4YB8A

Ca. korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 in complex with phosphate and adp
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
464
structure length
464
Chain Sequence
MNDLERLFNPSAIAVVGASKDPSKIGSQILRNLLSYGFKGKVYPINPTADELMGLKCYPKVSDVPDKVDVAVISVPSDKVLGVIDDCGKAGVKFAVVITSGFKEVGNEELEEELVRRAHSYGMRVLGPNIFGYLYAPARLNATFGPKDVLSGNVAFISQSGALGIALMGYTVVENIGISSIVSVGNKADLDDVDLLDFFDKDPNTGVIMIYLEGIAPGRGRMFIDVASRVSLRKPIIVIKAGRTEVGARAAASHTGSIAGSVAIYESAFKQSGILMAKSVEDAFDWTKALSWNPIPEGERLIVLTNGGGAGVQSTDTFADNGIYLSKPPESLIQEIKKFVPPFASFANPIDITGMAPDDWYYMGTLAALKNPDVDALTVLYCQTAVTTPIGVAKGIVDAIKEAGNSKPVTVGMVGGPEVAEAVSFLNKQRIAAYPTPERASSAMSALYAYARARSYVMKSLAVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords alpha subunit of Acyl-CoA synthetase (NDP forming)
publication title Structure of NDP-forming Acetyl-CoA synthetase ACD1 reveals a large rearrangement for phosphoryl transfer.
pubmed doi rcsb
source organism Korarchaeum cryptofilum (strain opf8)
total genus 175
structure length 464
sequence length 464
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13380 CoA_binding_2 CoA binding domain
A PF13607 Succ_CoA_lig Succinyl-CoA ligase like flavodoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 4yb8A02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 4yb8A03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4yb8A01
4N18A 2Q3EA 3C1AA 2PKRA 5G0UA 1RWBA 4EDFA 1TA4A 4R1TA 4Y6SA 4OSOA 4QXMA 4AJJA 2FHSA 4WOKA 3LLVA 1B2LA 2JHGA 3FHLA 4MKRA 4EZBA 5LDHA 3KZVA 4P4GA 4YJGB 4NBUA 4MVJD 3SC6A 2HQ1A 3DHEA 1PSDA 1WDLA 1XGKA 1PGJA 4LSWA 4Z9XA 3DFZA 3QWFA 4E12A 4YT4A 2ZJ0A 1F17A 2GR9A 3ROQA 3TL3A 1C1DA 4YYZA 1EUZA 1I5RA 2B69A 1X0VA 5BSHA 1CRWG 2GERA 4Z0HO 2CVOA 1Y5MA 3OJEA 2GNAA 1Q0HA 3VH2A 3S2GA 5HM8A 1PQUA 1YO6A 2GASA 2C2YA 3CE6A 4CR6A 1D3AA 4J43A 4PLHA 4DL9A 3ETDA 1BXGB 4R9SA 1YJQA 5AVOA 4E32A 3K8ZA 3VPHA 4K26A 4UVIA 1WXDA 2I3GA 3D3EA 3GT0A 3MOIA 5BNIA 1ID1A 5CAEA 2PZLA 5L4LA 1K6JA 3MWEA 3H4VA 3UCEA 1YOVB 3C24A 2GF2A 1J5PA 3DONA 3QQPA 1A9ZA 2EXXA 4Y98A 3IKTA 2BFOA 1ISJA 5T67A 5CDYA 1NBOA 4YJFA 5F1KA 5G0SA 4KQWA 4UEJA 3L6OO 1V3VA 3NJ8A 1H2HA 3GPIA 4DLBA 5B4UA 3W6UA 1KEVA 1KVRA 1D8AA 1NVTA 3RU7A 1A4UA 1IULA 4MINA 2JL1A 3SX2A 3W6ZA 5GZ3A 2POQX 4PZCA 1LSJA 2ZJ1A 2CUKA 1ZCJA 2E37A 5DCWA 3NTRA 5THKA 1R4NB 5AOVA 3EYWA 3ZU2A 4MVJA 4E30A 4ZQGA 3EW7A 1KBZA 3MZ0A 1HE2A 3K73O 4MVJH 5G4KA 1ZKMA 2V6MA 2NU8A 3GZNB 1QR6A 3VOSA 4NJOA 3EVTA 4J1NA 1C1XB 3RROA 3JQGB 1M67A 1DIHA 1PU2A 2VWHA 4OXKA 3TWOA 4CL3A 1HXHA 2CMDA 4QFCA 2NUAB 1D1SA 1Q0LA 1RYDA 1BVUA 4FD3A 4IDFA 2D2IA 3BMCA 4E4YA 2D5CA 4NIMA 1NQ5A 2H1SA 3BHJA 2NU6A 1O94A 1DIGA 3VPFA 3AU8A 1U8FO 3PVZA 3ZV5A 1YKFA 3ZNNA 1XLTA 1PQWA 1LXCA 5KKCA 3KETA 1YDEA 1LRKA 2OFPA 1WMBA 2VUUA 4N54A 1JWBB 1D4FA 3GFBA 3QWHA 4U0KA 5JSFA 4NJMA 1YBAA 4DBZA 3G17A 3LLSA 3PZRA 5A9SB 5TJHA 2DC1A 1QYWA 1X1EA 3DEYX 1A71A 4JJIA 4JP2A 4ZGWA 5DDIP 1P74A 1DLJA 3TZQA 3OF2A 3L9WA 3I9KA 1X0XA 1NX6A 1YQGA 2PK3A 3BIOA 3H8VA 2X4GA 4O63O 2B35A 4I9NA 4J9UE 4XB2A 1PL7A 3GEGA 2DBRA 4L74A 4W99A 1ZFNA 4UUPA 5IF3A 4JIGA 5KJCA 2X5KO 3DBVO 5BNFA 3KYCA 4Q9NA 4E2ZA 4Q3CA 4ALNA 3L77A 2X0NA 2WD8A 2Q4BA 3UF0A 4I5FA 4GWGA 3EHEA 3ITKA 4YT8A 1G0OA 5U9CA 3P5SA 3IMFA 3ONFA 3BMOA 1KIFA 2VHYA 3GRKA 1S7CA 1Y9AA 1E6EA 4IZIA 2QYTA 4O6VA 1YB5A 2IYPA 1IUKA 4WLNA 4QTZA 3WSWA 2BMAA 3AFNA 3HFGA 1P33A 4MIYA 1WMAA 3TDKA 1TLTA 1P1KA 4XQ9A 3NT2A 4RZHA 3I9JA 2NU7B 3T7CA 3VPSA 4H15A 2EW2A 4ITUA 4XGNA 4OL9A 4W7IA 1CJCA 4W6ZA 3GNTA 5ITVA 3GGPA 2YJZA 4CLHA 2VZ9A 4J91A 5EMHA 1T26A 2IEDA 2DUWA 1GV1A 4RVHA 1H94A 1YS4A 3PGJA 5L7YA 3KTDA 1GADO 4L4SA 4CLOB 4FFRA 3GY0A 1H6DA 1GCOA 4ALMA 4PFJA 1LDNA 1HLDA 2V7PA 1E7YA 3DC2A 3LU1A 4O59O 4C7KA 5TT0A 2SCUB 4NPCA 3OIGA 1VSVA 5DBIA 1T24A 2JCYA 4ND1A 4F46A 5TSDA 3DMYA 3BMNB 4ZVVA 3U5TA 2FPIB 3VKUA 4KWHA 1N5DA 4AJHA 1HWYA 2FPPB 2GZ2A 2P68A 3GN2A 4FW8A 4IXTA 1Z73A 3JQ7A 1P0FA 1DPGA 1E7MA 4UUNA 1ENZA 4TRMA 1VL6A 4CV1A 4IGEA 1JKIA 4CR8A 1GPDG 1LSSA 2PY6A 1DIBA 4OIMA 1Y8QB 2HMSA 4XX0B 4GMGA 4P4LA 2VN8A 1A7KA 4I9UA 1ZW1A 5TT1A 1IHXA 3WNVA 3PWKA 4J49A 5EPOA 9LDTA 2OL4A 1D7OA 1ISHA 4BNIA 2C20A 3WMXA 3JQCA 2G0TA 4BMVA 1N7HA 2O3RA 4YAKA 2O7SA 2ZQYA 3OIFA 4IS2A 5CDUA 3I9MA 1VSUA 4GGPA 4RGBA 3AM4A 4GSLA 3ZH2A 1EQ2A 1XQ6A 1YGYA 2JD0A 1DFHA 2EP7A 3U4HA 3WMWA 3ZU3A 1JDJA 3ZWXA 1D1TA 1JVBA 4UUOA 2DTXA 4PVCA 4PG4A 2PWZA 2OO5A 5IXSA 1H93A 3OEWA 3QVWA 1CQJB 1VE9A 3VZRA 3AK4A 3DBRB 3QV1A 1E1KA 4Z9YA 3WGIA 4MO2A 3UFXA 1YBVA 4BKUA 3JQ9A 3DZHA 3C7AA 4R5MA 5JS6A 4JROA 1PJTA 1ZK1A 3RD5A 1IPFA 1V0JA 2CFCA 2P9EA 2Y1GA 3W8EA 4D3FA 3UXYA 2DLDA 4GQAA 2PH5A 3VH1A 4RDHA 4D3DA 3QP9A 4S1VA 3KYBA 3BMQB 5TRTA 1H6BA 4O0LA 3RSHA 2X9GA 1LLQA 3WBFA 4FS3A 2ZTUA 1GUYA 2AHRA 1PS9A 1EDZA 2EGHA 4B7XA 1F12A 4OQZA 2NVUB 3LSYA 4OXYA 2YQ5A 2NLOA 2BELA 2HMWA 3RVDA 2BLLA 3MTJA 5BSEA 2DKNA 1O6ZA 4YAGA 4CLRA 2B4TO 3I9LA 2J8ZA 1BSVA 4DXHA 1PJ3A 1HZJA 4BO9A 4CQMB 1F14A 4Y67A 3DBLB 2D0IA 1QLHA 3AOEC 1T2EA 3F6YA 3QVXA 3HJAA 5FF9A 3FR8A 4M8SA 4UVEA 1E5LA 2ZCUA 3H5RA 5DCYA 1P1FA 1GFSA 3PHJA 4QO7A 5DP2A 1VKNA 1NAHA 3ADPA 3DBHA 1R4MA 2VZ8A 1ZK2A 3BHMA 3IC5A 1K6XA 1RPNA 4CMBA 4DIOA 1NPDA 1N7GA 3ANNA 2P91A 1AHHA 4Y9DA 3S2FA 4BNZA 1P44A 2ZATA 4J7XA 1XYGA 5JCJD 1A72A 4TMFA 2EGGA 1HDRA 4CM6A 1GZ3A 2FR0A 3QY9A 3DOOA 2BI7A 4E5KA 1RM5A 2EW8A 4L9RA 4W7HA 4CODB 3ROMA 5DZSA 4LW8A 3QLJA 3QVSA 4JBGA 4Z6KA 3VZQA 2Y1OA 3GHHA 4MOWA 3O8QB 4XGKA 5ICSA 3KSZO 3FI9A 4LK3A 3D0OA 4JBHA 1DJNA 3FNFA 4HFRA 4U8GA 4WLEA 3TL2A 2NU9B 4JXKA 1YB4A 2UV8A 4XB1A 3RUHA 1NR1A 3WQSB 1HKUA 3HHPA 5AXBA 3I52A 2DFDA 3KUXA 1O95A 3ETEA 3SXPA 4XDZA 1LQTA 2CF6A 2NTJA 2P5YA 4TRRA 3E48A 4LSMA 5F1PA 1HYGA 2DTEA 1GZ6A 3VKVA 1DRWA 5MGBA 2V6FA 3F47A 5H82A 5L4SA 2HDHA 1QRRA 4WOJA 5A03A 1HDGO 4R1UA 3TOXA 1BW9B 4GLOA 3DZKA 1ONNA 5ILOA 1KVSA 4CL8A 3ZI0A 3K2EA 3FNGA 4A27A 1MP0A 4II3A 1BDBA 5JCJA 3C1OA 4RPGA 5IG2A 4UREA 2PKQO 1VJTA 3ZV4A 3IUSA 1LC0A 4CQLA 3FPLA 1NHWA 2QX7A 2VTDA 4A26A 1VM6A 2IRWA 3HNPA 3CMMA 4HP8A 1ZNQO 5G0WA 1YQDA 1SC6A 1XEAA 2EERA 2W90A 4NK4A 2P9CA 3IQDB 2J3IA 5ICMA 1N9GB 1DDOA 4HXYA 4IPTA 3GNSA 3Q2KA 5ES3A 3OICA 3FR7A 4FGSA 3A14A 1QYCA 1ML3A 4MKXA 1TVEA 4TQGA 3B6ZA 1M6WA 4MVJF 4R9RA 1T2FA 3ZWNA 5ER6A 2CDAA 1ZBQA 3D4NA 3TPCA 3V1YA 4DLAA 4WASA 5IAAA 1SZJG 5TNXA 2I65A 2E4AA 4BNJA 4WCFB 5BT9A 2RAFA 2DM6A 3GF4A 3V2GA 5DNAA 3RC2A 5FFFA 3F1KA 3GOHA 1Z7EA 4GVLA 5TF4A 5JMWA 3INGA 3C3XA 1B3RA 3DZFA 3ZNQA 1QMGA 4B4OA 5L7TA 2PLAA 1L7DA 5L4NA 3OSUA 1JLLB 3UUWA 3VTZA 1H6CA 1EUCA 3RFTA 3R0IA 3DMTC 4BV8A 3GMSA 1YH3A 3P19A 2PR2A 1VPDA 4QT0A 4BOYA 1NXQA 3AUSA 1FJHA 3PYLA 1HETA 3PWSA 1IZ0A 4BO4A 4IQ8A 1JAYA 1PEDA 4XQCA 3RQSA 5KJFA 1L7EA 4E5PA 1EBUA 3LDHA 1PZEA 1ZMTA 3DZJA 3B20A 4OKNA 2PTGA 1PWZA 4J0EA 3ZCXA 1I30A 1UJMA 4Q39A 1ONOA 4DQXA 5F21A 2I67A 1H9AA 3NGXA 4W9NC 1U5CA 4OOFA 1I0ZA 5DT9A 5C7OO 3A06A 4CLDA 1GR0A 4PLFA 4AG3A 4R3WA 5A05A 4LMRA 2D1YA 1ZXBA 2Y93A 5A06A 1ZSYA 5L95A 1N1EA 3TNLA 3WQQA 2PD6A 4YAIA 2BI8A 2FSSA 1MB4A 3PQEA 4NMHA 1CQIB 3MJEA 1SPXA 1EUDB 3ZGYA 1BWSA 1EK6A 5G0VA 1VJ0A 3ENNA 1TT5B 3WLFA 4BNTA 2W2KA 3DTYA 3F5SA 5IDQA 1TT7A 1ENOA 4CLEA 3PRJA 2X1HA 4DPLA 4NHEA 1U7TA 3Q6IA 1T2AA 2B37A 1Z74A 3FSRA 4K28A 4R41A 1E7RA 5JLAA 4EJ6A 3EC7A 2FWMX 3E18A 1P1IA 4BQPA 3T4XA 4L76A 2DFVA 2LDBA 3E1KA 3GH3A 5KJ1A 4CMEC 1ULUA 4N5NA 5L9AA 3MWDB 1DAPA 1LSOA 4FOSA 1EBFA 5BSGA 4D0SA 3U09A 4ESOA 4G81A 4E33A 3OP4A 3OQBA 1J6UA 5HA5A 3OJFA 3QA9A 4FGWA 3V1UA 2BHLA 4JX8A 3ZWWA 2Y1FA 4IUYA 2NQ8A 3E9NA 3JD3A 4J1QA 3C8MA 4ND5A 4I5DA 2A92A 4AJNA 1N2SA 3ROKA 4DA9A 5DF1A 5KOIA 2A9FA 4K1LA 5T8KC 1NYTA 4U0JA 3WTBA 3GAZA 3JD4A 1HE5A 3RAJA 4BO0A 3DB2A 1JKJB 1PGNA 2G76A 2YFHA 1WAMA 2J3JA 1HYEA 3OJ0A 4JNKA 1YBMA 4MJLA 3H65A 2O23A 4YT2A 4PZEA 3DHYA 2ET6A 3AW9A 1AE1A 5JO0A 4I9HA 4L4RA 3A1NA 3JYNA 3RBXA 3CXRA 4YXFA 1MC5A 4HX5A 4DIBA 1EVZA 1AUPA 1W4ZA 3WGOA 5COBA 1X13A 4M89A 2FOIA 1HDOA 4YJHA 1U9JA 1E3WA 1EFLA 3Q1LA 3WBBA 2GZ1A 1KEWA 4E5YA 4AJOA 2RHRA 2RIRA 2W2LD 4XR9A 3D5QA 3T7EA 5CAEB 2Y0EA 5EESA 1VI2A 3P2OA 4ZD6A 2WDZA 4KMSA 2JD1A 4WLUA 2FRDA 4IJVA 3WQRA 1I01A 2W8ZA 4GH5A 5JAMA 1BXKA 4AJ4A 4BNLA 2OOSA 4BO8A 3AOEA 4YPOA 4E5NA 3FD8A 1Y9EA 4RDIA 4XD2A 1UZMA 2BKAA 2JD2A 3AY6A 4MDHA 3UCXA 5T57A 3FPCA 1K89A 3H5AA 1JN0A 4K9DA 5ENVA 1HSOA 4BGEA 4BNKA 3L4BC 4RPKA 4UUMA 2W4QA 1HDCA 2YYYA 2ZYDA 1PIWA 2CVQA 3PK0A 5G4KB 3EVNA 3SC4A 1AGNA 3CZRA 3KM0A 3HDQA 3EMKA 1UDAA 4BO7A 1GQ2A 3NX4A 4O5OA 4KOAA 5DOVA 3JQAA 3ULKA 3ZHYA 4JCOA 1PGOA 3BMCB 3KLPX 3WIDA 4P38A 4JBIA 1B14A 4PG5A 5FI5A 2NU6B 1OZAA 3HWRA 4MPDA 1EFKA 2W2LA 1U7HA 5U1PA 2AA3A 4YBZA 3RFXA 4B4VA 5JC8A 3QRWA 3VZSA 4YTEA 3VH4A 3U3XA 4WUVA 2H63A 1RM4A 3BTVA 2VT3A 4JK3A 5JCXA 3ZWMA 2HRBA 4NJMB 3RC1A 1G6KA 1B8UA 4IDEA 5C3MA 4N5LA 1M2WA 4RPHA 1DIAA 5AXAA 3K31A 2C0CA 1OI7A 1TEHA 4XYEA 1Q1NA 4MVJE 2X22A 3UAGA 5CPFA 4BGVA 1Y6JA 5B1YA 1FMCA 2AG5A 5A4DA 1I3MA 4PRKA 4XRGA 1K6IA 1I10A 3NRCA 3AM3A 4AJIA 3LVFO 1PJQA 1U3UA 3OJLA 5KNLA 3U62A 1P0CA 3QSGA 2VRBA 3P7MA 3KYCB 3TSCA 3ONEA 3ONDA 4D42A 3VHRA 4BIIA 3C1TA 5BQFA 4IXWA 1NNUA 3PLRA 2CDCA 3OETA 3E03A 3UICA 3DDNA 4FCCA 1LI4A 3B1KA 1RM0A 3HDYA 4G2NA 4FJ0A 4IQGA 1LA2A 2NNLD 3IS3A 4HNHA 2A94A 4CMCA 3LC1O 2G17A 4IDGA 2VCYA 3K30A 4WGGA 3FNHA 2JFFA 4NK5A 4CMIA 2X9NA 4JJFA 3QIVA 5B37A 1P1HA 1PZFA 3CINA 1WDKA 3UVEA 1EVYA 4J4HA 5EIOA 3FWNA 3ASVA 4XA8A 1GCUA 3E82A 3RJ9A 4HBGA 5HS6A 2ZTVA 2QHXA 5I9LA 3QVTA 3WSVA 4IZHA 4DMMA 3WFJA 4G65A 3CMCO 1H2BA 3SLKA 5ILGA 4KWIA 2O3UA 3ZW9A 3LZ6A 3F4BA 1ZSNA 4YRDA 1CDOA 5I7EA 5CP8A 1E6WA 1HZZA 3CTMA 4GWKA 5JY1A 2DPHA 4I08A 1I2CA 2WD7A 2Y66A 3PJDA 4K6CA 4LCEA 5TQVA 2VWGA 3K9QO 1R16A 2FR8A 3DAPA 3DMTA 3AM5A 4NZ9A 4LRSB 5HBRA 2VOEA 4IJWA 1QYVA 3JQ7B 2OORA 1DC3A 4CM4A 1RJWA 1DC5A 4X54A 5EL0A 1IB6A 1EE9A 3MJTA 4J1SA 5I8WA 1DC4A 3Q11A 2WE8A 4INAA 4BO6A 1XA0A 1F06A 1X1TA 3PQDA 3SVTA 1SBYA 1PR3A 5ITWA 3NYWA 3AU9A 4L0QA 4C4OA 5KKAA 2FPGB 3ZU4A 4I8XA 1KOLA 2OP1A 4OYRA 4R1NA 1N8KA 3PHHA 2JFGA 2HK8A 1PJ2A 4A0SA 1ZZEA 2XPCA 2NSDA 2ZCVA 4FBGA 3UW3A 3WGTA 1BG6A 3HZZA 1UXKA 4H16A 3H9QA 4P22A 2YV2A 5GZ6A 2YHIB 4RF2A 3IDSA 4TKLA 1VLLA 3JV7A 3B1FA 2NM0A 4LMPA 1DO8A 3RASA 4FFMA 5DN9A 5DCUA 4PLGA 2O48X 3D3WA 1PTJA 4M86A 4IM7A 2X58A 2ZTMA 5TGDA 1YQXA 1CYDA 2QIOA 3PPIA 4II2A 1PX0A 1BMDA 1PL8A 2EHDA 4BKPA 3M2TA 1M76A 4AJKA 1VL0A 4AJPA 2Q2WA 2AG8A 2PD4A 1BRMA 1Z82A 1A5ZA 3Q3CA 1FDUA 4TVBA 4XKJA 3WJ7A 2CDBA 4LISA 2YDYA 1YOVA 3S1LA 4BHTA 1T4DA 5JAZA 4CMEA 4ZN6A 4GX1A 2NTVA 1J4AA 1HF3A 1DRVA 2AXQA 3RCBA 1H0KA 3KO8A 4B79A 4XDYA 4BQRA 4FFNA 4CUJA 1K5HA 2BF7A 2JKVA 3FF4A 2C29D 4Z3DA 3WYCA 4ZRNA 4CLXA 2AEFA 1W73A 2PZJA 2PNFA 2WEKA 3EGOA 4R51A 1NR7A 1WP4A 3IP1A 5T8KA 4RZIA 4ZQFA 1UDCA 2FMUA 4QX6A 3AI2A 3H9EO 1KS9A 4E13A 3FN4A 3JD1A 2O2SA 2VRCD 1KVUA 5KJ6A 1JAXA 5JAQA 2GLXA 1DEHA 1DXYA 2C7VA 4GX5A 4CLRB 1NFRA 4MIEA 3GZNA 4MVJM 2VUTA 4Y6RA 3IP3A 2O7QA 2B83A 3D1LA 3GVHA 2Y67A 1HL3A 1LDMA 5JYDA 2NUAA 3DZGA 4XRRA 4YACA 3W8FA 4AL4A 3DHNA 4Z0PA 3PZBA 1CETA 3GMDA 4BMNA 4XYBA 4H3VA 4PLTA 1A9YA 1H6AA 3KXDA 2Y0DA 3GVXA 3DBHB 1R4MB 1UAGA 2C59A 4OQYA 1E7WA 3BHIA 2ZB7A 4FJ2A 1UZNA 2NV6A 3FBTA 2RH4A 3UHAA 1N1GA 1I33A 3GN1A 1F8GA 3LYLA 4NBWA 1ZXLA 3JQBC 1LLCA 1E77A 1YXMA 3EAGA 3I9NA 5JO9A 4OGWA 3IIEA 2IDZA 5L40A 3P2YA 1AHIA 2Q2QA 4QUKA 1XU9A 3TQHA 4J2HA 1KEPA 2C54A 3KYDB 1WPQA 4FFLA 1NPTO 4RJTA 4YAJA 1B0AA 1BVRA 2J3HA 1B15A 4B7CA 1WW8A 4TZKA 2G82A 2PZKA 2BH9A 3L4BA 4L75A 4W82A 4D0RA 3OBBA 2W98A 2I99A 4AJLA 2VRCA 3AUTA 4IINA 2FP4A 1Y7TA 4UEOA 3L0DA 3TZ6A 2QYSA 5JDCC 1E0DA 3GEDA 3KOUA 3M1AA 3ZWPA 2HRZA 5I7VA 1T25A 4J7CA 4MP6A 1EQUA 1QV6A 1B3BA 4GKVA 5L53A 1C0IA 2UUOA 1KYQA 1Q7CA 8LDHA 4BO1A 3GVIA 1SCUA 1SNYA 3JQ6A 5KVSA 3HDHA 1Y8RA 2GPTA 2BD0A 3DO5A 4OH1A 3X2FA 3MJCA 3BYZA 3U0BA 3DAFA 3Q9UA 1E6UA 2CF5A 4CUKA 3WGZA 5JFOA 1CERA 1L1FA 4DQUA 2GN9A 4E6PA 4YDRA 1PQPA 4OXNA 1EE2A 3DWFA 3NUGA 1LJ8A 3JCZA 4ZQHA 4EUEA 2JAHA 1ENPA 1ZEMA 1C0PA 5FWNA 3W4IA 4CLOA 3G1TA 4XZ3A 1KERA 4CQLB 1FDTA 1XELA 2P9GA 3DL2A 2I5PO 1S6YA 4EYEA 2Q46A 4XQGA 1DLIA 3AOGA 1UZLA 3DZBA 3K5PA 3OIDA 4KQXA 2ZB8A 3VC7A 3MJ4A 2EG9A 4J0FA 2O50A 1IHYA 3G1UA 1XCBA 3HG7A 3GVPA 4GSKA 3V5NA 4HFJA 3OEYA 4GAEA 3S2IA 4IIUA 2DU8A 3LT4A 3AUAA 3H3JA 1SOWA 2J5KA 1XG5A 4DVJA 6ADHA 1KC1A 4R1SA 2HAEA 4B3IA 3EDMA 2FPIA 2NWQA 4F3YA 1RM3A 5CDSA 3OFSA 5J23A 3WGGA 3WLEA 1I32A 2OHXA 2D5AA 3CIFA 3JQ8A 4B3JA 5B12A 2I6TA 1XDWA 2Y1CA 4WEOA 3L07A 4E2WA 3UN1A 5BSFA 3D7LA 1VL8A 2WE7A 1YB1A 2Q1WA 5KTKA 3KEQA 4XX0A 2GZ3A 1EDOA 3QWAA 1TI7A 1I8TA 3GFGA 1B16A 3BA1A 1ENYA 1YL5A 3VZPA 1DOHA 2QG4A 5T64A 3OQ1A 4FC7A 4ZQBA 4YWJA 3RBZA 4D43A 1TB4A 2QZ9A 1K2WA 2UUPA 4KDEA 2WYWA 1DRUA 3GR6A 2WSBA 5IN5A 1ZK0A 1I2BA 4CQMD 2YQ4A 4MP8A 3AY3A 1GEEA 3KHUA 3ZV3A 3Q9NA 3S2EA 4P4NA 3TF5A 3E8XA 4DMLA 3IL2A 1OC4A 4Q3NA 4EUFA 3ICCA 4QECA 3WYBA 2F00A 1HDXA 4WECA 4KTVE 3S55A 4BNHA 4M55A 3WX0A 4DPKA 5KJEA 4DBVO 1HE4A 4B4UA 1O0SA 2WM3A 1B8VA 3NT5A 3GG2A 4R3NA 1ONPA 1ZSVA 2IYOA 1Y1PA 1O9BA 1M66A 4RL6A 4ZU3A 4URFA 5T5QA 1R0LA 2IZZA 4PLCA 5CPBA 4BVAA 3WGQA 4A7PA 4F45A 3M2PA 1NP3A 4N5MA 1PS0A 1E1NA 1OC2A 5JE8A 3R3SA 4BNFA 3OQ6A 2GYYA 2W2KB 2RCYA 3C7DB 1GZ4A 3BMQA 3FBGA 4NDNE 3PQFA 1MXFA 4TRJA 1P1JA 1UR5A 3KBOA 4IY1A 2QZZA 4NU6A 4Z9FA 4B8WA 3NJ4A 2H5LA 1V35A 3KVOA 1DHRA 1MX3A 4NFYA 2NVUA 2D3TA 4ALKA 4ALIA 1R12A 2DUUA 2AEMA 3PDUA 4BNWA 3SJUA 3PYMA 2AQIA 1SMKA 1CF2O 2XXBA 1SAYA 2HMTA 4CQMA 1HE3A 3VH3A 3NTQA 5U4QA 3NT4A 4Q3BA 3DBLA 4IDCA 4EEZA 4D3SA 4RV9A 4GVXA 3PDJA 4LRTB 1LRLA 4LVCA 3KB6A 1PZHA 4B7UA 3ANLA 2YV1A 3D5TA 5I9MA 3FNEA 5F3RA 4NI5A 5G2OA 2A4KA 4XQEA 1GL3A 5COQA 5GMOA 4KDFA 4OHUA 3A4VA 1NHGA 2VYND 2YV3A 5JNLA 4BUCA 4JP3A 1W8DA 1MGOA 1P9LA 4CMHA 3PJEA 5C7IO 1C0LA 3ON5A 2HMUA 2B5WA 2JJYA 4RVUA 3HSKA 1J0XO 2X23A 1PJBA 4WLOA 4E2XA 2C2XA 4WLVA 4YRBA 3WTCA 2Q99A 2PA3A 3R3JA 1E3IA 2NADA 3CKYA 3ZDFA 2D8AA 4NG5A 3LT2A 3AI3A 3N74A 2HMVA 4O1MA 4UULA 1R37A 5K0ZA 1BHSA 3LQFA 5TJ9A 1WZEA 3H2SA 1EZ4A 4RVGA 3WNQA 3ENKA 4IBOA 4IGFA 4BNGA 5GZ1A 4CMAA 1ZH8A 3FTPA 3UKOA 3I4FA 3TFOA 4I1IA 3G79A 1NTOA 2HKIA 4PLVA 1P31A 1ARZA 1SEPA 3RUFA 2Q4EA 1NVGA 2GD1O 9LDBA 3LC2O 1LNQA 3FTNA 4DYVA 3GUYA 1Z7BA 2PFGA 5EJ2A 3RWBA 1JKFA 3NDJA 4E0BA 3PHGA 1F8FA 1T2CA 2ZYGA 3JTMA 4RORA 4J4BA 1NASA 3RBVA 5IZ4A 1T1SA 2R2GA 1M75A 2VT2A 1BW9A 2HJRA 1I2ZA 1NM5A 2VTEA 5KVCA 4XWYA 1LU9A 3LT0A 2VYNA 3DOCA 3GGOA 3JQBA 5TX7A 3WB9A 3RC9A 4HADA 1IYZA 3VTFA 2WYUA 4DPMA 1UDBA 2ZQZA 2GN4A 3JSAA 4CM8A 4RVSA 3WIEA 5HS4A 4QSMA 4BNVA 2HLPA 3INRA 3JQAB 1GUFA 2YW9A 1KETA 4RQTA 3I6IA 1ISMA 3E6AA 3ROPA 1GQQA 3BZUA 2C5AA 2P5UA 2X0IA 3ITDA 4IDAA 4RF4A 1EK5A 2BGLA 4IS3A 1UXIA 5EERA 4C7JA 1X14A 5JDCA 4IIVA 4TROA 1QLJA 4NFSA 4BNXA 1PZGA 1GV0A 4IDBA 1I3KA 4PGFA 2I76A 2Y68A 1C1DB 3RUIA 4E31A 1SB9A 3U49A 2UAGA 5AQ1A 2EJVA 4H7PA 2D59A 3PIDA 3C7CB 1IE3A 5G0TA 3TOZA 2JCXA 2GN8A 3ANMA 5AXDA 3BTOA 2JFHA 1P45A 3GRPA 2Z95A 4JLWA 3WYEA 4YEDA 3BTUA 4LGVA 4GI2A 1KY5A 1MG5A 3HB4X 1NQTA 3RU9A 4F6LA 3MWEB 4B4WA 4FIZA 2VHVA 2XXJA 3DR3A 5IJZA 3R6DA 3RFVA 3WOHA 4MKZA 4D44A 1ZO8A 2HUNA 4YJFB 4ALLA 3Q0EA 2CNBA 1E92A 1M6HA 2DAPA 5KVQA 4DREA 4HFNA 1GEGA 2BFMA 5CHEA 3HADA 4RVFA 2I3AA 4FSHA 3FCOA 3B1JA 1ISGA 3I4CA 1PGPA 1U3VA 3CSDA 3VDRA 1LEHA 2X8LA 4AICA 4A2CA 3L6DA 3NV9A 2YHUA 4CMIB 2NQTA 2AQHA 1I24A 4XYMA 4GKBA 5IDYA 2IZ0A 2VHWA 3WGHA 3HN2A 3PYXA 2NU8B 4RLHA 2CSUA 1Y81A 3N7UA 1EEHA 2ZYAA 1YDWA 1CQIA 3JQFC 2HO5A 3IJRA 1FDSA 2JHFA 4AJ1A 3AWDA 1WWKA 1WLYA 5DULA 2CVZA 3U9LA 3RKUA 1QXSA 1C14A 5JAIA 1XWFA 3QW2A 5ENDA 5H83A 3V1TC 3F1LA 4YA6A 5T6BA 4IMRA 1LDBA 5CEEA 1O8CA 1YE3A 2B0JA 2Q2VA 2HSDA 2Z1MA 1C3VA 1GU7A 3RKRA 1H9BA 1UP4A 1MUUA 3NEPX 2NVWA 1KC3A 4E21A 1U3TA 1FF9A 4CM4B 3RUAA 4WCDA 4BV9A 4OMUA 1X7GA 4GBJA 4NR0A 4XEHA 4E5MA 1JQBA 1WNTA 1ZJYA 1E3EA 3STHA 5JYEA 4GX0A 3LF2A 4WNCA 2OBNA 2OP0A 1ADBA 2Q49A 5G4LA 4BGIA 4ID9A 3WFIA 2VYVD 1DIRA 3CEAA 4Z0TA 3SBOA 4D7AA 5TLSA 3NDRA 3NTOA 3GG9A 3VPXA 1JKJA 5DP1A 3DZIA 1Z6ZA 3ZWVA 4GL4A 1ADCA 2DTDA 3H9JA 3QWIA 3WGYA 4KTTE 5L45A 2FR1A 3BMOB 1KVQA 4R01A 1LX6A 1GYPA 4FPXA 3D3WB 3JYOA 1LTHR 2OMEA 2IE0A 4RPJA 3L9XA 4UAGA 4U6SA 3ZWBA 3N58A 4R16A 1DJQA 2O4UX 2F1KA 5A9RA 1A7AA 4CM9D 4Z3KA 3WWZA 7MDHA 2V6GA 1E1MA 1LDGA 4CPDA 4Y8VA 2Q1TA 4J1TA 5JBIA 2YY7A 4OKIA 4UVHA 3ZWAA 4AVYA 2GN6A 1U5AA 4XJSA 5JPIA 3JYQA 2VHZA 3D4PA 1R15A 1E7SA 5A04A 1UP6A 2I9PA 1BGVA 3RIHA 3ZHXA 3F3SA 3QJ5A 2WTBA 2DPGA 1HSZA 1ZMOA 4LCJA 5JMPA 2VNSA 4ZRMA 3F9IA 1Z45A 4U6QA 3GLQA 3H9GA 3PWZA 4KUHA 1ZK3A 1O5IA 3OECA 4I5GA 1KY4A 3DTTA 1I3LA 2ZTLA 1IPEA 1DHTA 2VYVA 4DYDA 2EKQA 3QWBA 2WMDA 5K6AC 1YVEI 2ZB4A 4MVJI 1JVSA 1VRWA 3WR5A 8ADHA 1T4BA 4EITA 4HFMA 4OM8A 3KRTA 2NVBA 1GPJA 1HT0A 4BO5A 1NWHA 4KZPA 3VDQA 2OZPA 2JAPA 4IJKA 2H6EA 2IZ1A 3ETGA 5AXCA 1R6DA 1RKXA 2YUTA 5A3JA 1OOEA 2FZEA 3QE3A 3COSA 4KUEA 2ZK7A 3CUKA 4Q3EA 4CM9A 1U28A 3LK7A 4YJGA 4R54A 4GLLA 3ZZNA 5CG2A 4W9NA 4PG6A 3K96A 5IDXA 2EKLA 2P4QA 3D64A 1R0KA 2G5CA 3GHYA 4CUZA 4PIVA 2XAAA 3PTZA 4NNJA 2O2YA 1SO8A 5L51A 4A5OA 3VVBA 4GX2A 1WZIA 4PCVA 4WE3A 5TS3A 1KEUA 2X5OA 1LUAA 3K2BA 4UEKA 2IXAA 3LC7O 3G3EA 2BFPA 1GYRA 3EZYA 1ZIDA 4ALJA 1MG0A 1ORRA 2AE2A 2YDXA 2C07A 5ER9A 1Q7BA 1BXGA 3O9ZA 3ST7A 1CEQA 4DC1A 2QRKA 1E3JA 1EVJA 4J4TA 1UXHA 2FP4B 1LDYA 3GUCA 2Z5LA 2O3JA 4IJUA 1ISFA 1U1IA 3UFXB 2J3KA 1FXSA 4RCVA 5KCZA 1AXEA 2XOXA 1UXGA 4EJ0A 4RPLA 3QHAA 4OJNA 1OFGA 3ZWOA 3ZU5A 1E3LA 2G1UA 1VC2A 3KV3O 1SB8A 1Y5RA 4BNUA 4NBTA 1SCUB 4I5EA 1T2DA 1BXZA 3AUUA 3U4DA 1Y8RB 2DBZA 5CEJA 4HWKA 3AJRA 1I36A 2X5JO 4PN3A 3V2HA 1O89A 3OM9A 3O03A 5EQDA 1R4NA 4S3MA 2GGSA 4NH4A 5A02A 1AN9A 1FDWA 1OMOA 3F5QA 3PJGA 5IZCC 2NACA 3WXBA 3NDIA 3RUEA 3PGXA 2EJWA 4EEXA 1C1XA 5TIIA 3JQGA 3RI3A 1EVIA 2HK9A 1Q0QA 3BXXA 3H6KA 4DTIA 1T1RA 3FWZA 3HFSA 1E1LA 5B4VA 2B4QA 4A03A 1PJCA 2BGKA 1MV8A 4BL5A 1LBEA 4RLSA 2VWPA 2GCGA 1LC3A 4IMPA 3WDSA 1DC6A 3HQ4O 4D41A 4DIFA 4MVJP 1QYXA 1ZEJA 3DAGA 4M49A 1B8PA 1YWGO 4TSKA 1ADFA 2B4RO 2UVDA 4CMKA 2X9VA 4FN4A 1F0YA 3K6JA 4G5HA 2RBEA 4E2YA 3JQ8B 4QFDA 1VJ1A 3SJ7A 3IUPA 4CM5A 2FZWA 4XJTA 2DBQA 4NBVA 2J5RA 5A9SA 1NQOA 3PXXA 2GO1A 1WVGA 5L3ZA 1E5QA 4FR5A 2O4CA 3DOJA 4NQZA 2J5QA 1B26A 1V3UA 1XU7A 3MJVA 3RUCA 3F4LA 1V9LA 2TMGA 4NBRA 4QEDA 2FPGA 5MDHA 2Q45A 2FN7A 3GZ4A 1A27A 1QG6A 3TZCA 2XF8A 5L7WA 2Y1DA 5CFZA 5HRUA 4Q3AA 2GRAA 3U4IA 4TWRA 4YQZA 4FOOA 4EW6A 3DFUA 5JC1A 4BGUA 3A28A 2YHIA 4XR4A 1NAIA 3OA0A 3S8MA 4BNMA 3ICPA 1FK8A 3BTSA 4K6FA 4PVDA 1W0CA 3JQFA 4HY3A 2GSDA 2E49A 1P77A 3GVCA 3AI1A 5IDWA 2Q1UA 3E5RA 4WCFC 1ZUD1 4BO3A 7ADHA 2AW5A 2CD9A 4DGSA 3LT1A 4OOEA 1AXGA 4L4XA 4E3ZA 4FC6A 1MFZA 4CV3A 3OJOA 3GDGA 4DQVA 1MC4A 2PKQP 5AYVA 1JW9B 4YT5A 2NU7A 2EV9A 3NAQA 1LSUA 3ORFA 4PLWA 2R00C 4TKMA 3MTGA 4BB5A 5JW6A 3WICA 2E48A 5CEFA 3VVCA 2VNAA 2NTNA 4TRNA 4YB8A 3E9MA 2BRUA 1R0SA 1X7DA 2HU2A 4HNGA 2UDPA 2EP5A 4CMGA 4EBFA 5I9NA 3TZHA 5B4TA 3PI7A 3GGGA 3HB5X 2ILTA 1YRLA 4FQ8A 4D79A 2HK7A 3ZV6A 2SCUA 1E3SA 2V6BA 1X15A 3PP8A 1DAOA 4M87A 3O26A 3C85A 1GD1O 1QP8A 2BGMA 5I7FA 2AEJA 4W4TA 1JU9A 1GY8A 3BMNA 4GGOA 4HUJA 1LDEA 2QW8A 4MVJG 3PFFA 3UCFA 4JGBA 2P2SA 4FFPA 3EZLA 3H7AA 2EEZA 2FPPA 4NFHA 2BFAA 4WKGA 1RYEA 4J90A 3GDOA 3JYPA 5JXWA 1Y8QA 3JYLA 4XIYA 4D45A 1P1RA 2PD3A 4ILKA 3ZN2A 3M1LA 3TZKA 4WPGA 5I7SA 3OMLA 4XGIA 3W1VA 3ZHBA 1JA9A 1EUCB 4J16A 5EN4A 1LQUA 2B36A 4N7RA 5JDIC 1IZ9A 3UGKA 3V8BA 5EINA 5C37A 3O38A 2VHXA 4M54A 1PR9A 3KSUA 4BB6A 4PG7A 4ZQEA 4BKOA 2A35A 3F46A 1SEVA 1W6UA 3KYDA 3IOYA 1K0UA 4BKQA 3ZWCA 2Q1SA 2Q50A 1ZK4A 3I23A 1NVMB 4JJGA 4ONEA 1UAYA 4BNYA 2C7GA 1H5QA 1NWCA 1QSGA 3Q2IA 3WS7A 1HDYA 1ZJZA 3B70A 4L8VA 3OHSX 5THQA 2RHCA 3MJSA 3JQEA 1CQJA 5K6AA 1GQYA 2AE1A 4HKTA 3DBRA 1FDVA 5C7LO 5ADHA 3PHIA 3RJ5A 1B7GO 3LF1A 1DB3A 3V2UA 1YJ8A 3I6QA 3HUDA 1TXGA 3W4KA 4YVFA 3KEOA 4Q3DA 3KSDO 4EUHA 4ND4A 1PJLA 3CZMA 1XKQA 3O4RA 1ZVMA 4RVDA 3FRJA 4YCAA 3U4CA 1P3DA 1EMDA 2LDXA 3EY4A 1VKOA 1E7QA 3OH8A 2FSVA 5HWSA 1HEUA 1ULSA 5KVVA 1Q7GA 2QRJA 4R5HA 3INTA 3TRIA 2B5VA 5F5NA 2FY8A 1DFIA 2EF1A 3I1JA 4AJEA 5H81A 3RUDA 3MOGA 5CDTA 4UVDA 1LRJA 3E9QA 4BS9A 4AFNA 3GDFA 4CM8B 1KVTA 4DWVA 3K92A 3VPGA 1HDZA 3GPDG 3PFWO 1HTBA 4GMFA 5LC1A 3SEFA 4GPD1 3DQPA 6LDHA 4PG8A 4OSPA 3NGLA 4PRLA 4WJZA 4ZJUA 3GK3A 3TN7A 3T4EA 2X0RA 3ZNPA 2PH3A 4FB5A 4F6CA 5A9TA 3NKLA 1HRDA 5HTOA 4R4JA 5K9ZA 3AFMA 2AQKA 4CMJA 2OXIA 1UP7A 2HJSA 4YR9A 4J3FA 5LCXA 4CR7A 4A10A 1PJSA 2D4AA 4ZA2A 4L73A 1N92A 3JQDA 3SLGA 4XYLA 1BTOA 4P8RA 4LN1A 1PJ4A 5LDGA 1C0KA 2ZIZA 1U2GA 2H9IA 1IL0A 4BO2A 5FEUA 3GA0A 1I3NA 5JY6A 1UUFA 3HN7A 3D4OA 3ZNOA 4IQ0A 1IY8A 1GUZA 2Z1NA 3MCVA 2IEBA 2GUGA 1UXJA 4PLYA 4YJHB 1E3WB 1QV7A 4DUPA 1CIVA 3O8QA 3L4SO 4J7UA 1ADGA 1LLUA 1GTMA 2IODA 2VZ0A 4AJ2A 1DBVO 3G0OA 1OBFO 3CH6A 1PS8A 4JN6B 2PGLA 2NU9A 2J6IA 5IZCA 4OAQA 3I5MA 1YL7A 2Y1EA 4LVUA 1MA0A 4YAEA 4WEQA 2ZKLA 4Y6PA 2JCVA 4FFOA 1JTVA 2Y99A 1GAEO 3TFQA 1QKIA 5IXYA 1V6AA 2VUSA 2VOJA 3H5NA 4CM1A 2WJPA 4CM3A 2X7HA 5BNTA 3ZWYA 2O3SA 5A1TA 1SOVA 4PZDA 4BMSA 3I83A 3KLMX 2PV7A 2UYYA 3EK2A 4J9VA 3GC6A 1IOLA 2AMFA 2R6JA 3IAHA 2AQ8A 2V65A 3PHLA 3L6EA 3AY7A 1ISIA 4U7WA 1U4SA 3CPSA 2PGJA 2WWRA 4RF3A 5FI3A 4YRAA 2YZ7A 3GEMA 4EJMA 1Q2XA 4NU5A 3X2EA 3TJRA 4B8ZA 3HDJA 5F1OA 3W8DA 4CM7A 2DBVO 5EQFA 3VAZA 5FYDA 1NFQA 2DT5A 1U3WA 1HLPA 2I66A 4M1QA 4ND3A 1A4IA 1LLDA 5DBFA 2Y0CA 1N9GA 1JWAB 1CWUA 1U2DA 3ASUA 2C5EA 1GDHA 1NFFA 4RF5A 1XSEA 5I8ZA 2VWQA 1YONA 3I3OA 4EGFA 1HYHA 3H2ZA 2E82A 3QVOA 4UVGA 1GYQA 3WWYA 1V8BA 3OA2A 3W4JA 1R66A 2GDZA 5C5IA 1J49A 4RO0A 4J6FA 4PLZA 4BKRA 4DRYA 3ABIA 5A5FA 4RQUA 5KWEA 4ZHSA 4WCFA 3DXFA 4U5QA 4XIJA 1XHLA 2PZMA 2OBYA 3PJFA 3R1IA 1YL6A 1K3TA 1U8XX 2R00A 3H3FA 1NQAO 1JLLA 3ZHZA 4HV4A 2ZB3A 2QRLA 3I9OA 2YFQA 3ZW8A 4B3HA 2DVMA 3JD2A 3GQVA 4IDDA 1MFPA 3JD0A 4WLFA 1Z75A 3JQAD 4WK6A 2OUIA 3ADOA 4TZTA 2O3TA 3PLNA 4YJDA 1QYDA 3GAFA 2CZCA 4JQCA 4D46A 4DLLA 5KIAA 3MEQA 1MXHA 3WG9A 4A73A 1XQ1A 2HCTA 4CV2A 3IKVA 1XIVA 1PL6A 3H9UA 5CDGA 4OO3A 1PGQA 1U4OA 4CV0A 5GY7A 2CY0A 2TMDA 1V3TA 4EI2A 3UOGA 2OGUA 1WDMA 3G49A 2WYVA 2P4HX 5IN4A 4MIOA 3UH1A 1DFGA 4KUGA 5DBGA 4J2OA 5IFLA 2VQ3A 4ZICA 4CJXA 2Y05A 4R68A 3E5MA 4TVOA 1OAAA 5TC4A 5A5EA 5CG1A 4DC0A 1EUDA 1PWXA 3M6IA 2PGDA 4BNNA 1XR3A 1G1AA 1TT5A 1UH5A 2EKPA 2O3QA 2QQ5A 4WNIA 4YQYA 1G0NA 4KP7A 4XCVA 3PIIA 4FJ1A 3GNQA 3BAZA 2E6UX 4XYGA 4R69A 4ND2A 2X0JA 2DQ4A 4QO8A 1DSSG 2IXBA 5BR7A 1X7HA 3PEFA 2WD7B 1NPYA 5DOZA 3RC7A 2X86A 5COAA 3EUWA 1QORA 2X6TA 2EIHA 1BDMA 5JDIA 5A3VA 3WJAA 4PLPA 5F5LA 3JQ9C 4MP3A 4QQRA 4FDAA 1MLDA 2EWMA 2C82A 3MWDA 3HE3A 4ROSA 3A9WA 3IJPA 2RH8A
chains in the Genus database with same CATH superfamily
3LPDA 3ORSA 2A14A 3V3TA 2CDRA 2MYPA 3MELA 3HYRA 4LYFA 3RRYA 4LECA 1Z0KA 4YFYA 5EYPB 4OSOA 4QXMA 4DF3A 5YASA 3IQHX 2JHGA 5F23A 3FHLA 3M4NA 5IH3A 4FKBA 2CV1A 3AF1A 3KZVA 3PNPA 3V6LA 3GH1A 4YJGB 1NVAA 4IIXA 4UBLA 3SC6A 3DHEA 3KL2A 2PU5A 4W9RA 4R3UC 1WDLA 1XTUA 1GT91 2XE8A 1G6Q1 4AWBA 1RMTA 5AKHA 4Q3OA 4NESA 3DFZA 3L0CA 1XTPA 2EDAA 3G9XA 3FVQA 1L5HB 3AJDA 3QFHA 4GECA 5DEOA 1RJEA 3TLYA 4EK9A 5AH0A 4YRNA 1KZYC 3O2JA 3T3IA 5KHAA 1EUZA 1G6OA 3O0DA 1S3IA 2BFFB 1Y5MA 2VIIA 2JK0A 4O1IA 5ALJA 5IM5A 1AHNA 2OPHA 3T4UA 4MDEA 2Q1YA 1GPH1 1YO6A 2P1ZA 3H1BA 4B6EA 3IQIX 1KAOA 1E2IA 5LQJA 1D3AA 1ZIYA 3ENWA 5FH9A 3ETDA 2C4UA 4KV9A 1AXRA 2DHCA 1YJQA 3ETJA 4PHHA 4R9SA 1RLOA 5AVOA 3I6BA 3K8ZA 3PPWA 5DTRA 3VPHA 3WL3A 1I7PA 4K26A 4DEVA 1WXDA 4WZBA 3DLPX 4X90A 2JFQA 2B5OA 1L8AA 4LZWA 4W8GA 2GBLC 3DE4X 1KZ4A 4MROA 3TKAA 3DONA 4DCPA 3ZJ4A 2EXXA 1B43A 4JX9A 4GPEA 4GD3Q 5T67A 1SA0B 2W11A 4YJFA 1GGHA 4Y2UA 2F55A 4NCIA 4AZ3A 7REQB 2NP7A 2AZ4A 2HIHA 2I6FA 2JI8A 4DLBA 2QB5A 1IBSA 2LR0A 1YFZA 1O97C 5KTPA 1YC2A 3SBXA 2Q5OA 3SX2A 1A4UA 2LXNA 3PGKA 2H16A 1QDLB 3D6NB 4K6GA 1R8YA 2C2HA 3GCXA 3ZWKA 2CUKA 2JLUA 5CLJA 1A2KC 1RBQA 3A0RB 2IS1A 5KNCD 4KSCA 3ED5A 1LQ2A 2SKDA 4RY0A 5AOVA 3ZU2A 1HO3A 1T6NA 1XRSB 3I8XA 4HD8A 5HJ2A 2XMPA 2YXDA 3LOPA 5JMTA 4FYHA 2XWPA 4A82A 1KBZA 2ZJ2A 3V4SA 1C2YA 3URKA 4RK1A 1ZKMA 3LUJA 5E1BA 3AHIA 3DDWA 4RD0A 3UM9A 1O54A 4NJOA 1EZ1A 2A0WA 3IBYA 4DLZA 2RAVA 5LOVF 4L85A 3JQGB 4JHLA 4KRGA 4ND8B 4MV5A 3U44A 4CL3A 1ZGCA 4QFCA 1NVBA 1R74A 3OPVA 3LAWA 4FD3A 2COEA 4CIXA 5F7OA 3CLSC 2Z5VA 3BMCA 4M9XA 1XMOB 3K2QA 1ULHA 2Q1XA 4NIMA 1X7YB 3BHJA 2UUAB 1O94A 3ZU6A 3VPFA 1U8FO 3ZV5A 4YIKA 3ER8A 3ZNNA 3H0EA 3CJQA 2ZULA 4XWOA 1PQWA 1R0ZA 5FNVF 4HAIA 1NULA 2HWYA 4TS3A 4EA9A 4G1BA 1LRKA 3L4EA 4ZAZA 4NMMA 2PIDA 2ZVJA 5AKYA 2NXEA 1YBAA 1VE3A 1YVRA 2COUA 3EULA 3EWIA 2WJYA 3KPUA 1KJYA 2ZGVA 3MCAA 4X91A 3THOA 1X1AA 1IAVA 3FZQA 4JJIA 4B31A 1AURA 3LBNA 2F59A 5FLEX 4EM6A 1MB0A 1P74A 2ONZA 2JFZA 3GT4A 5AM0A 3O91A 1VPTA 2CJYA 2QJWA 2R1UA 1Y34E 3L9WA 2G28A 2PK3A 1RPZA 4O63O 4HDOB 2X4GA 1FTWA 2G08A 4J9UE 5ITZA 1WVIA 2WIBA 1MIOB 4ZYVA 3B6IA 5C5DA 5KYYA 5IT5A 2O8CB 4KSBA 1KGSA 2XTAA 3AR7A 2DBRA 4PAMA 4W99A 3ESCA 2A58A 3GRFA 5JZVA 1N3IA 1ZHFA 1ZFNA 2B25A 4JLNA 1EQAA 2ZYVX 2X1VA 2X2OA 1CUVA 3DBVO 3RVJA 3DWGA 1TGYA 4E2ZA 1XB2A 1ZIXA 2X0NA 2WD8A 2Q4BA 2F1IA 4GWGA 3BQNB 3P5SA 3IMFA 5E6UB 2HWUA 4TWIA 5AJYA 4YR7A 3TXAA 1UPXA 2VDJA 4V0LA 4O6VA 1YB5A 4JB8A 1WR8A 4LKRA 1U80A 3DFMA 3S7TA 5E2IA 3R8CA 1AUVA 3WSWA 1JHVA 4G1FA 4Q1EA 3IXLA 3PC3A 5BW4A 4HDCA 2TS1A 5G02A 1TLTA 4ZDKA 3NT2A 5C7IO 3LUGA 2NU7B 3ZXSA 2MSDB 2QRMA 1NU6A 4H15A 4ITUA 4W7IA 3OQNA 3X43A 1JPJA 3GLIB 1XQ9A 1T26A 4PTLA 2DUWA 2OK8A 1GV1A 4F2GA 1H94A 2F1OA 4EI9A 3KTDA 1MEOA 4CLOB 5JXHA 4FFRA 1XWWA 1H6DA 2C78A 2VSXA 1KJ9A 2WG1A 3GY0A 1SD1A 1L5FA 4O4JA 5IJWA 3H1TA 4G0ZA 3AF5A 2HXGA 2YH2A 5FBZA 1BIFA 2JAOA 3OQJA 5MN5A 4IP0A 1LF5A 5TT0A 2SCUB 4BVGA 3D0RA 4D9MA 2WI8A 2R3SA 1OT5A 2I6UA 4NOMA 3KHSA 4N3NA 4Q18A 2HLDD 1VSVA 5LMNB 3F6SA 4G0MA 2ZDGA 4DJEC 2JCYA 3DPSA 4ND1A 2YOHA 3MXTA 1Z2DA 2BEUA 3WE7A 5AOBA 2OV8A 5LQNA 1Q3TA 2PXXA 3DMYA 4EB0A 3DKKA 4O8CA 1EM8B 2B99A 3M5DA 1N5DA 3EISA 3KR2A 2CEKA 1FDIA 2ZE6A 2X5XA 1CZUA 4AJHA 4FKZA 1GGKA 2E18A 2RFLA 5GWXA 1PT6A 2P68A 4JQOA 1EB9A 2CL5A 2PH7A 4QOIA 4FT4A 1I13A 4HUQA 2LZ0A 3LUCA 1DPGA 1M0SA 1XXHE 2VC2B 1SG9A 2X4IA 4UUNA 4QVIA 2XNJA 1FNSA 1ENZA 4TRMA 4TTPA 4Y7CA 4CV1A 1DRJA 1MNQA 1QANA 1UJ5A 2ZVPX 3A31A 4ZK6A 4L4UA 1WMFA 5A5GA 1ZRSA 4A0HA 2JAQA 1SPBS 2I6SA 2O7NA 1RWNA 3OOSA 5SICE 2VHJA 2ODPA 2HJVA 4DLUA 1CUYA 4AUKA 3LXXA 4B17A 3DMHA 5IVKA 2NSLA 4PBTA 1DQNA 1YDGA 9LDTA 1B6TA 1UKZA 2C20A 3OEHD 2JLXA 1LY1A 2H65A 1U1EA 1IPHA 4PYRA 4DQ0A 3BWVA 2ZQYA 5F51A 3E7XA 5GP1A 2RI0A 4KGZA 3HHEA 4YAKA 1SHZA 5IYZA 1DCTA 4BMXA 3I9MA 4GQBA 4NLLA 3O2NA 1QZZA 2GBGA 4GGPA 3KB8A 4R0NA 2DULA 3C15C 1KMNA 1HT3A 3U3OA 5BN5A 2L42A 2AR7A 3WMWA 4D8TA 5CB4F 3GXOA 3FKSD 2VH1A 2ZJ5A 1GG5A 1W0JD 3H19A 3VUEA 2WKWA 5B6IA 2ZBGA 3WRYA 1A9OA 3D8UA 3DD1A 3GFQA 3K15A 3IPCA 1DZ3A 2JF0A 2GJ9A 3OEWA 4HMOA 5FO0A 4B3TB 1CQJB 2P3QA 1X3LA 3VZRA 2C9BA 2VJQA 3JASB 3DBRB 3W5SA 1M6VA 3UFXA 4RX1A 3HYLA 1D0SA 3RRNA 3IODA 2O2DA 2MR5A 2V9ZA 4MWTA 4R5MA 4WERA 4IJQA 5E8JA 2YMLA 5AW9A 4B6GA 2BUAA 1EX9A 3OFND 2IJGX 5ISMA 2GA9A 3ITEA 4K3UA 2GEKA 4UBIA 5HQ3B 3QOXA 4U7PB 3KQPA 3QP9A 4EGJA 1B73A 1GN8A 2IYZA 1F3OA 4HLCA 2K2WA 2BP7B 2RJOA 4DDVA 1SCNE 1ZD3A 2X9GA 4FS3A 1J0BA 2AHRA 3ZYZA 2ZWAA 3BCSA 4HGYA 4LZJA 2EGHA 2XRFA 4H6PA 4UC0A 4AY6A 3C3MA 4X62B 3PD7A 4A2WA 1IHUA 1OGYA 3LSYA 4R1LA 4Q4AA 2PMWB 4PSVA 3RVDA 3A6DA 3MTJA 3SC2A 4IIJA 5BSEA 1DI0A 3B48A 2YV4A 4KE7A 4ZVTA 3L8DA 2J8ZA 1BSVA 3G8CA 1O95D 4L51A 4BO9A 4NX2A 1EFTA 4C4RA 4P93A 3DBLB 1KI1A 4YX9A 4H27A 1NBMA 2A7QA 3QVXA 4AI6A 3HJAA 5FF9A 4RJJA 3FR8A 4UVEA 1GG8A 1E5LA 2E4YA 3NLLA 4Y0VA 1CDEA 2XNKA 1XYVA 2Y27A 3H5RA 5IRCD 3WSTA 1A76A 2Y92A 2ZPUA 2GZAA 3PHJA 3VSEA 4FHDA 5DP2A 4BYGA 2WUWE 2WJAA 5LNK1 3ADPA 3J81k 2BWJA 5DX1A 3IC5A 1K6XA 1RPNA 2I62A 4RGYA 2VPZA 4P4SA 2GD6A 1QK3A 3S2FA 3N53A 1Z35A 1P44A 3GPBA 4MB0A 5B64A 2CNLA 2HB6A 3HP1A 1JDBC 3N6XA 2VP9A 4HXGA 1U2TA 2XMCA 1JR3E 3A1DA 3LX6A 4GT1A 1C30A 3RVQA 1TEZA 1CIJA 2XOKA 4CRWB 4DCCA 3RE1A 4E5KA 1RM5A 4CETA 3NBYC 1QGYA 3NM5A 4ZXPA 3ROMA 3B7PA 5DZSA 3F6CA 4JT4A 3VZQA 3K32A 4PGAA 1JE0A 4FOTA 1GHTA 2Y1OA 3BCRA 5LA6B 4MPRA 5F78A 1V7QA 4LK3A 3K0CA 4E11A 1HA3A 3ZVKA 1CZRA 3HI4A 3I01A 4FCWA 1DCFA 4JI7B 5KWSA 1V9SA 3M1IA 2NU9B 5ERYA 3A9RA 5KYGA 1FUIA 1VQ1A 4FWTA 5BV8A 1XPOA 5AI6A 4BX8A 4GEKA 4QOFA 1BD3A 2A67A 4KXQA 4LJYA 3WQSB 3CVYA 2WKPA 1MJ5A 1R8SA 3G68A 1I1OA 4FNGA 4H1UA 4J0IA 4OBEA 2GEUA 3ETEA 3SXPA 2CUZA 1D1PA 3HDGA 3CZPA 2W9XA 2QZ4A 4TRRA 2F8TA 1Y6RA 3E48A 1HYGA 3C8HA 2CMGA 1T34A 2G07A 2BM0A 4O02B 2FPXA 2V6FA 5E9WA 3VR6H 3LSTA 3QLUA 2JASA 3BSWA 4P58A 4N76A 1RCFA 1BWPA 1MA3A 1TZJA 3DXZA 1QRRA 5A03A 4MGEA 5B1HA 2WTUA 3RFUA 5K0LA 2GI4A 3NBUA 4OLHA 3TOXA 5JD6A 5ARDA 1ONNA 1BMFA 1KSGA 4FFVA 3ZI0A 3NGMA 3QBVA 4A27A 1XAHA 2FZ4A 2OD2A 4UTRA 3AJ9A 4IVQA 2YXPX 1ISRA 1J20A 1KO8A 1T8PA 4C43A 1OPXA 5FRDA 1C7FA 3R8FA 2PKQO 1L4FA 3WLTA 1ORTA 2XHEA 1T29A 1GAQA 4CQLA 1EJ0A 3D7NA 3IAM1 5LVAA 4JI3B 4D5GA 2O19A 2Q21A 4AIIA 3C6MA 3CMMA 3UPDA 3WNBA 4HP8A 5IFKA 3HP7A 3V8VA 1H05A 3COZA 4GM1A 4X0EA 1M2KA 1SC6A 4BQEA 4RHYA 5DBEX 1K8RA 4NV1A 2P9CA 4Q4DA 2GAAA 2J6BA 4GXQA 2IOFK 1S8NA 3EQ7A 4QODA 1W46A 5ICMA 4RH1A 3WWOA 4IPTA 5HE8A 5ES3A 3Q2KA 2QSUA 4O2LA 1QFMA 3IELA 4OPMA 4EI8A 4LJ5A 3C6XA 4O25A 3EPKA 2BMEA 5EPEA 1J7KA 2WHQA 1ML3A 1M2VB 2WTEA 4PHCA 4JBXA 4PSKA 4TQGA 3OLVA 1Q0PA 1RIFA 3B6ZA 1M6WA 4GE0A 4MVJF 4OB8A 3DDUA 1G8FA 4HN2A 3L4JA 4DJDC 1EP2B 1CF4A 4KPGA 1ZBQA 1Z4NA 1GZUA 4ZAYA 3ET5A 4DLAA 5AESA 4Q00A 2EFEB 5C81A 3AUFA 4M7WA 3TVYA 2QY9A 3USES 5LNK6 5BT9A 4F5DA 3RK1A 1GPNA 2DM6A 2RAFA 4URZR 4HGOA 3F1KA 4GVLA 1NMYA 3C3XA 3G9TA 4B0OA 3S99A 2GTIA 5L7TA 2EEPA 5BP7A 4EFNA 3A9SA 4PHFA 2FAXA 5L4NA 2HWKA 3OSUA 1JHDA 1QHNA 5DE3A 5ECYA 1L4EA 3UUWA 3VUFA 4Q1DA 5CCEA 3JR7A 1H6CA 1VMKA 1Z3CA 2XNHA 3P94A 3P0JA 3DMTC 4BV8A 4PYJA 3ZDQA 1K68A 2W2TA 1NXQA 1FJHA 4NYIR 1P9WA 2K7ZA 3QPWA 3ECAA 4M46A 5DHFA 5JARA 1IUPA 5LMUB 4IQ8A 4M1WA 1QNLA 1JAYA 3K5WA 2RKOA 3HL4A 1MAUA 4WA7A 4MRPA 4QQNA 2KX7A 2G67A 2WSMA 2ZANA 5DTEA 3VOAA 4UZFA 1PZEA 1XQWA 3ABQB 4NATA 3TIVA 5ICCA 2PTGA 1KHTA 5DW0A 1K6MA 3W0LB 3UT5A 2J9GA 1DAEA 1MRZA 2I2CA 1CLEA 4QFMA 4COKA 1ONOA 2XODA 3NGXA 3TD9A 3IESA 3SBEA 3W5UA 1LPAB 4Y2HA 5I9BA 1E59A 4ANFA 2C3MA 4OOFA 3V7WA 3I01M 3KQTA 4MQ5A 2YWCA 1RS0A 4AP9A 1A4XA 1GR0A 4FZRA 3EGDB 4PLFA 2N46A 1IXRC 2D1YA 5JS2A 1U3CA 2Y93A 1J1ZA 1ZSYA 5J40A 5L95A 1GRRA 3ZHQA 3TTWA 5AVQA 1XU4A 5MGNA 1Y7IA 2PD6A 1JHPA 3F78A 2BI8A 3MMSA 4B4KA 4KQGA 3CLTD 3IMEA 4FR0A 3M5CA 4KAJA 1CQIB 2WJ4A 4MB2A 4K6HA 3JARB 1GM5A 5J2TF 1SPXA 2OK7A 3ZGYA 3EOAI 2GF0A 1ZXXA 2PYDA 2VJMA 1FEZA 3EEFA 2IS6A 1TT5B 5KHOC 4WJLA 1ZWLA 2AFHE 2OKCA 2W2KA 1XTZA 1PTJC 4E51A 4DBLE 4IWYA 3U7RA 5GINE 5AK4A 3HB1A 3SIWA 3ZXYA 4DDHA 3TLGB 3K09A 4DPLA 1V4VA 5DNUA 1KDRA 3FSRA 2UZ3A 4JBNA 1FJGB 3OM1A 4R41A 5JLAA 1VLJA 4MAAA 1EGVB 5C3UA 3VI3B 3H99A 1YA6A 2K6GA 3NP9A 3AFIA 3JYHA 4I50F 2DFVA 3BB1A 2LDBA 1GVNB 3E1KA 3L8EA 4FGUA 4PAGA 1XZAA 5AKKA 2V1UA 4O4IA 5L9AA 1DAPA 2C2GA 3WFZA 1NYRA 5BSGA 3K9HA 3L8MA 2FJ0A 1AA6A 1QBGA 4G81A 1GRCA 3EXFA 3IGFA 5HA5A 1PR5A 2AOTA 1H8HA 1M7BA 5EWJA 1DQRA 3DVAA 3QA3E 4RFLA 2Y1FA 4IUYA 1BMTA 4J1QA 4JOQA 4LI3X 4MDFA 2XVXA 3PPVA 1N2SA 4AJNA 4DA9A 1QGAA 1XE3A 5KOIA 3IEPA 3OPMA 1S4QA 3QVUA 4B3MB 4PPYA 5AK0A 4BVLA 3IOBA 3W79A 5BN3B 3HUTA 4KGXA 4RVCA 4GMXA 3QX3A 4KEAA 4FMCF 3GRCA 1I6WA 1MX5A 4D4GA 1OTXA 1PGNA 3R6LA 2OBXA 3H11B 1HYEA 3D8NA 3CC8A 3H65A 3ROGA 4PZEA 3GBSA 3H18A 2P0EA 3OD5A 2J07A 3FMFA 5MN4A 4I9HA 2XVAA 3PU6A 2Y4NA 5AUQA 2FGJA 1XD8A 4N39A 1MC5A 4YXFA 4HX5A 1ORWA 2RGWA 1AUPA 4K6OA 4ZEWA 4HNAA 2RJNA 5COBA 1E3QA 1JHYA 4NF2A 2WHYA 1HDOA 3K5IA 4YJHA 1E3WA 1EFLA 1S1CA 1HG1A 4PQGA 4QEKA 4E5YA 4M7OA 1S8FA 1VYHA 4DEYA 2C8JA 2VVTA 4NP6A 3PNOA 3OZGA 2X0DA 4COOA 4LWPA 5CAEB 2OVFA 2HHHB 3DFFA 4G86A 1Q1EA 2Y0EA 4MDYA 5EESA 2PMEA 2OLKA 4C3VA 1VBFA 2WF7A 3DNMA 4WLUA 1ZCZA 1WOYA 1HLFA 1UMDA 3WDLA 4IVPA 2BDTA 2W0SA 3CE9A 3QLVC 4Q47A 5EJMA 2DRIA 1L7OA 5KYUA 4NY1A 2W8ZA 2W2QA 1L5KA 1BXKA 4AJ4A 2IUYA 4BNLA 5BSKA 1XZKA 5BUZA 4E5NA 1V7PC 3RS9A 1Y9EA 4RDIA 3ZZMA 1VL2A 1BE6A 4S1TA 2P9JA 4XD2A 5CIWA 1YNOA 1OI3A 1ZKDA 4V3BA 4BPBA 1E9DA 5A4KA 2W5UA 1NRWA 4J0CA 1P19A 1C2TA 2WUEA 1JN0A 2ZWMA 1WS6A 2XB9A 5B3JA 4K9DA 3EH1A 2WPDA 3QQ5A 1TO1E 5K4HA 1FFYA 4BNKA 5KPDA 2HADA 4B87A 3EA4A 1Y6FA 2ZWIA 2W4QA 3WNCA 1K88A 1K8QA 1IY9A 4PR0A 4EB3A 2ZSHA 3PK0A 1MAAA 4KXUA 3QVGB 3KWFA 3TLBA 5CUQA 2FUNB 1L5SA 3LUFA 3TLAA 1KXJA 2P41A 4QJ5A 5JTTA 2OO7A 4KREA 4RYDA 3EIWA 1EX7A 1UDAA 1W1WA 1QOPB 5I4KA 1JXOA 3I61A 4KGDA 3T1OA 3T95A 1VP9A 3HU1A 3E8MA 1Y4AE 3B1XA 3B85A 4KOAA 5D51S 3ZHYA 2H2DA 1PGOA 3QEMA 3UUEA 3WIDA 1CTQA 2AF3C 3A1UA 1NP7A 2H4HA 1B14A 1Z5NA 4P38A 1YZFA 5EJ9A 4MPDA 5EUBA 4X7RA 2IS4A 3A2KA 5U1PA 3F71A 5IPFA 4B4VA 4JWKA 3GJYA 1LWOA 3GP3A 4FYVA 5LD2C 1RM4A 3HRHA 1Y1SA 2J0UB 2PPLA 1GNLA 4AK9A 2VT3A 2D8MA 4JK3A 3L02A 5JCXA 2HRBA 4NJMB 5JADA 1F5NA 5IUKC 2XYRA 3CLKA 1I4OA 1WXQA 1OWLA 1Q3HA 5EVCA 1MQ9A 4N6NA 1TKCA 2F9FA 1CZHA 4IDEA 4UJ3A 5DYWA 5L8VA 4EQ6A 3C3KA 4LRQA 1DP4A 5AXAA 3K31A 2W8BB 3BXEA 3SPXA 3T5DA 1TEHA 2Z4RA 4MVJE 3VZDA 1DXHA 3MRSA 1XZFA 1J97A 3VSCA 4MZDA 2NV2B 4HAUA 2B7BA 2QG9A 1Y6JA 5EWLB 1NRIA 2D7CA 1YUMA 5KKNB 1TM7E 2O2IA 4MYCA 1VKJA 3HJUA 4KC0A 3LI2A 1Q74A 1K6IA 2ZBEA 1G8JA 3NXSA 1I10A 5IULC 3L0ZA 1FOEB 3DDZX 2R8YA 4AJIA 4DIMA 1U3UA 1QK4A 1JLSA 3SVZA 1W36B 1OT3A 2XECA 3QSGA 2VRBA 3LNTA 2AKAB 3BMXA 1KDYA 1CEEA 4QUHA 2FPKA 3TSCA 4QDKA 2C5FA 4LSZA 3DE3X 3WO0A 3ZIAA 3I5YA 4OFZA 1BXRB 1XVUA 4WZZA 3ZI7A 3UJCA 5DNWA 4MNTA 3KZXA 4ZGGA 4Q7EA 3PNLA 3WNZA 4ESVA 4PYMA 1J2TA 5EAIA 2IK8A 1K4KA 3E03A 3FNRA 2CYAA 2JLVA 4RQAA 1RM0A 2P2LA 3HDYA 4JL6A 2C57A 3KLBA 1UMKA 2I4IA 5E38A 3RLFA 4Y2YA 4MJXA 2NNLD 3LC1O 4F11A 2VCEA 3AESB 1INLA 5CURA 4ZO8A 5EPUA 3R9KA 4WGGA 2BFEB 5L6LB 1QQAA 3AG6A 4JLUA 4ARIA 3PCXA 2P9BA 4ZRDA 1ZCFA 3PS9A 2X9NA 1YU6A 3QITA 4JJFA 1P1HA 3CINA 4BX0A 1RQLA 2CHQA 2QUAA 3I0ZA 3UVEA 3S81A 1H1LA 2R6R1 2QTVA 3D8BA 3FYTA 3ASVA 3FWNA 1AZWA 1MJHA 3RJ9A 4GE3A 4HBGA 5HS6A 3UMGA 1ZX1A 4N12A 5GJVC 3G2HA 2QSYA 1RTTA 3OX2A 4HTFB 3FYUB 4IZHA 3SEQA 3AIOA 3HPRA 1PR2A 3SLKA 1OU0A 4RM2A 4KWIA 3TNJA 3VNVA 1PBTA 5JWOA 3LRXA 3FUCA 4KIUA 4OHXA 4C14A 1ZSNA 5I7EA 3IDZA 4TL6A 4ZI7F 1PD0A 1E6WA 1JPNA 3FW1A 3PSHA 5JY1A 4CEJA 5ECDA 2B1JA 2DPHA 3A9VA 3DFKA 2ZQ5A 3PUIA 4I08A 3LVQE 1R16A 5D3ZA 1BDJA 3KT8A 2MJLA 2FH5B 1T8YA 4A36A 2VDOB 1WUYA 1YB2A 5DM70 4OHBA 2QK4A 2LCQA 1LFDB 3AG5A 1M1NA 2OORA 4K3VA 5KCMA 3UWKA 4BN0A 5MHTA 4ZVOA 1O0BA 4GM4A 2W2XA 1DC5A 4WRRA 4X54A 3HKCA 5AJWA 3IOMA 4PXSA 1O3YA 2IY7A 2C4VA 2X6QA 1Z2PX 1SC4A 1DC4A 1UWCA 1I14A 1YR1A 2QT1A 2W6QA 2WE8A 1XA0A 2XDAA 3OIWA 3Q11A 2JJ2A 4GRDA 1K7EB 5ITWA 1PR3A 3H04A 2H1LA 3I2KA 4RFVA 1N33B 4QYIA 3IB3A 5KKAA 5CA0B 2FPGB 4A23A 1TQDA 4OYRA 1Q91A 5AVXA 5KNCA 4X7BA 2ZJAA 1PJ2A 2XPCA 3AR2A 3N2ZB 2VPWA 3U5ZB 4NPHA 1OLUB 2HH9A 3HJBA 2Y0PA 3PUKA 3LC0A 3QG1A 1MO6A 5GZ6A 2YHIB 1NNI1 1RLMA 2CJPA 3CKKA 3ADBA 1OWMA 1NW5A 3H3XA 2V5VA 4P3NA 1IEQA 1S3FA 3JV7A 4BN5A 5CFQA 2NM0A 4LMPA 2JLBA 2CXQA 4OLJA 1EYZA 2WF8A 5DV9A 3CY6A 2ZIXB 1KDPA 1D2NA 1LS1A 2D1QA 3TQQA 4X00A 1ZBDA 4IUDS 3I1FA 3CURA 1OX4B 3E53A 5D3KA 4II2A 1W4BA 3ODGA 2QQGA 1BQ3A 3MMPA 1JJVA 5GM2A 3L6CA 3M2TA 4KITB 4GR4A 1F6BA 2AG8A 2PD4A 4XKJA 4UNSA 1A5ZA 2H7CA 1FDUA 2P9QA 2FZGA 2V9PA 4PC3A 5KX5F 1TM5E 2YDYA 5KTMA 3V1LA 4BHTA 1UEIA 3A1EA 2WA1A 1T4DA 2Y1LA 1CUEA 1PT8A 1XEXB 1Z17A 1QX3A 3QHQA 5KYWA 4GPAA 3AMVA 1Y3FE 4S1WA 4AO6A 1DRVA 2AXQA 2DFPA 1JHQA 3P2EA 5JXJA 1R64A 1XZMA 1Y37A 2Z43A 1YQUA 4KYTA 1FY2A 3M4JA 1V47A 4FFNA 4ZT5A 2BF7A 3BH6A 3I0NA 3WYCA 4ZRNA 4BP1A 3ZYCA 4GL2A 1GILA 3O93A 1J1UA 2WEKA 3EGOA 5IVPA 1XVTA 2ACWA 5T8KA 1FC0A 4C9BA 4CWAA 2DLCX 3N8GA 1XDGA 2JEOA 5GTDA 5H3HA 4HDMB 4E13A 3FN4A 1WUHS 3ZCRA 4KXYA 1RADA 1D1QA 4IDQA 1Q1AA 1KVUA 1WQ3A 2QJOA 2W00A 3EARA 2B21A 2P5TB 2XCOA 4P5EA 3PUJA 4ZP1A 4EG5A 4TTAA 4MIEA 2QR2A 1QVRA 3GZNA 2A1TR 5CNKA 3ZEIA 4RE5A 1RMQA 3OZRA 4V0RA 4B76A 5HOEA 4E15A 1SUAA 3CVOA 3IP3A 5HK9A 1UM9B 5JIBA 3CCFA 3E3NA 3F3KA 3GVHA 1LZLA 3KYJB 4DRXB 2W2MA 1KI2A 1LDMA 1A8SA 3E35A 4ZK2A 5AP9A 3A4MA 1XCMA 5JS8A 1IFXA 2IZ7A 5KAPA 3W8FA 3DHNA 2O2GA 3C3BA 3PZBA 5BYAA 2VPYA 4TKVB 1FFEA 5FTJA 1J9ZA 2QM7A 4WBSA 1BU8A 1VSBA 1H6AA 3KXDA 5JVDB 4CCYB 2CSXA 2NO4A 1UAGA 2Z8ZA 4G9GA 1C4XA 1Z2NX 2R6ZA 4LXHA 4ZPJA 4RE6A 4UDOA 4QKQA 4LUCA 4M1OA 5K0NA 2CLKB 2IHNA 1V37A 1E89A 2XWBF 2NV6A 3FBTA 3H2JA 2QQ0A 2RH4A 1N1GA 2Y1WA 3GN1A 3LYLA 4NBWA 3SS8A 1WB5A 2WWXA 2BR5A 1S7GA 4TYWA 4HWRA 3O75A 1KRXA 1YXMA 4I6JA 3NFYA 1OWNA 5CIQA 4OGWA 3IIEA 4ENUA 1G55A 3PE4A 1O4VA 2VLIA 4DCVA 1AHIA 2V3VA 3UWOA 1ZAKA 3DUWA 3JWPA 4J2HA 2C54A 4KFCA 4I46A 3EJ6A 1NPTO 1DKUA 1GG2A 1S2OA 4YAJA 2WIDA 2PGNA 1TX4B 2BM9A 2AVNA 3C97A 1WB9A 3DE6X 2J3HA 4UM8B 4XUGB 2Y9MB 4B7CA 5B1EA 3R5XA 3UGTA 2PZKA 4L8LA 4P98A 5LXTF 3D8TA 2HLDA 3OBBA 2JHCA 4ZC8A 3SY8A 4L5BA 5B58T 2O8FA 3AUTA 3BL6A 2PMKA 3AF0A 5FR1A 4FD2A 2QYSA 4IILA 4CCAA 3BRWA 1E0DA 3GEDA 3KOUA 4EG8A 4EX7A 1F1BA 3KPWA 5DK6A 3A58B 3PCRB 3ZWPA 2GPBA 3B13B 4QQ8A 3IQXA 4FMDB 1HYQA 4C2UA 3LXMA 4LQDA 1J0DA 4X45A 1D8TA 1B3BA 4GKVA 2ETXA 1YZHA 4RACA 1X9HA 2PE5A 2M2IA 2N1MA 2HM7A 2F6RA 2REOA 3O3NB 1WY5A 2J9RA 3GVIA 2QXUA 4XVQA 5ESRA 4CDGA 1SNYA 3JQ6A 4B1FA 4XH9B 5KVSA 3B5JA 1E2QA 1Y8RA 2BD0A 5DGHA 3MJCA 5LB2A 3Q9UA 2VF8A 4CUKA 1L7AA 4JR2A 4YCLA 4Q1CA 4V0ME 1YZQA 1N32B 2FSFA 3PUVA 2H85A 2D2XA 3AVPA 4XM1A 4YDRA 1ODCA 4OXNA 4WDRA 1LJ8A 1Z07A 1D9XA 1KH3A 4UNPA 2JAHA 1DXOA 1SCJA 1ENPA 2G4CA 2AOWA 1IRIA 4QYWA 3OOWA 3R23A 1GNVA 3IHLA 2EFDB 3ZY6A 4AG6A 4DOMA 2WVJA 1DTWA 1YK0A 5F9MA 5T3YA 1QQ7A 1N6HA 2RG7A 2PUHA 3T9CA 4BV3A 2C5BA 1U2SA 4FKMA 1FDTA 5I3CA 2Q6OA 2PMCA 4EYEA 3BWDD 5A2QA 3MCWA 3DZBA 3OIDA 4UTVA 2ZB8A 5T41A 4ZAGA 3DE2X 3EEYA 1QJCA 4G8DA 4MGKR 3DO6A 4PM4A 1DPFA 4F2WA 2P3LA 3GVPA 4XVUA 3V5NA 4IOJA 4HFJA 1IBMB 4G4SO 4XWTA 3G2KA 4YRFA 4I3FA 1UKBA 2EQ5A 1A82A 3EDMA 3EXEB 5JNUA 5IVDA 4AZ0A 4I3GA 4HMPA 4OSEA 5CVJA 4GM0A 4UATA 1YQEA 2A0FA 2L17A 3LUHA 4CN8A 3O3OB 3WGGA 3PGA1 2BGIA 2OHXA 1EAMA 4NNOA 3G8AA 3MJDA 3TD2A 5B12A 1C7RA 1P7ZA 1XDWA 2JGDA 4NZOA 4BC1A 5CFOA 2VG8A 2I6GA 4WEOA 3L07A 2J32A 2PZBA 4I6EA 3ZXIA 2H0QA 2VXOA 4EHJA 5BSFA 1L7MA 3Q98A 3MA0A 5B3AA 1FVOA 1W94A 2WE7A 2FSHA 1VZ3A 2X41A 2XW6A 5KTKA 3KEQA 3FFWA 1YS9A 3PFCA 3QWAA 3EPPA 1I8TA 3RS3A 3WDKA 1J8FA 3QTBA 1ENYA 3VZPA 1DOHA 5C7YA 2V8BA 5T64A 3KVNA 5IM4F 2Q0QA 2IOQA 3QYFA 4FC7A 5I4BA 4ZQBA 6AT1A 3IQGX 1U1FA 1TB4A 2BAGA 2HFJA 1K2WA 1TUBB 3Q0IA 1DRUA 2WSBA 2Q2NA 1I2BA 4F9EA 4FEGA 2GAFA 4UTNA 2RB4A 2XF2A 3ROFA 3BJRA 5LYJB 821PA 4M8LA 3T7KA 4XUCA 4ZO4A 2GEJA 1U2EA 2FN4A 4Q6WA 3S2EA 1IMJA 1N0UA 1G7SA 4CYMA 3E8XA 4OQEA 4DMLA 1OC4A 1DGQA 4O1HA 3ZDXB 4QECA 4GW3A 1P4JA 5FD8A 3TG8A 2P2GA 1KARA 4E5DA 1Z8DA 3AKYA 4H1TA 4WECA 3V4FA 2XXAB 4Q7MB 5DJ5A 1QFXA 2RC5A 3WX0A 2C31A 3GIDA 4MA4A 4QQKA 1ETHA 2IYVA 5LOVA 5FPSA 4EKIA 5HUQA 1TC2A 1O0SA 4QJIA 3ZV7A 1T4CA 2IYLD 2WM3A 1FMLA 3BILA 3HLYA 4N1AA 1JHXA 1ZSVA 3R5HA 3SR3A 3TR0A 2A5GA 3AERA 3ASYA 3B51X 3DV2A 3QFSA 2Y0BA 1M66A 4RL6A 5DRTA 4URFA 2QZJA 4ZU3A 4EY4A 2IZZA 5J3JA 1YBFA 1TE2A 1UAAA 3IVCA 4GICA 4JKIA 1QH1A 1R6XA 4PC2A 3ZVMA 5JE8A 3B6JA 3RYIB 1ESCA 2GYYA 3ENVA 2RJ3A 1M3SA 3BMQA 3FBGA 5ECGC 1MXFA 4ARUA 4G85A 1P1JA 1SHJA 1XKLA 5EMJA 3WLRA 1S9HA 1J00A 3IP7A 3P4YA 1N5MA 5E4FA 4OU4A 2LCIA 2MINB 2QZZA 4NU6A 3N2NA 5FAKA 1HGXA 1K66A 2IF0A 2RGUA 1W6RA 1XO1A 3DDHA 4YWHA 3OZ7A 1MX3A 3BB3A 2PFSA 5CLQA 1Z38A 5K0FA 2NVUA 3MW8A 4PZPA 2Q3CA 1N6NA 2PBZA 1WPGA 2YHSA 3OFVA 5JH7A 2FMTA 5C8VA 1YZGA 4HQKA 3PYMA 1NOIA 1A8UA 3NVMB 5IARA 1KL7A 2HMTA 1K5PA 2B7LA 4OKSA 1CUIA 3L8CA 5EZQA 3VH3A 3IKLA 3LS2A 4Q3BA 4ER7A 4JBLA 5HP4A 4IDCA 3L1VA 4TT3A 4B7ZA 2L0XA 4HF7A 2OLEA 4JS0A 2B1QA 3INYA 4OX9Y 3GWZA 1HL7A 2JFXA 3L7JA 1DWOA 1IN5A 4G5XA 1Q19A 4GQIA 4R2XA 3OQMA 3CKMA 1X80B 3KB6A 5HZGA 4AY3A 3T5CA 4P32A 2ZRPA 3VKWA 1X7ZB 3FRIA 3VTKA 2YV1A 2WMNB 1QHHA 2FETA 1KR5A 2A4KA 4NI5A 1PSWA 1P0QA 1WPXA 1GL3A 1N9KA 3OE4A 1NDUA 4MTLA 4OGFA 4TQUS 5COQA 1B0ZA 4BLVA 3NYIA 3KHKA 1COZA 5D6OA 3AP1A 1FZQA 3SYMA 1MGPA 5ARBA 1V9CA 1W8DA 4QL3A 4U39A 2HA7A 4UNNA 1MGOA 5EGSA 4W5QA 1RIIA 4LPKA 4L5AA 1L4MA 1USKA 3CLRD 2B5WA 3MAJA 5HZMA 2QV0A 4RHUA 2GPSA 2ZUDA 4ECAA 3GLHE 4F7DA 5FUBA 1I7DA 1JE1A 4RZXA 4CF5A 1HI9A 1FP6A 2Q99A 1C3JA 4LYEA 1RC1A 2DQZA 1BU5A 1E3IA 1CQXA 3CKYA 4BXOA 3PNVA 1ADJA 1ONBA 2I9KA 1R9JA 4MEAA 3LT2A 3FDXA 3D81A 3N74A 4JJEA 1NZDA 4N0QA 3LQFA 5EMKA 2H1RA 3JRWA 4IGFA 1C3OB 5GZ1A 3AKZA 4IFIA 3RTGA 3SU8A 2YJ5A 3UKOA 4MWGA 4ZIRA 1Y8CA 4GWLA 5CM9C 5GJWC 3IHKA 4KQMA 3G79A 1U7OA 4YUVA 4GOMD 1J0CA 3O8DA 4RADA 2ZM5A 2F3PA 1SEPA 1E6KA 1NVGA 2GD1O 1XJQA 2VXYA 3AQ4A 4L08A 5B2EA 1QOZA 4JYZA 4UHBA 1Z7BA 2PFGA 3FPJA 4WVFA 3NRBA 1VMAA 5EJ2A 4O4HF 2R6CA 5AHXA 4FYJA 4RORA 4LVNA 1GQSA 4IH9A 4NCHA 3L0YA 3U4GA 4UBMA 5IZ4A 4RY2A 1NF8A 5L3SB 4L5JA 1EXMA 1I2ZA 4TUYA 1Z4LA 3HR4A 1NM5A 1WBJB 3ZDCA 3BXPA 3CUSA 3CNEA 5KINB 3ANXA 2HF7A 1NVVQ 4X84A 3X1KA 3QF4A 2LV8A 3F74A 1AC5A 4R7ZA 1HFKA 3RRFA 1G2OA 1FFBA 3LO8A 2HRCA 3IVGA 3IAXA 3VTFA 2WLTA 3QMWA 3BD7A 4DPMA 2ZQZA 3OE5A 4H7IA 2K4MA 4TV9F 2DKFA 4RSGA 2P79A 2AI3A 4OU5A 1DKPA 4MW6A 3I6IA 4OGLA 4AKTA 3U6KA 2BKXA 3G23A 1U2QA 1ISMA 1UWVA 2OB1A 2UYGA 3O4GA 1M5RA 2RI1A 2C5AA 3AIMA 2AKEA 3N05A 3KP1A 2P4UA 1F8XA 3FOEC 2X0IA 2ZRGA 4IDAA 4ZZ0A 2Q7XA 1W5BA 2BN4A 4PF1A 4MPJA 1IVSA 3RIYA 2AJLI 1P62B 1X14A 3BULA 4AZVA 4IIVA 4TROA 5DIZA 5K3BA 2W2OA 3FLBA 4BNXA 3QKIA 3BREA 4JUDX 4LX8A 5GOTA 2ATXA 2JEZA 1A9SA 2I76A 1P8AA 4RDXA 1N2JA 4DQKA 3RUIA 3V9PA 1P39A 3CONA 4MV1A 4E31A 2VRNA 1F0KA 2WZDA 2JCXA 4FLFA 5DXAA 4NSNA 3OZTA 3ANMA 4G5GA 4AKHA 3BTOA 1Z8NA 1VKRA 2J0QA 4ZOEA 1P45A 3D4IA 3H7IA 5BT8A 3V4LA 4JLWA 3TDMA 4MW5A 2G5PA 4AN1A 4Q3LA 4RA6A 4W5HA 3QIAA 3FGOA 2BCJQ 3KJZA 4LWOA 4GI2A 4V0QA 5SYNA 2JAXA 4GOOD 5EIAA 3UK2A 4LRYA 1XEWY 2MSEB 3BKXA 3KHTA 4KXVA 2GCOA 4MUXA 1IOZA 4LY6A 4PEVA 3RU9