYPB 1E1NA 1AKEA 3R9IA 4L78A 1QX4A 1YB5A 3U2QA 3IQIX 3WC4A 3EUWA 3OPYB 3F6BX 5U4XA 4D02A 2I2XB 5BSUA 5HOQA 4XIYA 2LDXA 5K6RA 5TMBA 4IWXA 3BUSA 1CE8A 4PWZA 4TMKA 3KUCA 4P2GA 4AP6A 4ZMRA 3OUUA 2R48A 3PP8A 1WULS 2QUJA 2RFLA 3I39X 4ND5A 3HKDB 4NOMA 4UE3S 5H9VA 4XEHA 3KD2A 4D46A 4MI9A 4F2PA 4YMHA 3LC2O 4AZ3A 2H5JA 1VE9A 3M3HA 4DVGA 3TLJA 3HPQA 3W2FA 3CLUD 3V4LA 3ZCRA 3FXAA 2PA3A 4OXRA 3BFVA 1WZIA 4FT2A 1RQ2A 5GQSA 3AI2A 4G4IA 3SHOA 1GZUA 1EHCA 1PZXA 2OOSA 5FPHA 1I7LA 3A1CA 3A37A 4CUKA 2VZ0A 4URHA 4ZIRB 1KNQA 1RYMA 2AJLI 1NUQA 3CNOA 3A04A 3PL5A 1XVVA 4DV0B 3HHPA 2DHRA 2LD4A 3QVSA 1SQ6A 3H5RA 4MKXA 4QYMA 4ZPJA 4XYEA 4EZBA 1Y7TA 1P17A 1EYZA 2ZWIA 5KSYA 1W6UA 2CEKA 2PTGA 4IG4A 5IM5A 5TJHA 3V34A 1EVKA 3LWNA 4OB6A 1DG3A 5FUWA 3VHXA 1SXQA 4FHCA 1JKMA 2QNRA 1WZ2A 1IVYA 5JRZA 5A1JA 1PL0A 2QQ5A 5DHUA 3DOCA 5AFSA 4L8LA 1YZ3A 1EK6A 2HOQA 2HLNA 2NZYA 1Z4PX 4Z9AA 4G25A 4O2AB 3TQOA 1KWGA 2I7DA 1QPGA 4OP2A 4TWZA 1ZUNA 3K1ZA 3FCOA 3H42B 4G5OA 5EKTA 2IWHA 3RQSA 1MA3A 3WNQA 4LOAA 1T9GS 3I5MA 4N0QA 3B3QA 1T2VA 3JAKA 4NY1A 1GR0A 2QTVA 2PUCA 4WZAA 3UC9A 4RLSA 1KTVA 1Q50A 2VPPA 3K0AA 4UBNA 3JTMA 1IZ7A 2PU5A 4C4RA 1DAIA 2BSQA 2CNDA 2CXPA 3LDGA 2A5LA 3AV0B 2EGUA 1JR3E 4UVGA 1J8DA 1WQ4A 2YHIB 4ZVQA 4ND8A 1B2LA 3NHFA 4YMGA 4DL9A 2BGUA 3LE8A 4GP9A 2O8EA 2LCIA 1Z0DA 1QVWA 4K9LA 4TXMA 4CM7A 5JYEA 4JIMA 1VJCA 5AKIA 2WV9A 3S5UA 5DLPA 4F3RA 3INNA 3IR6A 4C9BA 1OZGA 2AW3A 2HU7A 4L6IA 1WTAA 3OZBA 4KXXA 1DXYA 3FE2A 3NTXA 1GDDA 5A3JA 2P3QA 4OJMX 4X5OA 4ZCTA 3RUPA 1ORWA 1QIFA 3FCUB 2AT1A 1V1RB 1XZQA 2A1TS 2CJXA 1KJ9A 4LZZA 3P2IA 4AJKA 4EYSA 5BW5A 1RACA 3MFYA 1JYEA 3N0XA 2F43A 1NBMD 3OFNA 1K9SA 5JMPA 3U1BA 1UWCA 5JMOA 1OH6A 2YMLA 4HATA 2GM4A 2VQ3A 5ECGC 1IHDA 4L3VA 5AKKA 1GUYA 3JZDA 5G1OA 2YYSA 1IRXA 3GFSA 4QOEA 2OVBA 2PNFA 1V1MA 5TQ2A 3IAM1 2IEDA 4QT4A 1XKTA 5AW8A 3LVRE 3S5JA 2FVXA 3HZRA 4PC3A 3WL3A 3EBOA 3F1LA 4K28A 2ZR9A 4TS4A 5HS6A 5J5VA 1PUJA 1M2FA 4IFBA 2QRVB 4GWGA 1A8HA 2LKDA 3HNPA 5FR1A 4OBEA 2FEXA 2O8FA 3VQTA 4JOQA 2PFSA 3ZU3A 4A2CA 5DIZA 1KFEB 3VSDA 4DQUA 2VDNB 3KUXA 4Q18A 1EAYA 4I50A 1M2KA 2XNCA 5BORA 5C1IA 5JJCA 4JDPA 3H4TA 3GZJA 4IOJA 4B7CA 5ITZB 2NO9A 3C6BA 5HRCA 2FZLA 4FFOA 2M6LA 4B6GA 4K6CA 1E9DA 3LU1A 3CISA 3C3CA 4K3VA 1DRKA 1QP8A 4TM7A 2GD2A 3QVJA 2O23A 2QUHA 4MW0A 4QSHA 3ZWPA 1NE7A 4OX9B 1UPUA 1XMIA 4LNUA 3KL2A 3EUFA 1P1BA 2GEJA 3EN0A 2O5RA 3EAFA 4WNAB 4X97A 1PJBA 3MFQA 4IILA 4ZOAA 4LVUA 1NVUQ 1NW9B 4NZZA 4RVUA 4TKVB 2XKAA 3JSAA 4RY8A 3MINA 2R2AA 1E9FA 3FWPA 1NNLA 2P0AA 1FMJA 1FMCA 1JI0A 2G88A 3EBLA 4JEIA 3ZY5A 1UJBA 4CCAA 1LDYA 2HYDA 2J9FB 4KNWA 2VP2A 1DC5A 1Q7RA 4O4IA 2VJBA 4A0GA 3INYA 4BJHB 2QAIA 1N6HA 1PJRA 2O7RA 3U1VA 4P4SB 3WLMA 4XGIA 4M1TA 5CMLA 3RS5A 3WA6A 4BVBA 2H1IA 4KMRA 4L7QA 2FSIA 4KEAA 5JRDS 3LUFA 2CJFA 3G02A 1H0SA 4QJ4A 5J4LA 3HB1A 3FTQA 4N49A 4C7OB 4PV7A 3CGGA 2RARA 1JXQA 3H5WA 3N2LA 3WGKA 3D4LA 1Z06A 2J3MA 2M32A 3BXZA 4RDCA 4E4RA 4DDUA 2IEBA 2F3UA 3P5BA 4MB6A 5BPFA 2B5WA 2W6ZA 3LOQA 2D1QA 4EEZA 1EHYA 2D1SA 2EX4A 2FWAA 4KUGA 4E12A 2D59A 2ZQYA 4OL9A 4UD6A 2DBYA 3QWIA 5I7AA 3IT3A 4ZZ1A 1F1JA 2IYZA 3A28A 1BQ3A 3DFMA 4OL0A 3WGGA 1J9GA 4NCAA 4M1ZA 4R1LA 1WUJS 1DV2A 1HDYA 2Y1KA 4CF4A 4ZYYA 4QJIA 3T3EA 3ZNOA 1OI4A 4RLHA 4MTCA 2B4QA 1UC5B 1EUDB 4ZDWA 4D5EA 2EYUA 1R12A 1UBMS 3QPBA 5CIWA 5K5EA 3BDAA 1RMTA 2YRFA 1PEYA 4F4DA 1YHZA 2ENUA 2O50A 2WFAA 1USKA 3N8DA 4NYMR 2DPHA 4CLEA 4YCMA 1LLDA 3W2HA 4NULA 2O0HA 3CA8A 1WF6A 1S3SA 1XD2A 1XT6A 1JFFA 3NM5A 4RJJA 5TF4A 1FFXA 2G76A 4MVJD 5KSOA 1J8VA 1LV8A 4WIAA 3RVJA 1RM4A 3AILA 2E21A 3V7FA 3LXUX 2X1VA 1I3KA 3IR7A 1Q7CA 2LCQA 4EPXA 3GLFA 1RAFA 1VECA 3AZPA 2YUTA 4FEGA 3QBTA 1AE1A 1N9ZA 5EWLB 1WEKA 5DT2A 2VATA 4FN5A 3ESDA 1PJ8A 2Z2YA 4KVAA 5A4MS 2CL6X 1GZSA 4UUAA 3D6FA 2WIFA 3IVGA 5ALGA 1ODJA 5F2OA 1LK5A 4W8GA 3UUFA 2QMZA 3KJIA 3EEFA 2FW7A 4YUZA 4U2FA 4HGYA 5IMSA 3Q5DA 1VLJA 1B41A 4G9EA 4FCTA 4WACA 1NNUA 2BBSA 4BCCA 1L8OA 2F3PA 1BMTA 1RC0A 3ETCA 3KWFA 2QI9C 1HDXA 2RBEA 4YHHB 4QFBA 5HIJA 3DDZX 3PGKA 1XDGA 2JIOA 4YUYA 1ZJYA 3AEKB 3FZQA 4IW3B 3AVTA 3DLCA 5FTNA 3AGQA 1GYRA 4HH3C 2J0QA 3GV0A 2BFAA 2JPDA 2ILVA 2PFGA 2WJYA 5FOVA 2OG1A 4OSEA 4RM3A 3K4HA 3GRCA 4IAOA 4OH1A 5CCBA 3JWPA 3PWTA 3TTSA 1G2PA 1V8FA 2RHGB 4HPWA 1UBFA 2Z0MA 3M6FA 4WLNA 2E4XA 1YR6A 1F2VA 2C2MA 4HRAA 3CNEA 5KJFA 3RSZA 4EB6A 1T2EA 1P7YA 2WMNB 1VSQA 4XFKA 4CFZA 4LUCA 4YJ2B 5MHTA 2ZRCA 4QUHA 3ZWVA 3C6KA 2CLIB 3VGPA 4AZSA 2DPLA 1GL9B 3EZ2A 2V3VA 3FWKA 3RHFA 1F14A 3DUFB 5A0TA 4E94A 5LDHA 5JPDA 1Q1GA 5AJVB 1SWWA 1WTCA 2J9GA 4C3VA 2KBFA 1AQYA 2ZBQA 5LZ5A 3CMCO 1F2UA 3IILA 3NHMA 4FGUA 2X86A 2ZJ4A 4MV4A 3VYRB 3HNRA 3QEMB 3TPFA 3LNCA 3N58A 4XH9B 3GJ7A 3SK0A 3L7CA 3I92A 1AS0A 1W29A 1WE2A 1P4JA 1JTEA 5SV2A 1P31A 2F8LA 4N7JA 3H05A 2VWQA 3KSMA 1Y5MA 1Y7IA 1YDMA 2CKMA 4RADA 3CPEA 4AJ1A 5G0UA 2OHVA 3ETNA 4YXWD 4ZO9A 5C46F 3H9GA 4GXRA 5EMJA 1WCV1 2WF6A 2ZIZA 1CUVA 3EXIB 4WKOA 1NT4A 3HC7A 4A6DA 3F4KA 5BWMA 2PYIA 5LXTA 1RE1A 3FZNA 5SYMA 4HDMB 1FRZA 4BMXA 5CX1A 2GXAA 4ETWA 5IUKC 2GPYA 5C5IA 1T36B 4OXXA 5L7TA 4MO2A 3DTTA 1M6HA 3H2ZA 3B48A 3OOYA 4PAQA 2XDQA 1L2TA 4QXQA 2PK3A 2FN9A 1QCZA 2ZVQX 3ETHA 3VUFA 3ZHOA 1RHKA 4EHJA 3QE9Y 3IDOA 3K9HA 4WI1A 4V3BA 1JFVA 5LQCA 2ZFUA 1JDBB 2F8SA 1U2DA 4UQPA 4FZ3A 4G86A 3NRCA 1KJ8A 1EZ4A 3FAZA 3SXPA 1KKLA 2FPLA 3UFBA 2G63A 1R10A 2R5FA 3RG2A 1XSEA 3AVOA 2PXAA 2HMSA 4BC0A 1XHEA 4P5EA 1KKUA 1QGAA 2CD9A 4N4AA 4PQEA 5DP2A 5CFQA 1ZGZA 2I7CA 1LBHA 3NMUF 2PIDA 4R05A 3HRIA 1V5GA 4EI2A 2WIBA 2YFKA 121PA 3FWHA 4ZN6A 4LK2A 3TW6A 1NRXA 3A3PA 5IVHA 2ZSJA 2FW8A 3QYJA 4PCVA 3NKLA 1P19A 1PR4A 2GZHA 2HJRA 4EOGA 5HZMA 5KMGB 3NEAA 4L7VA 3SU8A 2BZSA 1NFRA 4F7WA 3MS2A 2CJPA 3HFRA 2QTCA 1MOPA 3Q0EA 2X0DA 4BFVA 4OFZA 3AF6A 3UUGA 3B38A 1F6WA 2B0JA 4YCSA 3O4FA 5CVTA 1H2AS 1CVIA 1KY4A 2JEZA 3AFMA 5F1OA 3SBDA 2WD7B 1XCGB 3QXHA 4ICIA 2K7FA 1M2VA 4J8PA 3V8VA 4N5MA 3UCEA 3TEFA 3AUTA 1DJOA 1RRVA 3JQBA 3DH0A 4RQUA 2I4IA 3SXJA 2V03A 1HLGA 3FTCA 3WSWA 3C15C 3OIFA 4FTWA 4C21A 2EIHA 4HSEA 2ZAOA 1F51E 3ZPXA 1G5RA 3E9EA 4CFYA 4F86A 1XV5A 2YHAA 4TTSA 1JE0A 4MKFA 5H1YA 4L6CA 4G1EB 1XZAA 1TU4A 1YT5A 1WMSA 3CJQA 4V02A 1AHNA 3IEPA 4BNWA 1ZSYA 2MR5A 2QROA 5LNK1 4R1TA 4TRMA 1NF9A 3NIGB 2HTFA 1M2OB 2JHAA 1LPNA 3E22B 1N6NA 1TXGA 3V2HA 4L85A 2C07A 4NCNA 5GONA 4BMSA 1R4NA 3TOCA 4DQVA 4RTMA 3RM3A 1MDFA 3I62A 1E8DA 5LYJA 1XNJA 3L49A 1F1BA 2H2AA 2FSPA 1JPNA 1OBOA 3EWSA 3W04A 5AH0A 4CG0A 3GJXC 4EYEA 3TW8A 4HRXA 4AB1A 4IUBS 3TQIA 2J0VA 5DEIA 1P0QA 2HJSA 2VAXA 4BQQA 1M76A 1DT3A 1L8LA 1U8AA 3B1WA 1ZGHA 4EJFA 3A2KA 5K3FA 2N1BA 3NTUA 4YPFA 2EFDB 3IJEB 3MWDB 1CZRA 4ESOA 3PUVA 2JLUA 4IVPA 3EXHC 1YMVA 2B4AA 2FUCA 3PE6A 3R20A 4MA5A 1U0RA 1V6AA 5D84A 4YP7A 2HT1A 2UDPA 2QE7D 3D8HA 2EU8A 4ZVTA 5A3SA 2C5EA 1DEXA 3K31A 2Q2VA 4OX9Y 2O8CB 1BJKA 1DSSG 2GEFA 2EW8A 1U90A 3GUVA 1AV7A 1JMKC 2A5YB 2FP4A 5MFPA 5K3CA 3CR8A 3LP8A 5EHQA 2CHUA 1ZA1A 2VHEA 2GAJA 5CFMA 5DISB 2WINI 5B3JC 3QXGA 3TPZA 3TFQA 3DC7A 1NXXA 2Q27A 3KIPA 4RWZA 3CWZA 4G9BA 3R7DA 1C8KA 3NALA 2XUQA 4R2LA 1L4BA 4D9JA 5DE3A 3DTNA 1A97A 3FYSA 2W58A 1OQAA 2QRPA 4EUSA 5M2QA 1CR2A 5KTPA 1WOYA 1YR3A 2IA5A 2XH8A 2GYVA 5FBZA 1UEIA 2CF5A 3OT1A 2I2AA 3TCXB 3R3SA 3TLEA 3VMFA 1E8NA 4MI3A 3AJEA 1TQHA 4P9NA 1X94A 2ZT5A 2R6FA 1E2HA 1KETA 4HN4B 4OHWA 2RGUA 4O4LF 5KSWB 3J81k 4NBUA 1SUCA 4DLUA 4B3SB 1U9YA 2GD1O 5E6UB 3C43A 4PS1A 3I5XA 1WD7A 2VG8A 2ZATA 4F3KA 4XWOA 1BS9A 1CY7A 2Z3WA 1D4ZA 3LDUA 3PI6A 1QRUA 5ALRA 2CGEA 2QTTA 1TW2A 3L92A 1TUGA 1M8FA 1X39A 1KMNA 4URXR 2TMGA 2REXB 4NH4A 3STUA 1VP3A 4QLOA 2IF0A 4OHFA 5CJJA 4FE7A 1D6MA 2QLMA 1SBCA 4DOMA 1IFXA 3KAJA 4V0ME 3N07A 1ZG3A 5KPDA 4CTMA 3VSBA 4MUIA 1KPIA 1T3HA 3HY3A 3QTBA 4JA0A 1X87A 1XLWA 3M1YA 4RV5A 4YLEA 4PY2A 4GSYA 3BFJA 4B4KA 3LGXA 2Q0QA 2XWPA 2YHBA 2PPLA 4H1TA 3WX0A 3V55A 4Z9YA 2Q3HA 2Z5FA 4JWTA 3PKZA 4LY0A 4YA6A 4DYVA 5CM2Z 5JBQA 3WZMA 4JBNA 2UVPB 3O6VA 2QK4A 4OHUA 2PL9A 4L0QA 3JQ6A 3OQNA 2RKOA 2VL7A 2Z5LA 4GX0A 2QM7A 5THQA 2NU8A 3IAXA 2HMYB 4MUKA 4PHGA 1PZHA 4JT9A 2WG2A 2YYYA 5JAOA 1MHPA 1OCEA 5EE1A 1FNMA 1VPEA 1Z2CA 2QRMA 4V0NA 5DNCA 3S4YA 2B3DA 2FMXA 3R7FA 5FBVB 2KQUA 3AKEA 4K9PA 3V8RA 1ABBA 5C8YF 3R3YA 4Y6GB 2VJYA 4Q48A 4KLRA 2QVGA 1I4LD 1DTSA 1Z0IA 3Q5GA 4DLWA 3C5HA 3TLXA 4J1TC 1GY8A 3AP1A 3NAGA 2O1WA 4ACAA 1U1DA 1MR3F 4HVTA 4Q39A 1KARA 5KOJB 1ZXXA 1G3UA 5FNVB 4CIVA 5COAA 5DASA 3C4VA 1GN9A 3BTVA 2QX9A 2C5GA 1Y9ZA 2WJHA 4L8VA 3PC6A 3S8MA 1CQXA 4X3PA 4GR4A 1P4GA 4EW3A 3KZMA 4A8JC 3FOZA 1DOZA 3MM4A 3EMDA 4QYIB 3OLQA 3KZCA 3Q8WA 3VYUB 3ZDEA 3P1JA 4ETMA 3ISTA 4M9QA 2QVBA 2BT4A 1B00A 3G1WA 1UIRA 2IYUA 1T5HX 3EVEA 3G0IA 4O4JA 4EJ6A 1YQXA 2KM1A 3JQ8B 3DEFA 2AEEA 5DYWA 2BBTA 4IOKA 3GCGA 2VDPB 1F2DA 1RAAA 4YRLA 4FI3C 5HM6A 3ASZA 5FJIA 3I28A 2IUUA 1GFZA 2YXLA 1L5KA 1HORA 3QK7A 4HTFA 3B1YA 4GLBA 3R5FA 4KLZA 4DCVA 4ENWA 4XTCS 2C59A 5AXAA 2UXCB 1QIKA 1VIVA 2B3TA 3M4XA 1EPUA 4Q4CA 1IYZA 4GVPA 2PMWB 4M9XA 2W6IA 1R15A 2FPXA 4PCAA 3KKKA 4C87A 2Z2KA 3HVHA 3DJFA 4H6PA 4R0NA 1LNQA 1E3TA 1S2GA 3IERA 1C30A 5TPZD 5E3JA 2NYUA 3SKXA 4DQKA 2ORYA 3GDHA 5A0VA 2CV2A 4DFDA 1A9XA 1DXOA 4MV6A 5EY5B 1S0UA 1Z6YA 4BUZA 7MDHA 3HUUA 4AJHA 5CPFA 3TFWA 6PFKA 3OKCA 4YUAA 1SVWA 1TTPB 3S44A 1EE9A 1PWEA 3GG9A 3O4IA 3GEGA 2DBVO 2IPXA 3AF2A 4J0JA 1T6ZA 4FGKA 3AUUA 3W4JA 3LT2A 5K3AA 3WBFA 5IEJA 4KBFA 4X65B 1Z6ZA 1ZICA 2G5CA 2YOHA 4RGBA 5A62A 4KNVA 2WA2A 5KAPA 4HGNA 5KQRA 2HNBA 2WABA 4IQ8A 4QVKA 4OUDA 5LP1A 5BMVF 1H2XA 1YJ5A 1ADGA 1CQIA 2V59A 3E23A 3OVMA 4PHCA 2ZRLA 1C3EA 4YALA 3MEQA 3LWZA 3SLRA 3MTJA 5TIIA 4JC0A 1I2CA 2BR4A 4GHWA 2AJCA 4PO8A 4YJHB 5HTKA 4ARCA 4OFBA 2G17A 4FOPA 2WFLB 5BSMA 1GV0A 1CUWA 4C7OA 4URZR 4AVYA 1V3UA 3X44A 4R9NA 3G9UA 3UUEA 4B3MB 4OFWA 4BB5A 1UXKA 4KPYA 5ER6A 4CKZA 3IODA 2HJHA 4TT3A 1QBGA 1W88B 3UAZA 3JWGA 4TMYA 5CA1B 4W5TA 4PLGA 1UPCA 3HZOA 2UZ1B 3HCWA 4PPFA 3UKDA 1YS7A 2WPDA 5CP8A 4DV1B 4PQYA 1E7WA 2Q5JA 2X0NA 1XKLA 3PL1A 3MMZA 1G21B 4RELA 2M98A 3DAPA 5GOZA 4I55B 3CPHA 2PKXA 2Q62A 2AG5A 1HYBA 5SZKB 1N25A 3W2GA 5HUQA 3AVXA 4JYZA 3LD9A 5DBFA 3T7RA 2I62A 3EXFB 4DIEA 1M75A 4X1KB 2YWXA 1VI5A 2ORVA 3EDMA 1XMOB 1D07A 3D9QX 3AJRA 3UK0A 2ZTMA 2Q7OE 3S6JA 4AIRA 4UTRA 4DIOA 4I6JA 3EDOA 4TRNA 1JNYA 3CLUC 4UAUA 1QUEA 3PFBA 1I9CA 3O4VA 4Q37A 2O4UX 1K9VF 3RTEA 4RPGA 1FYFA 1H1TA 3M2TA 1ZAKA 3OEHA 1F0PA 1NTRA 1T4GA 3WDKA 2O8DB 2CZQA 5DULA 4M8KA 1Q95A 4NS1A 3MQ2A 1C80A 1TD1A 1EEHA 1Z0AA 3HXLA 3EF0A 4RANA 1FUEA 2CVHA 2P4QA 1D2GA 2E6UX 2FPUA 1NVBA 3U4CA 5G0WA 1K6EA 3MTBA 3D0OA 3ILSA 2GR9A 3A1WA 2SKCA 2CHEA 2EVWX 5LQSA 2X1HA 3COZA 3OETA 4IV5A 2HU5A