4X8LA

Crystal structure of e. coli adenylate kinase p177a mutant in complex with inhibitor ap5a
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
214
structure length
214
Chain Sequence
MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAALIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Adenylate kinase
publication title Structural basis for catalytically restrictive dynamics of a high-energy enzyme state.
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 76
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4x8lA00
1S1MA 4OK3A 4XIGS 3Q7PA 2FU5C 4NYJR 2BMJA 2JJ2A 4RFSA 1VYTA 3MRSA 4RZ3A 2OFXA 1RPZA 4BFYA 1D5CA 5JJKA 3GEHA 3TK1A 2QAGC 2OBLA 4JLMA 3WMFA 4BLRA 1BIFA 3IHLA 3CX7A 2IK8A 4U5XA 1N6IA 5HPYB 1E4YA 1XEFA 3AVOA 2ATXA 1KO1A 1HY3A 3I1FA 4DIEA 5UKDA 4DCVA 3AVXA 3RRMA 4GT1A 4OI4A 4IOLA 2XXAB 2PX0A 2BJVA 2J9RA 3W90A 1M1YE 3EASA 2CVFA 2ZJAA 1ANKA 3GLGB 1EGAA 1NY6A 1G4UR 1OKKD 4EPTA 3ETLA 4M9SA 5JMTA 3QG5A 2GCPA 2A5DA 5AWFC 2QRZA 5LB2A 4DIDA 4OK5A 2VP5A 1SVKA 4NHOA 1E4VA 1E79D 4URZR 3RRYA 1MOZA 2VP6A 2ZRPA 4JYCA 4UJ3A 2ERXA 4LC0A 4Q9IA 4IDPA 4MGZR 2O0JA 2ZI4A 4ACAA 1G8FA 1GWNA 5BN4A 4HLQB 4P0TA 2WTUA 1WCV1 2REBA 1Y3AA 2CMKA 5LBIA 1Z06A 1NJGA 4F4IA 4CVNA 1FMJA 4CF7A 5TMPA 3QNUA 4CEHB 1VG0B 3AVYA 2F3TA 4UNQA 1KIMA 2HJGA 4KYIB 4PZZA 3PFIA 3CRMA 4PQRA 1XCPA 4Q4AA 2O8BA 2OFOA 4DWJA 1GFIA 1KHTA 1KMHA 2LKCA 1E2LA 2G1KA 4HUQB 2QTVB 5HZKA 1RC8A 3K0SA 3C16C 4FIDA 3ZYCA 1VYVA 2EVWX 2J5XA 2P6UA 3ADBA 2ZJ5A 1G21E 4DBLC 2AL7A 4D0GA 2Q9AA 3RWMB 1S4QA 1ZNZA 1U98A 5FPYA 4B2IA 2EFCB 1KNQA 3MD0A 4D4LA 3OAAD 2V3CC 3UMFA 5KDOA 2V1UA 2A5FA 1GRQA 3M0EA 4TZ0A 1EK0A 1G6HA 1RZ3A 3FB4A 4UNRA 2Z4SA 1W5SA 1NN3A 2YWEA 1E9BA 3WHKA 5BN5A 2O8CA 3UG6A 2CLCX 3MAAC 3PENA 5K8UA 1QHIA 4Q4JB 4ESHA 3BH6A 3BJIC 3FPAA 2ZU6A 3NH6A 4TLBA 2QT1A 4JIMA 5HTKA 4B76A 4C0HA 4RD2A 2EYQA 4GL2A 1M7HA 1P5ZB 1ZD1A 2ZSEA 2JJ1D 1RW4A 1II8A 3HWSA 2EW1A 2W0MA 3GCGA 2WSSA 3CF0A 3W8RA 2Z43A 1PLLA 521PA 1R5BA 2N46A 1M7GA 2QUZA 3K0CA 3K53A 4WA7A 4C30A 2WJIA 3HR8A 3IPXA 2OCYC 4NP6A 1NJFA 3A58B 3REFA 1A5TA 4C0QC 3RS0A 4LHWA 4LV6A 1UEJA 4B3GA 4B74A 2ZSDA 4RCYA 1EX7A 1Q3HA 3GQBA 1VG1A 1OFUX 2JLWA 3HYTA 4XD7A 2Q9CA 2OEPA 3R7WA 2GA8A 1YVDA 5EXTA 1AZTA 2Q6TA 2ODWA 1Q21A 2GETA 5AUPB 3Q5EA 4Q00A 3R9IA 1D2NA 1XEXB 3I5YA 3LQQA 1EWQA 2IYWA 4Q7MB 4LYJA 4YMUA 4N1AA 3O8BA 4QNRA 1YRAA 2GESA 4QFMA 1HURA 4TLCA 2VF8A 4BZQA 1Z6GA 2IA5A 2V9PA 3ADKA 1S2MA 4I1UA 1OH6A 2ODBA 2IWHA 1Q12A 4QXAA 2QN6A 2P67A 5KSOA 3A36A 1OIXA 2G0TA 5CITA 1D2EA 1EFRD 1W48A 1J7KA 3EA5A 4FCWA 3K0AA 3VKWA 1HE8B 3DZ8A 3SN6A 2QNRA 1QF9A 1LS6A 3UMSA 1F2TB 2X2EA 2GZHA 4OQNA 3OESA 4ACBA 3MWJA 2CLDX 2D7DA 5GADl 5D3MB 3RSLA 3L2OB 1S3GA 1K5GA 2QAJA 5C2JB 2CHQA 4Z8YA 4Q9HA 2XTZA 1W36D 2ZANA 1CLUA 3WYFA 1DELA 2JLVA 2AKAB 2IYZA 3SEAA 3PEUA 5GJWC 1TQDA 4KFUA 3EC2A 5IK2A 2IF2A 5FI1B 3SDZA 2PL3A 3AKEA 2GXQA 2G77B 3B85A 4Z1MA 1BMFA 1AKYA 1K8RA 4HLUA 3GP8A 2DBYA 4A8JB 4XTRA 3D8BA 4DEXA 4RD1A 4HAZA 4EDHA 5JLJA 1SVOA 4V0ME 3Q3JB 4M0LA 1S1CA 1IAQA 1NNEA 2BM0A 2BBWA 5F9HA 3C15C 2ZRJA 3VTKA 1XMSA 3A37A 3R9XA 4FN5A 4PX9A 3LX8A 2P3SA 4PSAA 3SHFA 2D7CA 2B7CA 3B9QA 1E2HA 3F0TA 3ZJYA 1AQUA 4G5GA 1KK3A 1T5LA 4A0RA 4EJSC 3U7GA 4R98A 1TMKA 2VF7A 3MWLA 1W2HA 1NP6A 4KJZA 2YWFA 2FA9A 1N5LA 3LXRA 2H57A 1FUKA 2HF9A 2IYXA 2ZRNA 3QBTA 3RHFA 2CK3A 4WOPA 3FMPB 1XTSA 5LPNA 3K70B 2JCSA 1U90A 4IHQA 3NG1A 1N0VC 2DR3A 1HQYE 3KTAB 4B2LA 3SR0A 4A15A 4CEIA 1EESA 2I1QA 3VKHA 1YZNA 1JQJC 3B13B 1DPFA 4P4SA 4WIAA 3CLVA 2XOKD 4ZIRA 3DM9B 2YOFA 2Q21A 2QU8A 2WMOB 2A30A 1CJVC 2FPKA 3GFPA 3TSOA 2W6IA 2O8FA 1XTRA 3CPHA 4LJ7A 2J0VA 1G3IA 1R10A 4LK2A 3SFVA 3LNCA 4EUNA 5KOYA 3WMEA 4PZYA 1KOFA 1Q20A 3DL0A 2C5LA 3RANA 2QE7A 1HUQA 1TF7A 4Q02A 5A5GA 1DADA 1GL7A 2QORA 3QPVA 3THXA 2KB0A 3W6PA 1N6KA 3OIWA 4L16A 3I5XA 5TV2A 3ZVRA 4GNKA 1IN5A 4DLRA 2V55B 4NCIA 2HLDA 3AH8A 4M8NE 4AKIA 3DO6A 2V6IA 2OBNA 4RFVA 2JDIA 3B2EA 1NMXA 1DARA 5CJPA 4A4DA 1L4YA 1Z28A 2ZJZA 1E6CA 3SFZA 3UIEA 1DAIA 3QBVA 2HT6A 4XVUA 2PX3A 1IXRC 1Q3TA 3S1AB 2EFEB 3TMKA 2R9VA 4EQ6A 2GJ8A 3MSXA 1ZMXA 5CIWA 3MGCA 3RNLA 5DLQC 5AK0A 1G64A 2IHBA 3UXMA 1OKKA 2ANBA 4BFTA 4WZBE 1XD8A 3PV0A 3G5UA 3BB1A 3LA6A 3PUZA 8OHMA 4DT1B 3WP0A 4LBWA 1EFUA 1KSFX 4EPXA 3IO3A 4D4MA 5EE5B 4OKSA 1KDOA 2PLFA 4BLPA 1F2UA 3THWB 2VQSA 4LBZA 4BZXA 2QP4A 4N0EA 3QPUA 1TADA 3BFVA 3R8CA 2J46A 1P62B 2V7QD 1GOTA 1VG8A 4D4KA 1ZYUA 3RC3A 4N0DA 4QG7A 1NF3A 2WWGA 4LC1A 1F3OA 2QAGA 3QF7A 1XJQA 3NC0C 1VDZA 2R44A 1NY5A 2J3EA 3EZFA 3AVTA 2OUKA 4FMBB 4Q01A 1XEWY 2PT5A 4L9WA 4JVMA 4Q21A 2BMFA 4TSFA 1QG4A 3IPYA 4QBIA 3W6OA 3GJ8A 1DAFA 1ZD9A 1OXVA 3K09C 2EFGA 2BC9A 3U3KA 4IEIA 3VR1A 1S8FA 1SVMA 2QQEA 5JJLA 4TT3A 1C1YA 1P3JA 1OSNA 2QTFA 4C0JA 1E0SA 3DPUA 3AVQA 3B8HA 4IJMA 1KNXA 3SBEA 2OSBA 3EZ7A 1W1WA 3QXCA 3TW4A 4R2HA 5DI9A 1E2DA 4EPWA 1ZIOA 3U4QB 2XB2A 2YKGA 2IS4A 4URUR 4MDFA 1XP8A 1W0KD 4DLUA 1OXXK 2ZRCA 2H17A 3ZH9B 1XZPA 3W3ZB 1NIPA 4IEEA 1R5OA 1E9CA 5LD2C 2ZROA 3PEYA 3Q85A 3UATA 2A5YB 3CM0A 3IDQA 1ZBDA 4W5WA 2V54A 5EUQB 1UKVY 5FL3A 2F55A 2WICA 4B3DA 1G5RA 3K0FA 4NCNA 4V0KA 2A3RA 1Q0UA 2AHOA 4BFUA 3FHOA 2NO7A 4KLNA 2VHJA 1N5IA 4I1SA 4IVPA 2L0XA 3NC1C 1CULC 2WKQA 1KSGA 1Q1EA 3C41J 5BYJA 2EWWA 3HPQA 2WJYA 2ZRBA 3GLHA 5C4GB 1R4AA 4MRSA 4NCKA 1ZD8A 3AUYA 1E9SA 1IXSB 3R9WA 3UWOA 3GJ5A 1JXOA 4PAQA 1CR0A 1IJEA 3VU9A 4IDQA 2FE4A 2F1JA 2J45A 3FHCB 3SNHA 4KSBA 2ZS9A 1GSIA 2ECKA 3FTQA 1KO5A 5TDHA 4FWIB 4QJ5A 3X1ZA 4KAXA 4B33A 3OFND 3L8ZA 3UK6A 2JGNA 4KODA 1FP7A 4XWKA 1TU3A 3DVLA 2HCBA 4NDZA 4JBXA 2F43B 5L3QA 1VIAA 2RCNA 5CM9C 1W4CA 1DEKA 3BAFA 3IHWA 1Z22A 1W0JD 3LAWA 2WIBA 1GP2A 1HT1E 1WMSA 3W5IA 1WF3A 5DI3A 4LDJA 2BOVA 3LD9A 1G3QA 1XBTA 4OHXA 3VHXA 2I1VB 1UEIA 3FFBA 4BFZA 2VLIA 3X1DA 2O8DB 4I1VA 5IHPA 3TVDA 1US8B 1SVIA 4MYTA 2C98A 1AGPA 4TTPA 1XPOA 3FE2A 1W44A 1XTKA 3C5HA 1N25A 1JR6A 2NO1A 3KJEA 2IYTA 5DYIA 1CU1A 5KHOC 5CK5A 2H8KA 3KKMA 1WXQA 3W6NA 3BK7A 1OV4A 2Q3MA 2JLZA 3A4NA 4Z8XA 4ARZB 4PHTA 1PZNA 3QOFA 5EXSA 1WRBA 5FOXA 2R6DA 4F92B 4DKXA 2AN9A 2BJWA 1J8MF 3I4LA 1TNDA 4P32A 4US2R 2F1RA 1MKYA 2QGNA 2ZS7A 4Q47A 1RRPA 2BIFA 2VHUA 4DSOA 4DUGD 1KDRA 4G01B 4TLEA 2ZAOA 3THYB 4MDEA 1I2MA 1OT3A 4HYYA 2OO7A 4TL7A 4A1FA 1KY3A 2FPLA 2W00A 2F1HA 1VKJA 5SZKB 1TF5A 2ZRFA 4LV5B 4DLXA 4YQFA 4ILEA 4LHVA 2QQ0A 4IFBA 3AVPA 3BB3A 3FYHA 4NMMA 4Z51A 2HJVA 3A1WA 5H8WA 3VX4A 1ZCBA 2ZTSA 4AK9A 2EFDB 2GXAA 2WWXA 4DC9A 1IY1A 4Q7KA 3VNUA 4PC7A 4Q7LA 3TUZC 1KI6A 2LWIA 5B58C 1CR4A 2RGCA 3DHWC 1GTVA 3QUSA 3GLFA 1PVOA 1IN6A 2RGGA 1YZGA 2VP9A 2YC4C 3EXAA 4PFSA 4OHZA 1CJMA 2CE7A 2C96A 2QM7A 2YINC 5FUXA 3QJYA 1GL9B 3LFUA 1SQ5A 2B7BA 1US8A 4M1MA 4Q1DA 4Q4HA 4BFWA 2XSZA 2BKUA 1XD2A 1OF1A 5BW8A 1QHHB 3MFYA 3ZIAD 5FUYA 3ZLJA 1TX4B 4JYBA 2R8RA 4E03A 4Y0AA 1ZU5A 1OPXA 4A0HA 2ZS8A 2IWRA 3DDCA 2X1VA 3AF2A 2B21A 2YOGA 3GJ0A 5CYOA 3FVQA 4NBSA 5BWMA 1R2QA 4MRRA 3GFTA 4IXNA 4DLSA 3A6PC 2IT1A 4EJSA 3NWJA 3WNBA 4HAVA 3PG5A 4JLAA 3B6EA 5J4VA 1FTNA 2ZRHA 5B64A 1KGDA 4RFSB 4WXPA 1Z3IX 1DVRA 1FQJA 1W5TA 3KFXA 4PO8A 3ZDQA 4ON9A 3K9NA 3RS7A 2OLKA 1ESNA 1G4AE 3TQCA 2FEOA 2MSEB 5C4MA 2PEZA 3A1SA 1N6PA 1H8HD 1M34E 3KQHA 2FSIA 1FW6A 1IN7A 5A4JA 2J0QA 1KO8A 1NLYA 1E98A 3SJBA 4LYAA 1TL7C 1VIYA 1ZM2A 2VSOA 1OFIA 4C2TA 1GRRA 1FOEB 1N5KA 4Y0VA 4DLYA 1P75A 4ASUD 1XJ0A 1T3SA 2BM1A 2E9SA 5FPTA 4LRWA 2XJ4A 2UVQA 5J4YA 2C03A 4DDVA 5EZ6B 1XB2A 1FZQA 4X8HA 5L3SA 2FEMA 2GNOA 2NOAA 2J41A 4A2PA 1HQCA 3VHLB 3MJRA 4A6PA 4KO8A 3V4RA 3TQFA 2CE2X 4FI3C 2PMDA 1KDTA 3U3RA 3QKTA 3OIYA 1ESMA 4MGIR 3L0SA 2CCKA 1GNPA 1NKSA 3I61A 2KJQA 4PSVA 2ZPTX 4ZDKA 2D2FA 4ABYA 2GCNA 3CZQA 2ODNA 1DBSA 3K8YA 1FL9A 4ZO4A 2G1JA 5B57C 2ORVA 2PCLA 2BEJA 3LRPA 1MR3F 3LVQE 4PQYA 4S35A 1CKEA 3RYTC 5JRJA 3NBYC 2PCJA 3GLHE 4Q4AB 2O8BB 5J4LA 1KMHB 1Q57A 2HV8A 4PR0A 3HU3A 1QDEA 4B3XA 1P2SA 2CNWD 1NI3A 2ONJA 1DE0A 5SZHB 1G9XA 1M8PA 2CJWA 4O2LA 3PEVA 5KDLA 4B43A 2OG2A 2QI9C 2WJVA 2EQBA 2YVUA 3GJXC 2F6RA 2ZR7A 5KO2A 4DHEA 1E1QA 3UWKA 1HV8A 1U9IC 3EA0A 1OIWA 1GKYA 2H16A 3CRW1 5FBLB 4RY2A 2O8CB 1KSHA 1YQTA 2H5EA 1O87A 1XNJA 4QGHA 3FMIA 2FZ4A 3FKSD 2GK7A 3UG7A 1NN0A 1UFQA 4RD3A 1E99A 1D8TA 5JFGA 1A2KC 1VCNA 2BCGY 2JJ8A 3B5JA 5EP4A 3VR2A 4B32A 4YDHB 1OHHA 4M1SA 1DS6A 1COWD 1FX0B 1G8YA 2ZYTX 3F3YA 4LPSA 4M4SA 5FTMA 1W0KA 3EWSA 1FTSA 1IN4A 1JR3D 3VR5A 3VKGA 4QHSA 2IX3A 1II8B 4MKGA 1TQ4A 2JIZA 5JEDA 1G3MA 2DFTA 5JRZA 2ZREA 4PPQA 1E9FA 2C99A 1UBCA 3M4YA 3EZ9A 5IDVA 1X1RA 621PA 3R8FA 2IXEA 2ATVA 4IDOA 3ZZTA 5FTKA 1KJWA 3NVAA 2UKDA 4C9BA 1TF2A 4YMVA 1W4RA 1E2EA 3T06B 2D74A 4URVR 2KWIA 1Q22A 4OJQA 4MKIA 3R7WB 3SQWA 1FNNA 1TTTA 4TTQA 5HKKD 2WKPA 4C0KA 2XNSA 4DDWA 2YNMA 2C04A 3B82A 4JL8A 1SVLA 4HB3A 5AJYA 1W4BA 5CB6A 3EAQA 2QPAA 4D26A 3QEOA 1Z08A 3K09A 2R6GA 4C0LA 2GZDA 4WW0A 1LB1B 3FHTA 4X8OA 4B34A 5KUTA 3C8UA 3TGPA 5C46F 3AKDA 1HEIA 3ICQB 1LNZA 4B73A 2OXCA 3PCRB 4NYJQ 4JSTA 4DZZA 1K6MA 2VSXA 3K0AB 4IXMA 2RGXA 5F2EA 1LF5A 1U0HC 3F5FA 4LY6A 2OILA 1KI2A 3K0EA 4QOSA 3KQNA 2VEDA 4NH0A 5DE3A 1OB5A 3ND8A 3PEWA 3ZD6A 1X1SA 4O0MA 3GLFE 2NIPA 1Q44A 5F3WB 1E2IA 4OI2A 4E07A 2ZI7A 2FH5B 1OB2A 5J40A 3RS4A 5DN6A 4NYMR 5CIQA 1G1MA 1RYHA 1FX0A 1XMIA 2FGJA 4KI0A 4F7WA 3R20A 4CZ2A 1F60A 2R2AA 4DDUA 3GEEA 4L4UA 1NMYA 3CF6R 2VYFA 4CRWB 2ZYUX 4UXIA 1W36C 1G18A 3A1TA 5AJZA 2RB4A 1Z2CA 1WDTA 4UNSA 4FCVA 3ZGXA 2VP4A 3RSOA 1T0JB 5DHAA 3V00A 1E9DA 4BGDA 2ORIA 3ZZ0A 1G19A 3K9LA 1KK0A 1UPTA 3HYRA 1CR1A 4JLKA 5FL7D 3EW9A 4D25A 3AKYA 4UQOA 1Z47A 4JKIA 5JWHA 2GEDA 3K9GA 1KSJA 1I2DA 3CH4B 2HT1A 3V4FA 1GKIA 5SZJA 1TEXA 2FJUA 4Q48A 4TL9A 2GWHA 4M1OA 3X1YA 4CEJA 1UBFA 3A1UA 4MYCA 1R0YA 2YHSA 1ZNXA 3CPEA 2AFHE 5EZ5A 4BRUA 4M1KA 4MYHA 1ZRHA 5HE8A 2AD5A 4BEBA 4MRNA 4JLVA 4R2IA 1BYIA 1U2RA 2DWQA 3PIRA 4CEIB 2FFQA 1E2FA 4GZMA 4M22A 1XFAA 3I8SA 2J7PA 4P4SB 4Q1EA 3RRNA 1SZPA 1E0KA 3A4MA 1E9AA 2WHXA 3FGNA 3PR1A 4ZIRB 1CEEA 1E94E 2IS1A 1KYIA 2W2TA 3MG9A 2FGKA 1RFLA 3G82C 2R6AA 3CWQA 4HDCA 2EU8A 3NHAA 1NIJA 2HYIC 3AV0B 2O8FB 1RYFA 3CRRA 1ZM4A 3OEEA 4BFSA 2OV2A 2F7SA 2WOOA 3CNLA 1NRJB 5AR1A 2BHRA 1AS0A 4XSGA 3TLXA 2GKSA 4D2IA 5CK4A 1YHNA 2OFWA 2ANCA 3ND9A 4OI1A 3THXB 2UZIR 2CHVA 1KK2A 1RVDA 1WA5A 4NYMQ 5DHFA 5M04A 2OESA 4MUBA 3B78A 1KJZA 3M6AA 3AF0A 1YZLA 4MUAA 3T1VA 4NZYA 4XWAA 1N0WA 1Z6YA 2FG5A 3O47A 4PQFA 2Z6VA 3VR6A 4US0R 3VNVA 2GXUA 2SHKA 4LGMA 1UADA 3BH7A 2WOJA 3NBFA 1M2OB 1JXMA 1P72A 3AQ4A 2BDTA 3WNDA 4PO1A 1GILA 1Z29A 2UZ3A 1W4AA 2XNDD 4AD8A 1OFHA 4KHZA 4GP6A 3RRZA 1G291 5DIFA 4E22A 3BGWA 1HYQA 3BWDD 3NBXX 2Z83A 2QPTA 5FOSA 4KXFB 1KO7A 1KI7A 3WY9A 2ZR0A 3KKOA 2YC2C 4GOJA 4EQ6B 2B6HA 3EZ2A 2QMEA 1P4SA 1G5TA 2PMKA 4Q66C 3BD9A 1G20E 3QF4A 3IBGA 4J0QA 1Z0JA 5FOWA 1G3UA 4WZAE 1GL6A 3AB3A 4PZLA 4F38A 1CBUA 3AF1A 4LCBA 3LLUA 4DDTA 1ZC4A 3W5JA 1NN1A 2QROA 4Q5IA 1MABA 1N5JA 1AK2A 4RD6A 3VX3A 2H1LA 4LBYA 2OAQ1 1XZQA 1NLZA 1TU4A 3AVVA 4W9MC 1CF4A 2IHYA 1X6VA 3P32A 1KMQA 3JZMA 4AIIA 3RLFA 3TAHA 4LJ6A 2ZI9A 4DLWA 4LWZA 4A0FA 821PA 1F2UB 1XMVA 3LVRE 1IHUA 3LY5A 4C0AC 3BRWD 3SYKA 3HDTA 3WRXC 1X86B 1Z0KA 2YWGA 4BFXA 4MITA 1KKLA 2ZUBA 1EXMA 1XCGB 5HE9A 3KQKA 2ZRAA 3IKJA 2GRJA 3M1IA 3FMFA 4EAQA 1Z8FA 1VMAA 2QAGB 4JKYA 2VP0A 3TSZA 5KSPA 3JZAA 3WYGA 1IN8A 2N1BA 4Q18A 4LUCA 1Z0FA 2QBYA 1YZQA 1XCMA 1E1RD 1EFCA 1KI9A 3QI2A 1UM8A 2C95A 4PC6A 1IY2A 1CXZA 1BH2A 1AGRA 3DOEA 2ZRMA 4DCUA 1WBBA 3NIBA 2CEAA 2WM9B 5FBQB 2EFHB 1MO6A 5DYGA 3WRYC 4M9XA 1JAHA 2ZE8A 3CX8A 3HP1A 3DKPA 2A78A 2RGBA 1KDPA 2FNAA 2ZRLA 4JLBA 4JMPA 2VH5R 4HZUA 2GVDC 3SQXA 5L3RA 2ZE5A 4LYFA 1W49A 2R6FA 1ZC3A 4TZ6A 4LV8B 5KSZA 3QKUA 4DSUA 1P2TA 2QG6A 1V43A 2ZR9A 2ZYVX 2QSZA 1SXJC 2YJTD 4QBGB 3X1WA 4BEJA 4KFSA 4ERNA 2C8VA 4PHGA 5L3VA 4DB2A 4AG5A 2GDJA 1G7CA 4QGFA 3LDAA 4WXRA 3DKVA 5JCPA 4QGGA 5DH9A 1IY0A 4HLDA 4XJXA 1WE2A 2JLUA 1YZTA 3K0FB 3C4JA 2WWYA 1NBMD 1UJ2A 2Z4RA 3BFXA 3Q5DA 2QRNA 4OQMA 3HU2A 1E79A 2F1IA 1NG9A 2AXPA 1LV7A 1N6OA 4F93B 2FMXA 3DZDA 3U7HB 5KPJA 2X2FA 2GF9A 1SVSA 2ZRIA 2OLJA 2DY1A 3AF3A 2ZYWX 3FDIA 1FUUA 2Q9BA 3EC1A 1AQYA 5JI3E 2G3YA 3GLHB 1C9KA 3P4XA 1UKEA 4YXWD 4EPRA 2IXGA 3MCAA 3U5ZB 1CRPA 5FPSA 4DCSA 4G5RA 1KK1A 2MSDB 1ZCAA 1Z6XA 2OE2A 3VU9B 1NVVR 2Q3HA 2PT7A 2QEQA 1ZAKA 2OHFA 3OF5A 2B92A 1HE1C 1U9IA 2F9MA 3MUFA 4ZI3A 1YZKA 1UAAA 3NDPA 3QVVA 5EQTA 1Q1ZA 2BMEA 3F8TA 1VG9B 2CL0X 4A9AA 1AS3A 2NMVA 3EIEA 1SXJD 5L3QB 1GRNA 3IGFA 2NTYC 1MT0A 2CL7X 1CJTC 1GKUB 2IUTA 2MMGA 3E70C 3P20A 4K8OA 3T61A 3OAAA 4DB4A 3J81k 4YONB 5EXXA 3LH5A 3U3JA 1Z07A 5K8LA 3KUDA 4M2LA 3TSWA 1QRAA 5DI3B 4H1VA 4P4TA 4LHXA 1SVWA 4QGAA 4Q4LA 4B2PA 2IC5A 2FSHA 1JJ7A 2ZVQX 1W36B 4G0NA 4PPNA 4OHVA 5JS7A 2J0UA 4B6FA 2O8EA 1VHTA 1Z0IA 2NO9A 2JLXA 4QJ3A 2OAP1 1S0UA 2GCOA 5LDDC 2JJ1A 1W47A 2QENA 4QKQA 2IBMA 4NU0A 3UANA 2H18A 2AKYA 5KPDA 3ADDA 2GEUA 4RKEA 4IRUB 1DG3A 2JLSA 3LBHA 2C78A 4O2RA 2CDNA 5FPKA 4NE2A 3KZ1E 2E87A 4RKFA 5AJVB 1OH7A 1H8ED 1XXHA 5CLQA 2A7QA 4Q7JB 2FSFA 3L0OA 2AWOA 1XPUA 2QMHA 1R0XA 1G41A 1NG1A 3CNOA 4U7DA 4S2EA 1II9A 2A5GA 5G3YA 4PXAA 2G0NA 4HLCA 1KI4A 1Z6AA 3N2EA 4IDNA 3ZVMA 1GG2A 1JPNA 2VBCA 3T5DA 4M1TA 3TR0A 1E9RA 3ZQ6A 1LTQA 2FV8A 3RAPR 4UXJA 3U6KA 2ZM5A 2J1LA 1FP6A 1QG2A 1EG7A 2QMUA 2WMNB 4FW9A 4C0SA 5FBWB 3TBKA 2RHDA 5EE0A 1NVVQ 1JECA 3KDSE 1JJVA 1RJ9A 5EE1A 5GJBA 3RABA 5FR2A 3UMRA 1KI6B 3AKCA 4M21A 4X8LA 1EFRA 4AG6A 5CM8B 3GLFB 2GTPA 2FF7A 3L8YA 2F9LA 4NYIR 4CW7A 2ZJBA 2BCJQ 2TMKA 4CT4B 2G88A 2AR7A 4DEYA 2VIIA 1G7TA 1MRSA 1MH1A 2BKEA 3Q72A 4Q4HB 3BH0A 2WSMA 4FINA 1XD2B 1KAGA 4WBSA 3D31A 3LO5A 3T1TA 5GVRA 1F5NA 1U99A 3BERA 1IBRA 1Z83A 2YZ2A 3W3AA 3N2IA 4CGZA 2NGRA 1T6NA 1G6OA 3NHBA 4NONA 4RVCA 1P61B 2FDCA 3TR5A 2VTKA 4L15A 4EJSB 2VL7A 1I4LD 4NPHA 5HZHA 3KXIA 5G3ZA 2PZGA 3SC3A 3IIKA 4LHYA 3EARA 5JHHB 2H7VA 3T35A 2VO1A 5K8TA 1ZUNB 3KFVA 4IOMA 2WSSD 1GM5A 3PVSA 4X8MA 4D0NA 5E7JA 5GJCA 5JECA 2A9KA 2WJJA 4AURA 4JBYA 1IQPA 3H4MA 5KSYA 2GILA 1G7SA 2XAUA 1N2CE 3WMGA 1BYUA 5KU1A 1DOAA 4HAUA 4GBMA 4EKDA 4XD7D 1S3SA 1NL3A 1ZVQA 2V4ZA 1DTSA 1N6HA 4GSYA 2EWVA 3GEIA 2EYUA 2VRWA 3OE7D 2RHMA 2XNDA 4LJAA 3GJ7A 3EWAA 1OYWA 3DEFA 3U3MA 1TEVA 1W46A 3D7MA 3TE6A 4LJYA 1KY2A 3CR7A 3SJAA 4XWOA 2QY9A 2FWRA 2XGJA 2XJ9A 3I72A 5L3SB 4MKFA 1OXUA 4GOXA 3MMPA 1ZINA 2DFNA 3TUJC 1KTVA 2OBMA 1JBKA 2C2HA 1FMLA 3ZZUA 3O8CA 4YMSA 1F6BA 2CVHA 5P21A 3QENA 4BRWA 3KQUA 1IOZA 1FPMA 5E7IA 2FPMA 1P9NA 5AJWA 1SKYE 3I3SR 5BYKA 4JLNA 1R8QA 4TMTA 2KBEA 4ZKDA 3BXZA 1CS4C 2XOKA 4AKEA 4TYPA 1YKSA 3AP2A 1E3MA 1JNYA 4GRAA 4ZPXA 4BLSA 4DRZA 2DHRA 2ZE6A 3K1JA 5KYKA 3EPLA 1F48A 1QVAA 3E1SA 4BLQA 2CL6X 3BC1A 1QHYA 1PLKA 1OH8A 1AA9A 2YWHA 3IBYA 6Q21A 2XTMA 2BVNA 1S96A 4B47A 2X8AA 3KXLA 3BIFA 2REXB 4I81A 1WP9A 4HATA 3U61B 1A7JA 3NEYA 3QKRA 4EPVA 5EXPA 5IK2D 1BO6A 4FMCB 4B35A 2P65A 3BFKA 4Z1MD 3LBNA 1RIFA 3AGQA 1BMFD 2OZEA 3FWYA 1DG1G 4BZPA 3H84A 3QSYA 4HEJA 5B30A 4AYTA 3KX2A 2WZQA 1LF0A 2CJWB 1RRCA 2ZUDA 5KNDA 1PV4A 3H86A 1G8PA 2D62A 3HJNA 4AWXA 4QC2A 1E2NA 1X3SA 1ZUIA 5G40A 4LJ8A 5LB4A 3QE0A 1KO4A 3LQRA 3LW7A 3TJZA 2ZJ8A 2GJSA 4PHHA 1EWRA 1YR6A 4BLTA 1OH5A 3QXXA 1AKEA 2VSFA 4A8JC 4PC3A 4DSTA 2ZJYA 3H1TA 5EP1A 3T1OA 3X1XA 1G3RA 1ETUA 1XTQA 1FNMA 1G7RA 2BMDA 1LFDB 5FOUA 3KL4A 1D9XA 2ODEA 4LJ5A 2O0HA 2IYQA 3EG5A 4CT5A 2GF0A 3JVUA 3UKDA 1Q1BA 4DLVA 1QHGA 2AFIE 3O8DA 1W2GA 3CRQA 3IO5A 4NL4H 2PZFA 2GXSA 2YOHA 1MO4A 4UXHA 1YZUA 1R8SA 3WXMA 1T91A 3U60B 2RKOA 2JA1A 121PA 1HA3A 2WIAA 1NBMA 4LX0A 4W5JA 4B75A 2DWOA 3IIMA 1D6JA 4A92A 4MGYR 4JBWA 1XX6A 3U7EB 1JAIA 5CDFA 2HUPA 2W6ID 4TYYA 1XXHE 1PJRA 1TPZA 3AF4A 3BS4A 1ZM3A 4YLGA 3MLEA 3ADCA 1TUIA 3A4LA 2V7QA 3L82B 3B1YA 4OHWA 4YXWA 3LXXA 4XVRA 2WKRA 3CIOA 2QE7D 3ASZA 3U6BA 3V9PA 1XMJA 5TXGA 2NZJA 2RH5A 3ZVNA 1YR7A 2OT3B 4Z54A 5JSZA 2QSYA 4LI0A 4C7OA 2GVZC 5FUVA 1Q1QA 4KLZA 5FPHA 1FQKA 2XZPA 1Z0DA 2RMKA 1T9HA 1AM4D 2J7KA 1S9HA 4URXR 1E2PA 1MRNA 1SXJA 2JDID 3IQWA 3SYNA 4AKGA 1NVXQ 4UNPA 4RJLA 3REGA 5LD2B 4C4PA 2WVJA 5FBVB 2B8TA 3ECCA 1OLOA 1ZIPA 1J99A 2ZJ2A 1R0WA 2D06A 3ONWA 2DCUA 2GEVA 4TWZA 4B3CA 1E9EA 5FH9A 3K70D 1T8UA 4GI7A 3CWZA 2WJHA 5J47A 2HYDA 3LW8A 4H9GA 3BOSA 2WBLC 3EIHA 4RSGA 1IM2A 1P6XA 3P4YA 2WWFA 4LHZA 3CUEF 2KBFA 1P9RA 5AUOB 3PJRA 1T8TA 3WNCA 3WBKA 4FMDB 3PXGA 1ZUHA 1OE0A 3CH5A 3NEJA 3C7KA 1LVGA 4QL3A 5AJXA 3W34A 2QPOA 1H8EA 2BV3A 3CPJB 4KSCA 3C5CA 1M7BA 2GBLC 1NMZA 3QKSA 1U0LA 4QJ4A 3QXHA 3HR7A 2AK2A 4CEJB 1QHSA 4A36A 4KVAA 4ZCMA 2DPXA 3SZRA 2WWWA 1GNRA 4GPTA 1KI8A 5EE9A 2O52A 1JALA 421PA 1B23P 2ZVPX 3B1XA 4ZDJA 2XZOA 2QMOA 2GJKA 1SHKA 3OFNA 1PUJA 2P5SA 4LOAA 2FOLA 4I4LA 3AEZA 4AC9A 4M9ZA 5DNYB 1Z63A 1UDWA 1NSTA 1XEWX 2AXNA 2FFAA 4TSFD 2PEYA 4WZ6A 4QM6A 2X77A 1JPJA 1A1VA 4RD0A 2QM8A 1JI0A 1UDXA 2ZSFA 1KI1A 1W0JA 2C9CA 2NO6A 4M53A 3EPKA 4TT3D 5JZVA 3QQ5A 1CIPA 2ZI3A 2X19A 1ZM9A 4L5BA 1ODFA 4E09A 2XZLA 3DOFA 2WJGA 2FFHA 1AIPA 3B7GA 2G83A 4WAUA 1J2JA 3T12A 1XWIA 2XXAA 4EFLA 3IQXA 4RZUA 2XB4A 3CKLA 1TQ6A 3NTUA 5FTNA 4A2WA 1N6LA 1G16A 1V5WA 2O5VA 1GNQA 3IEUA 1QVRA 2V8OA 1P73A 3GLGA 4BFVA 1RRFA 1M74A 1EX6A 3KJIA 4RZ2A 1HTWA 4TMWA 4JT4A 4HZIA 4ZDIA 5TVKA 1DAMA 1N3BA 1C4OA 4GDFA 4OJKA 4F91B 2DFLA 4BE7B 4Q1AA 3W9YA 4DUGA 2JASA 4RCZA 5H68A 2ZI6A 2I3BA 4U00A 1UBGA 5J4HA 3VFDA 4CDGA 2WPDD 2BEKA 2PJZA 4B6EA 4II7A 4CEHA 1Z5ZA 4PSKA 4TYNA 1XD9A 3OE7A 4OQXA 1JEDA 1YR8A 2A5JA 3BORA 4GOKA 2YV5A 3QF4B 2ZIAA 5JEEA 1S9DA 3I92A 5DO9A 4IKEA 1PLJA 4GP7A 4ZI2A 4HUQA 1AN0A 1HH4A 3CZPA 4JJKA 3QG1A 4NCHA 1MABB 3RS5A 4Q9KA 2MMCA 5G41A 4A2QA 5JWOA 4JT2A 2F3RA 4OL0A 3I62A 4LSGA 4FMCF 3TUIC 2KSQA 4K81B 4AYWA 3LLMA 1P60A 3EPJA 2FFBA 2VPPA 1BOFA 1P9WA 2H92A 4TLAA 2IW3A 5BXQC 2BBSA 4PPGA 5C1BA 4HDOB 5EP2A 3VMFA 4ESVA 1JQLB 5JCZA 1IJFA 1HT2E 3A1VA 2IS6A 4OK6A 1VCOA 3QPWA 2JATA 1NBME 4HDQB 3ZVLA 2NQ2C 4JL5A 5IT5A 3KKQA 3FKQA 4V0NA 1KZGB 4O3MA 3GD7A 2IS2A 5TB5A 1YR9A 3ZIAA 5CDFE 1XDBA 1GUAA 4Q4JA 1QHXA 3ZD7A 1UKZA 1Z2AA 3RC8A 4TN1A 3B1VA 5F9FA 4W7SA 2QBYB 4DXAA 2IEZA 4UNNA 4XVQA 2RGNC 3D6TB 4Q19A 2JLQA 4LZZA 4Q1FA 4DLZA 1J8YF 2BWJA 3NKVA 3PITA 2IL1A 1CRQA 3MWKA 3EZ6A 3N70A 3TVTA 4PTLA 4YMTA 1CJKC 1OIVA 1LS1A 1H8HA 1VECA 4MQBA 4QNMA 4URYR 5KNCA 3TAUA 2C9YA 4TMVA 5FI0B 3L0IB 1VHLA 4HZUB 5E3HA 1SXJE 3OZXA 5AUQA 5F98A 3TIFA 4URWR 5CLLA 3IIJA 4ASUA 3RWOA 1UBEA 3NBZC 4NTZA 2XITA 5HR5A 3ZQJA 4V0LA 3B60A 1XEXA 3U7FB 2ZXUA 2GJ9A 3OEHD 1SKYB 1XRJA 4MRPA 4XSHA 3U2QA 4XTCS 1GITA 5FBRB 4HUTA 3GLIB 4V02A 4Q1BA 4WVFA 4D80A 5FUWA 4L9SA 4QHTA 1KZ7B 4KBGA 2P0EA 2REOA 2YYZA 2NPFA 4PAOA 1AZSC 2ZAMA 3UPUA 4DJTA 1N6NA 4EIWA 1O3YA 3I8XA 3NXSA 5H1YA 3AM1A 5KNBA 2ZUCA 4MYUA 1F2TA 2CCJA 1ZJ6A 2NO0A 1SKQA 5HCNA 5IF9A 2N42A 1LW7A 3JVVA 3L43A 3CONA 3KJHA 5D3MA 3AVUA 4A0GA 4E5UA 1GDDA 4JSYA 1U8AA 2XSZD 3AP1A 5JHGB 4Q03A 3VQTA 2QT0A 2P6NA 1KJYA 1YE8A 1E69A 4B71A 3OIVA 2QZ4A 2CCGA 1AJEA 5FR1A 3GPLA 4BPBA 3ZS9A 4LJ9A 5JBQA 4D82A 4HI0E 1A82A 5L8VA 3QVUA 4IDHA 3CX6A 2CNWA 4G5SA 4PHFA 5EE3A 4A8JA 1XJCA 4TL8A 3U44B 3FMOB 1XU4A 4JLJA 1NSFA 4G3XA 1P2UA 2OCAA 1OW3B 2W6JD 1TUEA 1G17A 1E2JA 1BS1A 2ZRGA 5KDDA 1II0A 2JLRA 1SULA 2XX3A 3A8TA 3BBPA 5HCIA 2XEXA 2W2VA 4R7ZA 4TQAA 2HDNB 1B0UA 5KTYA 2O0KA 4PO9A 4EFMA 2QA5A 3BB4A 4OYHA 4FMDF 3FKSA 4NKRA 5EUMA 4DSNA 2W0SA 1K5DA 3WYAA 1CTQA 2HEIA 1IONA 1D2MA 3KQLA 2PLRA 4US1R 4ZCIA 2J0UB 2ZE7A 3TW8B 2O8EB 4D4JA 1WQ1R 2W2XA 4IW3B 4D0LB 1COWA 3GLIA 2GCOB 1UF9A 1X8KA 2HXSA 4QBFA 1JR3A 3E2IA 3L0PA 4HB4A 5JI2E 3DM5A 4HAYA 2GAOA 2XTNA 3TRFA 4BASA 4DCNA 5C18A 2J0SA 3SYLA 3KTAA 1KKMA 5ELXA 3RVBA 1DAHA 2ZEJA 5CJ2A 3X2SA 3KXKA 3GLGE 2ZQ5A 2P2LA 3LBIA 4O25A 3WP1B 1XXHB 3RDPA 4HB2A 4IOKA 4R9UC 4QBHA 3KKNA 4V03A 5FOVA 4A82A 4B44A 4LPKA 1E2GA 1FFHA 3QEJA 3FOZA 4ZCLA 1DAKA 5CB8A 1OJLA 3KKPA 3VAAA 3AUXA 3T15A 2BBOA 1DAEA 2AD1A 2ZRKA 5HKKA 3N5CA 1E2QA 1OYYA 2QGZA 3TH5A 4YDSA 1YJ5A 1OFTA 1EFHA 1NKTA 3QXJA 2G9NA 4IOJA 2IYYA 5J4KA 4BLOA 1ELOA 3AVWA 4BQSA 1L4UA 1U94A 5GJVC 1XTJA 5FFMA 1RJ9B 4TMXA 3U44A 4MKHA 1VPLA 2JJ2D 2WAXA 3Q7QA 4OHYA 3K9HA 4DCTA 5IRCD 2IYVA 4I1OA 4JVNA 2DB3A 2NG1A 1JEEA 2IYSA 2G6BA 4KVGA 4F4CA 2V6JA 1GZSA 4HAWA 1DAGA 4ZDWA 1QBKC 3GFOA 2MSCB 4HAXA 3PUXA 2AWNA 2IYLD 1H65A 1E1QD 2J59A 3EIQA 4EPYA 4HSEA 1G8GA 5D3QA 4GMDA 2OCPA 3I32A 1Y63A 3NDBB 4IVRA 1GVNB 4UKDA 1L8QA 1ZNYA 2DFKB 4LJ4A 1GIAA 1OXSC 1RKBA 2JAQA 3EPHA 5DGXA 5K8IA 1D9ZA 4B3BA 1E2KA 5TY0A 1ZNWA 4Q9JA 3CR8A 221PA 3Q8XB 3S1AA 4FWTA 3CRVA 2FZLA 3P26A 1OHHD 2IYRA 3CB4A 4AYXA 3U3OA 2ONKA 3IILA 2P5TB 1J70A 3CW2A 4BWYA 4G5QA 2GBLA 2JIZD 1N6RA 1T4GA 1M6NA 1QHNA 4B3FX 3CBQA 4ITRC 4KFRA 3MWYW 2Z0MA 1TQ2A 4F4JA 3Q9LA 1E2MA 2IUSA 5A0FA 4DT1A 5FL7A 3CNNA 1DO0A 1EFTA 2ZETA 2ORWA 5G53C 4JL6A 5AUNB 2E1RA 3PUYA 4GZLA 2ZU0C 3THWA 3KB1A 4OQFA 1BKDR 4MA4A 3ASYA 3P1JA 4NCJA 3MJHA 3K0CC 2GZAA 4PC1A 2VHTA 2R62A 4UJ5A 1DO2A 1YU9A 1KI3A 2WPDA 1T3LA 2CXXA 2PZEA 3GJ3A 3OHMA 4KU4A 4MH0R 4TL6A 4QHYA 5EP3A 1AS2A 1KAOA 1WB9A 3WHLA 4XOIA 2OM2A 2ZSBA 3TKLA 4XH9B 5BN3A 4RZXA 1ZM7A 4PANA 4AI6A 721PA 2Q3FA 3E5HA 4W5HA 5DISB 1I4TD 4POAA 2QL6A 1NLFA 1GAJA 3KB2A 4JS0A 5CYPA 1OXTA 3LV8A 3SU8A 1XPRA 4LYHA 1XF9A 1L2TA 3C14C 3B1WA 3CF2A 5E7MA 2PJRA 4OBEA 3PUWA 4D81A 1IXZA 5E4FA 3O8RA 3IEVA 1YRBA 4JLDA 5E95A 3QKRB 5DN6D 2RAPA 4JLPA 3QY0A 3ZS8A 1I4DD 3U4QA 4U02A 2OXRA 1U8ZA 3DMNA 4TMZA 4TLDA 3SE0A 2FN4A 1E32A 4PC2A 4CIDA 3W8NA 3QIAA 2JLYA 4P33A 2RGDA 2W58A 4C3ZA 3SHWA 3TNFA 3T34A 1U0JA 4N3NA 3QXSA 4TMKA 1VTKA 2NZ8A 2JEOA 2Z5FA 3HU1A 1CP2A 4JLOA 5SZIA 3SOPA 3H2YA 4HLUC 1NN5A 2C9OA 2D4HA 4LBVA 5BQ5A 2D2EA 3SI7A 4DLTA 1N0UA 1VCMA 4TQ9A 2AK3A 4B48A 1P7CA 3KJGA 1CR2A 2GK6A 4M9QA 1Z0AA 2HXYA 2NPIA 4JZKA 3T5GA 2A2ZA 2CBZA 2PBRA 5FOTA 4ZKEA 1R6BX 3SBDA 2CLSA 2ZJOA 1MO5A 2ERYA 2ZI5A 2K5UA 4IFEA 4RD4A 4TYQA 4HB0A 5FTLA 2GHIA 1RRGA 1TAGA 4OQLA 4GMXA 4CYMA 3RS2A 3KUCA 3H0KA 3T1QA 4R71A 1T5IA 2IYUA 4KFTA 3OEHA 1ONBA 3NH9A 1RE0A 3IUYA 1Z6TA 3VR3A 1UKYA 3GLIE 1PUIA 4A6XA 1JR3E 2ZSAA 2HCJB 2J7PD 2F43A 1R0ZA 4I99A 4NYIQ 2FSGA 2HF8A 4TTRA 3ICEA 4PAMA 2J87A 2LKDA 4QRHA 2VHCA 1WBDA 1VYUA 3LX5A 2IF0A 3OEED 2WWHA 1R5NA 1XTIA 5H70A 4D6PA 2B8WA 2RGNA 1MV5A 2ZRDA 2LCFA 2Q0HA 2ZITA 5JWRA 4V0OA 3SS8A 2IXFA 1T3HA 3I73A 2WWIA 2O8DA 3BE4A 2WAYA 3EX7C 5JJIA 1U8YA 2W83A 5GVSA 1ZU4A 5JSZB 4FXPA 4C7OB 4BUJA 1A4RA 1E1RA 1L7VC 2RGAA 1VCIA 4KCGA 2IUUA 3THOA 4KBFA 4TYWA 1CJUC 4K46A 1X8JA 1NVWQ 2RGEA 4P4UA 2WV9A 4FCTA 4JJZA 4ARZA 1SXJB 4IVQA 2GAAA 2C77A 4ZV4A 4OI0A 4DVGA 1MO3A 2ASEA 2W6JA 4MRVA 3SJCA 4P3YA 4C2UA 5FTJA 2P6RA 2VA8A 4L8GA 4M1WA 1E0JA 2DYKA 4YMWA 2KE5A 1QZXA 3THYA 3HPRA 2QP3A 2FX3A 3GMTA 5EJEA 4G1UC 4JVSB 2KI5A 3WBJA 2CK3D 4PPFA 5ANRB 2PH1A 5B2ZA 5J5CA 2GJAA 2R6CA 5DSZA 4GFDA 2Y8EA 4YC7A 3VR4A 4EFNA 1LY1A 4FD2A 4Q1CA 4KITB 1R7RA 4AKHA 1A2BA 2IEYA 2QTHA 4KYUA 3LWNA 3DMDA 4JVLA 3P27A 2R65A 2VHQA 4QM7A 2CHGA 2AX4A 3GJ4A 4M1YA 3K70C 3PQCA 1U81A 3FFAA 1T0HB 2I4IA 2OCBA 4P31A 3PUVA 2V1XA 3SJZA 1SGWA 5TARA 4C0BA 5JS8A 1NVUQ 3QKSB 3D3QA 2D3WA 3GJ6A 4G5OA 1SHZA 4KV9A 2DWPA 2QP9X 4Q9LA 4TQUS 1E96A 1X8LA 3AP3A 3B1ZA 1P2VA 4H1UA 1JB1A 1E0AA 1QHHA 1W7AA 1G5PA 3AGPA 3RS3A 1J90A 4MGKR 1ZP6A 2BBTA 1ZW6A 4V0MA 1G8HA 3B9PA 3G0HA 4AY2A 2HLDD 3OIUA 4BECA 3CO5A 2VP2A
chains in the Genus database with same CATH superfamily
1HEYA 1S1MA 4J03A 1D09A 4GKKB 4YAJA 1JHOA 1GN8A 1Y5NA 1AKTA 2XGGA 2W7TA 3SSOA 4F46A 3KOMA 1VYTA 4QYWA 2BDUA 1I5EA 3VYUB 1D5CA 1NJSA 2RHOA 3EISA 1YFLA 3JAKA 5JJKA 3GEHA 3COZA 4X91A 2QAGC 5BUZA 5IT9A 3HCDA 2XCRB 4HOYA 3WMFA 3BEOA 3GJYA 3SF0A 3IHLA 5AVOA 3CX7A 4U5XA 2B4KA 1JDUA 3AVOA 3JVEA 4MQMA 2ATXA 1KO1A 2DWCA 1XTTA 4KIFA 4F3TA 3I37X 1P1HA 4GT1A 5JYEA 4OI4A 3H9GA 1DG9A 2C5HA 2YW9A 4BUCA 2A86A 2C7QA 5ELMA 4RELA 1ZIYA 2RHWA 4RPLA 4IX1A 1ANKA 5DGCA 3GLGB 1OKKD 3RV3A 2H3HA 2C3OA 1MD9A 4A8HA 4OXQA 4NAHA 2V7GA 1BEEA 1ZJZA 2OD2A 3DFZA 4RAQA 2XUGA 2A5DA 3TDNA 5AWFC 1RYMA 4MUHA 1JLMA 1MFZA 4DIDA 3OKAA 4Z86A 1KJJA 2VK8A 1K6XA 4G5HA 4ZOLB 5LQAA 1IPHA 5KWEA 1K4YA 4D9FA 1J7JA 2ZRPA 3D8HA 3QXGA 2IYOA 2R7LA 4MUKA 3A9CA 4JZYA 5EHXA 3DOUA 2OKCA 2O0JA 1N4AA 4ZI7A 2XKJE 4ACAA 1L1FA 2V3WA 5KHLB 4C7MA 4LJRA 3WQBA 3R3ZA 4P0TA 5EEHA 1SIOA 5IN4A 2REBA 3EGDA 4FD3A 1NJGA 4X6YA 1XTZA 4CVNA 2P9JA 2AN3A 2Z5LA 2IQIA 4EI7A 1VG0B 2D1FA 5KHAA 3I0NA 3AVYA 1KIMA 1UDCA 1P29A 2PRZA 5C81A 2HJGA 4U7WA 4PZZA 2ZWVA 4RTMA 1Z6ZA 4FDMA 4PQRA 3K71B 4GR4A 4JUDX 1RPTA 5LXTF 1GTZA 4I5FA 4I66A 4J0DA 2NU7A 1W30A 3PHCA 1KHTA 1OWLA 3E15A 5GPBA 2NO5A 2M6LA 2XWJI 4KN9S 4OA8A 5H4GA 1W94A 3K0SA 4WACA 5IDXA 1VYVA 4Y1RB 5JMOA 2J5XA 2P6UA 1LPNA 1L6IA 3BRSA 2V7VA 4DBLC 2VYNA 3RWMB 1SHTX 1W73A 1MOQA 1DBQA 2HMSA 3P0IA 5KYNA 4G81A 1ZNZA 1U5AA 4DBVO 3OLYA 1UWLA 4C14A 3TG2A 4WXHA 4B2IA 1KNQA 4XSVA 5TMDA 2A6PA 2QSUA 1XDSA 2V1UA 4LMBA 1GRQA 4E4TA 1RC0A 1RZ3A 1ZESA 2NXJA 3FB4A 1XA4A 1SD5A 4E21A 2YH2A 4L27A 3VYSB 5KNCH 1VE5A 2MSLA 1E9BA 3BTVA 2ASVA 5H16A 4B84A 2O8CA 1PV2A 4IJ6A 5K8UA 3VNQA 1QHIA 5L7TA 1ZY2A 4Q4JB 3B1FA 5EIBC 1MO2A 3BH6A 3IVRA 4S1OA 4ESHA 2ZJFA 1ENOA 3NH6A 2Q3CA 1RXWA 2HRBA 4IHJB 5JS6A 4P0PB 3D4PA 3ZEIA 2R1ZA 3OPVA 2QT1A 5HTKA 2AI3A 4C0HA 3QOWA 1DTEA 4GL2A 1M7HA 2XR1A 3PQ8A 1D0VA 4CMCA 1RW4A 2PFSA 2G36A 3LHKA 4Q6BA 2A35A 2N3ZA 4TKUB 1TO1E 4R0MA 1II8A 2ZIFA 1EJ2A 1AZLA 4N3AA 1AQJA 2WD7B 1LW6E 2JFNA 3CF0A 1JBQA 1ZWKA 3ZNOA 4JUBA 2Z43A 4HMOA 4XYEA 2WFZA 1Y8RA 2H48A 1SBQA 3HB7A 2Q29A 2WJIA 3IA2A 1XCBA 4MDYA 4X1KB 4N41A 5FWYB 1A5TA 5FYQA 4JI2B 3RS0A 4LV6A 1TJ3A 3OZUA 4RCYA 1ENYA 3O2QB 1Q3HA 5IG2A 5BNFA 1ZJ4A 4JI5B 1EFVA 1FFXA 4FHGA 4PNPA 3K6KA 4ZT7A 5A5EA 4LJSA 3PLAE 3R7WA 3HEMA 2CC2A 5EXTA 2Q6TA 1U0GA 2AQHA 1Z6QA 3IQGX 4ROSA 1F7UA 2I4MA 4CV1A 1XLVA 2GETA 4DCJA 1XXLA 2CNNA 3R9IA 4E5PA 3I5YA 4P22A 3R7LA 1PV1A 3OZSA 1EWQA 3WTBA 4JXKA 1DB3A 2GESA 4J0IA 3TTSA 2P11A 1H2BA 3EQ2A 2ZUTA 2IA5A 3HYNA 1QO7A 1S2MA 4I1UA 3A25A 3A36A 3ROZA 1H2FA 5CITA 4XX0A 5IVPA 3RIGA 4KQKA 2V03A 4FCWA 3KYBA 4E2XA 4Q3CA 1FZTA 3SN6A 3NTVA 2WSLA 2GZHA 3B38A 4OQNA 5LYJA 2PYZA 3OESA 1R3UA 5GADl 5D3MB 1SOAA 4MHSA 4ES6A 2GZRA 1RCUA 5LQSA 5JNSA 4UZEA 4C4TA 2XWPA 4YV0A 2YDXA 3QFHA 2GFQA 1HLGA 4GMGA 4Z8YA 3SBXA 1LA2A 4ECEA 4HEHA 4UOEA 1W36D 1CLUA 1P6UA 3KVYA 2I2DA 3SY8A 2AKAB 3WJ1A 1HKUA 4UFPA 3PEUA 5GJWC 3W3AD 2AMYA 3EC2A 1NLUA 1VRVA 2W11A 4PHCA 2QV7A 2PL3A 3PF8A 4ODIA 4IG4A 2VPZA 3E9CA 1P4AA 1BMFA 1AKYA 2JCGA 4HLUA 1Y8QB 3MXOA 5KTNA 4A8JB 2ZSIA 4DEXA 3BMXA 2CT8A 3E9ZA 5HA5A 3PA6A 2XUQA 4GNRA 1I7LA 4WGGA 2QN8A 3I28A 3BK1A 4M0LA 1VSUA 1PG2A 1IAQA 5FWYA 1P0CA 1ZG3A 3QBDA 5CLJA 4B6GA 5LDGA 2ZRJA 2ZTVA 1ZDMA 2KLHA 3MN1A 4UPDA 3A37A 3UUWA 5JYBA 2X2OA 1BU8A 2X8JA 3LX8A 4PX9A 1KRXA 1YBHA 3LGSA 5K0FA 4JI0B 2XYPA 1EHIA 4HFJA 3HYCA 1YNOA 5D87A 4MINA 1T5LA 1PR5A 4DIOA 4U2FA 4YRQA 2ZJ7A 2O2SA 3IKMB 5DHRA 5K3SA 4YTEA 3D5TA 5AI4A 3DV0A 3I6IA 1YULA 1WDKA 1WIWA 1N7GA 3C74A 4U0JA 1GFWA 2PU5A 2HKIA 1ZOOA 3NPMA 2ZRNA 5T6MA 4F2PA 3K70B 3PXEA 2PUBA 1Q6YA 1N0VC 2DR3A 4LK3A 3RVPA 3ZBQA 1ZK3A 2DRIA 1QTRA 4KQCA 3ERCA 1SCIA 4XLZA 2P8SA 1ZD2P 3IB6A 5E4JA 4CEIA 1M72A 3T7JA 4B4UA 1EESA 2EHDA 4DMRA 4KUHA 1YZNA 1CUJA 3PC8C 2C4MA 1JEOA 3URMA 3NT5A 3E61A 5JMTA 1X7WA 1U5BA 1Z5UA 3CLVA 4WIAA 3WZMA 4E1AA 4UTXA 4ND4A 4ZIRA 2PT9A 1N2ZA 1DRUA 2I6SA 2JA2A 2Q21A 4MS4B 3VZSA 5EJ8A 3GFPA 5KBYA 2Q6KA 2G1PA 4JJ4A 4OMFG 3X1JA 4JFAA 2J0VA 1G3IA 4B5KA 3J7AC 3AJDA 4Z4HA 4LK2A 1SK8A 2VC2B 2FZWA 1VKOA 4UPEA 3DUWA 5DIZA 4YO7A 1F9EA 3IVCA 3GVIA 4I50B 1KOFA 3HU5A 1O95A 2C5LA 2QE7A 1HUQA 1PVVA 4Q02A 5A5GA 1DADA 1GL7A 3I12A 1I6MA 1P19A 1VCHA 2OD9A 5CFOA 2INGX 3I9V1 5JS2A 2QVBA 3CEJA 4PE5B 4DR7B 4EGFA 4FM9A 2JNWA 1EFPA 5TNXA 2XCTB 5CTJA 3I5XA 5TV2A 4ALNA 1ESCA 2DCMA 3N8DA 3ZVRA 3TN7A 4LF6B 2UXBB 4G4JA 3W0LB 1X9GA 4O4JA 1EUYA 3WYDA 2V55B 1YFKA 1W85B 4XGKA 5K8VA 4YJ2A 3OETA 4M8NE 1R8XA 1S02A 1SVNA 2OBYA 3DO6A 1L9XA 5EERA 4KHPB 2XAAA 2X6RA 1B93A 1YR3A 2R79A 3AOGA 1RZUA 4WK6A 4HVLA 1BN6A 1EAYA 5CJPA 3C3YA 2E85A 1ABFA 1L4YA 1T8RA 4GPZA 1QCCA 1Z28A 4EOGA 4CETA 3E0XA 3KSMA 3KXDA 4HXGA 1QCDA 3ABIA 3H6GA 1J8DA 2ZJZA 1YBAA 2ODPA 2ZYHA 2OXTA 2NU8B 3UCEA 2R5FA 4C04A 2CV0A 1QGUA 2WHYA 2BTQB 4BJ3A 4BWVA 4NATA 1Q0PA 5FA8A 4F97A 2QRMA 4E2YA 1CEXA 1UC4B 5BVHB 1LI7A 2E89A 2CY0A 4EQ6A 1BWQA 3R7AA 1JU9A 4DIFA 4A16A 2V7XA 3MSXA 5CIWA 4IH9A 3ZWPA 4ZZ3A 2FW7A 2JHAA 2ZUWA 3MGCA 4FZJA 3WKEA 1UPCA 4D3ZA 4DJ5X 2NZXA 1RJEA 1FLAA 5JOQA 1G55A 3KWLA 1B6RA 1F4VA 4R9RA 2GGSA 7YASA 3M6XA 1VMDA 2F3SA 2QVLA 3TTTA 1KEPA 4IIGA 1TRKA 2DAPA 2I2AA 4N40A 5FYDA 3LA6A 5LP6B 2OQVA 3BMCA 3ESCA 5IKOA 3TZLA 3ZDCA 3PUZA 4RNDB 4CF6A 3ORQA 3WP0A 1KSFX 2Z58A 5TPZA 3IO3A 4O63O 5GIOE 2R2GA 2I3DA 2PLFA 3QRWA 5ECDA 1PIWA 2QUHA 3FTNA 2XNKA 3TINA 3NHPA 3C7TA 4EJ6A 3THWB 1BFDA 3KYDA 4I46A 2VAVA 3FTDA 3KV1A 1WWKA 3FZEA 4RJJA 4GHWA 3I58A 1OGIA 4B17A 4RXMA 4DA7A 2V7QD 2PK3A 3K4PA 1VG8A 1ZZGA 4LRQA 3UAVA 4D4KA 5CYGA 1JYFA 3IPLA 4H6VA 3ZEAA 1NQAO 5JXWA 1PNOA 1EXDA 1FVXA 4UULA 3S7TA 4CKBA 4G4IA 1QMGA 1U63A 2QAGA 1B73A 4X92A 1JPUA 5CLHA 3M9XA 2RCYA 3WO0A 3SXUB 5JASA 2QIOA 1X19A 1NY5A 4DJEC 1UM9B 5JANA 4M7OA 3W9SA 1DCMA 3QVMA 1XEWY 4RJKA 1Q0LA 4JMLA 3SZUA 2NP6A 2NUAA 3G7UA 1YHYA 3PHBE 4G9BA 4Q21A 4TKZA 3QU5A 3T5CA 1H9CA 2VTEA 4PZAA 2I6UA 4H08A 4MQEA 3C6ZA 1TJPB 3CSDA 1DKOA 3IPYA 3L0ZA 4LRYA 3RQSA 3V2GA 4QBIA 2M6RA 2PD3A 1FK8A 4B6JA 1ZD9A 2OO5C 5G02A 2Y1EA 4G8JA 2BC9A 3U3KA 3BL6A 1STOA 3FF4A 3NIDB 2QQEA 3Q11A 3VDXA 4IICA 2P3OA 1OSNA 2Q3DA 2QTFA 4U2GA 1K97A 4BVJA 1I7SB 2YJNA 2LV8A 3E7FA 1LSOA 2NACA 1OI3A 4BTLA 5KB3A 1C2YA 4OJNA 1ZIOA 4AUKA 3U4QB 2VNIA 4JROA 3PL1A 1K88A 1K3FA 2B3TA 2H06A 2XD9A 3LHDA 2H17A 4IAOA 1N1DA 4M0DA 3VR5D 1XZPA 1OLXB 4IEEA 1GTL1 1XZGA 4XLTA 2EIXA 3GYGA 1EVQA 5L53A 4I55B 1K3UB 4ARSA 1E9CA 1FY2A 5LD2C 2ERCA 1SKAA 2A5YB 2QLBA 1KC1A 4MMYB 1W93A 5EUQB 1HRKA 1VBFA 1U9CA 3HNOA 3RIEA 4S0ZA 4EW2A 2F55A 1G5RA 2ATCA 1Y6ZA 3L77A 5T7BA 1ORHA 1TM2A 1Q0UA 1VBKA 2QYHA 5ITZB 1WD7A 3MW8A 4PYOA 5NLLA 4ANFA 1SXPA 2F2TA 4BGEA 1NDQA 4IVPA 3UC5A 4KGZA 1CQJB 5HMLA 3TTWA 4AJIA 2L0XA 1HEUA 1BHSA 1CULC 1GCGA 4RK7A 1SC6A 3P71T 1KSGA 3UBTA 3C41J 5BYJA 2EWWA 2QU7A 2ZRBA 3GLHA 4NMXB 4A6EA 2RAUA 5C5CA 1R4AA 4WTOA 3RSCA 5BWCA 3WK8A 4FT2A 5A3VA 1IXSB 4K05A 3SX0A 3WHPA 2X0NA 2BFAA 1IJEA 4NESA 3VU9A 4TWAA 4CHTA 3H97A 5CA1B 3VBEA 2J45A 3SNHA 4MIYA 3OPYB 1FFCA 2ZS9A 2YCBA 2Y76A 3FTQA 1KO5A 1UBLS 3CUKA 2ZYSA 4FWIB 2HU2A 4KAXA 1KZHA 4AKSA 4B33A 2NXCA 3OFND 3L8ZA 5DX8A 4AP5A 1FP7A 5FLYA 4K6FA 4UM7A 2HCBA 1J9GA 2ACVA 5I3ZA 4FFLA 5JVDF 2PXAA 4G0PA 1VLMA 3U40A 2VJQA 1HX7A 3P2IA 1K8ZB 3FDXA 2RCNA 2EARA 2W93A 3MINA 2HRCA 4L6AA 4QPPA 1D3AA 3RHTA 1W4CA 3ZU2A 4UQLA 4D1YA 5LXTB 3OQVA 4GOLD 4IDAA 1F8YA 3ZCPA 3JTMA 1C8VB 1WMSA 1V37A 3LUDA 5JNWA 2XMSA 1D1PA 2ZSKA 3LD9A 1B3RA 4BFZA 1SBIA 2I1VB 4TYMA 1QTQA 4MHOA 4M3NA 4IDBA 3JYOA 2GSWA 4I1VA 4FONA 3DZIA 4Y6SA 1IUKA 1US8B 2D54A 4Y67A 2G4LA 1KZ9A 3W05A 2C98A 3EUWA 3N75A 5LU8A 3WMRA 4DDHA 4LXUA 1W44A 3O31A 3DEIA 3K8QA 5ILGA 5FD8A 5IYZF 1SEPA 3ZHCA 1U4NA 1YJAA 2IYTA 3HS3A 3FTFA 5FPQA 2PBFA 1TCBA 3TLAA 4HCJA 1K0UA 2ZYGA 4MTCA 2BGIA 4MMZB 1WXQA 2YMMA 2JLZA 3A4NA 4RH3A 4BB5A 4CM7A 1XDZA 2XCIA 1GPLA 5EXSA 5FADA 3VU3A 2WABA 3N2KA 4ZC8A 2BJWA 1R8JA 3FUTA 3SWWA 4LNHA 5B6PA 1TNDA 3PE6A 4JVOA 1MKYA 1E3TA 2BIFA 4DUGD 1RAFA 4K88A 4CL3A 1KDRA 2ZAOA 3CNHA 1FVOA 4E5VA 2OO7A 3VNBA 3JWJA 1KY3A 1UXKA 5E38A 2Z2XA 4S12A 3KQTA 1CZHA 3OPYA 1IL0A 1GGVA 5HFAA 3I9MA 3HO6A 2Z3VA 5EJ9A 3OTOB 1DX4A 1O08A 3TEMA 2HMTA 4H3KB 1IBMB 3LIIA 4IFBA 1OREA 1YHZA 2V5VA 2W9XA 3FYHA 3M1LA 4JLUA 1Z4LA 4W9NC 4MA0A 4FCCA 3ZHZA 2B9EA 3A1WA 1OLUA 2CLIB 1CUAA 3TOSA 1ZCBA 1H69A 4R2WA 3O2SB 2WWXA 1X7DA 4NXNB 2Y1XA 5TS3A 4IZ6A 2C3YA 3HFGA 3Q0TA 3DWGA 5IEBA 1WXFA 5T64A 5KJ6A 2DFVA 2HRZA 1GTVA 3QUSA 3P5BA 2I4NA 5F5XA 4ZVKA 3HJGA 4RTJA 2G5CA 1O5IA 1YZGA 2VDUE 1CQWA 2YC4C 1REQA 4OG2A 1O4VA 3MTGA 4BAUA 1Y1TA 2C96A 2CE7A 2QM7A 3DF7A 4F96A 1GL9B 1PUXA 2BHSA 1NM5C 1US8A 2FP4A 2M32A 2VRCA 3GGCA 4M1MA 4Q4HA 1JB9A 1E1CA 2BKUA 3E27A 1XFDA 5EWLB 1TLFA 1EINA 3PS9A 4RK6A 1NHGA 1T3GA 3ZIAD 5LWQA 2V97A 1TX4B 1ZI8A 4FSDA 4EG8A 4Q3DA 2B5OA 4Y0AA 1ZU5A 1N33B 1A96A 3CHYA 2ZS8A 2IWRA 3VPCA 1F06A 1UKCA 2YOGA 3GJ0A 2EJVA 4MRRA 4DLSA 5LP1A 1I1NA 1MEEA 1GTMA 3NWJA 1U3VA 2Q8NA 3L7DA 1NJ6A 2BGJA 2KM1A 4RFLA 1GKKA 3ETNA 4JLAA 4JJAA 4E13A 5K6RA 1FTNA 2ZRHA 1XZ8A 3N0TA 1SY7A 5B64A 1VLHA 4RFSB 4PO8A 3KFXA 1W5TA 3ZDQA 2N47A 4ON9A 4L4YA 4TROA 3RS7A 5L4NA 2OLKA 1J49A 1ESNA 3M2TA 1BXZA 3PYLA 3ZK8A 5KX5A 4KQXA 3TFQA 2Y0CA 3DTTA 1GL3A 3IT0A 1M34E 1Q0HA 4WKGA 3K32A 1SWWA 2CXNA 1OA0A 3L05A 3URKA 2GERA 2WAAA 3FPLA 4QOJA 3OD1A 1OFGA 4CIAA 3QHQA 5BORA 3W5BA 1H4TA 1KQ3A 2WYVA 4G0XA 3DEKA 1VIYA 2AV6A 1GRRA 1RJWA 2I6FA 4RCVA 1P75A 2QJOA 3ZVKA 2W2QA 4M0MA 3PC8A 1T3SA 2DPYA 1IU9A 4OXNA 1JG6A 1WTCA 2XJ4A 1YOVB 5FPTA 1SUDA 2QHXA 3CF4A 3OOEA 1NVDA 4RH0A 4X8HA 3HCEA 1K4KA 4IJKA 5BY2A 3LQ1A 3A4TA 5EJIA 4F6LA 3MJRA 1TB4A 2P27A 1E2BA 4G26A 4KO8A 2ACEA 3L84A 1Z36A 2CE2X 1HFWA 3MWDB 4OREX 4DR2B 1ZICA 1AGNA 3ROMA 3W5UA 2SKEA 5GONF 2PGJA 3OIYA 3HWRA 2R96A 1ESMA 1NGSA 3IP3A 4NNOA 4EELA 4GEKA 2CCKA 1GNPA 1YDWA 2H52A 3Q8WA 4C08A 3R74A 1GU1A 2WVHA 1D5WA 4BMDA 2XWQA 3ZBPA 3DDNA 3SS9X 2MOKA 1KFBB 4XB1A 3R0VA 1BD4A 4DV2B 5DDIP 1CZRA 1NXXA 3I4FA 1MR3F 3LRPA 3QW2A 2O06A 1CKEA 1RWBA 3AFOA 1TIPA 3RYTC 3C3AA 3D3EA 2M9MA 3AHHA 1LD3A 3TKAA 1RQLA 2ZIXB 3C7AA 3NV7A 4G6ZA 3I0MA 1KZ4A 1Q57A 2DP4E 3G23A 4I9UA 3HU3A 2PUGA 2WUWE 1Z7GA 2I6XA 3GFQA 3ZX5A 2CNWD 4AJ2A 4B3XA 3Q10A 3EG9B 4F0JA 4HWGA 1I2ZA 1ZGJA 3RSFA 5AVTA 5ALIA 4D02A 4HN2A 1KZYC 4G9EA 3TM4A 1P2GA 3GZNA 1RAEA 5DBFA 3UH1A 2C2GA 3BTUA 2QUBA 2PS9A 4MWGA 1V5FA 2W2KA 1IOVA 3PYMA 4IDFA 4R0NA 3WFJA 4DNXA 3V32A 3SXPA 4DHEA 5ALGA 2CXRA 4PSDA 2FWJA 1OIWA 3DTVB 2Z2KA 3EA0A 3RE1A 2F8LA 4FZRA 2OQRA 4RVSA 1KSHA 1U2EA 1UK7A 1P7VA 4GP9A 1YQTA 5DB4A 1O0SA 2VYQA 1ONSA 1O87A 1Z45A 3L7BA 1DMRA 2Z4TA 5F3RA 4AXBA 2YXBA 3UG7A 2FZ4A 3KLPX 2YZ7A 1UFQA 2Q49A 3U62A 1S01A 4Q12A 1WG8A 5DRYA 3HXMA 1E99A 5JFGA 1VCNA 3IE2A 3IAS1 5ER6A 4B32A 3Q1KA 4YDHB 1OHHA 1TZKA 2ACKA 4QWWA 4XWTA 3ZIUA 1FX0B 4DBZA 2ZYTX 3F3YA 4M4SA 1ISFA 5FTMA 3PDIA 1IN4A 1KMNA 3M89A 4D4IA 3VKGA 1HKHA 4Z51A 1L5YA 4PRZA 1TQ4A 4UOQA 3I30X 4YP0A 4DE5A 1A7AA 2PVSA 2QX7A 5EYPA 2RE8A 2ZREA 3G8YA 3R8FA 4KUEA 2CMGA 4PY2A 3QIVA 3LA8A 3E3NA 4PS1A 4OOEA 3ZZTA 1KJWA 5EI5A 5HOEA 4WXYB 3PDCA 3UFBA 3U17A 2Z1MA 3W7BA 5LFAA 1OPRA 4D79A 2B2NA 1FXUA 3DDSA 1WLYA 2Q9UA 4OJMX 5AKXA 2IHTA 3K94A 2HU8A 3PUKA 2KWIA 5AI9A 3SQWA 4DREA 1FNNA 2VUHB 3DBLB 2X3YA 5HKKD 1R00A 2AXEA 3I1YA 2PD6A 1FS6A 4OHMA 2H0QA 5A9RA 1EDZA 2C04A 3P9SA 2ZBRA 4JL8A 1K8YB 3LTNC 1UOQA 1W4BA 4MR8B 3CIFA 3P9PA 1GNTA 3S2GA 4E14A 4UBJA 3CZAA 2QPAA 3QEOA 2OO5A 2EKPA 2R6GA 4KPUA 4W6ZA 2GZDA 4C0LA 4LJLA 4X8OA 1YK0A 3FCYA 2JD2A 3JQEA 5DLYA 1I7QB 4LY9A 3G8AA 1H5NA 5F2OA 2GYUA 3KSRA 1OI4A 1LNZA 2FDXA 4B73A 3F47A 4W7IA 1A9XB 4NYJQ 5BP7A 2H85A 4R31A 4DZZA 1K6MA 1ML3A 2JAWA 1ZZEA 3BFPA 3BG5A 2NT3A 1JEYB 1I8TA 2JFGA 1PL6A 4HY3A 2RGXA 1AB5A 1C1XA 2KS6A 3C85A 1U0HC 4L4RA 2AOVA 2OILA 1KI2A 3TPCA 3U3XA 4D42A 3PNPA 3QFTA 4KNYA 3COJA 2CBXA 1OMOA 1F7VA 3SQNA 4D96A 3EFEA 1N34B 4ZZ1A 3ZD6A 2L19A 2X5NA 4O0MA 2NIPA 3KHUA 3DHEA 5E9QA 3CGGA 4IIVA 4E07A 1MXHA 1SOWA 1OB2A 2O6HA 1QGYA 4UTNA 5JQGB 5CIQA 1G1MA 1ZN2A 1FX0A 2QG4A 2BGNA 4OHRA 2NXNA 4F7WA 3LMKA 4XUDA 5BW4A 5DSXA 5C5EA 4MCJA 3F7TA 1W59A 5FEUA 1Q2XA 3K5IA 2JFHA 3R20A 4X97A 2R2AA 1QB8A 4DDUA 2NAFA 4M7WA 1V6SA 1EB8A 2XUFA 3CF6R 5JDCC 3NATA 3K9WA 2ZYUX 4UXIA 4R1NA 2R7MA 4CRWB 1FTYA 1TEHA 1BA3A 4AJEA 1PWYE 4E4RA 1W36C 1G18A 1IOLA 1YV9A 1M2FA 3A1TA 4HDMB 5LMUB 1RRVA 3UA4A 3OOSA 3HM2A 4FCVA 3R9XB 1YD7A 3ZGXA 1T5SA 1UINA 1IJKA 1WHTA 2F3PA 1T0JB 2EW2A 2O7SA 1E9DA 2R4UA 3AIIA 2FXIA 3DG9A 3G0IA 4JK3A 4OKNA 4MRMA 2OA0A 1GA1A 1G19A 1TVEA 3K9LA 4I3FA 3OMLA 1N2JA 3ONNA 5DSTA 2UUBB 1M2EA 3GRYA 4JLKA 5FL7D 2P1ZA 2Z04A 3UCFA 1QX3A 3AKYA 1TXGA 4UQOA 1PYOA 2PWBA 1YI0A 4FEGA 1A9TA 3L93A 3GOHA 4KWTA 1KSJA 5F52A 2AQ8A 3LQKA 1L7QA 2C4NA 3CH4B 3HBMA 2BONA 4O2AB 3V4FA 3H6KA 1OUMA 3DGEC 4TL9A 2GWHA 2QTZA 4MLDA 3NTOA 4CNBA 4CEJA 2OBBA 4Z4QA 1UPXA 3OUUA 1IH8A 3C0KA 3VAYA 2QVXX 4IO1A 1WR8A 4BRUA 4C7VA 3OSUA 3C87A 3V1TC 1RXEA 4E30A 4NEGA 2V7EA 1KBQA 5AMXA 2JF0A 3S29A 1BYIA 2PRIA 3LOUA 4M83A 1GNSA 1WKVA 4MWDA 3AJ8A 2VXOA 2DWQA 5CIYA 1Y37A 4B8YA 3SF8A 5IS2A 3VDNB 1CUEA 3HZZA 3WIOA 1NE7A 3A9WA 4P4SB 4Q1EA 5FXMA 4FEEA 4IM7A 2AMLA 2GJ4A 3FGNA 4NS4A 2WHXA 5C8YA 4WBNF 4L28A 2IS1A 1KYIA 3LUGA 3DZKA 4TKVB 1GPUA 1V3TA 2AUMA 2FGKA 4C0XA 1HYBA 3DB1A 4DMHA 3G5TA 4UTOA 1NIJA 2J0EA 3NHWA 4FHFA 4IGEA 4XM0A 5E9WA 3VO1A 4C7XA 5A4DA 1TT5A 3IKVA 4JSRA 2OV2A 1XC7A 1L7OA 4NQZA 3ZUPA 3RFFA 1X7ZA 5AR1A 3R23A 4AMGA 4L5CA 3OD5A 3I9FA 1X0XA 4NBKA 1AS0A 3F6YA 8ATCA 4FE4A 3TSCA 1B8OA 4D2IA 1OCEA 3L4EA 5G0UA 1YHNA 5GOTA 3TLGB 3THXB 3WJAA 4Z9XA 1HLPA 4BNDA 4LAFA 1E7SA 5TC4A 1WA5A 3HABA 5M04A 2XQFA 2QRHA 3AM5A 2EF0A 4TPKA 1LJLA 1XQ1A 4E88A 3NHLA 1ODTC 4YCJA 2EEZA 3R41A 3QKWA 4N0QA 4WCFA 2O1SA 1RR6A 2HF2A 1YBFA 2O7RA 1RM3A 1XL0A 3CKKA 5EIFA 5K0NA 5M29A 1FRVA 4F56A 4F84A 3DCIA 3ANLA 3VR6A 2I65A 1PT7A 2AUTA 4G8CA 2H1IA 5SY6A 3NBFA 4ENVA 3ABSB 1DI0A 1IJBA 1ORRA 1OV6A 4QDTA 2DR2A 1E5LA 4OAOA 4BNJA 1Z29A 4L9RA 3SZOA 3PEFA 4N3CA 1YIOA 2XNDD 4W9NA 1LPPA 1OFHA 3KTFA 3H2JA 4O2AA 5CH8A 4KHZA 5DCUA 2X86A 1Z4JA 2XE6A 4WJZA 5AIBA 2CGEA 2CJPA 3DDOA 5DIFA 4E22A 3BGWA 4YP1A 3LCJA 4O1HA 3COSA 2PZAA 3CU5A 3KLMX 3G2HA 1GARA 1KFJB 1KI7A 1HSZA 2Y68A 2ZR0A 2O5CA 2YC2C 1Z37A 2XOXA 4LVCA 3H9CA 1IBCA 1XMQB 2QMEA 2CZQA 1YAHA 1UFRA 2PKYX 2MCFA 3BDAA 1G5TA 3G49A 5F2KA 2FUNB 2ZVDA 3QF4A 1Z0JA 4Q9AA 5FOWA 3OQOA 1GL6A 4R6XA 4F38A 1KRWA 1DWPA 1NM5A 1J97A 4ALMA 3W8EA 3PGLA 1X1CA 3VX3A 3IBFA 3ET4A 3ON5A 4MV9A 3VPDA 1U1FA 1WSBA 3CH7A 1XZQA 3EQ9A 3VAZA 4C07A 1X80B 1NLZA 3BX1A 4AVYA 2NNWB 2P6OA 1V16B 3FNHA 4EY5A 1N7HA 4BQPA 4W9MC 3PIDA 1D7AA 4RLHA 3TAHA 3T3OA 2A94A 3OZGA 821PA 1F2UB 3B7PA 3LVRE 3U4AA 3UYLA 4LOJA 5CPFA 4IHAA 4N7BA 1Z0KA 2BFFA 2V0NA 1MQAA 2E6KA 3FFXA 3ZJ4A 4BO7A 4N4AA 1EXMA 2ZRAA 1L7EA 3IKJA 1ECPA 1JLRA 2GZMA 2D5CA 5CT6A 4H1WA 5BN5B 1RLOA 2HWUA 2R6R1 4FVTA 1ILWA 4FFNA 4Q24A 3AJEA 3UT5A 2EHJA 1KWGA 3PRYA 1SFRA 2YWDA 4MQLA 3C70A 2N1BA 1V26A 5EJAA 2WFAA 2OZLB 4LUCA 3ZY2A 2QBYA 1NBAA 4JASB 1E5TA 3PQDA 1VPVA 1TMOA 3PXCX 5COAA 1AURA 1JILA 3T3PB 4Z0HO 3ZU4A 2VNHA 3D6UA 4M6WB 1Q0QA 1FFWA 1FCJA 1CXZA 1RCTE 4P34A 1BQ3A 2XVXA 1N2CA 1AGRA 5ALJA 3SEZA 1Y1SA 1N75A 3D5EA 1CRZA 3D5QA 3NIBA 1BCSA 2CEAA 4OSEA 4EG4A 3Q98A 3LDGA 3ZHOA 4RIIA 5DYGA 2FP3A 3WRYC 4M9XA 2ZE8A 3CX8A 3DP7A 3RFUA 2ID9A 3D8RA 4KP7A 1V48A 2Q8PA 3DKPA 4PBRA 3A0RB 1RQ2A 2A78A 5C34B 1GPNA 1A9QA 1UAYA 1I32A 3WOHA 2BSAA 4JMPA 4BRZA 5I51A 5EGNA 2WD8A 3VC3A 3WGQA 1W49A 5JAIA 1CY7A 1RMTA 4R69A 3V97A 5KSZA 1KPHA 1T9CA 1KQOA 1MP0A 4ERNA 3AWDA 3X1WA 2YJGA 4PHGA 2DWUA 5DF1A 3RU3A 4EBBA 1D1SA 1F0KA 4QGFA 4RQTA 3LDAA 1BMQA 3ICVA 4X1YB 4UD2A 4YUWA 3FA2A 3DKVA 5JCPA 5CBPB 4J7XA 4P83A 2H1RA 3NC4A 4XJXA 3FSGD 2H2AA 2XI4A 5E2IA 1JYEA 1Q2UA 1YZTA 2I7XA 1YCFA 2ISQA 2JGFA 2GNAA 1UJ2A 1DDGA 4OQMA 2FZ5A 1H2AS 4GVXA 5JISA 5A0TA 2OBXA 2DQ4A 1L7AA 3C6YA 2XY4A 3K2BA 1ZH4A 3HDYA 2H6EA 2O20A 4UBOA 5HHTA 4ABTA 3DZDA 3SD7A 3AUKA 2G67A 3EGCA 3G5MA 4ZMSA 4ZXFA 3U7HB 2ZRIA 2OLJA 3WVNA 4OLHA 2ZYWX 4DYDA 1DJPA 3OMWA 2Q9BA 5BT9A 3UENA 5B1YA 5DLPA 3ZGLA 4C20A 4YXWD 1CF9A 1C1DB 1Q83A 1EEXB 3OOJA 4Y6OA 2RH8A 3QWIA 1EA5A 5LYJF 1QYDA 1T29A 1T5OA 3JD1A 4MLPA 1UXHA 5FPSA 4DCSA 4G5RA 3D8TA 1M54A 3GJRA 2HA7A 4GMKA 3MIZA 2I2CA 1EU1A 2QRLA 1L4MA 1Z33A 3WDSA 4UBLA 2DM6A 5DBIA 2OHFA 4BLUA 3QE3A 5TSDA 3L4JA 4HYEA 1TW2A 4Q3EA 2F9MA 3H1BA 1XVAA 2HB6A 1EJ6A 1W9HA 2BMEA 5FIUA 1VE7A 2P4HX 1VG9B 3F8TA 4ZQHA 3CUWA 1AS3A 2VNKA 4A9AA 3DSRA 3EIEA 1SXJD 4RTPA 3IGFA 1RLUA 2NTYC 1A7KA 3JQAB 4PM4A 2CL7X 1W5EA 3T61A 2OWEA 2YFQA 1J6UA 3QU9A 4K8OA 3LYHA 1EKXA 5TPWA 1I14A 1XVIA 5TEWA 1PX0A 4NI5A 4LFBB 4DJDC 1Z07A 3PX2A 4A0QA 2GYVA 3FJOA 1EUDB 2QUKA 3NTQA 4QYIB 2AEEA 3VHXB 1NVTA 5F2NA 1NBHA 1MPXA 4EUKA 5GZ6A 1EI9A 4Q4LA 3SJ7A 3NHJA 4C88A 4DV3B 3QSGA 3IUNA 4PQGA 1JKJA 1JJ7A 3ELDA 3HGMA 4TVSA 2AFIA 1D2GA 1NR5A 2ZVQX 3ND6A 3QELA 4CJXA 1W36B 3OFJA 1LRLA 1X87A 3TI7A 3ABRB 3GU3A 3HSKA 4GIBA 2PGDA 3Q2IA 1ZJJA 1VHTA 1Z0IA 2NO9A 1EP2B 2OAP1 3G88A 4QJ3A 2EQ5A 1W47A 2QENA 4RTNA 2XRFA 4JHXA 1T1GA 3ZLTA 3AEUA 3BILA 4RS4A 4LVOA 4ZCSA 4BIMA 1C7RA 2JFYA 3SDBA 3BRQA 2IPMA 4F5WA 4O2RA 1W87A 4NE2A 4AB1A 4KNWA 1ABBA 3W2TA 4U63A 3ZUGA 4Y1EA 5CB4A 2FSFA 1PJ8A 2YMLA 3HKEB 4MVJP 4YRKA 1XPUA 1BWPA 1W88B 2ESRA 2QMHA 2ZUSA 4UCXA 1A8SA 1WXDA 2P91A 3CNOA 4S2EA 1II9A 2A5GA 4TKMA 1Z12A 2Y05A 4F4DA 3NBKA 2ZATA 3QU4A 4FX2A 4HLCA 3JQGA 3I42A 3N2EA 6CHYA 3A3OA 2VBCA 3TZ6A 3TR0A 5HQ3A 3ZVMA 2LTAA 2UUAB 2D2IA 2YTZA 2FV8A 4BP3A 3R5KA 4K9KA 1CDEA 1MX3A 1YZFA 1FDUA 3G59A 3LDFA 3BEDA 5DV9A 1FP6A 4C0SA 1EG7A 4FW9A 3N7UA 4I9NA 5C53B 2CV1A 1SAYA 4R1TA 3TL2A 5EE0A 4N01A 1LTHR 1JJVA 1QFSA 1ZRSA 2QQ5A 1GQSA 1T8PA 5EE1A 3T38A 5GJBA 1YDEA 3RABA 5JJCA 5J2UB 5A6SB 3LQ4A 4MIEA 4M21A 1CUFA 3IDOA 2H65A 4X93A 4LZNA 4AG6A 2JAOA 3N07A 1QZTA 2FK7A 4O4HA 4U9IS 3SIRA 2C00A 1WW8A 4I7EA 2FF7A 1GADO 2NVOA 2H59A 2Z9CA 3L8YA 1I3LA 4J0HA 3ZYZA 4CW7A 3N0XA 5EOVA 5AW9A 2BCJQ 2AOTA 3A6ZA 1BOOA 1ADJA 2G88A 2AR7A 5H5JA