2QXTA

Crystal structure analysis of the bacillus subtilis lipase crystallized at ph 4.5
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
179
structure length
179
Chain Sequence
b'HNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSADMIVMNYLSRLDGARNVQIHGVGHIGLLYSSQVNSLIKEGLNGGGQNTN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipase
molecule tags Hydrolase
source organism Bacillus subtilis
publication title Structural basis for the remarkable stability of Bacillus subtilis lipase (Lip A) at low pH
pubmed doi rcsb
total genus 66
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2007-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qxtA00
4B82A 1TCAA 3F67A 3PF9A 2JGIA 1CUYA 2RGUA 3MGAA 3Q8WA 1FFBA 2HU5A 1SFRA 1CQWA 1XQVA 3G0BA 4P08A 3E3AA 3FVTA 4TGLA 3ESAA 1JU4A 2XQKA 5AKLA 1W52X 2XDWA 1QO7A 4BCDA 4WFJA 4XIIA 3ICWA 4QA9A 4ARAA 2Z3ZA 1XRRA 3A6ZA 2JGFA 3R40A 1R88A 4QDTA 3C43A 5KBYA 4UPDA 2XUOA 3BJMA 4ROTA 3HEAA 5K3AA 3FYUC 4P93A 1MTZA 1MAHA 2XMGA 2I3ZA 5K3DA 4GDMA 1JI3A 1QIFA 2WIKA 2C5GA 4CIBA 4EY4A 3MUNA 1LPNA 4HZGA 4OSEA 4Y2UA 4C4XA 3PF8A 5JAHA 1RYYA 3ESCA 4UFPA 5KWJA 2HU7A 1T2NA 2GYWA 2BFNA 4C4YA 4OD0A 2HU8A 4C01A 4CFSA 1EDEA 1H2XA 4G1FA 3GUUA 4X3CA 1ZD4A 1QIJA 3HC7A 4Q82A 4C4ZA 1XRNA 4NMWA 1XQXA 1BEEA 1CUVA 2IITA 1TCBA 2WHPB 2GZSA 2XB6A 4HXEB 1TQHA 5AKGA 4GLBA 1XRPA 5LZ8A 3WA6A 4QDXA 2YXPX 2C5FA 5AKKA 1JMKC 3DKRA 4UBIA 5KWIA 1E8MA 3L1JA 3W05A 1GZ7A 3I2JA 2XUGA 4QDOA 3G9XA 2WIDA 2ZYIA 1ZIYA 2BUCA 1QIHA 1ZI9A 5CMLA 3F96A 2G5PA 2B20A 2RAUA 4FTWA 2C58A 2X8BA 1Y37A 3DYIA 3WQHA 4PW0A 2C7BA 4AO8A 2UZ0A 4G5XA 1UKBA 4BATA 3CXUA 4PSDA 2QZPA 3P2MA 1QFSA 2PVSA 2VT7A 4G9GA 1HPLA 5T4FA 5AM0A 2G5TA 4QLOA 2PBLA 4AN0A 3R3UA 3BIWA 1G5FA 1LZKA 3D2AA 4GECA 1QO9A 5ALJA 1TKRA 5AM1A 4G4GA 3WKEA 4D9JA 2ACKA 4GI1A 2YYSA 2WFMA 4J0CA 4UBJA 2ZSHA 1XZBA 5JARA 3R3XA 4J7AA 2WFLB 1BCRA 3QH4A 5F4ZA 5CT9A 4L72A 4ZGBA 3BIXA 1CUZA 1QTIA 2OG1A 4H7IA 4TVKA 5AH0A 3JYHA 1GQRA 2HFKA 3A2LA 3F98A 1WM1A 1XZGA 5LZ5A 1BEZA 3FSGA 3S2ZA 2XMQA 2HADA 5LZ2A 1CUGA 1MO2A 5E4YA 2AJDA 2HRRA 4U2GA 4UBOA 5ALEA 3IUJA 5ALUA 3H2HA 1N8SA 1CLEA 5CW2A 5A6VA 1GPNA 1YA8A 3PUIA 2BKLA 2H7XA 1N5RA 3GBSA 5AOCA 1X2EA 1CUWA 5ALFA 1L7RA 2YASA 3F97A 4BTVA 3AINA 2Z5GA 4DGQA 2OLEA 2XUDA 2WQZA 4Q3OA 3D3NA 4OCZA 2RHWA 1YAHA 4KRXA 3H1AA 4Y2SA 1P0QA 2O2HA 4U2CA 3QMMA 3H19A 3FYUA 3R3ZA 3H2KA 1Z68A 4EY5A 5AI5A 2QJWA 4HXFB 4EY7A 3GELA 1U8EA 1EINA 2ZYSA 4BC1A 2JGEA 4OYYA 5A2GA 5DNUA 1XRMA 2O7RA 1W1IA 3G9UA 4UHHA 4B0PA 5D6OA 1CR6A 4RNCA 2J4CA 1R1DA 3G0CA 4B9AA 3IUMA 4YK7A 2QS9A 3L1HA 4EY6A 2OCLA 5DWDA 4C88A 5DYTA 5JZ9A 2BGNA 4W9RA 3FYUB 5DLPA 2AJBA 4AQDA 2QMQA 5ALOA 1SCQA 3H18A 2JBWA 4PV7A 3QVMA 3KDAA 4DNOA 2IIVA 4J0GA 1FFCA 5C8VA 5LIPA 5AP9A 5ALSA 1YASA 3JW8A 4PO3X 1K6EA 3WA7A 4QLAA 5AOBA 5BOVA 5K3BA 3O0DA 3NUZA 4FBMA 5JANA 5HKAA 1WPXA 4FFVA 4WJLA 2PM8A 3PE6A 4N5HX 2XQIA 2Y1KA 2ZYRA 3WKDA 5C7YA 3WK5A 1W6RA 1D07A 1E8DA 4NZZA 3D59A 1ZI6A 3F9CA 1LNSA 5AM4A 2VATA 5FPQA 4QDUA 2FJPA 2Z3WA 3AJAA 2WKWA 4U2EA 2HFJA 1FFEA 5A7HA 4A23A 2DHCA 1CUBA 4OU4A 2DHEA 1F8UA 1QIIA 5CT4A 3I28A 3WWEA 3DL4A 1CUDA 1XLVA 1SC9A 2DCMA 4K6KA 2DFPA 4RPCA 2C4HA 1WB6A 5AKIA 2ORYA 3M3DA 4B0OA 1ZI8A 1LZLA 3PI6A 2GYUA 1VZ3A 4EBBA 2BAGA 5CH5A 3R3YA 3B3QA 5DNWA 1X70A 2FJ0A 2PSFA 2HA3A 4HVTA 3WZLA 1AURA 1A8UA 2J4FA 3W9BA 3DQZA 5BV7A 2P8SA 1SOMA 3DJYA 3AIOA 3SK0A 4HAIA 3L1IA 4FLFA 5EI5A 4OYLA 4BBZA 3WL6A 1WHSA 4X00A 4B80A 3FLEA 5JAUA 3WKBA 1P0IA 1XRQA 3CCBA 4Q34A 5IKXA 3EQ9A 1DINA 5FPPA 3WK4A 2VJAA 4EA6A 5FUMA 4X71A 2QT9A 4JEIA 5ALDA 5JD4A 1TK3A 4XWGA 4AO7A 5HF8A 1CFJA 1ZD3A 4FWBA 3E0XA 4I4CA 3HZOA 3GZJA 3ICVA 5T4HA 1Q0ZA 1ACLA 1TRHA 1THTA 2H7YA 1DQZA 1UFOA 2AXEA 4W1QA 4GBGA 3WZMA 3SWWA 1PJAA 3I1YA 4DMKA 2I3DA 4J0KA 1XROA 5JIBA 1LLFA 3E4DA 2WJ4A 3WKAA 4AZ0A 1AC5A 5CBKA 4Q3LA 1IUNA 1XZLA 2XUIA 4B85A 1U4NA 3C8DA 3FVRA 4MXDA 4FLMA 4EHBA 4BVLA 4H7DA 3HXKA 3SC2A 1VE6A 1H2WA 2QRUA 1CUXA 3I1IA 3QBJA 1YB6A 2OPHA 1L7AA 1BN7A 1C7IA 1T4MA 5LP1A 3O95A 5IVKA 2DR0A 4K2AA 5CXXA 2R8BA 4AMYA 1JJIA 3NOXA 3RARA 1UK9A 2PL5A 3OOSA 3KD2A 3AZPA 4QWMA 4C89A 4F0JA 1QLWA 5CT8A 3IDAA 2QXTA 2WU3A 3ZV7A 1GKLA 4DNQA 1CUJA 5HF6A 4ITVA 2X5XA 1ORVA 3F8SA 4KE7A 2WTMA 3BJRA 4UFNA 1F0NA 3NWOA 4BRZA 2HA7A 3O4HA 3OTQA 5DNVA 1R3DA 1ODCA 5JZSA 5A7FA 1EK2A 1CUCA 2ZYHA 4Z49A 4B84A 5D3ZA 5K3CA 4A5SA 4BDTA 3WL7A 1R4ZA 1CUUA 4HRYA 5HQ3B 1GGVA 1MAAA 4K5QA 1B6GA 4AXBA 5AI0A 4BCBA 3HABA 1VOTA 2VAXA 2XUJA 1NU8A 5T4EA 4WFKA 3ESBA 2H7CA 3IA2A 4Y2XA 1VZ2A 5DYWA 1JFRA 2PPLA 3DOHA 1XZFA 4BAGA 3S8YA 4ZV9A 1IUOA 1EB9A 2R11A 5DTIA 4F21A 3M82A 3MVEA 2XI4A 2V96A 3I6ZA 2H9YA 4EUSA 3GROA 4H7JA 5IVHA 2XQGA 1OILA 3DEAA 4HXGA 1H22A 3I2GA 4J0HA 4UBNA 2I78A 4K6HA 3WK7A 2WUDA 1XZDA 4KAJA 2Y6UA 4YX9A 4J3JA 2RIPA 3HLKA 1MX9A 4BE4A 2WU4A 3LCRA 1UOPA 3O4IA 3W06A 3PICA 4OB6A 4QDZA 2C0QA 3G0DA 4H7EA 1F0PA 5FDFA 3DL7A 4EY8A 1DX4A 4ZWNA 1DTEA 1ACJA 5ALKA 4B81A 4G4JA 3V9AA 4XVCA 2HL6A 4B83A 3CCCA 1AUOA 1YS2X 1TIBA 4UBMA 5AKYA 3WMRA 4M0FA 4CCWA 3G9ZA 5AKHA 3H17A 3M81A 1M33A 2BGRA 3NGMA 1AQLA 1MPXA 4LYEA 4C6HA 2XLCA 5CT6A 2AJ8A 5CTAA 1IZ7A 3IB3A 2JF0A 2PUJA 5CH8A 1XZHA 1YSCA 1DX6A 1USWA 4DMHA 2O7VA 5ALVA 1K63A 3SX4A 3OM8A 4DSAA 5A62A 2WIFA 3ANSA 1QTRA 3EIOA 3VVMA 1HKHA 3HSSA 1VXRA 2K2QB 1XKLA 3OG9A 1JJFA 1O6FA 1A88A 1UKAA 1ISPA 2ONCA 3DNMA 1MN6A 2BUAA 4EZIA 3QITA 3KOOA 1THGA 2XQFA 2WUGA 5FKJA 1ODSA 1QIMA 1CV2A 4AZ3A 3N0TA 4IH4A 1CVLA 1BU8A 3K2IA 3AZQA 1QE3A 3VJLA 3STXA 1CEXA 3DDUA 5CH3A 4BTLA 2XMBA 5LKAA 1U65A 5HK8A 2V97A 3VVLA 3C6XA 4Y2YA 3WK9A 1PFQA 4ZREA 4JYMA 3TGLA 2VJDA 5AM2A 3V1LA 4KR0A 5AKEA 4WCVA 5AI8A 4MJ3A 3DCNA 1YA4A 1QJ4A 1ZOIA 4BDSA 4X92A 2GBCA 2XUFA 3WWOA 1XZCA 4PSUA 1EK1A 5A71A 4N8SA 1AMNA 2WSLA 2PSJA 1H23A 3LIIA 5ALYA 3TEJA 1TCCA 1YB7A 2Z8XA 5ALLA 5I9IA 3C6YA 4U2BA 4RE5A 2ZJFA 1EDDA 1AGYA 5E4TA 2CJPA 2Z8ZA 5EIAA 3A2NA 3BE8A 3BL8A 3D5EA 4M0EA 1EA5A 3FAKA 5AK5A 3W2TA 2VQ6A 4B7ZA 1N5MA 1H2ZA 5AI4A 4DLNA 4QZVA 1BCSA 1LPBB 2D0DA 1GPLA 4PSCA 4W1RA 4DM7A 1QIGA 2ZSIA 5IVIA 3LIPA 2VJBA 1XZJA 3VKFA 6YASA 3R3WA 5J3JA 2JEZA 2QOEA 5AK3A 3UUEA 4MYDA 1ZJ4A 4X90A 1GQSA 2EDCA 3TRDA 5FXMA 4L3WA 1QIDA 4FFWA 1E5TA 1L7QA 5K3FB 2B61A 5E2IA 5D3KA 1AKNA 4CCYA 1EX9A 3C6ZA 1JU3A 4BCCA 1BN6A 4PNZA 4BYMA 3QPDA 1BS9A 3WIBA 3O9VA 3X3HA 2ZJ7A 2CEKA 5ALZA 5AK6A 4M0MA 2Y2UA 3UUFA 1MNAA 1A7UA 2OXEA 4XJVA 3T52A 2CB9A 2O2GA 3WL8A 2J3DA 1UWCA 4LKOA 5AK4A 2AJCA 4OUKX 4Y2RA 1IUPA 1AZWA 5E4JA 4G4IA 4HS9A 2EDAA 1XZAA 3WIOA 1ODTC 1UOQA 5EHQA 4B9EA 3W04A 4IHAA 4FMPA 5KREA 3QMVA 5CURA 5EIEA 3EBLA 3EQ8A 2OQIA 3OPMA 5AKXA 1OXMA 3O9MA 4BE9A 1DT5A 2PU7A 3V48A 1RWQA 1IMJA 3K9BA 5JATA 4AX4A 3IIIA 2QXUA 1UZAA 1HL7A 4Y2VA 4IO0A 3AILA 4DMCA 3KSRA 2QUBA 3G0GA 2OAGA 3ED1A 3MUOA 1WHTA 2V98A 4H18A 2GBFA 2IX9A 1FSSA 4UHCA 1J1IA 3V1MA 4RE6A 4YPVA 1G4HA 4I3FA 1QZ3A 1W76A 2OGZA 4Y2PA 4BAZA 5IH7A 1VE7A 3G9TA 3WWDA 3WK6A 1DQYA 3RK4A 5ALXA 1CIJA 3VJMA 3I6MA 2WM2A 3DYVA 2VA9A 2XMRA 1MX1A 3V1KA 1W75A 3DOIA 4UHBA 2OQVA 1UOOA 2HRQA 4GEGA 4QWWA 1G42A 1PV1A 2WJ6A 3PFBA 5AKZA 2Y6VA 5AOAA 2XLBA 3WKCA 3KWJA 1J06A 3FWHA 4Q1VA 1XFDA 3C5WP 1EDBA 4X7BA 3FSGD 2WIGA 1XQWA 3H1BA 2WHRA 4F60A 3AFIA 4KE8A 1Q0RA 4J0DA 2Y2VA 1JKMA 1XZKA 3G7NA 4P92A 3VJKA 4JYPA 4X6YA 2E3JA 2VSQA 4ZXFA 4JUIA 2AJLI 4X93A 3BDVA 2BJHA 3AUKA 5EHXA 1VJ5A 2WLSA 2HA0A 1JMYA 4LXGA 2XT0A 1WPRA 1O6GA 4AMZA 4UHDA 5HF5A 4WY5A 1EI9A 1CUAA 1CQZA 2YH2A 3IULA 2ZJ6A 3STYA 1JJBA 4AO6A 5JYCA 2VJCA 2Q0XA 4H7FA 3PUHA 1LGYA 4DTCA 1DWPA 1YS1X 4J0IA 1GPKA 5EIHA 1W4LA 3WJ1A 3U1TA 4BC0A 1VA5A 2XUPA 3WL5A 2PSEA 2RONA 2X76A 1LBSA 4DMFA 3STUA 1HQDA 5K5EA 2ACEA 1A8SA 5HKBA 1QFMA 4MWTA 2WIJA 2JGMA 4I19A 1KU0A 4U2FA 4H77A 4RGYA 5H3HA 4H35A 4K6GA 1ETHA 1UXOA 5LLSA 1VA4A 4KE6A 3IURA 4OU5A 4W1PA 3G8YA 2OCKA 4IH1A 1CUIA 5ALQA 5LYYA 3LS2A 5JD6A 3VDXA 2HDWA 5ALWA 5JZBA 3WYNA 5K3FA 1E66A 3LP5A 4J0JA 3G0IA 3WWCA 3DS8A 1FFAA 2XE4A 5AIBA 2WTNA 1K8QA 1LPPA 3QM1A 5ALNA 1EB8A 3O4JA 1LPOA 4JNCA 3KWFA 4BP8A 5T4BA 3BF8A 5DJ5A 4AN1A 5FP0A 2HA6A 5ALPA 1ZGCA 4WY8A 4BZZA 4ARBA 1DWQA 4KE9A 2NW6A 1BROA 1EVEA 3FCXA 1S8OA 4BRSA 4INZA 3TJMA 2WG2A 2OGTA 4G8DA 4UHEA 2WUFA 3QPAA 1XZMA 4X91A 3STTA 4PQEA 5ALTA 4KAAA 2B9VA 3I2HA 5LZ4A 1R9MA 2XMSA 3V1NA 1HBJA 4H7KA 5AICA 1YCDA 1LPMA 5SYNA 4LHEA 4S0XA 1OCEA 1JT2A 2XMZA 3K6KA 5ISMA 3HYSA 1MU0A 1QIEA 1KU6A 5DYYA 5K3EA 2CMFA 4L9AA 3HJUA 1LPSA 5JAOA 1XQYA 3ZLTA 2WJ3A 2GBIA 4C87A 2CBGA 2CKMA 2QUAA 5JALA 1WOMA 2HM7A 4G8CA 2RHTA 4UBLA 1IVYA 1WB4A 3ANTA 1XZIA 2PU5A 4N8EA 3ZPXA 3IVMA 4B6GA 4FNMA 4Y2JA 4XX1A 2XUAA 3EF3A 4DIUA 1I6WA 1DWOA 3C5VA 3U0VA 4BVJA 2GYVA 4FKBA 5CT5A 4KYVA 4MEBA 1UK8A 1ZICA 5JAPA 1ZJ5A 4FLEA 4J03A 3IBTA 4ZRDA 4DYHA 3C8HA 4L0CA 2BUBA 1LBTA 3PFCA 1MJ5A 4TPKA 4OB7A 2V9ZA 4N5IX 4UHFA 4NS4A 1HLGA 2XMCA 4KRYA 2VF2A 1VKHA 5HF9A 5I7UA 3RKSA 3DLTA 5EHZA 2JGLA 4P9NA 2BCEA 3M83A 4LIPD 3H0CA 2WFZA 3RLIA 4IQ4A 2W22A 5C8ZA 4QE3A 1B41A 2WG1A 5AHXA 1J2EA 4U2DA 4FDMA 1Q84A 2ECFA 5HK9A 3STVA 2HHAA 3HRHA 4WDRA 4UBKA 1EVQA 3ILSA 1X2BA 4KACA 2WILA 1CUSA 1YAJA 4GWLA 5AKJA 2WUEA 2PKYX 3R0VA 4CIAA 1P0PA 3B12A 3C87A 3CN7A 3ZLVA 3I2KA 3QYJA 5C8XA 3STWA 5LZ7A 1QIKA 5AM3A 1J07A 5AI6A 4G9EA 1BE0A 4FOLA 4E15A 1CPYA 5ALHA 4KJXA 4Q3KA 4W1SA 1KEZA 1P0MA 1RP1A 1Q83A 5ALMA 2CUTA 4KEAA 3GA7A 3FYTA 1UKCA 4H7HA 4QEKA 5FOQA 4O08A 1FJ2A 2WHPA 2DQZA 4PF1A 2H1IA 1EH5A 3G02A 2B4KA 4AB1A 1C4XA 1R50A 3HI4A 4BAUA 4E11A 1DT3A 2QKYA 5CXUA 1E8NA 1XLWA 2J3QA 1R9NA 2WHQA 4EB0A 2RI6A 3WJ2A 4OB8A 4E14A 3A70A 5HCUA 3VISA 4CI9A 3R41A 3IUNA 3O4GA 1E89A 3QMWA 4W63A 3ZI7A 2ROQA 5EHNA 4Y2TA 1XKTA 4H0CA 5BWBA 1XRLA 1TAHA 5HQ3A 2JEYA 5DTJA 5LZ9A 2XUHA 4OPMA 5ALIA 4G8BA 5EGNA 1FFDA 3D2CA 3ESDA 4LYDA 1UK7A 3RM3A 3DKKA 4MYSA 3BWXA 3JWEA 3H04A 1MNQA 2PSDA 3H2IA 2FUKA 4JH0A 2PUHA 3UMJA 4F5ZA 2DSNA 3OURA 3YASA 3I2IA 5C81A 3E1GA 2D5LA 1N1MA 1UK6A 1MT3A 4MQLA 3AIKA 2DHDA 1H2YA 1C7JA 2XUQA 1U2EA 1GXSA 3B5EA 4V2IA 2HIHA 3CN9A 1YR2A 5FRDA 4KAFA 1UT6A 4UUQA 2HA5A 4FHZA 1EHYA 2QVBA 5HZGA 1BRTA 3R3VA 4BP9A 1ZD2P 4N8DA 3I2FA 3C70A 3AIMA 2QTBA 4IH9A 2FX5A 4ETWA 1SCIA 2DQYA 3LLCA 3WI7A 2C0PA 3QPCA 2XQJA 4Y9SA 1HDEA 4X95A 1AX9A 4Y7DA 3N2ZB 1ZIXA 4FNGA 1GKKA 5HFNA 4HRXA 3D7RA 4DSZA 3H2GA 3W9UA 2QR5A 1QONA 1Y7IA 4CG3A 3WYDA 2WG0A 2W6CX 2OCGA 1CUHA 2G63A 3C6BA 1K4YA 2EEPA 3I6YA 4LXHA 2ES4A 2CZQA 4NVRA 5YASA 3Q0TA 3PDCA 3C45A 5JASA 2JGJA 5AI9A 5CRIA 4UFOA 5I8PA 3ZLUA 3D0KA 5SYMA 5LKRA 1ORWA 3H2JA 3BDIA 4CCYB 4CG2A 4QNNA 1GT6A 4BZWA 2HA4A 1E3QA 1VLQA 1QGED 2VEOA 4LXIA 4MEAA 4ZI5A 1Y7HA 4MQMA 1K5PA 3AZOA 1MX5A 4MWSA 2O2IA 3OC0A 5ALGA 2OGSA 3QZUA 3A2MA 1NX9A 2VT6A 4WDQA 5BWCA 5FLKA 1A8QA 1G66A 3KXPA 4BB0A 1F6WA 3D4LA 3FLAA 1EXWA 7YASA 2VAVA 1ZD5A 2I03A 1QOZA 5IVDA 1XZEA 3VXKA 5ESRA 4ZV7A 4Y2QA 4GXNA 1XLUA 4X97A 1LPAB 5AM5A 2LIPA 2OAEA 4BVKA 2QM0A 2VTVA 5HFAA 1CUFA 3IUQA 1DU4A 5EFZA 3ZWQA 2GBGA 2GZRA 4X6UA 1WCYA 5AO9A 4E46A 3T4UA 1NU6A 2XMDA 4WFIA 1IZ8A 2QJRA 2OCIA 5JD5A 2JIDA 2JGKA 4X94A 3D2BA 3FLBA 4Q05A 1CRLA 3FNBA 5ALRA 4GW3A 4X85A 5AJHA 4HTAA 3GFFA 4YASA 5FV4A 1WB5A 2G4LA 5A7GA 1VXOA 3WLAA 3BXPA 2PSHA 2XUKA 3BF7A 2WFLA 4CG1A 2ZVDA 3WK8A 4A16A 3FOBA 5D7BA 1CUEA 5AIAA 3DD5A 3WWPA 1SCKA 2HA2A 2PX6A 4DNFA 1ZGBA 4DNPA 4GHWA 5JADA 3FCYA 4X6XA 3EQ7A 3FBWA 4FBLA 3HACA
chains in the Genus database with same CATH superfamily
2ATXA 2HK9A 1CY4A 4I1SA 1FRZA 3JX9A 1XTVA 3IESA 3B38A 5FTJA 4KDRA 3UMRA 1L7EA 1TCAA 2HF8A 3PF9A 3VYTB 4C20A 5A9RA 5HTOA 1PJLA 3K4PA 4LJSA 1A8PA 1GNVA 1CNFA 1ZIPA 1AB5A 2BIFA 3Q8WA 4HN4B 4U9UA 5T3YA 4RABA 3TNDA 4B6JA 2B25A 1SFRA 2Z3VA 2QN7A 1QP0A 2PMDA 3WLPA 5JS7A 2OHFA 3K0FA 4IO1A 3L0PA 4AS2A 4ETMA 3AU9A 4R68A 3RT7A 2ZJOA 5JMOA 2ZJ1A 3DV0B 3ES9A 2V7BA 3FVTA 4JA0A 3I01A 5IM4F 3ND7A 1F2DA 3LI2A 2ZR0A 5AKLA 4B2IA 4B8WA 1VPTA 2AN1A 4KODA 5JUWA 3MM4A 1PP4A 3Q7QA 4KWEA 5GP1A 3D4OA 2FWJA 2H4WA 5KDDA 1NBIA 3I8XA 1GG8A 4FHGA 1RTTA 4CNQA 3LHKA 3VNRA 3EFBA 4G5YA 4AJLA 4C3ZA 1T15A 3L7IA 1BU5A 1G8AA 3ERCA 2ETVA 2F00A 3GBPA 3NAQA 4KUHA 5BQ5A 3AXTA 4HSGA 3A6ZA 4RS4A 1CFZA 2YDXA 1N8KA 5FL7D 1KYXA 3VDQA 4NESA 3ASUA 1TM2A 3I9JA 3EFEA 5FPHA 1WB9A 1W2WB 4EB6A 4QDTA 3T95A 1PJQA 1REQA 3COZA 5KBYA 2GTPA 2OT3B 3PQ8A 4GLJA 4KQIA 4V24A 2HPHA 5E38A 4UPDA 4J1SA 2B9EA 4BPRA 3BX1A 3N76A 2VHUA 3W4IA 2GQ0A 2WNSA 3OO1A 5K3AA 3K09C 1TM5E 4Y67A 1EPUA 3O2SB 3C8MA 4Q1AA 4K6OA 4ZIRB 1K9VF 2NYRA 3NAMA 2IS1A 1WP4A 4EQZA 7MHTA 3A9RA 2C03A 2XT9A 5K3DA 2GEUA 4FFMA 3I58A 3C7AA 3HU1A 3OF5A 5CLLA 4NU0A 3TUJC 3QNWA 1N33B 5IK2D 1TUIA 3UOWA 1ZM4A 4Q3AA 3TD6A 4FILA 3P9RA 2NU7A 1D09A 1I13A 2P27A 2E9SA 3AR6A 3CPEA 5KWJA 1T2NA 2JI4A 4Y6RA 1DG9A 4N7MA 4OD0A 4ZCIA 2RB4A 1E3TA 2R96A 1PWHA 3DMGA 1V96A 2V7QA 4I3HA 3C85A 5EIXA 1K7YA 2E18A 1U1DA 2ICAA 4G1MB 4TXNA 2XCRB 2IXBA 2PIAA 2R47A 4BGUA 1H2XA 4G1FA 2JASA 4W8OA 4YMWA 1CXZA 3O1LA 4OQZA 4TUYA 4X3CA 2IDJA 3VGPA 1QGDA 2BFEB 4BNNA 4F84A 2BEVA 1NXOA 3FUWA 3GRPA 2F43A 1K7SN 3HC7A 3UWSA 4HH1A 3PNYA 3GN2A 4DG9A 1VBFA 4BJ6A 1NE2A 1GP2A 1I2AA 4E5DA 4CM6A 4H2DA 3HLYA 3AEZA 3G5MA 3PWTA 3Q0IA 4C0BA 3H86A 4UM5A 2PR7A 1M2OA 3WGUA 1G3QA 1KMNA 1RKUA 4NYMQ 4BB5A 3RTCA 3U62A 4C4ZA 4DV1B 3TXXA 2RAFA 3DSRA 3KNZA 2W70A 4C76A 1XRNA 4OSOA 4CDGA 1XL0A 2VJNA 3I72A 3GEIA 2WVAA 4WBNA 1FX1A 1CUVA 4ZCSA 1NR7A 2WJHA 4XWWA 1NLZA 2OYRA 2F2TA 1SBYA 1VDMA 3DE4X 2WHPB 2OZEA 2GZSA 1Q1NA 4LTMA 1VJ1A 3E8SA 3LP8A 5KJ6A 2XCQA 2CLSA 4BGIA 4X41A 5A0VA 4QSMA 1DIGA 5IP5A 3C5HA 5FFNA 5AKGA 3DVSX 3TBKA 2HHJA 1UDWA 1MO5A 3SDSA 1EJBA 4DA4A 4DR1B 4FI3C 2JS7A 2VK8A 4LSGA 4LDJA 3SR4A 3UAGA 2HCFA 2Q5CA 4QDXA 3WA6A 1O6ZA 3ZXXA 2I80A 2CLCX 2XT6A 5IAAA 3BD8A 1KZ4A 4PBRA 4PAGA 1E8MA 3L1JA 4RBNA 1DCFA 2EKZA 5BXQC 3C3AA 2WYVA 2FB9A 4HAUA 3DVLA 5IYZB 3SXJA 4NH0A 1W19A 2C96A 1U8FO 3DQPA 3Q6MA 1NG1A 1T26A 2WIDA 5DRTA 3ELDA 4R9NA 1W47A 1QAOA 1YR6A 2X19A 2BFEA 3CS3A 3ILYA 2Z2YA 4IGFA 5KPJA 4FMCB 2EFJA 2FUEA 1G0OA 2ASVA 3A32A 3GB9A 3HXTA 2H59A 4BFVA 1L5FA 2X8BA 2Z1NA 4F2DA 1FFXA 2IA5A 4RD1A 2A57A 3AYZB 2VP2A 3HBNA 2C97A 3KHKA 3G13A 4MVJD 4PW0A 5SYAA 3R7NA 1KXJA 3M5CA 1CJMA 3AB7A 1EFHA 4RJIA 2BI7A 1HDCA 1TEVA 2C7BA 1F0YA 4DG5A 3MN1A 1X92A 2EHJA 3L0ZA 4G5XA 1ECPA 4MGIR 4UMDA 4K9PA 5KHLB 1UKBA 2CW5A 4Z7NB 1KSGA 1P4RA 4JGBA 1G20E 3FTNA 4M4SA 5FI3A 1PT9A 1NOIA 2DP4E 2O50A 2SKDA 1JHOA 3EA0A 3EG5A 4HBGA 5KVAA 1ABEA 1B74A 1MJFA 4PSDA 5CFNA 5IPFA 1U2SA 3DMPA 1MENA 2WMOB 1NBMA 2QUKA 1RLUA 3TFWA 4FYXA 1QNFA 4QHYA 1ZK4A 2FEWB 2YVLA 5K3SA 3TE6A 2GJSA 3NANA 4IF4A 3BMQB 4WW0A 4BLOA 4XASA 4D92A 4E07A 4KMSA 2QLTA 5E3HA 4RD6A 1GGHA 2JCBA 4NOMA 4ZOBA 1QR6A 5DEIA 5BUCA 1QVWA 1GFWA 1XAGA 4XR4A 1H5QA 1K5GA 3WLRA 4CR6A 2IPLA 5AM0A 1XVUA 4MICA 5H02A 2C9BA 1MJNA 1I2ZA 2J7PA 3MA0A 1EXNA 1L5WA 1L5HB 2C8LA 3QE2A 3K3PA 1H3EA 1LWNA 1U7HA 2DTXA 3AL0C 3BIWA 1G5FA 1GGMA 1G5TA 3BMOB 4QVKA 2OQRA 4BTEA 5CLJA 1NXQA 5E3JA 3H42B 1SXQA 2IS6A 2XGGA 4F6CA 5JS6A 2WWWA 1RAFA 3D2AA 3A6FA 3CR7A 3N2KB 3G79A 1GCUA 3OLWA 1QO9A 3I9V1 3K72B 1G5RA 1W96A 1OGYA 3K9CA 4RK5A 4G4GA 3SEFA 1E3SA 1IAVA 2C77A 3CTMA 1MC4A 3RVMA 2ACKA 5FFFA 2GTHA 4OHKA 4RVNA 3VC1A 4DZTA 2H4JA 2YYSA 5EYPA 1X3LA 2PFSA 2GEVA 1KZ7B 3SIXA 3TOCA 1A9TA 3KZMA 2VHXA 4C0KA 4Q01A 4UM7A 1N2JA 4I1UA 5LLDA 1JTEA 1PQYA 1EMDA 2D74A 3CURA 4M7WA 1Z38A 2OHIA 3SXPA 5FOTA 3UQYS 1EWQA 4KO1S 5J2UB 4NF2A 3F3SA 3PUZA 5IYZF 3RROA 1YZGA 3ED5A 5HNKA 3IXQA 2C94A 3DE5X 1MD9A 2ZANA 4WZZA 4F7DA 3UPUA 3A4IA 1UPTA 3DG9A 5DSXA 4ABYA 1P75A 2CSXA 4FQ8A 1CJTC 1TGYA 4E94A 1N7JA 2DM6A 4H1TA 1SUBA 1AK1A 3F7NA 3JV7A 4EHJA 3E35A 1XNRB 2LRHA 3MWKA 2VCEA 1RM5A 1SQ6A 1I9CA 3QLEA 4WKPA 4B4WA 2QG4A 1GQRA 2P30A 5GJWC 3GUVA 4PPFA 1JGTA 4FDVA 1T0UA 2EZTA 3A9CA 3FSGA 3D2LA 3G2LA 3JRNA 3QKWA 4X20A 3DZFA 1YHNA 3GR6A 4B8YA 3Q7IA 2PMKA 1MB2A 4NCXA 3TOVA 2ZI7A 1VLHA 4JGIA 4XQEA 4WK0B 1P0CA 3TNYA 4H27A 5EG5A 2P40A 3M6WA 4WXEA 2D2VA 4CM5A 4BO3A 4OI4A 4NBKA 3VRHA 4D3YA 3E7DA 3OI7A 1U1CA 2Z56A 1ZITA 1M2OB 1G63A 1JDNA 3HVKA 4JT8A 4MR9A 1N8SA 2C82A 1OROA 2NYUA 1CLEA 2PBFA 2VAMA 3IKMB 3K9NA 4PLWA 3AUAA 4RLSA 3TH5A 4DQXA 3SS8A 2J8ZA 4QIHA 1VP9A 2WZDA 2YVKA 3JQBC 4CLDA 4FDTA 4X24A 3U1VA 1ZR4A 4NYIR 3GLGB 4BLWA 3VOTA 3CC8A 4QTTB 3K0BA 1BNCA 4UTXA 2Z2JA 2PE5A 1XEWY 2YXEA 3KQKA 4KV9A 3AR8A 1U0LA 4KAXA 1NVKA 3B6IA 2FVXA 1M10A 2R751 5ESDA 5L3SA 3NP7A 2NZ8A 2VNHA 4LSMA 1P73A 4GBJA 2CXOA 2Z5GA 3LTEA 2X6TA 3LCUA 2RHOA 5EQTA 3ONVA 2B8NA 2GBPA 3HYLA 4E0BA 3W2IA 2IY8A 4BNIA 1B42A 1Z37A 4C4TA 1XHLA 1MQ8B 1AA9A 1WMFA 3Q1KA 3H1AA 1P0QA 3O31A 3RYHA 4DBZA 3L92A 5IN4A 3E2PA 1M6VB 2O5RA 2XZDA 3QMMA 3U6KA 4BNDB 3K09A 5ILOA 1Z68A 1VGRA 3HO1A 4B2YA 2QJWA 1GU7A 4HXFB 3LVFO 4AKTA 1E5VA 4XCQA 4S0ZA 4OM8A 1U8EA 3X1ZA 1EINA 4LXTA 4V0LA 3FBTA 5KHAA 2VDMB 4BC1A 2FYTA 1FDVA 1P4HA 4CGYA 5DNUA 4QUJA 1JE0A 2JB9A 3PPXA 3LO5A 1X7XB 4I9NA 2RG7A 1CTQA 5TXGA 1SWWA 3EZGA 1JR2A 1ULBA 2KM1A 2O14A 6REQA 4D1YA 4B0PA 4YXWA 2ZI5A 1C9DB 1SB9A 4M83A 3PV0A 4RNCA 2NXCA 4EJFA 1WSWA 4M89A 4FDLA 1JQ3A 1OVMA 1MOSA 1XWFA 3KTDA 3PC3A 5FTKA 1T1SA 1T5SA 2YINC 3LL7A 2OHVA 5G4LA 3L1HA 2XIQA 5JJBA 3PDIB 3L9WA 1B6TA 1YL7A 4P5EA 1SIBE 3F6EX 4OOFA 4UDOA 5ETJA 3BXOA 5ARDA 4GX5A 1YRWA 4H17A 3TEFA 4M21A 4EY6A 2OCLA 4BRWA 1JYSA 4TKLA 1X0XA 1U8ZA 1WKVA 3MGCA 4ARZB 4C88A 1ZQ9A 3FMPB 3IEVA 1LTKA 1U2GA 3GYGA 3IUSA 1XJQA 2FK8A 4FYMA 4AQDA 3WGJA 2QMQA 1NWCA 5ALOA 2GN4A 2Q2NA 2O7NA 4LJLA 5E95A 4A10A 3ZVLA 5T67A 1TYCA 2Z4RA 3FM9A 3PC8A 3JTEA 3T5GA 3ETLA 4E09A 3QVMA 3FHTA 1M2VA 3SEZA 1JEJA 2ISSD 3P9SA 1Z8NA 1AQUA 4MPRA 4DNOA 4G5QA 2I99A 4TKZA 1EUYA 5COBA 4NRDA 2YN2A 5I7OA 1PGNA 2IBTA 1Z5UA 4PFQA 3C14C 3UANA 4O4JF 1DNPA 3TOXA 2AE1A 4EARA 2W6NA 5LIPA 1N1DA 2YVAA 1K6JA 2ZS9A 3G2KA 3S2YA 3JW8A 1Y89A 1YCHA 1ZEJA 2FX2A 2FSSA 4D8WA 5DXJA 5BOVA 3CRRA 3F6SA 2G1JA 1HZZA 1NYRA 1QHHA 2E4XA 2SCUA 4I9HA 3O0DA 5FWYB 4F4HA 1U5AA 3EMDA 4V0ME 2R00A 3VPSA 4MUFA 2CV2A 5CM8B 4QDKA 2JAPA 4FW8A 1U7ZA 3RU9A 2P9FA 2KLBA 2OBLA 4FFVA 2H54A 1TM1E 4G5FA 1MIHA 5G41A 4F45A 3PR2B 5FT9A 4A5OA 2HIAA 3GDHA 1VECA 4WPGA 1NVWQ 3EGOA 4CLOA 4CE6A 2Y1KA 2ZYRA 4M38A 3VU8A 3AVXA 3FPBA 3QLVA 3WKDA 1P7YA 3HM2A 1ESDA 4RFVA 4XH9B 5TQJA 4K9QA 1GVHA 3N05A 3A3PA 2OENG 5FA6A 4XQ9A 3TIVA 2C7QA 1W5BA 2FFHA 3GP8A 1GTJ1 3GGDA 4MZDA 1UJNA 3FMOB 3PLNA 3ZJUA 4I50B 4JL5A 2HDHA 5JMPA 1T25A 1X13A 2WHYA 3KEQA 1ZI6A 4R2HA 1DTWB 1FLNA 3CJQA 1C9EA 1XTRA 5GGXA 2Q4TA 1N2CA 4ZXPA 3TMKA 2ZSBA 3F9CA 3LUAA 3Q7TA 3VH4A 4LFAB 1VG1A 4YJ3F 1YVDA 1RYNA 2NTEA 3CJTA 4UDNA 1KO4A 1TU0A 1WXIA 2Y1CA 3ANLA 4R05A 4ALIA 3AJAA 4HB4A 2P2ZA 1HC7A 4DDWA 2R6GA 4U2EA 2A1TR 1Z0ZA 3R6TA 2HJHA 2CK3D 5DHRA 2HMWA 4RA9A 4LZAA 5ELXA 3G2NA 3LAWA 2QE7D 1C9JA 2NSJA 4AJNA 4B76A 5AQ1A 2VPQA 4UREA 1XXHE 1KYQA 5IASA 2QF7A 1DCKA 1MEJA 3V7WA 2ZETA 2V7GA 5A4AA 5CT4A 2Z0MA 3I28A 2YC4C 4ACAA 3WWEA 3HBFA 2FOLA 4EGAA 4V0QA 3DL4A 1JTVA 2JZOA 4JEUA 2O8EB 5K01A 3FVVA 4TWZA 3DTVD 1Q0SA 4L8LA 1BXRA 2GYYA 4ZYXA 3TL3A 3JVEA 2GH1A 1OHHA 1V35A 3KWMA 3S68A 1ZI8A 5JQGA 2GD1O 2G0AA 1LZLA 2HQBA 2VNKA 3EDOA 3MAAC 4DWOA 4CETA 3OJEA 2R5FA 3GJSA 3R8FA 4TL9A 3RRFA 3NHMA 1N1GA 1SY7A 3MCVA 4URUR 3U1BA 1IEQA 3R3YA 2UXBB 2D2XA 4JUBA 2P3SA 4EJSC 2G3YA 1SG6A 3KZOA 5JS8A 3KJXA 3DZCA 1Z0SA 4O1MA 1UMBB 5AVJA 2Z95A 1O96A 3VAZA 4NQZA 1SVLA 1C3EA 2CJFA 5TMBA 3WB1A 3Q9LA 3WZLA 4CQLB 1A8UA 2PGAA 5KVCA 1ODLA 3K31A 4Y9UA 5ES4B 8ABPA 3DBOB 2HRDA 1DAIA 2WT9A 2IH4A 2D5IA 4YGXB 1Q6ZA 1L2TA 3GRYA 1SOMA 4C22A 4KGDA 4RWZA 3ZJTA 1TUBA 3AIOA 4EW2A 3OTOB 1QKKA 2AFRA 3RRMA 1GTG1 3SNKA 3NVMB 5JO9A 4FLFA 2IYZA 1M9NA 4W5HA 3P32A 2A9FA 4J76A 1ZG3A 3EDCA 1MO3A 2LD4A 2V8BA 4ZOEA 4I4TF 1ESEA 4EAAA 3H13A 5AVSA 2RIRA 1H3NA 2PZFA 2W2OA 3M2PA 3ZD8A 3FSJX 2DY1A 5K7SA 1L4NA 2QL9A 2EKQA 1D6NA 2I2XB 2IKSA 3DWFA 2I9PA 3WL6A 1GZ6A 1R27A 2PQ0A 4OATA 4GO1A 2VLBA 2GLTA 3CR3C 1H8HD 1RQLA 3O8QA 3OQVA 2YC2C 5ERXA 1R00A 3TPZA 3JWJA 4JQOA 1DINA 4B75A 3HHEA 4C7XA 5CB4F 4KPFC 1HE5A 3QHPA 1MIOB 4EA6A 2FP4B 1NQUA 3AEKA 2UVPA 5EXEA 1PI3A 1GKYA 2IODA 5JW6A 3A36A 1JA0A 1EK0A 2CL7X 5ALDA 1NLMA 1ZCZA 1X19A 2Z04A 5JSFA 1U8AA 3RRJA 4TQAA 2BM1A 2XF8A 1N8NA 4KN8A 3D7NA 4CEJA 1UJBA 2GRAA 4BX9A 5KB3A 4OBEA 1ZD3A 3E0XA 4NK5A 4ZQEA 1T29A 1GG5A 2CNNA 2GESA 1YJAA 4RADA 4RK4A 4DV2B 3OZAA 4TMXA 1KIFA 1UXJA 3DBIA 1Q0ZA 3FSRA 5DT9A 4CM4A 5IZCA 4AKHA 1ENOA 3LT2A 3OZTA 1ACLA 3KU4A 2SECE 3BK2A 3W2GA 3KPUA 5ELMA 3PVCA 2JCXA 3ZDRA 1PGOA 1D9XA 1QMGA 3CGGA 4PZZA 2D4HA 2GJ4A 1UFOA 1Q95A 4ENSA 1HNXB 3RIGA 3SWWA 5CNMA 1PJAA 2UUPA 3QJGA 1H69A 1VB5A 1RQPA 5GQSA 4G07A 2I3DA 3GMDA 4J0KA 3OZUA 4N5MA 3DDSA 2P79A 3Q5EA 5AW7A 1QFXA 4WASA 4DB2A 2WJ4A 1H8HA 2DKOA 1T9AA 1UJ6A 2Y99A 2HJGA 4HN9A 1RWPA 4LF7B 2GM9A 3NCHA 3INNA 4HZUA 1HMPA 4K9SA 1RQNA 1NX6A 1QVRA 1ZOPA 4MARA 5FQNA 3BK7A 2ODQA 2R7LA 3OA2A 1AC5A 2R7AA 4YCCA 3V3KA 2QW0X 1DHRA 1OLSA 2C9OA 2WJZB 4LNUB 5BORA 4GVLA 2GK6A 4O0LA 4PG5A 1O9BA 2JLCA 2O0MA 4P3OA 5G1NA 4E31A 2HWXA 5AR1A 3DM5A 4EHBA 1RPZA 4O02B 4LF5B 4XM2A 1NSFA 3QENA 1UXIA 4ENQA 1JTFA 3RAFC 1P81A 5EKDA 3G85A 1I4LD 4YACA 1AF4A 3K1TA 1FYVA 4LVOA 2Q4BA 3ZJYA 4EFNA 2B69A 2X41A 3H8WA 4MIOA 4EPTA 4RVSA 2A30A 3FPGA 2AFVA 4GMDA 2OPHA 5CDSA 1ZGJA 1C7IA 4CUJA 1H93A 2VP9A 2HCJB 2E1RA 2V65A 2ZKLA 4WBNB 2Q62A 2DR0A 4ETNA 2IX3A 2BBSA 1OLOA 2R8BA 1R8YA 5CXXA 4YT8A 1JJIA 2YRXA 4M54A 1TM4E 4NONA 1CJSA 1UWVA 4B6QA 2ZPUA 3F9IA 1WKCA 4X1IB 4HVCA 2XAAA 2C4NA 1J2RA 4GYKA 4IR7A 4C89A 1V1MB 1MXFA 2B78A 3VNQA 2MHCA 1O95A 4M9SA 1JZSA 1TT5A 1ZMXA 1K7CA 2YN4A 3RHSA 5E3IA 2BMVA 4TUYB 5BW6B 3FWPA 2GKGA 1ADYA 2J30A 1SHTX 2WUWE 4QU5A 4FMDB 3EXIA 5AK0A 5HQJA 3K71B 1RWKA 2XNHA 4TXMA 2O3JA 4E5SA 1EWTA 2OXTA 1V1RB 3PC2A 4JJAA 3KYCB 2HQ1A 1V4VA 4CM1A 4S04A 3C3KA 3BH7A 4LK2A 4CDMA 2X3YA 4Z7JA 5H4GA 2BW0A 3F8SA 2H08A 1FBTA 3H1FA 2OHXA 3BJRA 4BO8A 5JJ5A 1EVZA 3KJIA 4ZIRA 4GC5A 4MUMA 5DBFA 3I9V6 5I7VA 4R54A 4UFNA 1JIIA 2RBGA 1YR9A 3ZNOA 5BVHA 2WW8A 3BFJA 4L0DA 2HA7A 4UEOA 1JDJA 1FXWF 1QF7A 1Y8RA 2H57A 2AQHA 2ZTVA 1OIVA 3PSHA 4QQ8A 2A5GA 4J1QA 4JLWA 2QW8A 4FFRA 4MQBA 1UWLA 1DFIA 1NZDA 4CLRA 4ZYVA 2BM8A 3HVUA 1JJAA 2XA2A 3DMTC 4NS1A 2IYLD 1PFKA 2QXYA 2Q3HA 3NT4A 5K0LA 4BUZA 2ZYHA 1FS6A 4X5OA 2FN8A 4G63A 3IVAA 4AECA 3PNQA 3U3XA 5D3ZA 5K3CA 3I5AA 4BDTA 3ZIUA 4HNSA 5D6NA 3HZRA 4JHLA 3WL7A 1NSTA 3OZCA 4AT1A 2ORIA 4WZBA 4JLPA 4N3AA 1CUUA 4HRYA 3RVKA 5I7WA 4GR4A 4YAJA 5EXPA 3QIVA 2W83A 1KNQA 1MAAA 1HWYA 1OC4A 4GGMX 4UTPA 5JJCA 1N34B 4AXBA 4GH5A 1HSZA 5AI0A 4BCBA 1EEXB 3BTOA 3ICCA 4EQ6A 2PT6A 1GN8A 1VOTA 1N3LA 1NU8A 5T4EA 4EKGA 1VYHA 1YT5A 2GRUA 5IVPA 2BOVA 5G02A 3VR1A 2PS9A 3TD2A 2HYIC 4NU6A 3I34X 3LHDA 5DU2A 3SSMA 4F2HA 3ESBA 9LDBA 2C4VA 1HTBA 2GRJA 6CHYA 3A4YA 2Q8NA 1K92A 2C9DA 4YAGA 2FEAA 1IM8A 5DYWA 3V4PB 3WOHA 1JILA 1FZTA 1P1IA 4E4YA 1B0PA 4Q6WA 2YWDA 3RGGA 1XD9A 4HNQA 1XZFA 5L95A 4DS3A 3HDYA 3RC8A 5DBGA 1GFSA 1RYZA 4MI1A 3RTEA 4P5DA 3T4PA 1SCNE 1NM5A 2HO4A 4NICA 1J56A 4EG5A 5C80A 2C7VA 5CXQA 3M82A 3EWAA 4IUCS 1OGJA 2XI4A 5EWLB 5IT9A 3HJTA 4BP1A 2V96A 1NXPA 2GUGA 1Z0KA 1GAWA 1FCJA 1HYEA 1WABA 4EUSA 5BMOA 3GIDA 3ZBQA 4H7JA 5HZHA 4N6GA 5IVHA 4DRXA 4RIFA 4WLNA 3TUIC 4UEKA 5JMWA 3LKDA 1O94A 3DEAA 1C30B 4ALJA 1H22A 2ZE7A 2H3EA 4Q4JA 4QJ5A 1AS0A 2GN9A 4S1OA 4J0HA 3OOJA 4E2FA 1M5UA 1W1WA 3HGQA 4UNPA 2BYTA 4ZRMA 3RS0A 1FU8A 1NAIA 4IFBA 2XCOA 1K06A 3QTLA 3DQQA 3R7AA 4I81A 2I78A 3EXIB 4K6HA 2OBFA 3BGOS 1T3LA 1WD5A 1H9BA 3NFRA 1U28C 2P2DA 3GEEA 4L9WA 1D6JA 1ZC4A 3T35A 1PR9A 4XVCA 2UYYA 3CF4G 3W6ZA 2E21A 5LWQA 1UMCA 5B1DA 1DFHA 2EQAA 5L6MB 1C0KA 2FY8A 1YE3A 3NBQA 3BH6A 2WYUA 3LCRA 1UOPA 3NATA 3O4IA 2C8JA 4JELA 3T5TA 2ZB3A 2WSYB 4J2TA 3QBDA 1YONA 1DLJA 5D5QA 2FRXA 5LC1A 1VHDA 3G0DA 1RRGA 4ZVLA 5DK4A 4G26A 1V43A 3BSFA 4I1YA 2AFIA 4F46A 4RJTA 4EHLA 3R9XB 4IJVA 4KWCA 1D2RA 4R2XA 4QXMA 1R6UA 2B4TO 2EW2A 3LW7A 2I34A 4Q7MB 4RSHA 5DB4A 3KT8A 4E03A 1NGSA 2BFDA 3F5MA 2F67A 3BE4A 1AUOA 4XJXA 4F72A 3UT0A 1QC5A 4YRQA 5KQPA 5GADl 3RNLA 2Z2IA 4HLUC 4JEHA 4OJQA 3T9FA 3HQ4O 3WZ2A 3SJUA 5JDIA 3SR3A 5CDGA 1WLSA 2OV1A 3GK3A 4GKJB 1V2HE 2CDBA 2VDPB 2P1ZA 4INPA 1T1JA 2ZTMA 1XYYA 3CF6R 3PWKA 4M0FA 3HCPA 3M81A 4CCWA 3AR4A 3BKWA 1AQLA 1JEOA 1RABA 5JBIA 5B4TA 2C9YA 4C6HA 1GV1A 2E5LB 1KEPA 5CT6A 1HUQA 4M9RA 2WNIA 5F7ZA 1L8XA 2JF0A 2PUJA 4JXKA 5E9QA 3WGMA 1YSCA 2GFIA 1V39A 4TTJA 1G8PA 5EMLA 3OCJA 5LDDC 1TK9A 2GPYA 3K35A 3PTLA 2PRSA 3ITKA 4X66B 1V8BA 1WCXA 3ZDXB 3O8RA 1USWA 4DMHA 2O7VA 1QV9A 3C39A 4UMVA 4XUDA 4FIDA 5BYJA 4MW7A 5IAEA 3SX4A 1CB7A 3UF0A 4Z1OA 4PY2A 4DSAA 1S2LA 1P4JA 4EYSA 5DHSA 1UMDB 1WDWB 4MR7B 5IMBA 1XEXA 2JGDA 1UFRA 1MC1A 1ULHA 2Q6OA 2ADOA 2ZT6A 3UCEA 3PRKE 3SJBA 4RX1A 5H68A 3ANSA 4IYJA 2LKCA 5KJ1A 1HKHA 4BS9A 3GL9A 1XZQA 1JN0A 4P4SA 1O8BA 3O73A 3UJ7A 3A6GA 4MUXA 3RSCA 1KIAA 1XKLA 5J2TB 3IX7A 1V8OA 3DC2A 2QAGA 1O6FA 5JSKA 2ZTLA 3IQDB 1OLUA 2Z43A 1V95A 4BNKA 2SHKA 1WMDA 2BGJA 1MN6A 2BUAA 3ESQA 1JNXX 1PLKA 4JT4A 1J99A 4FFDA 4QVGA 2IGTA 5FKJA 2HV9A 4ZVMA 4QYIA 2YXBA 3QKUA 1GFZA 2FZ4A 1CV2A 1JG1A 4AZVA 1SD1A 3UV3A 4RY2A 1YRBA 2PX4A 2PYDA 1B8VA 3AHIA 3KE8A 1UBMS 1CVLA 2NXWA 1BU8A 5CFZA 4RH3A 3TTSA 3UJBA 4MYHA 4H1HA 4FS8A 3ZQ4A 3UA3A 3P2OA 2I76A 3STXA 3ZHUA 4BMYA 3G23A 3DDUA 4UMFA 2FAXA 1WHSB 4K9NA 3GLVA 2QVLA 4RY8A 4XGIA 1KSHA 2AEEA 4MR8B 4CQMD 5L9AA 4BTLA 2CUKA 2B36A 4YMHA 1PFUA 4YAOA 1PJZA 3AR2A 3I6BA 4J9VA 4R1QA 4Y3UA 1WV0A 3G2HA 1A2KC 3C6XA 4RL4A 2GHQA 1UT5A 1JA1A 2XITA 2RK3A 3KHUA 3GFGA 4PPNA 4ZREA 2PUEA 2B92A 9ATCA 1AVTA 1SVNA 4KQGA 4GS5A 3G8DA 3TGLA 1QQTA 1G20A 2NNWB 3UJ8A 2ZUVA 1I3CA 5KOIA 5EPUA 4Z4CA 4BMPB 1UUFA 3FCEA 4CIXA 1RW4A 2XNKA 5FEMA 3DVQX 2G08A 4W5NA 1CRWG 1ZW6A 4JJ4A 5DI3B 5KNBA 3DCNA 5TEWA 3RU3A 4K0KB 4WZAE 4LDZA 1NQWA 2HSEA 2IZOA 2R68A 2VP3A 4NYMR 2JLUA 4A82A 2XUFA 3C3DA 2I1VB 3E15A 3R6WA 1ZRHA 1WPGA 4NDNE 1SXPA 5DI3A 3RAJA 2O2YA 1C2YA 3WLHA 3SQMA 2PSJA 3IMFA 1VPVA 1SVUA 4OFZA 3L2OB 3Q5GA 5ALYA 1VRWA 4LUCA 3TEJA 3LLSA 3ND6A 2V6IA 1SBTA 1TCCA 2WSMA 3O91A 4XAQA 4MJLA 3MWLA 2XNCA 5TPWA 1ATIA 3UXMA 3JRXA 3V8EA 2PUVA 3VYVA 3SFZA 2PKEA 3DMTA 1XB2A 1O95C 3A27A 3TGPA 4NAHA 4LHXA 3N6VA 2PIDA 1ZUIA 3E61A 5E4TA 3RHZA 1UDXA 4J4TA 2GKOA 1GILA 2VAPA 4ID3A 3VTAA 5KNLA 4URXR 1P44A 2B94A 2PGDA 1OU0A 2C5AA 2CJPA 2RGDA 1C9NA 3KVYA 3LXXA 3R77A 1Y1QA 1JSXA 3CEPB 1R6XA 4IS2A 2VK4A 3R5FA 4BMCA 3N8GA 3HP7A 3HY6A 3A2NA 3KQNA 3VSDA 1T9KA 1TZKA 1X6VA 1U3VA 4ZOAA 4XVQA 3NJ4A 1DV1A 3AUJB 2CFCA 3PSAA 4OSPA 3FNIA 1UZMA 2E37A 1TD9A 4PLTA 3DAYA 5AK5A 5TQ2B 4EB8A 2VQ6A 1X7ZB 3TQQA 1CY7A 3OCZA 4U8HA 5JEEA 1P62B 4RKFA 4M8NE 1UJ4A 4RV5A 1U6JA 1QYXA 2B1GA 3U3OA 4B3RB 3SCZA 4QZVA 2JRCA 3T3IA 1Y6QA 2UYGA 4BWVA 3U19A 1XT6A 1OXBB 1OAOA 2NXEA 3P26A 2W71A 1TJ5A 3N0RA 1DIBA 1GPLA 4MSUA 3GOHA 4RKEA 3REGA 4ERNA 4DM7A 2MDTA 2BHSA 1RWBA 2P2YA 3O74A 1GSIA 4MV6A 1B3RA 2CXQA 3SJZA 1U8YA 3I6IA 4RXUA 4EKNB 1SM4A 5AFSA 1E6CA 1MOPA 3GLFB 2O1SA 3TB6A 3Q8XB 3LIPA 3ZU2A 5CA1F 5KKNB 1FX0B 1XZJA 4AK9A 1WULS 2FKAA 3MJEA 1R4NB 1ZJYA 5DLYA 1RDFA 3OD1A 2VTBB 4A0HA 1ELOA 3TLAA 2MINB 1PQPA 2QOEA 4JLBA 5AK3A 4EG7A 3C3BA 2HY7A 2ZI3A 4NOJA 4OOEA 4PGHA 3RW9A 4D97A 4DLLA 3GLRA 4F1WA 1ZIDA 1EVKA 1KI4A 1NDHA 2DUJA 1GNLA 2B30A 2QRMA 2WZBA 3EGDB 4NMLA 3S5UA 2ZXUA 5DXFA 3T94A 2HPAA 4JBLA 3QWHA 4OL0A 1QZXA 1ZUD1 1PBNA 1QIDA 2OBYA 2ZZKA 4J6FA 2OHJA 2Y71A 3FVQA 4OAPA 1TMOA 5JVDB 1LS1A 3ILVA 1MFPA 1ZHHA 1GGEA 4JLAA 4Y1RA 4YDRA 1U3CA 2BDTA 3BRWA 2VHTA 1UF9A 4FNOA 4LJ8A 4RF2A 2A4KA 1YQWA 1GZSA 4YJFA 1H4TA 3GF4A 1OH8A 5JXGA 2B61A 1PT7A 3N7AA 4RK6A 1D1QA 4JA2A 4Q4CA 1TEHA 3JWIA 3TYXA 3EYAA 1EX9A 2V0CA 1G19A 1AGXA 4FD2A 2I87A 3DXZA 3OCVA 3KZXA 4WKCA 2ZR8A 4BYMA 1W9HA 3TM5A 1F17A 4L4YA 4RESA 2QN1A 2YY7A 1GCAA 2ZJ2A 3BG5A 2YJ3A 3CPSA 4MVJE 5BMVB 1M5TA 4XSGA 2ZJ7A 3O03A 5HX7A 5JXWA 1O5IA 4LZPA 4JWTA 4HDCA 1SU7A 4DSOA 5FBHA 2YVUA 3DYBA 3LRTA 5BR4A 1SU4A 5DISB 1G8YA 3O94A 4V02A 2H2DA 3LUBA 1TOAA 1TW3A 4B40A 1A7UA 2P4EA 2OXEA 3LCMA 4XJVA 1ZD1A 3PGJA 5KINB 2O4CA 3CZCA 4E5YA 3PVZA 4BEVA 3RKRA 2IYFA 3T4XA 4WCDA 5JRZA 3GIWA 4CMHA 4RF4A 4L0QA 2V7PA 3OCUA 1Z2NX 1VCIA 5TARA 5EJ2A 1KJQA 3U7EB 1Z82A 2BEJA 3WL8A 2PZ8A 4MQEB 4RKQA 3R9KA 4A73A 1F5SA 3EHDA 1KETA 3GLGA 2FMTA 4OUKX 4Y2RA 3KUCA 1IUPA 3I42A 4NMXB 2C88A 4JI5B 3ZWOA 1V26A 5C7LO 3WIOA 3ZY3A 3MMNA 1TADA 1OFUA 1VIMA 5HIMA 3X1XA 1EWYA 5J4KA 1ORDA 3RRZA 1YR7A 4B9EA 4D45A 4PX5A 1TEZA 5KPDA 3KIPA 4YIHA 1NURA 1N9GA 3FNHA 5DHAA 1BJRE 3TW4A 3NALA 3DTNA 4TRJA 4PYJA 2HMVA 4IDBA 5CURA 3ZI4A 1B23P 3U4IA 2QD1A 4BZPA 3MIZA 1A7JA 3B3AA 4XPIB 3AYXB 3T7TA 2OQIA 5CDFE 4DUZB 4BGEA 1DDGA 5DCUA 1NW9B 3LT0A 1QE0A 3OPMA 3RVRA 4YRBA 5EIOA 1R0KA 1T36A 2EJCA 1TM3E 3QVTA 1XEWX 3LPDA 4EYOA 3JQPA 2ZR9A 2ZIEA 1DT5A 5FH9A 1B00A 5A3VA 1M8KA 5KNCD 2BRUC 4HLNA 1E3WA 1YRLA 3PIRA 3NR2A 1GPMA 2ZAMA 5EKTA 1KA9H 5CBPA 2AI2A 2FPUA 2H17A 3IO5A 2YRFA 4RIGA 4TT3D 3THWA 3RVPA 4KQJA 1IMJA 2JIQA 4TZKA 5J5CA 4BRUA 3I4FA 2CUZA 1A95A 1Q7GA 4YRDA 4FYYA 1Z6YA 5EWJA 3W5HA 2VH2A 4KG7A 1RQRA 3IIIA 1P7VA 2AVNA 1GEEA 2E4WA 3PE4A 1UZAA 5JV5A 4B5KA 1CF4A 3DZGA 3V32A 3U4AA 2Z1MA 4KR2A 5D3MB 5JC1A 7AT1A 5IXJA 3FHCB 1S6YA 2BRUA 4JB8A 3ASZA 4BUCA 3CA8A 1IG3A 5HMLA 3M5WA 2V98A 1BHQ1 3Q3JB 4H18A 2GBFA 3VNUA 4KLCA 2AF4C 4DIOA 2QGZA 2ZQYA 4O8ZA 5EYPB 1V4NA 3G9QA 3TTYA 4WV3A 3S81A 1G5QA 3C0KA 1JR3D 1MTOA 2KQUA 3B20A 4QXRA 3QWIA 4I3FA 5C1BA 1Y7LA 1NULA 3SQLA 1CEYA 1NI5A 4LJRA 2QD3A 2OGZA 3LOPA 4ENPA 2IH5A 5BN3B 3ZCTA 3TPFA 1W9MA 2HUNA 1CEQA 1P1HA 2P5TB 2YUIA 3AEUB 2C2ZA 3HYNA 3QVOA 2C2BA 2QTGA 1OWLA 4HQ6A 4XOIA 3RYCB 3T0FA 2HX1A 1NKTA 3R2JA 2OD7A 3F90A 3I6MA 3S27A 4EWLA 3I8SA 3PFKA 2IUUA 1DEAA 5FULA 4J1TA 4X1YA 2VA9A 3S29A 1JVNA 4FXOA 1QQAA 5JH7A 1ZGHA 4P33A 3BREA 1MX1A 1E32A 3PK0A 1PZGA 4GL4A 3DOIA 4CQLA 4CQNA 1OZHA 5SY4A 1DDOA 1TYBE 1JH8A 2BE9A 3PGLA 2ZYAA 1BXGA 4IINA 1KSFX 4X8HA 4DF3A 4I5DA 3KQWA 1V0JA 5DFAA 1RRPA 1W87A 3EDMA 1S02A 3KKOA 1RZVA 4EGFA 1S0UA 1WNFA 3H9CA 3PFBA 2XWBF 2QBYA 2GO1A 4MV3A 5GVRA 1EP3B 1H0KA 1T8PA 2VYQA 4WOCA 4F06A 1GL7A 1P9OA 1GNPA 3QX8A 4PO9A 1J06A 4LMRA 4N7JA 5LUAA 2BFFA 3IV6A 2WIGA 4TKVB 1WVIA 4LGYA 4X7BA 5EZYA 8GPBA 3H1BA 2YIDA 2EWVA 2R86A 3G2JA 8AT1A 3SI7A 3GRAA 3PRJA 3AFIA 3TXYA 4HVLA 4CIWA 4MVWA 5I7EA 1Q0RA 4CXMA 2EFGA 2VKTA 1DG3A 1SOUA 2OAQ1 1PJ8A 3KYIB 4HH3C 5F1PA 1VLJA 1KDOA 3PUVA 1L3IA 1XTZA 1ISHA 2QMUA 3GFVA 3PQ4A 4IGAA 1S4MA 4JYPA 3VJKA 1RKBA 1BC5A 1AY0A 4RTKA 4AKIA 2JJ1A 1UP4A 2NP7A 4UTRA 1SZDA 3B5IA 3SZOA 4UD6A 1N6RA 1I7PA 2XW6A 3AESB 3ANYB 1NNEA 2ETXA 3KQPA 1NF8A 4RTPA 2EAUA 3ZUPA 5AHKA 3L8FA 1WXQA 5C1OA 1V5WA 3RSGA 4RZUA 4KBYA 2Z6UA 3PKIA 3WGVA 4CR7A 1IB6A 1SBCA 4HDSB 2PGJA 4UU8A 4G86A 2PRJA 2C5HA 2XWPA 3AM4A 2I7TA 3ASYA 1CUAA 2FLVA 1P77A 1CQZA 3EMVA 4ZT5A 1FOEB 5LQSA 3EY9A 3V42A 3ZWNA 3D3KA 1ISSA 2FF5A 3QW4B 4F4JA 3STYA 2ZBEA 5COAA 2FFAA 3FMGA 2IYUA 1C0EA 4HOYA 1J0AA 2B8JA 3D6HA 4J4BA 5IANA 2JIOA 1ZRSA 4MI3A 4D2IA 4AO6A 4V0RA 2J5BA 3A0RB 3FFBA 4LQ4A 2NMVA 3O2JA 2KHZA 3VA7A 1TF2A 2ECQA 1C41A 1PX0A 2Q0XA 3PL1A 2I4IA 1SULA 3KHTA 4LGMA 5KOJA 1SKUA 2GASA 1V4BA 3X2FA 5JT1A 3WE7A 4Y6SA 3CKLA 4DTCA 1KKMA 4HJXA 4JI2B 2R97A 1U0SY 3DV9A 4J0IA 3EXHA 3KK0A 5EIHA 3OBBA 1FJGB 1TJPB 2H2WA 2AZXA 3QBVA 1LSUA 3NRCA 5CIWA 4AD8A 5FAKA 2C3YA 1YS9A 3IKTA 1O0CA 1G2QA 3WL5A 2IHJA 2XBMA 2RONA 5HYVA 4L74A 4MGEA 5JTTA 5JZVA 1L5ZA 4IBOA 4RFSA 1H6BA 1Z6AA 2EX0A 1HQDA 2TYSB 4HXYA 4M8IA 1HE4A 2QYOA 2RGNC 4H1UA 2CV0A 3LBFA 5C9ZA 2V4UA 5K5EA 3EXG2 1IWBB 4M6WA 3RSHA 1BYIA 5AUOB 4BLPA 1A8SA 4FGLA 4J6EA 2J67A 1FS4A 2MT9A 5A06A 2ENUA 5IN5A 1B1CA 3SLGA 5C3MA 1K0FA 3JAKB 5I5EA 3QOWA 1KU0A 1Y4DE 4GKAA 3PIIA 2OXFA 4H15A 4IMJB 4EGSA 3OQIB 3G2PA 1K6XA 5KYUB 2XBUA 3VI4B 1J21A 2O0HA 2WSSD 4YB8A 4BBPA 3M7IA 4DMRA 3ZXUB 1ZQ1A 2A88A 4DV6B 4RGVA 2GVNA 1EA7A 2A78A 1UXOA 4KE6A 2DKNA 3GAAA 1VI2A 3ICEA 1ZN7A 4FMCF 4EG3A 4P3KA 3AG6A 2XNDA 1JDTA 3OMWA 4E2WA 1FPQA 3FTQA 3WYGA 1ZN2A 3H2SA 5ALQA 1N2ZA 2GJ8A 5DM70 3X1WA 2OM6A 4YBRA 3HB7A 5B12A 4OMDA 1T4DA 3DBHA 2BTQB 2EQBA 4R3WA 2HMSA 2PX2A 2GDJA 4UUAA 3SOPA 5JZBA 4JBYA 1P33A 3ENKA 5BSEA 1E66A 4J0JA 3P71T 3S1SA 2AX3A 4PC1A 1T8UA 4IV0A 5EWMB 2XE4A 4F5EA 2W6IA 2ZRPA 3NOVA 3O7MA 4I5GA 2YV5A 4U7GA 5MGBA 1L4EA 1LJ8A 3NYIA 4FQ7A 2ID8A 1KBZA 2PV0A 2A35A 4R1UA 1YK1A 4UDYX 3TRIA 3ZVMA 3HNPA 4BNLA 3MRTA 3SZRA 5IWCA 3FTDA 1LPOA 1PBTA 1T8YA 3K4QA 1Q77A 1B6RA 4HEJA 4ZVPA 3VR5A 4BP8A 5JWOA 3V9PA 3LP6A 5F2NA 2OKGA 3P0EA 1HX7A 5EXTA 2ZXEA 4I08A 2P6UA 1CLUA 3D6AA 3LLVA 4FZ3A 5E1DA 1G41A 4B3DA 1A50B 5B7PA 3IALA 1MORA 2ZAIA 2HA6A 3K0KA 2P41A 5FP0A 3O47A 3JPYA 1ZGCA 3OCCA 4DBLC 4WBNF 2CFIA 5K09A 4G8JA 2DKFA 2HU2A 3MTIA 3NKFA 1GUBA 4IQ0A 4WIAA 1PT5A 1DWQA 1DBSA 1ZL2A 3B1FA 1YF3A 1ZVKA 3Q9NA 3T7RA 1C3XA 2PJZA 1NMZA 3OUTA 5BN4A 5HG0A 4H0FA 4LDPA 5KYVA 1PUJA 5A3RA 2UVPB 5B37A 1V6SA 4NJMA 3IPYA 4BRSA 2PAFA 4INZA 5DW0A 1N6PA 1NZJA 2AKAB 5LLTA 1DC6A 1T24A 3PP8A 5IMSA 4G8DA 1U5BA 2QMZA 3CSDA 1XZMA 3LGAA 3A2KA 2NP6A 1XU7A 3WR5A 4PQEA 4ZAWA 2I7CA 5ALTA 1JG6A 1X7ZA 1YE8A 1DOHA 3W3AH 4XLLA 1X7HA 4FOTA 4N3GA 5LZ4A 4W8HA 3EVNA 3ZOKA 3V1NA 4LZNA 1GHTA 1I7LA 2BT4A 2FG7C 3SF0A 2WBLC 5J5VA 4GI5A 1Q15A 1RR6A 2WI8A 5EFOA 2NQ2C 2ZTUA 3OESA 4E3ZA 1QFYA 5AICA 1NJ8A 4TXLA 3SF8A 3ZDDA 3USZA 1T8SA 2CDCA 1ZNZA 3VHLB 3SNHA 2A1TS 1A72A 4LHEA 4CL3A 4S0XA 3OE7A 4LI3X 3DNFA 3F8TA 5DYIA 1CQPA 5IUNC 1G6OA 1NF2A 1H5NA 2GCNA 4JOBA 4UCFA 3RRBA 2ZJ3A 3K6KA 3T5AA 1KYYA 1F9AA 1T1GA 2I2CA 3KOUA 5ISMA 5TPWB 3P0HA 2IV3A 1E9VA 4HH0A 1VIDA 5CYOA 4MX8A 2FHPA 3BVPA 3OFNA 4Q9LA 5K3EA 4E5VA 3QBEA 1G5HA 4WQMA 3D8TA 3KTFA 4PTLA 4WACA 2QTLA 1EVJA 2DHQA 4O4LF 3OBIA 5JAOA 3CYFA 3LE8A 1DAMA 4CMAA 3N07A 3EZNA 3KBOA 5P21A 2VWQA 1G16A 1LVGA 2CE2X 4NFHA 2CBGA 2ZJYA 3IEKA 4BKUA 2P3OA 1PDVA 2IP1A 1M83A 4MVJF 4RQUA 4TVOA 1U2DA 2D3WA 2QUAA 1AKWA 5TF0A 2FEMA 2HNBA 2OZKA 1QZUA 4J16A 3KL4A 2ZUTA 5C5DA 5JALA 1XHEA 4GF5A 13PKA 4HWOA 1DIOB 2HM7A 1DAEA 3AOEC 3DDZX 3A9WA 4R6XA 2RC5A 3M6FA 3L01A 2P1DA 3MTEA 1E9SA 3WGLA 2DBRA 1JDZA 1T5HX 3OTWA 4N8EA 4AIRA 4LTDA 4DNXA 4RV4A 2AZTA 1S8NA 1XO1A 2A1UB 1LBEA 1Z4MA 2YY6A 3NORA 3QOYA 1KOLA 2QLMA 3T1VA 3GMSA 4W9NC 4A6PA 4FB4A 2O54A 1PAUA 1KFBB 5HS4A 1XNJA 4JBWA 4RFLA 1JFSA 2P2GA 4XX1A 2Y8EA 2ERXA 1WMAA 3UFBA 3I62A 1H0HA 3AP1A 3WS7A 3KETA 4Q4DA 4OGGA 3X1MA 1U2ZA 1I6WA 2BFOA 3RAGA 3N2KA 3E5NA 1E7MA 1JLRA 1DWOA 2WPDD 2JKVA 2XAUA 1U2QA 1A5AB 1WEKA 1YCGA 1G3RA 3KJHA 1QS0A 3P0JA 4Q16A 3CEHA 4PLFA 1KS2A 3JZDA 4PGGA 1Z2DA 1UKVY 5CT5A 1N6LA 1I1NA 3A4TA 1IK6A 3OCWA 1HYGA 5DGHA 5K0ZA 4K1LA 2KI5A 1U0OC 4FP9A 1S2MA 1W85A 3ZS9A 2WWHA 4J03A 2VZ8A 4MVJG 1OMOA 2G04A 1EZZA 4NIMA 2AH5A 4HYTA 4ZRDA 3VR2D 4DYHA 1EEHA 1R9GA 4HB3A 5K8IA 3DO5A 1G8GA 3KOXA 4D57A 1L7MA 1P31A 2QE7A 2W48A 2OV6A 1EK5A 1TT7A 3PFCA 2UXDB 5GGYA 2W2LD 4TPKA 5EKUA 2BGMA 1FP4A 4N5IX 5I9LA 4C9BA 3PA6A 1BKDR 3STHA 3ZLBA 1X1TA 4NS4A 1AV7A 2NZJA 3ECAA 2X6QA 3GJ4A 1J70A 3I92A 4Q24A 5HS6A 4KRYA 3VC3A 1QHSA 2VF2A 4CLXA 1ZVVA 1FBNA 2BBOA 2ZWMA 5ADUS 4C5CA 1T5DX 4I9GA 1V2GA 5BQ3A 4BKMA 3GRFA 5I7UA 4TYMA 4TZTA 1Z4IA 3RKSA 4ISCA 2HRBA 3M83A 1DEHA 3KOWA 2ZIGA 2R7KA 1I33A 4FN4A 4WL0A 4FZVA 4PZ0A 4DPKA 1P1KA 3LX5A 2WFZA 2R3SA 3TLKA 1E5QA 1QF6A 2H6EA 2N42A 4IQ4A 1PFVA 3LKBA 1Q2XA 4G36A 4PLPA 1B41A 3AXSA 4OKIA 3KSMA 2WAOA 3A58B 2BCJQ 2WG1A 3FI0A 3UT5A 1BA3A 5AHXA 1ISMA 2RC6A 1J2EA 4ZOCA 4KOAA 2CDNA 3UAZA 1RLTA 1VKNA 2ECFA 2YNMC 3K2EA 3GOQA 3G6WA 1LDEA 1LI7A 1K98A 5C53B 4OXNA 1NPTO 4IILA 2HHAA 3ISTA 3LXRA 1FUEA 1RHKA 4ROSA 2VUIB 2H4XA 2IHZA 3IS3A 3MPOA 5CLFA 4BLRA 4WDRA 1ISRA 3C2QA 4UBKA 1EVQA 4NZYA 3ZGLA 1NVXQ 3ILSA 1Q12A 3DAFA 4GXRA 3X1JA 1D4FA 4EZBA 2YWBA 1WUHS 4KO8A 4KQ1A 2DPLA 4WGGA 3VPCA 3P9NA 3PXGA 3ME5A 1JDPA 1VHLA 2WILA 3EXHC 4RHCA 4FCCA 4GWLA 5AKJA 2WUEA 4O6VA 4P8RA 3U26A 1JDBC 4O4JA 5E6SB 2Z1DA 5DW3A 1I6LA 2VSOA 1II9A 2XXJA 1JFFA 2ZUWA 1NP7A 4OG2A 4RUKA 4B32A 4N5LA 1JF8A 2R7MA 4K26A 1CZKA 2QP3A 2ZDGA 3AEXA 5F76A 4ECEA 3ZIAD 4CPDA 3Q88A 3KKLA 5DNYB 1GTRA 1QU2A 1P0PA 4LF6B 2PS3A 5HIIA 3E27A 3FPEA 4ARSA 2PGIA 3S40A 4WOBA 1AM4D 5LZ7A 3STWA 1EX6A 4DA9A 3W2HA 2C00A 5T57A 5AI6A 3RBZA 3T3MB 3UQZA 3D31A 1K3TA 4WWHA 1H2FA 1B8PA 3AHFA 3ZWAA 1TJYA 5ALHA 4FFLA 4KJXA 2CY0A 1NT2A 5C34B 2I7DA 1A9OA 4PCLA 3OTGA 1HG1A 3UTCA 4KO2S 1M2FA 1ESZA 4L6AA 4XLTA 2HIMA 1PHPA 4G9BA 4YLEA 5K2MA 4AJ1A 4JI0B 3JR7A 4MQEA 3OEED 4WKNA 3MOSA 3MWEB 1M74A 4ZGWA 4XWAA 2HMTA 5BSGA 2XWQA 1VLLA 5ALMA 2WVHA 4OHCA 2HLPA 4MCIA 5F52A 3FETA 1KKUA 3JALA 2JFVA 3KJEA 3HCCA 5JVDF 3GA7A 2GLUA 3A8TA 4EPVA 3FYTA 4BLVA 3UAYA 1NUUA 1U1GA 4RYDA 3P8ZA 2UXCB 3NIFB 4KKXB 4YDQA 2QQGA 1FDTA 2XSZA 5KS2A 5TVKA 4ARCA 4JI6B 1GDTA 2DQ4A 1YZHA 1USVA 2WPDA 4PS0A 1C3OB 4TX1A 2BGTA 1H4QA 5SY6A 1BO6A 2DUWA 2H1IA 3B1XA 5CU7A 3WLKX 3KAKA 4XPIA 2XVYA 5ITVA 2JARA 4JQCA 2XKKA 1FXUA 1GUYA 1KC3A 1R5BA 2I2FA 4HDSA 4Q66C 1ABFA 4RD4A 1QV7A 1SU6A 2IDZA 1RMQA 3REOA 3W90A 2P78A 1EFVA 4HAZA 1EFDN 4MJ7A 3DW1X 4BQOA 1JAYA 1JNYA 3GZTB 1U11A 3O93A 3QU7A 1RM3A 4O2AF 1L7NA 1XLWA 2C83A 3OZRA 4HEA6 4PX9A 4ER5A 2HWWA 3A1SA 3A1VA 2A33A 4P36A 1L4YA 1KJJA 2K87A 1EE1A 3JVDA 4RMGA 3TSCA 1WF6A 1TMGE 1Y33E 3O3MB 1GZ3A 4KNWA 5JAMA 4EA8A 2CNDA 2O20A 4YIKA 1KK3A 2AWNA 4ZVUA 2DPHA 4V1CB 1OFHA 4KSYA 3VISA 1YZ3A 2MU1A 4PINA 1E99A 4Q00A 1BE6A 1PR1A 2C8VA 4J1TC 2IV2X 4EVIA 2ZUEA 3AR3A 2ROQA 1P2DA 2L69A 3PJDA 1QBKC 1UAYA 4KVFA 4M1EA 3SHQA 4A0QA 4HLDA 2R4QA 2BMJA 5C5CA 1TAHA 2W0SA 4RANA 2F62A 5HQ3A 1OTXA 1NW8A 1V5FA 5DTJA 4JXXA 2QBYB 4NENA 4NCKA 3UG7A 3GMIA 4ASUA 5FWXB 3THRA 1G21B 3WMXA 3BRSA 4OPMA 5B2FA 7REQA 1SOVA 3QEMA 5ALIA 1X14A 4G8BA 3SYKA 1A4UA 1ISGA 4WECA 1UQRA 4KXMA 4JI3B 4LYDA 1XP5A 4QPJC 3P45A 1IPEA 3DCJA 1FSFA 2NPIA 2QVXX 3UMYA 1UK7A 3AY7A 5E0KB 1EQUA 4LQLA 3REQA 4JKYA 4S1NA 1NUQA 3BFKA 3IILA 4WA7A 4D9BA 4RCVA 4MYSA 2BKXA 3GARA 4BHTA 4MIEA 3BWXA 3LCJA 3AM5A 1STOA 3H04A 1HT1E 2ZUFA 4P34A 3IPAA 1PW5A 1P4AA 1W2HA 2Y1GA 2Y1FA 3FXAA 5FA8A 2PSDA 2PRIA 1TKBA 3H2IA 4LJ9A 4JGGA 1GZHB 4XWYA 2H4HA 4LEIA 1CB0A 2HIGA 4TMTA 4DDMA 4DLBA 4W6QA 3VKWA 3UJNA 4C5AA 1E1QA 4PYOA 3KQLA 3HEBA 4O1HA 3FGZA 2NO6A 4HLUA 1SR8A 1N0HA 1P2GA 3CWCA 2YCLA 3E1GA 3F4KA 2D5LA 4IXDA 4WXRA 1HORA 3D3QA 4B6OA 4EYQA 5MDHA 5KI6A 2G09A 2WF7A 1BKYA 1DQRA 5ER6A 3SU8A 2JEOA 3P4XA 3BD6A 3FCUB 4FYJA 3HKDB 2I5PO 3QE0A 4DIKA 3WY9A 1H2YA 3H0KA 2ZIWB 4HADA 2XUQA 1GXSA 2IXAA 3B5EA 4E6EA 3H5WA 3M1LA 3QOXA 2FWMX 2HLDA 5E7QA 4PRLA 4LYYA 1ECCA 4KAFA 3RR2A 3K30A 2Z2KA 4J75A 4JKIA 4LKRA 4IKEA 3F73A 2JC3A 5CVVA 3U9SA 1NYLA 3LWNA 4JXJA 4EUEA 4R2KA 1M66A 3DAPA 4FHZA 4HWKA 2HK6A 2LR0A 4R0MA 3UPTA 1H0SA 3FH0A 1EHYA 1FYFA 3D7SA 3OEEA 3PGXA 3BN3A 4JLDA 5ERGB 4DV0B 2VZ9A 3R3VA 4BP9A 4J43A 3WRXC 2M1ZA 3OQBA 4A8TA 3I2FA 1YBFA 2GERA 5K8UA 4QECA 5LU9A 1UDCA 3AIMA 4MUNA 3DXYA 2DWUA 2HB6A 3QVGA 4LY9A 4FYVA 1IUKA 4Q7JB 1P2FA 4ISBA 3MCZA 3B6MA 1JXQA 2AYYA 1DRJA 1XDBA 3M34A 2G9NA 4KDFA 3LLCA 1K86A 1G7CA 3P94A 3R5HA 4MS1B 4AM8A 3NFYA 2BR5A 2IHBA 5AOVA 5FUQA 2AK2A 1KEEB 2NVOA 2ZGVA 4MKGA 3IPRA 2I8LA 4EPYA 2JD2A 5DULA 4GX0A 1G9TA 5EKXA 4UQLA 4TVSA 5DOZA 1FP6A 1HDEA 1PL8A 4ER3A 1SZPA 5LB2A 4GC9A 1Y5MA 2X13A 5BNTA 4J0FA 5LQNA 3D5QA 1ZIXA 4R5MA 4DA7A 1IXRC 1GKKA 1ECGA 3LYUA 1DXOA 2PX0A 3D7RA 5HFNA 3H2GA 4KXLA 4XIJA 2HGSA 5F23A 1D6MA 1QVAA 4Z7QB 1P5FA 4DSNA 1MW9X 2WD7B 5I9TA 1VLMA 4UVGA 2IYYA 3DHWC 1CQJB 1VI6A 3FCOA 4LCJA 5AVOA 4NFYA 1HYQA 2N9UA 4Y1GA 3G2OA 4D4GA 5B6JA 4MRAA 1M67A 2C04A 1KYWA 2H1SA 3PEYA 1K4YA 3TZEA 2HJRA 2PD3A 3M5DA 3BAFA 4QAJA 2ZEJA 2ST1A 5L53A 4DMMA 3OOHA 3LZDA 1U5BB 3R20A 4XWKA 1P74A 3QV1A 2ES4A 5D1HA 2B5WA 3WL4A 1Z25A 1KE1A 5DBIA 1EQAA 2JAXA 3ACBA 5G2OA 2QORA 2RD2A 1BA2A 1NMEA 1W30A 3PEFA 5AI9A 2QM3A 4UFOA 5FNVF 3TVTA 2GM4A 1KY4A 3ZLUA 2QHXA 4JJZA 1XPJA 4GI7A 5LKRA 1ZHFA 3GNLA 2MJLA 3E9DA 2ZULA 1RXVA 2O8CA 1PNOA 3R0IA 4MDFA 1NIPA 1U3WA 1EP2B 1HSOA 3BDIA 4H4DA 3B36A 4QFDA 3GLGE 1Z34A 4QNNA 4RM3A 2VZ0A 4IXNA 5FUWA 2YIMA 1ONSA 3FPLA 2YVQA 2BR3A 1I4OA 3RDPA 1U28A 4AY5A 2WAXA 3VNBA 2JFNA 2F3QA 5GZ1A 2V1UA 4MEAA 3AUYA 5BVGA 3FF4A 2RCNA 3VUEA 1GPDG 4O4JB 4LJ4A 4EKIA 4RIHA 1K5PA 2PZEA 4C7VA 2FPIB 4DBVO 1MX5A 3L0IB 4YJKA 5ED0A 2Z9DA 3PTZA 3TTTA 2C9MA 4X7MA 4TL8A 2RGRA 5ALGA 3PPVA 3VDRA 2P1RA 1FXWA 1ICIA 3A2MA 2O0LA 2QY6A 4AROA 1WZ2A 3OSZA 1IN8A 5WRFA 1MAWA 3I5XA 1SCDA 2XOEA 2KW5A 3JQGA 2WF8A 1LTHR 4S1WA 4BB0A 3TMAA 4JSTA 1X7DA 1K6MA 1QM5A 2PKRA 1XEFA 1U04A 5AXCA 4BFXA 1G55A 3JATA 4BJ5A 5F2KA 3I9LA 1JDBB 1NXWA 2E48A 1H94A 1YV9A 2AHRA 3AEKB 3OIVA 1QOZA 5IVDA 2Q8PA 2Q41A 3SSOA 1RP7A 1WUKS 5CGQB 4UAJA 4GXNA 5C4GB 1XLUA 4BU0A 2CJWB 3AI2A 1L5GB 1LPAB 4W9MC 1IN6A 1VCOA 4QHSA 4L4ZA 1SELA 1G98A 2LIPA 1NRWA 3BXEA 4DWWA 4QKQA 3DBVO 3JQQA 4LDRA 1H6CA 2E5WA 2QM0A 4UATA 4BVKA 2CYCA 1R8JA 5BN5B 1CJBA 1DU4A 1T9CA 1VYVA 2ZRJA 2HF7A 4L4XA 1Y3CE 4PZUA 2BEWB 2G17A 1Y1KE 3AUXA 3ZWQA 1E20A 1M1YE 3JYNA 5HUJA 3B1WA 1WCYA 2C2WA 2CE7A 3SKYA 3CLUD 3QXJA 2RAPA 2FZCA 2J85A 3QLUA 3OCXA 3W1EA 4U7PB 4E46A 2XXAB 4PR0A 1NF3A 3DMNA 3D54D 1XZPA 3T4UA 5KTKA 1NPYA 4MWBA 1DBVO 2GDZA 3N59A 3UK7A 2IC5A 3KP1A 5HSGA 4K9MA 3TN7A 3DDOA 2JIDA 2NTJA 1QBGA 2JFZA 2BGLA 3FLBA 4FSHA 3CSSA 5NULA 2DH6A 3UHAA 4H6PA 1SBZA 1F2UA 2C7PA 5EIBC 5ALRA 5T6MA 4J3FA 5KU1A 3RHFA 3IBGA 1HDXA 1LQUA 2ZUSA 4WHMA 2FJUA 5AJHA 1FQWA 1FU4A 4X85A 4A8JA 5A5DA 4G97A 3PC6A 2JLSA 5HJEA 1L4FA 2W58A 4C4PA 2G4LA 2Q9BA 2IHUA 4FHFA 4X8MA 5K0SA 4TROA 1KDYA 3OU7A 2ACVA 1OXKB 1FU7A 1PG0A 3IJ5A 2UUCB 1CRZA 3KVRA