2QXTA

Crystal structure analysis of the bacillus subtilis lipase crystallized at ph 4.5
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
179
structure length
179
Chain Sequence
HNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSADMIVMNYLSRLDGARNVQIHGVGHIGLLYSSQVNSLIKEGLNGGGQNTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Lipase
publication title Structural basis for the remarkable stability of Bacillus subtilis lipase (Lip A) at low pH
pubmed doi rcsb
source organism Bacillus subtilis
total genus 66
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2007-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qxtA00
4BVJA 4RE5A 4F5ZA 4Z49A 2XMCA 1ORVA 2GBGA 5AI8A 1ZIXA 2JGEA 5IKXA 1XLUA 1X70A 2W6CX 4DLNA 1CUAA 1Q84A 3H1AA 1VXRA 1A88A 1EA5A 1U4NA 4OPMA 1ZGCA 1A7UA 5I7UA 2QR5A 4DSAA 2W22A 1E89A 1WB5A 3ZLVA 4NMWA 3FSGD 1WCYA 5HKBA 2HRQA 5E4YA 4OYLA 3FBWA 3HC7A 4Q82A 1TCBA 3BJRA 4OSEA 4QA9A 4X71A 4Y2RA 2WHRA 1J06A 3AUKA 3G9TA 1ZI8A 2BAGA 1FJ2A 3FLAA 2QMQA 2XLCA 3K2IA 5CT6A 3VJMA 4OD0A 2D5LA 1OILA 5AKYA 1TAHA 4J0JA 2OQIA 2HADA 3ESAA 3JYHA 3PF8A 3IDAA 3K6KA 5HF6A 4BDSA 3O4IA 1AX9A 1VE6A 1CR6A 2WUFA 1IZ7A 1R1DA 5LKAA 2WFLA 1R3DA 3LS2A 5ALRA 4KRXA 5LYYA 1IUPA 2BKLA 4UHFA 1FSSA 1FFBA 1YAJA 4H7KA 5HKAA 2ZYIA 2O2IA 1N1MA 4AO7A 1ETHA 4B82A 4J03A 4WY5A 3I6YA 2QUBA 1QFSA 3STXA 1YS2X 3D4LA 4CCYA 4DGQA 1CUUA 3PUIA 4KRYA 4UHHA 1H2WA 2DQZA 2HHAA 4OCZA 4H0CA 2AJDA 2VATA 1EX9A 3OTQA 2XUDA 3AIMA 1HLGA 1XKTA 4JUIA 5FP0A 2EEPA 4QLOA 1U2EA 5ALXA 1QIFA 1ZD4A 2OAEA 3QMMA 1H23A 2DQYA 1QLWA 4DMHA 4EY7A 1E8DA 1IUNA 5AP9A 1U8EA 1CUYA 5IVKA 3QM1A 3I2GA 5CT4A 3AZOA 1ZIYA 4W1RA 2GBCA 4WDRA 3BIXA 4J0DA 4BC0A 5DYWA 1WHSA 1H2ZA 4IQ4A 2JGJA 1EVQA 2O2GA 3V48A 2V96A 2QM0A 5CXXA 5LZ5A 1QOZA 4WY8A 3DS8A 5J3JA 5D7BA 3WZMA 2H7XA 3BDIA 5A71A 4G8BA 1XZKA 4J3JA 2E3JA 1Z68A 5CRIA 2WIDA 2ZVDA 1CUDA 3C8HA 2HA7A 1HL7A 5LP1A 4UBLA 1O6GA 1DWPA 5F4ZA 4HTAA 3BF7A 4G4IA 3R3ZA 1N5MA 3STWA 2BJHA 4DMCA 5LZ4A 4BAGA 1HQDA 5JD5A 5ESRA 5CH5A 3R3XA 1K6EA 1R9MA 1BCRA 3DOIA 3TRDA 3ZLTA 1N5RA 4P92A 5AKJA 4FLEA 2OGSA 2C4HA 2AJBA 2CJPA 3I2JA 1NU6A 5HQ3B 3RM3A 5DTJA 4CFSA 4Y2YA 4L9AA 2XUOA 4PNZA 3F9CA 4YASA 3RLIA 1A8SA 4BP9A 4EUSA 1ODTC 2XUFA 1UK9A 1UWCA 4OU4A 3QVMA 4EBBA 1BROA 3WMRA 5K3AA 1TCAA 4MWTA 2WJ4A 4ZGBA 3PFBA 1HBJA 3LP5A 1QE3A 1XLVA 1UK7A 3E1GA 4F0JA 1YASA 3CN7A 3KOOA 2ECFA 2ZYRA 3T52A 5A7HA 3H2JA 2Z3ZA 3AIKA 1JU4A 1W76A 4CG2A 2C7BA 1ZI9A 1XZMA 4Q3KA 5DNVA 2YH2A 2D0DA 4FFWA 4EZIA 4DMKA 5KREA 2XQFA 3JWEA 2EDCA 4Y2PA 1P0QA 2WG1A 2WIJA 3I1YA 2HL6A 5IVDA 1W52X 3R3YA 1GKKA 1DINA 1U65A 3KD2A 2JEYA 4C4XA 2WQZA 1WM1A 3C6ZA 4UBNA 2WJ6A 2X76A 4H7JA 2OCLA 5ALZA 3V1LA 4GDMA 2VAVA 2EDAA 4X6XA 3ZI7A 2ZYSA 3R3WA 5K5EA 3D3NA 5I8PA 5HZGA 5LZ9A 3OURA 5JATA 5BWBA 1M33A 3HABA 5HK9A 2PPLA 2VQ6A 3STUA 3OM8A 2Y1KA 4G8CA 5FPPA 6YASA 3MUNA 1NX9A 3YASA 2GBFA 4BRSA 3SC2A 4JNCA 3FYTA 2VTVA 5AKHA 3CXUA 1B41A 5AK3A 1TQHA 1J07A 4X6YA 2RAUA 4XVCA 1LPAB 1XQYA 4HS9A 3AIOA 3L1HA 4PV7A 3C87A 2VAXA 3M81A 4NZZA 4J7AA 1JKMA 1F0PA 1HKHA 3STYA 5ALVA 2ONCA 3C6YA 3HACA 4P9NA 1OXMA 2O2HA 1ZD2P 3WL7A 5HQ3A 5AM1A 4HXGA 1CUHA 3ICWA 3TGLA 3W04A 4B84A 1Q83A 1LZKA 4UPDA 3Q8WA 1XZJA 2I3DA 1C7JA 2Z3WA 2GZSA 2WJ3A 3RKSA 4FOLA 3O4HA 1LGYA 4K6HA 5AHXA 3GA7A 1JMYA 4U2GA 3QYJA 3FVRA 4AN1A 3STTA 1MJ5A 1EXWA 2IITA 4B7ZA 2X5XA 4LKOA 4Y7DA 3D2CA 3FVTA 4X00A 4EB0A 3C8DA 1DWQA 1ZD3A 2OG1A 1IMJA 4GI1A 1QIJA 5AK6A 2Y6UA 1QTIA 2YXPX 2VEOA 1E66A 4N8EA 4HAIA 4MXDA 3QH4A 1CFJA 4BTVA 2J3QA 1XRRA 4N5HX 4JYPA 3B5EA 5DWDA 2GYWA 2WFLB 1Y37A 4QDXA 4H7IA 5JZSA 2VJDA 2Y2UA 5JASA 1R9NA 2VJCA 4C6HA 1DX4A 3MGAA 5JZ9A 1JJBA 1JT2A 4C4ZA 1BN7A 3OG9A 1K63A 5CT5A 4WFIA 3IBTA 2DFPA 4X6UA 3SX4A 2WU3A 2FJ0A 1QIDA 5JALA 5JAOA 4YK7A 5D3ZA 3MVEA 4UUQA 1KU6A 4TVKA 1WB4A 1UK6A 3NGMA 1LBTA 2Y6VA 2PL5A 3V9AA 3FOBA 4H7DA 3T4UA 5JAPA 3LIPA 4S0XA 1MN6A 4FTWA 1XZAA 2JGIA 4CG3A 3WLAA 4BRZA 4ZV9A 1K8QA 5FLKA 1N8SA 4BTLA 4UFPA 5ALQA 1CUVA 5DYTA 3DCNA 1LZLA 4Q05A 5IH7A 3I6ZA 1WHTA 3WQHA 1YAHA 4J0HA 1QGED 4FMPA 1E8MA 5AI5A 5AO9A 1MTZA 5AM2A 5LZ8A 5CBKA 3JW8A 2HDWA 3ED1A 3WK4A 5AM3A 1EDBA 4BZWA 1JU3A 2GYVA 4BE4A 3FSGA 3D0KA 4QE3A 3W05A 2K2QB 2WHQA 2OAGA 1RP1A 3HI4A 2WSLA 1EK2A 4BDTA 1UFOA 4EY5A 4RNCA 1EH5A 1THGA 3QMWA 4BCDA 5ISMA 4H18A 4I19A 3WJ1A 3E0XA 4X3CA 4CIBA 1XQXA 4MJ3A 3NUZA 5AKLA 2DCMA 4BATA 4CG1A 4J0IA 4HZGA 3IUQA 5EIEA 5BOVA 2G4LA 3C43A 5AM0A 3C6XA 1BE0A 3ZLUA 3DNMA 2UZ0A 4TPKA 4GW3A 1L7RA 3V1MA 1W4LA 5AI9A 1E3QA 2WLSA 3D59A 2PSJA 1VZ2A 1QIGA 3WA6A 5C8ZA 5LLSA 2J4FA 3O9MA 4AO8A 1CUGA 1ZICA 1MNQA 2WTMA 1ZI6A 4HVTA 1CIJA 5DNUA 3VVMA 3PDCA 5HFNA 4KE7A 1Y7HA 3WWDA 1YR2A 1L7AA 1WPRA 2PKYX 2R11A 5AKIA 1DU4A 5AM5A 1ODSA 5KWJA 5HK8A 3KWJA 2PSEA 4J0CA 5ALNA 4XIIA 4KE9A 3VJKA 3FCYA 1JFRA 3UMJA 4X90A 4EHBA 4GBGA 2XMDA 5ALIA 5I9IA 2QJWA 1CV2A 5FPQA 3U0VA 2O7VA 5IVIA 2X8BA 3KSRA 3IB3A 4UFOA 2HU8A 1TK3A 2IX9A 1DTEA 2BGNA 4U2FA 3DL4A 3AZQA 1ZGBA 2QKYA 5E4JA 4CI9A 4QDZA 2BCEA 5ALHA 1CLEA 1ODCA 3FYUB 2G63A 4AMYA 2PSDA 1GKLA 2HA2A 1MAHA 1XZLA 4BZZA 3FWHA 3KWFA 4KE8A 4J0KA 1G5FA 3W9BA 2XT0A 4PO3X 2C5FA 2FX5A 5AJHA 1UZAA 2JGMA 5A2GA 4MWSA 2V97A 5AI6A 5K3CA 2WIKA 2AJ8A 1CVLA 1LPSA 2CZQA 1GPKA 1CUEA 4M0EA 5EI5A 3QPCA 3H18A 1F0NA 1EDEA 3LCRA 4H77A 1R4ZA 3U1TA 4XWGA 2J4CA 3ZWQA 7YASA 1W1IA 2BUCA 1X2BA 2VJAA 3PE6A 5H3HA 2VJBA 3NWOA 5D3KA 2XMRA 3A70A 2HM7A 3G8YA 1HPLA 2XUIA 4I4CA 3WWEA 3G0DA 5E2IA 1CQZA 1XLWA 3G9XA 3WK7A 4PF1A 3DYIA 1TCCA 4X91A 1MAAA 1YB6A 4X93A 4BE9A 3DD5A 1SC9A 4AMZA 1E5TA 5EHXA 2O7RA 1X2EA 4G4JA 2PU7A 2AJCA 1R88A 2XMQA 3DLTA 5A7FA 4U2CA 3EQ8A 2HU5A 5CH8A 2R8BA 2I3ZA 2VA9A 4IH9A 5EFZA 4W1PA 3WL6A 4PQEA 4LXGA 4B6GA 1J2EA 4KEAA 5EIHA 1MX9A 5AICA 2DHEA 5T4BA 4B9EA 1CUCA 3G02A 4FFVA 1H2XA 4DNPA 2ZJFA 2QTBA 3G0CA 5FV4A 4BAUA 4INZA 2B20A 3QITA 4KAJA 1SOMA 2WTNA 4A16A 1Q0ZA 1O6FA 1MU0A 1YA4A 2V98A 2WUGA 5SYNA 4L72A 5K3BA 2ACKA 1QTRA 3W06A 2VT7A 1FFAA 5AKKA 1XQVA 1YS1X 3PUHA 3WL5A 5BWCA 1XZFA 3N2ZB 1UOQA 3W9UA 3EQ9A 3KDAA 5EHQA 2FUKA 5HF9A 4FNGA 1KU0A 4JYMA 2ORYA 3IUJA 2CB9A 3I2FA 1AGYA 3FYUA 4U2DA 3VISA 4B0PA 4F21A 1AZWA 5HF8A 1PJAA 5EHZA 5A7GA 2C58A 2WUDA 4KR0A 2ZSIA 5JAHA 3KXPA 1K5PA 1SFRA 4UBMA 1BEZA 1CRLA 4X92A 4B80A 3SK0A 2XUGA 3AJAA 5JD4A 1P0PA 2XQKA 4EY8A 4D9JA 1MPXA 2WIGA 2ROQA 5EGNA 2JGFA 1JI3A 1IVYA 4MYDA 1XZIA 3FLBA 3IUNA 4HXEB 1QIIA 3I1IA 5FDFA 4OB8A 3SWWA 4GEGA 4PSDA 4Q3LA 2H7YA 4C87A 4ZV7A 3E3AA 3ESCA 1UKCA 3H17A 1FFEA 1XRLA 1MX1A 1CUBA 4X85A 3WZLA 4AX4A 1XZHA 3WIOA 4ITVA 4GXNA 1XZDA 4UHEA 4GECA 2RONA 2P8SA 1XKLA 3L1JA 4BCCA 4DIUA 1ACLA 4IO0A 3VJLA 3VXKA 3H2HA 2G5TA 1F8UA 4E46A 3GELA 1VE7A 2XMGA 3GFFA 2QS9A 2XUPA 5A62A 1FFDA 5ALFA 4MQLA 4OYYA 2XUHA 1TRHA 3EBLA 3QPAA 2BUAA 1GZ7A 3WKDA 2Z5GA 3H2KA 1RYYA 3C70A 4ARAA 1XRMA 5A6VA 3O0DA 4GLBA 1OCEA 1IUOA 1CUFA 4X95A 1QIKA 4LHEA 5LZ7A 4BVLA 5YASA 4E15A 3BE8A 4YX9A 4B85A 5SYMA 4X7BA 3D7RA 3R40A 3R41A 4AQDA 4DSZA 1SCKA 1SCIA 4J0GA 4FBLA 3H19A 2QUAA 5CH3A 4NVRA 3F8SA 4DMFA 3A6ZA 2XUAA 3D2BA 3ILSA 3DJYA 1NU8A 5ALWA 4EA6A 5CT8A 3STVA 1GQRA 4H7FA 4KAFA 4Y2UA 2HFJA 2WHPA 2H1IA 3E4DA 4WDQA 4U2EA 4YPVA 3PF9A 1XRNA 3I28A 2PUHA 4L0CA 4QEKA 5DJ5A 1S8OA 1GQSA 2LIPA 1YB7A 4GWLA 1LPNA 4X94A 4G9EA 2VSQA 1PFQA 1WOMA 3ANTA 4UBKA 4WFJA 4QLAA 2Z8XA 1VXOA 2QVBA 2H7CA 5EHNA 3WYDA 2XQGA 3ESDA 4ZXFA 2GZRA 4KACA 2QXTA 2PX6A 3H0CA 5FRDA 3B12A 5JD6A 2OXEA 3CCBA 4K5QA 1QIHA 2H9YA 2RHWA 2XDWA 1AMNA 1EINA 5C81A 2QT9A 5CMLA 1UOPA 3EQ7A 4JEIA 1AURA 4UHDA 1C7IA 4AZ0A 1I6WA 1DWOA 1XFDA 2JGKA 1WPXA 1MT3A 1CUZA 5AI0A 4PSCA 3G9ZA 2B9VA 2JGLA 5ALPA 1G66A 3CCCA 3ANSA 2RHTA 4K6KA 1A8QA 2C5GA 1BN6A 2QXUA 5ALJA 4B9AA 5T4HA 5KWIA 2NW6A 2WG0A 3AILA 1XZCA 2HU7A 3AINA 2Q0XA 3WKAA 5K3FA 3A2MA 3CN9A 1EK1A 5K3DA 1QO7A 3A2LA 2WUEA 3M82A 1EHYA 1UXOA 3K9BA 4FHZA 1B6GA 5FOQA 4FWBA 3I2HA 3WK9A 1H2YA 4WFKA 3WWCA 1GXSA 4B0OA 3DKKA 3QMVA 3LIIA 5T4FA 4AXBA 5C7YA 1EB9A 4FBMA 4IHAA 5AOBA 1QONA 1DX6A 4H35A 3R3UA 2GBIA 3EF3A 2DHCA 4WJLA 2BUBA 5ALYA 3O4JA 4W1SA 3A2NA 3HLKA 1LPMA 4BCBA 4HRYA 2WG2A 1LNSA 2XMSA 3QPDA 1VZ3A 4RE6A 4FDMA 3IIIA 1A8UA 2Y2VA 1CEXA 4B83A 4W1QA 2VT6A 2AXEA 4HXFB 3AFIA 4BP8A 1D07A 2VF2A 3L1IA 1JMKC 1G42A 5ALTA 5AH0A 2B61A 3GUUA 1P0IA 1AQLA 1YSCA 5FUMA 1R50A 3S2ZA 3WK8A 4Q1VA 2ES4A 1Q0RA 3WL8A 5DYYA 2XE4A 4UFNA 3IUMA 4EY4A 4RGYA 2ZJ6A 5JAUA 2PU5A 2HA0A 1WB6A 3DL7A 4K6GA 2OGZA 3WWPA 5ALLA 4CIAA 3H2IA 4WCVA 1EDDA 4N5IX 5K3EA 1EB8A 2JIDA 5CXUA 2J3DA 4C89A 2XUQA 3C45A 3PFCA 3G9UA 3RARA 1ZJ5A 5E4TA 4ZI5A 5AKEA 4QDTA 3WK6A 1T4MA 5CTAA 3X3HA 1XRPA 1UKBA 3FCXA 2DHDA 2JBWA 3F67A 1VA4A 1FFCA 1K4YA 5JIBA 1JJIA 3D5EA 3VKFA 1LBSA 1BU8A 1AUOA 3C5VA 3WA7A 4CCWA 1G4HA 3V1KA 4UHBA 3PI6A 3I2KA 5C8VA 4PW0A 3DQZA 4Y2QA 5LKRA 3R0VA 1J1IA 2HIHA 4AO6A 4U2BA 2WKWA 1ZD5A 2XUJA 4FLFA 4BC1A 2XB6A 1UK8A 1GT6A 4Q3OA 3F97A 1W6RA 3B3QA 3RK4A 3V1NA 4M0FA 3UUFA 3WWOA 5ALOA 1XZBA 5ALGA 5CT9A 3GBSA 2OPHA 4FLMA 4A23A 2PSFA 5AKZA 2JEZA 3VDXA 2WILA 3WKBA 3H2GA 3O95A 1MNAA 4AN0A 1H22A 2XQJA 2XLBA 4M0MA 1XROA 1XZEA 3VVLA 2HRRA 4G5XA 3G0IA 1SCQA 4OU5A 4KJXA 2ZJ7A 4QWMA 4P93A 4RPCA 5JARA 3N0TA 2WIFA 2ZSHA 3OPMA 4KAAA 1CPYA 3O4GA 4ROTA 5ALEA 3H04A 3WK5A 2QRUA 3ICVA 5CURA 3IA2A 1F6WA 4L3WA 3TJMA 5ALSA 4UBIA 2QZPA 4C88A 4LXHA 1AC5A 1GGVA 1QJ4A 4BBZA 1CUSA 2XMZA 5DNWA 5JANA 3HYSA 3FYUC 3BJMA 1ISPA 2HA3A 1EVEA 1BRTA 1QIMA 4W9RA 3WI7A 2QJRA 3IURA 5T4EA 3WIBA 2YASA 4Y9SA 2XUKA 1CUXA 3FLEA 1ACJA 3NOXA 5ALDA 5ALKA 1DQZA 4G4GA 1C4XA 4N8SA 4OUKX 2RIPA 2ZYHA 1CUJA 2CUTA 4Y2TA 2WHPB 3W2TA 4DTCA 5ALUA 3F98A 4O08A 5AOCA 2XMBA 5AIBA 4G8DA 4QWWA 4IH1A 4XX1A 2HA5A 2HFKA 3HSSA 3ZV7A 4JH0A 4H7EA 1VA5A 2OCKA 3I6MA 4QDOA 1ZOIA 3DYVA 1YCDA 3Q0TA 4P08A 1T2NA 4V2IA 3EIOA 3FNBA 1IZ8A 5HFAA 2HA6A 2PM8A 4AB1A 3G7NA 2CMFA 3OC0A 2I03A 1XZGA 5FXMA 4E11A 1P0MA 4KYVA 4MYSA 4ZREA 2PBLA 5AKGA 3IVMA 2OGTA 1RWQA 4B81A 3GROA 4A5SA 1VKHA 1QZ3A 4NS4A 3FAKA 4MEAA 1LPPA 2WM2A 5LIPA 2I78A 1THTA 1L7QA 5FKJA 3DDUA 3BL8A 5DLPA 3HZOA 2PVSA 4AZ3A 4MEBA 3LLCA 3HJUA 4C01A 1AKNA 4DYHA 1XQWA 3G0BA 5CW2A 5EIAA 5D6OA 1DT5A 5K3FB 3P2MA 2C0QA 3MUOA 3HXKA 5ALMA 4FKBA 2CBGA 5AK4A 5AK5A 5LZ2A 1JJFA 4UBJA 4C4YA 3WKCA 2AJLI 5JZBA 1EI9A 4DM7A 5AI4A 3BIWA 1PV1A 1YA8A 4DNQA 2PSHA 1QIEA 2BGRA 4DNOA 4UHCA 3M83A 1TIBA 5BV7A 3BF8A 2JF0A 2FJPA 3UUEA 5HCUA 4PSUA 1QFMA 1VLQA 4QDUA 1BCSA 1VOTA 4XJVA 2XQIA 4BAZA 1MX5A 4I3FA 1CUWA 3HEAA 1UOOA 3AZPA 4Y2SA 3M3DA 1LPBB 3D2AA 4UBOA 4X97A 4IH4A 2G5PA 4Y2VA 1ZJ4A 2DSNA 3HRHA 2V9ZA 4LYDA 1GPNA 1ORWA 4LXIA 3G0GA 4K2AA 3QBJA 4DNFA 3S8YA 3GZJA 2C0PA 1QO9A 4Y2JA 4E14A 1LPOA 3IULA 3BWXA 4Q34A 2CEKA 4LYEA 5IVHA 4FNMA 5DTIA 4BVKA 2OCGA 1BS9A 1Y7IA 4Y2XA 1DT3A 4GHWA 2YYSA 3PICA 2BFNA 4OB6A 3DKRA 4HRXA 1MO2A 2DR0A 1TKRA 3O9VA 2XI4A 2B4KA 2OLEA 4G9GA 4OB7A 1GPLA 2RGUA 4QZVA 4EY6A 5AM4A 4W63A 4CCYB 3ESBA 4ARBA 4BB0A 1KEZA 2WFZA 3ZPXA 4KE6A 1CUIA 4LIPD 1LLFA 5HF5A 3TEJA 4ETWA 2PUJA 5JYCA 3C6BA 4QNNA 4F60A 4H7HA 1E8NA 5C8XA 5AOAA 3WYNA 2CKMA 2OQVA 3WJ2A 5JADA 1HDEA 2IIVA 1BEEA 2GYUA 3R3VA 2WFMA 2RI6A 3C5WP 3F96A 1DQYA 1UT6A 3I2IA 3OOSA 1USWA 3BXPA 5AKXA 4TGLA 4N8DA 1CQWA 2HA4A 3DEAA 4ZRDA 4MQMA 5KBYA 1VJ5A 2QOEA 3WKEA 1UKAA 4BYMA 3DOHA 1XRQA 1W75A 2OCIA 2WU4A 3QZUA 3H1BA 2ACEA 4G1FA 5AIAA 2Z8ZA 4ZWNA 3BDVA
chains in the Genus database with same CATH superfamily
3P0RA 3EH2A 1MA0A 2R00A 5CBPB 2ZXEA 5I9TA 1YMVA 3ZKWA 1HNNA 4JOBA 4ZDKA 1C1XA 1N2CB 1Z25A 2B37A 2XMCA 4PRYA 1E6WA 1DAHA 1PSWA 1H4TA 2ZE5A 4JLWA 4ZVTA 1JHPA 1ZIXA 2WWXA 2JGEA 3IHWA 1R9GA 2I55A 5IKXA 5IXSA 1X70A 2W6CX 4DLWA 1ZCJA 1CUAA 2ZYUX 2IYOA 3LA8A 3H1AA 2EL9A 3SF0A 1PJ8A 4G9BA 2ZI4A 4RLHA 3OAAA 1B8PA 4ENRA 3RJTA 4GVXA 3GI1A 3OLYA 1V35A 2Y1XA 4OPMA 1UQTA 1ZGCA 2B98A 5FBHA 2JHAA 1YKFA 3EWIA 1JZQA 3VR5H 2X0RA 4CKZA 5GZ1A 1EM8B 2W22A 1QLHA 4MVYA 1JKIA 3PPVA 3PP8A 1NONA 3E9YA 3OJOA 1WCYA 3NYIA 2Z0MA 1KSGA 3S0JA 1ZEMA 2W2MA 3NG1A 4BNXA 1RAFA 2JK1A 4DJJA 1ZZGA 3EVTA 2X8WA 3QVLA 4MZXA 1Y7LA 3JQ9A 5J23A 3WGLA 3RAFC 2YYYA 1USIA 4ETMA 3FH0A 3HB1A 4ND8A 2VHYA 3RTBA 3TLAA 3VBEA 3ZLJA 1XHEA 3OCCA 1T6YA 5EVJA 5EZYA 3UMGA 1TCBA 3BJRA 4M9XA 4CL8A 3OSUA 3W5VA 3D7KA 5IF9A 3AL0C 3PCXA 4A2PA 1DKOA 1J8YF 3F6YA 2WHRA 1W9MA 2XBLA 3WB2A 2B82A 3H5RA 5D87A 1N0UA 1IHDA 1VBFA 1ZS9A 5JNTA 3M1AA 5BYBA 5GGXA 1XPRA 2PVCA 2BONA 5K0FA 1FJ2A 3ZBPA 2QMQA 2YR0A 1DJOA 3OPXA 4K1XA 5H4HA 4LDRA 5KHAA 1NVVR 5A5EA 2NTNA 2PH1A 4D0NA 4V0KA 4NU8X 2OORC 2VTKA 2D5LA 4K8RB 1TYBE 2YMMA 3NB0A 1U0JA 4IG9A 1EBUA 1R6XA 4ZAGA 4BDSA 4IHJB 3X43A 3IQHX 2ZJZA 5DMXA 4AKTA 1VE6A 4EQ6B 3ASVA 5HBRA 2FRDC 3OHPA 1IZ7A 5EYPB 5EY5B 2QRQA 3AETA 1EMDA 1NF3A 3CW8X 5H80A 3G5TA 2QMYA 2YWGA 3E22A 3H5NA 4KI0A 5EJ8A 2V6MA 3CLRC 3N6VA 4DR1B 1I30A 4CL2A 4PLTA 3SLGA 3UGJA 1T25A 2ZULA 3PDJA 4ZD6A 3ETNA 2J9XB 1WBBA 1USGA 4G1BA 1G3IA 3IPXA 5KQGA 4V0SA 3Q7SA 2OYSA 2SCUA 3OEEA 3OJLA 3QVSA 4MR7A 3QKRA 5IWCA 2G82A 1NTOA 2BDEA 5LJLA 4FC7A 1TL7C 1IXRC 1OZAA 4BFVA 1HT0A 5FADA 2JD2A 1E20A 2JANA 2GT1A 4MGKR 1N1MA 4YCNA 4IWXA 4MPJA 3PX7A 4OHVA 4B82A 5BUQA 4LG1A 2IBMA 1T0IA 3FCSB 1R0WA 1KR2A 3GQBA 3V8PA 5LD2B 3P9RA 1WBJB 1P61B 3OEED 1L8OA 4QXQA 5BUSA 5JFTA 3D4LA 3VJRA 1S8FA 1NZJA 1AA9A 4TWJA 2R6GA 4Q1BA 1G7CA 3B6IA 4HH1A 3HO6A 4ICIA 5BW6B 3LFTA 4OFZA 1YQTA 2FFJA 3IUEA 1WDTA 3TGPA 2J9YB 2N42A 4ND2A 3R23A 1LK5A 2G09A 3OTQA 3FSRA 2W00A 3AIMA 2DUMA 3HGQA 1BFKA 4F6RB 5C53B 1M8GA 1M0EA 5CDFE 3NVMB 4FX5A 4X62B 1E6KA 4MB2A 1QRTA 3AERB 1U94A 2FW0A 4X1IB 4BO7A 3C3PA 1N5DA 2CDNA 3CPHA 3FDXA 4J7XA 1U2EA 4PG4A 2QENA 1QIFA 2OAEA 2PFGA 1OV4A 3BPSA 4HAUA 4OM7A 4BP1A 1H23A 2DQYA 5CDSA 1MOPA 3ER6A 5F2OA 4EY7A 1H0HA 4URHA 5I7AA 1I8TA 3QVJA 1E8DA 2R7MA 3IV7A 4RK4A 3UAXA 3PRHA 4M83A 3V7FA 3EVBA 5C8YF 1ZR2A 1XLTC 4Q4AA 4DQLA 4COKA 3GRYA 3DMTA 2CZCA 2NO6A 4WDRA 1LQ2A 1GFIA 3C41J 4K9KA 3BIXA 2AJTA 4JOCA 5FTMA 4BLPA 1Y63A 3JTEA 1JPVA 2WSYB 3WIDA 4A0QA 3T1HB 4YDRA 1D2RA 1EVQA 2IODA 4HF7A 4LBVA 2PUAA 4EPWA 1J0AA 3L84A 3KQPA 2AE2A 4LDZA 4KZKA 3ROXA 3EC7A 5LCXA 1V8DA 2D1YA 3MT8A 2BI4A 3FUXA 3ABRB 3O21A 4J91A 5JVDF 3O8BA 4AD8A 1L7PA 5JXIA 4LHYA 2JS7A 1TYDE 1DCMA 2II6A 1RYBA 3EWNA 3JQEA 4O8CA 2XZDA 4ZOBA 5D7BA 5HM8A 5MGNA 3L7NA 2UU9B 4II7A 3TOXA 1N1GA 2P6UA 3CW9A 2P40A 1N8KA 3BDIA 3EDYA 1QO0A 3E9NA 2UVPB 3EPPA 2QU7A 3M0EA 4GT1A 2D2XA 4DCUA 1N0HA 3ZGZA 3KYCA 2X0IA 5ARBA 4G8BA 3KDSE 4Q9DA 3HDHA 3K32A 3WLRA 4F4IA 3P2IA 1AQNA 4LGCA 5EP3A 1DQRA 2JIZD 4J3JA 1RPAA 2EZ9A 3CWCA 1M2KA 3GFOA 2H54A 1TCUA 4NYMR 3UHJA 1IHOA 1GT91 1JEOA 1FMJA 1Z68A 2VYQA 2WIDA 3QLVC 2AZMA 5CRIA 4BO1A 1P9NA 1R6TA 3D3WA 1DRJA 5ICMA 1EM6A 4UBLA 4AUKA 3MN1A 5FCDA 3T1TA 5F4ZA 4HTAA 3FPJA 1RI2A 2OXIA 5CA1B 4UEQA 1U1IA 1N5MA 2TMYA 2V0CA 1JEQB 2BHRA 2XUZA 3M49A 2Q50A 3N2NA 2XT6A 3Q3JB 2BJHA 4CMGA 3DWGA 3GHYA 1F1JA 4C0XA 1HQDA 2ZTHA 3IBGA 3IEPA 5JD5A 2V7QD 3N7UA 1LLUA 4KQEA 5FNVB 4YACA 1WKCA 4PCLA 5LA6F 1K8YB 4BQPA 2NV6A 4PXAA 1MVLA 2WTAA 3UN1A 3M2TA 2HW8A 2W9XA 4YJ2A 3DOIA 2Q5HA 3TR6A 3TRDA 3TZCA 2E4XA 4LJKA 5EXDA 3P0JA 2L2QA 4WZZA 3E3OA 2GA8A 4YRKA 3NIBA 2V7EA 4PPQA 2R6CA 1D4OA 1EP1B 2EZUA 5DFAA 1XTVA 4YYEA 4MRMB 4YP1A 2I62A 1KHHA 3P9SA 5CXQA 3CPSA 2LR0A 3NCHA 5BQFA 3OTWA 5KQSA 3HDYA 4WQMA 3T06B 3CT6A 1RS0A 1QQ6A 3I1JA 3A32A 3AUXA 4O33A 2ZWPA 5F52A 1NYRA 4DAOA 1A5AB 2AJBA 3RUCA 2O1XA 1H6DA 5L3QA 1RHUA 5JSUA 5CYPA 4OJYA 4RDCA 1HI9A 1MVNA 2O1EA 1PYGA 2PR2A 3I2JA 5L7WA 4CODB 3URMA 4I55F 5IAGA 4HPXB 3BK1A 3A9SA 1LTQA 2CYBA 2VPYA 3O1IC 3FUVA 1WBDA 4Y2YA 3GB9A 2BKAA 4L9AA 1NXVA 1E2LA 1E92A 1JLKA 3DMNA 4CKEB 2F1IA 4EY3A 4PM4A 3EA4A 2FVYA 2R96A 3D1LA 4H15A 4AAYA 3GJ6A 1ODTC 3D4PA 1OLSA 2XUFA 2PXXA 4M8LA 3DOUA 2COKA 1UK9A 5DHSA 4EKDA 5FF9A 3NOOA 1YJQA 3NTLA 2XRMA 2D3WA 3U3DA 1WXDA 2YN4A 3Q5GA 1YE5A 3SDZA 2HB6A 2CF5A 3SE0A 3G2OA 3EXG2 3ETEA 1CP2A 1D0VA 3K4QA 4MTCA 4PBSA 3QLEA 1TCAA 2MSLA 3DL2A 4MWTA 3TLGA 2ZKLA 3SBOA 2EKPA 1YC2A 3JQBC 3LDFA 4TN5A 3U7EB 2XYGA 3LP5A 1QE3A 4CFZA 4DBLE 2GKOA 3VRHA 1DEKA 4U5XA 1YASA 4F0JA 3D4NA 1QFJA 1RABA 3NHMA 3QSGA 2V4ZA 4G2NA 2DFVA 2JAXA 2YS7A 1EVLA 2ZJ3A 1E1CB 1JUDA 5A7HA 2B34A 3H2JA 3T52A 2EQ5A 3ACDA 2PX8A 2J46A 3ZVRA 3AIKA 2DBRA 4LE1A 4Y0VA 1OT3A 2B0CA 3ZWWA 3RAEC 4TWIA 2GJKA 1JU4A 2OAQ1 4RH1A 4YFVA 1NQVA 3EWSA 5CK4A 1W76A 2Z6VA 3RSHA 4CG2A 2C7BA 3D6NB 5K3OA 3P52A 1N2EA 5IAKA 5DNVA 1PR4A 3IVAA 1XE3A 3IE1A 4FFWA 1C1DA 1QMPA 2SBTA 3HDVA 3IP3A 5CVVA 5CNKA 3GEBA 1CEQA 2CLIB 2W8ZA 2G9ZA 1H2BA 1P7PA 1H1LB 4C6TB 4Y2PA 1U7OA 4GVPA 3L41A 2WIJA 1M2GA 2AFHB 2VHXA 4XD7A 5J2TA 4LMBA 3GX1A 2HL6A 3NC0C 4M37A 1P80A 2PQ2A 4I3GA 4DCPA 4FGSA 3X44A 2ARKA 4JC4A 4TZ0A 1XO1A 4RD4A 2PL3A 1SG0A 5LUAA 2PL1A 3GCZA 4AJEA 3FF4A 1CNFA 2DULA 4HH3C 1AZTA 1IAVA 3LUJA 2WQZA 3LUDA 2CSXA 2HMWA 3Q1KA 5GINE 1P3JA 3GT7A 1Z5OA 4PYLA 1MC4A 5JNWA 4UBNA 2OCLA 1E5LA 1JTFA 2WTEA 1SUIA 3CW2A 3FY4A 1AKQA 4HBZA 1NXWA 3V1LA 6CHYA 3UBTA 2XTNA 2P6RA 3TOVA 3R3WA 3USES 2JPDA 4MW6A 4HAZA 2O1WA 4OQQA 3VH1A 1ADCA 1MQSA 2LXNA 4DY4A 3NTQA 1TIKA 1DC4A 2NT4A 2IDZA 3JPWA 3KYDB 2WKQA 3QRWA 1KOJA 1EFAA 4INPA 3FRIA 4WLVA 4N9WA 4U9IS 4XLZA 4AWBA 1BE1A 2YWHA 3E9DA 3HABA 2PGLA 1F3OA 4KWEA 1V5WA 2UUOA 1BW9B 4FHFA 1P77A 5AVJA 5IMBA 5U4QA 1G21E 5FI1B 2BY4A 4MITA 1MDBA 4W6ZA 4DT1B 4CQMA 4WZAE 5DSZA 4R2HA 2YZKA 2ZAOA 5J4HA 3QHAA 2OCXA 2YUIA 4M0UA 3O4FA 4R41A 5T67A 4CR7A 1HDOA 5KSYA 4ZOCA 4U5QA 2O6HA 3L43A 4ZAFA 1Z0JA 2QZJA 4G0OA 5BSGA 2SKDA 5DCLA 3K0HA 2VP4A 3FTQA 3KSAC 4Q7QA 2XZTA 2UYHA 4IUCS 1DIAA 5FPPA 3HHPA 3UK7A 1XEAA 1X7GA 7REQB 1RZ3A 1JLRA 4FZ3A 3MUNA 6YASA 5JXWA 4BNNA 2QTHA 2IYYA 2GBFA 4AU1A 2HMUA 1I6LA 5F1KA 1FDOA 4J2HA 2GEVA 1FS5A 4JNCA 3EVAA 4WGFA 2FNAA 3RIHA 3I01M 2BFBA 8GPBA 3F6SA 2YY7A 3K1AA 2G06A 3FJYA 2YDYA 1C9KA 1O57A 2PUWA 2FEXA 2VF5X 4B2YA 1BVRA 2VTVA 3ZZMA 4YRLA 3CXUA 2Q28A 1VI6A 3L92A 4JC8A 3BWYA 1Q1AA 4RPKA 2J9FB 4WLNA 4XFDA 5H82A 2IPOA 4OQ4A 5B12A 5ADWA 1B41A 2P1DA 4RETA 2OM6A 3JRWA 3QEOA 3WGYA 1YVEI 4Y8VA 2IRWA 1KY5A 2F9MA 3UICA 1FMTA 1M7GA 5IT9A 3WMWA 4YCCA 5EXPA 5AUPB 4DOMA 1U31A 3HNRA 3FNRA 1Q3KA 1D2CA 4MO9A 1DAOA 3RV3A 3GMIA 3W34A 2RAUA 3EVEA 5JXHA 1D8TA 4PCAA 1LPAB 5DEOA 3W2FA 1QE0A 1NVUQ 2Y1GA 4HS9A 4WPGA 4CGYA 5JT1A 2YWJA 1OFVA 3L1HA 1WG8A 2QVZX 3R5KA 4FKZA 1TO2E 3HY4A 3QE9Y 3IJ5A 2BZGA 2AI1A 1TJPB 4XDGA 4X7RA 1ZZEA 3L1UA 4DDWA 4R71A 5I7RA 5GTDA 1QVWA 4Q24A 4NZZA 3HNOA 4JJEA 1KJQA 1ZWKA 1Q2XA 2NUAB 1ST3A 3NBQA 5BUCA 4GL4A 1GR0A 4H0FA 5BVHA 5B58C 3EIUA 3R3HA 3D8HA 3HCRA 1O54A 3NVAA 3BKWA 4U7DA 3I62A 1T35A 2O0HA 2HQRA 2RHMA 3C6YA 2QTGA 4TKMA 3PFIA 3SC3A 4YVFA 1YS4A 1JQAA 1FX0A 1QHHB 1QRRA 4YAKA 2IPNA 1FFYA 3EGWA 2O2HA 2R8PA 4MINA 4XM0A 3X0DA 1ZD2P 2JLRA 2O7QA 4LUCA 1PVVA 4B31A 4BO3A 1RWPA 3ZW7A 2Y8EA 4YAFA 1W94A 4ER6A 3WXBA 4WY2A 2EX4A 4U3JA 1TQ4A 5DTMA 4HXGA 3ZK9A 3I0MA 2BHSA 3ICWA 2C31A 4NESA 4NOKA 1OWNA 1XK7A 3W04A 4B84A 3TGLA 1Q0SA 2DQ4A 4UPDA 2QIPA 3Q8WA 5JAQA 4HX5A 3W4JA 3EPRA 5CIWA 1VG0B 1C7FA 2I3DA 5HOEA 1NMYA 1C7JA 5CEEA 5IVPA 4L02A 3C14C 2Z3WA 4Y0NA 3K8ZA 3PT9A 1WMEA 1OFUA 2JHGA 4BQOA 2ZUUA 5HIAA 2QAGC 3P5BA 2OT3B 2CFTA 2F6RA 3C6MA 3LC7O 1U2GC 1UDXA 1T1JA 2P2GA 3TUJC 1A9TA 4OUDB 5DI3B 1AOXA 2GXAA 2DWQA 4HQLA 1U9ZA 1I2BA 3LOQA 3G2JA 1W4BA 4DL9A 4IV5A 4AN1A 3L4KA 4YJ3A 1QM5A 1Z7WA 2X2PA 4OBXA 2DQSA 4L57A 3QE3A 5GONF 1AXRA 1TA4A 4JITA 4BFYA 2Y3IA 4FFRA 2IHBA 2O19A 1GP2A 1E60A 3THYA 4LKOA 2LCQA 3KTFA 3OCWA 1ZA1A 5KB3A 4QUDA 5BYJA 3C8DA 3VR4D 1V4VA 3UFBA 1T2VA 3KUXA 5TV2A 1Z8NA 2VPZA 3BYZA 1DWQA 2EP5A 1II0A 1VPEA 4MQBA 5FFMA 1P1BA 3QVOA 4C0HA 1URPA 2ZUVA 3WMGA 1VQ1A 5EINA 4UM5A 1WO8A 3L7BA 1MG5A 1MOZA 5AK6A 1D6NA 1VIYA 3WHKA 1YJ5A 2Y6UA 3H5VA 1QTIA 3IUSA 1RJWA 5EWLA 4EUHA 2VTEA 2GCGA 4Y18A 1GAJA 4EO7A 3DMHA 3QK7A 4OY3A 3A1UA 2GMWA 2X5KO 3IKVA 4N8EA 4HAIA 2IIBA 1E4EA 2C2BA 2P6PA 4WN9A 2IW3A 2BEJA 5HUHA 2QRMA 1L5OA 2J87A 2OD2A 2VJLA 3QBTA 4ILKA 3SIWA 1TUIA 2J3QA 3K5HA 4JLNA 4Z0PA 4HATA 5B58T 1XRRA 3GLHB 1XEXB 4IIBA 1PGQA 5EQTA 1L8QA 5EERA 3ZWOA 1P5RA 1WEHA 4MI3A 1VCMA 2YRXA 4TLDA 1P1HA 4I46A 1E2KA 4TUYF 3MIZA 4PTZA 1Y37A 1N9ZA 2GFQA 3NAQA 1OREA 1O5OA 4U9HS 4PLVA 3U2QA 7YASA 3W90A 3CUKA 4KFTA 2Y2UA 5C7OO 1R9NA 2VJCA 1QGYA 3R7AA 2F1OA 4NH0A 1LSJA 3GEPA 3EGOA 3ZHXA 2D7JA 4OBBA 4NJEB 3KLPX 3EHDA 4KQ2A 2YZ7A 3L4BA 4D0LB 3B38A 3SYTA 2Q9BA 3ET4A 4S1WA 1RLOA 2EYQA 1NZFA 1BKDR 1XMSA 2X0KA 3REOA 4IXMA 4XUDA 1NVWQ 2AA3A 1K63A 2GCOB 2I34A 4PCUA 4EPYA 2XECA 4PN7A 1B8OA 4B6FA 1KE1A 4PR0A 1TM2A 3HS3A 3UENA 2A7QA 3GH1A 4YUZA 3KJXA 2OK8A 1OH7A 1FYFA 4WFIA 3NI2A 3NHJA 1ANKA 2QTCA 2ZATA 1HFEL 1BJRE 3B2EA 2R6R1 2LTAA 4ZJZA 2H1OA 2WU3A 1VSVA 4HFNA 1IZ0A 3GFPA 5K3FB 1W4AA 1V95A 4GAEA 3C8ZA 1C2TA 3KYIB 1J7KA 4EGFA 3LP6A 2XNHA 4TVKA 3GCXA 5K0CA 3EQ6A 1SC1A 1Y82A 1P9LA 3AYZB 3NGMA 2GH1A 1SZJG 3I6QA 2HPZA 1H2FA 2OBYA 4L5IA 3RS7A 1FTYA 2Y6VA 2FY8A 1NAIA 2JKYA 4W5JA 1ZOPA 2Y4OA 3ZI0A 4UM9D 2XEXA 3QIAA 5CDYA 1RM3A 3L0CA 4Q12A 4NCKA 2XMPA 5KDLA 4DUYB 3G82C 3B82A 4ZYVA 2WV9A 2RHDA 2C9DA 5BNWA 3GFBA 3AF3A 4ZQEA 1B00A 3GGJA 2CCKA 4ER7A 1GTRA 3FOAA 4R51A 1P44A 4QGFA 3WLAA 3ZU4A 4JXXA 1E7RA 2A33A 4PX9A 2VDLB 4XIGS 5C80A 4KWTA 4MVCA 4R31A 4Y6QA 4O25A 5BSRA 4ABYA 1DHTA 1OTHA 3DCNA 2H48A 3GLQA 1ISMA 1J20A 1NMQA 2O5CA 3IO3A 5EKUA 1RHMA 2ODNA 5FB3A 1WHTA 2CK3A 2W6OA 4HLDA 4J0HA 3C8MA 5C3MA 4O2BB 3W7VA 1QGED 4RAQA 4FMPA 1E8MA 3RIYA 2IIPA 4CR8A 3KTDA 4ZO4A 3IHKA 2XXAB 3ABQB 4I1YA 5F5NA 2E6UX 2J7PA 5BQ5A 3N28A 2YOGA 3EWAA 3A1TA 4YRSA 1I0LA 5DOZA 1B7GO 4JLVA 1F0KA 1JU3A 1PKXA 4HD8A 4BE4A 3D3QA 3QU5A 3GJYA 2HJHA 2RAFA 3D0KA 3FSGA 4KPEC 3NDPA 2HRZA 3IVRA 4YP9A 1QNFA 2FN8A 2GNPA 2N1MA 2OAGA 1KBOA 4B79A 2BFDB 3PENA 4LDQA 1YL6A 3D54D 3QUBA 5K0JA 3A0RB 2QL7A 3VYWA 4BDTA 1QP8A 5IC4A 4IEIA 1AGNA 2JCVA 1T0JB 3W9SA 4RNCA 3RVQA 4EY5A 4W5NA 5EMJA 1NI3A 1UDCA 1IHPA 4UDYX 4J6EA 3DXZA 5IZCA 3HUTA 5HIJA 2WU1A 5K8VA 5ISMA 2JEOA 1HYGA 4FGLA 3PUXA 3MCZA 3JTMA 3EAFA 4TN1A 3PRJA 1B0AA 4ZO8A 2XEDA 2I1WA 4JLPA 1FJGB 4NJMB 4B6QA 3JSXA 3L06A 4F5YA 1UBMS 4HSGA 5AKLA 2WP0A 2I9PA 4RTPA 4FJ0A 2FXVA 4BNIA 2CLDX 2FE1A 3B2QA 1GZ4A 5FBWB 4I1OA 1C4OA 3KJIA 4PS1A 4MW9A 1BCRB 1Q50A 4I9GA 2Q0QA 3L0IB 5E7JA 2PKQP 5BR7A 1KZ7B 1BMFA 3I2YX 5BOVA 3BBPA 3M89A 2JI6A 3UAWA 1C7EA 2YVUA 1P45A 3SX2A 2G4LA 5A3RA 1VKOA 3BGSA 2HDOA 3C43A 4J4HA 5DX8A 4NBKA 3HJRA 4P2GA 4RVOA 2VPIA 2FOLA 1JIIA 1ZXXA 2A5GA 4XPIA 1NBWB 1BE0A 5BSFA 3H9QA 2FI1A 5F1OA 2UZ0A 2GJAA 3WRYA 3OZFA 4KGDA 2JJ1A 3H9BA 4GW3A 4ZT4A 1XX6A 3KE9A 1ZAKA 4TTSA 3R44A 3HVKA 1BMFD 2H0RA 4O4JB 2EJTA 3F7NA 4XGKA 3D59A 1I5OA 3BQ9A 4PQGA 5JCXA 1FRFS 3ZEAA 3GLFA 3T3IA 3UATA 4DCVA 4KZPA 3FDIA 4MYRA 1U5CA 2OWEA 5DLDA 1R0LA 3K5IA 3G2MA 2UYYA 4YAIA 4D57A 4L9SA 3P2EA 1OAKA 1CUGA 1F3LA 1SOVA 2HIAA 2X77A 4B6SA 3LVFO 2LPMA 2WTMA 4MP6A 1ZI6A 3CC8A 4QODA 3FVVA 4DIEA 3D9QX 1PLKA 2XZLA 5DNUA 4DR3B 5H83A 4QYSA 4KE7A 4WESB 5HFNA 1Y7HA 1XWWA 3ES9A 4MROA 1VRVA 4MKIA 1RZRD 3EPJA 2O8VA 3KUDA 4QTUB 3WLEA 3ZVLA 5J4KA 2ONKA 1FFWA 2P27A 3REQA 2GUGA 1JH9A 2ZIEA 4ZVRA 1H9AA 2OY0A 5A4DA 3KQKA 4PZ9A 2XBMA 3QTLA 1E7QA 1RMTA 5IKOA 2P5YA 4H17A 3WYGA 4AP6A 2VJQA 4TYYA 2C2MA 4MQ6A 1ZH2A 2R6AA 1P2TA 3KWJA 4JIGA 1A95A 1G9SA 1CQJB 1BX1A 1XQ6A 1Q1BA 2CC2A 1JE0A 2OBLA 3EDCA 1JQ3A 2FW7A 5IF3A 1WVIA 3C7CB 4JASB 3VJKA 1ORDA 4FQ8A 4JYCA 4W7HA 4O5OA 4US1R 3OCYA 5K8IA 4X90A 1BGXT 2DTEA 4E2WA 3P2YA 5JDIC 3PDIB 4B4DA 4CKXA 1KBZA 1DKLA 3FPSA 1EE9A 2EFHB 1O97C 1YOBA 4EHBA 4GBGA 3CX6A 1B6RA 3ONWA 2MYNA 2FPLA 2IXDA 3E3NA 4OYHA 4XCQA 5ALIA 3BB3A 4TXHA 1T24A 4YAWA 1QGUB 3TLBA 4Z4CA 2X8BA 4A7PA 1KZ4A 4FJ2A 4PZPA 3UMRA 4G97A 4D1YA 5JECA 2RK6A 4RD6A 3URKA 4JVOA 3E1SA 4MLPA 1TK3A 1IAQA 4YCDA 3ACBA 1DTEA 3T9DA 1XG5A 3PXXA 1G20B 2R8YA 4R8RA 5LDDC 3N2EA 3EGCA 1YKGA 4RMHA 5KNDH 3I0ZA 1A71A 1MP0A 1VKNA 3AZQA 3KU1A 3N70A 3PNYA 4BYGA 4D8XA 4QO7A 1LNZA 2WABA 3RU3A 2J0UB 4TSFD 5AVKA 2ATEA 4U6QA 4FDAA 2GHRA 4XQCA 1ZKMA 2R79A 2BCEA 1KMHA 3ITNA 3ZV4A 3QV1A 1Z7GA 4UMVA 4ER3A 2NYUA 4G8JA 4UHJA 1LI5A 1G8MA 1ODCA 3F47A 4M9SA 4DR2B 1ZM7A 2AE1A 2F8TA 3IFSA 2IPLA 2G63A 3TF5A 4K0KB 3OQ1A 5B37A 4XWAA 4JBLA 3O8RA 1NW6A 4BWGA 3JASA 3Q3GE 1FA9A 4FGUA 5TVKA 1MAHA 5DT9A 4MUNA 3FWHA 3SJCA 2JDIA 4GOKA 4EZBA 2QAIA 1G5FA 5AK0A 3AF1A 3IC5A 4LV5B 4N39A 1OWMA 3DBOB 3NHFA 1ZNWA 4Y1GA 1G17A 4I08A 2PFSA 2W6QA 2HT1A 4IHQA 1U8AA 3A6KA 1U28C 2H0QA 2VYCA 3Q7PA 1UZAA 2J9RA 5KJFA 5BQOA 1ECJA 5F51A 1WCIA 5FO0A 4E1AA 3BFVA 4NBLA 3AVOA 5KOHB 2DXIA 3C3BA 2JDID 2WIKA 4QYTA 3ROKA 3TQOA 2FPWA 2AJ8A 4REQB 5THQA 4OEHA 1CVLA 1LPSA 2C4TA 2EXXA 3F4BA 4WJZA 3VU8A 1DO8A 3O8DA 3PHGA 1GPKA 1K68A 2D1FA 4KXNA 4IDBA 5EZ5A 3NNSA 3F46A 5JH7F 5IDXA 4EYOA 3P9QA 1VPDA 3GLTA 1F0NA 4DA7A 1SA0B 2BR5A 5BYKA 5CEJA 1C3JA 1QH8A 4N3NA 2AOUB 4UCWA 3ELDA 3ACCA 3K09A 4X45A 2LE0A 4UU1A 2DF8A 4B4UA 2QNIA 2JFZA 1Z9BA 4OIFA 3FFAA 1X2BA 2H9IA 2QNBA 2XMRA 2PD6A 3UWKA 4ZI7F 3DCIA 4HTFB 4R8LA 4EPXA 1EE2A 4L15A 1D6SA 1WVMA 3E9EA 3PCRB 2R6FA 1XQ9A 4L76A 3PE3A 3JQGB 3WWEA 4HWTA 4L9WA 1VHLA 1EQ2A 3E9QA 3TK1A 4DDUA 2OFPA 2W48A 5TF4A 1IN4A 3V55A 4ZARA 3CB4A 4D9CA 1O95C 5H59A 4DLZA 3DYIA 1S7GA 5CYFA 3CRMA 3P20A 4D79A 4Q7KA 2YVKA 1X86B 4HWSA 1NP7A 4P54A 1RQ7A 3BA6A 1RW4A 1UMBA 5B1DA 5JCJA 3RJMA 3BG5A 2PKWA 4RV4A 2I4TA 2NO0A 3DD5A 3VHXA 2R1TB 4DA6A 3QFTA 2R4UA 2J3HA 3Q0IA 4Q0MA 3ZWYA 1AE1A 4XSVA 3VR3D 3G1WA 3IJEB 5ILOA 2W2VA 1E9EA 4AMZA 5CFOA 3S8EA 1FW8A 1E5TA 4G1MB 1KI7A 1JJAA 2AWNA 3ST7A 5JAZA 5FUWA 1XCGB 4DZRA 2ZSEA 5K6AC 3TZKA 3KQSA 3MRVA 1FRQA 3X2EA 5EIFA 1HR0B 4PO1A 4NR0A 3UJNA 1RZVA 4WK2B 2PT7A 5BN1A 3WV5A 1SCNE 5CH8A 5DW3A 5JQGF 3OECA 5LQAA 3AG6A 2VA9A 1RVV1 4IH9A 2GPYA 5L4SA 1CP3A 1U6JA 2HLNA 3ETJA 2OO7A 3QBVA 4YH1A 2AG1A 3FAZA 2GLUA 4MYUA 2B8WA 3JYOA 4PQEA 5CX1B 1H0KA 5AXBA 4S04A 1J2EA 3D3JA 1TFUA 2QP4A 5AICA 1FDUA 5HJ7A 1TF5A 2B99A 2FWAA 3PDUA 4MV1A 4QBGB 3IODA 1TLTA 3ONNA 1QBGA 2Q5IA 3DA8A 3USCS 5I7OA 4F6CA 4KIWA 4QGHA 4EB6A 1N8TA 2MYUA 4FFVA 4HDAA 4ZXPA 1JP7A 4HH4A 1DV2A 1C7QA 2UUAB 1U0BB 1I5EA 1NJ1A 3B1WA 1TD1A 3OM0A 5CJPA 2QRVB 4FMBB 4KQXA 3NT5A 2A0WA 2XVYA 5EXTA 3LBFA 3A4TA 4D97A 2ZRAA 4FZJA 2WDPA 2QUHA 5K2OA 4N4AA 4PG6A 2BF4A 4R1UA 1LD3A 3WB9A 1X13A 1Y81A 2MR6A 4CT5A 5FI0B 3WO1A 5I7HA 4YAUA 3VMMA 1CYDA 1QQ5A 1VCIA 3MWFA 4B48A 4OMFG 4YRCA 1KC3A 2V98A 3ZDZB 3ZHQA 1I7PA 1CR1A 2Y1FA 1A9YA 5SYNA 3RODA 1QH1B 1PX0A 3G0OA 3GRRA 3IT1A 3SJUA 3W06A 1DX9A 2HTFA 3SQNA 1XQVA 1KWKA 3T7TA 3WL5A 4DRZA 3ERCA 5BWCA 1DGQA 4GXRA 1DC7A 1K5GA 1XZFA 2R6ZA 3VI4B 4BU1A 5C18A 3OO1A 4MW7A 2C7OA 4TSKA 2Q3DA 5KOJB 1JHUA 3ODPA 4YP5A 2VP5A 4E3ZA 2EF0A 1Y4SA 2IVFA 3WNDA 4DGSA 4XD2A 1E1YA 2WBLC 1CF2O 3N2ZB 5HMLA 1A9OA 2GPNA 1U2TA 3KDAA 1V1MB 1BHQ1 2JFFA 5EHQA 4LQCA 4KPFC 2I5PO 2FUKA 2ZTLA 1TKAA 3LKDA 2XB2A 4I4TF 5ADUS 1S2MA 2VT3A 1L4EA 5K6TA 1IG3A 1KU0A 1DAIA 1U0EA 3TEFA 2ORYA 3JQAA 1GL6A 1HG0A 1HETA 3K31A 1QF9A 2OCYC 4IO1A 1VMEA 1BYIA 1WU7A 4B0PA 4F21A 4HVAA 1KAGA 3ZZ1A 1A98A 1UC8A 2A35A 2HK9A 2PIDA 3IHTA 5HF8A 2WAYA 4V39A 5EHZA 5JAIA 1ZSNA 2QXYA 1BDJA 2C58A 1NA5A 4RS4A 5T3YA 1R0YA 2WUDA 3BORA 4DEXA 5HTOA 2PD3A 2CXUA 4HPJB 4POAA 1V7QA 1X7HA 2PRYA 3MWJA 4HLCA 4X20B 5KJEA 4H3VA 3C4VA 4BO4A 3PGMA 2RD2A 4OX9Y 4NPCA 3LX8A 1CS0A 2CXQA 2P3QA 5DCUA 1JDTA 3A06A 3KXPA 1ONNA 4GX2A 2WJHA 2XCSB 1WSBA 2E85A 2H85A 1K5PA 2RGWA 2VSYA 1E0SA 4U7PB 1BEZA 3QWAA 4D4JA 1KDVA 4G1VA 5CCXA 1WQ1R 3SE7A 5EZSA 1GSAA 1YDHA 3PUKA 4OI4A 2XCTB 1G7RA 1JPUA 3LT0A 4WTOA 4D9JA 4Q00A 2AVNA 1CIPA 1P1KA 3GNLA 5D3QA 2WIGA 1J2UA 1LA2A 1OFGA 2ROQA 3BE5A 4JR0A 4R84A 1Y1LA 4CG0A 2V74B 5JJ5A 4M60A 5DXJA 1E9SA 4UAJA 2C9MA 2QMHA 4Q7EA 1XZIA 2VUSA 3EZ9A 3GRKA 4G81A 3IUNA 4AS1A 3QPUA 3ILVA 1AB6A 4GM1A 3K70C 3VC3A 4QQKA 3GPCA 2PWYA 4J7CA 1QOQB 5ED0A 3USZA 2ZWAA 4TV8A 1K6XA 3SWWA 4FQ7A 1QVZA 1YB2A 5DX1A 3DULA 4RANA 3S70A 5AUOB 1HE3A 3BIFA 4FK8A 1V41E 3E84A 3QLJA 1KYZA 4UU0A 3RVBA 4CV2A 4N5NA 2P7IA 4NU0A 4ZV7A 2VDKB 5TQJA 3FWKA 1G59A 2XGSA 3HJGA 4GUAA 1IQRA 1M1ZA 4QASA 3P7MA 3J7AC 3A9CA 1QG0A 3BMCA 1MX3A 1UP7A 2D8MA 5HPYB 1X39A 3IQIX 4FYHA 3EY4A 4G6ZA 1ZCAA 2PRIA 2RCNA 1HY3A 4R69A 3VPXA 2CXPA 2EFGA 3Q12A 2PJUA 4TTTS 4UUAA 3WZLA 2DKOA 3WIOA 4TS4A 3BS4A 5EA2A 4QXPA 1YS7A 2FMUA 4RLSA 5AJYA 3KT6A 2VSXA 4GECA 4OHBA 3S5JA 5J9FA 3BL6A 4GRAA 3ZWAA 1L7XA 1U3WA 4J2TA 3OX1A 4L85A 4LWOA 4XKJA 1TDJA 1UJNA 1WXWA 2CXNA 3TRKA 4DMRA 1NJ8A 1K7EB 4DIUA 1K2WA 3GWZA 2YJ6A 1J90A 1RAGA 3ILHA 4IO0A 5CB8A 3LBIA 3LBYA 3OZSA 4HRVA 4J49A 5IM4F 5LMCA 4C76A 2Q62A 3S44A 2Z95A 1UMKA 2W6ZA 2ZTSA 1N5LA 2ZBRA 2ZWOA 4KB5A 1E1RA 4LCBA 2Y77A 1N9KA 4E46A 4L0MA 2FVXA 4F56A 4R7TA 1R4MA 1H05A 2GAIA 5L3ZA 3MOIA 1FFDA 2AFIB 2C7QA 2HYDA 3O1HB 4YLEA 4Q47A 2ZKIA 3I61A 1TRHA 3IKMB 4MYHA 4R8VA 3U44A 3QPAA 4IFBA 4KR6A 1ADGA 2FMKA 4CU2A 1SD2A 4IHKA 1G98A 1Y3FE 4S2UA 2K2WA 3WKDA 2NU6B 3FVWA 4A26A 1CF4A 4Z3OA 3DTTA 3L1KA 2RGNC 3UWPA 2PFKA 2BRUA 3H2KA 1PUIA 1RYYA 1X14A 5JRZA 3K0AB 2Y0CA 3KOXA 1ZN7A 3GJZA 1DC8A 4KLNA 1T6NA 4I8IA 5JNLA 4MX8A 3VO2A 4AX8A 4YQFA 4P31A 4YCLA 2PLFA 4LJRA 1TFRA 1T3LA 2A5DA 2MSEB 4S1OA 4WIAA 2PS3A 4XM2A 3MW8A 1UWLA 2INGX 2E55A 1OI2A 5T7BA 3S2IA 3KZMA 4JLMA 3TB6A 3S2GA 2J0EA 3NHKA 4R6WA 3AR8A 5ITWA 3HDJA 3WBFA 5FHRA 1EFLA 1QIKA 2PLNA 2PT9A 1FU4A 2R1UA 4HGOA 4G2TA 2JAHA 3D7RA 4X7BA 1TUBB 4KLAA 3PLNA 2ZU6A 1II8A 3PNMA 4AL4A 2YJGA 4DBLC 2AGVA 2Z2JA 3ONEA 2RHCA 1GZUA 5IJWA 3G8CA 3W4IA 3E7DA 3KRTA 2ZT8A 9GPBA 1IN1A 2X4IA 4MV5A 4YREA 4FBLA 2QRPA 2OSBA 2XNDD 1UBCA 3QUQA 1TIPA 1RCTE 3Q10A 4H1UA 4BZXA 2DPXA 5D3MB 5ED4A 2EZ8A 3F8SA 3U5TA 2XCIA 2JI4A 3TRIA 1OBVA 3U4HA 1GFSA 2C3YA 3WLIA 2QDXA 2W58A 4AULA 2WM3A 1AKUA 2H00A 5A1TA 4QTXA 2MOKA 5ALWA 1JL3A 1SXJA 4IDGA 2GLTA 1CVIA 4JUCA 1RAEA 3ECAA 1RTTA 4F5EA 5CT8A 1LV8A 1R6UA 1U8UA 1T5TA 1ZVMA 2WD7A 1K6MA 4Q3AA 4X5OA 1U8TA 4Y2UA 1GAQA 1S4MA 4Q9AA 1UDAA 5JPIA 1ABEA 1JAXA 2ZS7A 1A4IA 4LISA 4NONA 1RAIA 4IM7A 1GPWB 1BQEA 4RVFA 1P91A 4X84A 3ZW8A 2H5JA 4HGYA 4S0ZA 2WHPA 2X14A 2H1IA 2QUKA 3IOCA 5ILQA 2FG5A 3E4DA 1T26A 4JSRA 2AG6A 3LUAA 3PF9A 2QM7A 4YPVA 1YL7A 2DTDA 3FOCA 4I99A 3CR8A 4P38A 4WZBA 5DJ5A 5JEEA 2B0JA 4HQOA 2LIPA 4CI0B 1DKUA 4GWLA 5JSYA 4JT9A 1NXXA 5EE1A 3RRBA 4MUIA 1K0FA 4EFNA 1NVGA 1PFQA 3PT5A 3VDNB 1WMFA 2HK7A 2I33A 3HFJA 3QE2A 4LY9A 4EVQA 3G8DA 2BMWA 4MIEA 4YIKA 4AJHA 3OEYA 4KU4A 4ZPJA 2IEZA 5TX7A 4B3GA 2J59A 4I2VA 4NL4H 3QF4A 1F2TB 3R7WA 4IFIA 3UOWA 5LWHA 2BHNA 1EGQA 1IZYA 1VXOA 2BFFB 2VBIA 1LDBA 3W79A 2XTAA 1YJCA 1LWOA 1Q6YA 2WHXA 3QJ5A 1Q74A 2H1VA 1RWKA 2IF2A 3HLTA 3AR7A 1VECA 1K6JA 2NWQA 3A1WA 3R9XA 3MERA 1RJ9A 2BLLA 1XPJA 1CHDA 3T1YB 3RHTA 4JDPA 2HY7A 2NUBA 3VFDA 2DLDA 1JMVA 2PX6A 4ZZ3A 2PZBA 1I4DD 4LK3A 2C2XA 2D3TA 3F2IA 3HBNA 4XASA 2E5LB 3TTTA 1T2CA 1UZUA 3B12A 5D1HA 3P1JA 1DAMA 3CCBA 4U4AA 1JVSA 1QVRA 2H9YA 1W581 2RHWA 3C3AA 5C0OE 4IXDA 1ZSYA 1Z56C 1DRVA 4X7MA 1O8BA 1EINA 4Y6OA 1JAIA 3TSCA 4AVYA 4YUWA 5C81A 4R81A 2GWHA 3U31A 1V6AA 2C00A 1Z5ZA 1AURA 4UHDA 3PDWA 5DN6A 2RBGA 1BGVA 4AZ0A 4TYWA 4OQYA 3JD0A 2ZRJA 5G2OA 3H9EO 5K1ZA 4R1LA 2J3MA 3BH0A 2XCRB 4I1PA 3JATB 2FN3A 4IDQA 4FT2A 5HMMA 2AG8A 3G9ZA 2RHHA 2O8FB 2JGLA 5JPDA 4BPBA 3ISJA 5LOVA 3J80A 1BEUB 2BVNA 3ANSA 1T1EA 2OXTA 3G5MA 4B45A 2JFVA 4C0LA 3DVQX 4YMUA 4ZYZA 4NBSA 4OO3A 4RIHA 1A8QA 2G70A 3VC2A 4B6JA 3QX3A 4B9AA 4FWTA 3WWZA 3GRFA 1FDWA 1GN8A 3QA9A 3DO6A 4NIMA 4CM1A 3LFHA 2G07A 1GIAA 3D43A 2KLHA 3H87A 3ICOA 3K1YA 1WUYA 2DETA 1PRYA 2O2JA 4PVDA 3GAZA 2NVWA 2HU7A 4LXTA 1O0SA 3LECA 1Z75A 2KW5A 2FSVC 1TC1A 1JQ5A 2PXAA 2Q5QA 4RFSA 2JAQA 3GN2A 3HP7A 3B2NA 3NNDA 1I9GA 3SKVA 4H4DA 4MUJA 1QUFA 3ZK8A 5GAJA 4HNGA 1XD2A 3WJ7A 1HC7A 3UMCA 1OSNA 1Q3HA 3CMCO 8ABPA 2X40A 2VUHB 3SM9A 3TRFA 2G4CA 2A59A 3BTVA 4B2PA 3I2HA 1TJ4A 4QJ4A 3AVQA 2X4DA 4XEHA 2C3MA 1QKKA 3FPKA 5IM5A 3WK9A 4EH1A 3F4KA 4PC3A 1XMXA 3RYHB 3RBVA 4OJKA 1DKNA 2EJWA 3MJCA 3VOSA 2ZYDA 4B0OA 3EEOA 3TG2A 1T43A 6GPBA 3G9QA 3CVJA 2LIVA 2N0SA 3DHWC 5F9MA 3TCNA 2MMCA 4FBMA 1MEJA 1PZGA 3LAWA 3TPFA 4N0PA 5KTYA 3K0KA 3E3LA 2JHCA 1PNVA 3BT7A 3SQWA 2JBHA 2Q27A 4ZU1X 1V9CA 1RXYA 5DX0A 3PGXA 4D42A 3FOEC 1CJCA 1GRQA 4LGVA 1IRIA 2BDUA 1A7AA 4OKNA 4BO0A 3RVRA 3VYRB 5JATA 2HBZA 3BH6A 4GPEA 4UD6A 4UQLA 3U6KA 4P34A 1DJPA 1VMDA 4D8YA 2GN6A 1Z7EA 3PHIA 5G1PA 1B16A 2KQUA 2DHCA 1EVZA 2BMEA 3OMLA 4E03A 4UM7A 3GA5A 1UUFA 4WJLA 1LUAA 1QQ7A 2I7CA 2NXNA 3PBKA 2CLHB 4C08A 2ZI6A 4CHGA 3HLKA 5FBZA 3HR4A 5ICSA 3H11B 2ZRMA 1M7BA 1IBRA 1ZHFA 4LY0A 5DBFA 2QN8A 1WZNA 2QD5A 3WGKA 4XUGB 2XMSA 3CKYA 3QPDA 2CD7A 3FOFC 2QRLA 3HKDA 1Y1TA 1SN7A 2G9UA 3HU1A 1M2WA 4YBRA 3IIIA 2F43B 2IY8A 3RF7A 1G9XA 3HPRA 3UKJA 2XY4A 2CLSA 2CLFB 1ZJJA 3JPYA 2QW0X 1LF0A 1M5UA 3P4UA 4UULA 1VE5A 3DPIA 1U7UA 2WJAA 2CNNA 3AFIA 5TR9A 2QR3A 4BP8A 1D07A 1WD7A 3PNVA 1JMKC 3DONA 2GAOA 3GJRA 4A1OA 5CAEA 4WAUA 2NUPA 3M4NA 5AH0A 2XVMA 1AS2A 1T5HX 3UF0A 4J0QA 3EBPA 1ULBA 4OVKA 2OESA 2W2XA 2C84A 3DE0X 4WNCA 5FUMA 1R50A 1XRSB 2FQ1A 1XNQB 1UBEA 4BXOA 4ZN6A 5L4LA 3K1TA 4NG5A 1UQRA 2XAUA 3LU1A 4E4RA 2I6SA 2ES4A 1Y9JA 2PPVA 3BWDD 2KBFA 3AM4A 3LY5A 4HDKB 5HILA 1W7AA 2F8LA 2PBZA 1LV7A 3MD9A 4GX0A 2XE4A 4YV7A 3GIDA 3RQIA 1T3SA 3DT8A 5TMPA 4UFNA 4ZYUA 4GI2A 1PKEA 2C8LA 2ECOA 5ARDA 4P3NA 1K66A 2M9MA 5DM0A 5JAUA 3AI7A 1NW4A 1V26A 3NHAA 1SHLA 2BI7A 3TO5A 2VIIA 1ZC4A 2OGZA 1OI4A 2EW8A 3PG5A 1C41A 3BWMA 4GOJA 1QP4A 4IJUA 1I9CA 4TLBA 1T10A 4N5IX 1AKEA 5JHHB 1U3TA 4LTDA 1JYFA 2FP4A 4M9QA 4FMCB 3UJHA 1OTXA 4FS3A 4EENA 3RBXA 1V1JA 2ATIA 5L8VA 3AVPA 2WC1A 3OJ0A 2RDMA 2NNWB 4JVMA 2QLFA 1Q5PA 3SVTA 3JQFC 4ZAVA 1ZJ5A 5DM1A 3W6PA 3N2IA 4XB2A 5L40A 3PYXA 5FA5A 1NOJA 2QGNA 2E82A 2P4UA 2VSNA 3DV0B 1JR3D 4G5QA 4NEQA 2Q9UA 3ZNOA 3HRKA 4U02A 1QRAA 1T4MA 1VLHA 4AICA 3U61B 1HNWB 5K0BA 1ZRNA 2BBSA 1C2YA 1GSHA 3KAPA 4LXXA 3PXGA 4R40A 1E3EA 2IUEA 1IBCA 2ZCUA 3PQDA 2QN7A 1M1NB 3G17A 5E8RA 1YFLA 4EJSB 3NHZA 1I4LD 3MWDA 4HNSA 4DIDA 2H29A 4XYLA 3ZD7A 4R05A 1BA2A 3FHJA 3KPUA 3LUGA 1M2FA 4XVRA 2DEUA 3RRYA 1U7TA 1G41A 3ZWMA 1LBSA 1SHZA 3I01A 3FPLA 1QH0A 2D0PB 2JFBA 3C5VA 1WCWA 5E4FA 2Q0HA 1CY8A 2CNDA 1KARA 2G77B 3C5HA 4O2AB 1WZIA 1O94A 1P4AA 1R64A 1WSWA 2GXUA 2W2TA 2WF5A 3QELA 4IMIB 4ZMRA 5G3YA 1CETA 3IEIA 1FP4B 4FX2A 4L8FA 2VXBA 3EY9A 1KO4A 3R0VA 2AZDA 3E70C 3ZBQA 1UPTA 2ZB2A 3VTAA 5HM6A 3CONA 4CM4A 5EEGA 1ODLA 4YUVA 1OAOA 1RRKA 4QARA 1LDMA 2AHOA 4R83A 4FIDA 1N2GA 4IGFA 3AHEA 3EIXA 4L0DA 2HIHA 4GPTA 4XVHA 1DG3A 4H6XA 5FL7A 2C7VA 2JARA 3HXLA 3QOFA 1G55A 3Q87B 1O94D 3FYDA 3M4JA 4PFSA 4R0MA 1PV4A 1JWAB 4KL8S 3AP2A 4N7RA 4PYMA 3U60B 1E3DA 1FFXA 3ANNA 3VUFA 3B3QA 2IUTA 1T2FA 3RK4A 1Z0KA 4L5YA 4OLBA 3M4YA 3BK7A 1ZK0A 4M0FA 1UP6A 1KZYC 4A91A 4URXR 4QREA 5CBPA 4Z4EA 4OXQA 5F2EA 5CB4B 1GQYA 2G5GX 3SEAA 1RXVA 2X2OA 3GG9A 1U2ZA 1N2CA 1SAYA 1D09A 1QZZA 4PVCA 3U0BA 3EZFA 2J08A 3GBSA 1WSAA 2NYVA 3H4TA 3BB1A 4E2ZA 5GZ3A 1X0XA 2YW9A 3V80A 3OEWA 1B73A 4A23A 3HKBB 1R18A 4C03A 3HEMA 3QFRA 3EA0A 4QPZA 4DANA 1FTQA 3R3JA 4RY2A 1YBAA 3CT4A 2J30A 3NHSA 1CQIB 1KC1A 2Q2QA 2WILA 3LHDA 2RJOA 3H8WA 1TZJA 4Q19A 2X8AA 1JR6A 3D6FA 1LBIA 2BFPA 4RYLA 3RASA 3ZY6A 3WAJA 2FG6C 1G38A 1OYYA 3IQGX 3PVCA 5LYJF 3M9XA 5F5LA 4F2PA 2DG2A 1JILA 3EOZA 2DH6A 3GRUA 3GT4A 3R76A 2OFXA 4BB5A 1C1HA 1I1HA 2BZ1A 3TAUA 2PUTA 4JUBA 1J4AA 3PC8C 4YDQA 1QYVA 1TT5A 2C2ZA 3AEKB 4KH0A 3IVGA 4M0MA 2HEGA 4TMVA 1R0CA 2ZRIA 3ROPA 3D5QA 1NLUA 2E5WA 5KYXA 5C51B 1JIJA 1H4QA 4QT0A 4F91B 2FPRA 3G0IA 1IY2A 4US0R 4YRBA 5CVCA 2GI4A 2CFOA 3HUDA 4WE3A 4ZRNA 5LQRA 3OE1A 5DHUA 5BPFA 3SZMA 4FHDA 3ROGA 2PJDA 4C4TA 4K2HA 1J1UA 2GK7A 2VOEA 2ZB3A 2D2IA 4P6VF 4DW8A 2ODBA 2CN1A 1R4NB 4O4HB 4PTYA 4QBIA 2WQ6A 3QSYA 2GCPA 3HH8A 3Q72A 3A3YA 1F38A 1RSZA 1WR8A 2BCGY 3W5HA 2P6NA 2YHIB 7ADHA 3Q8LA 1V48A 2JIQA 4NCJA 2UAGA 3OE7D 4OH1A 4JOQA 1PWEA 3K8OE 3QFCA 2WZQA 2ZOSA 2A9JA 4LN1A 3OPMA 3GR6A 4QNRA 1AXEA 4KAAA 5KCMA 1DAEA 3DMGA 1CPYA 2J5BA 4NSNA 2B83A 3K35A 2OHHA 4IHJA 2GXQA 1QYXA 5AHRA 4LS3A 4EQ6A 3FROA 5I7VA 2EVWX 1KYIA 2QUZA 1RE0A 3Q7QA 4LSGA 4V0ME 1T2UA 3GG2A 2QRUA 4TXMA 3TEMA 3BWBA 2H16A 3SMVA 5L53A 2XNJA 3IA2A 1OFHA 3ER8A 1NP6A 2CEAA 5CHYA 5T8KA 3DT6A 1RT9A 1VL2A 5ALSA 2FZ4A 3JQRA 3JWGA 4HQRA 4UBIA 3N59A 4MKGA 3RFXA 2H1FA 1E2GA 4UZEA 4I0WB 4YRTA 4BBZA 3LNCA 3OWXA 5C5IA 3AEUB 5JANA 3I4FA 1G16A 5DNWA 1V5FA 2DT5A 3OX2A 1VKZA 2C95A 3ZGYA 4PQRA 1JECA 1O89A 1QS0B 1GDHA 5COQA 4JI8B 4EKYA 3UHAA 1R74A 1X38A 2IUFA 1Z5PA 3H2ZA 3ODGA 3TSZA 3U1BA 3B9QA 3C7TA 2OO5C 3DF9A 4YAOA 4YR7A 3PNLA 4LBYA 1FNSA 2P68A 3AJDA 2I29A 3IJPA 4W9RA 2I4OA 3A9VA 1G18A 2YWXA 1NN0A 1OIXA 2A30A 5KYUB 3UB4A 1Z6ZA 1T0PA 5CEFA 5IJZA 4V0NA 5I8ZA 2JLCA 1B42A 3QX9A 4KVFA 2YX1A 1T4CB 4MI6A 3W2GA 3DXFA 1OD6A 5ALDA 1NYQA 2ZBQA 1BH2A 2IH4A 3TX6A 1EFCA 2P9GA 5G41A 3V42A 2QN9A 3MEQA 1H0SA 1LX6A 5C4IA 4F6RA 4BVBA 3M6UA 3TD6A 4YLYA 1C8VB 1N1EA 1RHKA 1GLGA 1TB4A 2B4TO 4IW3B 4Q3NA 3AERA 4HB3A 3W2TA 5JCPA 1H5UA 4X1IA 4D81A 2VI5A 1C7ZA 1VC2A 3G7UA 3MMXA 2AN9A 2QHXA 4ZOLB 2WMDA 2X8LA 2VSOA 4DTCA 3RGGA 1L7MA 2AIRA 1TZ2A 3F98A 1NLMA 4NATA 2XMBA 3AWIA 4O08A 1GU1A 2EWWA 3IR5A 4LJ8A 1V9SA 4IH1A 5FTJA 3V8QA 2DFNA 4JVNA 3ZU5A 4EAQA 2H5LA 3CLUD 5EFOA 2J3KA 1E2MA 4OA8A 4S35A 4CIXA 3O0TA 3DOEA 3OPYB 4AMUA 4Q3DA 1P1JA 2VH2A 1UJMA 2ZCVA 3CZQA 3UA4A 1VDZA 5ARCA 2QP9X 5B30A 1JLSA 1H85A 3DWFA 5DM60 1LFAA 3OT1B 3I9JA 4YJDA 2H5IA 5JV5A 4HI0E 4Z0TA 4BGVA 1QWSA 2CZGA 1T91A 5IRCD 1OC2A 2QA5A 2VDJA 3GF4A 1JLHA 3FNBA 4BJ6A 2JHFA 2C7RA 3MOSA 5AHWA 2IV7A 1U2RA 3W3AD 2PM8A 1K5DA 1KF0A 4WXRA 3TBFA 4EGJA 4AT1A 3G2NA 1MKYA 1Q14A 1X1EA 2DUNA 2ORVA 3V7WA 4E11A 4PZ0A 2BM8A 3L0OA 4JJ8A 1P0MA 3NIFB 1A9SA 3PV0A 1IU9A 3ZX5A 1M6YA 1N3IA 4MYSA 3F2VA 4U39A 2PBLA 4G4SP 4R5HA 1AV7A 1EFUA 4ZREA 5TLSA 1N2IA 2O2EA 1G8SA 2WKPA 3IVMA 3OFKA 5K3SA 3RKUA 3FETA 3UMVA 5EPUA 3TLKA 1RWQA 4RSGA 3PFWO 1PT8A 1RC1A 4MA0A 1P4RA 5U4XA 3TDMA 1JPNA 4A5SA 1Y7PA 4D92A 3BILA 3JVUA 4MEAA 4DMUB 3ZDDA 1J33A 1TOAA 2HQSA 1FSPA 3X1ZA 2P4QA 4FDLA 5LIPA 2I78A 4DRXB 5AVQA 1F8XA 1Y6RA 2XVXA 1THTA 5KSPA 2CFIA 4TS9A 1MJGM 4MAFA 5BN5B 5BT9A 3O7WA 3H2BA 4BN5A 2H2IA 3PK0A 3A4VA 4DQXA 2IZ1A 3HP4A 4X8MA 1O3YA 3VNSA 5I3ZA 1JBKA 1N7JA 1U9IA 2OQRA 1D1QA 1OX5A 1GITA 2B8NA 4OQFA 1YNOA 1W5FA 2FW1A 3MC1A 1JEQA 3KX2A 3EH1A 4MCIA 5AUQA 2Q1XA 2QLMA 2XNCA 4XEUA 1L5NA 2ZB8A 1ZFNA 3T0FA 3O82A 3U26A 4B3FX 4E5YA 1CSEE 1NI5A 4G89A 1SR8A 4JK3A 2FCRA 4MSUA 5GOZA 1L5LA 1NUAA 3RVDA 2ZPAA 1LDNA 2VK4A 3I52A 2IPXA 1CB7A 2J5QA 3HJUA 1JKXA 5AXCA 4M0LA 2JGDA 4AG5A 1V8ZA 4IIYA 4DYHA 4EYSA 4M9CA 1P6UA 1LXCA 2FFHA 2X9VA 3W9BA 1I36A 1RXWA 2CV1A 5CW2A 1FZQA 1Z22A 3SEZA 5D5QA 4BMNA 2VWGA 5LQMA 1JHQA 1FW6A 4TYPA 4Q6BA 2ZIWB 4NFHA 1FRZA 4OL9A 1XYGA 3AQIA 1P39A 4FKBA 3KPVA 4BQNA 3KOUA 2HOQA 3I58A 4BOYA 1AQJA 4ZCIA 4MRMA 4MUGA 3K9QO 3PXDA 4K9QA 2IP1A 2SHKA 4C7JA 5JS2A 3ZXYA 4Q16A 1YBFA 2VQFB 2VTBA 4ZI2A 1QHNA 2HCBA 1Z83A 2VZ8A 1OH5A 5JR3A 2AJLI 3HCWA 3T54A 2HRBA 4H3SA 4LY3A 4URZR 3KBBA 3WFJA 2OBNA 3KKMA 4KK4A 3OD1A 2G72A 2V1UA 1C9YA 4LGYA 1F6DA 4DNQA 2BELA 4NXNB 2BGRA 4UKDA 5F64A 5AVYA 3T15A 3SVLA 2Q3LA 3M83A 3KHSA 4PIVA 1SURA 3TXAA 2OK7A 1E7SA 4LJYA 2FX2A 1LEHA 4RK7A 5EMLA 1YVRA 1EU1A 2AUNA 3AWDA 3HV0A 1ZIPA 4C22A 4ENSA 4WKNA 2EF1A 1Z4OA 3ZJVA 2CNOA 4C3UA 1MIHA 1XL0A 4MO2A 1ULUA 4IILA 1RWOA 3BRSA 3KR2A 4JBYA 4Z2YA 3TTVA 1GTMA 2X3UA 1KK0A 3W2EA 1VLQA 2XJ4A 3GT0A 2EV9A 2W2NA 4CKYA 5CLJA 4HLUC 4W5OA 1BWQA 5EQJB 5KO2A 1VOTA 2PA0A 3RTCA 2BGKA 1NRJB 3JQDA 4G5YA 3EVZA 3WXMA 1ZU5A 4Z9BA 4ZVLA 2BGTA 4M87A 1OU4A 4K05A 4G5RA 1GKUB 5KZMB 2DAPA 1PJSA 1P7VA 3WRXA 1T3HA 4EA9A 5IEJA 4I3FA 2VDWB 2VHEA 3AM3A 3LRXA 1QF7A 2OR3A 4ZVKA 1JT9A 5DBGA 1Z7YA 1E1CA 2XVAA 1AHNA 3AZPA 4FFNA 4GGPA 3PYMA 2IIQA 3JQ8B 5J47A 4Z4FA 1ECLA 2E9SA 1Z4PX 3M3DA 2QLTA 3L4BC 3OY2A 1W6UA 1JR3E 1OC4A 2NSYA 2WJPA 4Y2VA 1F2UA 1TQ8A 2Y1EA 3I34X 1ZJ4A 2I7XA 3VR4H 4HFMA 4NOJA 1EE1A 1W0KA 3G5AA 3RHSA 3HU3A 1X94A 2QMZA 2I0FA 2CBZA 2BGMA 4PAWA 1PSZA 2BDTA 3L40A 4LHVA 1Z6AA 1H1LA 1T2EA 3RVJA 2RHGB 4G01B 3N2KB 4C6TA 1PU2A 3Q6MA 2IHZA 4ZOEA 1HQCA 1XYVA 2QQGA 3S8YA 2A0YA 3W05A 3W0LB 1G5RA 1Y8CA 2IE8A 4LJLA 3GARA 1S2IA 1MO5A 3FDZA 1OFTA 1FPMA 1IWBB 2HJSA 2OWDA 3BWXA 4D74A 4D0SA 2JIOA 4CUZA 1TYEB 4J1SA 4UNPA 4JT4A 1O5IA 4M0PA 3Q5EA 1J39A 2PYZA 3PXUA 2CFCA 3RSSA 4QU9A 4N7MA 2GRAA 4BVKA 5JG7A 1ECPA 1U0OC 1ML4A 3SKXA 4IRMA 3ZVNA 3ZHSA 2J7KA 3DVAB 3R7NA 1Y7IA 1GYQA 2DBZA 3GZTB 4GNKA 4GHWA 3OCJA 4XLLA 5DSTA 4Z54A 4OB6A 4K6CA 4YDSA 2X9NA 1M3SA 1T3GA 4AF6A 1KKMA 2O5RA 2WE8A 3IP1A 4HRXA 5DHPA 2VHQA 1MO2A 3DTVA 3A3NA 2CSUA 4MR7B 4II3A 2AMYA 3LRPA 2JI9A 4GRDA 1V1RB 1VB5A 1X80A 4KXYA 1E58A 1BW9A 4HUJA 5G4LA 2LBPA 2VDRB 3O9VA 3DLHA 4DT1A 1U0RA 3MBOA 1UBSB 3O8CA 4QBKA 1Q7RA 2Z57A 4RIGA 4X60A 3INNA 3N53A 2MTBA 1JR2A 2PWAA 3H1GA 4GWKA 3D3KA 1H9CA 3IQWA 3NO4A 4W63A 4ZQHA 4P0PB 3LSTA 2P6MA 1G5IA 3UVEA 5ENVA 1CK4A 3IBSA 3DE2X 3PX3A 5BORA 2RGCA 3IIKA 1Q0QA 3E5HA 3ESBA 2XT9A 4C05A 5HW0A 3D8TA 3UXMA 4QULA 1KAOA 4BB0A 3KOMA 4ASUD 1E5QA 5AW8A 3G5UA 4AY6A 5C31A 1NF9A 4CCAA 3ZPXA 2NUTB 4U7TB 2FJUA 1RQRA 1WXQA 3AHFA 1MC5A 3TRHA 2IYAA 3K5PA 2JL1A 2C59A 4ETWA 5T64A 4MQ4A 2PUJA 2G7MC 3WTCA 1EWKA 2QGFA 3C6BA 2FQWA 4B6PA 4PXYA 4D0RA 4NK4A 2J9FA 2IYVA 3DAHA 3MB8A 4LECA 2D6FA 1XAIA 2UV8A 5C8XA 2OM2A 5SV2A 2Q29A 5HXAA 1KI2A 1ZGAA 2I66A 4V24A 2BC9A 3M1LA 4XYEA 2IIVA 2VJOA 2VNAA 3IDZA 2WFMA 3OLCX 4I9HA 3NZEA 4G5GA 5C1IA 1WXFA 4EHJA 3UCXA 3WDMA 3C5WP 2DYKA 2JKZA 4KQCA 5K4AA 1IOZA 1GGJA 2JAUA 3QP9A 3KT3A