2QXTA

Crystal structure analysis of the bacillus subtilis lipase crystallized at ph 4.5
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
179
structure length
179
Chain Sequence
HNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSADMIVMNYLSRLDGARNVQIHGVGHIGLLYSSQVNSLIKEGLNGGGQNTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the remarkable stability of Bacillus subtilis lipase (Lip A) at low pH
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Lipase
total genus 66
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2007-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qxtA00
1E3QA 1QIDA 4LXGA 1LGYA 2XQJA 3DOHA 3HXKA 1K5PA 4AMZA 4A23A 5LZ4A 3JYHA 4BCCA 3RK4A 4YK7A 4QWMA 3PFCA 4LHEA 3ESAA 2OQIA 3IDAA 1N8SA 5BV7A 1VA5A 3WWOA 1LPBB 1VZ2A 4JYMA 5JANA 3WK6A 2XUQA 3STYA 4ZGBA 4BP8A 3PFBA 5AP9A 5C81A 5FPQA 4M0EA 1EX9A 4RGYA 4X90A 5AI5A 5CT6A 3WWPA 2O7RA 4Q1VA 3WKAA 1SCIA 1TAHA 1A7UA 1DWOA 4AQDA 4UBKA 1JMKC 3A2LA 4G4GA 4Y2YA 2GYUA 1E66A 5K3DA 3H2KA 4B85A 1EHYA 2ZYIA 3GELA 5I9IA 5ALVA 3I6MA 4MYSA 1QJ4A 3WK8A 4OU5A 5I8PA 3WL8A 5ALUA 3FLAA 4AO7A 3V1KA 1GKLA 4Q05A 3VVMA 4G1FA 4G8DA 1HDEA 1NU8A 2XMGA 4F5ZA 4HRYA 2VAVA 3A70A 1R9NA 3G0BA 5ALJA 1ZD2P 2HRQA 1JFRA 2BFNA 1PJAA 3MUNA 5FP0A 5K3AA 1UKAA 4L0CA 4X97A 1YS2X 1OXMA 3UUFA 3OOSA 1W52X 4HVTA 1FFBA 3NWOA 1YB6A 1LPMA 1YA4A 2QVBA 4OUKX 4TGLA 1F0PA 4ZI5A 1U4NA 3EBLA 1H2WA 2JGJA 4BDTA 1XQXA 1J1IA 4FMPA 2VF2A 4EY4A 3EQ7A 4PO3X 3I6ZA 2XI4A 4UBOA 4X00A 3H17A 4GI1A 4B0PA 3HYSA 3M3DA 2XB6A 2BJHA 5LZ8A 1WM1A 2BGRA 4W9RA 2GBCA 2Y1KA 3STWA 2B61A 3LS2A 3A2MA 1QIGA 3C8HA 5AO9A 5IH7A 3DL7A 4LYDA 1GPKA 4BP9A 3IBTA 5AI8A 2VT6A 4QZVA 3VISA 4F60A 1G4HA 3LIPA 5AM5A 4KRYA 2HDWA 5AM2A 2FJPA 1WPXA 4Y2XA 2Z8XA 3WK7A 4DYHA 3AZPA 5C8VA 4DMKA 4ZXFA 3V9AA 3DYVA 2JGFA 1Y7IA 2V9ZA 4DNFA 2WG0A 2QJRA 1QIEA 4LXIA 4J0GA 4CCYA 1U2EA 2HU8A 2VA9A 2PU5A 4QDUA 1R50A 1CUZA 2O2GA 3GZJA 4AX4A 2X8BA 4OYYA 4OU4A 3R3ZA 1ORWA 2I03A 2WG2A 4KE7A 2C7BA 3ESBA 1XZIA 1X2BA 3O9MA 1AUOA 4IHAA 4CCYB 4EBBA 2YXPX 1LPSA 1CIJA 1OCEA 1SC9A 1KU0A 5AKIA 3C6XA 3IUMA 4E15A 2HL6A 5E4TA 3FVTA 4H7KA 5FRDA 2C5GA 2H7YA 3WQHA 1QIHA 1UK8A 1CUWA 3A6ZA 3CXUA 1WHTA 1CUEA 1XROA 3F96A 3F8SA 5AKYA 2X5XA 5LP1A 2WM2A 3G0GA 5ALNA 2VJDA 3D7RA 2O2HA 4RNCA 1ZI8A 4GBGA 2J4FA 1NU6A 1OILA 3WKBA 2ZYSA 1VKHA 5K3FB 3O95A 3ED1A 3D3NA 5AKHA 4N5IX 5FV4A 3FBWA 1Q0RA 2WILA 5EHNA 2XE4A 3TRDA 1YSCA 3TJMA 3QMMA 3PE6A 1DTEA 1AC5A 2ROQA 1AURA 3H1BA 3FYUC 2CZQA 3K2IA 1UOPA 2HA0A 5JZBA 3WL6A 5EIHA 5FLKA 4OB6A 4JEIA 4PSDA 4WJLA 5CT8A 4ZV7A 1MAAA 5KWJA 1ZGCA 1LPOA 2XUPA 4K6KA 2XUAA 4M0FA 2JF0A 4MQMA 3G0IA 2V98A 4N8EA 5EGNA 3DOIA 3C87A 4NMWA 3QPCA 2XMQA 2XQFA 4FWBA 4IH9A 2DFPA 3BE8A 1Q0ZA 1WB4A 2EEPA 3UUEA 5KBYA 5T4EA 4E46A 4N5HX 4H18A 5FUMA 3R3WA 4DMCA 3OM8A 4H7JA 5DYYA 3GUUA 2DHCA 2O7VA 1P0MA 1L7RA 4ARBA 5FKJA 4CIAA 1QFSA 5AK5A 1CQWA 5C8ZA 3C43A 5AKEA 1CUGA 1QO9A 4MEBA 6YASA 1XLVA 2J3QA 5A2GA 1IZ7A 5JD6A 5JAHA 2PBLA 2DHDA 4L9AA 5DWDA 4V2IA 1EVQA 5LLSA 4K6HA 3A2NA 3HLKA 3JWEA 1E8NA 4N8DA 4Q3KA 4I4CA 4FBLA 1IZ8A 4MWTA 1C7IA 3KWJA 1RP1A 4GECA 1BE0A 1ZJ5A 5AK4A 1XRNA 1TK3A 1AX9A 4KRXA 1ZD5A 3D4LA 2WTNA 3S8YA 4OB8A 2HA2A 3BDIA 1EA5A 4YPVA 1R3DA 1Z68A 2WUFA 2B9VA 1F8UA 1U8EA 5BOVA 4PV7A 4BRZA 3HZOA 4LIPD 4BCDA 4C01A 4YX9A 5EI5A 2YASA 3HC7A 1SFRA 1EI9A 4C87A 4Q82A 4EA6A 4M0MA 1WPRA 1QONA 5D6OA 3SX4A 5ALDA 1XZCA 1HBJA 5CBKA 1XKTA 1ZGBA 3I2GA 3KWFA 1EB9A 2QUAA 2RIPA 3O0DA 3DD5A 5HZGA 4HXGA 1WB5A 1G5FA 4AO6A 2ZYRA 5E4JA 1J07A 3WL5A 5JZSA 3WZMA 4FNGA 3U1TA 4UHFA 3VXKA 4RE5A 4DNQA 2JBWA 4QLAA 4X94A 4X6YA 4U2FA 2W22A 4J0KA 3QM1A 5A62A 5JIBA 1CV2A 2HIHA 4ZWNA 3FOBA 5ALTA 4EY7A 4NS4A 1DU4A 1QGED 3PUIA 1CUDA 3ZLVA 2GYVA 4G8CA 1AZWA 2DHEA 4Y2VA 4EY5A 1CUHA 2DSNA 2H7XA 2HA6A 3WK5A 3RLIA 5AKJA 4TVKA 4ETWA 1VA4A 1LPNA 2HRRA 5ALSA 5H3HA 5C7YA 2HU5A 2IIVA 4FNMA 1KU6A 4ROTA 4JYPA 2XLCA 3C70A 3SC2A 4GDMA 3I2HA 4BYMA 3WJ2A 4UFNA 3AILA 3VDXA 2XUKA 2Z5GA 4LYEA 5AICA 5KREA 4G9EA 3AIMA 2VAXA 3WWCA 1S8OA 1TIBA 2QMQA 1CR6A 4GHWA 2HADA 4HZGA 4HXEB 5ALGA 2Y6VA 3VKFA 1K63A 3AZQA 2Y2VA 3Q0TA 1ISPA 2WHQA 2C0PA 3G9XA 3EQ8A 2I78A 3QPDA 4YASA 2PX6A 5CURA 2BKLA 5ALLA 5JZ9A 3G0DA 1UK9A 3OG9A 1RWQA 5CH5A 2NW6A 1R88A 3IULA 5ALZA 2OQVA 2CB9A 3SWWA 1VE7A 3L1IA 3FSGA 3KOOA 5AK6A 1XZEA 5J3JA 3QH4A 2Y2UA 4P08A 2PSDA 5HK8A 3P2MA 2JIDA 2PUJA 1CUJA 1QZ3A 1QFMA 2XQIA 3TEJA 5AK3A 1FFDA 1DX4A 3IURA 4OCZA 5CH3A 4PSUA 1VE6A 3PF8A 3C6BA 4BATA 1W1IA 2IX9A 2XMRA 4HS9A 3DNMA 4BVJA 3OC0A 1XRQA 4H7EA 4X93A 1H2YA 3FVRA 2OAGA 4H7HA 4L72A 1LZKA 4I19A 4FLMA 1GPNA 3GROA 2ORYA 4H77A 2XUIA 3H04A 3D2BA 1XLWA 4A16A 3WKDA 2XUGA 4DSZA 1LBTA 3GA7A 4EUSA 1CEXA 5CT4A 4Y2QA 2AXEA 2ZJ7A 5JARA 5DNWA 4TPKA 5LZ9A 2GBIA 1TCBA 3W06A 1BCSA 4Z49A 1W6RA 2ZYHA 1N5MA 4WFIA 1UKCA 4OB7A 4G4JA 1VZ3A 4XWGA 3H2GA 1WB6A 1YCDA 1AGYA 3O4GA 2WHRA 5E2IA 5HFNA 4DLNA 4P93A 4Y2TA 1W75A 1YB7A 3KDAA 5HFAA 4UHDA 3Q8WA 1VOTA 2AJCA 2QOEA 1L7AA 1W4LA 4BB0A 3QZUA 2XMBA 4G9GA 4Y2SA 3STUA 3V48A 3WK4A 5F4ZA 4CIBA 1IUOA 2HA4A 4AO8A 1GT6A 1MX9A 1E8MA 1FSSA 2HA3A 1FFEA 4BC1A 3QPAA 4UBIA 1DINA 3U0VA 3V1LA 4EHBA 3CN9A 3IUQA 4KACA 4Q34A 4F0JA 4H0CA 3O4IA 3R3VA 3TGLA 3W05A 2WJ4A 5K3CA 5DJ5A 1E8DA 3IA2A 4IO0A 5FDFA 2G4LA 4ZV9A 5CH8A 3DJYA 1BROA 1ACLA 4BE9A 2WUGA 2C5FA 2VT7A 4D9JA 3G9ZA 5HF6A 4NVRA 2QUBA 1Y37A 2I3ZA 3F67A 5JD4A 2W6CX 4PSCA 5EFZA 2QR5A 2XDWA 2FJ0A 5ALIA 4X71A 1FFCA 3ESCA 5ALKA 1YR2A 4QNNA 4UBMA 3VVLA 2RGUA 4BAZA 4Y2PA 2OCGA 4KR0A 3WWDA 4DM7A 4IH4A 1LLFA 1CUCA 4PNZA 2HFJA 3C5WP 1EDDA 4UBLA 3C5VA 4S0XA 1MX5A 1XRRA 3IUNA 3STVA 5AIAA 5FXMA 2HU7A 5K3EA 5EIAA 4Y2RA 1TRHA 3FWHA 4B80A 1P0QA 4AN0A 2RHWA 1JJIA 4UHBA 3I2JA 1ODTC 3OTQA 1NX9A 3G02A 1CUFA 3WIOA 5A7GA 1XZGA 4X95A 4BTLA 3HEAA 3HI4A 4OSEA 1EK1A 5AJHA 4QE3A 5A7HA 2OPHA 4C6HA 4DIUA 3IVMA 1X70A 3ZPXA 2XUJA 2QT9A 3G7NA 5HQ3A 1GZ7A 2BCEA 1CUYA 1ETHA 2Q0XA 5YASA 3STTA 1JKMA 2ES4A 2GZRA 4W63A 1Y7HA 3H0CA 4ARAA 4P9NA 3OPMA 4W1SA 2C0QA 1XRMA 2CBGA 2QXTA 1XZAA 1CPYA 2WFMA 3R3YA 2WFLB 1WHSA 4BDSA 5HQ3B 4G5XA 2FUKA 5CT9A 1VJ5A 3FAKA 3BF7A 1EK2A 2CJPA 5D3ZA 2XQGA 2WIJA 1EDBA 4DSAA 5IVDA 3ZLUA 5SYNA 4INZA 3ICWA 1C7JA 3AUKA 3WKCA 2WFLA 5KWIA 1ZICA 4BBZA 5LKAA 3AJAA 5T4BA 1EXWA 4G4IA 5AH0A 4HXFB 1R4ZA 2VTVA 1Q83A 2AJ8A 5ALFA 5JAUA 3WMRA 3W04A 1GQSA 2QJWA 3JW8A 1DT5A 4U2EA 5DYWA 5DNVA 3MUOA 3ZI7A 2YYSA 3F97A 1BEEA 3FCXA 5ALHA 3N2ZB 3H2HA 1SCQA 2WU4A 3OURA 5I7UA 4B7ZA 5BWBA 1ORVA 1YASA 3QMWA 4FBMA 3QYJA 5DLPA 4GEGA 4ZREA 4AB1A 1F6WA 1N5RA 4J7AA 3QBJA 1FFAA 3DCNA 1L7QA 1JU3A 5EHXA 5ALOA 4MXDA 3DYIA 4HTAA 2WFZA 1VXOA 4G8BA 2G63A 5ALEA 4DNOA 4K5QA 3YASA 1YS1X 4AXBA 1XZKA 2BUAA 3DKKA 3CCBA 1QIIA 4B83A 4KE6A 1VXRA 2OXEA 4EZIA 4WCVA 2GBFA 1CUVA 1MX1A 4H7DA 1CFJA 2K2QB 4QDZA 2GZSA 2ZSIA 2XLBA 4FLEA 4EY8A 4WDQA 4JH0A 1SOMA 1C4XA 4B9EA 1EB8A 4WY8A 2PSEA 5ALRA 1XQWA 4EB0A 2PVSA 1XFDA 2YH2A 3B12A 4FDMA 1XZDA 3WJ1A 3M82A 4X3CA 1K6EA 2HFKA 3ILSA 4XJVA 4J0CA 3KD2A 4GW3A 4Q3LA 1GPLA 1XQVA 1AKNA 1PV1A 3FSGD 4FFWA 2V96A 2ZSHA 1LPAB 1B6GA 3CCCA 1UK7A 5AKGA 5AI4A 2WHPB 1ZI6A 1QOZA 1QIFA 2PSHA 2C58A 2ONCA 2VJAA 1A8QA 2XUHA 1UKBA 2PPLA 1IMJA 1PFQA 4XVCA 3ICVA 1YA8A 2JGLA 4U2CA 2ZJ6A 3W9BA 4UBNA 4Q3OA 3MGAA 2WHPA 2D0DA 4U2GA 5DYTA 1GGVA 3WWEA 2RAUA 5FPPA 3PUHA 3BJRA 1TQHA 3WYDA 4JNCA 3IB3A 3WL7A 2WSLA 4FFVA 4CG1A 3F98A 3E1GA 3BIXA 4DGQA 1QLWA 1XQYA 1QIKA 1LBSA 2WIFA 1RYYA 3IIIA 3R3XA 2FX5A 4ZRDA 4J0JA 3FYTA 1P0PA 4X92A 1XLUA 2XMSA 3I1IA 3HSSA 3NOXA 1B41A 5JADA 2OLEA 3QVMA 1E5TA 4C88A 2ECFA 2WJ6A 3PICA 2BGNA 5LZ2A 3LCRA 1UOQA 2XUFA 3WLAA 2I3DA 1FJ2A 4OPMA 2VJCA 4IH1A 5E4YA 4X6UA 2XQKA 2WKWA 2LIPA 1T2NA 4PF1A 4MWSA 2R8BA 4CFSA 2WG1A 2HA7A 4Y2JA 2V97A 3DS8A 1CRLA 3N0TA 4Y9SA 3I6YA 2DR0A 4Y7DA 3AINA 3H2JA 4QA9A 4X7BA 4HRXA 3HACA 5AOAA 3PF9A 4I3FA 2Z3ZA 3W2TA 3WK9A 2XT0A 1QO7A 3D59A 2J3DA 3T4UA 2QKYA 3WZLA 4K2AA 1K8QA 4UUQA 5AM1A 5CTAA 2WTMA 3FNBA 3SK0A 4KE9A 2XMCA 1A8UA 2DQZA 4XIIA 1O6FA 3KXPA 1XZJA 1ODSA 4CI9A 1TCCA 5ISMA 4QDOA 1XZLA 1A88A 1A8SA 4MJ3A 5CW2A 1BN6A 5AI9A 4H35A 2QRUA 5K3FA 3C45A 2IITA 1CUIA 1GQRA 1UT6A 3STXA 2BUBA 2B20A 3AIKA 4UPDA 4KAFA 4B9AA 5AM0A 5HF8A 2QTBA 3H19A 1DWPA 2Z8ZA 3AZOA 2CUTA 4OD0A 1J06A 5CT5A 2C4HA 1ZD3A 2WIKA 3H1AA 1UK6A 2X76A 3ZLTA 3WIBA 5AM4A 3LLCA 2R11A 4PQEA 2H9YA 2H1IA 3FCYA 4CCWA 3WI7A 5HKAA 5JALA 4KYVA 5AKZA 2B4KA 4W1QA 2O2IA 1JU4A 3L1HA 1QE3A 4WFKA 4QWWA 1YAJA 4BZWA 2AJBA 4DMFA 3I2FA 3I2IA 5ALPA 3B5EA 1XZBA 3K9BA 1W76A 1MU0A 4CG2A 1BCRA 5IKXA 3R0VA 4RPCA 1BN7A 5LKRA 1YAHA 4FHZA 1M33A 1IVYA 5DTJA 1LZLA 4N8SA 4HAIA 2QXUA 3AFIA 3C6ZA 1LPPA 1WOMA 2BAGA 3G9TA 3DQZA 1J2EA 3PI6A 1R9MA 1XZFA 3KSRA 1JJBA 2JEYA 3LP5A 5C8XA 3VJKA 1QTIA 1BEZA 3H18A 2JGKA 4GLBA 5AKXA 1EVEA 3R41A 1BS9A 1U65A 5A6VA 1THGA 1MNAA 4KAAA 4J03A 1HPLA 4ITVA 3C8DA 2XMDA 5EHZA 4BZZA 1UOOA 2WIDA 3CN7A 5HF9A 5T4HA 1MNQA 4X91A 3GFFA 1MO2A 3DEAA 3V1NA 5DTIA 4BCBA 1IUNA 1ZIXA 2WUEA 1QIJA 1H2XA 4JUIA 1USWA 2WJ3A 2G5PA 2OG1A 2G5TA 3RKSA 1ODCA 1HKHA 4W1PA 2WQZA 2EDCA 3LIIA 1CLEA 1UWCA 5CMLA 5JAPA 1ZD4A 1ACJA 3UMJA 2JGMA 4KJXA 4QDTA 4J0DA 1R1DA 2XUDA 3D2CA 3B3QA 5EHQA 3AIOA 4BVKA 3EF3A 3D2AA 5SYMA 2VEOA 4FTWA 1G66A 4UHEA 2BUCA 5BWCA 1H2ZA 4QEKA 5IVIA 4X6XA 2WUDA 2ZVDA 4DTCA 5AM3A 4C4ZA 2OCKA 1DQZA 5JAOA 4QLOA 1O6GA 4P92A 4C4YA 2JGIA 3I2KA 3H2IA 4XX1A 4B82A 2VSQA 7YASA 4B84A 5JATA 5K3BA 2HA5A 4DMHA 5IVKA 3NGMA 5IVHA 2PSFA 3DLTA 2RI6A 1ZJ4A 3I1YA 5ALQA 1D07A 2WIGA 2P8SA 1MPXA 1G42A 4BRSA 4H7FA 5AI0A 1ZOIA 2PSJA 5ALYA 4UFPA 1THTA 4LKOA 3RM3A 4AN1A 1QTRA 2OCIA 5K5EA 3ESDA 3S2ZA 2OCLA 2AJLI 1UXOA 1AQLA 5HCUA 2OGSA 2GYWA 1JI3A 4PW0A 3K6KA 3FYUA 1XKLA 4BC0A 2QS9A 2ACKA 4QDXA 2OGZA 1CUSA 2CEKA 5D7BA 1JJFA 4UFOA 4KEAA 1BRTA 1DQYA 4BAUA 3ANSA 3DL4A 3IUJA 4MEAA 1IUPA 2PU7A 2XMZA 4FOLA 5CXUA 1EINA 3FYUB 2Y6UA 3HRHA 3BJMA 1DX6A 3WYNA 1CQZA 3D5EA 1LNSA 2JGEA 3HABA 2E3JA 4CG3A 1VLQA 2DQYA 2PL5A 4WFJA 3QITA 4NZZA 4W1RA 3BXPA 1XRPA 4AZ0A 3NUZA 5FOQA 1EDEA 1HL7A 2HHAA 2XUOA 4GWLA 4AMYA 1XZHA 4FKBA 5LZ7A 5AKKA 3F9CA 5AKLA 2PUHA 1JMYA 2VATA 1JT2A 5DNUA 5JYCA 4BAGA 1DT3A 1CUUA 1HLGA 3R40A 1TCAA 5A71A 5ALWA 2AJDA 4KE8A 1MJ5A 3GBSA 3WKEA 3E0XA 1KEZA 5ALXA 1H22A 2CKMA 1K4YA 2PM8A 1H23A 2ZJFA 2VQ6A 5AI6A 3ZWQA 3V1MA 5AIBA 3ZV7A 4WY5A 3E3AA 5LYYA 5AHXA 4LXHA 1CUXA 3D0KA 3EIOA 4E14A 4B6GA 4U2DA 1UFOA 2RHTA 2PKYX 3M83A 2VJBA 3R3UA 4B0OA 3T52A 2OGTA 2D5LA 5CRIA 1TKRA 2DCMA 4L3WA 1I6WA 2EDAA 1BU8A 1EH5A 4AZ3A 5EIEA 5AOCA 4IQ4A 4UHCA 5HKBA 1QIMA 5T4FA 1WCYA 2JEZA 3X3HA 2Z3WA 4UHHA 4J0IA 3FLBA 4X85A 4WDRA 4C4XA 4FLFA 1MN6A 1XRLA 3O4HA 1GKKA 3BDVA 3HJUA 3E4DA 1DWQA 4KAJA 3RARA 1P0IA 3O9VA 5LIPA 5JASA 4J0HA 3G0CA 4O08A 4K6GA 2WU3A 5HF5A 2J4CA 3VJLA 4A5SA 2RONA 3WA6A 1CUAA 4C89A 3G9UA 3BIWA 1UZAA 3PDCA 1X2EA 4OYLA 5HK9A 3W9UA 1CUBA 2CMFA 3I28A 1GXSA 4MQLA 5ALMA 2WLSA 5D3KA 1ZI9A 2ACEA 3WA7A 3O4JA 4GXNA 1T4MA 4BE4A 5LZ5A 3ANTA 3MVEA 1MT3A 4J3JA 1N1MA 2QZPA 3DDUA 4RE6A 1HQDA 5AOBA 5A7FA 3C6YA 3L1JA 4H7IA 1E89A 2QM0A 3BL8A 3QMVA 1ZIYA 2GBGA 3VJMA 3BF8A 5CXXA 3BWXA 3G8YA 3M81A 1MAHA 3EQ9A 4UBJA 4EY6A 5JD5A 3FLEA 1MTZA 4Y2UA 1XZMA 2OAEA 3DKRA 4F21A 1SCKA 2HM7A 4BTVA 1Q84A 1AMNA 1F0NA 4BVLA 4U2BA 2UZ0A 5ESRA 2H7CA 4DNPA 4E11A 4MYDA 1CVLA 4B81A
chains in the Genus database with same CATH superfamily
3BXZA 1P1CA 3C8ZA 5BUSA 1NLFA 3E5MA 3ZZMA 2D06A 1EE2A 2NQTA 3CR8A 2G7MC 5TXGA 4EGJA 5MN4A 3HP7A 2OCDA 2XQJA 3H5RA 1QMGA 4AJ4A 4ES6A 4HS4A 3NBXX 4O2BB 4BNDB 5I7WA 4HWKA 2G1PA 4N82A 3EAGA 3EQ2A 1JECA 3RK4A 2ZB4A 1R3UA 1JG2A 4YCBA 4A2QA 4MWEA 2GAFA 2BCGY 3ZD8A 4L08A 1GDDA 5D00A 5LMCA 3PFCA 4MJLA 3A58B 5ECDA 1LFDB 1H8HA 4KVZA 4G0ZA 5B37A 1HDXA 1N8SA 2JBAA 4B3MB 3AVVA 3OZSA 1A1SA 2UVQA 4S1VA 3G5LA 1XEFA 2O5EA 2XUQA 2AF3C 4DG9A 2FZLA 4YROA 1TTPB 4ZGBA 4JBXA 3KZMA 3NEAA 2CN1A 5K20A 1ZA1A 3THXB 3ZE1B 2VWQA 1CXZA 1SC1A 5C81A 3IFSA 4IYRA 3LP8A 2XNDD 1EX9A 3ZG6A 2Z1DA 6Q21A 1JQBA 5B4VA 3B1YA 5CM8B 4KXNA 1P72A 1OXVA 4CDMA 1GCUA 2PX3A 3PS9A 2ZB3A 4DQUA 2O7QA 3LDHA 4BO0A 2D7JA 3CEAA 4OUDA 5J2UF 4LNUA 4KZPA 3ROGA 2Q5EA 3D31A 3KJZA 5DPMA 3ZVKA 4GBJA 3MQFA 3PL5A 5JCJA 2GJKA 1K3TA 4AG6A 2CJXA 1P6XA 5HRCA 2PLFA 3I9NA 1FUKA 1ESZA 1UL1X 1EDZA 2IZ7A 3GJ7A 1QRAA 5FA6A 3WDSA 3R9XA 3HKBB 1OYOA 4LRXA 1II0A 3GLQA 3VR6A 2X6TA 5KPJA 4IIJB 5D1HA 2O1XA 4R71A 3BFKA 2ZJ4A 2EFGA 5TPZD 1VKZA 3BB4A 3P2KA 4J94A 3LC7O 5DLDA 1L5OA 1DFIA 5FFNA 1EESA 1JAZA 3CNBA 4OVKA 4FS8A 2C2OA 2IIQA 1NURA 4XDHA 5T7BA 2BSXA 1NU8A 2XMGA 3SBXA 4UEOA 2HJVA 5GMOA 3SZ3A 5EEHA 2C94A 4HY3A 1OI2A 5FTLA 1R9NA 4II3A 2NNLD 3RU7A 4EHLA 4JEUA 3B8HA 2ILVA 3ABSB 3E3OA 3PWZA 3HM2A 3T3DA 4M9RA 1SG6A 2FHSA 1O97C 4HNGA 3TZHA 1TM7E 1OU4A 1PW5A 1ZC3A 4YRSA 4X97A 1PG2A 5HGJA 5EC8A 1FL9A 4BB5A 1KI6A 1Z4QA 3E8XA 3O3MB 3OOSA 3QFTA 4L8VA 1NZFA 1PIWA 4CV1A 2XXAB 3FR8A 2VHEA 2CC2A 3UMCA 4R2XA 4JI3B 2QN8A 1EG2A 4YA6A 4C0SA 3HU2A 1C4KA 4RHXA 2R7NA 3B3GA 3BA6A 2XDQA 3MMSA 1Q2UA 2FZGA 1L5WA 4IMIB 4ZAZA 5I7AA 3W4IA 1U4NA 1JILA 1ZJZA 2QPOA 3QEOA 1UPXA 1ZL0A 2FU5C 2TMKA 5DNDA 5H59A 2ORIA 1B6RA 2L0XA 5KVVA 1P31A 1TU0A 4EY4A 3BH6A 2HJSA 3WHLA 3H5AA 2GKOA 4PO3X 4CKEA 4FXPA 4YRQA 4XCQA 3S7ZA 4TRNA 1NVVQ 1OJLA 3H17A 1QH1B 3NUQA 4AJKA 4WOKA 2BFEB 3R8FA 4DLBA 3EDQA 1P1HA 5CGQB 5EG5A 2P3LA 4ZEMA 2XB6A 4Q15A 3KUDA 3VOTA 3BXHA 2P9ZA 1Y4AE 2QW8A 2BGRA 5F7XA 1EMDA 1VLJA 3T06B 4E5MA 2YC4C 3KQTA 3IUEA 4P3YA 3E82A 5BSHA 3TD2A 4RPLA 3H42B 1TLTA 4EG3A 3V9PA 4IHJF 5IH7A 1BXGA 1YRHA 2FEWB 4NZOA 3OLVA 3T15A 1XVTA 4IFEA 2VWGA 4QVKA 4CKEB 4PLTA 2Z9BA 4EAAA 1LC3A 1RJFA 1I13A 2W48A 4R1PA 3CB2A 4EI8A 1WBBA 1ZMTA 1DADA 3QVJA 4CL8A 4Q03A 1O54A 5U1PA 4QZVA 2XQVA 1CIPA 1G4HA 1JZSA 2G40A 3FOCA 3PQFA 1A4IA 3V8NA 4F60A 2O8BA 1HL3A 3VI4B 1F9AA 2AK2A 4MLPA 3EEBA 3VNAA 5FUYA 3EH2A 1DFGA 1SWWA 2HDWA 1Z28A 4NTZA 1ZR2A 1G18A 2FJPA 1WPXA 4Y2XA 1ZRSA 5TNXA 2MYUA 4RVOA 1SU7A 4CYMA 4Y1RB 5L3QA 1YQXA 3HCAA 4PC7A 1JHQA 4OP3A 2IZOA 4FINA 4UQLA 4FFBB 3V9AA 3GLSA 2B4YA 2V9ZA 1L1RA 2HCRA 1ULTA 5CAEA 4JLKA 4JNKA 1VDMA 3IMCA 5K0SA 3L0IB 3U3MA 1NQ5A 5DBEX 4MP6A 4FB4A 5BN1A 1SBNE 1PX2A 2WJIA 4CCYA 3UK0A 2RDMA 3PRYA 5TE9A 1NW3A 2X4IA 2G77B 2PVPA 2WAOA 3I37X 6NULA 1X3LA 3K96A 1Z5PA 3VNSA 4YTEA 2O07A 5C32A 1XD8A 2HU8A 4FDUA 1B1AA 3F8TA 1XA3A 2EZUA 5LQNA 3EGXA 1UP4A 2O0JA 3QBTA 4YP7A 1ULBA 1SUCA 4BBJA 2POCA 4QDUA 3H4MA 3NCTA 1LSJA 1E2HA 2O2GA 3P0JA 3HBLA 4G09A 1YFKA 4TWRA 5JU6A 4MKIA 2DTEA 2VK1A 2GJAA 4TTRA 3GLGE 4AIIA 3VHLB 4E2FA 2FWRA 1CQXA 3NFYA 2A5GA 4P4NA 3HUEA 4QPNA 1YZQA 3K1YA 2I03A 1OI3A 3PNOA 3FDFA 1XZIA 1Y8RB 4Z9FA 1X2BA 3AUYA 1GRCA 4BTEA 4HQLA 1AT1A 2XBLA 3NMUF 4EBBA 5CEJA 1IWOA 2YXPX 3JD0A 3I09A 1OCEA 1LWNA 1PDWA 3V4FA 2Y1GA 5AKIA 4DLWA 1AXGA 1S2DA 4IOKA 2WTXA 1ZNZA 3ZWXA 4QYIB 3FFXA 1PZFA 1Q3HA 4UW9A 2AUMA 2B4RO 1HNZB 3EOBI 4I66A 4JOQA 3Q1LA 3IBGA 4PLFA 5E4TA 4W5JA 5I9MA 5KJ6A 4OHUA 1OWNA 4QUDA 3OO1A 4N3CA 4YGXB 3LPCA 3FVTA 1FVXA 3GJ6A 3PLNA 3SXPA 1MORA 3EVAA 3UNXA 1U02A 1E6LA 1QIHA 4TV8A 3ENKA 2QD5A 3CJQA 2CHEA 5IKOA 1KSGA 1S6YA 2AHOA 4WFQA 1OZFA 3E7DA 2ZB7A 3IPXA 3D5QA 3F8SA 1B6TA 4O2AA 3AF3A 3LX5A 1O0BA 1ZGAA 4H6WA 3OX1A 2QVLA 4MRSA 3G0GA 4CQLA 2NMVA 1LDNA 1NNI1 4UXHA 2WR8A 1L7MA 3OC6A 4FYHA 4LNHA 4OQYA 4ESVA 3PJDA 1E5LA 4ZYUA 5C3MA 4PLPA 5BNFA 1UEXC 1GDTA 5KYWB 3WKBA 1MIHA 4M76B 4M9XA 2XZOA 1MGPA 1VKHA 4UASA 1I2DA 1V5EA 2YJTD 2YV2A 5K3FB 2NN3C 5JC8A 1VL5A 1O77A 1MOPA 1YJCA 3DE0X 2YIJA 1YJAA 4X5OA 5SICE 4X1YA 1J4AA 1FYXA 1J23A 2K6GA 3FBWA 1Q0RA 3FRHA 2CHUA 3EGVA 3NDRA 3ZK9A 1X9GA 2FUNB 4E2XA 2Y71A 3NIBA 4H1TA 4M9QA 1R6AA 4OKSA 1V26A 2C1XA 3LPLA 5FIUA 3SM3A 2HKIA 3FWKA 4D6PA 2PFSA 3GAAA 4RKFA 1A82A 1G8SA 1RYEA 4EJMA 3D64A 1DTEA 2ZIXB 1PYOA 4JKOA 1I14A 3RTCA 2W6NA 1Q1BA 1BAPA 4EO9A 5AVKA 1P80A 4MP8A 3ZW9A 5IXJA 3QKRA 5NLLA 1QYCA 3FRJA 2CZQA 3K2IA 1Q1GA 3ZS8A 4FYWA 4DSOA 5JZBA 4RACA 1TADA 5KDOA 1OV4A 1RHUA 2YZNA 1P81A 3DM9B 4OB6A 5IM4F 4DBLE 4N41A 4LDNA 3M4XA 3G68A 1UEIA 1Z0SA 2RAVA 1VLVA 2AXNA 3RTAA 4WJLA 3UENA 1GUZA 5CT8A 2N46A 2CUZA 4IEIA 3IXLA 4DAEA 4ZI7F 3DMFA 1Q95A 3O7MA 1CX9B 1NUTA 2PA0A 2VHWA 2ZDQA 3ORSA 3V1TC 3K0FB 2LP4Y 2YMQA 4AD8A 4YCLA 1PF7E 5KYTA 3LT0A 1D0VA 2P2GA 2ZSUA 5LMZA 3DP7A 5K8TA 1Z8DA 3COSA 3LC2O 3NJRA 2Z2JA 4G1BA 4M87A 3TLKA 1ZGCA 3OFNA 4NNPA 2RGEA 1DSSG 2CUKA 1V0JA 4K6KA 4IIJF 4MH0R 3V8MA 2JF0A 4MQMA 5LUAA 1UP6A 2AQHA 3N8KA 4F11A 3PNMA 1X87A 3DZJA 4D3SA 4L16A 2LVBA 4RO0A 3VKHA 5ESXA 3LOUA 4QC2A 2GD6A 3BRQA 3TRHA 2YVQA 2JHCA 1Q0ZA 4BLQA 3GLFA 3MCVA 4JBLA 4PEVA 3T7SA 4BLOA 1XPOA 2EEPA 3QVTA 5EPUA 5J1SB 2NU8B 3BERA 3EHEA 1WMDA 2QE7D 1V8PA 1ZUNA 3UUEA 3ZY6A 3TZBA 3GEBA 4RK4A 5T4EA 2D1QA 4I7EA 1XCOA 2QY6A 2WJGA 3LPAA 4JIMA 3OECA 2X5OA 4QBIA 5DN6A 5B36A 3CVXA 2O59A 5JJIA 3R3WA 3ADKA 3SZMA 4BU1A 2RH4A 1Z6XA 5EYPB 2IGTA 1QP0A 1X74A 4DMCA 1T2UA 2R7AA 3TUIC 2EP7A 1NIJA 3HXLA 4LJ7A 1B76A 1JGTA 1X7XA 1YZHA 3E7XA 3GUUA 2O7VA 2KB0A 1TJ3A 3KT0A 1XV5A 4L9WA 4LYHA 2ZANA 4HWOA 5CA0B 3LF2A 4D0RA 3HJHA 3QX7A 3O5AA 3S8MA 2FVYA 1QFSA 2DF8A 2W2OA 4NBVA 3QUBA 2NU8A 2JLBA 3TINA 4ENTA 1AH2A 5CPFA 1R2QA 4I3GA 1W1UA 1CQWA 1JHXA 1KDRA 2JFZA 2MT9A 2ZRAA 4JP3A 4QBFA 5AK5A 5HCNA 4BBAA 5CFZA 1RSZA 2Z4RA 3R7WA 5JBIA 5F98A 1C0PA 1BKDR 1QUEA 3DQQA 4PGHA 6YASA 4OYHA 1NT2A 2VJNA 5JD6A 2PBLA 2ZE7A 3ND7A 2FH5B 4TLAA 3T4XA 4L9AA 4KX5A 1EVKA 3HADA 3AM3A 5DWDA 1EVQA 3H1EA 2KMLA 4QX6A 4WKOA 4K6HA 4BBPA 1H2FA 3A2NA 3IPCA 4N4AA 1YK0A 4FYVA 2BGKA 4JDUA 4KGZA 3UAWA 1Z6YA 1ZVKA 2G1AA 3JWEA 2YMMA 1DXQA 2VHUA 3OOEA 4IRUB 2FEPA 3ZIUA 2XD4A 5DGIA 3RF6A 1HT2E 3DL2A 1EVZA 2M6RA 3K6JA 1GL3A 1IZ8A 4Q3KA 1QHSA 3LP6A 4GECA 1KMMA 1BE0A 3RTDA 5LYJF 1QYWA 2A9VA 3GDFA 3JQCA 4B6EA 1AX9A 1MJFA 3NDJA 3QWAA 4KRXA 3OIVA 2JVJA 4DT1B 5KQLA 1GN8A 1U0SY 3TJZA 4OQZA 2OCPA 4XAQA 3W8RA 4PO1A 1MW8X 3S8YA 4M36A 4OB8A 3RUFA 2JI7A 3V7WA 3NNNA 4WPGA 2WWWA 2GXSA 2P1ZA 5DHRA 3AL3A 1QQ6A 1FUIA 3DFFA 4XJVA 4YPVA 3ND8A 1S3FA 3R5TA 1Z3IX 3DTYA 4R7ZA 1IB0A 5TRTA 4DADA 5JSHA 2JK1A 4TLBA 1KH2A 3H3XA 4AVYA 3AHFA 1Y8QB 2C82A 3AWDA 1E1LA 1P2VA 2XADA 3D0QA 2GK6A 3FHJA 3GVXA 3TZKA 2NVWA 2C88A 3HZOA 4Z1MA 2F90A 3HGTA 3ZX4A 2JZCA 4C01A 4URXR 5JLAA 1DCKA 3DOEA 3K0KA 3F5MA 3KOXA 4FYMA 3K6SB 2AKYA 2B0CA 4ISBA 3H9CA 2G67A 5EI5A 3R5FA 5FWAA 1SFRA 1EI9A 5CXSA 5HKKA 3BMOA 3N39C 4YAEA 4EA6A 4X1OA 1D03A 3ZBQA 1VI6A 2R1ZA 1A9SA 1PL0A 1DKOA 1OFVA 421PA 5KS2A 1P74A 2CLMB 1QWOA 1XKTA 2BKVA 2IUEA 3HE3A 4IJQA 5FTKA 3V8PA 1SXPA 4QJ5A 3M4ZA 3UK1A 5FNVA 2EJWA 1TFUA 3IGFA 1Y48E 4EYEA 4F97A 1T3LA 1GZDA 3L9WA 4JSYA 4RFSA 1SPBS 3NHLA 2BKUA 4E09A 1HOXA 2QUAA 5GJCA 3KZXA 1QU3A 5CNJA 4KSYA 4FR2A 5COBA 3ABOB 3DD5A 4GGPA 4N47A 5HZGA 1RCUA 1AMUA 1WB5A 2B6HA 1RT9A 3GFBA 4NCXA 4BJ3A 1NPYA 2E4UA 5K4AA 1BNCA 4C5AA 2QV0A 5JZSA 2OBBA 1ABBA 5EZQA 4Q21A 5TVKA 4CMGA 1L2TA 1QYDA 2OHHA 1N8NA 1Y9AA 3N74A 4KQWA 3U1TA 2X5JO 3GL9A 4LXYA 3VXKA 1WCWA 3V3KA 1TEXA 3KTAB 2YHIA 4MW1A 3RAPR 3LO5A 1MFPA 5MFZA 1IY9A 4I1SA 2ZRJA 2JBWA 4C4PA 3U1VA 4AY5A 1BVHA 1ZCAA 5JCPA 1B4DA 4MVJP 4REQB 3V7FA 1N57A 3LCMA 5IAKA 4ZVRA 3A1TA 1ONSA 4S0ZA 3SR0A 4F3CA 4C0KA 3AC0A 4XIYA 3AWIA 3NDIA 3QM1A 3TCKA 3Q7EA 4WESA 4F56A 1G2QA 3WNDA 1N25A 1CV2A 3LBFA 2J48A 4URFA 1JAIA 3D8NA 3AOEC 3FHOA 1W30A 3BIFA 3MFYA 4EENA 4EHNA 5JZVA 1YR8A 4R8RA 5FL7A 1THZA 4L8YA 4L76A 5ALTA 4EY7A 2EERA 2ZJ8A 4NS4A 4HXYA 2L82A 2XCUA 3O84A 3W3AD 4LVOA 3EXG1 3PUIA 5LQCA 4P0PB 3CVWA 4HGYA 1NV9A 1D5CA 1A4UA 1YNSA 2HUPA 4AC9A 2CLSA 5FX2A 4LRUA 4MWDA 4Y9UA 4DIKA 3NC0C 4UNSA 4Y2VA 1V25A 2EF1A 1IHYA 4LMAA 3PQ5A 2HA6A 2IW3A 2NYVA 2YY6A 4RKWA 1MCZA 1U7TA 4OXRA 2NNWB 3RLIA 1QB7A 1OB5A 1WV0A 4XW2A 2HPAA 2RG7A 3BG5A 4CLXA 4ETWA 1N5LA 3QSYA 1M34B 3OLXA 2W37A 1CTQA 4QARA 5ALSA 1N6PA 2B1IA 3NEPX 3QEJA 1KMQA 2XXJA 3DBIA 3IAS6 1BHSA 3F6CA 1GGEA 3QXCA 4KDRA 3UKOA 5HYVA 2DLNA 3N0XA 2M2IA 1CG6A 5FEUA 3H8VA 5FADA 4DM4A 4NMMA 1JFLA 4JC8A 1KH1A 3C70A 3SC2A 2BRUA 1XDBA 3G82C 4V0QA 4GL4A 4ENWA 4KXYA 1LQ2A 4HMOA 2KPOA 4BYMA 3MCZA 3M7IA 2GDJA 3WG9A 2A5JA 3F71A 4HUQA 3TS1A 2OKCA 4UFNA 2CBXA 1NV8A 5A6SB 1OXUA 3CSUA 4C3OB 2J9FB 5DOVA 1WQ4A 4RY2A 3TLYA 2XUKA 1UMDA 3VDXA 2YL2A 4AN4A 4MAAA 4LYEA 1T10A 3P2EA 3VR4D 5KREA 4G9EA 3TM4A 1JW9B 1BGXT 5JH7B 1TQDA 3TVTA 3WWCA 2C0CA 4DR3B 3IRUA 3B51X 4Y0NA 1KRHA 1TIBA 3ND9A 4R8LA 1P4RA 2IUYA 1EJ2A 3KFVA 1NXTA 4YJ3A 3VC1A 4HZGA 3V4VB 4DIOA 1ZCZA 2B37A 4X9XA 4FNAA 1YCHA 3NTQA 1C3JA 3I12A 3THOA 4HUQB 4V0RA 3WIEA 1ZK1A 4ZMRA 2XKBA 3AY6A 2DHRA 1RQNA 2Z95A 3AI2A 1SD2A 4EABA 2F55A 2HWUA 2SCUA 1VJDA 3HCOA 4LEIA 2CHVA 3AB8A 4J9UE 1DTSA 1XWWA 3AOGA 3F9RA 4BS9A 3CWQA 3WNZA 2DX7A 1U8YA 1Q6YA 2VHXA 2GXQA 2GK7A 2AG6A 1HYHA 3QA9A 3EQ8A 1KJQA 4DIMA 3AONB 3DEKA 2PX6A 3N2EA 1UPFA 2BKLA 4RY8A 2JLSA 3RS2A 3TI9A 3W5VA 1NXOA 4XSGA 3LXRA 1N3LA 1XP5A 5EUCA 1RWPA 1VB5A 2I66A 3EBPA 3OG9A 4QUHA 4BO6A 1I7QB 2I6FA 4BO8A 2DZDA 1NVBA 2IKSA 5IDXA 1AGRA 2YYZA 2WHXA 4N0MA 2BOVA 2OXTA 2SCUB 4LF8B 2RBKA 3AV3A 1XX6A 1VPTA 3LT1A 2X0DA 4UKDA 2CXRA 2PGXA 3U37A 2R6AA 4TTAA 2W2KA 3FSGA 3DWEX 3ZHTA 3CUWA 3KOOA 2IV7A 3M2PA 4KIWA 1D2EA 4K6CA 3WO0A 2PMKA 3UB2A 2HMUA 2BGLA 3JRXA 4NENA 3PZRA 1RLUA 1HX7A 4TYQA 4XWOA 3QH4A 2RD2A 4FZVA 3KB6A 1KIMA 1S9HA 3QWFA 3KKEA 4K87A 3KO8A 3OOHA 5HK8A 3HCBA 1PNTA 5FNVB 2JIDA 1U9IC 3GCDA 1UJ4A 1X77A 4NSNA 2FPWA 4QO8A 5K6RA 4RANA 2Q5LA 4RU1A 2PH1A 4RHEA 1LRKA 4BWVA 3GU3A 5DX0A 5HZMA 2XQIA 3M5CA 2C2HA 4JLNA 2GDZA 3TEJA 3ZXIA 4KN5A 4ESHA 3D3EA 1BGWA 5J2UB 3DQPA 3EW7A 1D2GA 1FFDA 5DX8A 3F3YA 4KMOA 4JKIA 5KYYA 3KM0A 1NJ6A 4AZTA 4YCMA 2XOKA 4OCZA 2IEYA 5IAAA 1AHPA 2BR3A 1VE6A 3PF8A 1H3EA 3C6BA 1PG0A 1J90A 1Y81A 2JJ8A 3KSMA 4K9KA 5AXAA 3T7DA 1AKVA 1Q3TA 3T94A 4TUYB 1IHUA 3NOQA 4HS9A 4JOBA 1W5BA 1ZHFA 3TFOA 4GYKA 4Q1BA 2WKRA 1COWD 4JOSA 3UW1A 1YRWA 2DY1A 3KT6A 4Q6WA 1ONBA 1XRQA 2GARA 4CTKA 4GOOD 2NPIA 1H2YA 3ZGYA 1M0TA 5IUKC 3ELUA 5IH3A 1XOIA 2R4QA 3GJ8A 4L72A 1JSZA 1XJ0A 2XECA 2VJMA 5CITA 4KPEC 4FLMA 3EOZA 4X62B 4UMDA 1SEVA 3DWIA 2E49A 1K5GA 2HDNB 2HHLA 4M21A 5BT9A 4AX8A 2ORYA 4H77A 2GEJA 4D9BA 3S4YA 5F51A 1MC1A 1NN0A 3CCFA 1LNZA 2XUIA 1BDMA 3CF0A 4LGMA 5DZSA 3OT1A 4RK5A 1UC4B 4EKGA 4C6TB 4TUYA 5L3SB 4YRBA 2IH4A 3M6UA 2WB2A 2C9OA 4G07A 3NHSA 1FK8A 1K6XA 4E13A 3U1BA 1P9RA 2ZWAA 2H7VA 1GTZA 1OAAA 1V1RA 3ASZA 2VYNA 3AW9A 3COYA 1WKBA 3WKDA 2XUGA 4XCVA 4FX5A 5G3ZA 2W5UA 1E6WA 1Y3IA 4DSZA 1WQ3A 1LBTA 3N8NA 3OQJA 2H2GA 1RWOA 3AEUA 1XMJA 3S5JA 4EUSA 4UTPA 4QOHA 3FMOB 1VPLA 3RFTA 3ABZA 1YDGA 2CVZA 2P2LA 2VA8A 3MTQA 3CTPA 1TFRA 2XT6A 3DE4X 4IUDS 2HNKA 4OREX 3T3PB 5HQ3B 1UBJS 4ETNA 5CT4A 2DB3A 2JIZD 4HAVA 2G08A 3OJWA 3RVDA 1PK9A 2VK4A 2YNMA 2GERA 3ZGXA 4RWEA 2AZTA 2ZJ7A 4A8PA 4B7AA 1KTVA 2L69A 2PRJA 5DNWA 1ZINA 3TW4A 5JVDF 1IUKA 2WAAA 4C2TA 1AZTA 1IPHA 2GKGA 5C0OE 3F7OA 1YU6A 5K0EA 1XL0A 4KIUA 2OV2A 4HUJA 3F90A 4YWJA 4P4LA 3U80A 1U8ZA 1CDEA 4LJAA 3AKYA 4WFIA 4UQPA 4RJ2A 3VSDA 2DSTA 1A71A 2JIOA 1WDWB 1I2CA 4J7CA 4N3GA 1HZZC 3FTCA 1Z34A 1HNNA 1RYNA 4OB7A 2X22A 1BH2A 4RTQA 4JJIA 3P9IA 1FS5A 4L78A 4TWJA 1JEJA 3DYBA 3IP8A 2ISCA 2J8ZA 3OCCA 3O4GA 1E2GA 4PAQA 1Y5RA 1R9GA 1HNWB 2V5UA 2WHRA 3FTDA 4OIMA 1O9HA 1XP8A 4ZO4A 1O2DA 4HTFA 1T5HX 2YHBA 4I6EA 3GD7A 1UBLS 2QOEA 3OM0A 2JFYA 5J1TB 1WOYA 3TSCA 5REQB 4BKUA 4CIVA 4G56A 4MVJF 5JE8A 3N58A 2Q6TA 3TRIA 3WGIA 1YRLA 3ZKWA 1LLQA 4E3ZA 3UK7A 2I1QA 1AQ6A 3ORYA 1X39A 3QZUA 1H4TA 4NJEA 4Y2SA 4AUNA 2J3MA 2REXB 4BNXA 2PHZA 3DLBA 1J8MF 3MA0A 3ZD7A 1EX6A 1BX0A 4RNDB 3LWNA 2A0WA 3V48A 5GM2A 1RKUA 1L8XA 4AO8A 1SRQA 1A9PA 3LC1O 1DL5A 1L4UA 4JS0A 3G3EA 4IRMA 2YTZA 1ZVJA 4R0VA 1G6OA 5K51A 5NULA 1IY8A 2BFDA 5H83A 1Y1TA 3ZDAA 1GIAA 3PRJA 1NXQA 3FM9A 4WXMA 2PO5A 1SCDA 1FSSA 2UVPA 5JYDA 2CVQA 2QVZX 4YJ2A 1SVNA 2VCEA 3GUVA 3WYGA 3FTFA 1V2HE 5MGNA 1Y3AA 4ITUA 3D7MA 1G20B 1KE1A 1L5NA 1Z4JA 1DINA 4UEKA 3O03A 2CVHA 4UAGA 4LYJA 1B00A 5HA5A 2H06A 3JRNA 1L7PA 4ZVOA 2QPTA 1YQWA 1GAJA 3O4IA 2P5YA 4NPHA 3RUEA 2VP3A 3C4VA 3R3VA 1TKBA 4XPIB 3TGLA 5KNDA 1JTEA 4M1QA 5U4QA 4X1IB 2EKQA 4RVNA 1FDRA 3K8ZA 1KYTA 2Q6KA 3NQ41 1E8DA 3T5BA 4DLAA 4Y6SA 3NW9A 1JG4A 1PP4A 4YDHB 4RORA 3EMVA 3TECE 3G17A 2EHJA 1HEUA 4RIEA 1CSEE 1KQ3A 2G70A 2MMGA 3GD5A 4QOFA 4YAFA 5EIFA 3DJFA 1PSZA 3WMEA 1WSWA 2IP2A 3UYKA 5A9SA 4GPAA 4KI7A 1WW3A 3UG7A 3ZS9A 5HW0A 1G20A 3DJYA 5AK0A 5K2MA 1NXPA 5KU7A 4XVQA 2Z57A 2Q3DA 4DQKA 4EKDA 4F5YA 2A0YA 1DNPA 1FSFA 4HEHA 1QBGA 4HSGA 4PYQA 2WWRA 1N2EA 3CEPB 4HDKB 5FI5A 3RHTA 4AKGA 4D8XA 4YDQA 4OJYA 1AN0A 5E0KB 3SMQA 4Z7OB 1T0IA 3OM9A 4XSVA 2UUPA 2QUBA 3FNHA 3RVQA 2HMSA 3RT7A 4BO7A 2GH1A 4ZRMA 5LSAA 1MJHA 1V4NA 4P2BA 2QR5A 4IV8A 3JU3A 4HAYA 2VUSA 2B1QA 2H2IA 3LVRE 4D74A 4X71A 1M1UA 5FI1B 5JNWA 3VDRA 5KQGA 4DUGA 2P6UA 1I33A 3UC9A 5K05A 4EG5A 3R4CA 2VHTA 1SB9A 2Q2VA 5JQGF 2DM6A 3VVLA 1FSPA 2IV2X 3OIFA 2Q0SA 1LD3A 1A9XA 2REQA 2DY0A 3RJZA 3QXGA 4Y2PA 4DCMA 4DLVA 5IT5A 3A1FA 1HOTA 3KZOA 4QXAA 5HEKA 2Z08A 3MRXA 2GM9A 4KK3A 4DLTA 4KR0A 4DKJA 4G0NA 3EWNA 1T5BA 4B3RB 3OCVA 2I54A 1MPTA 4ZN6A 5IT4A 2Q5JA 4D7AA 2GO7A 2GEBA 3DE5X 2G8LA 3X2FA 4NHOA 1L4MA 3AETA 1PLJA 1KKMA 4A2WA 1EDDA 2BTQB 2FOLA 2ZRDA 3Q2KA 5FD8A 1TX4B 4UM8B 3IEUA 3IV6A 3C5VA 4RQBA 3KZCA 4G5HA 5ICSA 1WDLA 3ZXUB 2ZT6A 1UDBA 4WOJA 2A59A 4RVHA 3STVA 2XYVA 1A3CA 4MW7A 4C4TA 2AEEA 9ABPA 2NXJA 1XBTA 2C77A 4GUAA 1G5IA 1QGUA 1C1HA 1G291 2HU7A 2WSBA 3HKCA 4P81A 5A5EA 2B5VA 2OHGA 1VKOA 4IHKA 2VSOA 4JBWA 8LDHA 1ZVMA 5EL0A 2JG3A 1CDOA 4J7XA 4B80A 2XMPA 3ZCUA 3S40A 4MWCA 5H70A 3L6RA 4DV2B 1H85A 5LQMA 1EK0A 1XCMA 4PXSA 1MA0A 3QOWA 2ZI6A 3UWPA 1ZGZA 4DSTA 4MTLA 3TLJA 4CM5A 4LK3A 1NX9A 2X86A 1CUFA 3G02A 5BN4A 4BV2A 1K4MA 1RBZA 3UANA 2HD4A 3ZZ0A 1XZGA 3NHPA 4X95A 3DLIA 4BRWA 2C84A 2ZWPA 3CRW1 4YRRA 2NACA 3D81A 2VUIB 1PU2A 3DAPA 3HEAA 4PRLA 3QVVA 5IC5A 3ZJYA 4YPOA 3BT7A 3KVVA 1U98A 2XPCA 4NLLA 5CBPB 1M2HA 4IDHA 1R12A 3DT9A 3L8GA 3WIVA 5AJHA 1HFEL 1ZM3A 4R1TA 1PDVA 1S8NA 4ZOLA 1JE0A 2R7KA 3I3OA 3T1TA 1QS0A 1R0LA 3TBFA 4TZ0A 1QCZA 1YV9A 2VP5A 4C6HA 3JQAA 3IVMA 3BB1A 3ZPXA 1YZFA 4IP0A 4PXYA 4O5AA 2CYCA 1ABEA 2PMBA 3HDHA 3O21A 4QFCA 4KFRA 3U7IA 5KU1A 4YY3B 1J8QA 3TXYA 1TD1A 3Q9NA 4TKVA 3ETLA 3DMPA 2ZSKA 5BN4B 3DZFA 3RAJA 1CUYA 2Q0XA 1G2IA 1INLA 5A3JA 3K30A 1GZVA 3H0CA 4FK8A 4ARAA 4CL3A 2CB0A 3L06A 1WCV1 5AOVA 4I5GA 4W1SA 2YICA 2AKEA 2FEAA 2PUWA 4G36A 1XRMA 1YB5A 1KYWA 2WMOB 4MX8A 4NNJA 3WOVA 2I71A 1DBQA 1QOQB 1OXSC 2BDEA 4S1NA 5THKA 4WNAB 1W34A 3D8UA 3ZUGA 3ET4A 1Z6AA 5I8ZA 3KEGA 1XZAA 2JAQA 2WFMA 2PZKA 3DHNA 3P9SA 4XDGA 3MRSA 1LI4A 4RZXA 4GP7A 3CH5A 5CT9A 1TVEA 2R8ZA 4B79A 4L07A 4FJ1A 4EUKA 4KU4A 2VJYA 1KJWA 2P27A 1WWKA 2RGCA 1MRSA 3JZMA 4EF4A 2WIJA 2IS6A 2YZGA 3WDLA 2R25B 5JBQA 1OBFO 3H6HA 3HWWA 4ATNA 4RAOA 4JQZA 2IEZA 3KUKA 4JSTA 4DF3A 1XCBA 4R54A 2R00C 4IXNA 1U7UA 4AG5A 4CI0B 4Z8XA 3B9PA 4MVJH 4DDMA 3ZN2A 3VR4H 1L7BA 3LC0A 4HLQB 5GY7A 1MHPA 4BNYA 3GC6A 1V45E 4YRNA 2Q3FA 2RGBA 3SSOA 2Q9BA 3ZEAA 1Y4SA 1SBHA 3GLHA 4KFTA 2IH2A 3FZYA 4PGGA 5KYGA 2WFLA 3P4XA 1QF7A 1F17A 1JB1A 3AR2A 3H7AA 2CMDA 2QM8A 3KKZA 3O8LA 3ORHA 5FUQA 1HG0A 3NHYA 5EESA 2AWNA 5HKKD 5KWVA 5FLEX 3OEWA 4IJUA 2ISSD 3BWMA 5EZYA 4R2MA 1KEEB 5DV9A 4BBZA 4UD2A 4UVHA 3BS4A 5JW6A 4ANFA 3U09A 4UOZA 2PUAA 3GGCA 4BX3A 3FW1A 5T4BA 2WHEA 1EXWA 5HJ7A 2ODTX 4WZBE 5AH0A 4C22A 2EVWX 2V7EA 2O3QA 2O50A 1Q83A 1FX0B 2AJ8A 5IUJC 5HG0A 4MMZB 4YECA 3CS3A 2PKRA 1TPYA 1VMEA 1Z17A 5FI0B 5IARA 2QJWA 3WVNA 2KE5A 1SZDA 1BXGB 1L5QA 1DT5A 4HUTA 4U2EA 1J0CA 3NLLA 3WLLA 1VJ1A 3C6MA 5ILQA 4R9SA 3REQA 3ZIAA 1YWGO 2JJ1A 2HU2A 3VV2A 3DOUA 3B8EA 4D5EA 3FCXA 3RBAA 4E07A 2IYFA 4MUJA 1JI0A 1I9CA 3D0OA 1IJFA 3M6AA 1GA6A 4QSHA 1PCXA 5FJIA 4W5TA 1SN7A 1Q74A 4J43A 4DNXA 3K9LA 4JJFA 5AW9A 3U39A 3AR5A 2CLEB 4TSKA 4KH0A 3PPYA 1XXHE 1X15A 5HIIA 4JROA 2I4LA 2L17A 2DHQA 4HDSB 1PRYA 1IYZA 3HDJA 3I5XA 4MCHA 5G02A 1SULA 1TO6A 1U7DA 3OURA 3RO7A 4HYTA 1NMYA 2PXHA 1JQAA 5DBHX 1ORVA 1RI3A 3IVXA 3WIDA 3ONNA 4AKIA 1OYYA 3OQHA 5KTSA 1WUYA 3TPCA 1PW7A 4FCTA 1CC1S 4GEGA 2I2WA 1KYIA 4O8CA 1IEQA 1U2ZA 3WQBA 4AF8A 4Y6QA 4EGFA 5IM4A 1PI3A 1UZMA 3L79A 3O8QA 4MYTA 5ECYA 4GL2A 2C2GA 5KOJB 3L4BA 2ZK7A 1N34B 4IDOA 1RHMA 3DB2A 3J80A 1W5AA 1UBUS 2B8EA 1MB4A 2N42A 4MPRA 2IUUA 4NWIA 4FR0A 1VJRA 2EP8A 1KERA 4MXDA 1K2VN 3DYIA 4JC4A 1JPNA 1M5RA 4UNNA 2AMJA 1XMVA 3FNRA 3RT1A 3LRPA 1X7YA 5E38A 1SBQA 3H86A 4BU0A 2QV7A 5CHYA 4KXQA 2H52A 3LVQE 4GMXA 4IVPA 5AXCA 5FOTA 1M83A 1PQYA 5ALEA 3T1QA 4DNOA 3W1WA 2CWDA 1ZGJA 3PFNA 1KP9A 2OL4A 3YASA 3E61A 2XCTB 4AXBA 1XZKA 3RFXA 5JMPA 1KC3A 1L7EA 2C5LA 4EGQA 1ZJJA 4Y2HA 3BEDA 1BW9A 5ARBA 1QIIA 5C4MA 1RMQA 2V1XA 2VK2A 4KE6A 4ACBA 1G8AA 5CDUA 1ATIA 3K0HA 1ECJA 2WF6A 3BWVA 3PB3A 3PFKA 4EZIA 2G0TA 4NP6A 4WCVA 2CDBA 2D4HA 5FTWA 3EGOA 3SLGA 4Q7LA 2Y92A 1CUVA 3ETCA 3NYWA 4DCOA 5EWMB 1G6Q1 2G06A 3O90A 3MF4A 3QIVA 4RXTA 4XA8A 4E70A 5IKPA 5ERYA 4DDVA 3AR9A 3UJCA 2VG8A 1WF6A 3BHJA 2R6DA 2W93A 1JEDA 4O2BA 1NJGA 4YQZA 4BNDA 1N6NA 4EG0A 4O2AB 2K2QB 2RARA 1TGVA 3LDAA 1J0AA 2ZRHA 3KWLA 4NZ9A 4C14A 1GQ2A 1OSNA 4W7IA 3AM1A 4JLSA 2GZSA 3QU2A 3D7SA 2ZSIA 2HNBA 3IP5A 2DOKA 5EUBA 1BW9B 4WDQA 4OLAA 1CY4A 2EW1A 1K3FA 3ZJTA 2QI9C 4CKBA 1MVOA 5DE3A 4FW8A 2PEZA 4YC7A 4YV7A 2VHQA 4RV5A 3BGIA 3FIJA 2C2MA 1TO1E 2HQSA 2OV4A 3EPRA 3T0FA 1I3KA 1PNRA 4BN4A 1OBOA 3AFGA 3E7WA 4S1OA 1E98A 2Q6OA 3ILYA 2J0UB 3FF4A 2ZRCA 1GRNA 3I9KA 4FSDA 2IEBA 4R9RA 3RD5A 1Y1LA 1PT8A 4HDMA 5BMVA 1YIAA 4BASA 3D8RA 4TZTA 1VYUA 4XSHA 5LP6A 3DL0A 1JZQA 4YI5A 3VDNB 4RZ3A 2IVZA 1XZDA 2O23A 3RUIA 4GDFA 1WXIA 3MJRA 4D4JA 4FP9A 2FV8A 2JLZA 3A6KA 4QGAA 2FMUA 2JASA 2XX3A 1FTGA 1MR3F 2WMNB 2EAUA 3K1AA 1TW3A 2ZAIA 2ABWA 1UFRA 1EGHA 3KD2A 4GW3A 4X61A 1RHJA 3ZWVA 5KX5F 1FMTA 1NMEA 1Z5NA 2YWDA 1EWTA 2PWZA 4U6NA 4LBYA 4F3KA 1XQVA 1Z4PX 1OBVA 4UXIA 3HH8A 4K6OA 4PG8A 1PV1A 2FKAA 3FSGD 3MCUA 3P94A 4FFWA 4GC5A 1KAEA 1JG6A 2O9JA 4UOQA 3SJBA 1SC3A 4CCSA 4DAOA 3O2QB 1RTKA 2P7IA 4EJ0A 4W7SA 4O02B 1CZHA 4AJNA 1TCUA 1C0KA 2ZBVA 3HBFA 4CU5A 2CVFA 5CXQA 1ZUIA 4TKMA 1BH6A 1KY4A 2PMWB 4TV9F 5JCOA 3IEXA 5E9AA 5AKGA 4RIHA 4ALNA 4FNOA 3B2NA 4R8SA 1XDWA 1QIFA 5IWCA 1Y5NA 5F35A 2PSHA 1Z9BA 4B8WA 1T2FA 3W3AA 4OQMA 2ZUEA 3BSFA 1PBTA 1OH7A 1GM5A 3DW1X 1J0EA 3I58A 2ONCA 1KPGA 3QY0A 2JKZA 1MAWA 2F48A 2BFFA 1A8QA 2XUHA 3AI3A 3KQMA 4FCVA 4M0UA 4TKLA 3E58A 2A86A 2YZ7A 4R2HA 2IYQA 4FEYA 1PD0A 1LDEA 3IUBA 4Q37A 1AA6A 1EAYA 1IMJA 2YIVX 1AK2A 4RK0A 4ZQEA 1JH9A 1M2VA 2NV6A 2B21A 3ICVA 1R66A 1A9TA 2PX4A 3LZ6A 1NN5A 5FWXB 3EDOA 2JGLA 4ZQGA 1LBHA 4OA5A 3W8DA 4U8GA 3W9BA 5BNIA 1TT7A 1VHTA 3WQSB 4RSGA 4YXFA 4F9GA 4U2GA 1HV8A 2ZBPA 3F6EX 4WACA 3CEJA 4HNUA 1YR9A 3WWEA 3WRXA 3H1GA 5B2EA 2RAUA 2CJFA 2J7PA 1GYPA 5HUHA 3AUTA 3KZKA 2BFFB 2QZ4A 4GVLA 2P77A 1IEXA 3ITKA 5FPPA 1B8VA 2VF5X 3FPKA 1L4NA 5FO0A 5K7SA 4UCFA 1TQHA 1BHJA 2BDUA 1ORHA 4ZFNA 1TEZA 2EARA 4LQLA 3PC8A 4JMPA 4S3MA 3RHFA 1NVMB 3OEHD 4WK2B 5I7EA 5LQKA 4F3YA 1RLTA 1SHKA 3JQ9A 1DXHA 4P7GA 3WYDA 2C7QA 2YWEA 4DTIA 4R7TA 3Q15C 4NESA 2E37A 4PONA 1V2GA 4BB6A 3E1GA 4JJ7A 4F86A 4TS4A 5FPYA 3O31A 2Q9UA 4BECA 5LLDA 2YMLA 1GPJA 2ZBRA 1FBNA 4CFZA 4DGQA 5CG2A 2AA3A 4TRRA 2AN3A 1QIKA 2C3OA 2I4TA 5C31A 5CB4F 1Z5OA 3SEQA 1R6UA 4CV3A 8MHTA 4TTTS 1RYYA 2WV9A 4ESOA 1E2MA 4LX0A 1C30B 1G0NA 2NU9A 4IGKA 3ZDDA 2QLLA 3T12A 4EVIA 1EU1A 3G2MA 4JT9A 4WK4B 5GJBA 3GPBA 4OG2A 3V33A 2O8VA 4GEKA 1REQA 1IOWA 3J7TA 3D2LA 3BMNA 4URHA 2GWRA 4X92A 3LQYA 5J5CA 2GZ1A 2QVCA 4DJTA 5CCEA 2UUAB 1BQEA 3C14C 3HSSA 4YUWA 3KQUA 3KQPA 5C7IO 4O3MA 3QVMA 1FP4B 3QUSA 3TLZA 3Q8MA 2O05A 3TIIA 1KARA 1PX0A 1PNVA 3IEVA 2V0CA 3ZDEA 1SIBE 4JUBA 2YY7A 5TT1A 4ERXA 3RAGA 3L6DA 3H5TA 2A4KA 2R751 1PN3A 3GZNB 3IE2A 3ELBA 4IH1A 2MSEB 4GO1A 4HMPA 1LK7A 4MRAA 1JTVA 2PXCA 4XYBA 1BU5A 2XQKA 3AXTA 1P3JA 2LIPA 2XGSA 4B5LA 2R96A 3FCOA 4JLUA 1YRAA 4Q47A 4CTMA 5HR5A 4TWBA 1Z4MA 1C1DB 1JHYA 5ES3A 1QDLB 4PF1A 4MWSA 4C2AA 4E1BA 1SAYA 5DGTA 4FU0A 2R8BA 3AJEA 3ZC3A 3VUFA 1DX9A 3N1UA 4QGBA 3TBKA 3IAUA 4KYUA 2MTBA 2H5LA 1EWYA 3INYA 3PNQA 3UAXA 5IZCA 4Z2YA 1AB5A 3JASB 1JDBC 1PJQA 4ZT4A 1DRJA 2FRDA 2I6SA 2OMKA 3EGEA 3N0TA 4YRFA 1AXEA 1WSDA 2ISQA 1TJYA 5F9FA 3GP8A 2DKNA 2IE0A 4JAVC 3H2JA 2OBLA 3GAZA 4HRXA 1QFJA 2EG9A 2XNDA 5AOAA 1YE8A 4HCJA 4DCGA 1V7ZA 2AEFA 2XGMA 2OB1A 2Q5FA 3ILVA 3W2TA 3WK9A 3PFWO 3C48A 4GX2A 5BR4A 1CR2A 1QX3A 2WVAA 5EKXA 5COAA 1C9YA 3IR7A 2XITA 5B30A 2NO5A 3D59A 4RA6B 1KVQA 3FAZA 4LDAA 1KIFA 4O4HF 1K5HA 3TIGA 2H3EA 1JEYA 3PBKA 4UJ3A 5ADVA 2LIVA 1Q57A 4PAGA 1K9VF 5E6RA 1GAQA 3GHYA 2QNBA 1B0PA 3TTTA 2YXDA 3EMKA 3PVCA 5C8YB 4I3HA 5IJ0B 3R5JA 1R6VA 1FFSA 2C3PA 2VJKA 5L6LB 1IU9A 5LNK1 4UU0A 3U3OA 1WVMA 2ZW9A 4URYR 1MMFB 3DCIA 1W6UA 2WB4A 3BTVA 3IKJA 3MJVA 3NBUA 4HX5A 4ZEXA 1FQJA 4KXUA 3CZPA 5DNYB 3TR5A 1TNDA 3KV1A 1E69A 4OQEA 3HDQA 1TCCA 2NG1A 3WP1B 4CU2A 4P4SB 5TJHA 3HXQA 1KJJA 4QDOA 1JLRA 4IIGA 1XJWA 1EFTA 5GOZA 1A8SA 3KQWA 2QLJA 4MJ3A 2I9KA 3WFZA 5HDQA 4V3BA 3G1TA 3PNYA 3ETDA 1BSVA 5JSKA 3RIEA 4BGVA 5IJ0A 1KQGA 1PDOA 4EFNA 2HK7A 1CUIA 1WXXA 4YAJA 3G2HA 5A06A 1UAYA 4DMUB 2IF2A 2N9UA 4FQ8A 4GXQA 5D85A 2C4MA 4PSVA 1SBYA 3T9BA 1NVVR 4UPDA 1G5HA 4KAFA 2J33A 1GTG1 4L5JA 5HP4A 4ABYA 3TQFA 3EODA 1IMOA 1MOQA 1XUOA 2Q8QA 2X15A 3DF9A 5HF8A 4PCLA 2H9AA 2QTBA 3RT9A 2HIGA 1DWPA 4Q1CA 5FV7A 5HIAA 4MV5A 1IEVA 2QGZA 3OAAD 2WIKA 2BCJQ 5J58A 4CJXA 2C00A 2W2QA 5E9JA 4B4KA 3VZPA 4M0LA 2DT8A 3UUWA 1NT4A 3PHLA 1AF7A 3MFQA 4HPJB 1RJEA 1XIVA 3UGQA 1Z8HA 3ZGVA 3DAYA 4RLFA 1L8QA 2O7NA 2B4KA 3K16A 2FSVC 2FYTA 2G9QA 1AUQA 4RZQA 3VOAA 1FDSA 3M5PA 4ZZ1A 4NMHA 2GEVA 1N1EA 4MQ4A 1F8GA 3C1AA 2YW2A 2RE8A 5C51B 1PJLA 2H4YA 3ANMA 2ON6A 1JEOA 3FDJA 3GNLA 3L1HA 3OFJA 3I9MA 4MRRA 1GPUA 1E9VA 4WTOA 4QWWA 2YV4A 3FH0A 3S7TA 1PFVA 5LYJB 4NHEA 4XGKA 1R64A 1XEAA 3KYBA 4XDYA 1YAJA 5CDFA 4OHFA 5BQPA 3HFRA 2BSQA 1FTWA 3UJHA 4ZHQA 2AJBA 1USUA 1FEZA 2CXOA 4G5FA 3WRVA 3VZSA 1G5RA 3GRRA 5ALPA 4G0XA 1G2OA 2VNHA 4JB0A 3G49A 5LJIA 1XZBA 3E8SA 4TMXA 3TSZA 1XTPA 1NBAA 2HW8A 5AW4A 3OICA 1W76A 2QSJA 1Z45A 1PAUA 1QPBA 1U2GA 1V7QA 1MU0A 2W0SA 1EGVB 1BX1A 1FFXB 2ZRKA 5JSUA 3GLFB 1WKVA 2GPWA 4OJTA 4QU0A 3W2EA 1RJGA 1N78A 3VPFA 3HWSA 3RJ5A 3PCXA 4PTYA 4NDNE 2QQ5A 1TVKA 1DO2A 5F2KA 5A3SA 3HN7A 4NEHB 5EFOA 4WBXC 4ZHQB 5EE0A 1XHEA 3C3PA 3QEKA 2HQOA 3JVUA 4P80A 4BX8A 1BD3A 2WINI 3T9AA 1D09A 1KI1A 2ZUSA 1JDTA 2VEDA 3FG9A 4WOBA 1M74A 1D5WA 5FULA 2GRUA 3FYSA 4RVDA 5KNBA 3LA8A 4XOUA 1DBSA 1K7SN 1RHRA 3AFIA 4RY9A 1LPPA 1E32A 3B78A 3VH3A 3DQZA 3GMDA 3SAJA 1J2EA 3I9OA 3N87A 2B5WA 1XZFA 5JNSA 3IMKA 1JJBA 2JEYA 3PITA 5IASA 1TPZA 2NYRA 2PZJA 5CVJA 1QTIA 1BEZA 2Z5LA 3AOEA 4D8TA 3IHLA 3R41A 3CNHA 2W0MA 4XB6B 4ZCPA 3WGKA 4ZCMA 1SXQA 1KO8A 2BM1A 2G0AA 1MC5A 1U65A 1BHQ1 7AT1A 4DLZA 4KAAA 4DHEA 3M0EA 2EFCB 3SMVA 1XD2B 4TTVA 1KI7A 3S70A 2XMDA 4FMCF 3O4VA 3UQZA 3X1JA 1NBIA 1NAIA 2PDAA 5TR9A 3QQ5A 4EHDA 3KE9A 4YLGA 2IS2A 5DB4A 2ECPA 1KA9H 4XYGA 4YRTA 1L4LA 2WVHA 1NOJA 3TEMA 2WEKA 1X38A 2P67A 3DEHA 1JR3A 2G1JA 4K05A 3IAM6 5EXXA 3D1LA 2Y1WA 2VDUE 3R23A 5CCBA 1VIMA 1G8FA 1OC4A 4MYRA 4JXXA 2YDYA 4KQGA 2WAYA 1PVVA 2QD4A 3UVEA 4XYLA 4XJSA 1DELA 4GI2A 2NIPA 2ZBGA 2UZIR 2ZRNA 3NXSA 3CVYA 3CRNA 3NKFA 4JEHA 4PFQA 2GHTA 1G1AA 4MDHA 3NFRA 1ZIXA 3N59A 3OHSX 5ICEA 3AW8A 4WX2B 1JHVA 1Z08A 1L3CA 1OZ0A 2QRPA 3E5HA 4OI2A 1OIVA 1QIJA 5FF9A 1H2XA 2AQKA 1USWA 2WJ3A 5HM8A 3M1IA 2OG1A 1SQ5A 2FW7A 5HRAA 4L2IB 3R0JA 1K0UA 2G5TA 2RGYA 4HGRA 3H05A 3GLFE 1R5JA 1TLFA 3LA6A 2OHVA 2F3RA 5JV5A 2WQZA 2A4MA 2FK8A 2VJMB 3DDHA 3WGOA 4B76A 3LJKA 1SU6A 1NULA 1O58A 5J43A 4CGZA 1CLEA 3L7DA 4AS3A 3ZU2A 4EA7A 2ACVA 5DK6A 5JYEA 2A7QA 4WHMA 5JAPA 1Y3FE 3E9RA 3IHKA 2Z4SA 3UMJA 4C7OA 1JNYA 5GZ3A 4WXYB 3GGPA 4M2LA 2OYCA 4B73A 1Y80A 3GFVA 3N3AC 4JLOA 4I55F 3ZTWA 3D2CA 4DRXB 2GPTA 1IQUA 4M7WA 1GCGA 4ILEA 4D96A 4RTKA 1K7FB 2NVBA 1V1RB 3K8YA 4G5SA 2WWGA 2P41A 5I9BA 3PGKA 3EIEA 2VEOA 4HDNB 4NK4A 4H4EA 4AP9A 1U5AA 2IXFA 1AG9A 4DLLA 5FNZA 1G66A 1U7WA 1W48A 1SKAA 4GKVA 1RBMA 4RFSB 4XR4A 5EP3A 2P9EA 3ASVA 3GEDA 3IR5A 3U16A 4QEDA 4DPKA 4C4RA 2J67A 5EMHA 5H80A 2Y9PB 4QEKA 1OWLA 3OJLA 3QI7A 4PZZA 3JZIA 2GPJA 4ZT2A 1NI5A 1H9BA 2XA1A 2ACWA 2B7CA 5IVIA 2WUDA 4ADSG 1WNFA 3FHLA 1P29A 1QX4A 3AUAA 9LDBA 2SKCA 4DRXA 3KXKA 4XUCA 1DQZA 1OVMA 1ZN9A 2Z3VA 5IF9A 5JAOA 2YS7A 1SVUA 3GJ5A 4QLOA 3WAGA 5C5EA 1NY5A 2GJ8A 2R2AA 4G26A 1MP0A 2X0JA 1CJMA 4IIFA 4NFHA 3R09A 2BD0A 4QDJA 1H8HD 2BMVA 2O1EA 3I2KA 4X20B 1Y9DA 4IVRA 4QG3A 1OF1A 4N3BA 4P33A 1TM1E 1NVDA 2QGNA 1DC5A 4R31A 5LPNA 5A5GA 2XRZA 1BMTA 1S4QA 1Z83A 3TD9A 1EXVA 1TYZA 1KEWA 4GMKA 7YASA 2AXPA 5DM4A 1J21A 1E58A 1ZU4A 5GWXA 2FKNA 2RK3A 4K81B 2HY7A 2EG5A 3PJFA 5KQMA 1E1KA 3IHTA 3G2JA 3OU6A 4JB8A 2NZJA 1JN0A 3LO8A 4XVRA 2C97A 4ARVA 1W2WB 5IVKA 4DA6A 1PS0A 4O1HA 1STOA 3MWDA 1SU4A 1Y1SA 1XD9A 4MVJG 5CDHA 1ZZEA 3VR2D 5IF3A 2VC2B 3E27A 2WF7A 1DAIA 1Q19A 2IY7A 1ZJ4A 2FW9A 3QUCA 3ZQ6A 1OI4A 3UG6A 1H4VB 1IM8A 3E9EA 5U4XA 5ALQA 4QXRA 1D07A 1FW8A 5CBKA 4EB3A 5DCYA 2P8SA 4BNVA 4C7KA 1X1SA 2IBSA 4Q9AA 2H4JA 3AVQA 3KEMA 5EKDA 4KWTA 4XWKA 2PSJA 4DV4B 5HTOA 1KAHA 2AMFA 4F4JA 2UUCB 1T4CB 1LSSA 3AH8A 1JWLA 3OFKA 4LKOA 4MAFA 4QQNA 4R5HA 1PVOA 1P17A 1MG0A 5HBGA 2YWGA 1ODJA 2AE1A 2XWPA 3EEYA 1J42A 3H4VA 1ZKMA 1PK7A 2B36A 2VZ9A 4RZIA 2UZ1B 4CV0A 5DP1A 5T41A 1M8FA 3KEQA 5GV8A 1L5SA 2QN9A 2OCIA 3NPMA 3ESDA 5AVYA 1PJCA 4BFYA 5C1PA 2J9FA 2VUTA 3GBVA 1E0AA 2ODWA 1VCMA 2BGWA 4PYIA 1ZH2A 4J3NA 1V9LA 3RTBA 4FZ5A 4N01A 5CD1A 4RC9A 3IIJA 5HCUA 4XPIA 4XTCS 1PL6A 3AP3A 3O93A 4H59A 2IXBA 3G5AA 5DXJA 4ME6A 4X1IA 4KIGA 1EXNA 3AP1A 3K6KA 1XAGA 4BNWA 3L0BA 1R0CA 3W5UA 4CMJA 1TO2E 3CF6R 3L8MA 1XKLA 1Q20A 4BC0A 1U0FA 2UZ1A 2VLIA 3PDWA 3OX2A 2P9TA 4QDXA 5KVCA 3GOQA 3U61B 1CUSA 2GCPA 1KQFA 1NNUA 3ASYA 9LDTA 4QAJA 3W1EA 5CIWA 3INRA 1JJFA 2PGLA 1CETA 3BXGA 3KSDO 4UFOA 2HV8A 4KEAA 2F3PA 4LBWA 4U7FA 5JXGA 2WD8A 4K6FA 3C4QA 5IM5A 4N12A 1NF2A 2JARA 2PTGA 3B9RA 3DL4A 4U02A 4CIXA 4K8RB 4MEAA 2Z0MA 2ZITA 5J4HA 3QHQA 1TU3A 3UXEA 1XEXB 2NT4A 4FOLA 3MGCA 1RADA 3MTBA 1TJPB 2RGWA 4DUPA 1NVEA 1YZGA 4M8NE 3GRFA 2V7WA 3ENWA 4ZVQA 5ICGA 2FUCA 4OXYA 5JFGA 1QGAA 1T3HA 2JLQA 2P40A 3BFXA 5BSRA 1DX6A 2WJWA 1ZY2A 1LRLA 3K92A 1I7PA 3WYNA 2FHPA 2XGJA 3CE9A 4LKRA 3F78A 2A3NA 1QC5A 1VSUA 4P8RA 2BEWB 2RI1A 1PZMA 3QQPA 1KBQA 4LBZA 2BTOA 4EEXA 2O4CA 4WFJA 3QITA 3U62A 3X1KA 3NHUA 4FEAA 3FB1A 4HWGA 3VKVA 2SKEA 1CVRA 1LA2A 3FPSA 5FOQA 3UT5B 3AETB 3DZCA 5A1JA 1W85A 1F38A 2LD4A 2O3RA 2OBXA 1QORA 3UKJA 2GNAA 2E4VA 4B6JA 4KPYA 2IQIA 1A69A 1QO0D 1DEXA 4NC9A 3ZU4A 1SG0A 4GWLA 4AMYA 2ZWIA 5BSVA 1C1XB 7ADHA 1SXGA 4GSKA 2IW1A 5AKKA 1JIKA 4XM0A 3F9CA 3GLIB 2YFQA 1NPTO 5AKLA 1GPBA 2PUHA 2BEWA 3PNSA 4Q9LA 1JMYA 3RQSA 1H1LB 2NSLA 5JVDB 3FDXA 1JT2A 3LOPA 2E0IA 3N5KA 5H16A 3RFUA 2QWXA 1ZCBA 1DT3A 1XA4A 5JYCA 4OHRA 5CU7A 1U1IA 3W6PA 2NZYA 2XVYA 4F6RA 1H4SA 4D82A 1SUWA 1YVUA 1XK6A 2DWQA 3BKWA 5DKFA 4HMQA 5KSZA 3PC6A 2NO1A 1ESEA 3LT5A 3KOYA 3OPXA 4NCNA 3LSTA 5A71A 1DO8A 3Q10A 5ALWA 3FPAA 1MJ5A 3KP1A 3MWJA 4E22A 4Y3UA 4WA7A 4KQ6A 3O1JC 4TWZA 5A0FA 3U4DA 3GBSA 3ONWA 1PQUA 3CIOA 4BZXA 3WKEA 2HBZA 3HR4A 4RZSA 3OVMA 3B6KA 1ONOA 1H22A 5ALXA 4ZVSA 3TQRA 4U1RA 1NX6A 4JI4B 2I22A 5BQXA 4BNJA 4BFWA 4AIRA 2F1OA 2R0QC 5G1NA 1E2JA 4QL3A 1BXZA 3DO8A 4ZI3A 4BGDA 4DB4A 4F6RB 1D6JA 3MGGA 1TAQA 4QJ4A 4U63A 4CR7A 4OXNA 3TOVA 3V4RA 2G9RA 3I4FA 1YCFA 5AW1A 3ZWQA 4DC0A 1RQPA 5CB6A 1EE1A 4WY5A 4AZ3B 1MO5A 1U8XX 3ORRA 3TG8A 3SKXA 4Z6KA 4GOXA 3SBDA 1AK1A 4KV7A 3ZGOA 3PP8A 3JAWA 1CUXA 3D0KA 3EIOA 3SVZA 1QNFA 4MYUA 4RABA 5LLTA 3EZFA 1BVYF 1OU0A 5JTUA 1W5EA 1MAUA 1TXGA 2BZ1A 4PFKA 3TX2A 4Q4AA 4R1LA 4Q24A 2RG1A 3ACBA 1A4XA 2QRMA 3N6VA 5B1SA 4Z7JA 3OJ0A 4PPNA 1U2PA 2VJBA 5F77A 4ALKA 2R3SA 5TT0A 1HQCA 4B4DA 1YC2A 2ZQZA 1UBKS 1R74A 4C7VA 5JXJA 2GILA 1KVUA 1W4CA 4M0KA 1C14A 2BI7A 2ZOSA 5GONF 3UPUA 3T3MB 1VIAA 3O8RA 5FR2A 5KI6A 3AEUB 3OEED 2Q8PA 1JQLB 2QP9X 5J2TF 3A1SA 3U2QA 4RJIA 1EH5A 2GNOA 3QI2A 4O0MA 7GPBA 2R86A 1YBMA 4BLVA 4KPUA 2PZ8A 4C78A 1ZHOA 3O8OB 4I1IA 4IAOA 1X92A 2E5FA 4J1TA 1H2AS 3T35A 5HKBA 2IOYA 2Q2QA 2H65A 3ZHRA 1P8AA 1HTWA 1SBCA 2H59A 4HQKA 4MITA 1BA3A 2PZLA 1JE1A 2H0AA 2Q45A 2QRQA 1OX4B 1JPJA 1ZM4A 3DR3A 3BK2A 4UHHA 4W5HA 1JYEA 4R2JA 1W73A 5ITSA 3TNJA 4MIYA 1MKYA 5FAKA 1P4AA 3JALA 3CLUD 4WDRA 1UANA 3B3AA 1T9HA 3T5CA 4BNHA 4X8OA 4AZWA 3DHVA 4RD0A 5JCOC 4F45A 3X1WA 4B43A 5C1BA 1RRPA 3UGJA 2HJRA 4A10A 4LQDA 1GL6A 1SVKA 4PVCA 1CY0A 5JRZA 3FJYA 1IN4A 3KEFA 1P0IA 4YPFA 3L0PA 2WQ6A 1JLLB 1WP4A 3K20A 3DLPX 4JHLA 4A6EA 2WU3A 2NYUA 3NOVA 4DRZA 3FXAA 8ADHA 5DFAA 2BJWA 1KEEA 1LU9A 4P36A 4JJAA 2QAGB 4A5SA 2RONA 2I6GA 4N48A 1T2DA 3B1WA 1JQEA 2PRKA 1U90A 4BIMA 3ZGLA 5B7NA 4QO7A 3CJRA 5DCUA 3IO5A 2Q9AA 3P9YA 1KSJA 2HTEA 4KDFA 4C89A 1T13A 3CXRA 2O52A 3BIWA 3LQ1A 3OU2A 4WGFA 1UZAA 3PDCA 4Z86A 4A03A 4CQMB 5IXSA 3CNLA 1TK2A 3U3XA 4ENRA 2QHXA 2B82A 4PY2A 1CQJA 4AUKA 1GP2A 2BMFA 3PKIA 1P7CA 1Z5WA 4RS3A 5HK9A 3CC8A 4YXWA 5JT1A 4E0BA 1KKLA 3MIIA 1SXIA 1LBEA 1QG2A 1I3NA 1NWCA 4DLKA 1XKXA 2NSDA 5AVWA 2CHQA 4KTVE 2HXGA 4L9RA 2JHGA 2W2PA 4Z9BA 2IEGA 5BWNA 1P2GA 1V5FA 2ZT7A 1XTUA 3G89A 3FCEA 3ITNA 4KJZA 4RM2A 5EE3A 3UJAA 4Z7NB 2UVDA 3QELA 1G2PA 1E1RD 4MQLA 1H1TA 5ALMA 1G7TA 1JQJC 2Q2WA 1GR1A 2UVPB 3KCNA 4JZYA 1M72A 3DBLA 3HNOA 4WZAB 5EAIA 2DFDA 3JQ9C 2WJJA 2NZ8A 2ZYWX 3WA7A 1UC5B 4DUYB 3A4MA 4FKMA 4Y6OA 4CLRA 4E32A 4U0KA 1PGPA 4B6QA 4C7BA 4LRTB 4TMFA 4UCWA 5LZ5A 3L8FA