2QXTA

Crystal structure analysis of the bacillus subtilis lipase crystallized at ph 4.5
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
179
structure length
179
Chain Sequence
HNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSADMIVMNYLSRLDGARNVQIHGVGHIGLLYSSQVNSLIKEGLNGGGQNTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the remarkable stability of Bacillus subtilis lipase (Lip A) at low pH
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Lipase
total genus 66
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2007-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qxtA00
4G4JA 2Y6VA 3STUA 1T4MA 4DNPA 5LZ9A 3AINA 2VEOA 3KWJA 2K2QB 4Q34A 1C7JA 1XKTA 2GYUA 3G0IA 3STTA 1LLFA 4EBBA 3I2JA 1X2EA 1NU8A 2V96A 3H19A 4QLAA 2H7XA 3BF8A 5CXUA 4X6YA 1W76A 1W75A 2G5TA 3QPAA 4Y2YA 3DD5A 2Z8XA 4XJVA 4H7FA 3GZJA 3O4JA 1K5PA 2HA2A 1RP1A 4GXNA 2BUBA 4Y7DA 3WA7A 1EB9A 1QGED 4Y2SA 4OU5A 4BVKA 4CI9A 4ITVA 3C45A 4Y2RA 4H7JA 4KRXA 4INZA 2PX6A 2C5FA 3VVMA 3L1HA 2PSJA 1ACJA 1XZJA 2XUAA 4KAAA 4XX1A 1QJ4A 4J7AA 5K3BA 4HAIA 3Q0TA 3WMRA 2G63A 2XB6A 4K2AA 4B81A 3FBWA 6YASA 1HQDA 1CUAA 4MQLA 3WKBA 1A7UA 4FLFA 2PUJA 2OCKA 4DM7A 2XE4A 1TRHA 4RE5A 4Y9SA 2WUEA 3HZOA 3I6ZA 3F97A 3IULA 2H9YA 4WJLA 1KEZA 1UK8A 1K8QA 4BCDA 5AKZA 2CMFA 2H7CA 4MJ3A 4J0CA 1YCDA 4F0JA 1O6FA 1TIBA 1FFBA 4IH4A 3CCBA 1JJFA 4LHEA 1G4HA 4BAZA 1E8NA 1NU6A 3ANTA 5CT4A 2FJPA 4QEKA 4EHBA 3DLTA 3VXKA 1FSSA 5LKRA 4B82A 5CBKA 2FX5A 4BAGA 4KAJA 3AIMA 5C8VA 1R50A 3F8SA 3FYUB 1U4NA 3G02A 1GPKA 2VTVA 2XMRA 4UHEA 4BAUA 2Y6UA 3OPMA 3HEAA 1MTZA 3WKCA 3QITA 2J3DA 3W04A 2LIPA 1LZLA 2PKYX 1CUEA 4K6HA 5A6VA 3C43A 2PM8A 2BAGA 1LPAB 1VXOA 4GDMA 2P8SA 1Z68A 1QIDA 1H2ZA 5C8ZA 4ETWA 4AQDA 3G0BA 2GBIA 2JGJA 2B9VA 1J1IA 2XMQA 3R3XA 3GBSA 3H2GA 3KD2A 2C4HA 2ONCA 1O6GA 2G4LA 1TK3A 1MN6A 2QT9A 1UK6A 1BEZA 1E8MA 3OURA 5EGNA 5A7GA 1XZDA 1QE3A 1VKHA 1JFRA 2WUDA 2JIDA 4BTVA 5ALUA 1A8SA 3DDUA 5IVIA 1ZGBA 3O4HA 4OB7A 5CT8A 2WHRA 1K63A 1XZGA 1MU0A 3EIOA 1A8QA 3L1JA 4JUIA 2O7VA 2QS9A 4G9GA 4Q05A 5AP9A 4UHCA 4A5SA 5HQ3A 4FMPA 5ALKA 1E89A 4BP9A 1VA5A 4IO0A 2XMSA 3FLEA 1X70A 2RAUA 1SOMA 3P2MA 5FPQA 3BDIA 4J3JA 3VJKA 1IZ7A 5AM0A 5CXXA 3MUNA 2XUPA 1G5FA 4QDOA 4QDUA 2O2GA 1AKNA 4B7ZA 4LYDA 4FWBA 5FLKA 4B9AA 4BRZA 5HF8A 2J3QA 2I03A 1ZOIA 4X93A 5IH7A 5EIEA 1UK9A 3BF7A 5DLPA 4UPDA 5ALWA 4AMYA 4B9EA 1CLEA 4C89A 5F4ZA 3R3YA 4EY4A 4BZWA 4G4IA 3EQ8A 2HIHA 1EDBA 2DCMA 3BJMA 4WDQA 1TQHA 4J0HA 2VATA 3W9UA 1VOTA 2WJ3A 3M3DA 4X85A 5ALPA 3TJMA 2AJLI 3MGAA 5LP1A 3D2BA 1CUZA 2IIVA 3B3QA 4G8BA 1CVLA 4AMZA 1T2NA 1JU4A 4Y2JA 4I3FA 1VLQA 1JJIA 5K3CA 4H7DA 5AKHA 2WIDA 3RK4A 4DNOA 1WHSA 4CG1A 3ICVA 4X7BA 1NX9A 2JGLA 4G9EA 5JZ9A 3G9TA 4E15A 3KXPA 4P9NA 4ZGBA 2D0DA 1HKHA 4PF1A 4RPCA 4J0KA 1VJ5A 5ALMA 2ZSHA 3HSSA 2HADA 3PICA 3S8YA 2OXEA 1YR2A 3BL8A 5SYNA 4FHZA 1H2WA 5AM1A 3Q8WA 1ODSA 3O9MA 3OM8A 3DYVA 1YA4A 3O4IA 3IUQA 2WG1A 2D5LA 2HRQA 1MPXA 3O9VA 3E1GA 4C01A 4HXEB 1EH5A 4RNCA 1WB5A 4I4CA 5AOCA 3HI4A 5IKXA 4X92A 4FFWA 5CTAA 2V97A 4K6GA 4FNGA 5K3EA 2GZSA 2ZYIA 2I78A 1UOQA 3DJYA 1E3QA 3QVMA 4LXIA 2JF0A 3FCYA 5IVDA 1J2EA 4XVCA 4DMCA 1BE0A 3RM3A 5ALQA 5JD6A 3C6XA 5AH0A 4EZIA 5EIHA 4F60A 3DEAA 1XZLA 3HRHA 4CG3A 5ALXA 3ESCA 3G9XA 4EY6A 4G1FA 4BP8A 4H77A 2XUJA 3QMWA 3IDAA 3HABA 1WB4A 1MX9A 4YX9A 3H2HA 4H18A 3D3NA 1VXRA 4KE6A 5K3FB 3H04A 5HF6A 1E5TA 3FCXA 4MXDA 4UBMA 5T4BA 5DTIA 4LYEA 4BB0A 2EEPA 4HS9A 1N8SA 5AM4A 5AHXA 5DYTA 4OPMA 1ACLA 5ALLA 3I28A 1L7AA 3QPDA 2PBLA 5E4TA 2G5PA 4PW0A 1RYYA 1UK7A 1JU3A 1XZAA 2R8BA 4X91A 3D2CA 1OXMA 2JGEA 4ARAA 4OD0A 4CCWA 2QM0A 4B84A 5LYYA 2ZYSA 3WYDA 3LP5A 4PSCA 4Y2QA 1F8UA 4OB8A 4YPVA 2AJCA 1WHTA 1AZWA 3K2IA 4CIAA 4PSUA 5AK5A 1FFDA 1GZ7A 5K3DA 2ZJ7A 4F21A 1W6RA 4H7IA 3WK8A 3I2KA 4MEAA 3D0KA 2AJBA 3LCRA 5JAOA 4UBIA 1W4LA 2WHPA 3DOIA 2GBFA 4IH9A 3X3HA 5JD5A 4NVRA 2O2IA 1ZI9A 2YH2A 3DOHA 2C7BA 3KWFA 4C88A 4W1QA 5C7YA 1WCYA 1JI3A 5AIBA 3WIBA 4BTLA 3DS8A 2DQZA 2WUFA 2HA6A 3LS2A 4HRYA 2Z3WA 3V9AA 4IQ4A 3I2FA 3ZLUA 3LIIA 1YB7A 5D3KA 1UXOA 2E3JA 2HU5A 4BDSA 3WL7A 4A23A 4X6XA 3G0CA 3WLAA 1M33A 3OG9A 1BU8A 4J0GA 5LZ2A 4CCYB 1IVYA 4DNFA 1CQWA 2HM7A 3TEJA 1QOZA 1CUUA 1UWCA 1XZBA 1ZD3A 1QIKA 1XZIA 3HLKA 4M0EA 2ZJ6A 4RE6A 1N5RA 1S8OA 5JANA 4FDMA 3FVTA 5DYWA 3V1LA 3IA2A 1YB6A 5AKXA 4ROTA 4LKOA 4AXBA 1IUNA 1CUVA 4NZZA 5DYYA 1CUXA 1EVEA 1AGYA 1F0NA 1UFOA 3BJRA 1IZ8A 2HU8A 5LZ5A 2OCGA 2XUKA 1Y37A 4AN0A 1CRLA 4L0CA 5HZGA 1LBTA 4PSDA 4FNMA 1ZD4A 1GGVA 5CRIA 3V1NA 3JWEA 3WK9A 5YASA 4WY8A 2WKWA 2BFNA 2AJ8A 1L7RA 5JALA 2ZSIA 5CT5A 3V48A 2JEZA 4X71A 5FDFA 5C8XA 4EY7A 1TAHA 5FV4A 1N5MA 3ED1A 3WL6A 3HC7A 1U8EA 3H1BA 3QMVA 5EFZA 4C4YA 1R88A 2VT7A 3HXKA 4PV7A 1SC9A 2WQZA 4ZRDA 5AO9A 2QKYA 1MNAA 5AI6A 2XUGA 2ROQA 3G0DA 3R3VA 4UUQA 2JGMA 3AFIA 4L72A 5E2IA 2BGNA 2ZYRA 2HU7A 3A2MA 4N5HX 4DMHA 1OILA 1EHYA 2CZQA 4YK7A 3WKAA 2CBGA 2XLBA 1VZ2A 5EHXA 1IUOA 1GPLA 1UOPA 1ZICA 2I3DA 3R3UA 3L1IA 4J03A 2CB9A 4QWWA 4TVKA 1MJ5A 1CPYA 4WFKA 3W9BA 3BXPA 1WB6A 3F67A 4KYVA 3IUMA 1Y7IA 1ZIYA 4LIPD 4B83A 1HPLA 5EHNA 5AIAA 4ARBA 4FLEA 2X8BA 1ZD2P 5E4YA 1H2XA 1KU6A 3STXA 2ZJFA 1XRRA 5D3ZA 5KWJA 4OU4A 2OGTA 1DU4A 2QUAA 2JGFA 1IMJA 5ALZA 1XKLA 2WM2A 3QM1A 4AZ3A 2JGIA 3GROA 5FXMA 3HYSA 4DSAA 4HVTA 2PPLA 1QIFA 1MNQA 2FJ0A 3E3AA 1PJAA 5ALEA 3F9CA 5DJ5A 2ECFA 4O08A 2XUFA 2V9ZA 5I9IA 2Z3ZA 2BUCA 1C7IA 1XZKA 4FKBA 2GBGA 2GBCA 2V98A 3KOOA 5ESRA 4EB0A 1P0PA 5JASA 4Y2UA 5D7BA 2JGKA 2VA9A 4H35A 4Y2VA 4QDXA 2GYWA 1AQLA 4GEGA 4FBMA 3BE8A 4BDTA 2IITA 4UFNA 3D7RA 2XQIA 1FFEA 5AI9A 3ILSA 4GECA 5JATA 1BS9A 1YAHA 2RGUA 4E46A 3W06A 1DQYA 2VT6A 5JD4A 3U0VA 1RWQA 4KAFA 5CH8A 5AJHA 3T52A 2R11A 3D4LA 1G42A 2RI6A 5SYMA 5JADA 3O0DA 3DCNA 1EXWA 2O7RA 1DT5A 4WCVA 1QONA 1B6GA 3FNBA 4K5QA 5ALHA 3H0CA 1YS2X 3QH4A 1WM1A 2HDWA 1G66A 4QNNA 4HXFB 4KRYA 3CCCA 3I1YA 3FSGD 3WWEA 3WYNA 3IIIA 1QIGA 3I1IA 1ZD5A 2WFLA 5HK8A 1EX9A 1QTIA 4JYPA 5FUMA 2VJDA 2XUHA 2QXUA 1EB8A 1Y7HA 5ALFA 3VVLA 4X97A 1ETHA 1QLWA 1QIIA 4J0DA 2WIFA 4Q3KA 1PFQA 4OYYA 3HJUA 3SWWA 4X90A 3RLIA 4MEBA 4ZV9A 3LLCA 4KE9A 1XZCA 3PI6A 4JNCA 3FOBA 4MQMA 3QZUA 3FAKA 2VAXA 2XQKA 4Y2XA 2QR5A 1CUCA 2O2HA 5A7HA 4UBJA 4BRSA 3C5VA 1XRQA 5EIAA 4UHFA 4U2BA 3ESDA 5HK9A 2CKMA 3ZLTA 4MWTA 3U1TA 1JJBA 4N5IX 3V1KA 3ZWQA 4Q1VA 3RARA 4BZZA 2ORYA 2QJRA 1R3DA 2BCEA 2BGRA 5FPPA 3C6BA 2XUQA 2RIPA 4AZ0A 1DX6A 4Y2TA 3AZOA 2WJ6A 3K9BA 1VA4A 3FVRA 2BJHA 1SCQA 4PO3X 3AIOA 4BYMA 1EI9A 1ZGCA 1P0QA 1VE7A 3I2GA 3A2LA 2JEYA 4QDZA 4KE8A 3FYUA 3KSRA 3QBJA 1XFDA 2J4CA 4HTAA 5AM3A 1Q84A 3QYJA 5CMLA 4ZV7A 5ALYA 1R9NA 1XZMA 3PF8A 1CV2A 2VSQA 3UUFA 2HFKA 1CR6A 4C4XA 3ZLVA 4EUSA 4F5ZA 5CW2A 3UMJA 3HACA 1CUFA 1E66A 2I3ZA 2WHPB 4W63A 1E8DA 5ISMA 4CG2A 1GXSA 4G4GA 2BUAA 3E4DA 3E0XA 1D07A 2OAEA 1LPBB 2OLEA 4WY5A 3WJ1A 3D5EA 4U2CA 4BE4A 2QVBA 5FRDA 5LZ8A 1XRLA 1UKAA 5A2GA 4YASA 3NOXA 2H7YA 3GA7A 3WZLA 5AI4A 2DSNA 2VJCA 4G8DA 1AC5A 1LBSA 1XQYA 4KACA 4OSEA 4UHDA 4U2EA 5HQ3B 4P92A 5BV7A 2RHWA 2EDCA 3I2HA 5BWBA 4H7KA 3BIXA 1OCEA 3ANSA 5T4EA 4AB1A 5DTJA 1C4XA 4DMKA 2IX9A 4P93A 5AKIA 1QZ3A 2OCIA 2DHCA 3R3WA 1CQZA 4EY8A 1GKLA 1JKMA 4UBLA 1HDEA 5CURA 5HF5A 3SK0A 4W1SA 1MAHA 4BCCA 2WTMA 4J0IA 2HA3A 1UKBA 1JT2A 5AOAA 4MWSA 1A88A 3G9UA 5DNUA 3T4UA 1VE6A 2WUGA 3C6YA 5IVKA 4J0JA 2XQGA 5ALSA 5CH3A 4C6HA 2WG2A 3B12A 3DYIA 3WK4A 1QIEA 2PSDA 1HL7A 2PU7A 3LIPA 3VDXA 5LZ7A 2J4FA 3VISA 4D9JA 1QFMA 4GI1A 1BCSA 1ODCA 3AILA 1UZAA 1FFAA 2HA0A 2ES4A 4PNZA 4GW3A 1CUYA 1I6WA 5FP0A 1DWPA 2WHQA 1CUDA 3CN7A 5I7UA 4GLBA 3C87A 1DWOA 2HFJA 4FLMA 1K4YA 3OOSA 4XIIA 3WA6A 2OGZA 2WG0A 2XMZA 2BKLA 4QLOA 2AXEA 4RGYA 4LXHA 1QIJA 3WI7A 3WIOA 3SX4A 2VJBA 4U2FA 4X6UA 4GWLA 3G0GA 4OCZA 3DNMA 4OYLA 2OQVA 5C81A 3D2AA 5HFNA 2DHEA 3RKSA 2X76A 2XUOA 1BROA 2W6CX 1F0PA 5T4HA 2C5GA 5ALDA 4KR0A 3STVA 1QFSA 3R41A 1WPXA 2B20A 1W1IA 4AO7A 4V2IA 1W52X 1UKCA 3C8HA 3WK6A 1ZI8A 2HRRA 4NMWA 3OTQA 1GKKA 4CFSA 3S2ZA 3VJMA 4G5XA 3WL8A 1TCCA 1LZKA 5A7FA 4B80A 1XROA 5HCUA 4OUKX 4UFPA 2FUKA 4HXGA 3I6MA 3IBTA 1GQSA 1F6WA 4QE3A 3A70A 5EHQA 5AKKA 2VF2A 2QUBA 3D59A 1P0IA 1AUOA 4B6GA 1EA5A 3ZPXA 1WOMA 1THGA 2XMCA 2PSHA 1DQZA 1XLWA 2DR0A 4DSZA 4C87A 3F96A 5K3FA 5ALTA 2Z8ZA 4B85A 3O95A 4GBGA 1XLVA 1K6EA 2GYVA 4DGQA 3WWDA 1CUIA 5ALIA 1XRPA 5HKBA 2WLSA 2ZYHA 1ODTC 5I8PA 5ALOA 3G9ZA 1LPOA 4MYDA 2OG1A 1LPSA 3H2JA 4ZREA 3MVEA 1CUGA 1Q0ZA 4MYSA 3W2TA 1DINA 1ISPA 1GPNA 1XZFA 1UT6A 2CEKA 2QXTA 3I6YA 3OC0A 4AX4A 1DX4A 4X94A 3ESAA 3WL5A 2XT0A 5ALGA 1IUPA 5JAPA 2JBWA 5JZSA 3VJLA 1ZI6A 4KEAA 3WKDA 4FTWA 1YS1X 1FJ2A 2VJAA 3DKKA 4NS4A 5BOVA 2ACKA 1Q0RA 1CUSA 3H17A 2Q0XA 4C4ZA 1CUJA 1LPNA 3PF9A 1EDDA 3DKRA 2WU4A 2DFPA 3DQZA 4G8CA 4WDRA 4TPKA 4Z49A 5LZ4A 2PL5A 4A16A 2XUIA 1LPPA 4FFVA 1TCBA 5JYCA 2PUHA 1H2YA 3C70A 3JYHA 4DYHA 5AOBA 4UBKA 4H7HA 1CUHA 1YSCA 4N8EA 4IHAA 2QZPA 5A71A 4PQEA 4UBNA 3STYA 1ZIXA 1R9MA 3EQ9A 1CFJA 2XQFA 3N0TA 4TGLA 3BIWA 2YXPX 5LLSA 5FKJA 1MO2A 1QO9A 1TCAA 3M82A 4CCYA 2PSFA 1LPMA 4QWMA 3JW8A 1BN6A 5AI5A 2NW6A 1AX9A 4ZXFA 3H18A 3DL4A 3G8YA 4BC0A 3FYUC 5D6OA 7YASA 4DMFA 3C6ZA 1BCRA 2XLCA 4BE9A 1R1DA 2YASA 2B4KA 3N2ZB 1CUWA 4X3CA 1VZ3A 2HHAA 3FWHA 4UBOA 5J3JA 2XUDA 1BRTA 3NGMA 2EDAA 5AICA 1X2BA 1XRMA 4WFIA 3MUOA 1WPRA 3PFCA 3ESBA 4I19A 1XRNA 4AN1A 1ZJ4A 4UHBA 1DT3A 2X5XA 4ZI5A 2Z5GA 3R3ZA 2WU3A 2WIKA 5IVHA 5AKLA 5AKJA 1Q83A 2WJ4A 4EY5A 3IUNA 2Y2UA 1LNSA 2HL6A 3WWPA 3AUKA 4DLNA 4AO6A 1XZHA 4UHHA 4DNQA 2ACEA 1XZEA 5AM5A 4HRXA 4HZGA 1XQWA 2PSEA 1H23A 3TGLA 3V1MA 5AKYA 2WIJA 4W1RA 1U2EA 5DWDA 2AJDA 4QZVA 4IH1A 2XMGA 3PE6A 3GUUA 2OCLA 2HA7A 4QA9A 2OAGA 4X00A 3FYTA 5AM2A 3IVMA 5A62A 3AJAA 3EF3A 4W9RA 1ORVA 5AK3A 3SC2A 4Q82A 3H2IA 4DTCA 5CH5A 2Y1KA 3PDCA 1EINA 3ZV7A 3NUZA 1USWA 1J06A 4L9AA 2DHDA 5EI5A 2WSLA 1YA8A 3BWXA 3WK5A 5JZBA 3GELA 4N8DA 3PFBA 3AIKA 3WK7A 5AKEA 4M0FA 3FLAA 2QTBA 3A6ZA 1EDEA 3B5EA 4WFJA 3NWOA 3FLBA 2WILA 3I2IA 3M83A 1SCKA 1TKRA 3A2NA 1JMYA 4L3WA 5K3AA 5KREA 4BC1A 1MT3A 4M0MA 4N8SA 3STWA 4BATA 2CJPA 2OGSA 1QO7A 1XQVA 5E4JA 5JAUA 1HBJA 2C0QA 5AK4A 5DNWA 1QIMA 2PU5A 3FSGA 4BBZA 2XMDA 2B61A 4JH0A 5KBYA 2H1IA 2QJWA 2WTNA 1QIHA 2QRUA 3IUJA 4GHWA 5EHZA 4U2DA 2QOEA 3W05A 3H1AA 1A8UA 5HF9A 5FOQA 4H0CA 1J07A 5CT9A 3WZMA 1B41A 3C5WP 4UFOA 3PUIA 3BDVA 3O4GA 4BVLA 1ZJ5A 4XWGA 5ALVA 4P08A 1UOOA 2VQ6A 5HFAA 5T4FA 1QTRA 4B0OA 5ALJA 3WQHA 1FFCA 2OQIA 4E14A 3WJ2A 1GQRA 4H7EA 3QPCA 4B0PA 1BN7A 4E11A 2RONA 4K6KA 5AKGA 3IURA 3WWCA 3R40A 1R4ZA 2Y2VA 4W1PA 3EQ7A 3CXUA 2XQJA 3VKFA 2DQYA 4EA6A 4Y2PA 3C8DA 1XLUA 2RHTA 4BVJA 2GZRA 1H22A 1XQXA 4JYMA 3YASA 4U2GA 5ALNA 1YASA 2WFMA 1ORWA 3CN9A 4LXGA 5K5EA 4ZWNA 2WFZA 2WFLB 4DIUA 1SFRA 3M81A 1PV1A 4Q3LA 1DWQA 2UZ0A 3IB3A 1MX1A 5JAHA 1KU0A 2WIGA 2CUTA 3H2KA 4Q3OA 3GFFA 3PUHA 4KE7A 1LGYA 4S0XA 1EVQA 4FBLA 1EK2A 2XDWA 4FOLA 4AO8A 2C58A 3DL7A 1YAJA 4KJXA 3WKEA 4CIBA 2YYSA 1THTA 3KDAA 5CT6A 3ZI7A 2QMQA 4OB6A 3TRDA 2XI4A 2VAVA 5AI0A 1AURA 1GT6A 2OPHA 5ALRA 2C0PA 1CUBA 5KWIA 3G7NA 3QMMA 5JARA 1DTEA 3ICWA 4BCBA 1BEEA 1N1MA 5BWCA 3R0VA 1HLGA 3EBLA 1CIJA 2PVSA 1AMNA 3K6KA 2ZVDA 3AZQA 1L7QA 2W22A 3F98A 1MAAA 1U65A 4JEIA 1JMKC 5LKAA 2XMBA 3AZPA 5JIBA 5HKAA 1CEXA 3UUEA 5LIPA 5H3HA 2HA4A 1SCIA 1MX5A 5AI8A 1EK1A 4QDTA 5AK6A 4X95A 2HA5A 3WWOA 1P0MA 5DNVA
chains in the Genus database with same CATH superfamily
2Y6VA 4YCAA 3DSRA 3GRRA 1MAWA 1T4MA 5ENZA 4DNPA 4D9NA 4P4SB 3PJGA 2HLDA 1YUBA 2FN8A 2QP4A 3KWJA 3RQIA 3MAGA 1J0EA 1TK2A 1Y6RA 3AHCA 4LC0A 3WJ7A 1ZJWA 5BQXA 1C7JA 2ACWA 2C59A 3LQ4A 2JDID 2GYUA 621PA 1GZSA 4XOUA 3F7MA 1VTKA 4OJNA 1E3EA 3R7FA 1DQSA 1F9EA 2FSPA 2R751 3DLAA 3FR8A 4INJA 1BW9B 5A1TA 1X2EA 4E2XA 1WXGA 3JQ6A 5KTMA 2CVZA 2QRZA 1R0SA 2WZQA 2OQRA 3KVOA 1SEPA 4LG1A 3OU2A 4YP5A 1DEXA 3FRHA 2I54A 2DFKB 1NBEA 1P61B 3PWTA 4B4UA 3WGUA 1B1CA 4QFBA 1DAIA 2PWBA 1HZZA 3KKNA 3GAAA 4N0EA 1QZTA 2R8YA 3U3RA 4N18A 4RD4A 3VNRA 4ASUA 1LJ8A 1XLTA 1JHOA 1RYHA 2AR9A 4JHLA 2IHNA 5L6MB 3O38A 5KTPA 4Q7EA 5FO1A 4PLTA 3GHYA 4TUYA 3NLLA 5I9NA 4Y2YA 2UVPB 4RO0A 3GP8A 1OZHA 2XNKA 5CEEA 2DJ5A 5AVZA 1NT2A 1R6DA 3O4JA 3N8GA 3EMKA 4HH4A 4M8SA 2HA2A 1OI7A 3LHIA 3NHKA 4RHYA 2JK0A 1RP1A 3PX7A 2P2DA 1LRJA 1PLLA 4GXNA 2QRHA 2Z2IA 4MRPA 4RH0A 4YDRA 1XXHA 1ZXBA 1IOWA 1QGED 4Y2SA 4KOEC 1KE1A 2BM0A 4NJMA 1KY4A 2QM7A 3CKYA 3DB2A 2JI7A 5J9FA 1PJCA 1FTWA 1OC2A 1YT5A 4CI9A 4W5NA 4ITVA 3CE9A 3C45A 1E3WA 3N8KA 2GLXA 2JI4A 3QXCA 3Q7QA 4NBLA 4A7PA 4FW9A 3UV3A 1TEVA 3VBEA 2WM9B 4RJTA 3MTEA 4H4DA 3M1IA 3Q9LA 4BKQA 1IK6A 1Z75A 2JHFA 3FETA 3VR4D 3WXMA 2FN3A 3A28A 4G56A 4TYPA 3ADBA 1X7WA 2OBFA 4JT4A 1ZEMA 2LXNA 2RGYA 3OH8A 4MYRA 1PZGA 3VVMA 3ZHYA 4MRMA 3FJOA 4TN5A 5THXA 4DG5A 4KI7A 2NU7B 3UAZA 1ACJA 5B1HA 3CRQA 1YRYE 2YMPA 1N2BA 4PINA 1DG9A 4OXKA 3WBFA 3LKBA 4HVLA 1XYYA 4F3YA 3KKEA 1QK5A 4XTCS 1XNJA 2ZWOA 4G3XA 4HAIA 4AIIA 4NICA 4HZUB 2UUAB 5DTMA 2XB6A 3AR6A 5JVDB 5JQWA 1IZYA 1L3BA 2QX6A 4AJOA 1H69A 4UU1A 3VPFA 3WKBA 4MINA 2VUUA 3ZGYA 4MVJI 4JENA 4OHRA 4NEHB 1QK3A 5FHQA 3O8NA 4GL4A 4C3ZA 3RTBA 4F8YA 2BRUC 3O03A 3MINB 4NU6A 3TIVA 2QGZA 4EKYA 4BV8A 1CIVA 2C5EA 2F9LA 1Z4QA 2WUEA 1TCVA 1KC3A 2YZMA 3RVSA 1KR5A 4MZXA 2R7MA 3RQSA 3EGDA 3F97A 1M0SA 2H9YA 3TR6A 4KPFC 4F93B 3QXGA 3EPJA 3Q3JB 3UATA 2DECA 1DKOA 1QUFA 1KEZA 4KYTA 4H3VA 1UK8A 4V0LA 3P8ZA 1GU7A 1QGYA 2DWCA 1XCBA 1T4CB 1NI4B 1QUEA 2AHRA 1GLVA 2J0UA 2ZTVA 3SHTA 2IYOA 4BFYA 4DAOA 1SN7A 2H7CA 1JYFA 4MJ3A 4YIKA 4TYQA 1P60A 1YCDA 3KYIB 4EFKA 1ZITA 4M9RA 4C9BA 1P6UA 2IP1A 3MMSA 4RS3A 1K8YB 3UENA 4DWOA 2PZBA 3A8TA 5LA6F 2JB9A 3NNNA 2BCGY 3GLHE 4WRRA 3RBVA 2QL6A 1K06A 3GAFA 4G0OA 2ZRJA 4HDMB 1E1QD 4LNAA 2IU0A 3T7AA 2WOOA 3LBFA 5J58A 1T5BA 3U6BA 3A9VA 3I01M 3BWEA 2QTFA 3LXXA 4GX5A 1GIAA 4MAFA 5FBWB 3DZBA 2JH3A 3P9SA 4YO8A 5CT4A 3IESA 4OJMX 5TGTA 4B3CA 3H1GA 3HJFA 1U9YA 3AY7A 3OIYA 3ZJVA 1YJ5A 5AVOA 2GAAA 5KYKA 2NQ8A 1ODFA 4ZU6X 2JLVA 3PSAA 1HTWA 2B3TA 2M6RA 4B82A 5CBKA 1QLHA 2FX5A 3QOYA 3RS3A 3VAYA 2YINC 4KAJA 5HA5A 2PGNA 4DRXB 1WL8A 5JLJA 1U99A 3AIMA 1V6SA 2J9FB 4FE3A 3V9PA 3NGXA 4TLMB 3E48A 3D4PA 1U4NA 2Y4NA 3KYDA 5AUNB 1PJ3A 2QQ0A 1XD2B 1ZN2A 4FR2A 5ITZB 5K0NA 1HETA 3LFHA 4KLNA 5BT9A 4BGUA 5LVAA 1LX7A 2FXIA 3QWAA 1O95C 3OPMA 4FZ5A 2SHKA 4UCXA 3WLSA 5I3ZA 1NXTA 3C8MA 3T5PA 1L1QA 3OLXA 3OY7A 3VV3A 4BNJA 1R66A 3PHJA 4JA0A 1NLUA 2J3DA 1AQNA 1EVJA 2H08A 3PS9A 5ES3A 3ZZ1A 4EYGA 5EHIA 5FUYA 2ILVA 3PDIB 1MORA 4CVNA 3A0UA 3IO5A 1CUEA 3L8YA 4K6HA 3VR5A 3TKYA 4QREA 2DKOA 5A6VA 2ZIFA 4LMPA 2G70A 4QYTA 2P6NA 3N39C 2I4TA 4YV2A 5B6JA 4PHFA 5ECYA 5DTQA 1W0KA 3A1UA 3B2NA 4MS4B 2EQAA 2P8SA 3D7MA 5H80A 2V0GA 4JSTA 1Z68A 3GAMA 2QRJA 3A31A 4NMHA 3AWIA 4QGGA 3VH1A 1TU3A 4BMOB 4KN9S 4Q7QA 2D5IA 4NBNA 2PUDA 2XW6A 3UWKA 1YBFA 2MDTA 1SO8A 3G0BA 4BGIA 3KKKA 3P9RA 1U9IA 1Z4JA 2RK3A 4W6QA 2XMQA 2P4QA 2AEEA 4BLUA 3KD2A 5I47A 5JSZB 2XRZA 2C4HA 3IL2A 3L93A 1N3YA 5T41A 4L8VA 4IVQA 2ONCA 3O3MB 4L08A 2XY4A 1SKYE 2Q9UA 4I50F 4KI0A 1MN6A 4OOFA 1YUMA 1ZH8A 1QGZA 1E6UA 2HK9A 3OURA 3PK0A 4I14A 4XGQA 3L0DA 4YMUA 3F46A 4RV5A 4XKJA 4LDZA 1MABB 3GD5A 2WYVA 2G1KA 3TXXA 1JQEA 3IPXA 4G63A 3TLXA 1ZY2A 2GD2A 3LDGA 3SD7A 2J33A 1A8SA 3DDUA 1QLJA 3JY6A 4KMSA 3O4HA 3MBOA 4Z9XA 1LUAA 2WHRA 2VQSA 1IPFA 1X0VA 1UXHA 1GNQA 1XZGA 2MSEB 1T9AA 1X1DA 3LPDA 4NOJA 2CNLA 1A8QA 3LUAA 4H17A 3TBFA 5CCDA 4RHCA 5IAAA 5SZJA 2Q07A 4D43A 2FFBA 3AONB 3IGFA 3QQPA 4MB2A 2ET6A 1WCV1 2PWAA 4P1ZA 4YRMA 1FQJA 3O8LA 1B8PA 1NOIA 3PFFA 5C0OE 2OYRA 4D3SA 1GT91 4LDNA 1A8IA 4FDLA 3WAJA 5HQ3A 4AY6A 13PKA 4YMSA 3DAOA 4UEKA 1MKYA 3GFSA 4CF6A 1E2IA 3KVYA 3D8BA 4HLDA 4LJRA 2JFXA 4L9SA 1Z39A 5JS7A 3M6IA 3VV2A 1E89A 4EK9A 2HT6A 4K9SA 4YAFA 4RTJA 4MVXA 3Q7RA 4IO0A 4P3NA 3G5AA 1H65A 1J70A 5C9ZA 5B3JA 2UV8A 3EVFA 4GGOA 4LZJA 2COUA 1G7TA 4QUBA 2RAUA 3GUHA 4FZRA 5FPQA 1M2EA 1Z06A 1JXOA 4PC7A 3ROQA 5AM0A 4MKHA 1SC4A 4UNNA 4DJEC 2HEGA 2I9KA 4H59A 4ER3A 2IYPA 3QX9A 4G36A 2PX5A 2ZXFA 4J6EA 4EH1A 1XTUA 1AQUA 1VSVA 3G2PA 4QDOA 1XAGA 3I04A 3W1VA 1C80A 4Z3OA 5B1SA 1RZUA 3LWDA 4B7ZA 3P19A 1T1SA 4BO9A 2FEKA 2OXRA 4HNHA 4XE5A 2B4RO 2FEAA 3JQ8A 1EUQA 2RKOA 1SUIA 5FLKA 3ZDZB 4B9AA 3KTAA 3EH2A 1H8ED 1LWOA 1ZOSA 4BRZA 4JI7B 2N46A 1P5ZB 2W6ID 2R68A 5DRYA 3WO1A 5HF8A 4QXMA 3RJZA 1O9GA 1SVUA 1Z4OA 3BQNB 4M0LA 3U4MA 1F2VA 4ER5A 4JZKA 3SQDA 3BF7A 4UPDA 5ALWA 5DLPA 9GPBA 3QSGA 5CVDA 3K0BA 2M9MA 3GLGA 3SEQA 2GN1A 1CLEA 2R4TA 2VF4X 3P0IA 1NRJB 3R3YA 2W2MA 4BNMA 2JJ1A 4WXHA 3A6GA 4BZWA 1L4LA 1WEHA 1LSSA 2AUTA 3GVXA 3R5KA 4K9KA 3BJMA 1AN9A 4PBRA 4WDQA 1EAMA 5HTKA 2V3VA 4J0HA 3W79A 3EDOA 2ATEA 1LI4A 1IE3A 2MT9A 3BH7A 3D8UA 4GLOA 4HWTA 4X1KA 4QUIA 5ALPA 1KMHA 2IIPA 2CLIB 1KO7A 3TJMA 4L5JA 1KGDA 4XI9A 1DUSA 1U28A 4IWNA 4FILA 5EXEA 2NPIA 2X42A 2YN2A 3D3EA 3EISA 5EUBA 4CMGA 1TI7A 3VTKA 3ZK9A 3CH7A 3EG9B 2WWXA 1GRVA 2FPWA 4RTPA 3O6VA 5K0SA 2A1TS 4NF2A 1JU4A 3Q5DA 3UXEA 5K3SA 4IHJB 5HS6A 4HYQA 4PX5A 2H2GA 4G09A 4UVEA 4YQYA 5AVXA 1O6CA 1ZMXA 4WINA 1E7RA 4RK4A 4H7DA 2XQVA 2J59A 3HCFA 3D7NA 3MT0A 4HAVA 1FTNA 2J3EA 3BGIA 3C16C 4HI0E 4IIEA 4MA5A 5E1MA 3RK4A 4H1WA 3T1TA 2IC5A 3CB2A 2R8XA 3R7NA 4I4TB 2Z83A 3ZJYA 5FH9A 5IM4A 3NHMA 5HP4A 1WE2A 4QPCA 4URVR 1NSFA 2H54A 3KXLA 2A1UB 4X7BA 1XHLA 2WWGA 1F2DA 2JGLA 4G9EA 4TVOA 5C4IA 3KQKA 1M9NA 5H70A 1HDRA 1W25A 2CLEB 1O8CA 4JX9A 4DCCA 3EXAA 5BQOA 4U3JA 3FY4A 3G9TA 4E15A 4PG6A 1C9KA 2RIRA 1X39A 4RZXA 1PNQA 1FQWA 1V9LA 4DQXA 3SSNA 1QP4A 4GH5A 3EYWA 1HKHA 3HBNA 2CLCX 2E4VA 3L18A 5JFTA 4RPCA 1IXYA 1Z3CA 3FTFA 4KPUA 4ALMA 2H8KA 3M70A 4YAEA 3AEUA 1TC2A 4CLOA 3TIGA 3NUQA 3Q1LA 3VU8A 3BXOA 3CKKA 3G8BA 3S8YA 1XMPA 2H92A 2OKGA 4I1PA 2A0UA 2OXEA 5A02A 1T9CA 4PCUA 2XYRA 1AUQA 1J8FA 2AUMA 2NT3A 1VLMA 2JH9A 3A58B 3D4NA 3R9IA 3HBJA 2IYNA 2ACVA 3L6UA 2XCRB 2BZ0A 1OPXA 3ACBA 5FF9A 2J9ZB 3DHVA 2HX1A 2X6TA 4UMVA 1UM9A 3OM8A 3U4CA 3D6TB 1WLYA 1M7HA 1YA4A 1PFVA 3DONA 1IOZA 1P18A 2ZZMA 1XGKA 5CVUA 3O2JA 4DMUB 1HDIA 1E99A 3BRSA 1FFGA 4MIYA 1MPXA 2WSMA 3GRKA 3WNBA 4D0SA 1F8YA 5EE3A 4HQNA 4ZOLA 2YVUA 3E1GA 3X1JA 4DC1A 2QTCA 1ULUA 1P33A 2NQ2C 3MOIA 4AECA 4ZQBA 4E0BA 4RD2A 1WB5A 5AOCA 4LE2A 3HI4A 1N0UA 3OJFA 3AL2A 1EM6A 2B2XA 4KMMA 3MCAA 2NP7A 3MLBA 3MS2A 1ISJA 1E7YA 3ABQB 3QPBA 2QT1A 4JX8A 1NW4A 4FZ3A 4YH1A 3P9IA 4KJZA 2V97A 1LNQA 2I2XB 2EG9A 3DPIA 4FNGA 4C6RA 4FGSA 8LDHA 4RL4A 5ADVA 1JXQA 721PA 4NAUA 1RKQA 4KCGA 1KJJA 2V6FA 4HDNB 3TSZA 1UOQA 1Z2NX 1OXXK 5JNWA 3TVDA 1CJVC 4TTIA 4BJHB 2H2DA 1YR1A 4LXIA 3DVAA 1TFUA 3HP1A 1O97C 3U9TA 1VIYA 5JJBA 2WP0A 2NLOA 5JMPA 1BE0A 1UODA 3B7WA 1CS4C 3KZMA 2CJYA 1LI7A 1U7UA 1YCHA 1YGPA 2E49A 1KI3A 2ID7A 2BVNA 3BTSA 3I5UA 3HP7A 2HTFA 4BMXA 5FBVB 1ZQ9A 1YHNA 1H94A 3GUZA 3ZGZA 1XEWY 4YRGA 3G2LA 4G1VA 2BW0A 2ZANA 3WRVA 3O93A 2CHGA 2PAAA 3DZDA 3G9XA 3MWEA 5DU2A 1NWHA 3F74A 3H75A 3NWJA 2ZQZA 3I9NA 4KW7A 3SVZA 3CU5A 3QMWA 1TIKA 3BQ9A 4DBLC 3ER9A 3Q3GE 5E6RA 4QRDA 5U4QA 2Z2YA 3WB9A 3WHIA 3J81k 2ZM5A 1DJQA 1II8B 3EY4A 1N0VC 1Z16A 3MXTA 4JJ4A 4YX9A 2AG6A 2BLNA 2YTZA 3ZD8A 1ZCFA 4H18A 3D3NA 5I5EA 4BMYA 1ZK4A 2CE7A 3JATA 2C1XA 4KE6A 3H04A 4RVOA 1N6OA 1KARA 4OYRA 1O03A 3HB7A 4X1IB 3H4IA 4WESB 4XIFA 5PNTA 5A4IS 5E1DA 5BORA 3OCCA 3FCXA 5ENDA 4EGSA 4RTMA 3OT1B 4MXDA 4LXUA 2WT9A 1RM5A 4EG0A 4UBMA 5T4BA 2EEPA 4U7WA 2P0AA 4G1CA 5J63A 4HS9A 1OWPA 1Z38A 3A4NA 4GU5A 4JB8A 1MB3A 4PSAA 4BECA 4ZYWA 2P6RA 2AKYA 2R6DA 4LF7B 1IB6A 2EARA 1HK7A 3L04A 5AVJA 5I5GA 3U81A 3ETHA 3RVDA 3TLMA 4HGOA 2RH4A 3RUEA 3RTGA 2V58A 1LF0A 1PS0A 3PC4A 1WD5A 4R1MA 5FUWA 1SD2A 4PW0A 1S3SA 4GP6A 3PGJA 2GWHA 2FSHA 5DM2A 5F3DA 1BVRA 1TIPA 1AN0A 5FTLA 4DADA 3O3CA 4X91A 5EMNA 1WMFA 1UC4B 1WHSB 3DDCA 3DMYA 3KU1A 4OA5A 2HRZA 2ZITA 1G6OA 3FCAA 2IZ6A 3EOZA 4C3OB 2NACA 1U63A 1RRCA 2JA2A 2QTRA 3UJ6A 2G5CA 5DGIA 3FF4A 4YI3A 1DEKA 5EZYB 4EI8A 4GC5A 1STOA 2EWWA 2BL4A 4B84A 4K6FA 3EUWA 4QUJA 3TLZA 2VZ9A 3OVMA 3KJNA 4QU5A 1SOVA 2WT8A 9MHTA 5EESA 4KVFA 2P5UA 3LP5A 4Z2AA 4QAQA 3QY9A 3EE6A 1PGPA 3E5MA 3HH8A 3CZPA 3K5WA 1QR6A 2C5BA 4RVDA 1ZMOA 3VU9A 4ZD6A 4XSVA 1AZWA 1YDMA 5FA5A 2J0EA 3GP5A 1ZVMA 3QWIA 4NE9A 1E1KA 4EVQA 4C7OA 2VRNA 3TZBA 2KLBA 2R7AA 4F2HA 3K2IA 3G3EA 1GGKA 3TZQA 3VNBA 3KDPA 1PGJA 4PSUA 1F2UA 4U9IS 4A8JC 1T8PA 1DI0A 5LFAA 2QG6A 4XRGA 2ZJ7A 3SOPA 4EO9A 4F21A 3M9XA 3I2KA 5KDOA 1GSHA 2Q9BA 3Q7IA 3ZNQA 4TRJA 2L0XA 1AKEA 3H5LA 4RPLA 3KPYA 1OOEA 3G8AA 3A9CA 3CW9A 3UTCA 5CA0F 16PKA 1FXWF 3TM5A 1VJCA 3DYBA 1W4LA 5EL0A 3TE7A 2HK6A 1L1EA 4NBKA 3K0SA 1VHLA 1F7UA 5H0IA 1SH7A 2R6ZA 4Q3EA 3L6CA 1Y1RA 3JU3A 1SRRA 4WWHA 5FFFA 2YH2A 4Q15A 1F8XA 4TROA 1S2NA 4LHXA 1LBQA 3KAQA 4YCMA 1GGNA 2NUTB 2C3UA 3UMVA 4KU4A 2XJ4A 1RCUA 4BJ5A 3FAZA 5EMJA 1TUBA 5BN5A 3AR2A 2RGNA 1Z47A 4MLDA 5TQ2B 3W5UA 4B75A 4BTLA 4AZ0B 3SC2B 1QOPB 3GLIB 5TLSA 2ISSD 1KFBB 1OX5A 2B1GA 3EA5A 4GRDA 4TXJA 1IULA 3REOA 4K9QA 4NSNA 4IQ4A 4OJTA 4DYDA 5D51S 3I2FA 3ZLUA 4Q00A 3B6IA 2NU9B 3O2NA 3R4CA 1NMXA 1CE8A 1R0KA 1AKVA 1W0JD 2GASA 1VKZA 5IUJC 5K51A 3GPDG 4HF7A 5DXFA 1A2OA 4D9GA 1SQ5A 1TL7C 3I45A 2VNSA 5D3KA 4YRPA 4A36A 1NQOA 1YMUA 2UYYA 4LTDA 4MRAA 3UQZA 2P4UA 2GSWA 3HK2A 2IODA 1UJCA 3W78A 3Q0EA 4JUBA 4EUHA 1PG0A 5BN1A 5KTRA 2HU5A 3BFVA 4TLEA 4WPGA 4RULA 3A9WA 1VC2A 5SICE 3VDQA 3ER8A 4X6XA 3G0CA 1XO1A 2DWPA 4L4UA 2DHQA 5THQA 3SNKA 3VYVA 2PD4A 4PAMA 5G0UA 1T36B 2DULA 4MWCA 2JVJA 4D0GA 1IVYA 2MYUA 4WOBA 1CQWA 3RTCA 4M9UA 3UAWA 1CUUA 4CE6A 3CVJA 1ISSA 1DC6A 1UWCA 1Z4LA 3IHKA 3R0IA 4V0MA 5CBPB 5JCPA 4ID9A 4KQCA 3R7AA 2EAUA 4Y6RA 4YMLA 1Z8NA 1D2GA 1QIKA 2GBLC 4BUZA 4PCLA 3FRIA 4X3OA 4ZDJA 3PPIA 2XXJA 4TXNA 4IS2A 3DO8A 4R69A 4RE6A 3U6KA 4Q5IA 4D7AA 2X5KO 3U37A 4QTZA 1RLUA 2M6SA 1VM6A 3LQ1A 3PFNA 3SQMA 2FPGA 1TJ5A 3ORRA 5DYWA 5K3OA 4EYSA 3C14C 4C07A 1KK0A 1ZCAA 3GJQA 4ZYXA 2ZBQA 3BGVA 4RA6A 2FP4B 2EYQA 2NXJA 3TL2A 3IDOA 2PZ8A 3VPSA 4C4SA 5IT5A 5AVVA 1AGNA 3EXHC 1P81A 3EPKA 3UIEA 3ZBUA 4JOQA 1J5PA 3PWKA 3RU3A 2C2GA 2NU9A 5JAIA 2PGAA 1CUVA 1V16B 5BV0A 1Z2EA 2VSXA 2CDRA 2PKEA 1E1RA 2EZUA 1EVEA 2HBQA 4KSBA 1R4AA 1BHO1 4ITRC 4J2TA 4OQZA 3SJAA 2HT1A 1UFOA 1PNRA 4RV9A 1IZ8A 1JR3E 1AS2A 2BELA 4Z4GA 2CYBA 1RPTA 4HEHA 5LZ5A 2BFFB 2IS2A 1N92A 5EQJB 4DCMA 4E4TA 1MW9X 3ABSB 2OCGA 3AG5A 5EWMA 4Q4LA 2V6GA 3WYBA 2A5LA 3OZBA 5KHLB 2IBTA 1FTYA 1V5IA 5EEHA 2XUKA 4WT7A 4WKGA 1SUAA 2H31A 1RAAA 3ZVLA 2AE2A 1GZ4A 2ZJ4A 3EIWA 5IBCA 1CRLA 1DHTA 3IVAA 1QH8B 4L0CA 1Y6GA 1MIHA 1YQQA 5B58C 3GNLA 5MGBA 2EJTA 3RSSA 3ZE9A 1U9JA 5F77A 3V1NA 3JWEA 3V4RA 4WNIA 5LR6A 1Q3TA 2HWUA 2WINI 2WKWA 4BNIA 5JJIA 4TTQA 4KV9A 4NABA 3UCXA 3FNFA 3IQFA 1FDTA 5DHUA 4X9XA 2Z95A 5BMVB 1GM5A 1OMOA 3ICOA 3RW9A 5JALA 5GGYA 3UT0A 2ZSIA 2ZYVX 5CT5A 3LQ2A 5BW6B 3ZQKA 1HF3A 1RQRA 1FRNA 1ZD8A 2Q4BA 1B3RA 3EPPA 5BQPA 3VA7A 4QM7A 2CMDA 4H31A 5FL7A 4GLFA 3MRSA 4C06A 2ZOSA 2VC2B 1RZRD 1KOJA 3ORHA 4JXKA 4ARZA 5BWNA 4ENVA 3GP3A 2I67A 1BXGB 3H9EO 3LBNA 4OOEA 1N2OA 1G0OA 5JBQA 2ECQA 1E5VA 3W5HA 5EFZA 1Q7RA 4EHAA 5I01A 1QKKA 2YBDA 4OQDA 3A1TA 1Y3FE 3LKZA 1HE4A 3EGXB 1Z7YA 3HXKA 3IPRA 4FW8A 5AO9A 5ICCA 3LECA 4Q02A 1US8B 2QKYA 4LOAA 4QYMA 1JIIA 1ZHFA 2AD1A 2ZJ1A 1MNAA 1R64A 5P21A 5PGMA 2O8VA 2Q4EA 3GCDA 4Q1BA 3UMMA 4TLLB 4EO4A 4AM8A 2ATXA 3EIXA 4PPNA 1K5DA 2VH2A 4YRJA 3PYXA 4R2IA 2JGMA 3F5QA 3AFIA 2AEJA 4F6RA 5HKKA 1NOJA 4LBZA 5IBPA 4ZCIA 5E2IA 2V45A 1JQAA 1YD7A 1QS0A 3KSUA 3WLQA 5CB4F 4ZTUB 1GPYA 1TE2A 2X0FA 3RRBA 3EB9A 2W42A 2O2YA 4ZVVA 1E7WA 1JJAA 1M8PA 2AXPA 2R6AA 1EE2A 2BIFA 2HAEA 2WAAA 3PGXA 4RF5A 1IL0A 5KQMA 1E0DA 4V38A 4ZAYA 2XCIA 4GVPA 3BMCA 2NXNA 4WW0A 4UCWA 3DTNA 3GOQA 3PGMA 4BX3A 4DMHA 2NYRA 2CZQA 2JJYA 1CY0A 2ZIEA 4C0XA 1KBZA 1ONNA 2VJKA 3MILA 1VZ2A 4IZ6A 1SOUA 2P2YA 2WVHA 4K9OA 4TM7A 1T4DA 4E5UA 1F6BA 1S7CA 3N2LA 2INGX 2EJVA 1YCFA 1GPLA 1RVV1 2HYDA 4OQPA 4UAJA 2RB4A 3TNDA 3WE7A 5HHTA 3L4KA 3R1IA 4PG4A 4Z4HA 4RFSA 4YGYA 5D87A 1EUCA 1WBJB 2VJQA 3BL5A 1XV5A 4ZV4A 4L8YA 2ZDGA 2G25A 1E3MA 2W2LD 1VBFA 4RVNA 2EKLA 2XMPA 4EJSB 2EFGA 1IG0A 1CPYA 4LJKA 3W9BA 3BXPA 1AD2A 1WB6A 2X3YA 2YNMC 3F67A 4CKYA 3IUMA 4X60A 3O73A 3SLRA 3HKCA 3ZS9A 2XZOA 4B17A 2DETA 2FZWA 1A71A 3TTSA 3UWOA 1WABA 4OI0A 4YCSA 5HIJA 1BNCA 3IAS1 1BCSB 4B83A 2ZRHA 3WGNA 3KAKA 1M2HA 2GM4A 1AM4D 1E9CA 3AI3A 3SHWA 1M2NA 3ECAA 4KQEA 4DCPA 4AICA 2XGMA 4U1RA 3OPVA 3ZEAA 2H0AA 3TL6A 5KNLA 5A0TA 4WVLA 2QYSA 1FJHA 1R6TA 2YDXA 2ZJFA 1ABEA 3CM0A 3NV7A 1UMBA 4FDVA 5EZQA 1W5AA 3QBDA 5KS2A 4OU4A 4GX0A 1FBTA 3G1TA 1XXHE 3R8XA 2OGTA 4BKOA 1FNDA 5BNWA 1LXCA 2QUAA 3KJGA 1ORHA 2O0KA 2RAFA 2W2QA 3HO8A 3NTRA 4PO1A 3RC7A 2VSOA 3TCNA 5A03A 4XEHA 4BGDA 3UPTA 3KTFA 4KQHA 1T15A 5ALZA 3QKTA 5J4VA 3ZBTA 4RLHA 4NV1A 4ZZ1A 3GGJA 4P35A 4HX5A 4B44A 3TFWA 4TZ0A 2VH1A 4W8OA 3S68A 4BTVA 2HSEA 3GROA 3HWSA 3KJIA 1T9BA 4CNBA 1BH2A 3KETA 4CDGA 2PPLA 3HB4X 1QIFA 2VHTA 4MP8A 2GYYA 3TSCA 1Z2OX 1UKZA 4XYLA 2BFFA 1O96A 1Y8RA 3E3AA 1PJAA 1PT5A 1Z0SA 5AW2A 2RG7A 3A3NA 5ALEA 3ZZMA 4ALIA 4NWIA 2BBWA 2HXGA 2QVXX 2ZR0A 4X1KB 1JDBB 3INYA 3F4BA 2VK4A 4WKCA 5H9VA 5HE8A 2QF7A 3IUSA 5FEUA 3BHMA 3K1TA 3MWGA 4L07A 4Z86A 1F12A 4DCUA 5E2BA 1NSYA 4B09A 3DOOA 3DWEX 2UZIR 3HL0A 4PR0A 2B69A 3I9LA 4IWYA 5JASA 1TZBA 1J8VA 2JGKA 4WK0B 3LY9A 4FONA 2W2NA 5FEMA 1E4OA 4JWKA 5JAQA 4QXQA 3ZH9B 4IJUA 1MAUA 4H35A 1IM5A 5JHHB 4N1AA 3DVAB 3TBHA 4ED9A 1AQLA 2FQQA 3PRHA 4PFJA 4EZBA 1YA6A 3MJFA 3TK1A 3K70B 1SVIA 2O2JA 1UPCA 1OT3A 1SBQA 3BE8A 3LZDA 1N4AA 1DBSA 3W6ZA 5GQSA 2XT6A 1HI9A 1SUDA 1WXIA 3UCEA 1BCRB 4NYMQ 2CCKA 5EPUA 4ENPA 2HIAA 2IH4A 3NI2A 3H5WA 3V32A 2GT1A 4IDGA 5DOZA 4ZZ0A 5AI9A 3KQHA 2PA0A 3K9NA 3ILSA 3O91A 1FK8A 2C03A 3IJEB 1NW5A 2C31A 3DVLA 3K4QA 3QVVA 4JELA 4KLZA 4BNFA 4F11A 4BU1A 2YJ4A 4CIDA 1WG8A 2GRJA 5JYDA 3EZLA 4Y9RA 4RTQA 2HRBA 2QZ9A 3BXEA 4RJKA 4E46A 1KEUA 1H6BA 5FOUA 2I22A 1ZSNA 1TUEA 3LT1A 5CXSA 3RRNA 1AQJA 1N9GB 1DBPA 2PD3A 4LECA 3U0VA 3SEZA 3EBOA 1C50A 4MVJD 2ODBA 3QTBA 5G02A 3U26A 4QVKA 3BBLA 3T52A 2FZ5A 1CKEA 1NJ1A 1NYRA 1WDMA 2R11A 2ZJAA 4M0UA 5F1PA 1IVNA 1G1MA 4FDUA 4ZQHA 3K9FC 4X8OA 3KQSA 3ELUA 3U7HB 3K6SB 2NO5A 4KH0A 2GZMA 1CNMA 3ZU2A 4X8LA 4QRIA 3ZN2A 1EXWA 4GRIA 4PFQA 2FNAA 4WK2B 5HXAA 1B6GA 1KZ9A 2Q7XA 4ILKA 3ZYCA 4KQIA 1NN3A 3CMMA 4YRRA 1YS2X 1VSQA 1YDGA 4D9FA 4LJAA 4U7PB 3AXTA 1U8YA 2YNMD 2YVQA 1KRXA 5IYZF 1IEQA 5BY2A 2VP4A 3R4VA 2IEZA 2VXBA 5DYIA 3EVBA 1ZXLA 2E6UX 4CLRA 1NDUA 1ORDA 3PDJA 3SSAA 1BC5A 2L82A 4JLBA 4BO7A 1UCFA 3LSYA 2JANA 4JBLA 3I1YA 1S2MA 3FSGD 1D2RA 2A7QA 4UULA 1IZZA 2YFYA 4BUJA 5EIXA 1M66A 1ZD5A 3PIRA 3IVGA 1XSEA 1Z0JA 2WWFA 5KOYA 4QLBA 4DQVA 1LTHR 2B8JA 4DUZB 3ABIA 3EH1A 4WERA 3KM0A 4QTXA 4RPKA 5FUMA 4LWQA 1SBZA 1HQYE 4C76A 3PXCX 5JISA 2JPDA 1D3AA 5F4BA 3PDHA 4CKCB 4KK3A 3UAOA 3E8SA 1JTEA 2YQ5A 3NHBA 1BD3A 5F2EA 2VH5R 3UUWA 3BXXA 1GA6A 4X97A 4ZCRA 4J0DA 3TSYA 2WIFA 3JRXA 3WGZA 2Y76A 2I1LA 3VMFA 5JAZA 1IM2A 1QHYA 3TD6A 1QYIA 4BLPA 4I1RA 4HDQB 2VF7A 4RETA 2XCTB 3R7WA 1CR0A 3Q88A 1VCHA 1FNNA 2G0AA 3ONNA 3WQRA 3NM4A 3FNIA 4Z3KA 1HYEA 5JCJD 3CWCA 4OAOA 2ZIWB 5JZOA 5L40A 4ZMRA 1PFWA 1I9CA 2GS9A 1V4VA 3FAKA 4CKEA 3I2YX 3G5MA 3L49A 3VUFA 4V1CI 1H5NA 1Q44A 3CZQA 2HTEA 1XYVA 1CETA 4WLFA 2BFOA 1IHDA 3NRJA 4BO4A 3SIWA 3MTJA 4X7PA 1QHEA 1RNLA 1L7XA 2O2HA 2VP9A 4JD5A 1PK9A 1NXXA 1ZPDA 4L6AA 4X63A 2Z1MA 3MRXA 4RZ3A 1F9AA 4UBJA 2C4VA 1XKXA 3C3YA 1PE0A 4TZTA 3TO5A 3W9YA 1Y6ZA 3ET4A 5EIAA 5DN6D 1I6LA 4W5TA 3I6QA 4QPPA 1O5TA 1YZTA 1TM1E 2ALJA 1QBKC 2XA2A 3TLCA 4B3MB 5LUBA 1KI2A 1WUYA 2QZZA 1V3QE 4LFBB 5EMMA 1FRVA 2JNWA 1P4AA 3ZLTA 1JJBA 1QQ7A 2C3PA 1ESMA 3EY9A 3MJHA 4N5IX 3V1KA 4OHVA 2W4QA 3DAPA 3OPYA 5B36A 2V8OA 1LLUA 2Z57A 1V95A 1X3LA 3GPCA 3PDUA 1R3DA 2BGRA 4G0PA 3DULA 3F49S 2FW1A 2WM8A 4PNHA 3GUCA 4ZVRA 4E6PA 2VR1A 3KSBC 2Q9CA 3LYUA 1E2FA 4HPXB 3DE5X 3BTVA 3HVKA 3EIQA 3TMYA 4A4DA 2PQ2A 5BOSB 1VA4A 1ZSYA 2QTHA 2J9YB 3HWWA 3TF5A 1FDRA 3AIOA 3AM3A 5T8KA 4HTFB 3ZJ4A 1P0QA 2DPXA 3IR7A 4Q4JA 3TCXB 1XDWA 3KLNA 1O94C 1RHRA 5BSHA 3O8CA 1E7MA 1TW2A 4DFDA 4RVGA 1MO3A 2X2PA 3I2GA 4MSUA 3JARA 2J46A 4FJ1A 4FMDF 3LWBA 2D7JA 3KX2A 3P71T 2VTBA 1FNMA 1W48A 2VDRB 1BSVA 2W6NA 3A9TA 1YMVA 3WGJA 1J9ZA 1OYOA 1Q14A 3QBJA 1W581 2J4CA 2RFLA 5REQB 1BKYA 1OB2A 1Q84A 3JQDA 2HUPA 5EZSA 1BE1A 1DLJA 4RDHA 3V55A 4MWGA 3UB4A 3V2GA 3EJWA 3QUSA 5IAKA 1G6HA 3PL1A 1R9NA 1XZMA 3PF8A 3THWB 2JCVA 1N2EA 3RUDA 3UUFA 2QN2A 2AFRA 1DVRA 2IZ7A 2QLBA 4GUDA 4LF6B 1ZW6A 4KQ2A 3PX2A 5CJ2A 4ZOLF 1DOAA 1AQYA 3DOFA 4Q4CA 1S2IA 3QNMA 1ECJA 2AI1A 4XFKA 1NHWA 2FHSA 3DFZA 4B47A 4CMCA 4TKZA 5LCXA 1VYUA 2X5OA 3AW9A 3UMJA 5DHAA 6GPBA 2PNJA 2CFRA 4XXHA 1G5QA 1CUFA 1GKIA 2VT3A 4WBNB 4KODA 2RCNA 1LWNA 5AFSA 1P91A 3GNSA 4LZZA 2WHPB 5AJUA 3UM9A 4F46A 3SKXA 3AETA 1NKVA 1IQPA 2GO7A 4CG2A 1PSWA 2AHOA 3IXQA 1RAGA 4NZPA 1Z08A 5BT8A 1NF8A 4LRXA 4ND5A 2PX3A 5EUQB 4O1MA 1VSUA 4AYTA 5EE9A 3M2PA 4BV2A 3U3OA 4DBZA 1D07A 2DBZA 3Q7SA 4DJTA 3B6ZA 2BONA 2FEWB 2PFKA 4FCVA 4Z99A 3IAXA 1E2JA 4QICA 4R31A 3WBJA 5BR7A 2R7LA 3MXOA 4NCNA 3TAXA 1R4MB 5DLEA 1FP6A 4YEDA 3OLYA 5KNDH 1G7CA 5FRDA 5LZ8A 1EWQA 4BB5A 1R27A 3EC2A 2BHSA 3K20A 3TQOA 3UAXA 3NO4A 3NOXA 4ZWNA 1VMAA 1Y8QB 3WLLA 1VBNA 5JS8A 2P5YA 4J16C 3RVPA 4JIGA 4V0SA 1OREA 1B15A 2B7CA 3EZGA 4H27A 5EMLA 1YKGA 2DSNA 1SAYA 2Q6TA 4CI0B 2K87A 2PWYA 1ZAYA 2XZLA 3CTMA 4P3XA 5TQJA 2H1VA 1LY1A 2NU8A 4A3SA 1SB9A 2ZIAA 1DAFA 3W6UA 3I73A 1XQYA 1C3OA 3VC2A 1KSGA 4UHDA 1ZXXA 1IC6A 1WCWA 3NTLA 2R00A 1M0EA 4OF4A 2Q6LA 1QDEA 4JFAA 2GHTA 3R7LA 4AZSA 3I2HA 1TEZA 4L9RA 1ZZEA 1A9ZA 2PH3A 2PR7A 2YOGA 3ANSA 5KDLA 1PTJA 3AHJA 3K2BA 4HVAA 1C4XA 5DLQC 4DMKA 2O48X 4AWBA 1VMKA 2AFIE 5IK2A 1EFDN 3NHJA 1PYDA 1U1CA 3PYLA 4PHGA 1QG6A 1TB4A 2NYUA 4RY9A 4ENQA 1L8XA 2EL9A 1BXGA 2J09A 3TPCA 1RWXA 1L7NA 1UZLA 3ADCA 4BLWA 2DHCA 3DGFC 3R3WA 1BOOA 4LXTA 1VDZA 2WTBA 3HVJA 5KCZA 4LC9A 3X2SA 4R2KA 5DI9A 3AJ8A 1Z83A 1U7TA 1JKMA 2N1BA 1S89A 2OHHA 3DTTA 3PUXA 4YDSA 4UBLA 3IX7A 3WNVA 1J9EA 3F2IA 3IB6A 4K1LA 5KQRA 3VYRB 1OXKB 1P44A 1SUWA 4BKRA 4J0IA 2HQBA 5IH3A 3DUWA 1PDVA 2HA3A 2Y66A 4FMDB 5LNK6 2I3BA 5DVZA 2NUPA 2ZI4A 1MQSA 4MWSA 1A88A 3G5TA 1IBRA 3OU7A 2PXXA 2ZK7A 4MR8A 4PM4A 5TMDA 1YF3A 2P41A 3F6EX 2I55A 3OCZA 2GA9A 3QVGA 5D01A 4X20B 2IOHA 2NIPA 3D8HA 3HU2A 1UBMS 3LWNA 4NOKA 5B12A 1HRDA 4TQUS 5CLGA 1GYQA 4J0JA 1N2JA 4L3VA 4TWZA 4ZANA 4C2BA 2PY6A 3NNSA 3OCWA 2X8JB 3IC5A 4C6HA 3B12A 2G17A 2H17A 4MUEA 3ZGVA 1WHTB 1Z4KA 1NBHA 2AOUA 1BJKA 2CXXA 4CV3A 2NOAA 1VG0B 4B3FX 1QIEA 4LHZA 1XRJA 3KSZO 1D1TA 4MR9A 1PD1A 1IG3A 2PSDA 3P0JA 4MQFB 1TDJA 1VJ1A 1YR6A 2GARA 3HHEA 4HJXA 2BTEA 5A4MS 4A9AA 1CC1S 1YDHA 2PU7A 3LIPA 1XA3A 3LLMA 2O19A 1IATA 1LV7A 1JQKA 5LZ7A 4YA6A 3VISA 2J8ZA 2Q3HA 4KFTA 2Z6AA 2VEDA 4BE7B 2P7HA 1QQ6A 5EG5A 3E3NA 3FGZA 3TUIC 5BW4A 3RSQA 2ZBRA 3FSRA 2PX4A 4Q1CA 3KQWA 1DIOB 1U2RA 1QFMA 4L75A 4OBXA 2B30A 421PA 1RFLA 2YVKA 4E32A 2FVXA 3PPYA 4ZQIA 3T3PB 4GI1A 1BCSA 4S1NA 2YFKA 3AY6A 1U0EA 4ZYVA 3EX7C 3HDGA 3OP1A 2IXTA 4WN9A 1IB0A 1D1QA 3CY6A 3FW1A 4EDHA 2HA0A 1FYEA 2J5XA 2QPOA 3A6JA 2FE4A 3F5DA 4OA8A 3ESQA 1Q5PA 1N2ZA 3NFYA 3TW0A 5JT1A 3I5YA 2F55A 5DX8A 3GUYA 2LZ0A 2YNMA 4YACA 1UBGA 1FSFA 1ZP6A 4ZO8A 2WHQA 1CUDA 3CN7A 4QUDA 4P86A 1DWOA 1V3TA 1T5IA 2YWRA 3AT1A 3KR1A 2CLHB 3N0WA 3NDPA 4YFVA 5GOZA 5FNZA 1TT5A 4UXHA 1UQUA 2HYIC 4N5NA 2HK8A 4UXIA 3TR5A 1PQ4A 1OAOA 4HWPA 4Z0HO 2X3FA 1E20A 3VHLB 5EJ8A 5JFOA 1O4VA 3K9GA 4HDKB 1P2UA 3DMNA 5LQNA 4CFYA 4QSMA 2WU0A 3SM3A 3IP8A 2XA1A 2AXEA 4DLWA 2XRYA 2HPAA 4U6QA 2CEAA 2X0JA 3A3PA 4K9LA 3V8RA 4IGEA 3JQCA 1LQ2A 5L45A 3ZD6A 3AU8A 3P5BA 4BNXA 1U6IA 2YR0A 2QN6A 3CZ9A 3KTOA 2UYOA 2IXEA 2EIHA 4BFZA 2Y71A 3G0GA 2YVLA 4TM8A 1G291 1Z8FA 4ALKA 3DNMA 5K1ZA 3ZV3A 2ZSUA 2Q9AA 2XE7A 1WRBA 4A15A 2DHEA 3DE4X 3RKSA 2AZDA 3LX5A 3DXYA 5FWYA 5LDDC 1ZKMA 5H81A 2I1QA 2RHOA 1PQUA 5EOVA 4A92A 3RU9A 3B48A 3L2OB 4NATA 5CYOA 3V80A 2DBRA 1QFSA 1OYYA 1L1FA 3R41A 1U3WA 4LK3A 3VTAA 4HRAA 1PSDA 4XB1A 1SKMA 2B20A 2HZBA 4M7OA 3K1AB 1Y0BA 1IONA 3F5SA 4FK8A 2JFUA 1PWEA 3HGQA 1EK0A 3HU3A 3T7TA 4LZLA 1W52X 2GHQA 2YMLA 2SICE 3WK6A 5B2FA 1C9YA 4NRDA 1KR2A 1ZI8A 2HRRA 3PUYA 4OFXA 4JR1A 1QG4A 1PS8A 3S2UA 2QSUA 4LQCA 1XNGA 2RHDA 3WLEA 4CFSA 3R20A 2G83A 4TSKA 3FYSA 5DLDA 1ZU5A 3S2ZA 2OAP1 4CR6A 5A3QA 4G5XA 3V2UA 1A7KA 2P3LA 2RMKA 4X66B 1QTNA 1DTWB 4QTTB 4R1LA 5DWVA 2QBYB 3WL8A 2JIZA 3V2IA 1YJCA 2GDJA 2EX1A 1SY7A 1WZIA 1S2GA 1XKQA 1H05A 1D4OA 1JPJA 3ETGA 3H9GA 1QFXA 3PDWA 4NJMB 3IOMA 4UOQA 1GUFA 5A7FA 1XAJA 4K88A 3A4IA 1VB5A 3T1VA 2GO1A 5CEFA 1R5OA 4OUKX 1GPDG 3QLUC 2HDOA 1TLLA 3DAHA 4LPKA 1E6LA 3IBTA 1F6WA 2ERXA 2JARA 3ENKA 3CH5A 4DGSA 5EHQA 5AKKA 4YV1A 1E9BA 1OD6A 2VF2A 3MBKA 4CBVA 2ABWA 1E5LA 1GGJA 1NUHA 1NM5C 2EKQA 3MAAC 4ZC1A 3LQRA 3RF7A 3SJUA 4D41A 4D25A 1KRWA 2PG3A 1H1LB 4R2WA 1T24A 4B6GA 3U16A 2IK8A 1SKYB 3ZPXA 2J9XB 4AWXA 1THGA 1HSZA 2CK3D 4XM0A 3BBPA 5FUBA 3DUFB 4HUQA 4KX3A 2W4IA 4D74A 2ZSEA 5L4SA 2VZ0A 1XLWA 1BYUA 2L2QA 4TWAA 2DR0A 1H0RA 2X3UA 3I8XA 4DSZA 4WACA 3K0CC 3EEQA 1CULC 2C8VA 4DPKA 1CFZA 2QLNA 4AJ2A 1R5JA 1DKNA 1RJGA 2CDAA 3E53A 5F52A 1TKCA 2JIBA 1KO4A 4RZHA 3KALA 3ABZA 3EPRA 4RZSA 5DNAA 3INRA 1KK3A 1ST3A 1XBTA 4LOHA 1PUJA 2NU7A 4H7PA 3Q8LA 3KSAC 1BMFA 2NO1A 3CF6R 1IN1A 4E70A 1AB5A 1H5QA 3FDXA 1CUIA 5ALIA 1G8AA 5HWSA 3R44A 2FPMA 3ITKA 2HMYB 2LR0A 3R3JA 3B6MA 5HUHA 1ZGAA 4B45A 2WLSA 2OB2A 2YWBA 1OFTA 2ID9A 1U9ZA 2Y77A 1R3UA 3HZHA 4HC4A 1OLSB 4O2BA 4Q3AA 1ODTC 2YHBA 4EVRA 4B4OA 3GFTA 4CQMB 5I8PA 3NFRA 3MYYA 1ORTA 2D2VA 1Z0KA 4LDAA 4D0NA 5CB0A 5FR2A 3AUUA 4KDRA 5JROA 1YIAA 1XC7A 1XQ1A 1DZIA 3HADA 3VBCA 1SWWA 5JAMA 5M04A 1KTIA 1QR2A 2KE5A 5SV2A 1LEHA 3IBSA 4DV3B 4IYJA 1GUYA 3OP4A 1L4HA 5L51A 4U02A 2JFOA 1ICEA 1BO6A 4EF6A 1Q0ZA 5LMZA 1OH8A 2H18A 4B31A 4J16A 4UOEA 3QU5A 4IQFA 1UT6A 3HI6A 2OC9A 1KZ7B 4BMZA 4TLBA 4G0UA 4MCJA 2FYTA 1XF9A 3I6YA 4J76A 1P1CA 4PTLA 2B8WA 4LNUB 1VE1A 4MMZB 2D8MA 121PA 5B4TA 1GEGA 4R05A 4U00A 3QBVA 4UC0A 4EMSA 3U31A 5KVAA 2FA9A 3WL5A 4E12A 5K8UA 4IQ0A 1A2BA 1Z26A 1G7RA 2DPLA 3WGMA 4BHTA 3EXHB 4C29A 3U4AA 2CVQA 3CV3A 5JAPA 2JBWA 1QG0A 2BJWA 2FPLA 4UUAA 4ZDWA 5BNFA 3V4FA 2P35A 2WMYA 3RC8A 1NYQA 3HBAA 2W37A 5B6IA 4D6PA 3JVVA 2QL5A 1REQB 1YS1X 5DM60 1FJ2A 5MN6A 3VNAA 1G16A 4AJIA 3N8DA 4M60A 4A0RA 4BP1A 4EITA 3EVZA 4LEIA 2XWBF 4ETIA 2VYVD 3H17A 2H07A 2IE0A 4CR7A 2Q0XA 3ADKA 4FYIA 3RJTA 4C4ZA 4B6RA 3RKRA 2VP0A 3LP6A 3HJAA 1CUJA 1LPNA 3REGA 3QVOA 5DPMA 5ADUS 1NQUA 1T1IA 2IYRA 1QHXA 2QA5A 3C2QA 2IXDA 1CP3A 2OPBA 3FN4A 4L95C 1EDDA 2CZCA 3TZHA 2O52A 5DASA 3DO5A 1YRHA 2G09A 3GXBA 3MTBA 3BWVA 3UAVA 3WLPA 3T1OA 2BZSA 4B3TB 1RM0A 2VZEA 4IKPA 2I66A 2I1VB 4XDHA 3RROA 1H4VB 2CFTA 4PY2A 4WDRA 2H52A 3ZHZA 3C1AA 4ESHA 3U1VA 4Z49A 1KVTA 4JJIA 5J4HA 3OEYA 4GLJA 2RK6A 2EZ9A 1NXPA 3FPBA 5DCUA 4DA0A 4BNVA 5FCDA 5EQTA 5EAIA 4O4LA 2VJOA 3W1WA 2BH9A 2ZDQA 2A2ZA 3C8UA 4MR7B 5HR5A 1X1BA 4U7JA 5JJ5A 5DRTA 1JUDA 3PIIA 3A1CA 5ARBA 3OC6A 3L4BC 1DC4A 1R15A 1XEXB 3EXG2 3OWXA 4M1QA 4LQ4A 3RFTA 5FFMA 4HEJA 2H2HA 1MFPA 5ANRB 2QAGC 4L85A 4AAYA 1XEAA 4LWOA 1NNEA 4OBWA 2QDKA 4RQUA 2Q0HA 1V41E 1IOVA 1SK9A 3DL0A 5SZHB 5BSRA 1DRJA 3KOUA 4I1VA 5EPEA 5F2NA 3N1UA 2QZPA 3H42B 1NP6A 1BQEA 1R74A 3HA7A 3RV3A 4ZRNA 2BGWA 1G8HA 1RQPA 3EXHA 4OO3A 3QQ5A 4W9NC 4OL0A 3STYA 3FOCA 1OLXA 3EQ9A 4R9SA 1DARA 3Q2KA 3RE1A 2R4QA 1PN3A 2XV1A 4YUVA 2KBFA 3PTAA 3KB1A 2CL6X 3WGVA 1FEZA 5DK4A 2YXPX 5JWOA 1TLTA 4AJLA 2P9BA 3MQ4A 3SP1A 1X80B 5LLSA 1NBIA 4KQ6A 1QO9A 5I4BA 1JXMA 1TCAA 4RKQA 2PSFA 4B3BA 5IDQA 4MUBA 3GRCA 4PX3A 4QWMA 2MINB 3WR5A 3JW8A 1TK9A 5JH7F 4HZUA 2NX2A 2I2WA 5CTJA 3DP9A 2WKSA 3GFRA 2X4GA 3TX2A 5CVJA 1LW7A 3EVDA 3H18A 4DE5A 3IQHX 1P39A 3G8YA 1XA4A 4A5OA 1PZFA 2O5CA 1KP9A 3P5SA 1MQ9A 1UMKA 2LKDA 3H4VA 4URUR 3TOVA 4BNYA 1GPH1 1FDOA 4DV5B 4G2TA 2ZBGA 4HX2A 1WOYA 3RFUA 3BGWA 5EXSA 1B43A 3PENA 3ONVA 1MV5A 1BCRA 1JFLA 4HH1A 3B6JA 4EPRA 1FBNA 3IMGA 4NJEA 5C1PA 4AC9A 2B4KA 3DAFA 3DFIA 1CUWA 1L6RA 5KHOC 2J9GA 5TVGA 2YHUA 1J23A 3AI7A 3DQPA 4ZO7A 1CDZA 2J32A 1QMGA 1YQ9A 2OESA 6ABPA 2R9VA 2ZPAA 5KNCD 4UBOA 4GM4A 1DUIA 2XUDA 1BRTA 1XDSA 1YOBA 2YY6A 2RKWA 1T8UA 2C2WA 4NHOA 3I09A 3MCWA 2LCFA 3PUJA 4GX2A 3WGGA 2NMVA 5BOSA 4G65A 1C1DB 1RRVA 4DMGA 4MUNA 2BHTA 1XRMA 3Q72A 3E84A 4MCAA 1BIFA 2V7QA 4PBSA 4HDOB 5KYUA 5JCOA 2QL7A 1XWFA 2DU8A 4I19A 4AN1A 1LU9A 3OCJA 1GR0A 1KVSA 3FUUA 2DSTA 5TV2A 5F1KA 5LD2C 4W5QA 3DHYA 4YRTA 1DT3A 5EZYA 1PW5A 4UCQA 2WMNB 5EJ7A 3TLJA 1QYWA 3W0LB 2WJGA 2C7QA 2N75A 1M1ZA 1VL6A 1GFSA 2YQZA 2P9TA 2W2TA 2X5XA 3L8HA 4ZI5A 5CA1A 4F2DA 4YWJA 3PA8A 3HMQA 4O3FA 2G28A 3L01A 1GV0A 2Q5JA 3T1QA 3EEFA 4A0SA 2XYPA 1ZK2A 3IEMA 4FUTA 4QIHA 1D7AA 5AKJA 3RG8A 2ZJOA 2WAYA 1RC0A 2XIQA 3JXEA 4FUQA 4UZFA 1VYVA 2MYNA 4EY5A 4ZOCA 1P2SA 4TVSA 1N9KA 2VPQA 2Y2UA 4LMRA 4OIMA 3IPAA 3P4XA 5HGJA 1Q7TA 1Y63A 2XTNA 4H1UA 3P32A 4R68A 4BV3A 3UB3A 3AFNA 3JD2A 2P9YA 4UHHA 4EWLA 5EE5B 4DNQA 1SKUA 2F1KA 1VJDA 1IBSA 4HZGA 3ZGOA 1PR3A 2PSEA 3UBTA 5CCEA 3MS7A 3RUHA 3T7DA 4LRQA 3QUQA 5BV8A 1X3SA 1KYXA 1Q1ZA 5A4AA 1IPHA 3EEYA 5IKMA 1VLJA 1NN1A 3H5IA 1HSOA 1IN8A 5DULA 1V5EA 2P9HA 5AKYA 2WIJA 1MA3A 4DLZA 5J2UA 4W1RA 1E96A 2AJDA 3O83A 4EGCB 4HH0A 1ZGHA 2XMGA 3E5RA 3KKMA 2UYQA 1Y4AE 3L84A 4HLUC 3NUGA 3WIOA 4YRLA 2AK3A 2OAGA 4I4IA 2JIPA 2ZAIA 3IAAA 2W4MA 3H7IA 2YW2A 1KL7A 3BMNA 4M8KA 3PHHA 3TB6A 2D0IA 1ZH2A 4XVRA 3ROFA 1P74A 4ESVA 4R16A 1K7FB 4MUIA 2W83A 2DLCX 4NENB 1Y3HA 2Y0DA 3GA5A 3SKYA 3SC2A 4I2VA 4I99A 1KI1A 3R7SA 4W7IA 4MW9A 1TD1A 5KVSA 3ZQ6A 4GOMD 1CB0A 1WUKS 4WXMA 4EECA 1G98A 3JQ7B 5H5JA 1DOHA 1EINA 5CDUA 4HDMA 1I94B 3ZV7A 3BMCB 5CVEA 4NMXB 1SVKA 2P0YA 4L50A 3AKEA 2C20A 3A1VA 4L9AA 3V42A 3W8RA 1FL9A 2DHDA 4EMBA 3FOEC 4COKA 4UJ5A 2NP6A 2FLVA 1G5HA 1L4GA 1VGQA 2WSLA 4MRRA 3BWXA 3A7DA 4NZYA 2E85A 3PC6A 4N8DA 3WK5A 3PFBA 2V7QD 1HE5A 1SXJD 4EB6A 3KJZA 2E4YA 4RDCA 2QD5A 2ZUUA 4WCDA 2DERA 3KJEA 1XVLA 4E5VA 4PRYA 1KEEB 2GKSA 2AB0A 5AKEA 2BM9A 4Q9DA 3OQVA 1KO1A 3FLAA 1R2QA 2A9VA 2QTBA 3L7DA 4BFLA 2VHZA 4RSHA 1UT8A 2NNLD 2Y27A 1I8TA 2XKJE 4GPIB 4TTSA 3MG9A 2YVAA 3OICA 4M8IA 2PYZA 2V6MA 4QGAA 3A6HA 5K7SA 3R5XA 2HF7A 1NT4A 2FPIB 2X14A 3DL2A 3R77A 4Y18A 5E9JA 5EP3A 4GKJB 3PHCA 4KO8A 4M46A 1YQWA 2SCUA 4M4SA 4MS3B 2I6UA 2UXDB 1NIPA 4Q9IA 1KYYA 3ZVRA 1TYCA 2B1RA 4HDKA 4OP3A 3OQJA 4O8CA 4F4IA 3B1WA 4L3WA 1FXSA 5K3AA 1CT9A 1T9ZA 4HAXA 3V8NA 2IEIA 4CU5A 3I05A 1IEXA 3K1JA 2ANBA 2ZJZA 4HDAA 2CJPA 4LHWA 3WYCA 2QTVA 1ZM7A 1XQVA 2HD4A 2WF6A 1W85B 1AKYA 4WLNA 5JAUA 1GEEA 1TKAA 3ZTYA 1QIMA 5JSKA 2O1WA 1V9SA 2PU5A 1QYRA 4NAVA 2NSJA 1KJNA 4OAPA 5JTTA 4L6CA 4LUCA 3GN1A 1OGIA 4A1FA 3T61A 4ZAXA 5TARA 5A5VA 1HYGA 5FHRA 1C30A 4MWBA 2GM3A 3VX3A 3N86A 4D44A 5C80A 5DBEX 3D8RA 4P81A 1ZQ1A 2QJWA 3KYBA 4HPJB 4B7CA 2WTNA 4IX9A 1LS1A 4WZAB 1QIHA 2PAFA 4TTVA 2I6GA 3LUFA 3IUJA 1PI3A 4QXRA 4GHWA 1PEAA 3BM5A 3DOEA 1C9EA 4U2DA 5DSTA 4PO9A 5EHZA 2XNHA 4Z2YA 4I2NA 3I23A 4KTTE 1AMUA 4WZBE 2VJNA 3N6XA 4FGUA 4RXUA 4M1TA 5DO9A 2BI4A 3HHPA 1MT0A 3JD3A 5DNCA 3T5BA 1VKRA 3ANYB 3K8OE 2ORED 2K5UA 2ZYAA 1USGA 3ORSA 3PX3A 4GFDA 3TLGA 5L4NA 3CF2A 1RWNA 4DSTA 1JG3A 5BXQC 2DUWA 1B41A 3IJ5A 2ZATA 4JLOA 4BNNA 3THRA 2FMIA 4JI3B 2D7CA 4YRIA 1OU0A 2H06A 4OFZA 3E9CA 3EPHA 1MIOB 3EXEA 3ULKA 5AXCA 3HU1A 2Y67A 4EGFA 5JCZA 2KJQA 2YRFA 2HZ7A 1TX4B 1GRCA 2O57A 3ETEA 3PT5A 3QKWA 3CH6A 3W2EA 4ZYTA 5HZKA 1VCOA 1U2SA 2PEYA 3PC8A 1RYZA 5HFAA 5T4FA 3OZFA 1JIJA 1XJCA 2ZU6A 4PGFA 4B0OA 4JOBA 1EWKA 2KX7A 3AOEA 3I1JA 4G5SA 3FGNA 3I32A 1C4WA 4NEGA 5SY9A 5DYGA 2E4AA 1H0KA 4DZRA 3CF0A 3R09A 1W85A 7MDHA 3RPEA 2QD4A 2BGJA 4MK4A 4Y67A 2WP8J 2QG9A 1J1ZA 1J56A 4EHHA 1UEIA 3K0FA 4WKPA 4MH0R 5LXTA 1H2HA 2XVAA 4E14A 4XARA 2P30A 5UKDA 1PZHA 3AVXA 3H97A 3LWZA 3EDYA 3WJ2A 3H05A 1TECE 5IVPA 3RF6A 4JT2A 1NGSA 4B0PA 1AO3A 4YJDA 2O8DB 2G8LA 4B33A 2B4AA 1BN7A 4CM8A 1XMSA 5HBGA 1J0BA 1XMJA 1Q1QA 2CJWA 2JAWA 3WWCA 3OQOA 4G2NA 2E89A 2X19A 2Y2VA 4CIXA 2CCJA 4ZQCB 4G4SP 3CXUA 2XWSA 1CY6A 3ETDA 4H6WA 5F35A 2IV7A 2WWVD 5EWJA 3UTDA 1J8DA 1T5LA 3WIEA 2KMLA 4B8YA 1GYPA 2QU8A 4FNOA 3ROPA 3ZX4A 4D9CA 4DVGA 4FDAA 2E5LB 1KSJA 2H1SA 3R5JA 3D8SA 1WU8A 2VRCA 3KPVA 4IIJB 2NZXA 5B55A 2IKSA 2GZRA 4IMPA 1L9KA 1Z7EA 1H22A 4V0ME 1TYAE 2EHDA 1B0PA 3R23A 5BSFA 2GD0A 4NAHA 1I1QB 4H1TA 4RMIA 4U2GA 5DIZA 1LTKA 1AHIA 4WJZA 5BWMA 3I5XA 5I7HA 1DZ3A 5JEDA 1SELA 2WFMA 3CN9A 1JAXA 1O1YA 4RK0A 1CQIA 4G1EB 3VR6A 1NY6A 2WFLB 3GJ4A 2NUTA 2HOQA 3ZJUA 5GJVC 1B6SA 2FOLA 1VIVA 2WC1A 1PV1A 2AC4A 3IILA 1CY1A 1D2MA 1F0YA 2QL9A 3ADOA 1DWQA 2O7SA 5DKFA 2RJOA 2R0QC 4PYQA 2BP7B 1A3CA 3NBKA 3W8EA 3AVVA 1UDAA 1DDGA 1Q77A 2O23A 2CUTA 2NV2B 3BCHA 4CM4A 1N2XA 3H2KA 4QVIA 4I55F 3TD2A 2WHEA 1GKUB 3GFFA 4GZMA 4BZQA 3W6OA 5JDIA 4OI4A 1LGYA 2QR3A 4J49A 3ZHUA 4S0XA 1EVQA 3W4IA 5BSWA 1JEQB 1UL1X 3H0KA 2XDWA 4UXJA 1NBMA 1L5SA 3ONWA 5KI6A 4ZOQI 4W9MC 4DUYB 2CT8A 2EJWA 2C58A 4PLZA 2GPBA 1Q12A 3OFKA 4QL3A 4QXOA 4UU0A 4D99A 5EXDA 3F3KA 1S4QA 4HGYA 4FPXA 2AH5A 4PYLA 2EATA 4TL6A 1I3CA 4RTRA 1MTOA 2XNSA 3IP7A 4Q9JA 3Q41A 1T5DX 3P7MA 3UKJA 4DF3A 3R5FA 2YYSA 2ID8A 3K5IA 3KAJA 5L95A 2EHJA 4GL2A 3KFXA 2EL7A 3DF9A 3H3XA 3IVXA 2XXBA 4MV5A 4PLVA 5CT6A 1PLKA 5TPWA 3REFA 3ZV4A 1T36A 1RI2A 3IPLA 5EWJB 5C5EA 3B20A 1IY1A 4A6XA 2VAVA 3Q6IA 4EG7A 1NVXQ 3BHNA 1MZVA 3M9WA 5KC8A 4RD6A 4N54A 4ARUA 3N59A 1AURA 1NJGA 4EG5A 1YRLA 4QOSA 1KJYA 6PFKA 1CR1A 3CX7A 2YV1A 4TN1A 4UU7A 3B60A 4LSWA 1HT3A 3MA0A 3JATB 5ALRA 2BEJA 5HZMA 2C0PA 2ZEJA 3J7AC 2H4YA 1GAXA 2A0FA 3FNQA 2UVDA 3S81A 4RZUA 5KNBD 4HFNA 5A9SA 5CNJA 2PLRA