2QXTA

Crystal structure analysis of the bacillus subtilis lipase crystallized at ph 4.5
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
179
structure length
179
Chain Sequence
HNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSADMIVMNYLSRLDGARNVQIHGVGHIGLLYSSQVNSLIKEGLNGGGQNTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipase
publication title Structural basis for the remarkable stability of Bacillus subtilis lipase (Lip A) at low pH
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 66
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2007-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qxtA00
2JGKA 3BE8A 4P93A 1QLWA 1GPKA 3SC2A 4Z49A 3SK0A 3PUIA 3F9CA 1FFCA 2HADA 3STYA 4MQMA 1XZDA 3WIBA 4IH9A 4G8CA 1IVYA 2DHDA 4Q05A 3C8HA 2BUBA 5SYMA 1VE6A 3A2LA 2WILA 3IBTA 2QS9A 1MPXA 3EBLA 4FLFA 5LLSA 2OGZA 2O7VA 1TAHA 1G66A 5C7YA 3A6ZA 4P92A 3TGLA 1TIBA 2OG1A 2OQIA 5AM1A 2XMBA 2ACEA 3FYUA 5LKRA 4IH4A 1EHYA 3VVMA 2H7YA 3DCNA 5ALKA 4FNMA 5HF5A 3STXA 4QA9A 4I4CA 2WJ4A 3D0KA 4ARBA 4BAGA 5LKAA 4OB7A 5BV7A 4JYPA 2AJDA 1JKMA 3ICWA 4QE3A 3KWJA 1FSSA 1DX4A 5DNUA 5AM3A 4X3CA 1S8OA 2BAGA 1UOQA 1XRLA 5AM0A 3GUUA 1XZAA 1CUGA 4UHEA 1USWA 4C89A 4Q3KA 3SWWA 1WHTA 2OLEA 1K4YA 5EGNA 4PSUA 4D9JA 3R3ZA 3K9BA 3BJMA 3DLTA 1N8SA 5JARA 3W05A 4B83A 5JALA 1ZI8A 5E4YA 2R11A 3WWEA 3CN7A 4Y9SA 5I7UA 3IUNA 4W1RA 4TVKA 1Q0ZA 1XRPA 2I3ZA 3DQZA 5ALTA 3H17A 1Y7IA 1NU8A 1OXMA 1YAHA 3BIWA 3B5EA 1P0IA 3V1KA 3WWPA 4BRZA 3IUQA 1T4MA 4ITVA 2QJRA 1XZKA 2J3DA 2C0QA 4CG2A 3E4DA 2XB6A 2QXUA 1GQSA 2FUKA 3I1IA 4HXGA 3I2HA 5CTAA 1PFQA 1UK9A 4MYDA 3WL8A 1ZI9A 3DL7A 3WWOA 4IQ4A 2E3JA 4UBLA 4X97A 1MO2A 3VVLA 2OXEA 4BZZA 2PSFA 1IZ7A 2BJHA 2J4CA 2BFNA 5DNWA 4E14A 3OURA 2HHAA 1TKRA 4WDRA 2Y6VA 4UUQA 5AK4A 4PV7A 2WLSA 3DD5A 3I2JA 2XMSA 1X2BA 2VA9A 1UKBA 3D2BA 1R9NA 4X93A 5IVKA 3DYIA 4HXFB 2AJBA 1G5FA 2ZSIA 2CEKA 3M82A 2FX5A 2HM7A 1BE0A 1AQLA 5AIBA 4FLEA 4U2FA 5CT5A 1ETHA 3WQHA 3H2GA 5EIAA 2WIJA 2Y6UA 1CUIA 2DCMA 5D6OA 4LHEA 1P0MA 3G0BA 5AIAA 5ALOA 2C0PA 2QKYA 1F0PA 2OCLA 1H23A 1WHSA 1A7UA 1VLQA 2W6CX 1AUOA 1THGA 3FLEA 2PSEA 2W22A 3STWA 4S0XA 1K5PA 1BROA 4X00A 1TCAA 4UPDA 1HBJA 4BZWA 1UT6A 3HACA 4DGQA 1ZD2P 2IIVA 4BDTA 2CJPA 2XUDA 4KJXA 3BF7A 3QZUA 4DNOA 2JGMA 4AO8A 4B0PA 4J3JA 4X92A 5AH0A 3H2HA 1DT5A 2HL6A 4G4JA 3FSGA 1W6RA 2B20A 4X71A 3I6YA 1VXOA 2C4HA 4BB0A 3IULA 1U4NA 3QPDA 2C58A 5E4TA 3P2MA 2XMQA 3ICVA 1YR2A 1X2EA 2VQ6A 3I2GA 2HFJA 3PDCA 2VSQA 5A7GA 1ZIXA 2K2QB 2YH2A 1U2EA 1BRTA 3KOOA 4ZREA 5FOQA 3RK4A 1WPRA 1Y7HA 1EH5A 3WJ1A 2JF0A 4CG3A 2GYVA 5ALWA 2CB9A 3TRDA 3ESAA 5K3FB 2WFZA 1CUCA 1YSCA 2WQZA 4GHWA 4XWGA 4ZWNA 5ALGA 2YYSA 4EHBA 2VF2A 5DYWA 1D07A 2CKMA 5ALZA 1QE3A 4GEGA 1UK7A 2QVBA 1O6GA 3HSSA 2GYWA 4FWBA 5K3BA 1EDEA 4HRYA 4PO3X 4DSAA 5AM2A 2JGEA 1YB6A 1CUAA 4BTVA 3RM3A 4ZRDA 1XZMA 3BDVA 1HL7A 4OCZA 4L72A 2BUAA 1AX9A 1XZFA 5AI0A 2XQIA 5ALIA 3WWDA 3HXKA 3H1BA 1WCYA 4ZV9A 2DFPA 1Z68A 4Y7DA 3PE6A 3HZOA 3WZMA 5HKAA 5DYTA 3PFCA 3RLIA 2WHPA 1QIHA 1L7AA 2XUQA 3FYUC 4BP9A 4OUKX 1SC9A 3KDAA 3C5VA 2WFMA 3WKAA 2XDWA 3LLCA 4KEAA 3AUKA 2ONCA 5CT6A 1XLUA 3AFIA 4DMHA 2WG2A 5HFAA 3CXUA 1H2YA 2WU4A 3BJRA 3WYDA 4GECA 1L7RA 4BTLA 3K6KA 5AKJA 1JT2A 1ZGCA 2H7CA 3NGMA 1QFMA 5JAHA 5AKXA 1GPLA 4OPMA 2WHQA 1MX1A 4A5SA 5CXXA 4BATA 5ALUA 1N5RA 3I6MA 1LBSA 5FDFA 4AO6A 2XUPA 4C4YA 1CEXA 5JD5A 2EEPA 4AXBA 3VJLA 1MX9A 5J3JA 4E46A 2XLCA 3T4UA 4BE9A 1QIJA 3CN9A 2QXTA 5FKJA 3AIKA 1EVQA 5AKGA 1FFEA 4U2BA 4HXEB 2O2HA 2D0DA 3IVMA 4PNZA 3QBJA 4MXDA 2I03A 4C88A 3QMMA 1YS1X 1N1MA 1SCIA 1J07A 1EDDA 1LLFA 3WYNA 3OC0A 2G63A 5K5EA 4QZVA 1UK6A 1JU4A 4B84A 1GGVA 2PSHA 4FKBA 2Z8ZA 5HQ3B 3QPAA 4PSDA 2HA0A 5JZ9A 1RP1A 1CUDA 1ZD4A 1XRMA 3C43A 5ALXA 1Q83A 4GXNA 1MT3A 4W1QA 5ALNA 1LZKA 1CPYA 6YASA 3W2TA 4LXHA 2XUOA 4MJ3A 3R3YA 1WM1A 4ZV7A 1LPAB 2WG1A 4K5QA 4XX1A 1QGED 2VJBA 2GBGA 5C8XA 2JEZA 3HI4A 1SCKA 4MEAA 4YK7A 5HCUA 4CCYB 5JD4A 4JUIA 2PX6A 5ALQA 1ZICA 2QRUA 2ZYSA 2OGTA 1W76A 1DWOA 1B6GA 5DTJA 4XIIA 3I2IA 3PI6A 1XZCA 5AK5A 3B12A 2ZJFA 3QVMA 1A8SA 1MTZA 4X6UA 1CLEA 3ESDA 3IUMA 5EHQA 4CIAA 1YASA 2AXEA 3AZOA 2V98A 4TPKA 4MWSA 3OTQA 1XRQA 2Y2VA 1EX9A 1YA8A 2OAEA 3WZLA 4Q82A 2RHTA 3OG9A 1CUZA 2R8BA 3WK4A 4W9RA 5ISMA 3BXPA 1W52X 4HZGA 4B9EA 5YASA 3BIXA 1CUUA 5IVIA 3WL5A 4MWTA 5LZ7A 1F8UA 2RGUA 2XMZA 1CUJA 5AI9A 4C4XA 1XLVA 4ZGBA 5ALPA 2HA5A 4XVCA 4IO0A 1CUEA 1E3QA 4UHFA 4C87A 4ZXFA 4C6HA 1HKHA 3G0GA 1QIEA 4GLBA 1UXOA 5AK6A 3JWEA 3ESCA 5FPPA 4WDQA 2WIGA 4H7FA 4J0IA 5K3DA 1JI3A 4INZA 3QMWA 3CCBA 1ZD3A 4ZI5A 3G9TA 5ALFA 4QDUA 4FTWA 2WFLA 2ZVDA 3A70A 1WB6A 3DL4A 3FCXA 5E4JA 2B9VA 2WSLA 1QJ4A 3I28A 4B85A 2ZYHA 2Y1KA 2V96A 5DLPA 3M83A 4KAAA 3DJYA 2RIPA 3V1LA 3G02A 3FVTA 2WTMA 5AICA 4X91A 1HQDA 4C01A 4OSEA 1LPNA 5CT4A 2WUEA 3U0VA 3O4GA 3DOHA 1OILA 2DQYA 2DR0A 2B61A 2LIPA 4Y2PA 4J0GA 4BC1A 1ACLA 5K3CA 1MNAA 4DMCA 3FOBA 5CH3A 4J0CA 2Z3ZA 4UBIA 1CUFA 2P8SA 4Y2UA 3QYJA 4UBJA 5AI4A 2NW6A 4GBGA 1MAHA 3AZQA 1XQYA 3WKDA 1XKTA 4K6HA 1XQWA 5CXUA 1CVLA 3ANSA 2XMGA 4ARAA 3G9UA 2JEYA 4AN0A 3EQ8A 4G9GA 4BC0A 4GI1A 3WK6A 5AOBA 2JGIA 1QO9A 1MNQA 3Q8WA 4AQDA 2PVSA 3WL6A 2JBWA 5ALHA 2AJ8A 2ACKA 1CUWA 4JEIA 3JW8A 3OPMA 3A2MA 4F5ZA 5ALJA 3O9VA 3C6ZA 3V9AA 4EZIA 5DWDA 5AI6A 2OAGA 3DS8A 3WKBA 1RYYA 3RKSA 3WK5A 3F96A 4MQLA 1MU0A 2XQJA 3ZLVA 2V9ZA 4AN1A 4BAUA 5HF6A 4DLNA 1TCCA 3G0IA 2PU5A 3ED1A 5CT8A 5FP0A 4G8DA 1E89A 3QPCA 1EK1A 1R88A 3H0CA 4UBMA 3WJ2A 5LZ5A 2DSNA 3O95A 3DKKA 1XZJA 4OD0A 2IX9A 3BDIA 1R3DA 1AMNA 4H77A 2ZJ6A 2AJLI 3C5WP 5FLKA 1WOMA 2HFKA 3HJUA 3R41A 1THTA 3IURA 2WIKA 1OCEA 3O4IA 4BAZA 4UFPA 1L7QA 4AX4A 1R1DA 1GT6A 4KAJA 4G4GA 2BKLA 2QR5A 2PUHA 1LZLA 4F0JA 1ZGBA 5HKBA 2OQVA 4WY8A 5AKZA 4W1PA 1QIFA 3BL8A 4HRXA 4L0CA 1A8UA 1HDEA 5AHXA 4E15A 1MX5A 4XJVA 2G4LA 1H2WA 3FBWA 4B6GA 1VA4A 3E1GA 1ZJ4A 3CCCA 5I8PA 3ILSA 1AKNA 1DWPA 4UBKA 4MEBA 4DTCA 1QONA 3H19A 1QIMA 2XQKA 1DX6A 3AINA 1ORWA 2CMFA 1E8MA 2GZRA 3DKRA 3MVEA 1EDBA 2Z5GA 2HRRA 4WCVA 3PICA 1DINA 1VA5A 4NVRA 2D5LA 1VZ2A 4N5HX 1ISPA 3HEAA 5T4BA 1VKHA 3VJKA 2XMRA 2XLBA 1XZGA 3IIIA 1CUHA 4P9NA 1KU0A 4K2AA 4PSCA 4HTAA 4QLAA 4RGYA 2HU8A 3HLKA 1TRHA 3C70A 3FWHA 4X7BA 1I6WA 4H7DA 4I3FA 3FLAA 5ALRA 5JANA 3VKFA 5LIPA 1SFRA 3D3NA 2WG0A 3FVRA 3C6BA 3B3QA 4L3WA 2XE4A 2OCIA 4DSZA 4EY5A 3FYUB 3STUA 1A88A 4ROTA 5EI5A 5JAPA 5JATA 1IUOA 4A16A 2J3QA 5AO9A 4UBOA 1U8EA 1XZLA 4DNFA 4B80A 3D7RA 4BRSA 3WA7A 1EINA 3K2IA 1E8NA 2XUJA 1CUSA 2BCEA 3E3AA 3IDAA 5ALEA 1G42A 1UWCA 4BP8A 2C5GA 5T4EA 5JADA 3VJMA 1BCSA 1AC5A 4IH1A 4KAFA 4FBMA 3UUFA 5DYYA 4JNCA 4O08A 4KE6A 3F67A 5ALYA 1XROA 2HU7A 2DHEA 4QWMA 3KWFA 5JAOA 2H9YA 4EBBA 2HIHA 5FUMA 4FNGA 4YX9A 5AOCA 2QT9A 4Y2VA 2YXPX 4AO7A 2ZYRA 1GKLA 1JMKC 2WU3A 2PSJA 3EQ7A 5AI5A 1PV1A 2HA4A 4H7EA 3L1HA 1J1IA 1C7IA 1BN6A 3PUHA 2XI4A 3PFBA 5BWBA 4H35A 3HABA 5HFNA 1LNSA 5ALSA 4BVJA 1DT3A 2VT7A 1X70A 5KBYA 1CFJA 2HA2A 4LYDA 5ALMA 4W1SA 1W4LA 4CG1A 5IVDA 5EIHA 3LCRA 4OU5A 1F6WA 4F21A 2QZPA 5AKEA 4DNQA 3GBSA 1LPMA 2O2IA 3W06A 4FFVA 2GBFA 3ESBA 4EY6A 3D4LA 5A2GA 1ACJA 2I3DA 4H7IA 2O7RA 1C7JA 5A62A 2ES4A 1VXRA 4RE5A 3WIOA 3GFFA 3GELA 3IB3A 4DYHA 1QOZA 1XRNA 3BF8A 4U2DA 3RARA 3O4JA 1CIJA 2VJDA 2ORYA 2OCGA 2PSDA 5LZ2A 4KE7A 2FJPA 2XMCA 1DQYA 1J06A 3NWOA 2QUBA 1JJIA 1CUYA 4M0EA 4EY8A 2G5PA 5KWJA 4CFSA 4J7AA 1CQZA 5E2IA 1XQVA 1IUPA 5EHZA 3VXKA 5CW2A 3C8DA 1DQZA 3R3UA 1E8DA 3PF8A 1UZAA 4M0FA 1EXWA 2QUAA 3I6ZA 3O9MA 2RHWA 1DU4A 5AP9A 3FYTA 4J0HA 1XFDA 3I1YA 5FV4A 4BVKA 1YCDA 2G5TA 1ZOIA 3FSGD 3N0TA 4U2EA 3G9XA 4GWLA 1IMJA 4PF1A 4X90A 3QM1A 2JGFA 1J2EA 3G8YA 4LXGA 1ZJ5A 5K3FA 4FLMA 2ECFA 3I2FA 2GBCA 1AGYA 5CH8A 5FRDA 3F8SA 4P08A 2FJ0A 1FFDA 3F97A 2J4FA 1UKCA 4G5XA 4Q1VA 1C4XA 4Q3LA 5AM4A 1H2XA 1LPPA 1QIIA 5C81A 1VZ3A 1XLWA 5AKLA 2PM8A 1U65A 5FXMA 4DIUA 3IUJA 4OYLA 3O4HA 5C8VA 2XMDA 1TK3A 1CRLA 3G7NA 5K3EA 5ALVA 3G9ZA 4OYYA 4EUSA 3KSRA 1XZEA 5F4ZA 3AJAA 1BCRA 2VAVA 5CMLA 1MJ5A 3H04A 1AZWA 1H22A 5T4HA 3WLAA 4Y2YA 3WK7A 4Q34A 5CRIA 2WM2A 5LYYA 3HRHA 4UHCA 2WHPB 5A71A 1EB8A 3WI7A 5AJHA 4UHHA 5LZ9A 3R3VA 5DNVA 4RPCA 5EIEA 3H2IA 1KEZA 5D3KA 1WB4A 5IKXA 2QMQA 4J03A 4BCBA 1Y37A 5AKHA 1N5MA 4X95A 1R50A 4X94A 3ANTA 1W75A 4EA6A 4MYSA 2UZ0A 2XT0A 3WL7A 5T4FA 4N8DA 5D7BA 2DHCA 3YASA 5CT9A 3ZPXA 4LKOA 4E11A 5EHXA 3V1MA 4UFNA 2XUHA 4BVLA 2X8BA 4JYMA 3C45A 5LZ8A 3KD2A 5K3AA 2XUGA 1GPNA 4KE8A 2XUAA 5HK9A 5HF9A 5HK8A 2CZQA 1IUNA 1T2NA 5AOAA 2PBLA 3R40A 4G9EA 4BYMA 1CUXA 1QO7A 4G4IA 3HC7A 4RE6A 1BN7A 4FDMA 4DM7A 3FAKA 4U2CA 5A7FA 2DQZA 3EIOA 3D2CA 5JD6A 4FHZA 1CR6A 2WTNA 2EDAA 1TQHA 2IITA 1CQWA 4N5IX 2XUFA 2VT6A 4FFWA 4BBZA 4GW3A 4J0DA 4QDTA 5HQ3A 5ALDA 1GZ7A 1QTIA 1PJAA 2RONA 2JGLA 1UFOA 3O0DA 1Q0RA 1P0QA 1BS9A 3F98A 3R3WA 4OU4A 4DMKA 3DEAA 3H2KA 2HA3A 1LPBB 4WFJA 4U2GA 4BDSA 3QH4A 3VDXA 4EB0A 2HDWA 1ODCA 2RI6A 4QDZA 3AIOA 4B81A 2ROQA 3WK9A 1G4HA 1GQRA 3ZV7A 2OCKA 3D5EA 2XUKA 5H3HA 3W04A 2JGJA 4KE9A 4UHBA 1VE7A 5SYNA 4X6XA 1IZ8A 3W9BA 1BEZA 4B9AA 4LXIA 4HVTA 2EDCA 4CCYA 5IVHA 4H7JA 2C7BA 3UMJA 4GDMA 3DNMA 1ODSA 3LP5A 4Y2TA 4N8EA 5C8ZA 1Q84A 2WJ3A 3HYSA 2XQGA 1E66A 4DMFA 1K8QA 5AK3A 4FMPA 5AKYA 4V2IA 3FNBA 1B41A 2H7XA 4Q3OA 1YB7A 7YASA 5AKIA 5JAUA 3OOSA 2VTVA 4B82A 3ZLTA 2PUJA 3GA7A 4I19A 4UHDA 5JASA 3WWCA 4EY7A 2CBGA 2VJAA 5HZGA 1F0NA 1XZHA 4CI9A 2X5XA 3R3XA 5LP1A 4B7ZA 1ZD5A 4EY4A 1UOPA 1GKKA 2QOEA 4KACA 4M0MA 2PL5A 2Y2UA 4FOLA 4Y2RA 3G0CA 1JJBA 4RNCA 1ORVA 2WIDA 4G1FA 1M33A 1JFRA 3S8YA 4NMWA 4YASA 2Z8XA 2JIDA 1EA5A 3DDUA 2VEOA 4WFKA 3S2ZA 3VISA 3L1IA 3ZLUA 3IA2A 3WK8A 4UFOA 4NZZA 2BGNA 1NU6A 1UOOA 5JZSA 4YPVA 1ZI6A 3WA6A 4C4ZA 3PF9A 2HA7A 1CUBA 2WUDA 3EF3A 2GBIA 3D2AA 3TEJA 2WHRA 4KYVA 4A23A 4WY5A 1EB9A 5AM5A 4KRXA 5BOVA 4F60A 1CUVA 3STTA 4N8SA 5FPQA 4NS4A 2HRQA 4H18A 4HAIA 4G8BA 1LGYA 3U1TA 1QIDA 3DYVA 3D59A 2RAUA 2XQFA 3LIIA 5D3ZA 3V1NA 4CCWA 3C6YA 4QDXA 2WFLB 2C5FA 2XUIA 4PQEA 4HS9A 1QTRA 2PKYX 4W63A 4BCCA 4Y2SA 1E5TA 1HPLA 2QTBA 2ZJ7A 4J0JA 5CURA 3WMRA 1YA4A 1QIGA 1FJ2A 4H0CA 5ESRA 2VAXA 1R9MA 2X76A 3DOIA 3N2ZB 1VJ5A 1QIKA 1JU3A 3H18A 2O2GA 2GYUA 1AURA 1ODTC 4AZ0A 3NUZA 3X3HA 5ALLA 1CV2A 5A6VA 3TJMA 1EK2A 4X6YA 3FCYA 1MAAA 4KRYA 4X85A 2V97A 2GZSA 1DTEA 4B0OA 4JH0A 5DTIA 1JJFA 1RWQA 2WKWA 1EVEA 1XQXA 5CH5A 1YAJA 1H2ZA 1KU6A 1XZBA 2PU7A 3LS2A 4QWWA 2WJ6A 4K6KA 5IH7A 4AMZA 2WIFA 3ZWQA 3GZJA 1NX9A 3QITA 3MUNA 3H1AA 4QEKA 3T52A 2VJCA 3BWXA 3LIPA 5EFZA 3WKEA 3AILA 3M3DA 1WPXA 1GXSA 4H7HA 4PW0A 3OM8A 1LPSA 2QJWA 1P0PA 3Q0TA 1QFSA 1QZ3A 1UK8A 2VATA 1SCQA 1LPOA 3AZPA 5HF8A 2B4KA 4DNPA 5DJ5A 1HLGA 3M81A 3E0XA 3MGAA 1FFBA 2WUFA 2Z3WA 4LYEA 4BE4A 4CIBA 5KREA 3L1JA 1K63A 3WKCA 1K6EA 4OB8A 5AKKA 3EQ9A 5LZ4A 5JZBA 2AJCA 3ZI7A 3W9UA 4QNNA 4AMYA 1A8QA 1MN6A 4AZ3A 4AB1A 2BGRA 4QDOA 3SX4A 1XRRA 2WUGA 4QLOA 1BU8A 2ZSHA 4Y2QA 1O6FA 4FBLA 2HA6A 1XKLA 2HU5A 1YS2X 3NOXA 5CBKA 3H2JA 4ETWA 1EI9A 1TCBA 4OB6A 4BCDA 4J0KA 3MUOA 3KXPA 3A2NA 4Y2XA 2H1IA 1W1IA 5I9IA 3JYHA 4WJLA 2ZYIA 3I2KA 5JYCA 2BUCA 5AI8A 4K6GA 1VOTA 4WFIA 4Y2JA 2PPLA 3C87A 2QM0A 5A7HA 2OPHA 1DWQA 1FFAA 3FLBA 3QMVA 4IHAA 4UBNA 4H7KA 2YASA 3V48A 3STVA 4L9AA 5EHNA 5BWCA 3GROA 1XZIA 1LBTA 5KWIA 1R4ZA 3C6XA 3G0DA 1WB5A 1JMYA 4KR0A 5JIBA 3AIMA 3UUEA 4LIPD 2I78A 2Q0XA 1BEEA 4TGLA 1ZIYA 3R0VA 2OGSA 1UKAA 2CUTA 1SOMA
chains in the Genus database with same CATH superfamily
5CA1A 3MTBA 4EZEA 3DE7X 1E7YA 1U9CA 4EJ6A 4CM5A 1CDOA 4DA0A 1TFUA 1DPFA 1G21B 3THOA 2LV8A 3CZ9A 2WNSA 5FBKA 3CNOA 1Q95A 2CXPA 2GK7A 2RI0A 2COKA 2HADA 3AL2A 1K6IA 1HT1E 5E6RA 3R2JA 1XZDA 4MQMA 3NBQA 4P4LA 1EP3B 2CL0X 3DR5A 3EXHC 1SK9A 4WNIA 3WIBA 4BJHB 4BV2A 1DQNA 4EHDA 5BVGB 5JYBA 5JTUA 1PD1A 1IVYA 3PK0A 2EQ5A 2FFBA 3C8HA 2BUBA 1ISFA 2JLVA 2A14A 1H1LB 4EHJA 1H5NA 2O19A 1VFNA 1ST2A 3C48A 2X5NA 2VR1A 4H31A 3JQ9A 4IDGA 1NXSA 4NBUA 5H81A 5IJ0A 5LOVA 4X65B 3WNZA 1ECCA 2WILA 4HI0E 4BMYA 2HJVA 1HDIA 3ZH2A 4OF4A 5IYZB 4R1MA 5J63A 1NUSA 5TXGA 1MPXA 4MYRA 4MUJA 5LLSA 1QFXA 1QZZA 2IOFK 1NM5A 2O7VA 3U44A 3W8EA 4PC7A 3KYCA 2AZTA 1G66A 1RWBA 1DXYA 2QW8A 2EIXA 5C7YA 1MAWA 3A6ZA 3HHEA 2BFBA 3FZYA 2R5FA 2GASA 1Z29A 3ZDBA 4DADA 4OQYA 3TGLA 3DVSX 1EYZA 1VSTA 2OTCA 2R7MA 2OQ2A 2XMBA 4FZJA 5AM1A 4AUEA 5C2JB 1KMMA 2Q4EA 5BPFA 5LKRA 5CFPA 5HYVA 3OZVA 3DCNA 4G67A 1D8TA 2VHZA 1R16A 4ZYLA 2FR0A 2H07A 3PB3A 4I4CA 5LMZA 2YICA 3TKLA 2CN1A 1PK8A 3D0KA 4K2HA 4M0CA 2WWFA 4JKIA 3UN1A 1HE2A 4FHCA 2HDOA 4ARBA 4B3XA 3ZNNA 5FLXA 2G07A 3R23A 3IXMA 2YJNA 4TVOA 4Q6BA 5ECYA 1WMSA 3VR6H 4FFRA 2C5EA 1MG0A 4B3JA 4C07A 3CF0A 1SAYA 4JBYA 1C8LA 3NIFB 3R0JA 2FG7C 1A95A 2R6ZA 1PNQA 1JKMA 2AJDA 3ICWA 4HWKA 3FETA 3KETA 2ZIUB 1YR3A 3WDMA 2WJGA 1FSSA 1QV9A 3FKJA 3DV0B 2PKWA 5MF6A 4TTTS 1YR1A 1GTRA 1IDOA 1KYZA 1S8OA 2VCEA 3FJYA 1XRLA 4AI6A 3OT1A 2PXHA 1ANKA 3VYWA 4POOA 3M49A 3KZCA 1LSSA 4P34A 4KIFA 1XZAA 2AOUA 4R51A 1USWA 2HJWA 4RK4A 4C89A 2FUEA 2Z9BA 3K72B 5EGNA 5LFAA 1T9BA 4MP8A 2AH5A 2I4NA 1PLLA 5I5GA 1T15A 1F3OA 4KDFA 2QEQA 1L7XA 4QYMA 2J3LA 5A4IS 2IODA 4IGAA 2QN6A 1WZIA 3Q3EA 1JSLA 2X1HA 2XH8A 4J4BA 4S1PA 1N8SA 4YXWA 4B83A 1TT7A 3E81A 3ZJUA 4JIMA 1WABA 2I9KA 4MQ4A 4FXOA 2IYWA 2NNLD 3CN7A 4NV0A 4S1OA 1OOEA 2W98A 4XGRA 4KU4A 4BASA 4CWAA 2YCBA 3EDQA 3N86A 3U9SA 2CXQA 3JD3A 3OKCA 3IUNA 3RVRA 4MP6A 4D3DA 4W1RA 4QBKA 1RPAA 2JARA 2IKSA 2A8YA 3IUEA 4UXJA 1G2IA 2GEVA 3G2OA 1W29A 5B5SA 5A3SA 2VP0A 2PKEA 2PUVA 1Q0ZA 2BBSA 2WU1A 5EJ2A 5H5JA 2R5NA 1AF4A 4PZZA 2YNMC 1O3YA 3WXBA 5FWNA 3GWZA 3K35A 2DUMA 3GJRA 4CFYA 5IN4A 4JAVC 1SXJB 4C5CA 1VKRA 5AQ1A 2OO7A 1G4UR 4JJ4A 3GI1A 2D3WA 4OP2A 2C0QA 3AESB 3OQHA 3HCEA 1UPFA 3GEGA 1RCFA 4E21A 4RVCA 2P2ZA 4QGAA 1NBMD 2J9YB 3AETA 1KRXA 2CNWA 3TXYA 2ZATA 4YP7A 4DMGA 4HGYA 3WL8A 1UK9A 5LYJB 2R48A 3ZVNA 3TUZC 5HFJA 2WQ6A 1A77A 4D8VA 5IWCA 3EPLA 1YZVA 3DZHA 5EJ9A 4WY2A 1KI3A 2E3JA 4UBLA 2JI6A 4UXHA 2CHUA 1J70A 1MO2A 2C9BA 1QXSA 1UWKA 1D8AA 3PLRA 1XAHA 4AG6A 1PR2A 4JZYA 4WUTA 4GX5A 3AUXA 2J41A 4WOPA 3ZOZA 1UJCA 1LW6E 1Q6ZA 2DFNA 3TDNA 4HQ6A 4IUYA 2B1IA 1C2TA 3KVNA 1F2TA 2GEBA 5FYDA 1C0KA 3P94A 4E14A 2ATXA 3TINA 1N33B 4ZVMA 3OURA 1MBZA 3THSA 4RHTA 3BSFA 2GS9A 4HAUA 4UUQA 4XSGA 5KNBD 3VR2D 2XKAA 4Q21A 1IBKB 4BMVA 1NYTA 3GLIB 1R9NA 1T36B 3LUHA 2QE6A 3T06B 3DMTA 4I8DA 2ZSIA 3DHWC 3ITDA 1JQ5A 1MXFA 1FXWA 1RBZA 4RQUA 3WRYA 1BE0A 1ENOA 1FA9A 2FMIA 1K7CA 2NO6A 4TMFA 1V45E 3QFRA 1NBME 2CHEA 4HN2A 4U2FA 4DV4B 2G71A 3DEFA 3U3JA 1F6BA 2I5PO 1TO2E 4XYEA 3E15A 4BE7B 1ETHA 1XRJA 4JI8B 3NVDA 4M1OA 4TQ9A 5DTEA 2W2PA 5DX8A 2MR5A 1YBVA 1VRWA 2WIJA 3ZX5A 3VZDA 3A3OA 1G0OA 3KYDB 1K27A 4JUCA 4KNVA 4KH0A 5KVQA 5GMOA 5GAJA 1DBPA 5D6OA 1YGYA 2CL7X 1L8AA 3RK0A 1OTYA 1JZQA 2HLHA 3MWYW 5EE9A 2IV3A 4P4NA 2GF9A 4LI0A 5AIAA 5I7AA 2NO7A 3LF2A 1VL0A 4ND4A 5T3YA 3K92A 3QUBA 4QOHA 2F55A 1VDZA 5CBPA 5DTMA 3KL2A 5LDDC 2OCLA 1V0JA 4FUTA 1H23A 1EUCB 1SBIA 1SO8A 1JXOA 2ZULA 3HJTA 1IK4A 4J43A 4E6EA 1WHSA 4NYMR 2P27A 4DUPA 3RVSA 4KDCA 4H3KB 2ZIXA 4OQ4A 2ZTMA 1THGA 1KO1A 1NXXA 2WR8A 3FLEA 4BRWA 5BNWA 3ONWA 4H1VA 1VMEA 3DGFC 2G83A 3NV9A 5JSZB 3EZ9A 3N53A 4IIVA 1GZ5A 3SZGA 1NZDA 4HNVA 1YB4A 1TCAA 4TLEA 2CDAA 1F1BA 5AW5A 4PGAA 1WBBA 4G01B 4BZWA 4DMMA 2OV3A 1M9NA 2YIMA 4ICIA 4D57A 5LD2C 4AKSA 3HACA 3GQBB 3BWEA 4HYYA 1WMFA 2E87A 2FPSA 4RH3A 1AB6A 2IYZA 3C85A 4RO0A 2G8LA 2XUDA 4KJXA 1TXGA 2FB9A 4TMWA 3LDAA 1OR8A 2PEZA 2JGMA 1KYVA 4EO7A 1UJ2A 3FNGA 4LC1A 3UF0A 2VDVE 4WI1A 5L3QB 2PY6A 3QI2A 4X92A 5AH0A 4MGIR 1DT5A 4H1HA 3HKEB 2HL6A 1RKUA 4HNAA 3V8NA 3FSGA 5BW6B 5EWMB 3TIXB 3CR3C 3LCJA 1YBAA 3PITA 1SKQA 3VKGA 3V9AA 4JSYA 1XF9A 3BRSA 3AHFA 2NVUB 2FSVC 4I9FA 2P2GA 3AY0A 4UQLA 4ZO4A 2PTHA 4X71A 4X20B 5A0FA 1L4UA 4W7SA 4YHHB 4PZEA 5JS1A 3DR3A 3SQWA 3AM1A 4Z3KA 2AJTA 4BB0A 2Q46A 1JIUA 1D6JA 2FQWA 3CH5A 2ZR0A 2V6MA 1U4NA 1NNEA 3DTTA 1MORA 1DFGA 4RZUA 4YMLA 1RXWA 2ZZMA 1HUQA 3SLKA 1EFUA 2OP0A 2ZCUA 3R0IA 1PBNA 5KPDA 1JP7A 5TMBA 1TQDA 2GNAA 4HD8A 4CRWB 1U4OA 3M3HA 5F98A 1Y3AA 1KGDA 4DSTA 3TMYA 2DGDA 4NCIA 4EFKA 4E5UA 3BA1A 3C1TA 5FF9A 3SOPA 3K0SA 2BFEB 2I9PA 4P32A 1B26A 1QQBA 1YS4A 2PJZA 3NNNA 2J9XB 3ROKA 2YW2A 1BRTA 1Y89A 5JJ5A 3DUFA 3WLJA 2QM8A 3ZWPA 2ZRAA 4QTUB 5LPNA 1KO5A 2VPTA 1VCNA 1LNZA 1GARA 1HG0A 1D7AA 1VJ1A 3HV2A 4US0R 1FZQA 1O5TA 4OXRA 3R7WB 5K0SA 1OXTA 2XNCA 1E2EA 4AF6A 3OTWA 1TM1E 2ZBRA 4BPRA 2GVNA 3PHBE 3SIXA 1GEEA 2BW0A 4TV9A 3H2BA 3U3DA 1D0SA 4B43A 3A1SA 4GHWA 1P9RA 4C4OA 3GNSA 3D0RA 3A7DA 2YYSA 3QVKA 4EHBA 4QUEA 1NTOA 5E7JA 5GY7A 4AKHA 4RAQA 2ZRNA 1JTEA 3QV1A 4L02A 3KT3A 5EIXA 3HN7A 4HR7A 3ODGA 2CLLB 4FWBA 3I5XA 1EDEA 4LTDA 3HWWA 1OYYA 1OFHA 4AZTA 4HHEA 4R6WA 3D6AA 4NV3A 2Q2QA 4O29A 4HEA6 4PO3X 1EVIA 1N0HA 4RADA 4RPJA 4C7XA 1U0FA 3BMOB 3IGFA 4MUIA 3T7SA 5K45A 4YC7A 3IE1A 2JHAA 2YIDA 1G38A 1XVVA 2N9UA 2QTVA 1J0XO 4ZRDA 1UQUA 2G82A 4ZVKA 3C3JA 1QG6A 3O8DA 1UBKS 5KYTA 2AFIB 2QRHA 2E6KA 2PGAA 4L72A 2BUAA 4FFSA 4V39A 5ESDA 3VU9A 3JYNA 3LQ2A 1A8PA 4ARSA 1I30A 2P2YA 3KSZO 1KOGA 2NZ2A 1Y3IA 2VNIA 3OTIA 1MENA 5G4LA 3WFJA 1ORTA 2ZRCA 2ZR8A 3GT4A 5F9MA 4ZV9A 3PE4A 4EKGA 1C5KA 1D1QA 1L5WA 5CLHA 1RLJA 4Y7DA 4Q4CA 2HLPA 2IJGX 5CB4F 5IG2A 2SBTA 2XXJA 4BFSA 3CIFA 4H59A 3LX4A 5KAPA 5IT5A 3OKPA 2YZ7A 1ITZA 1EDOA 3E5HA 4X41A 1SIBE 3HY3A 2JA1A 2VRWA 3NWPA 4X63A 2WHPA 1XFAA 3BFPA 3GLKA 2YXNA 3A6HA 2F1HA 4QUGA 3SP1A 3UB4A 3NBKA 3M9LA 1HR0B 2IEDA 2WP8J 3FYUC 3K96A 4U9IS 1TGVA 4B44A 3PJRA 2A0XA 3L7BA 1LS6A 4FEGA 2FDRA 2AN4A 5BR7A 3AVVA 3H65A 1SQGA 4LGCA 2K4MA 4PINA 4IY1A 4JEMA 1GFWA 4A8JB 3PA8A 2FFQA 2CLOB 3U49A 4PZ9A 3TJZA 5F23A 4ZZ2A 2RKBA 2GLXA 4OEHA 4CQLA 1DZ3A 4A10A 3FI9A 4Q7JB 4U0KA 1WULS 2GCOA 3O94A 3DULA 3I64A 2IU4A 4BWVA 2FG6C 1TM2A 1N6NA 2BZ1A 1Y7LA 3K30A 2XYGA 3A05A 4YV7A 1PHPA 4D3YA 2D1QA 3CF4G 5IDYA 1QQAA 1E7RA 2NNWB 1XA4A 1I3OA 1TVKA 3K9LA 4DSUA 4EUFA 2ID8A 1H2YA 4RFSA 3B3GA 3BJRA 3SBEA 1UXHA 2BDTA 1NQ5A 2OSBA 1N7JA 3K6KA 1JA0A 2YWFA 5L6LB 3EVCA 1EJ6A 3UA4A 1U28A 1WDLA 2JCGA 3O84A 1RP7A 1ZGCA 3JATA 4R5HA 4YHBA 1I6MA 1OVMA 3NGMA 4PY2A 4QECA 2ZZNA 5EP4A 3NAMA 1NPTO 1KORA 3KHSA 3ZY2A 3GU3A 4OPMA 2P75A 2DRIA 3KAQA 3LVFO 4O4HA 3ZZ0A 4ZZ1A 2VYVD 1HDRA 1LSUA 1MX1A 1N5DA 1RXIA 3EAQA 4WGFA 4EPWA 5KUTA 1BSVA 1GCAA 4BATA 5CVDA 5LP6F 4B2IA 2XOEA 4DLYA 1FQOA 1XA3A 3BFXA 1D6MA 1NUUA 3JQGA 2QMEA 2B36A 3KKOA 5J23A 4AO6A 4ENPA 4L3VA 4C4YA 1RS0A 3CLVA 3ROEA 4CV3A 1WTAA 4D6YA 5JD5A 4XVUA 4KQIA 2ZBUA 1M2KA 1O57A 2CKDA 2HBRA 1SD2A 2RCYA 2VF5X 2ZU0C 4GGMX 4UCXA 2Y71A 3T9CA 2VSOA 4HEHA 3CUVA 4MVJM 4YMTA 4DPMA 1DOZA 5AVQA 2Q3MA 3CZCA 4PRLA 3T4UA 3JASB 4KRFA 2QXTA 5EFOA 1EVQA 3AIKA 2P2LA 3MMZA 4U2BA 1U81A 4UUOA 1EJ0A 3F1LA 4B6FA 5A03A 2HPAA 4GKBA 4AZVA 1Y8ZA 3V4SA 2ZTSA 1BXGB 2I03A 2R6FA 2IYRA 3DC7A 4FBGA 5B1SA 1JHVA 5C8YA 3QMMA 2P6MA 3KVOA 4EITA 1QDEA 5BNZA 5IAGA 1BMTA 1J07A 1P1IA 2Y9PB 2R8EA 5FWDA 5BRAA 3N6RA 2SHKA 3MMNA 3VOBA 1YFZA 5J2TB 2INGX 3OC0A 4WTOA 1QDUA 2G63A 5CNKA 2Q5LA 2OENG 2X14A 2QW0X 5JZOA 1GQ2A 3KZ1E 4G2TA 4PG7A 3DPUA 2IU6A 2PUWA 3AWDA 4IXNA 3I4CA 1EXMA 3DHNA 1HT0A 3M89A 4RD6A 1IZ9A 3KB6A 1YCGA 3BTSA 5KVVA 3PSAA 1G3RA 1GGJA 3GDGA 4RQTA 5EXDA 4ZEXA 3DGEC 5HQ3B 5KNDA 5HJ7A 5J4KA 3QPAA 3SVTA 5SY4A 4A82A 2HC9A 5JZ9A 3IT0A 1RP1A 5HBRA 1V3UA 1ZD4A 4CT0A 4OHCA 2QA5A 3FCCA 3AV0B 1J99A 1GUAA 4WZZA 2IBTA 5C46F 1K6XA 4GXNA 4W1QA 1TMOA 2R7KA 3FMOB 3PIDA 1TAQA 3ZR4B 1V5WA 2FZKA 1ODJA 3VYSB 3W2TA 3F7TA 1X74A 4PCVA 4TOIA 3QIVA 3E48A 2G36A 2ID9A 2H1SA 2ZJ3A 1LDYA 4N7JA 4MJ3A 3R3YA 4IIGA 1Q7TA 1ULAA 2J5RA 2R8OA 4JNKA 2QRVA 3GD7A 1YBHA 2H18A 3W3AH 4XX1A 1ZUNA 2V65A 1QGED 2FSUA 2IP1A 1RYHA 5JSHA 3N76A 2NACA 4KC0A 2WTAA 2VJBA 3DO5A 3AJEA 3PWSA 3OIVA 4QXMA 5A5EA 2Z6VA 3V1TC 4DIOA 1D3AA 5KTSA 4P4GA 1ULHA 4LF9B 1L7BA 2C54A 3KD3A 3OJOA 2GF2A 1XB2A 3JQFC 4JBHA 4YRCA 4I50B 1D1PA 5C34B 1CNEA 1YOVB 1RRCA 3USZA 4B7UA 2C9YA 1SCKA 4TWJA 1F6DA 2NV2B 3EARA 4NJEB 3B6IA 1CYDA 4TT3A 4WIAA 4DF3A 2PFGA 4MUNA 3D3KA 1ZU5A 2BGJA 2QR3A 4I55A 3BJZA 4II3A 3LX5A 1W9MA 1DMRA 5ALQA 1Z62A 1H2EA 1YIOA 2A9RA 1QGAA 1I0ZA 4MWOA 3QU5A 1TEHA 1HLFA 4IGIA 5DEOA 3K71B 1DWOA 2QU8A 3H3XA 4B7AA 3OF5A 2QPOA 3P45A 4IZOA 3H9GA 4OAPA 5KYWB 3E9RA 5B7PA 2XHEA 4HWGA 1SUAA 2YWEA 5L51A 1USKA 3PE3A 1AS0A 2B99A 4KN9S 5TX7A 2WE8A 3IDSA 5AK5A 1ZMXA 3BCUA 4MCHA 4EAAA 1A8SA 1LDGA 1PRYA 1RAFA 1E9FA 2BELA 2X2OA 4KV7A 1IBRA 4WZAA 5KTPA 2ZBGA 1N0UA 3OU2A 4CTKA 4OAQA 4ABYA 1EX1A 5K03A 3CW8X 2PE5A 3W5UA 1U7PA 2AMLA 3GPDG 4GMXA 1Z6XA 5DHTA 2RGWA 2ZRDA 3PNPA 3NONA 1UKZA 4R2IA 3OWHA 1YHYA 1RXYA 4I5FA 5E2BA 3UMYA 2CDRA 3TSCA 1ZK4A 4Z4IA 5TQJA 4YJ2F 3EX7C 2AXEA 4RFLA 5JROA 2V98A 3W6OA 2RKWA 3E9EA 3OOWA 4HDOB 2XKKA 4TPKA 4MWSA 4DUZB 5HKOA 1AXEA 4C0LA 1I3MA 2W2KB 1EX9A 2Y2VA 5ENVA 4ZAYA 3AEKB 3K1TA 1T5HX 4ZCPA 3WGLA 1NDQA 4KQCA 4Q82A 3L41A 3WZLA 1OREA 1T4CA 4PVCA 1M1XB 2NU7B 4PO1A 1X8LA 2R8BA 4V0KA 4IPTA 4I5EA 5ISMA 2Q3BA 1G8MA 3FLMA 3IODA 4C30A 3L01A 1B6SA 2FDXA 3HBAA 3G1WA 4PZ0A 5KJFA 1RI2A 1P2FA 1AKRA 4IDFA 1W5BA 3WFIA 4B9EA 3RODA 5IT0A 1RPNA 1SOWA 1R4NA 4KVAA 3BIXA 2JI8A 1HETA 1U1CA 1VHLA 4LX8A 2FN4A 5CB6A 1EE1A 5AJZA 1MEEA 2B9EA 1NMXA 1L8LA 5IVIA 3ZVRA 4ED9A 3AKZA 4YS6A 1NUTA 1Q22A 3QFSA 3SQLA 2GXUA 3I8SA 4DA8A 3E0QA 4JOCA 4IZHA 1F8UA 3QOYA 4GOMD 3AWIA 4HB4A 4S1TA 4UZSA 3MUFA 5HIAA 3LCCA 1NATA 1PD0A 3TO5A 3L7CA 2QG4A 1E0KA 1XLVA 5ITZB 1IWBB 2BFDA 2SKDA 1T2DA 1QWOA 2ZYVX 1WMDA 3A3KA 4OXXA 3FPJA 2OCAA 3OC6A 4G5SA 1WD7A 3E9ZA 1OLSB 3N3BC 2FA9A 3OSUA 3RFUA 1SVOA 4UHFA 5IARA 1HKUA 2V1UA 5EMNA 4INOA 4DPKA 1A9YA 3DT9A 5IT4A 1YH3A 2FF5A 3KKLA 1UXOA 1KYQA 3PPWA 1Z8FA 5C7LO 1UEJA 1L7PA 4UNRA 5KQPA 2R44A 5L45A 1VJRA 4PX2A 5HA5A 1LXCA 1DHTA 5KDOA 3AI1A 1B16A 1MKYA 1YOBA 2FK7A 2IYNA 5FPPA 2B25A 3BMNA 4EA8A 3O8RA 2WV7A 3JWPA 2OO5A 4LJKA 4Q3EA 5UKDA 3PUZA 3GJXC 3EA0A 4PCAA 3TIFA 4DLKA 1WSBA 4BNYA 3H5NA 4QOEA 5BOSA 3RYCA 2ZT8A 5J2UF 1W5FA 1ZD3A 1WKCA 2DLCX 2QDXA 2Z5LA 1D2MA 3PD1A 6CHYA 4H0NA 1RQLA 1L1QA 4FTWA 1E62A 2WFLA 1R0YA 1X1CA 1DWUA 2JS7A 4HZUA 4KRGA 2I4LA 1P60A 4PS0A 2CXTA 2DJIA 4DV5B 3K32A 2QUHA 3R44A 2VP6A 2XADA 4XWAA 4D0SA 1N2CE 2WSLA 3OPVA 3OA0A 1T0PA 4I1VA 4IGFA 1BDIA 1PJTA 1KXZA 3MM4A 5FH9A 1N0WA 3FXAA 1Q6YA 1X9GA 4FKZA 5DCWA 5K3SA 4YMGA 1LBEA 3RTCA 5JRZA 1V7CA 2QRLA 4LNHA 5C18A 3K0AB 3O8QA 2CNDA 2RC6A 5LIRA 2NSYA 2RIRA 3M83A 2JCXA 4Y6GB 1U98A 1U3CA 3V1LA 1ZUHA 2R8RA 2ZLBA 4ZDIA 1YFKA 1Z4IA 3RD5A 2F00A 5K9ZA 3FBGA 5CXSA 1WP4A 1HQDA 2H57A 2IY9A 4C01A 3L5KA 1TUBB 3RYHA 1E20A 5AJYA 2Q6IA 4OMUA 3DYBA 5F5NA 5SZHB 1TT5A 1XPRA 1SKUA 3O4GA 1UADA 1WU7A 2BTQB 2DUJA 2DR0A 1QWSA 1KAOA 4AIRA 2LIPA 4CMJA 4Z4HA 1B00A 3BFKA 3CTMA 1ACLA 3UJAA 4AMBA 4MB0A 1SXHA 3DVLA 1YJXA 3DTYA 2PXXA 3FOBA 2BR4A 4ZQGA 4GC9A 5BW8A 4P83A 1AGPA 5EIBC 4IUDS 4QNRA 4DQLA 3PGLA 3CW9A 1WXEA 1QQ6A 1L4FA 4AZ0B 3MJSA 2GM9A 2PXCA 1BMFD 5AI4A 1BJKA 1HYEA 5DMXA 4W99A 1TX4B 5A9TA 1BDHA 2O8CA 2KSQA 2OZKA 1H2RS 4FYIA 3Q15C 4H1TA 1U5BA 3SF8B 1C9JA 1H6CA 3WB1A 1Z4MA 2NXCA 4IHJB 5CXUA 2PRSA 2XUZA 3QP9A 4D0LB 1K3UB 2JAUA 1EGVB 3R6WA 4P7KA 2OXIA 3R7DA 3ENQA 2QNBA 4EEKA 1Y34E 2ZVPX 3G9UA 4NBRA 3NNSA 3L4BC 2IC5A 2FAXA 4Z7QB 3B7PA 3EMBA 1PS9A 2A35A 3ZJYA 3N74A 2EZTA 1ZG3A 4AU1A 3HO6A 4NZMA 2WYUA 1J0AA 1E0SA 2XDYA 3PGMA 1G9TA 4G9GA 1NNLA 2C59A 2Q5CA 3EZLA 4BC0A 2I4TA 4W4TA 5JRDS 4R8SA 4BNWA 1IN1A 3WRVA 1K7EB 2JDID 4GI1A 3IRUA 3S4YA 3WK6A 1P75A 5AOBA 2AC2A 4BQSA 2R84A 1MNQA 4DV7B 3CA8A 1GRVA 3WYGA 2I29A 4AQDA 5ULLA 2B30A 1KBOA 1VL5A 2FUNB 2YNMD 3DKPA 3KJNA 3L8FA 3PFNA 3PJFA 4HWPA 1P1KA 4PXSA 5FOVA 2VDUE 1CUWA 5AD1A 4JEIA 4L4SA 2JRLA 4FI3F 4BO3A 4NX2A 4WEQA 2J45A 5IASA 1KAMA 4QJIA 2GGSA 3LECA 2ZREA 1RI5A 4HRAA 4I1UA 2VYFA 4NR0A 2WNHA 1QS0B 3A2MA 2Q6VA 3NKFA 5ALJA 3EC7A 1PWXA 3C6ZA 3TNFA 5JNTA 5E9QA 4EZIA 1NN5A 3HA7A 5DWDA 2Z56A 3FZNA 3Q11A 3HTXA 1V6CA 3GFVA 4ONEA 4EYKA 2IW1A 3GLHE 1U2ZA 3TFOA 1RWXA 4EKYA 4RETA 5IX8A 1Q0TA 5KAMA 4K6FA 4CKYA 1OB2A 2G1AA 1O9GA 1V6AA 5D86A 5D3MB 1DKMA 2F9FA 2UYYA 4AJEA 1P1CA 1MU0A 2V9ZA 5E1BA 5HF6A 2PXAA 3Q2IA 1U1EA 4EGFA 2HJSA 4RJTA 3IJEB 2IDKA 1O6ZA 3HCNA 2JLRA 3UJ9A 2OFOA 2B8WA 2IIPA 2XNDA 4WLUA 1A9ZA 1U7OA 3RVMA 1CF2O 4L95C 4WHMA 5D51S 5C9ZA 2UZ1B 3AI7A 3CZRA 4M9UA 1Y3BE 4G8DA 3F6BX 1RBYA 2BM8A 3QPCA 1ECFA 4RY0A 4D9GA 1KVUA 3BJEA 2W2NA 1EK1A 1JG1A 1R88A 3IPRA 3TZBA 4PONA 5LZ5A 2Q6OA 4IINA 1IZ0A 2I54A 3NGXA 3P9PA 3SFVA 4DLRA 3O95A 1XDBA 2UYHA 3EW9A 1XZJA 2XBMA 4B4DA 2IX9A 1L5ZA 3I6BA 4MGEA 4TZ0A 1R3DA 1UZMA 3QA3E 1AMNA 5J5CA 1TVCA 2ZJ6A 3NG1A 2AJLI 2YYZA 3F7NA 4DWVA 1WOMA 2BKUA 2HFKA 2WPDD 1Y3CE 2FPOA 4EZBA 1FX0B 3DAGA 1I2MA 2C5HA 5TVGA 3WIVA 3DZDA 3QJ5A 2XCIA 5JXIA 2DY1A 1SRRA 3I3OA 4WBNB 3WHKA 2ZDQA 2VCHA 1QC5A 4JBXA 4CM9A 3AM4A 4P4TA 5WRFA 2HK8A 3BWVA 4AX4A 3GLFA 4AYWA 1W2GA 2FSSA 2X5KO 4NENB 4MWDA 3ZCPA 1LLCA 4G4GA 4AKGA 2BD0A 2BKLA 2IUEA 3WIUA 3V1YA 2Y9MB 4DXDA 4KWCA 4G84A 2Q2OA 3UOGA 2P2DA 4V1CI 3JR7A 3WV5A 3ROGA 1PFKA 1U8ZA 4EJFA 1XZ8A 3WR5A 3MTJA 1XCLA 4WXMA 4LZJA 4HDCA 3HDYA 3WQBA 4UDXX 5AKZA 2PGNA 4W1PA 2OD9A 1R64A 3I9JA 5B58C 5KSWB 2J4DA 2QTRA 3F49S 1X1EA 4DRXA 1PJLA 1QQ7A 5FTJA 1BKDR 5DX1A 1HGXA 1VBKA 1IN6A 1E1CA 2F7SA 4UVEA 3C4JA 5AVZA 2QPAA 2G06A 1MX5A 1KKLA 1S4MA 2XTJA 2QTLA 3VX4A 3NBXX 3RRJA 1CBUA 4KX5A 3NJ8A 4XJVA 3VA7A 3KTFA 4O2AB 3DDCA 2CLEB 3U13A 4AP5A 4M8SA 2LRHA 4RA6A 1KFJB 3B9PA 3UMCA 1NP3A 4MUXA 3VO1A 5BWMA 4XTRA 2QD5A 3JS5A 2O2XA 3E1GA 1EFKA 4INJA 1JHMA 3NBZC 5DHUA 2WV9A 3W5SA 4OX9Y 2Y1OA 2YHIB 5HW0A 2PGIA 4IDNA 4N6GA 3TIGA 5I8PA 4CKEB 4RKFA 1CERA 1GZVA 2XTNA 2JW5A 4JLWA 4O4JB 4D8TA 1E4YA 2J6HA 3A4IA 3MFQA 3BMCB 4F6RB 5KTRA 1JKIA 2R00C 3K94A 3JALB 1G6KA 4FT4A 4TYPA 2DE0X 1QONA 4DTCA 4GBMA 1N2ZA 1C8KA 1UDBA 1EFDN 4I6EA 4KIJA 3KOMA 5T4HA 4CETA 5K4HA 2W83A 4YCMA 3TZQA 5IW8A 3RBAA 6GPBA 2OBNA 1PR6A 3N3AC 2F43A 4R98A 4WINA 1F2DA 1HLDA 3EWSA 3ORYA 3L8MA 4OHZA 3PXEA 4OL9A 5A5FA 5B3LA 5JZVA 1JNYA 3ICEA 5CA0F 1ADCA 1ORWA 4KQ1A 5TGZA 3B51X 3GIWA 4MULA 1HORA 1IL0A 421PA 3OY2A 4I4IA 2JL1A 3PR3A 2EQBA 2V3WA 1R5JA 3LO5A 1NJ1A 1YU6A 1E2HA 4DQDA 2AUTA 2YV4A 2WUVA 1D2GA 4WCVA 4IGEA 1XDGA 1ODLA 3FWPA 1S0UA 1Z6ZA 3I92A 4LE1A 3LRXA 4WADA 4A2WA 1QE5A 3PHIA 4KKVA 4G1UC 4DDVA 2DTEA 3BK7A 4O02B 3TSAA 4ALIA 4HF7A 4BJ6A 3EXFB 3DUWA 3ZE0B 4G37A 5IH3A 4N5HX 1UC9A 3KEMA 1XD9A 1GPBA 1QQTA 3M70A 2QX9A 4FDLA 3BXEA 3GG2A 3L7DA 2LDXA 3DONA 1CR1A 2FR8A 3M34A 1G20B 1VL1A 4R8RA 1EWQA 1MO5A 1NLUA 2XLBA 1Z83A 2QL9A 4I36A 2XF8A 5CA1B 4YP6A 4HP8A 2NO0A 2ZSFA 3BULA 4EI7A 2YJGA 3B1KA 3O4RA 1CUHA 4GMFA 3I72A 2IPAB 4NBLA 5F64A 2ZT7A 5HUQA 1S4QA 2XOKD 3S1SA 2HSWA 3FYHA 3INYA 2ZYWX 4MQ5A 4BEJA 4GLFA 1F06A 3ZUGA 3I5UA 1YB1A 3VI4B 2ZAGA 3OO1A 1OZ0A 3R3SA 4Y6PA 4F9EA 5E6RB 4PSCA 3UTCA 1Q50A 2CXSA 3F5QA 2HAEA 4J4HA 4IWXA 2A5LA 1M5TA 3WC4A 1QK4A 4DOMA 2L69A 1KMIY 3I58A 4BUJA 2ZT5A 3HLKA 2D74A 3N8DA 4PPGA 1A7KA 3BAZA 3FF1A 4XJTA 3FWHA 5IJ0B 1XMIA 2NTEA 3E9MA 4DE5A 4DQVA 5LOVB 1I6WA 4Q66C 1M2OA 2CK3D 3JWHA 4MTCA 2O8VA 3RYFA 1BKSB 2C7VA 4J91A 1FJGB 5I48A 4H7DA 4I3FA 5EEHA 2QVCA 2BHSA 3FLAA 4BEBA 1C81A 3U44B 3RRNA 3SX0A 2J3KA 3DWIA 3KYCB 2HBZA 2C4KA 3QXJA 5LIPA 2UUPA 3FVRA 1YVDA 2PHZA 3A32A 2BFBB 2RB4A 3UMBA 3B3QA 1UXIA 4LGYA 3S29A 4L3WA 5JQGA 2J48A 4LY0A 1XLTA 4O6VA 3S2SA 4DSZA 1HTBA 1WXXA 2QTWB 3FOAA 5EGSA 4EY5A 5HWSA 1RLUA 3DMHA 3OOEA 5J5VA 2WAOA 3G7SA 4A3SA 1SIWA 2DAPA 3N8IA 3PD7A 3V00A 4AUKA 3PNBA 3CB4A 1GG9A 1J9GA 2ZJ1A 3GUCA 2JLUA 2ABWA 4IIYA 4TL7A 1GGEA 4DANA 1IUOA 1K5DA 1B3RA 5E1OA 5NLLA 1A2OA 1E64A 3WV4A 5F1KA 2ZYDA 2J30A 2FF7A 4ZEVA 4NYIQ 1MAVA 1VKOA 1R8YA 1TJYA 2D62A 4HFRA 2VHJA 5AO9A 3HA2A 4BZXA 2DT5A 1A4XA 1UBEA 2DH5A 2V0CA 1T4DA 3AEUA 3LHDA 1R0SA 3LBYA 3QVGA 5IC5A 1H4VB 3ZLBA 4KMSA 1PI3A 1G19A 2IYVA 1RR6A 2QK4A 4NMHA 4G5GA 4GYYA 4ASUD 4QASA 2ZIWB 2R25B 5F4BA 4V3CA 1E1YA 2OGUA 3DF7A 2J6BA 4LWPA 4WMLA 3RK1A 2CV2A 3AGQA 2BE7A 2HHJA 3RSLA 2GN2A 1IM5A 1M8FA 1EINA 1Z4OA 4N3BA 5ITWA 2REQA 1R5NA 4HWOA 4XGIA 5GJVC 2XUJA 1TTTA 1T8SA 2BHTA 3OT1B 5KZMB 5H59A 3CNNA 1MVLA 4FYVA 1P3DA 4BU1A 3KZKA 5A9RA 2AOUB 1G42A 2LCIA 2XD9A 2PG3A 3UWKA 2C5GA 5JADA 1D4OA 3EGIA 5C4MA 3LA8A 4IW3B 3QVVA 1BCSA 2J7KA 1QV6A 3E53A 4GXRA 2ICAA 1QG2A 1T8UA 1Z0KA 3VTZA 4P0PB 4BNZA 3G6WA 2FQXA 4K3VA 1AV7A 3BS4A 3AOEC 4RTSA 4DCVA 2IU0A 2FG5A 4RC9A 3DCYA 5KHOC 2CCKA 3F67A 2QQ0A 4YQFA 2AXNA 1JJ7A 3ETNA 1NBMA 3L7NA 2FWMX 2VLBA 4ZVOA 5T41A 1ZH6A 4MPJA 2GD0A 4DA9A 3SSAA 5I4CA 4KK4A 3PUJA 3AF1A 4DFDA 1U6IA 3QE4A 3W7VA 4RMIA 2DHEA 5FBWB 1H2BA 2VH2A 3UJPA 4DPLA 3KWFA 2QZJA 4D92A 2OHHA 1Q0HA 4OQDA 1JAYA 4N0EA 3PWTA 2AV6A 3TL2A 4F3KA 1HYHA 1XRSB 4YX9A 1JTVA 4Y2VA 3VMFA 2GPYA 2YXPX 4AO7A 3R8XA 4WPGA 1MRNA 5F7JA 1ZA1A 1X39A 1JMKC 3AR8A 3OZEA 4W9NA 1OXKB 2QTFA 4G89A 5H02A 1N6IA 3EQ7A 5DO9A 3TCXB 4OOFA 1KHHA 2YS6A 5IUJC 1FS5A 2JJYA 3DE5X 4PAGA 3VC2A 2RGDA 2XA1A 1NVDA 1T3LA 3D6VA 2WFAA 4RKWA 4EF4A 3KVVA 4U5QA 5D87A 1I3CA 4Z2AA 2QAGA 5KNBA 2HRZA 1A9OA 1AK2A 1GKYA 2GXSA 2WSSD 2XVAA 4QATA 3VR2A 4PANA 3WMFA 3BEDA 4CUZA 3DZBA 3RUAA 2GWHA 3IKMB 2NG1A 4G8JA 2D7DA 1LA2A 2H4WA 5FPTA 5BORA 1SUDA 4A27A 3AETB 1E58A 3H9QA 2XI4A 4ZOLF 2LDBA 1E79D 2EZUA 2Q5JA 2LZ0A 4YRKA 1T9GR 1KR2A 2ADMA 1X38A 2GMWA 8LDHA 3AL0C 1W8IA 3MJ4A 1DXQA 4XA8A 4AS2A 4PNZA 4TTSA 1Q57A 1B93A 1YVRA 5EIWA 2YWCA 1W88A 3GLUA 4G25A 1SQ5A 3V2IA 2Q4DA 3KC2A 3QJYA 3UJBA 4BVJA 1VPVA 4C9BA 1OBOA 1F8GA 1KYYA 3CZAA 4V1CA 3JD1A 4C7VA 2P65A 4ZEWA 3IVAA 1E1RA 1NULA 5JFGA 1UM9A 3KJQA 4KGVA 3CUSA 4MI6A 2HA2A 4Q7LA 2NPOA 4P5EA 1MW8X 4C3OB 1F2TB 5ALMA 3JQDA 4CM4A 4XASA 1USIA 4R5MA 1M2NA 2IHTA 5EPEA 4ARZA 2XCSB 3PEVA 4S3MA 2I6GA 4YLYA 1QAOA 1TUEA 4BO5A 3VUFA 3KZNA 4A2PA 1QRDA 2OBMA 4WKNA 4EW2A 3L8GA 5IVDA 5K6AC 2PZFA 4B40A 2O1EA 3JQAD 4IIBA 1JALA 1KDRA 1Q1EA 3IIJA 3DE1X 3O3OB 5DGDA 3UW3A 4F21A 3KSAC 2FX2A 4KI0A 2D3TA 2A92A 3WLFA 2FRXA 5AKEA 3UAZA 1UH5A 3IJPA 4DNQA 5IJWA 2QAIA 4PG4A 3F6RA 5LCXA 4LSWA 5AQEA 1T0UA 2JFZA 3K0EA 4ZVUA 3W06A 1PJRA 4RVNA 4C5AA 1PT9A 2VJNA 3IA7A 3GBVA 3OCJA 4LGVA 4AMUA 3AW8A 2WF9A 4JU8A 4MYHA 2IS1A 1Y1TA 3MMSA 4NFHA 4GNKA 4G0YA 2Z98A 4V0MA 3KE9A 4FFNA 1X1QA 2BMVA 4H7IA 4M46A 1GR1A 4E1VA 2XYPA 1O6BA 3FTQA 3NTRA 4E13A 1NDHA 3NEPX 2A9PA 3J7TA 4PLWA 5DT9A 1SVMA 3PQ4A 3LGXA 1A9QA 3V2GA 3WIOA 1DV2A 1K7XB 2OG2A 3VV3A 3EJWA 1AF7A 1RJDA 2BMJA 1I14A 2WAXA 3R8CA 2FPRA 1ZK1A 2XTAA 3SHQA 2UYCA 1WHSB 3L77A 4WQMA 3ZCSA 4DCOA 1GTZA 4HSGA 4PN7A 4L9SA 4C3VA 1CJUC 4U2DA 4EAQA 5K05A 2ZIXB 2XB2A 4UJ5A 2QVGA 4GX2A 4PVDA 3T4PA 4RTKA 1JNXX 5LZ2A 1NJSA 3IAEA 1TUIA 1YKGA 2XMCA 3EIXA 2P0EA 1J06A 3IAUA 3W9SA 4G0NA 1RPJA 2HMUA 4D43A 3M4XA 2Y1XA 1WSWA 4BV8A 4EY8A 1YACA 1DKPA 4IEIA 3IILA 3V32A 4EG5A 4CF5A 1W46A 1CY0A 3H0KA 4R7TA 1EBUA 1FOEB 1AUXA 4HQLA 1TKAA 2YHAA 5E2IA 3IBFA 3OKAA 2FKNA 5EHZA 1UPTA 2R6R1 3D54D 1HA3A 3RI3A 3ZU5A 3GX1A 4D3SA 4RX1A 1N4AA 2I2XB 5FEMA 2AB0A 2Q3LA 1CZOA 1KMHA 4F2PA 4DR6B 4YRNA 4JU9A 5FI1B 4KPYA 4HNAB 4NNOA 3EA4A 2HRDA 2A0FA 2H4ZA 2GKSA 1C7RA 4FK8A 4KQFA 1ZVKA 4M8NE 4AKEA 5JXJA 1D2RA 1E9AA 1P33A 2P4EA 4IAOA 2QUAA 4LKRA 1XAIA 2PIDA 1NXQA 1JIIA 4W9MC 3GFQA 3V7WA 4ER0A 2PAFA 2X0RA 4N01A 1IHYA 3C6KA 1XPUA 1E1MA 2C2KA 3FW1A 4JQOA 2W2LD 1AIPA 3NTOA 4OGWA 1DADA 2DP4E 2R86A 3FPCA 3KU4A 5D2CA 3C3EA 4BLSA 1FP6A 5K99A 3CYFA 1XKXA 3T1HB 2CYAA 3PC6A 3SLGA 2V6GA 4M7WA 3TTWA 2HF8A 2JLZA 4IOMA 3ZE1B 5L7TA 2ZYUX 2C20A 3I04M 5E1MA 2G4CA 2OBLA 3ECCA 1QYIA 2JKZA 4FFMA 4MV0A 4D9NA 2X1MA 3MEQA 5JNVA 3UY4A 1BHO1 3E35A 4ZK2A 4YJGA 1GNLA 1Q5PA 1OWLA 2XEXA 2X4LA 2XGMA 3DUFB 5GM2A 1WKVA 2BEJA 4X90A 4QJ3A 2ENUA 5JMOA 1OI4A 4LXGA 4REMA 4X7PA 1ZJ5A 3UMVA 4LJ5A 1BFKA 2A6PA 4JL6A 3UT0A 3CY6A 1SEPA 4QD3A 4P4SA 4XGNA 5CH8A 3ZOKA 2XXBA 4TQUS 1V11A 4TV9B 3OFND 2G67A 1WVGA 4OHXA 4JB8A 2J46A 3S44A 4E31A 5BMOA 2VQEB 2BJVA 1GLGA 1DAGA 3NCTA 1RHUA 4L8GA 3G89A 2CHQA 1S2MA 2HCJB 1QIIA 4MI1A 2BSQA 3P26A 3FYCA 4LBWA 3W5AA 3BZBA 3LXXA 2I7XA 2O8BA 1KNQA 1Q19A 3WGQA 4IXMA 3LQRA 1DAHA 4YI5A 1T0JB 5AKLA 1LB1B 3FDZA 2YRXA 4GOLD 4FM9A 3QSYA 3PQ6A 4PQGA 4GLJA 4OQNA 4U7TB 5F2EA 4N0DA 2VK2A 1ONNA 4MS3A 2CXUA 2VP9A 1A04A 4YRSA 3DQQA 4DIUA 1T26A 2PS1A 3PZRA 1GUZA 2FLKA 4TSFD 2NAFA 5KINB 3GA0A 3KKNA 1DCKA 5C8VA 2JLYA 1E59A 4BU0A 1PJZA 3Q4GA 1Q91A 2A5FA 2OM2A 4LHSA 3GZTB 2H51A 4Q9DA 2QTVB 5FUBA 3SXPA 4F2WA 1VRVA 1IHUA 4XSVA 3UKDA 5BQ3A 1JIXA 2VK8A 4MLDA 4NZOA 1FVOA 1EEHA 5ALVA 1U31A 1OH7A 3GMDA 3H4VA 2R1ZA 2ZEJA 3W3ZB 4JQSA 5AJVB 1UWVA 2X4DA 2D2EA 3AFOA 3VU9B 5HRUA 3OSZA 5F4ZA 2H16A 4J07A 4TXLA 4RD3A 2P35A 3MXOA 3T5GA 4MJLA 3KFVA 3VV2A 2J67A 4OUDA 1RQGA 4BO4A 3I23A 5IT9A 4ZYYA 5EYPA 3ADBA 1NASA 2B98A 3LGSA 3S2YA 1Z6YA 3WLAA 2QPTA 3A10A 3G3EA 3A9WA 1DLJA 2GPAA 5LYYA 1V8FA 4CR7A 1IXYA 1SUBA 2LNDA 4FZ5A 4M88A 1KK3A 1PYGA 2ONKA 2ADOA 3QLUC 4UHCA 2GPNA 1GTL1 2WHPB 3CONA 3KB8A 4ZO9A 4C6SA 1HDZA 1EB8A 1U1GA 5DK6A 3WGIA 3DVRX 1HYBA 1FDOA 1AKYA 4C0XA 4C1BA 4KWTA 4UHHA 3R3VA 1S3FA 3ZNOA 2A1TR 1EJ2A 1C9KA 4JB2A 2OA0A 1BJTA 3W6UA 5A4JA 1KEZA 2QUKA 4NZPA 5GWXA 2V1XA 1KFEB 3FCSB 4MH0R 3ZHUA 4LSZA 1T34A 2VYVA 3THYA 3RVKA 4TMKA 3WLEA 2EFEB 4EATA 5C53B 1N3IA 4TUYA 5EIBD 1Y37A 4CQLB 5E3HA 2DQKA 3K09C 4X95A 3VYRB 4E5NA 1MO4A 5C1OA 1PL7A 1FX1A 1S7GA 3R24A 2GCOB 4S1NA 1KOFA 3LCMA 2CE7A 3SQMA 1WU8A 1M6HA 1L5VA 4LC0A 2IWRA 1N75A 4NDAA 4IKPA 2P6OA 5JY1A 4ID3A 1P4SA 2XT0A 2CSXA 2Z4TA 1G9XA 1TVKB 2FR1A 1AQYA 2J3IA 3Q9NA 1OC2A 4ZANA 3L0BA 3A04A 3CUEF 4FJ0A 4RFSB 3I01A 4RVOA 1H4SA 1M1UA 1TQ4A 3M6AA 2DHCA 3NPAA 3T35A 3YASA 3U6KA 4IV5A 4HAZA 1VGVA 3PUYA 2YN0A 2YIVX 1NF2A 1YQUA 1ZXBA 3JATB 1JI0A 1H0RA 3ANMA 3O8OA 4FFOA 1ZGGA 3CLTC 3HY6A 4HPWA 1M6WA 4KXQA 1PQUA 2WIAA 1XE3A 4EYSA 5FBVB 4IJ5A 2QN1A 1RFGE 3JTMA 4J90A 1VYVA 3ZU3A 4O4HB 5LA6A 4JYMA 4PN3A 1QGDA 2Z57A 4URYR 3GYGA 3KD2A 1Z0UA 4POAA 2BFMA 4XIJA 3B7WA 1OFTA 4X1IA 2GLTA 4GH5A 4CIXA 2VWQA 3UCFA 4OA5A 5HK8A 2CZQA 1G5RA 3JQGB 1U8TA 3P0JA 3EZYA 3DZGA 4XQEA 4BP1A 3FG9A 1HYGA 2ZUCA 3QY9A 5EKSA 4EPYA 3IAM6 3MHPA 1KH3A 2B8EA 2ZW9A 3PFHA 2XJ4A 2FUG6 3HU2A 3ZZMA 3PS9A 1N5KA 3TRKA 4YMVA 1QO7A 4KQKA 1YDFA 2RGCA 3B82A 4O59O 2YZ2A 4I4TF 3OE5A 2YJ6A 1TK9A 3QVWA 4FR5A 4C22A 4DM7A 2YR0A 5A7FA 4B71A 4BMZA 1PK7A 2DQZA 4NCKA 2AC4A 1UBFA 2B1QA 3ZCTA 3Q3JB 4PPYA 2V7BA 3A3YA 3DBRA 5I3CA 2NPFA 1TYAE 4WUVA 5C8YB 1IJBA 1IK6A 4DA7A 1BO6A 3U3RA 4YP0A 2HDNB 5BSHA 2OORC 4JDPA 2FZLA 3DE4X 3QWIA 5E8JA 1ONSA 4C0JA 1E6MA 2E85A 1T2CA 4FFWA 5LQUA 2GVDC 1OX5A 4YNBA 2LTAA 4QYSA 5TT1A 5E7IA 4QXQA 4K86A 3IFSA 2D00A 1XHFA 2P9JA 1OBFO 2H52A 1OHHD 3EDYA 3OA2A 5ALDA 2B0CA 3WADA 5BN4A 5L4LA 1QTIA 3KQKA 1M73E 1A76A 1KR5A 4JKOA 4BNUA 2J32A 4RTJA 5G02A 3F6CA 4IIEA 3KKPA 3MJRA 2WT4A 3MWLA 4WKGA 2JBAA 4K9MA 4RCZA 4MYTA 5KYGA 2CV1A 3R3WA 1WQ3A 1R9JA 2BYTA 4Q4LA 4LDNA 1K75A 2UVPA 2PBRA 4PAMA 2J5KA 3QXGA 2O8FA 5KSZA 4HUQA 2HA3A 1F4LA 3EF0A 3NYIA 2EAUA 2DHQA 3CH4B 2Z95A 4WFJA 4BNLA 1UFVA 2HDWA 2MT9A 1FNBA 1ODCA 2GHIA 4XRGA 3PGA1 1JDPA 1M2EA 4F9FA 1Q15A 5ADUS 4WA8A 5IWAB 3D5TA 3WK9A 3U62A 5JVDF 4LHWA 1SQFA 4BWGA 5GIPE 4QG7A 4FJ1A 1SUFA 1YQEA 2RGEA 3UKOA 1CZUA 3QJGA 3UAOA 2WICA 1L4EA 1QH0A 5H3HA 1XV5A 2WBLC 1JGTA 1EP1B 2QRVB 3IV9A 1GDHA 2FH5B 1J6UA 1I2DA 3UJCA 4EECA 3B53X 4G1BA 5TJHA 4BLVA 1ZSNA 1ZUNB 2YKGA 2QV0A 5SYNA 1FEZA 1A4UA 1B15A 4X6XA 4V2UA 4DV1B 5KQGA 5L3VA 2OKGA 5F73A 2F1OA 3GCGA 2F8SA 1BEZA 1ABFA 3R7AA 3DMGA 3V2UA 4LXIA 5DHRA 4B9AA 4UUMA 4ENRA 5A4DA 1RPZA 1FLDA 2EATA 2ZDGA 2EDCA 1XHEA 4N76A 2WWXA 2QNIA 1KZYC 2Q99A 3JQRA 3WE7A 4CCYA 5IVHA 2JC3A 1EESA 2Y1DA 2Y4NA 1E96A 1BXRB 3G9QA 1J24A 2FMTA 3WGUA 2ISSD 2YL2A 2ZI9A 1ZM7A 3CWZA 3EUEA 4M60A 3F5FA 4I55B 4GXQA 3RQIA 1RKXA 2R7NA 4JUFA 4Y2TA 1HQCA 4N8EA 5EIFA 3TTTA 5ECDA 2GOYA 2WJ3A 1TZBA 3ILHA 3SEAA 4KWIA 3W1EA 3TLGA 5CB0A 1E66A 6ADHA 1GV0A 5AK3A 3CUKA 1Z2NX 2F3RA 3GRFA 5AKYA 1DG1G 1LVGA 4OP3A 5FWYA 5GP1A 5DISB 4C21A 1VLHA 1O2DA 4V2IA 4JYBA 3ZZTA 2CUKA 1B41A 2H7XA 2DZDA 2AW5A 4JOQA 1NOKA 4WLFA 1KH2A 4Y7CA 1H2FA 2JPDA 1DQSA 4IDEA 1J7JA 5EMLA 4XUEA 5KNDD 3OOSA 3QUCA 3PVZA 1OSNA 3GFGA 3O2NA 4HOYA 4MGHA 4WZAB 2H31A 1V3QE 2Z5VA 4PGMA 2BHRA 2NV6A 2AZXA 4K9DA 5LP6C 4WACA 4KVGA 3WGTA 1I13A 2R8XA 3X1JA 1YZGA 4DC9A 3V1UA 2P9HA 1NW8A 2JGRA 2VJAA 1NXPA 2XWPA 1P81A 3GIDA 3JWGA 5ICGA 3KQNA 1NYRA 1XJWA 3I61A 4KFRA 2CFSA 1CR4A 1XZHA 1PW5A 1SU6A 1N2CA 4FE3A 4CI9A 2PUGA 3FMFA 3R3XA 4OM8A 5EJ4A 3KHTA 1ZD5A 1ZVMA 3RFCA 3DPSA 4NFSA 4QFBA 1P73A 3ACCA 4UEQA 3BZWA 4KACA 1N2EA 4QPDA 5CLQA 3COSA 2IZ5A 4G2NA 3OJWA 4MVJH 3SHWA 4Q16A 3H3FA 4BFWA 1PAUA 1T4CB 2H1WA 3HFRA 2AS0A 2I76A 4YGXB 5D5HA 3ZBPA 1WL8A 3F4KA 3EXHA 5EERA 1KSGA 4KG7A 5IDXA 4UREA 3FVWA 3NBUA 2X1LA 4IHJF 1G64A 2Q0QA 1LSOA 4WESA 1M5UA 3UHFA 4PQRA 1NONA 1M33A 2GD1O 3CS3A 4LVNA 4ZTUB 1SURA 3E84A 4CIWA 1J2YA 3U9TA 1R4NB 1H85A 2AL7A 4XM2A 3TN7A 3R74A 4WFKA 2VEOA 3NHLA 4Q1AA 3RANA 3VISA 3T94A 3DZFA 5FHQA 2Y92A 1ILEA 4TYMA 4PSVA 4OGFA 4DCMA 4EX6A 4V0QA 1IZZA 1NU6A 1UOOA 2IXFA 3LU1A 3NEAA 4RL6A 1DNPA 3CO0S 2CJFA 1JE1A 4WJKB 3RRFA 3W4IA 4B79A 1SOVA 1T5SA 2G9VA 3O26A 3TPFA 3HO1A 3PF9A 1MGOA 3HKDA 2BFDB 3FMIA 2JFHA 4XDGA 4Q3BA 2YUIA 3TUJC 1DJLA 2EWVA 2GPWA 4DC1A 1F0KA 2G8NA 4WLNA 2EX0A 3V8EA 4YRIA 3I9LA 2O3SA 4KYVA 1V1JA 1ZW6A 4X8HA 1KEWA 3U7EB 1N6KA 4A23A 4WVFA 3U4AA 3BXZA 5FBQB 4EWLA 4F71A 4KRXA 1OQAA 1ZUD1 3GNQA 2WVGA 2YMLA 3BMNB 4A6XA 1POXA 2EHJA 4NS4A 1OLOA 5IJAA 2RGNC 2BFFA 4H18A 3A1TA 5I7HA 3QSGA 1CKEA 4HAIA 1UWLA 1QVRA 1LGYA 2V8OA 3F9RA 5BOSB 9GPBA 3RYCB 1I1HA 1AQJA 2D2XA 3HYLA 1G7RA 1I10A 1V39A 4L8WB 3LIIA 3F6YA 2Q5OA 4A1OA 4O2BF 4TYNA 1YE5A 2WFLB 1B1CA 3THWA 4HZUB 3J81k 1C8BA 3CZ5A 4O1MA 2Z8YM 5BR1A 5KYYA 5KKNB 4JP3A 3PL1A 3U4IA 1NI3A 4ZT3A 1QTRA 1BMFA 1OBVA 3VPSA 1IQRA 4N65A 3UMGA 2AVNA 4C4RA 2HGSA 2IVZA 4IOLA 4Y2SA 2VPPA 5IJXA 1PVOA 5EZYA 2QTBA 4GU5A 2FCRA 3ESRA 1N1GA 2AK3A 3EIFA 3GLHA 5JS8A 1DCFA 2P30A 3O8QB 1Q77A 1YA4A 3AJDA 1QIGA 2HSDA 1N2GA 2HYDA 1NM5C 1T0BA 4MRRA 1HE3A 1OA0A 4ODIA 4PM4A 4CMHA 4DG9A 4F46A 1V2HE 4HLQB 3OQOA 2IH5A 1YJCA 1CY4A 3DOIA 3H8JA 3CCFA 3MYYA 3M6WA 1QIKA 4BGIA 3PD0A 4CR8A 2HT1A 1XIVA 4G5OA 3L4KA 1JU3A 3H18A 4JEUA 3U3OA 1TT5B 4YXFA 4JI2B 4MVJF 4X60A 3HB0A 1SC3A 1IBSA 2ON6A 4JDUA 1SVKA 3E2IA 5K6TA 3DEIA 2HEIA 1ODTC 3L07A 3ROTA 4K0RA 4KXUA 4KPEC 2ZI7A 2WK1A 2JDIA 4UPVA 3P1JA 3DAOA 1G5HA 2NVBA 4HGRA 2GZ1A 1XMVA 2IHUA 1CRZA 3CVXA 5FA5A 3KB2A 1KQ3A 3L1VA 2YNMA 4F84A 1IN4A 1RWOA 1T9CA 4MUGA 5EZSA 4NBNA 1A27A 1HDOA 3HHPA 1CFZA 1EK2A 1YDEA 4X6YA 121PA 2WF5A 4RD4A 2O8CB 1U5BB 2FJUA 4D81A 3A3PA 5FPKA 2QE7D 3CV3A 2V97A 5A3QA 4N9WA 1QP0A 1JZTA 2GZSA 1XN4A 2HHCA 1XN1A 3PL5A 2WKWA 4YFVA 2Y1CA 1EVEA 1XQXA 3VO8A 2V7UA 5CK5A 2IA5A 3P9QA 2GJ8A 1GGFA 4YWHA 3RS5A 5CH5A 4ZZIA 4EP1A 4H9GA 2QZSA 1H2ZA 1NWCA 4R8LA 5JLAA 3WLRA 1YKSA 2ATEA 1KO4A 3QUQA 2E5LB 4Z86A 2X15A 2WSYB 1TW3A 2VKTA 1BIFA 2MYTA 2WIFA 2XYRA 2JJMA 1JN0A 1TNDA 3GZJA 3B48A 2DFLA 2UVQA 4Y0VA 4DB4A 1U7XA 1XCGB 3KT0A 2W2QA 4MRVA 2REOA 2C7RA 4WASA 1F20A 1NBHA 2FWBA 1GPAA 3BXFA 4UNNA 3TTSA 3MUNA 4RHCA 3W5BA 3DMDA 3WZ2A 4O4IF 5M29A 2B5VA 1ESMA 2QP3A 2ZJYA 3BWXA 3CVOA 5EFZA 3IMGA 5LQNA 3MK31 5I7WA 1TJ4A 2H2HA 3QEMA 1GZ3A 4H7HA 4PW0A 3V8RA 2I4IA 3OM8A 4ZOBA 1F14A 1IY0A 1IYZA 1ZJJA 3DW1X 3OZFA 4K1LA 4N3CA 4JI3B 3TW4A 1CR2A 2Q1UA 2IEGA 1AKQA 3QVXA 1UK8A 4ZAWA 4PG5A 2Z08A 1M72A 2WWGA 1YL5A 1DBRA 3C8UA 5EJ8A 1FRZA 2WPDA 3G2LA 1G16A 3T0FA 4FR0A 4NDZA 3ZDRA 2AOWA 4G0ZA 3DKIA 2ZAMA 5HIIA 1HLGA 1EAMA 1ICIA 3REQA 3M81A 4JYCA 5EMJA 4ADSG 1XQ1A 2B7LA 2OK8A 2ATCA 3NKLA 1RM3A 4HGQA 1NN1A 4TZTA 2ODBA 4CKXA 2J9RA 1FTNA 1Z18A 3BREA 4MCIA 3P20A 3TJRA 1Q17A 4O8CA 4A9AA 1NQTA 3GDOA 4JBLA 4NIMA 4GVLA 1JEEA 1UDCA 1UP7A 4Q1EA 3SJCA 1NV8A 4B3GA 1N6OA 4LTMA 4Z99A 3BRCA 2ZSKA 3CG0A 4OIFA 3HFSA 5A5GA 4LQ4A 2EWMA 3FOFC 1K63A 1YK1A 4MO2A 4NCJA 1PUJA 5JEDA 1INLA 1OTXA 1QHSA 3AHEA 2PVPA 3G2JA 2IXTA 3FGZA 3PHHA 1NW5A 1A9XA 3U3ZA 3FH0A 4M87A 4YLEA 1SG6A 3HN2A 4BLTA 5AKKA 5LZ4A 3MA0A 1M0SA 1Q12A 4IIXA 3EUAA 1ZGAA 5EEGA 4JCCA 5C3MA 3QKTA 3W9UA 3H2SA 4MW0A 3S1LA 1GUYA 3RF7A 3FN4A 5TGDA 4EO4A 1ONOA 4FYMA 3DAHA 4OIMA 1QC5B 3RSQA 3O9ZA 4QREA 1UM8A 3BRQA 3NYRA 4RCYA 3GLFB 3MC1A 1J0BA 4FSDA 1TC2A 4QDOA 1ZD1A 1XRRA 4Z6KA 1E9VA 1WUIS 8GPBA 3C97A 3P0IA 4G5RA 1X7HA 3VPHA 2W6IA 4U1RA 2DFVA 4Y2QA 3T7CA 5KQMA 2VZ9A 4FBLA 4JMLA 1CU1A 5I9NA 2SCUA 3OWXA 1YO6A 1XKLA 1Z28A 2AYXA 2HU5A 3NOXA 4M2LA 5KDLA 3DMTC 2FEAA 2FGJA 3H2JA 4CKZA 3R0QA 1HNZB 2KWIA 3HI6A 4WKCA 2E6UX 2QROA 4OB6A 3DT8A 3FHJA 1ADBA 2QX6A 2DERA 4J0KA 1EEXB 1IJFA 3PQ3A 1OC4A 5DK4A 1FQWA 2OHIA 4DRXB 2Y77A 4Y0AA 1NLMA 3PFIA 2Y1WA 4HDSB 3ZE6A 4CN8A 1E1CB 4UUAA 5HVNA 5I9IA 1E1KA 3G2HA 1SC1A 2WYHA 1U2DA 3DXXA 4KXMA 3SJZA 3NO4A 2J0SA 3P4XA 2PJDA 2OCYC 4RA6B 4I1IA 1ISRA 4XVRA 1U3FA 4J3NA 3IOEA 1AD2A 3T7IA 4DAOA 2QM0A 1J8DA 3UT5A 3UFBA 5A7HA 1U9YA 4EBFA 1JG4A 4C5BA 3C4QA 2PPVA 2ZWVA 3KVYA 2E2WA 2P2SA 2NP7A 2GKGA 4U2KA 5ARBA 1RQ7A 4N4AA 3VNQA 1YI8A 4EI2A 2NU9A 3CT6A 1C9DB 2DECA 4MW1A 3V8PA 4B6RA 4H7KA 3RHTA 3ABZA 1IQ0A 2C2YA 1D2CA 4GOJA 3KDSE 4KV9A 4Z4GA 1CRQA 1Y80A 3EFHA 3K0HA 2LBPA 2R62A 3IYLW 1KPIA 4D4GA 1V9SA 1RYDA 4FI3C 1YC5A 1FLNA 5CIQA 4JI4B 2F43B 3AB7A 4QSMA 3U7JA 3ZEAA 1P5JA 2PA3A 1CW2B 3FWZA 5FIUA 2C7OA 1A1SA 3CX6A 4X8LA 3ZU4A 3GPCA 3B78A 5DMHA 2Q4OA 2WHEA 4RIHA 1BHSA 3IVGA 3T3PB 3PNYA 5KWIA 2RGGA 4MVWA 3PXGA 1V7PC 2Z4RA 3C6XA 4J0QA 1E1DA 4CU2A 3T1YB 1KC3A 5LVAA 1JMYA 1D0VA 1O5IA 3AIMA 3UUEA 4KP7A 3OQ6A 4GI3A 4U02A 5FCDA 2I78A 3TNLA 1Q7EA 3RTDA 3NIDB 1CHDA 2Z9CA 2HCFA 3O90A <