2QXTA

Crystal structure analysis of the bacillus subtilis lipase crystallized at ph 4.5
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
179
structure length
179
Chain Sequence
HNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSADMIVMNYLSRLDGARNVQIHGVGHIGLLYSSQVNSLIKEGLNGGGQNTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipase
publication title Structural basis for the remarkable stability of Bacillus subtilis lipase (Lip A) at low pH
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 66
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2007-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qxtA00
3R3YA 3QITA 4LHEA 2GYVA 4K6HA 4AB1A 5DWDA 4FLMA 2HIHA 3I6ZA 3T52A 2VJDA 1O6FA 2HHAA 1DTEA 1SFRA 2OG1A 3OPMA 3WZLA 4KACA 3TGLA 1W76A 1E3QA 5AI4A 4ETWA 5C81A 3FYUA 1EDBA 3OG9A 1XLWA 4AMZA 1AGYA 3I2IA 4DSZA 4EBBA 2XI4A 5EHZA 1K5PA 2H7CA 2QTBA 1DWOA 4DIUA 5ALRA 1XZKA 4A23A 5ALEA 4MEBA 4INZA 4WY5A 1YA8A 4QDOA 4AX4A 4CI9A 1F0NA 4UHHA 4DMFA 3WWDA 4YX9A 5JAOA 2XB6A 3CXUA 4RGYA 2C0PA 5ALZA 2EEPA 3CCBA 2QM0A 2V98A 1W75A 3PF9A 3IUQA 5JD6A 5AHXA 5ALYA 1EB9A 2WJ4A 1VLQA 3O9VA 1MX1A 3E0XA 2OGZA 1WPRA 2WG0A 1CUHA 3LIIA 2PUJA 5AM4A 4DNQA 4HAIA 3C87A 3OOSA 1MTZA 4EY8A 3IVMA 1LPPA 4H7KA 5AI8A 3WQHA 4Q3KA 1AKNA 4J0HA 1Q84A 3FCXA 3VVLA 4X90A 3ZLUA 1LPNA 2JGMA 3WK9A 2C5GA 2K2QB 2X8BA 5YASA 3QPAA 5ALHA 1ZD2P 4I3FA 3ZPXA 4WFKA 4E46A 1ZGBA 1XLUA 4HXGA 4P08A 3C8DA 3I1IA 1G42A 3I2KA 3O4HA 4G1FA 1UOOA 3Q0TA 4A5SA 1ZIXA 4EY6A 1J07A 4HRYA 4X97A 5HFAA 5BV7A 1C7IA 3PDCA 1R9NA 3WL6A 1BEZA 4GI1A 1CUFA 3FNBA 2XMDA 3STYA 2CEKA 4IH4A 1ZICA 1YS1X 3K6KA 4UHCA 4H7IA 3C5WP 5CXXA 2C4HA 3WL7A 4GLBA 4BATA 5E4JA 4Q1VA 1FSSA 2BUCA 3A2LA 4UBJA 5A7FA 2WJ3A 2O7VA 4L72A 5A62A 3T4UA 4RNCA 1A8UA 5EHNA 2HU8A 3B12A 3BIWA 3ESDA 4UFNA 1IMJA 5EGNA 5DTJA 3KWJA 1XRNA 3QPCA 2HDWA 3LCRA 1UFOA 4E15A 3FYUB 5CT5A 3U0VA 5FUMA 2NW6A 4UHBA 4NVRA 1XZGA 3F8SA 5AM5A 2O7RA 3FYTA 4H0CA 1MPXA 1K8QA 2UZ0A 2VAVA 3K2IA 1AZWA 1JJBA 5LZ5A 1AURA 5ALVA 1UOPA 1GPKA 4L3WA 5HKAA 1EH5A 3G7NA 1A88A 1NU6A 1WHSA 2XQGA 2YYSA 1J2EA 1ZJ5A 2O2IA 2BUAA 3FOBA 1KEZA 3STXA 1QJ4A 4P9NA 3E4DA 2JF0A 1QOZA 3WMRA 2HRRA 2QS9A 2RGUA 5ALFA 2HFJA 2DHCA 1CUWA 1XQWA 3O0DA 4OB7A 5AK4A 3C5VA 3C8HA 3LS2A 1LLFA 5CMLA 4PV7A 1DWPA 4CG1A 2WFLA 2CBGA 1EDEA 1DQZA 4B81A 5K5EA 5AIBA 3G0BA 2XUOA 3DD5A 4IQ4A 5HF8A 1CV2A 4WJLA 1ZJ4A 3HYSA 1UXOA 5J3JA 4K6KA 4EB0A 2XMRA 3GBSA 3DJYA 3G0DA 4FKBA 4TGLA 2HA7A 2GBFA 1EK2A 2XUHA 4MWTA 3ANTA 4FNGA 3ILSA 5FDFA 1C7JA 1IUOA 2BFNA 4QZVA 4KJXA 4Q3OA 1MAHA 1UK7A 2FJPA 1THGA 1HQDA 3GROA 2BJHA 3C70A 4TVKA 2HM7A 1IUPA 1E89A 1E8MA 4W1RA 5JADA 4BVKA 4OYLA 2YXPX 4H18A 2VJAA 1YB7A 1EVQA 3AINA 3G9XA 2G5PA 1CUCA 4UBOA 2B4KA 4B6GA 2V97A 2CJPA 4J0GA 3OTQA 2Y6VA 2WLSA 2XT0A 1ZIYA 5AKHA 1XQXA 5T4FA 1MAAA 1G5FA 4ZGBA 4N5HX 1H2YA 3WKDA 2WILA 5LKAA 1XROA 2ACKA 4MYSA 4Y2RA 3QMWA 2Z5GA 4EY5A 4KR0A 5LZ9A 5CT8A 4QEKA 1XRQA 6YASA 1XZAA 3QVMA 5A71A 4WFIA 1RYYA 1B41A 2GBIA 1H2ZA 2WIGA 2GBGA 3QPDA 1EK1A 1U2EA 1LPBB 4JYMA 5LYYA 2JIDA 1DT3A 2OCKA 2Y6UA 1EB8A 4E11A 3DLTA 3QYJA 1CQZA 1O6GA 2FUKA 5K3DA 1EA5A 2EDCA 4UPDA 3HXKA 5C7YA 4DMHA 3A6ZA 2PPLA 3ZLVA 3OC0A 1W1IA 3IUMA 1W4LA 3D2BA 2JGLA 2CUTA 2XUQA 3H17A 1BU8A 5AKZA 2JGFA 2JEYA 4DGQA 1QTRA 4B82A 2RHWA 1GPNA 5EIHA 5A7HA 2R8BA 3F67A 1E5TA 3FLBA 4RE6A 3MUOA 4D9JA 3WJ2A 3FLAA 4BCDA 2EDAA 1CEXA 2HU7A 4X91A 2Z3ZA 3DCNA 1CUAA 3IB3A 2OCIA 3DDUA 3NUZA 4HXEB 2PM8A 3HACA 4MJ3A 2V96A 1ACLA 3FYUC 2GZSA 5BWCA 2ZSIA 4J0IA 1XZIA 2PL5A 2OAEA 3DOIA 5ALJA 3WIOA 4GECA 5AK5A 5DJ5A 4DM7A 2QOEA 1HBJA 2GZRA 1SCKA 4XX1A 3PUHA 3AIOA 3F98A 4J03A 2Z8ZA 5JAPA 5KREA 4BTVA 4X6UA 3TJMA 3WA6A 4PO3X 1ZD3A 1P0MA 3I6MA 1XZHA 5IVHA 4DYHA 3ZWQA 5CH8A 1WB6A 2PSDA 3HABA 4BYMA 2XQIA 4JH0A 1QE3A 1NU8A 4L9AA 3M3DA 5JALA 1T4MA 3X3HA 4OU4A 3BJMA 5FV4A 4MXDA 4KRYA 1G66A 2XQJA 1QO7A 1H23A 2BAGA 1QGED 1LGYA 5ALIA 2VF2A 2WHRA 4FWBA 3I6YA 3BXPA 2AJCA 4AO8A 1MNAA 4NS4A 4CFSA 1TCBA 2XMCA 5H3HA 3WK4A 3G0CA 1GKKA 1ODTC 2PVSA 5IVDA 1TRHA 4G4IA 4H7DA 1J06A 3DOHA 2LIPA 2XUJA 1H2XA 1ODSA 4Y7DA 3R3WA 4DTCA 5K3BA 1BCRA 2I3DA 1VXOA 4IH9A 3AZQA 1UKBA 4DNOA 4Z49A 3HJUA 4ARBA 3IA2A 1WHTA 4H7JA 2WU3A 3G8YA 2WG2A 2JGEA 1DQYA 3MGAA 4N8SA 2HA6A 3C6ZA 4AQDA 3WKEA 5CXUA 4RE5A 1VA5A 1F6WA 1RWQA 1B6GA 2XUPA 5A2GA 2ECFA 2Z3WA 1K6EA 3G9TA 4UBLA 1JMYA 4B9AA 5DNUA 4WDQA 1TAHA 4QA9A 1XRPA 3KWFA 3VDXA 2DFPA 2VT7A 4LYDA 3ZI7A 4F0JA 3WIBA 2WM2A 1DX4A 5KWIA 5JASA 2JGJA 2HL6A 1CUSA 1XKLA 2J3QA 4ZI5A 3FAKA 4L0CA 3WKAA 2D5LA 2R11A 2WHPA 4HVTA 5AO9A 1FFDA 1UWCA 3RM3A 3GA7A 4DMCA 1BROA 1QTIA 4DSAA 3Q8WA 3GUUA 1ORVA 2HU5A 5FOQA 3GZJA 5CH3A 1VE6A 1IZ7A 5AH0A 1VE7A 2ROQA 4CIBA 4MQMA 1Y7HA 1QIIA 3F97A 4S0XA 1QFMA 5ALSA 4ARAA 4BBZA 2XUAA 3PFCA 4F5ZA 4B83A 5AK3A 2XQKA 3D7RA 4Y2VA 1DU4A 5F4ZA 4PSCA 3V1MA 2ZYIA 1DINA 1EDDA 4JYPA 3FSGA 1PJAA 3AFIA 4G9EA 2I78A 4M0MA 3TEJA 1GZ7A 4DNFA 4UBKA 2WIFA 5IVKA 2Y2UA 1LBSA 5ALLA 3R3XA 4CG3A 2OPHA 3WKCA 1CUGA 5ISMA 2C0QA 1WB5A 2WUFA 1YAJA 5K3AA 4OB8A 3D5EA 3STVA 1P0PA 3E1GA 4LYEA 4BP8A 3ZLTA 2H7YA 3KSRA 5AI5A 2VA9A 4BAZA 2H1IA 4AO7A 4BRSA 4C6HA 4JEIA 3ICVA 4GBGA 4F60A 3PF8A 3VISA 1FFAA 1XZJA 5E4YA 3UMJA 3WJ1A 5LKRA 2GYUA 1X2EA 5BOVA 4W1SA 5DYYA 4EHBA 1H2WA 5JD4A 5HK8A 4K2AA 4Y2XA 1X2BA 3FWHA 4Y2YA 4BE9A 3HSSA 3MUNA 5DNVA 1BEEA 5CBKA 4UFPA 2BCEA 2JEZA 5AKKA 4J0JA 5C8VA 4OSEA 2ZYSA 4U2CA 4DMKA 1PV1A 3PUIA 4G9GA 3AIKA 3H2IA 1FFEA 5A7GA 5LZ8A 3YASA 2B20A 3JYHA 1XRLA 4BTLA 4YASA 5ALUA 1ZD5A 1XZEA 3ESBA 2WHPB 1XZFA 1BN6A 3W2TA 4FNMA 5A6VA 4QWWA 1PFQA 1MN6A 4B84A 3EF3A 5AJHA 5FPPA 1BE0A 5EIAA 3FBWA 4C4ZA 1THTA 1CVLA 1YCDA 4BVLA 1AMNA 5AIAA 2QRUA 3N2ZB 3HZOA 3DEAA 1JU4A 2WFZA 5JZSA 2XLCA 5FXMA 3GELA 1YAHA 4CCWA 4A16A 3OM8A 2ONCA 4UBNA 3B5EA 1QIKA 3IIIA 5HF9A 3WL8A 5AKYA 3V1NA 1JMKC 3D2CA 4GW3A 3ZV7A 5DLPA 3V48A 3DL4A 4X7BA 5K3FB 4OU5A 5JYCA 2Y1KA 3F9CA 2WIKA 1LPSA 1EVEA 4MQLA 4BAUA 2GBCA 1BRTA 3F96A 5AKJA 2OQVA 1X70A 3IURA 4LKOA 5ESRA 1XZBA 5D3ZA 3OURA 1FFBA 4K6GA 2P8SA 1BN7A 1JJIA 1GQRA 1YASA 4BC1A 4AXBA 4FHZA 3W04A 4MEAA 3DKKA 3BDVA 3LLCA 2DHEA 5AI0A 3CN9A 3FLEA 1JU3A 1GT6A 4ZXFA 4YPVA 4KEAA 1ODCA 3H2JA 3STWA 3R3ZA 4ZV7A 2PU7A 4HXFB 2J4FA 1TKRA 1WCYA 4GWLA 4QNNA 5JAHA 3QM1A 2YASA 3RARA 2QUBA 4MYDA 1U65A 4G8DA 4WFJA 2BUBA 5AI9A 3STUA 4NMWA 1ZI8A 4OD0A 1K4YA 2WIDA 3D0KA 5ALGA 1CUVA 3CN7A 4KAFA 3WWEA 1D07A 1AUOA 3I28A 4CIAA 3I2FA 3G9UA 3M81A 2AJDA 2PX6A 5ALTA 2BGRA 4Y2JA 1LZKA 1HPLA 2WTMA 5HQ3A 1KU6A 1WOMA 4X85A 1TCAA 3L1HA 4KRXA 4FFWA 5CTAA 3B3QA 3A70A 5JD5A 3HI4A 3HLKA 4KE8A 5FPQA 3STTA 3IDAA 4HTAA 5BWBA 1N1MA 3K9BA 1WM1A 3QMVA 4C87A 4QDTA 3BF7A 4NZZA 3WK6A 2VTVA 4X93A 1AQLA 1BS9A 2ZYRA 2O2GA 4WY8A 2W6CX 1VOTA 4EA6A 3AIMA 4BVJA 4G5XA 3BL8A 4Y9SA 3PI6A 4FLFA 2RHTA 3BDIA 3WWCA 5LZ2A 4F21A 2IIVA 3QMMA 5CT4A 4G8BA 4PW0A 2WUGA 5D6OA 2XUIA 4J3JA 1GXSA 5AICA 5JZ9A 5I8PA 1ZGCA 2DHDA 3GFFA 5EFZA 1YA4A 1ORWA 1GGVA 4XWGA 4W1QA 3C45A 1CUIA 1R4ZA 3WL5A 2Y2VA 2PKYX 4ZREA 5AKGA 5EHXA 1T2NA 4X3CA 4Y2PA 3KDAA 5T4BA 2HA2A 4GXNA 4BDSA 5AKXA 1DT5A 2AJ8A 4Y2SA 4X95A 3WK7A 4QE3A 1XZCA 3AUKA 1G4HA 1L7QA 2PSFA 2AJLI 2FX5A 3PE6A 1RP1A 2ZVDA 4KAAA 1L7RA 1CUYA 3RKSA 4IH1A 2DQYA 3A2MA 3BF8A 3I2GA 5ALXA 1FJ2A 2ZYHA 4N8EA 3QH4A 5IVIA 3W05A 4FBLA 1Y7IA 4J0CA 1A8SA 3VJMA 2VJCA 5HKBA 3EQ9A 1MU0A 4I4CA 2YH2A 4IHAA 1CUXA 4M0FA 2JBWA 4FFVA 3FSGD 2JGIA 4GDMA 5SYNA 2DCMA 1DX6A 5HQ3B 1WPXA 2QJWA 2VEOA 3O4IA 1U8EA 4BAGA 4YK7A 5JATA 2XMQA 3BJRA 3V9AA 1QFSA 1VZ2A 3I1YA 4EY7A 2WFMA 3VVMA 2H7XA 1K63A 5AM0A 4BC0A 4PQEA 5JAUA 3PFBA 1VJ5A 2QXUA 1TK3A 5EI5A 3G02A 5ALDA 5DYTA 4RPCA 3QZUA 3WA7A 4Y2QA 1XZLA 5AM2A 1BCSA 1CUBA 3D3NA 1JT2A 1KU0A 1IZ8A 4U2DA 1QIDA 4AZ0A 1GQSA 2HRQA 4DNPA 3IBTA 2XE4A 3LIPA 2AXEA 3DQZA 1J1IA 7YASA 5ALKA 3R41A 4KAJA 3ESAA 3SC2A 1AX9A 3DYIA 1H22A 1SC9A 4QLAA 3LP5A 4C89A 2DQZA 3HEAA 4TPKA 3BE8A 4X00A 4AN1A 1VXRA 4CCYB 5AOAA 4BB0A 1UKCA 1LPAB 1QIJA 4BCCA 3R40A 4G8CA 5DYWA 1YSCA 3E3AA 4O08A 4PSUA 3P2MA 2WSLA 4KE6A 3I2HA 3D2AA 1A8QA 4H7FA 1Z68A 4B85A 4OYYA 2XDWA 3W9UA 1R3DA 4Q05A 3WLAA 3H2GA 4IO0A 1W52X 2HFKA 1WB4A 5T4EA 1ZD4A 4LIPD 4B9EA 3W06A 4LXIA 1CR6A 2C5FA 2PU5A 5K3FA 3H1BA 4DLNA 1ZI9A 4H35A 2PUHA 5LLSA 1JI3A 1Y37A 3EIOA 5EIEA 4BE4A 4PSDA 2ES4A 3FCYA 5AI6A 1SCIA 1XRRA 3O95A 3V1KA 5K3CA 2PSHA 1OXMA 2JGKA 4KYVA 4GHWA 5CW2A 5E4TA 4EZIA 2VQ6A 4W1PA 1E8NA 2OGTA 2CZQA 1C4XA 4U2GA 4B7ZA 1EXWA 4WCVA 2X5XA 3WWPA 5LZ4A 1QIEA 4UUQA 3SWWA 4LXHA 2I03A 1P0QA 1JFRA 4BP9A 4FDMA 4Y2UA 1HLGA 1F8UA 1CUEA 3H19A 5AM3A 5AKIA 1HDEA 1HKHA 2BKLA 5IH7A 4PF1A 4N8DA 5D7BA 4BZZA 2WIJA 4OUKX 5JANA 1Q0ZA 2OCGA 4KE7A 3VJKA 4JNCA 3WYDA 5JARA 4OB6A 4BDTA 4HZGA 3S8YA 3H18A 1ISPA 1XFDA 2RONA 2WTNA 4QDUA 3FVRA 1E66A 3H1AA 5CH5A 1MX5A 3JW8A 4MWSA 3R3UA 3BIXA 1IUNA 1TIBA 2WG1A 3QBJA 4AO6A 5CRIA 4QWMA 2B61A 3G0GA 1E8DA 5AKEA 5KBYA 2HADA 5JZBA 2DSNA 5AM1A 3A2NA 4QDXA 1MX9A 2QKYA 2VAXA 5T4HA 1U4NA 2WUEA 3C6BA 1R9MA 3WYNA 1HL7A 4PNZA 2GYWA 3NOXA 4EY4A 4U2FA 3ICWA 3KOOA 3W9BA 3N0TA 2HA5A 1CUJA 4BZWA 2ZJFA 4B80A 1TCCA 3AILA 4QDZA 1I6WA 3HC7A 2CKMA 2X76A 3H2HA 4HRXA 4N5IX 5HF5A 3V1LA 4ZWNA 3MVEA 1CPYA 4Q82A 2ACEA 2G63A 2XUKA 2V9ZA 3SX4A 3ESCA 5HK9A 3D4LA 3ANSA 3RLIA 1CQWA 3DYVA 1AC5A 4XIIA 4Y2TA 1R1DA 5LP1A 2XUDA 1UKAA 1W6RA 3L1JA 5FRDA 1P0IA 3VXKA 1UK9A 2J3DA 1XQYA 3C6XA 4I19A 5SYMA 4FTWA 3U1TA 2G4LA 2VSQA 3FVTA 4ZRDA 1N8SA 1FFCA 4C88A 4W63A 4ITVA 2O2HA 2E3JA 4WDRA 1USWA 1VA4A 1ACJA 1M33A 4UBMA 1UOQA 2QUAA 3DNMA 5AP9A 4Q34A 4G4JA 2DR0A 1MNQA 2OGSA 1MT3A 1QONA 5DNWA 4HS9A 3WI7A 2J4CA 3H04A 3C6YA 3IUJA 1GKLA 1LZLA 3CCCA 1UT6A 3R0VA 4M0EA 2C7BA 1OCEA 4EUSA 2C58A 3ED1A 5IKXA 2RI6A 5E2IA 4LXGA 2XMGA 2CMFA 1UK6A 1QIHA 1IVYA 4FLEA 2WQZA 1SCQA 4C01A 2QR5A 3D59A 2XQFA 3JWEA 1EI9A 3VJLA 2RIPA 3WZMA 5AK6A 4XVCA 2XLBA 4GEGA 5AOBA 5EHQA 2HA0A 5FKJA 4P92A 5ALOA 4H7EA 2OQIA 2AJBA 5ALWA 2HA3A 3EQ7A 4XJVA 4UBIA 3SK0A 4KE9A 1EHYA 4JUIA 2QVBA 4B0OA 3UUEA 1S8OA 3RK4A 4E14A 2WKWA 1ETHA 2W22A 1XZDA 1EINA 2PSEA 1QZ3A 3G0IA 3L1IA 3O9MA 3H2KA 4W9RA 2FJ0A 1QIMA 2OXEA 3M83A 2WU4A 5KWJA 2QT9A 2WUDA 4U2BA 1JJFA 5C8XA 1Q0RA 1LPMA 2I3ZA 1UK8A 2WJ6A 1QIFA 1LPOA 4FMPA 3DL7A 5ALNA 4AZ3A 3S2ZA 2QZPA 3AZPA 5HFNA 5FP0A 1YR2A 3I2JA 1CIJA 1XZMA 5FLKA 1XRMA 1QO9A 4P93A 4X6XA 5CURA 5AKLA 2VATA 5HCUA 5LZ7A 1MO2A 4J0KA 5I7UA 4UFOA 4X94A 1MJ5A 2RAUA 2OAGA 2QXTA 5AOCA 3WK5A 2WFLB 3IUNA 1Q83A 4BCBA 1XKTA 2Q0XA 2OCLA 1OILA 2D0DA 2PSJA 1N5MA 2ZSHA 3DS8A 5C8ZA 1VKHA 4X71A 4CCYA 3TRDA 4CG2A 4QLOA 2B9VA 4BRZA 1CUUA 2G5TA 5K3EA 1LNSA 3AJAA 1UZAA 3WKBA 5JIBA 4FBMA 3BWXA 1QLWA 4Q3LA 1N5RA 2Z8XA 4X6YA 3VKFA 5D3KA 1SOMA 5ALMA 2BGNA 4J0DA 3H0CA 1CFJA 4H7HA 1TQHA 3UUFA 1XQVA 2PBLA 4ROTA 3C43A 2IITA 4H77A 3KXPA 4K5QA 3NGMA 1LBTA 1R88A 2ZJ7A 1XLVA 3WK8A 2QMQA 4C4YA 1NX9A 1EX9A 4B0PA 4ZV9A 4UHFA 3HRHA 1YB6A 4FOLA 1CUDA 1L7AA 1QIGA 1VZ3A 1CRLA 5LIPA 1DWQA 3IULA 2XMSA 1A7UA 4OCZA 2WHQA 5HZGA 2QJRA 4AN0A 4J7AA 3DKRA 4V2IA 2VJBA 1R50A 2XMBA 3M82A 4U2EA 3EQ8A 3EBLA 3O4JA 1F0PA 3O4GA 2OLEA 2IX9A 2CB9A 1ZOIA 5I9IA 1CLEA 5HF6A 5ALPA 2ORYA 3AZOA 5CT6A 5CT9A 1CUZA 2XMZA 3PICA 3G9ZA 2VT6A 2XUFA 1ZI6A 2XUGA 2ZJ6A 4AMYA 3R3VA 1JKMA 2H9YA 1YS2X 3WWOA 4UHEA 3KD2A 5ALQA 5DTIA 3NWOA 4OPMA 4C4XA 1GPLA 4G4GA 4UHDA 4X92A 2HA4A
chains in the Genus database with same CATH superfamily
5KX5F 4RSGA 4DZZA 5LLDA 5LMUB 4X64B 1Z83A 1U9IA 4L5AA 2GLXA 3H5NA 5H83A 2GYVA 4Y18A 2QN6A 4JJAA 4K6HA 4CNQA 1CBUA 4YV0A 4FLMA 3BD6A 2G7MC 1HA3A 3V8RA 1TO1E 3T52A 1O6FA 2I66A 4PAOA 1XDZA 1BYUA 1OLOA 1DV1A 4H31A 1IEVA 3CONA 3RANA 1GFSA 1Z15A 1XN4A 2Q2WA 2P75A 2ZAOA 4LJ9A 5FI3A 3WZLA 4Z53A 1Z5ZA 2FUNB 4LZZA 3CJTA 3IESA 5JTUA 5AI4A 1BJTA 5KC8A 3LLSA 4CFYA 2Q1WA 1V96A 1OH5A 3LBYA 1N9ZA 5C4GB 2WQ6A 3RUCA 1TQ6A 1W94A 4MW0A 4UDYX 3VVCA 4E94A 3D8UA 5DW3A 2GMWA 3EOAI 2JCGA 4OMDA 5GGXA 3MGBA 3WFZA 2GFHA 2NUTB 1PNVA 3RFCA 4G5SA 3SFTA 4M8IA 3LOQA 4RF3A 3I3OA 3JAKB 1K7EB 2P9QA 5KNCA 3TH5A 1R27A 4BO2A 3BH0A 1EK0A 3CUSA 1OZ0A 4A23A 2EG5A 3HU3A 1B3BA 3ZCUA 2BGJA 3G2PA 2VDPB 1YQGA 3UYLA 1F8GA 1RZRA 4QDOA 4AX4A 4I36A 4JKOA 4BNLA 5F5XA 1IE3A 1H1TA 4O4IA 4F4UA 1ZCBA 1GR1A 1TW3A 4JB0A 5KU7A 1FP4B 2PGNA 2QTHA 3PX7A 1TO6A 4YQFA 3PX3A 4YX9A 1E4YA 2B35A 2E87A 2XB6A 3CXUA 3S4YA 5BYBA 2YWFA 5ALZA 1MIHA 1UJ5A 2V98A 5DK4A 4BASA 4DVJA 2NTEA 4C7XA 1JFFB 2IUYA 4WECA 3WLJA 4YP9A 1Y8CA 1A7KA 3AGQA 3LTEA 3QEMB 5ALYA 1EB9A 3PE3A 1ZCAA 4L5CA 4NYIQ 4CLHA 1JZTA 5KUTA 1VLQA 4Z4QA 1VCOA 1ZRSA 5FNVF 2OGZA 1WPRA 3GFPA 5LU9A 1SOVA 3UFXB 2ORIA 2GTIA 4LAFA 2PZMA 5IYZA 1EA7A 3F5QA 4R2MA 2QGZA 1OBCA 1VFPA 1YMQA 2Q1SA 1SJ9A 3HMKA 1R18A 2YIJA 1W0CA 1Z5OA 2VN8A 1YNOA 1M73E 4HAIA 3PR2B 7REQA 1YB5A 3C87A 3CUUA 4G0QA 4J2HA 4KXMA 3RSSA 5B3LA 3WX0A 1VECA 2C9BA 1VG1A 2G9UA 5HPYB 3ZHYA 1P2DA 2OBNA 2W6PA 2K7FA 4RVDA 3WMFA 4RVFA 3FWPA 1BOOA 3W8RA 2W42A 1RMTA 1FU8A 1OHHA 1RLOA 1CSEE 1SBHA 2CLFB 3HJTA 5H59A 3HLYA 4N1AA 2EC5A 3WQHA 2M1XA 1PFUA 5KYUB 1OZFA 1B42A 3FCXA 5CD1A 4X90A 3UN1A 3ZLUA 1LPNA 4QFBA 4JFAA 4Y7CA 4BMZA 4ZCTA 3N6VA 3UCXA 3WIEA 2E82A 5BOSA 4HQOA 2V7GA 2X8BA 3G8CA 1RPNA 1ZD2P 4GS5A 5L6MB 2Q46A 4RK4A 3EEQA 3PHBE 2XRMA 1XLUA 2ZR0A 4D9IA 2IX3A 4NYMQ 3C8DA 4OYHA 4C29A 3I1IA 4RVHA 1IN8A 2OCYC 4TMKA 1NJ2A 3D6MA 4HB2A 1T3ZA 1JNXX 1T5DX 5THXA 3MCUA 2NZUG 2HYIC 1T9CA 2HQOA 4P3OA 4W6ZA 3GHYA 2BCGY 3PPYA 1FVHA 5L3SA 4C0SA 4MB6A 3WLQA 1CB7A 3GLGA 1CP2A 4R68A 1CY4A 3MMZA 2FSUA 1M5UA 1R4MA 1RLTA 3FTPA 4EY6A 3QUSA 5I8WA 4HRYA 1P1HA 1GDHA 2FYTA 4UQPA 2OZLB 4Q9LA 5D00A 2ZU6A 1BVUA 2ZUDA 3F7NA 1PD1A 3HWWA 4HRVA 2IZ7A 1CY6A 1E60A 1ZK1A 2A9KA 3K4QA 3MFYA 4K0RA 1GPBA 2XYRA 5BV7A 5IG2A 1CZRA 2A86A 1PUIA 3OHSX 3VC1A 3OQJA 4I8DA 3T9BA 1DXOA 4O4JB 1QGUB 5H68A 4CKWB 4R0MA 4Z9AA 2ID7A 3PI7A 1EHIA 3C7CB 3DFIA 3FNBA 2O1XA 4M7RA 2P9BA 1PZGA 1BW9A 2VUTA 3LZCA 3RG2A 2HN9A 1P4JA 3EAGA 2W6QA 3WO1A 4CMGA 1J49A 2FW6A 3IR7A 2QPLA 1LFAA 3C5WP 5CXXA 3ZDQA 2QAIA 1SQ6A 3WL7A 5AW4A 1LK5A 4GLBA 3BKWA 3DBIA 2G07A 1V7CA 3WNBA 1EWTA 2J07A 1AQYA 4BVAA 10MHA 1X80B 1M3SA 4L95C 2PV7A 4B3MB 1PL6A 1I4TD 1XD8A 3H05A 3OAAA 2VKQA 2ZIXB 3OM0A 4I46A 2R8PA 4D8VA 4QECA 4Q9KA 5KNLA 3KLMX 5LA6B 5GZ3A 2Y0PA 3KHTA 4Z86A 4R7GA 1MO4A 1IEWA 1NATA 3A6LA 3H9JA 1PNRA 2UUBB 1PN3A 1LBIA 5A62A 3R9XA 2H2HA 4MIEA 3A14A 4DIEA 2PFKA 2PQ6A 3DZBA 2FEOA 3LX8A 4RCVA 3U60B 1P5FA 4UFNA 1V9CA 2R5NA 2EZ9A 3PNQA 2W6OA 3HY3A 1T0HB 1JIJA 3A4NA 5DTJA 3W6NA 3QPCA 4L8LA 1CE8B 1XDSA 3S28A 1PQYA 4TKUA 4X8LA 5L3VA 3LCRA 1UFOA 4Q9HA 3RF7A 3H3JA 3CX3A 3AUAA 4HG2A 1DKQA 5TF0A 4C4TA 3ZGLA 4D96A 3TK1A 1SA0A 3IQDB 1N2IA 1GWNA 3F3KA 3BORA 4LNHA 4IRXA 4PZDA 1V4NA 2DPMA 4BWFB 5EP2A 4YCNA 5GAJA 2IDJA 5FUVA 4UTPA 2JAHA 3I9OA 4HADA 5JY6A 3D3JA 2UZ0A 4WXPA 4LGMA 3RBXA 1UP6A 2FEXA 4HAUA 4HVCA 3GRAA 3W9YA 4ZPJA 5D1HA 4EFKA 3KZ1E 1P75A 1S2DA 1G4UR 4I3HA 2ZUEA 3FXAA 3KQLA 1CXZA 1JJBA 4TLLB 4RLHA 3LC1O 4P8RA 3CH4B 1GPKA 4QDKA 4UOEA 2IZ0A 5LUBA 1EH5A 5BSMA 1KSFX 3IEIA 4JLWA 2V0NA 4LWOA 4DLPA 2CN1A 5WRFA 3HWX1 1RHQA 5E9JA 1Z8HA 4M9SA 2E85A 1WHSA 2YYSA 3T06B 2WMOB 3MJHA 4OLAA 3V4SA 3TZHA 2R6CA 1F2VA 2A5LA 5K8TA 4PLHA 1T0JB 1VSTA 2BF7A 4CZ2A 2O2IA 1OV6A 2UXBB 621PA 1KEZA 1PWXA 2W2PA 4M53A 4QAQA 5G3ZA 3KXDA 3WB9A 4PO8A 4TN5A 2GAAA 1GNPA 1N6PA 3JYQA 3ONVA 3QKSA 4IJWA 3SHOA 5A0TA 2JF0A 2C4MA 2V4UA 2IT1A 1QOZA 2M9MA 3RUAA 2R7AA 1XPJA 3BWVA 3EUEA 4F96A 2C4WA 2HRRA 1MB2A 3IT3A 3ZZNA 5JCZA 1OI7A 4NMXB 1KEUA 1W8DA 2G36A 2Z5LA 3M6IA 2HUPA 4XKJA 5DYGA 3E9QA 1F12A 2NQTA 3CLUC 5IABA 3EWIA 4P33A 3TZQA 1SO8A 4CMKA 4DAOA 5C80A 3D8TA 1RRPA 5AK4A 5LYJF 2ID8A 3LS2A 3T0FA 1YZLA 4PV7A 1DWPA 2AOTA 2XT6A 3Q85A 2D54A 3JATA 3IJ5A 4DB4A 4PG6A 1V5EA 4IEIA 4Y3UA 5C1BA 4O1HA 2P8JA 2H1CA 2XDQB 4KXFB 3WVNA 5AIBA 3PXCX 1T8SA 4FB4A 4ENPA 5K6AC 3PFHA 1F8YA 4F2WA 4FGUA 1P6UA 4EFLA 1M9NA 1S2GA 1IRIA 2IY9A 3Q98A 4RTPA 3NTRA 2VWGA 2RAPA 1F51E 2W58A 3N7TA 3VZDA 4BO6A 2IODA 1QQTA 3M4ZA 1RJFA 2GN2A 1NMXA 5DYNA 1AKYA 1JHAA 3PQFA 2LR0A 1Q91A 2XMRA 2OWEA 3G0DA 3IHWA 1ZVQA 3LBFA 1T2UA 3DYBA 4E3WA 3VR0A 5JXIA 1N78A 2CNWD 2ZB8A 5EG5A 1EK2A 3A25A 3KFXA 3MJSA 4QRDA 2GRJA 1KDYA 1Y4ZA 4M8SA 2IYSA 3KT8A 4AUKA 4EX7A 2VHJA 2DR3A 4Y9RA 4MX8A 1C3OB 1E32A 4UUMA 6GPBA 4P7KA 1XFAA 3O03A 5KOYA 1E61A 3UAZA 2F4VB 1G5RA 5IFLA 4Z9YA 3T61A 3NM6B 1TZJA 4HAXA 5K20A 4F4HA 4LFAB 1DO2A 3ZN2A 2I7CA 5DCUA 2X8WA 5CA1A 1LJ8A 3GPDG 1I30A 1CLUA 4KJXA 1ML3A 5EFOA 3EG9B 3L4BA 2B0CA 4BXOA 4B32A 1UK7A 4YRAA 1JAXA 1HQDA 3ADBA 3IQWA 3GROA 2EHJA 4MV5A 3GP3A 5HCNA 4RFVA 5AUOB 3KDPA 3ADCA 3E9RA 4V0QA 3MUFA 2CMDA 4HNGA 5EZYA 4COKA 1I94B 2HDNB 4H1TA 1ISMA 4AF7A 1PFWA 5ESWA 3VZSA 4B7UA 1X74A 4DJ5X 1PYGA 3EGVA 2DERA 1UPFA 2GHRA 3PUYA 1VMIA 3GMIA 4BVKA 3TG2A 3OX4A 4L5BA 3KT3A 4URWR 3RS0A 3MTGA 4CM9A 2CNOA 4H18A 1MC8A 1OD6A 1ZXBA 4TSFD 2VTBB 3KEQA 4XUEA 3CRNA 3OF5A 4A4DA 3BTVA 2PMKA 2IEZA 1FSZA 3C4VA 1AUPA 3DPSA 4DLZA 2ZPTX 1DBVO 3G9XA 2G5PA 2IPMA 3ILXA 1CQIA 4KQEA 3BOSA 3W8DA 4EJSC 4GVXA 1Q2UA 2XX3A 4R6XA 2QG6A 3NZEA 4MMXB 1JRLA 3NEPX 3FM9A 1Y33E 4PC7A 3VHXB 2WWWA 2CJPA 5F73A 3M5DA 5EESA 2BFOA 3SXPA 4H1HA 2WMYA 3VYWA 2BLLA 2V58A 1PTKA 1EYZA 2HBYA 4KXLA 1GIAA 4UJ5A 1DKOA 1G55A 1UQRA 2BFCA 2XT0A 5KNDH 3OZSA 5AKHA 1G3MA 3E05A 1CRPA 3HSKA 3AI3A 1EJ0A 3CQ9A 4DAEA 4O2AB 3SZOA 4AJEA 3O8LA 4YAGA 3PGMA 2I4RA 4KXUA 3O8QA 5IUNC 4N5HX 4FKMA 3BXGA 3LYUA 1Q95A 1NLZA 2GARA 5K4HA 1TB4A 1PKEA 2ZJ5A 4KWTA 2G1UA 1XAHA 1HT0A 3K92A 3LZDA 4UARA 6LDHA 2CKDA 5LJIA 4K9MA 1A5AB 1E9SA 1W88B 3CLTC 4E1BA 1T25A 1LLQA 2ACKA 1IOLA 1KPIA 1ZKMA 2PFSA 5AHOA 4CTKA 2ADFA 2MJLA 1UPUA 2ZFUA 3H4VA 2H5LA 4RSRA 4BLPA 5CB8A 1T2EA 2W2TA 2XUZA 2UZAA 3NAZA 5LZ9A 1EWQA 3IMGA 5CT8A 5KYGA 1J7JA 4QEKA 2H92A 4Q9NA 4J0QA 1T8WA 3EPHA 3I53A 2OT3B 4AJ1A 4MIYA 4RHXA 1KPHA 3OU7A 3QVMA 4XUGB 1QHEA 1TGYA 2CYCA 2WE7A 1HORA 3FGNA 4KJZA 5DM2A 3ANYB 3HNRA 4Q01A 5F7XA 5TVGA 2GZHA 3AYXB 3UQYS 3F1LA 5L95A 3RTGA 2AJTA 3JD3A 2AR7A 1HM5A 3N07A 4Z4HA 4EFMA 5L3QB 3CF0A 1GTL1 3JRXA 1FTYA 1AKUA 3RVKA 1X8XA 1MJGA 2GZ3A 4KLCA 3RS5A 1EK1A 4ZAFA 2ZUSA 1U2EA 3AJ8A 3DLAA 1Q7RA 3NHPA 3PDJA 2FDXA 4JYMA 1PUJA 4LRSB 3I73A 4CUJA 3P4UA 5TQJA 1E1CA 2AUMA 2BJVA 4M1EA 4PGAA 4YB8A 4C07A 4E11A 5IMBA 5AVXA 1CQZA 2ZYAA 5JD3A 4F45A 1EA5A 3OY2A 1OAOC 2EDCA 3DEHA 4UPDA 5HYVA 3QHPA 2I3GA 4QSMA 1VJGA 3R74A 1QP0A 2BISA 5AW9A 3EXHB 4II3A 2PV0A 3DONA 4AMBA 3ZLVA 3CEHA 2G09A 1Z2OX 2HSDA 1RD4A 1JJAA 4JC4A 1PEYA 4U8GA 3TINA 1T5TA 2Q1YA 4EB8A 1IBMB 2GZDA 3X1XA 2AFHA 5L7TA 3KB6A 4PQRA 3GUVA 4JQCA 1ZSVA 3H4TA 1QFJA 3GJ0A 5HGJA 3X1WA 4CEJA 4DC0A 2XGJA 2O8CB 3VR6A 4TRRA 1NW5A 4NZMA 3H7IA 4UVDA 1KMNA 3K09C 1JAZA 4V03A 2VK1A 2YJ3A 1TE2A 5TMDA 1Z45A 4TMVA 2NU7B 1UR5A 4GBMA 3LZ6A 3IVXA 4TX1A 2P2DA 4JQSA 5C1IA 3T3NA 4HPXB 4HH3C 4LXQA 1UXHA 3U4QA 2G5GX 5HDQA 5I9SA 3F67A 1NVWQ 4WUVA 4DJAA 4TYYA 3T7AA 1M54A 2LRHA 1R0KA 2BMJA 2R1TA 1SBQA 4D9JA 5K1ZA 4EF6A 1RPJA 1BX0A 2NTJA 4KTTE 1TCUA 2ZW9A 3KYDA 4NHEA 1ZW6A 2DM6A 4LMBA 3HCEA 1CZHA 521PA 1VCHA 1X7HA 2BZ1A 3A6KA 3IHTA 4BCDA 1TMOA 1WUYA 1U1FA 2P1DA 3B82A 1M8JA 4I55B 2FN4A 3K0AA 3DVAB 3CMMA 4WPGA 3FI9A 4MS1B 2UZ4A 1PJ8A 2FVXA 3PXUA 1ORHA 2OCIA 3LKZA 2E1PA 2I55A 3NUZA 4PSVA 3ROXA 3AL2A 4W99A 4K9NA 4P3XA 3LRXA 3C1TA 3BRQA 4MQFA 2BRUC 4W4TA 3RNLA 3KL4A 2PL5A 1BXKA 4TYPA 5E1OA 4DJTA 3MSXA 2PZEA 5ALJA 3VUFA 4WLNA 5FIUA 3JALA 2JCSA 1FU7A 1Q1AA 3DWIA 4KFRA 1EZZA 2EF0A 5AK5A 1XWWA 5MFPA 1CTQA 4PGFA 4B3IA 3VR1A 2O1SA 3L1VA 2JFXA 2AUNA 2GCNA 4LV8B 4NNPA 5LJLA 4N41A 3MJTA 1ENZA 4MV7A 4DRYA 1SCKA 4KN9S 3FPSA 4BNVA 1H1LA 2EBFX 2ZSBA 3QELA 4N3NA 4G84A 4Q1DA 1JG4A 1KSJA 3KAKA 4J03A 1BFUA 4UD2A 4DJEC 2Z8ZA 1QYWA 3LCMA 5JAPA 2IEGA 1PR2A 1IBLB 2GB4A 1A27A 1SG9A 5EWLA 2P2CA 5E6UA 5AW1A 4JAVC 4Z54A 5CJ2A 1H42A 2RHRA 3OF2A 1FL9A 4PO3X 4TLBA 3WA6A 1QDEA 5A03A 4D8YA 2Q9CA 5JVDF 4FYXA 4LZPA 2VPTA 2G4CA 3CW2A 4NFYA 1ZD3A 4TMZA 5CLHA 1JR6A 5JFGA 4QD3A 4GQBA 1N2OA 4WEOA 4DYHA 2O05A 4LZOA 3D31A 2F43B 4JA0A 4NXNB 5EIWA 2KLBA 4FFRA 5JNRA 2PSDA 1XTUA 3HABA 3LBNA 2KS6A 4OGGA 4CLOB 1M2HA 4R1UA 3L93A 5BPHA 5I5EA 3RREA 1VBFA 3VPCA 2YWJA 2PQMA 3DHYA 1NVAA 5DHFA 2IVZA 4ZCRA 4LE1A 5IJZA 3OBIA 1UADA 3SHWA 2ODWA 2VYFA 3B2NA 2VJPA 1AGXA 3ET5A 4GMHA 5LCXA 3TMAA 4DRXB 2PH3A 1WNTA 3I39X 4RXTA 1ZA1A 2ODEA 2G0AA 2O7QA 2QRKA 3PJDA 3QUBA 4IVNA 4Q16A 1L4FA 3OM1A 5FV4A 1UWKA 1DQSA 3IOBA 4ND2A 3CM0A 4DLAA 2QMZA 1B8OA 4UM5A 1XDDA 5A04A 4GI3A 2RAFA 1AS2A 4YV1A 4MIOA 1ACMA 2GA8A 1LGYA 1L9XA 1ZM3A 4EK9A 3PIIA 4HGYA 2NVOA 3HZRA 2ZIUB 4HEHA 2FFHA 2GCIA 2PS0A 4MW9A 2FE1A 1MAUA 2RHMA 2CSUA 4TV8B 3RABA 5FAKA 4KAXA 3R5SA 2AJCA 2X3YA 4JL5A 3C7DB 4XI9A 1MNAA 2PKQO 4F9EA 5B53A 3A6DA 1TCBA 1P7ZA 3GGSA 5H3HA 1R0XA 3WK4A 2IS1A 3PB3A 1E96A 1Z12A 4OJKA 4II7A 4K9RA 5IF3A 3G0CA 3Q3VA 1SK9A 1U0NA 1DUVG 2QTVA 4RS4A 4O2RA 4RA9B 4XCVA 4KQXA 4OAQA 4ZQCB 4ECAA 1PGNA 4G4IA 1GV1A 3OLXA 4H7DA 1LTQA 1OI4A 2BMFA 3GJ3A 2JD0A 2GXAA 1PGQA 1XI2A 2IYQA 3U7FB 1JSZA 1JN0A 1OIXA 1CETA 1KMHA 1ODSA 2AN3A 3M6WA 2V7PA 3R3WA 4FEEA 4M8NE 4KO2S 4URXR 2QNBA 4IPTA 5K3BA 3ZK9A 4QBGB 3NNNA 1VXOA 2JGDB 2OV6A 2UKDA 3FYDA 1IU9A 3AZQA 3D0RA 3GJ7A 3IP9A 2JVKA 3ZDXB 1HDYA 3EVCA 4Z49A 1K5GA 3KD3A 5LMZA 4FFMA 1VYTA 1XBTA 3FMPB 3FVVA 2VA8A 4ARBA 5A4JA 1PFKA 5HWSA 1W49A 2Z3VA 4ZEVA 4OFBA 1EFRD 2GF2A 1VRCA 3PTLA 2EBHX 2QTMA 4BQEA 5ILOA 2JGEA 1X19A 3WGHA 1YZKA 1IC6A 2HZBA 1E3SA 1K9VF 4NFLA 4PNPA 3MGAA 4KGDA 4PZEA 3EDCA 2GK4A 3DJFA 4N8SA 3O4VA 2HA6A 4AQDA 2QYSA 4ZAYA 4RE5A 3EODA 3LCUA 1S89A 5EYPA 1EQAA 4RH1A 4KK3A 2D1QA 1O9BA 1RT9A 1QS0A 3CS3A 4JITA 4PBSA 2XXAA 1F1BA 4BV2A 3H84A 2DETA 2LKCA 4K9DA 1ISFA 5H02A 5EAIA 5HBGA 3EGCA 1LDYA 2ECFA 2AKAB 1EFPB 4F6LA 1KVTA 1II0A 1QH1B 4LXTA 1BIFA 3HJHA 1XDGA 4RULA 2B1IA 4A26A 1PT5A 4URVR 1JMYA 5DX8A 5DNUA 1OWNA 1KJ9A 4GXQA 2FH5B 2OA0A 2QYHA 1Z0UA 3KJGA 3V4PB 1B6TA 4ER6A 4EVQA 1QCCA 3DV0B 3KWFA 2KE5A 2DFPA 3HJBA 3GHHA 1NV9A 3IUEA 1EDOA 1M1XB 4H1UA 4I9HA 1N2BA 1NBEA 3WIBA 1KGSA 3PP8A 3WB1A 3L1KA 5IAOA 2D06A 4BEVA 5CAEA 1OC4A 2W4IA 4EVIA 5KWIA 5DM0A 1WU7A 1YQEA 3MPOA 5LXTA 1H2FA 1O8CA 1QK5A 3EMDA 1EXNA 5JASA 3P2OA 1U3TA 2PX5A 3L0CA 3OZ7A 4QHSA 1I1HA 1Z8NA 3DWEX 1UPCA 1UBNA 3LDHA 4ZI5A 1N6IA 4V0KA 1QR2A 3WKAA 2JAWA 2P9TA 2RKWA 3C3EA 2AXQA 1QFZA 4UUPA 4LF5B 4UATA 1E64A 4PHHA 3WIVA 1UWCA 1XYVA 5AHKA 3RM3A 2VJMA 1RQ2A 1P7PA 4NYJQ 4B1FA 3PNVA 4JV5B 3NETA 3RU2A 4C0LA 2W6MA 1RU3A 4F12A 2QW8A 4QJ3A 1SVMA 1RWKA 3Q8XB 4LYAA 1ORVA 4RK1A 3RU3A 4EL5A 1XKQA 3NPMA 3U5ZB 2ZR9A 3AFGA 1E2LA 1LDEA 2B25A 4MGIR 1F3OA 1OKKA 3PGA1 1T6BY 1VE6A 1I36A 2YYYA 3VYRB 3G2QA 4G0WA 1W5EA 2IWHA 3RIXA 4AROA 4RDXA 3O91A 1O5IA 4CIBA 4ZU1X 4P6VF 1C9JA 4CM5A 2H5JA 2NO7A 4DA4A 1IJBA 3Q15C 4JXJA 2V6BA 1RWPA 1H69A 1QM5A 3NKFA 2J9GA 1NXWA 3PNYA 3QBTA 5ALSA 3GZ4A 3LDUA 4G65A 5C8YF 5KNDA 1RI2A 4OO3A 1ZM2A 4MCIA 2ZVQX 2R6JA 3L0ZA 1KRWA 5EIFA 1XAJA 5AW3A 1FNCA 1PWZA 3B52X 4B83A 5AK3A 4CL2A 4IINA 3ZU3A 4P31A 4B76A 3ELDA 2ERCA 4HLUA 5LXTB 2W8BB 3D7RA 3RT9A 3TYXA 1BS1A 2YYZA 5F4ZA 2PMEA 3TW6A 1BEUB 3V1MA 1ZEMA 2XSZD 1ULBA 1W0JA 3MJ4A 4URFA 4DBLC 3M4JA 3O93A 2NQ2C 3RE1A 1H2HA 5CX1A 1DINA 3JZFA 2ZSJA 1U28A 2P5UA 3QX8A 1DUSA 5B7PA 3MM4A 4RK0A 3ZU4A 5F76A 1A1SA 2C2YA 2LCIA 5JXJA 3FSGA 1FUEA 4KWEA 2WMNB 4UD6A 1H93A 4EW6A 3KUUA 3IMKA 1V48A 4G5OA 4G5HA 4DNFA 4UBKA 4S35A 2C5AA 4REQA 1K9SA 3JTEA 5K05A 1PK9A 1E59A 5LU8A 5IVKA 3EG5A 4MKHA 1W0KD 1BDJA 1LBSA 1V3TA 4OJYA 1Y4UA 5ALLA 3R3XA 2ESRA 3ZX4A 2R2GA 3VYUB 3LK6A 1YBMA 1AZSC 2O0MA 4M36A 1P6QA 2MHCA 4JGBA 5FBWB 4ZT4A 1WB5A 2R47A 2Z43A 3IDFA 5KJCA 4TWBA 2XWSA 3W2EA 4OB8A 5K8LA 1NASA 4E2ZA 2DBVO 3AQIA 3VU3A 2WWIA 4JEUA 1FVXA 4ZI7B 5E0KB 5CDFA 4M0PA 3NG1A 1VYUA 2BHSA 7AT1A 4LYEA 1RXCA 1RBQA 2XGMA 3O1HB 5EIBD 2XHEA 2Q3LA 1E98A 1PO7A 1SQ0A 4NG4A 4D44A 3W7AA 4EDFA 5I7HA 5C7IO 5JIBA 2ZDGA 4IL5A 4R1QA 2BGWA 4NARA 3RVLA 3TOCA 3DUFA 1XDUA 3JWPA 3T5MA 4Z0PA 5L3ZA 2PL1A 4X20B 3H97A 1P5RA 4CR8A 2E4WA 4G1VA 3UMYA 2ZGVA 2DH6A 2COKA 2VSOA 3E03A 4BN4A 2J33A 2NTNA 2BH9A 4GGPA 4A6PA 1P61B 1R5BA 4HDRA 3BA6A 4QTXA 2CUKA 4PYNA 4RPJA 4N3BA 3U3KA 4BJHB 4BZPA 5CFRA 3JWGA 1X7ZA 3DO5A 4BRSA 2Q7XA 3D5QA 2PXHA 3UC9A 4C6HA 2ZTUA 3NBYC 1PR9A 3EYWA 3CLSD 4JB8A 3ZWXA 4Z4FA 5FBQB 1O1YA 1P9WA 3KZKA 1DAKA 4MQBA 3Q3JB 3NOQA 4KLAA 1UJ6A 3TUZC 2EFJA 2GK7A 1X2EA 4M0DA 4W1SA 5AESA 2EKLA 5KTRA 3C3JA 1H2WA 4G56A 2YJTD 2VK2A 3L5OA 2Z95A 5EWJA 1KZHA 1UXJA 3ZHBA 4PHTA 5A5EA 4Y2XA 5FFNA 4O8CA 5JCJA 2WM3A 2CW5A 4U02A 2Q4DA 4Y2YA 3ZVMA 1I6KA 4S3MA 1AD2A 1XZQA 3F9RA 4KO8A 1HDCA 3WJ1A 4E7PA 4F9GA 5DTEA 5CBKA 221PA 3H42B 4RF4A 1U2ZA 2GVZC 3CXRA 4OIFA 4GF5A 2PGOA 4TLDA 5KTMA 1E7QA 1NFFA 4GX2A 1HDXA 5K0JA 1ZLXA 4FJ1A 4OSEA 3STHA 3T7TA 2IEIA 4DMKA 1MOPA 1XNGA 1YBFA 1Q1BA 1AO3A 1QCYA 1ENPA 1RXIA 1ZUHA 3A4IA 4WERA 4C7KA 4YT4A 2ZBDA 4ALMA 3H2IA 5KOHB 2RE8A 1FXSA 1FFEA 2FETA 1V25A 1PNTA 3O2JA 4PIPA 2NYAA 4H7PA 2B20A 2C7VA 2DULA 4I9FA 5A6SB 3JQPA 3SIWA 3CR8A 1JKJA 4PINA 4QQKA 2UXDB 4HEQA 4Q39A 2PS3A 1GLNA 2YQZA 1XRLA 3TLZA 4N7MA 4CV0A 3TN7A 4EB3A 1OJ7A 3FFAA 2XCRB 2QTFA 2C99A 2ZAIA 2XITA 1J56A 1JXMA 4HQRA 4M1TA 2Q4RA 4QQFA 5AVOA 1JEYB 1J8DA 4AX8A 4QUJA 4MAFA 4D5EA 4IUDS 2W70A 1XZFA 3TMYA 3R09A 4NV1A 5IDYA 4AS2A 3E3LA 3PWZA 2REQB 2MR5A 3UK6A 5IDXA 4Z3OA 4RWEA 3W2TA 4FNMA 1L4GA 1PFQA 2WAYA 5HKKD 5KHOC 1K6XA 4NJMB 5IHPA 1BX3A 1MN6A 3D3WA 4O63O 2DTEA 1GY8A 3HB0A 1H05A 2C9ZA 3W4IA 2YOHA 1LH0A 2R65A 3GA5A 1GHTA 3THSA 3AVVA 2FPRA 1PZNA 1XVUA 2OBXA 3ERCA 1O03A 2VQDA 3NVAA 3ONDA 4W8OA 5GJBA 4RX1A 1ZC3A 1A98A 4WAUA 2FXIA 5IJ9A 1I7DA 4AKIA 4BMSA 1AMNA 1L6RA 3SC6A 4F4CA 1LJLA 4YRBA 5B3JC 2VPQA 4XRRA 5EP3A 4DDVA 1VL1A 1K27A 5F9MA 4OY3A 2VRNA 2YINC 4KLRA 1KWGA 1HFWA 1O96A 1SU8A 4TV9A 3I01M 1U1IA 2MSEB 2MYUA 3E2IA 1IXRC 2BTQA 1P4AA 3BB4A 1GPH1 2JAQA 3ELYA 2V9PA 3UV3A 1Z2AA 1P73A 2ZWMA 2ZWPA 3BSSA 3OX3A 4IW3B 4J1NA 4PZCA 1YAHA 4U63A 3RSGA 4YH1A 4CCWA 5HZHA 4BUZA 3R5HA 2XTZA 3B6EA 3ZWKA 5B2EA 1G38A 2FUG6 4PWZA 1U2DA 5EJ6A 1GPAA 3TRIA 2RI0A 3WDLA 4F7WA 2VP9A 1SCNE 4N5NA 3RK1A 4ESHA 2YYAA 3F4BA 2O8FB 3IIIA 3U13A 4E13A 5D84A 2PA3A 4KDRA 3UKOA 2XB9A 3D2CA 3VR3D 4MR9A 2X14A 1SVLA 1T34A 1V37A 3AW8A 4B45A 3DL4A 3GLSA 5DCYA 3FRHA 3NW9A 1PVOA 3P0HA 1TU0A 4OU5A 4EG8A 1JE0A 2A6PA 2Y1KA 5AVRA 2WD9A 2XRFA 2WIKA 3DT9A 1M1YB 1GV0A 3F5SA 3FDIA 2EHDA 2AG6A 2CE2X 3BWDD 3LWZA 4MQLA 1P33A 4MROA 4Y1FA 4BAUA 4D81A 4F04A 1GTZA 4CXMA 4NPAA 2GBCA 1GPJA 5GOTA 1BRTA 2CNBA 3GGOA 5JS1A 1KGDA 1KMIY 5COAA 1XDWA 4OGLA 3GQBA 4E5VA 2I80A 1NFRA 1OTXA 1JA9A 3IURA 3CH7A 4LKOA 2IV2X 3HKDA 3TKLA 4BB6A 5A4MS 3VSDA 3LQ4A 3B6MA 3QPWA 2ZIVB 3T9EA 5ESRA 3FSRA 4KV9A 1TU4A 1OWMA 1H2BA 4W5JA 3C8MA 2C4UA 3CJQA 3ZGNA 4GVPA 2QSZA 1JHXA 2RK3A 3ZKAA 3E48A 4MAMA 2MCFA 4LYGA 4BO4A 2RKBA 2A4KA 1AGPA 2IGBA 1JLSA 3EQ2A 1YULA 4CDRA 1JHZA 3K9HA 1C1DB 5K45A 3DBLB 3GPIA 4L16A 2F2TA 4PX9A 3NO4A 5DSTA 5JJIA 4FHZA 1L7EA 5T8KC 1KI7A 2VJYA 3ZXSA 4MEAA 4IQFA 4DILA 3T0GA 3I61A 3FFTA 3TQRA 2C2MA 5C32A 3MWDB 5JEDA 1E2NA 3NYQA 1T3LA 2CGEA 3K6RA 1ZC4A 5EKXA 4ZXFA 3I9NA 2CF5A 3PEFA 2VBCA 2V7BA 5FV7A 4FYPA 3RFVA 3STWA 4X1KB 3IIJA 3R3ZA 2ZJ1A 3V1UA 4Q3AA 2QD1A 1EFVB 3NHRA 3ZCSA 4Y0NA 3L43A 1Q7EA 2OE2A 4HMQA 4AY4A 1QH9A 4RADA 4BEBA 4IMRA 1O95D 2FPIA 2H4YA 3CBGA 5EKDA 3OLQA 3BD8A 5G1PA 3V3TA 4I6JA 3RRMA 3QM1A 2F6RA 3LT4A 3CW9A 4LJ8A 2QUBA 5AVKA 1BMTA 1PDVA 3KB8A 4OJNA 3U4IA 2CCGA 4XVRA 3MERA 3IQEA 1U65A 2I99A 4EO7A 4EKYA 2BUBA 1G5HA 3STUA 1ZI8A 3NOOA 1K4MA 3PZBA 1SKYB 3FLMA 4DWJA 1DO8A 5C5EA 4LSZA 4G0NA 1JWBB 1PTJC 2Y76A 1NXQA 4H4CA 1AN0A 4NBSA 5FYQA 5B12A 1IXYA 1ZH0A 3QBVA 4O4HF 1QOPB 4QXQA 3F3MA 2AKEA 2I7VA 4ZYLA 1S3IA 2YXEA 4QXOA 4HPJB 5FR1A 5FUBA 1TMYA 3QYFA 3PR3A 4NDZA 3FPHA 3CN7A 2FW8A 3NGXA 4JVMA 4EJMA 4XFJA 1CP3A 1D07A 5HIJA 5KWEA 3A7DA 1U7WA 2D00A 3I28A 3HY6A 3OE7A 5KQPA 1L7DA 2NOAA 1U94A 2VWPA 1NUQA 3A3KA 4S24A 3UHAA 1M0WA 2AJDA 2Y05A 2EP7A 1Z6QA 3FRJA 5JXHA 3MAJA 5IPFA 4I50F 5EEGA 1WTCA 4HB0A 2Q2QA 4YIKA 3WRXA 1NVKA 2RGEA 2VIIA 1GQYA 2RH8A 3MTEA 4I5FA 4LRQA 3H9CA 1OI2A 2OILA 3KVRA 3KXLA 3BE5A 3PUXA 4FYJA 2AEMA 2WTMA 3P2EA 5JHGB 4IIJB 1Q1EA 4EITA 3U4AA 3PT5A 4C4RA 1Z0ZA 1KA9H 5BQPA 1TCAA 1DG1G 1SB8A 3NBZC 4NMMA 1KORA 5DHPA 4ZDWA 3DMYA 3REQB 3W0LB 4MVJA 5HZMA 4KREA 3A1TA 3JQ7A 1DEKA 1YTUA 1ZMOA 3R8XA 2KPOA 2PBRA 3QTLA 4ACBA 2O5RA 5J2UA 5CTAA 4EHFA 2C9CA 2R00A 3NANA 5FJJA 4JL6A 5CK5A 2FPPA 4CM7A 4MA4A 5KTKA 4DC1A 1DGQA 4C5BA 5JD5A 1IAVA 1M5TA 1QYDA 2VQ3A 1OFIA 3AY0A 4YQYA 3TLYA 4EKGA 2B99A 2YOFA 5FPQA 1YRLA 4WZBA 1KZGB 3SGLA 5HEKA 1DC8A 5M2QA 2IBSA 4WTOA 3T1NA 2QQ5A 3ITDA 4HTAA 5C3UA 3MG9A 1DXHA 3OUUA 3RR2A 3P94A 4X1YB 3IJRA 4B3SB 4U0JA 1MO6A 1AG9A 1WM1A 4HUQB 1DNPA 2Q8QA 2GJKA 1NVDA 3AETB 1UMKA 1KI1A 4BFCA 1WQ4A 2W2LA 4QBIA 4ZVOA 1SOWA 3EC7A 4MCAA 4GE3A 4NENA 4X93A 3VU9B 1OBFO 4CLRB 4EG1A 1PHRA 1XJCA 3ZZ1A 1FFXB 1R8SA 5E1DA 3FWYA 4WY8A 1ISSA 3Q7PA 4DABA 2AFIE 1US8A 2J9YB 4TMYA 4BVJA 2IZ5A 3QFTA 2E4YA 4DCCA 1EM8B 1O9HA 2D0IA 2XY4A 3BL8A 2G0TA 4G5XA 4YJFB 1A97A 1Z8FA 2E0IA 5MFZA 2I3AA 4B73A 5LNK1 5CA0A 4F4FA 4PQYA 1KYVA 4WFQA 3HEMA 2AXNA 2ZJZA 4WJKB 4DZRA 2C84A 2C1ZA 1QKKA 2V7UA 5DN6D 3QLVC 4QODA 1XPUA 4ITUA 1L5OA 2B8EA 1P7CA 1IONA 2ATXA 3MWEA 3WWCA 5LZ2A 3GLKA 4MGKR 4F21A 3GT7A 3QMMA 3MBOA 1PJQA 3I58A 5L6LB 2O54A 1CR0A 3E9YA 3DEIA 5D6OA 4IKEA 1GXSA 2B9EA 5JZ9A 1FTNA 2PWYA 3GFFA 4RV5A 5DSXA 3EZ9A 1UMCB 1YR6A 2VPZA 4AZWA 3R7WA 1KI6B 1A9SA 4L4RA 4AC9A 1XRJA 1FDVA 2WJVA 4OIMA 1MRSA 2GSDA 2JGAA 4IDFA 4J16A 2J0SA 1P1RA 2HLDA 2JCYA 3KPWA 4UNNA 3AVUA 5IJXA 2AVNA 3LY8A 3EPKA 1L7NA 4RMJA 2H51A 4PGMA 1IFXA 1RMYA 2OQRA 4XWGA 4DLTA 3WLHA 1NVGA 1C0KA 2QTNA 4FVTA 2VUIB 3DE7X 4KQWA 1Z08A 1YJAA 2BPOA 1CUIA 3VO2A 5FWYA 4CTJA 4OHXA 4DYDA 4UMVA 4FI3F 2FX2A 3V55A 4XJTA 1GAEO 1WXDA 2O50A 1MAVA 1P8JA 4DLVA 2UVQA 4DQ0A 5BMVA 3TTUA 2A30A 3QI7A 4X3CA 1R8YA 3B1JA 2HF8A 2BGKA 3KPUA 4C7VA 1V16A 4HBZA 4OHOA 1NSTA 5LDGA 3UXHA 1DBIA 1EVYA 1Q44A 1E3IA 4DBLE 8ATCA 3D8NA 1UKEA 4BBPA 2X8AA 5KINB 5IAEA 1OXSC 3VDMA 4RD4A 1QC5B 2CXHA 4IX1A 4F3RA 2C2BA 1QFYA 1R66A 2YXBA 5CDTA 2R6DA 2VZ0A 3HKEB 2OCXA 2FX5A 3PE6A 3C4QA 1RP1A 4KDFA 2II6A 4YT8A 1N6KA 5JSUA 3DSRA 3L4EA 3QLUA 2QL5A 3L8ZA 5TNXA 3RKSA 3CR3C 5JBQA 3REFA 2DUNA 1IQUA 4HEA1 4S2EA 3K6JA 5B2FA 3A2MA 5ALXA 1ZL2A 4ER5A 5BNTA 2ZBRA 2GN4A 1E6UA 3QH4A 1O2DA 5IVIA 1M6VB 2CXOA 3W05A 2HZ7A 4FBLA 1AXGA 3FNGA 1Y7IA 2FWPA 5K6RA 4QGAA 3OQNA 1FSPA 2A0KA 3Q3IA 3N2KA 5T67A 4XPIA 1YZTA 3RSCA 1ECGA 2DP4E 2VJCA 3CPJB 3PA6A 3PBKA 5HQJA 3RS2A 1MU0A 2OBLA 5KX5A 3MT8A 5LOVB 5BORA 3TAXA 1JEQB 1RKBA 4RJKA 1X7YB 5F9FA 2UVPA 4O4LB 2A94A 4B5LA 1AKRA 1AUQA 4FUTA 3TSZA 1E2DA 3GLRA 1H65A 2YNMA 3GCDA 2I4OA 4FFVA 4N47A 1XPOA 1E3WA 5KDOA 4TWRA 1NC3A 2P9FA 3C5EA 4C4AA 5CG2A 2BI7A 1W36B 3TZBA 2R79A 1NBMA 4RGQA 2NO0A 1DX6A 3VKWA 3HBFA 3TLMA 5DHQA 4Y30A 1LK7A 5HQ3B 5EXDA 1GUYA 1WPXA 4KODA 1SUWA 2QXYA 4HFJA 4KCGA 5FA5A 5J4KA 4DM3A 2GA9A 1U8EA 3LOPA 1B2LA 3H9BA 1HSOA 4ZT2A 5CBPA 4TUYB 3M70A 1PLKA 5HCIA 4CM8B 2W00A 3LRPA 4ZFNA 2XNHA 4W5TA 4QGFA 2B6NA 4XW2A 2Q6VA 2GCOA 2I22A 1VGRA 3AB3A 3ZWCA 3LQ1A 3EIEA 4M7OA 1RXVA 2HIMA 4N54A 4HS4A 4C5AA 1A8IA 1WDLA 2E7ZA 3AI7A 3RVJA 4H08A 1SU7A 2VPIA 3I1YA 3NWBA 1KP9A 2F8MA 1Z0JA 1GVNB 1K4KA 2QLNA 3NTVA 4JLDA 2FJUA 3ZD6A 2WT8A 4D4MA 1JDPA 3QKRB 3FCSB 2TSYB 4U6SA 1ZH8A 2HF2A 4OL9A 4L2IB 2HPVA 1WWKA 1UBKS 4PFJA 4JUAA 2W4QA 5JSZB 1TUIA 1F5NA 1GCUA 2NTVA 3BN3A 3C97A 1SCAA 3U80A 5DNEA 3UM9A 5KQRA 1PJBA 3NX4A 1NZJA 3SX2A 2JNWA 1J2RA 1M2NA 1TC1A 3ILYA 5K2OA 5JAUA 1VJ5A 2FUCA 1TK3A 3DZGA 3G79A 3KZCA 1JDNA 4MWZA 4RHEA 4G9BA 3Q2IA 1QX3A 4M9XA 4OUDA 4UCFA 2JD1A 3PVZA 1SKQA 1DQRA 2ERYA 4GVLA 3ISTA 1V41E 1L4YA 5ALDA 4OX9B 5FNVA 4BNJA 5DYTA 3OT4A 4GPTA 3WFJA 3QU7A 3FKJA 3QZUA 4Y2QA 3S1LA 4XM2A 4N0DA 1SC6A 3U1BA 2ADMA 1CJCA 1U0JA 2YQ4A 4H6WA 3U7QA 4QYSA 3NASA 1Z5PA 1ITZA 1QORA 1MIOB 1X3LA 3FNQA 1IZ8A 1B26A 4DMLA 1C1XB 1ZN7A 4DA0A 3M6AA 4QFDA 3K5IA 3V8VA 2B4AA 1U2PA 3DLIA 2B1QA 3Q6IA 4D0NA 3U9SA 2JGRA 3GC6A 2PE5A 1SUBA 2VXCA 4EJ0A 5BUQA 3LHSA 1J5XA 3FWKA 4M83A 2XOXA 1YJ5A 4QJBA 3UC5A 2Z2ZA 3HI6A 1U0BB 5EHIA 3AKZA 1WRBA 2X8LA 1IWOA 3R41A 4PIVA 3DDWA 3IRVA 2AB0A 1AX9A 1SELA 3BS4A 4M1WA 5HRUA 4Q37A 3IP8A 1QRTA 2FP3A 2LP4Y 2HW8A 1VKOA 3WL3A 3OU2A 3ZWWA 1YBAA 5COQA 2IU6A 4BMPB 2B7CA 3MINB 2DY1A 5LQAA 3LY5A 1SC9A 3KO8A 4EHAA 3L0IB 1P60A 1L5LA 1Y5NA 4JJ4A 2EATA 3FPJA 4S1NA 1I1QB 5AJTA 3H0EA 1RAEA 2E21A 2D4HA 2DQZA 2TRSB 4UZSA 3HEAA 3HVHA 4YDSA 1E6CA 4YR7A 3I5AA 3RODA 2JC3A 4PC3A 1KYTA 4PTZA 1CYEA 4CCYB 2GN9A 5I47A 3B1KA 3EVNA 2FOLA 3ZY5A 4ID9A 2C4VA 4MJLA 4EZEA 1J20A 3FG9A 3IPAA 3NIWA 3PRHA 1Y3IA 5KTTA 4YO7A 4LJ7A 5M04A 5G4LA 2CXXA 2VT3A 1UKCA 5EMHA 3EZ7A 4MW4A 4G6ZA 1CVIA 1SUDA 4CKBB 1W9HA 1ZAKA 3T38A 1W7AA 3DBVO 1ZVJA 1PCXA 3KZNA 1D0IA 3GN1A 2A59A 3BMQA 3E3AA 1J5EB 2WSLA 4NEQA 3HMQA 2VP6A 3D2AA 1A8QA 1QB7A 3VZBA 2F48A 2QGNA 5BNIA 4L6CA 1RPZA 1BWQA 1DEOA 2BEJA 3FAZA 3N70A 4TKVB 3DMRA 2HQRA 3PWKA 5EMMA 3O26A 2QLFA 3KZOA 3ZG6A 4DT1B 3T3IA 1U31A 1M34B 1YK1A 3OIWA 3WWZA 4FE7A 1SUEA 4O4JF 5E1BA 5E9QA 4B71A 4COOA 2PUBA 1P3JA 2V4MA 3ZJ5A 2IH4A 1VYVA 2OXCA 3JQFA 1BH6A 2FCRA 2CLHB 3FHJA 2Z83A 1FZTA 3IUYA 4G85A 1N0IA 2HBQA 2YVQA 4BLRA 2PD3A 4BRUA 2AGVA 1W4CA 3AEYA 1BE1A 4MW7A 1ULTA 5K6TA 1QP4A 1Y6FA 2KLHA 2OO3A 2QLJA 2IYLD 2Q8PA 4P5EA 1ZD4A 4B9EA 3R8FA 3K8QA 5EOVA 4C2BA 1ZW1A 1S2NA 1TKAA 3E9CA 2BGUA 5F5NA 4FEYA 5FR2A 3W5BA 1QRSA 3H1BA 3BILA 3LU1A 2XBMA 1ZI9A 5LA6F 5MHTA 3SN6A 2PUHA 4FE3A 1R10A 2W6IA 3LPDA 3QGMA 4LHZA 4NKRA 1E5XA 1DL5A 1JHYA 1KY5A 2OHOA 1DC5A 4JOBA 4NJEA 4J4TA 1C8BA 3U2QA 1JI3A 5ICFA 5FBVB 3U26A 1XEWY 4ZZ0A 5I3CA 2ZRLA 4ZD6A 2PZFA 3TTVA 1CDOA 3F3SA 3GEDA 4WNAB 3UHOA 3LUFA 1RZVA 3OZDA 2Q3MA 2IL1A 2YY5A 3IUPA 2VNJA 1OXMA 2VYQA 3PD1A 5KYVA 3CEPB 4EPWA 2H06A 1KFKB 3B1WA 4KYVA 2RC5A 5ARBA 5MDHA 2QN8A 1IQRA 1OU4A 1Q0HA 4OGWA 5E4TA 3U37A 3INTA 2P3SA 4KFCA 4W1PA 4PGHA 2A9OA 4AXXA 3VI3B 2YN2A 3IQGX 4GX5A 1ZUNB 2CZQA 2OC4A 4ZANA 2VWQA 1FXWA 3SR3A 4G0PA 3DZJA 2RGRA 1G9XA 3A1UA 3HZZA 1XNRB 3OEHD 4GSYA 2GKGA 2YN0A 3UENA 3EXAA 5KYYB 1QIEA 5LZ4A 1C30B 2G28A 1LVHA 2Z1NA 2ZTVA 3HKCB 4UUQA 3W8EA 5IKEA 2EEZA 2V65A 4Q0MA 1JFRA 3CNNA 4XD7D 2AEJA 3L7BA 3MJCA 1S0UA 3CVJA 1QPBA 2BN4A 3AR4A 4WJZA 3AU9A 1HLGA 4Y2UA 3ZCQA 4Q4JA 3R7SA 2QUIA 4BNIA 5ES4B 4QM7A 1P4HA 1CUEA 1M34E 4K9QA 4Z2YA 1X7WB 5TS3A 3HSYA 1KY4A 1UDCA 2NSLA 2QJOA 3D81A 1ZX1A 1QO0A 2YHSA 4L8GA 4MPTA 4NBKA 1HKHA 1L5WA 4RFLA 5FBRB 4DV3B 1K5HA 2FPXA 1G9TA 3D6AA 4N8DA 4Y6LA 3WBFA 2IZZA 5BSFA 5I4CA 3GJQA 3VZCA 2I4NA 1SKUA 5CHEA 1L4EA 1NQWA 4LXYA 5TQ0B 4WLEA 1N4AA 1Q0ZA 2BMWA 5LYJA 4IZOA 3LO5A 2OCGA 2ECKA 2VLIA 4KE7A 3A9TA 3SC4A 5KOIA 5ADVA 4H6XA 3PXDA 1I2CA 2Q0SA 1U3CA 2XYHA 4OB6A 1FX0A 1TZCA 1NLFA 4LY6A 4Y6SA 1P77A 4K8RB 4ZDKA 4W9MC 2PZGA 2EGGA 2JFFA 1Z13A 2Z2IA 4PFSA 1WXXA 2G83A 1ISPA 1SN7A 4YC7A 5FPYA 2RONA 2RH9B 2HMTA 4QDUA 1QHGA 3GWGA 1ESNA 4KO3S 1FFWA 4QOHA 5TGTA 2OORA 5CH5A 5CTJA 2VHYA 3JW8A 3MBKA 4ZI3A 1YGPA 2O2XA 3HDTA 4MWSA 2GDJA 5L53A 2EFHB 4LY9A 5K2MA 4FJ0A 2SKDA 4GX1A 2EKZA 4RD3A 2G25A 1UPAA 1VMKA 2Q6OA 4IY1A 5TQ2B 2H1HA 2PYDA 4XTRA 5ECYA 3SQDA 3OEEA 3P0FA 3K70C 1NKSA 4Q1BA 1QHIA 4LOKA 4QWMA 5D2CA 2O8VA 4D9BA 2IP1A 3E9NA 2WI8A 3AY3A 5GINE 2QMYA 3ZJTA 3KUXA 4XYMA 1W36D 1BA3A 4AU1A 2HADA 1GCAA 2R1VA 5TJ9A 5TSDA 1SG6A 1KZ1A 1KYWA 1JWLA 2ZRBA 1P6XA 3DT8A 2OC9A 2ZRNA 2IIBA 4KXVA 1MX9A 3ANXA 3DHVA 1OXBB 3GP5A 1KQNA 3HK2A 5GZ6A 3RWMB 4B5KA 4RL4A 4RLFA 4W7HA 1U4NA 2QRZA 1NHWA 1U04A 3G7UA 2CHEA 1AA9A 4TL8A 2YZ2A 5CNMA 5J9FA 4H0NA 2NU9B 1ZHOA 3GWZA 1WF3A 1V5GA 1LB1B 4PNZA 3ZHVA 4DSOA 4E12A 3K1AB 4RH0A 1Y6GA 1F2DA 2IK8A 2XCQA 3AJDA 4C7OB 1EGVB 1UBUS 3FWZA 5C0OE 4B80A 1USVA 1IWPB 4DC9A 1GZHB 4R4JA 2ZJ3A 4TL6A 3VR5A 1IATA 4ZJZA 4HEJA 2RGAA 1JYFA 4KPEC 1WCIA 4X3OA 1ZNXA 2O8BA 3ORSA 2HR1A 3CUWA 2B5WA 1L4UA 4EB6A 2CKMA 3GNTA 3H2HA 4N5IX 3H8WA 3FFBA 2G70A 4K05A 4ZWNA 4BE7B 3P9KA 1BYIA 1RI1A 1CPYA 5KSPA 1MHPA 2GN8A 2XUKA 1FDIA 3R0XA 4EI8A 2AL7A 1MO5A 2R8RA 4XASA 2R84A 1WUKS 2R7LA 2OVFA 1I6MA 4XX0A 3K0SA 3LQ2A 1PT7A 2A14A 4MUAA 5AVZA 1B3RA 4XM0A 3RLIA 3IMEA 1DO0A 1Y42X 2XIQA 4XWTA 3S2IA 4C7MA 1R1DA 2VSFA 3QUQA 4OXKA 2HLPA 4MDYA 4QPNA 3CMCO 4HN4B 4OMUA 5DX1A 4ZOEA 3L1JA 4EA9A 1GEGA 1IOVA 1P0IA 1J24A 2XF8A 1WJGA 4P84A 2OM6A 1LW6E 5KNBH 2OD9A 3AEXA 3INYA 4I19A 5ADUS 1W35A 2FE4A 1HDGO 1QHYA 3K0FB 3KQOA 4N9WA 2J3EA 1VHTA 1RYEA 1N8SA 1PSZA 1OWOA 4HB4A 4C88A 2O06A 3BVPA 3WMGA 4BN0A 2GASA 4FS3A 1FS6A 4AJHA 5DNAA 3IP7A 4TMFA 1A2BA 1J42A 2DKFA 4Y6PA 4C76A 2QM7A 1EG2A 4UBMA 4NHOA 4FIZA 4YXWD 2OB1A 4YTEA 4EYKA 2VT2A 4Q9AA 1D03A 4RHCA 4R84A 4OSPA 1ML4A 1PWYE 4BPBA 3HJFA 4U6NA 1C9EA 5BV1A 5AP9A 1C1HA 4O2AF 4E5MA 5FWNA 2ZSDA 2QZ9A 1XHFA 3PSHA 2BYTA 1N9GB 3U7EB 3WHKA 2KJQA 1NIJA 3OFNA 2GEFA 3GU3A 1XD2A 2CUZA 5I01A 2O0LA 5BVHA 4E31A 5IS2A 4DRZA 5LBIA 3PUVA 2MT9A 4KBYA 5LP6C 5EVCA 4TS3A 5K0CA 3H04A 1JVSA 1CKEA 1KAQA 3BMCA 5NULA 1KH3A 3GH1A 3U16A 3IUJA 1IH8A 1ZRMA 2GCEA 3B6KA 3HFRA 4IRMA 3H1EA 4L0MA 4AJOA 3U44A 1GKLA 3LC2O 3GUCA 2PH1A 4RCZA 1B00A 4DWOA 4HT3B 1UT6A 3TSWA 2XODA 1CJKC 3LGXA 4M0EA 1ID1A 1OASA 3M6LA 4DJFC 3NHUA 3OSUA 1UZNA 1OCEA 4EUSA 3MT9A 1H94A 4QO8A 2PUWA 3UO8B 4LMAA 3ED1A 1GADO 3MLAA 5L4SA 1VP3A 4J07A 2XMGA 3Q7EA 2J46A 4Q4AA 4JR0A 5GPBA 4Z7OB 1NP3A 1VKJA 2IC5A 2OQ2A 1RYMA 2CVHA 2XTMA 3EOZA 1IVYA 3KSUA 4GZLA 4MVYA 4JB2A 1YHNA 2WKPA 4KIUA 1BFDA 3AHDA 1QV9A 3K9NA 3MQFA 5JW6A 4AKGA 4MITA 1FRZA 1NJGA 2GD6A 5IH3A 4HDSA 4ARZA 2NXNA 3D59A 4JDUA 4KQ2A 2F3SA 4ZJPA 3UT5A 1EI9A 5T6MA 2P5YA 3WZMA 4NXMB 1LY1A 2DFLA 4QBFA 4GEGA 4ZTUB 3W5AA 2D1FA 1YS4A 3WG9A 1O58A 4ZOLB 3V8BA 2E1RA 3QU5A 4N48A 3K3PA 3TB6A 1H6BA 1T9KA 3C1OA 5FKJA 3TTSA 2AK3A 3EUFA 1EU1A 4LYJA 5EPEA 1Y3FE 5E7IA 4M0UA 2X2EA 1GRNA 1R5NA 1YCFA 3OWHA 2PT9A 4OX9Y 3L8EA 2YS6A 3L6DA 2PIDA 2W2KB 4ZO4A 4KE9A 1LLDA 1COWD 3MNFA 1EHYA 3BD7A 4RA6A 1VJCA 2D2FA 4B0OA 1EVIA 3BRWA 4FYKA 3GJ4A 4GOND 3I8XA 2D3TA 3EPLA 3E58A 1E2PA 1SHTX 4HEA6 5G1OA 1ETHA 1SR8A 2W22A 5DISB 3ZDEA 4NH4A 4QQNA 3EEFA 3PEVA 2Y4NA 1CNMA 1IHOA 2FOXA 3KAQA 5EJFA 3W5VA 1C3JA 1JR3A 1SRRA 2GHTA 2ANBA 3G0IA 4R0NA 1VCMA 3P0JA 2JCXA 4NZNA 4MO2A 4W9RA 4CDGA 1QIMA 2YMLA 3M83A 5H70A 4AJ2A 3ZCRA 5HIKA 5KWJA 4S1OA 1ONOA 2QT9A 1BMFA 1KZ6A 4I55F 1KJJA 2WUDA 5BW5A 3HBLA 5FAXA 5B1HA 4OP1A 3QY9A 2WT9A 3INRA 1M7GA 1CQJB 2XVAA 5DGIA 3TNFA 3TO5A 2FMTA 3ONEA 1LPMA 2A9VA 1GA1A 1M7BA 2WJ6A 1ZPDA 1M74A 1E4VA 3C1AA 3MWLA 3OPYI 5CVVA 3GFBA 3HHEA 4JODA 2JLQA 1XP5A 3FJOA 4MWEA 1T5SA 1RI3A 5TIIA 5ALNA 1ELOA 1E9CA 4CM4A 4FX5A 2C82A 1PT9A 2XYVA 1UAYA 2I2BA 3QSGA 3KL2A 4JEMA 1EFTA 1TYAE 2VUHB 1USIA 1GU7A 4KN8A 4J2OA 3TXAA 1HE4A 1J22A 1S8AA 1XMPA 2GYYA 2O7NA 2QZPA 1Z28A 3FZGA 3JQEA 4JQZA 4UE3S 4L8FA 4DLLA 1SXGA 1VGQA 4F3NA 1JILA 2ZRKA 1LI4A 3NP9A 4TKMA 2XCUA 3FCUB 3GRPA 3TE6A 1D2AA 2Q0QA 3RAGA 4EBFA 3TPFA 4UNRA 5EWMA 1CIJA 2E6KA 3SYTA 5ADWA 2H1RA 2J30A 2ZJ8A 1YJ8A 2XEDA 3AUTA 4Z1MA 1NLMA 2JH8A 3I9LA 4YP0A 4GMFA 5C5CA 3HP1A 4CEHB 4P93A 3ROZA 4D56A 1P1IA 1PJRA 4YRIA 2A1IA 5JS8A 4OHPA 2QP3A 1GUFA 3BSFA 1PS0A 5HCUA 5CB4A 1Z2PX 5LZ7A 3ZC3A 4Q00A 4AMGA 1P9OA 2PRZA 4GP7A 4FGLA 2EX0A 3WGNA 1QVAA 2J48A 2P3QA 3WGMA 3OQIB 2OAGA 2ATEA 2H4JA 2KYRA 4I14A 4HWGA 4TMWA 5E4FA 5AOCA 5B30A 3WK5A 4DNXA 1FMLA 2WFLB 4B87A 3GK3A 4IFBA 4BEJA 3M4YA 4OBEA 4RK6A 2BI8A 3AJ9A 3SEQA 4HVLA 5JAMA 2XEXA 5DIZA 2BEVA 3TW0A 5FL7A 1EFDN 2IXAA 4IMIB 5BN4B 2P30A 3W6OA 4KITB 2ZE5A 4J0FA 4BCBA 2HQBA 4UQLA 1I3NA 5TT1A 1IJKA 3I92A 3IP1A 3RFTA 4XXHA 1R0LA 1T8RA 1W5FA 2DUMA 5LB4A 3PXEA 2HMYB 4Q18A 1IN4A 3ZGYA 1DKRA 1N5MA 4HLNA 4DIOA 4N49A 3DULA 4PXAA 1X8JA 4TV8F 5CXSA 3T0IA 2IIQA 2PUGA 4BGDA 5JHHB 1N77A 2CBXA 1HMPA 4A03A 3ESRA 1NI3A 2P6OA 1A0OA 5KWSA 3LKBA 5D5PA 3V3KA 2GAFA 5FORA 1GTMA 4W6QA 1YQXA 3I9FA 2C3MA 1Z7WA 1I33A 5EMNA 2GI4A 2Y0CA 4MH0R 3M6FA 3NDRA 1T5OA 3DDOA 2H1OA 4P4LA 5HMMA 4MPPA 4R1OA 2HT6A 1LNSA 1WZNA 1L5QA 2A33A 2LV8A 5GMOA 1H8HA 4R81A 3CB4A 3WKBA 1ADFA 2P27A 1XV5A 1IG3A 3AEZA 2ISSD 5ABPA 5IFKA 4AK9A 2OGUA 2IOFA 4FMDB 4I4TB 1TLFA 3QWHA 4BNWA 3VPBA 4Z3DA 3LX4A 4Q3LA 2YFKA 3V8QA 3ED5A 2HI0A 1Y9EA 4W9NA 4CWAA 4DLRA 2EW2A 3VKFA 4CKCA 1SZPA 4IF6A 4N40A 4P4TA 4B6QA 5JQGF 2AT1A 2YRWA 3PVCA 4I9UA 4M49A 2PZBA 3EJWA 5H9VA 1XALA 5KQLA 5ALMA 3ZZMA 2V74B 2IUUA 3HGMA 2ZRHA 3FBTA 3IIEA 4J0DA 1V6CA 1XHEA 4ZYZA 4ZO9A 1CFJA 1MJFA 2GNAA 2WSSD 3CFYA 5C7OO 3H86A 4H7HA 3AIIA 3ZY6A 2QN1A 3N7UA 3NAMA 3VHLB 4ZARA 3AR2A 3FIUA 4W5OA 3I4LA 2PBLA 2VZ8A 4QFMA 2JFZA 1SCUA 2JHGA 4ROTA 1FW8A 5A5FA 2AMFA 4JLKA 1IXZA 4R6WA 5DXJA 5A3VA 1OYOA 4PXYA 2X19A 4HKTA 3NBUA 3RRXA 2JI6A 2IITA 1JQ3A 3KXPA 4JA2A 1U90A 5CM2Z 5L45A 4AKHA 2O2YA 3CW8X 4JVNA 2E4ZA 2GZAA 4WCFA 4M9UA 4PLVA 5FI5A 3NHMA 1QHFA 3UV6A 1EX7A 4A0QA 3U7GA 4YWHA 4XQ9A 3EZFA 3VSAA 5CCEA 2UZ1B 1MH9A 1C8KA 1QG2A 1U0FA 2X1HA 2QMQA 3QENA 4JUDX 3WK8A 4BO3A 1NX9A 2XGGA 1JU9A 3NHKA 4MQ6A 3R7DA 4P98A 4EVSA 3FBGA 2PK3A 3BZUA 4FOLA 1JYEA 1QIGA 4KPUB 3PQ3A 1PEDA 2J5BA 4AZSA 4REMA 3UWOA 5JZVA 4FCTA 3FTDA 4C6TB 2HEIA 1YVPA 4IIBA 4UHKA 4P5PA 2EARA 2GAIA 3DWFA 3RTEA 1W2HA 1V7PC 3ABSB 3ASUA 3U7JA 3TIFA 1AKTA 1ORTA 1T1RA 1U8AA 2P7HA 1PK8A 2W0SA 1NN3A 2ANCA 2WHQA 1AVTA 1X8LA 5HZGA 2UAGA 2GHQA 2HMAA 4AN0A 3E15A 4EI7A 4LC0A 3OOYA 2TMGA 4YEDA 5ARDA 1KDRA 3M33A 1SVSA 2XMBA 2ZSUA 1EGQA 3M82A 4PIMA 3VV2A 2I7TA 1D2EA 3O38A <