4X8LA

Crystal structure of e. coli adenylate kinase p177a mutant in complex with inhibitor ap5a
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
214
structure length
214
Chain Sequence
b'MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAALIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylate kinase
publication title Structural basis for catalytically restrictive dynamics of a high-energy enzyme state.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transferase
total genus 76
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4x8lA00
4PFSA 2J7PA 4N1AA 5FTKA 4A8JB 3K70C 2QMOA 2R6CA 4DSNA 4US2R 4A15A 4IHQA 4Z51A 1OHHA 3KXIA 5SZKB 1JEEA 4NBSA 1JR3A 4TYPA 4V0OA 1Z0KA 1VMAA 1E6CA 2QAGA 1KJZA 3K70D 2I1QA 4KBGA 1M7GA 4Q7MB 1F6BA 1RJ9B 5FTLA 4ZKEA 5IK2D 1TAGA 721PA 4LJ6A 1OIVA 1TQDA 2HF8A 1CR4A 2NG1A 4WA7A 2J41A 4G5GA 4PHTA 1ZYUA 1XJQA 4KODA 3TVTA 2WOJA 3PJRA 1KI6B 2P5SA 4A82A 5IT5A 3MJHA 1MRNA 1JPJA 1QHSA 1Y3AA 3CNLA 2G9NA 3TAUA 3LFUA 1KMHA 2FPLA 3EXAA 4RD2A 3RS4A 3ZDQA 1XEFA 3IIJA 1NVWQ 1XWIA 1HA3A 4CEHB 2QPAA 5C18A 2R62A 1FX0A 4B3FX 3FWYA 1T8TA 3M0EA 3QKUA 2HJVA 3B8HA 2GZHA 2ZE8A 3U3KA 1EFRD 2QRZA 3WHKA 3SC3A 4NP6A 1W4CA 1GG2A 4PQFA 3BD9A 2V7QA 3IGFA 3GJXC 4A8JA 1XTIA 4S2EA 4ZPXA 2Q3HA 1GIAA 2OBMA 2X8AA 3DM9B 2QBYB 1Q1QA 1R10A 3IBYA 1Q22A 4GOKA 2GCNA 3TNFA 4B3XA 5DYIA 3SEAA 2H57A 3T15A 2ZETA 4IDNA 1HE8B 1RJ9A 2V4ZA 4HDCA 2MMCA 3KZ1E 2ZYWX 2OBLA 3IILA 1MO6A 4FMCF 1ZUNB 3PCRB 4LYJA 2OFOA 3ZD6A 2OFXA 2JJ2D 1NMZA 4ITRC 3HP1A 1Q3HA 4KJZA 1WCV1 2RKOA 3RAPR 1KI6A 1BMFA 3A36A 4V03A 4LHVA 1U99A 4URXR 1KZGB 3BB1A 5UKDA 3TGPA 2NTYC 5DN6D 2O52A 3KB2A 4Z1MA 4M0LA 5BXQC 1ESNA 3NVAA 2C78A 1KI2A 1KI7A 1E94E 3ADKA 1QHHB 4PO9A 5AK0A 4DSOA 4CF7A 3LLUA 4LY6A 4A0FA 2GBLA 3P20A 4QJ5A 3WYGA 3FOZA 2YVUA 3GJ7A 4Z54A 2O8BB 3ASZA 2B8TA 3UIEA 2ZANA 3FMFA 4M9SA 2XZOA 2F1RA 4O25A 1IJEA 3G82C 2ZUBA 1E2GA 5G53C 3LW7A 4TLEA 5JWRA 1CJKC 3FMOB 2BM0A 4OQNA 2FOLA 4R9UC 5F98A 2QBYA 3TLXA 2FJUA 3WNBA 2IX3A 5FBQB 1A5TA 1JXOA 3QJYA 2EFGA 2GEUA 5EQTA 1WA5A 3PVSA 1A7JA 2FWRA 5LBIA 3CKLA 3DZ8A 4CT4B 2OCAA 2AFIE 3SI7A 3LX8A 1JB1A 1QVAA 4IVRA 5CIWA 2QQEA 1NLYA 1PJRA 1OFUX 1W2GA 1CJVC 2ERYA 2C98A 2ZREA 4LV5B 4QBFA 4NYIQ 3PEUA 1XTRA 2JJ1D 3PENA 1BYUA 2V7QD 3IBGA 4URYR 1E9EA 4IDHA 4PQRA 3FGNA 5FPTA 5LB4A 4CGZA 1XPUA 1XU4A 1QHHA 1S1CA 4ZI2A 1NI3A 2PEZA 3HU2A 2CHVA 3T35A 1JJVA 1V43A 4ILEA 4X8LA 2FFHA 4TZ0A 1G8GA 4DDWA 2WVJA 3W6NA 3TJZA 2CJWA 3QXCA 3AUYA 3M1IA 1S4QA 4LBWA 2R2AA 2IT1A 4NCHA 5F2EA 4MYUA 2ZR0A 3GFOA 2WJVA 1E1RA 1HT1E 2XTNA 4JL5A 5EE5B 4DLZA 2Z6VA 3W8NA 3DDCA 1MV5A 2NO9A 1EFCA 3A58B 4WZ6A 1W2HA 4NE2A 5J4KA 3J81k 4URUR 2PZFA 4A2PA 4HDQB 4FMCB 4ACBA 4US1R 4B3DA 1U81A 4HZUB 1HURA 3VR4A 4CZ2A 3C5HA 4ARZA 4EPTA 1KY2A 3AF2A 4TLCA 2ORVA 1RRGA 1BS1A 2AWNA 3AF4A 2QMHA 3C5CA 5FPSA 4E22A 5IDVA 2D2FA 2YOHA 1ZM2A 1NSTA 2B6HA 2VPPA 3OAAD 2C2HA 4QGFA 3F5FA 2FEOA 2ZJ5A 4OJKA 3V00A 4XSGA 1D6JA 1GUAA 4RCZA 1WRBA 1D2EA 3K0AB 4MH0R 4CW7A 3FTQA 3TSWA 4TMXA 2QL6A 3SJCA 3AP2A 1TMKA 4JZKA 4FWTA 2KI5A 2OHFA 2XSZD 4JL6A 2GHIA 3WBJA 5DO9A 1KSHA 2YWHA 3BOSA 3THOA 4UXJA 5GJWC 4DT1B 1NVVR 3U4QB 2F1JA 3BH6A 1AIPA 5LB2A 4UJ5A 3WHLA 1TF5A 3U7GA 1PUIA 4PHHA 4A2QA 1U98A 3A1UA 5AUPB 4CRWB 2RHDA 1G8PA 1KJWA 3RS0A 4D0NA 2WTUA 1CTQA 3O47A 2VP4A 3DMDA 3FMIA 4I1SA 2BMEA 3JZMA 2ODBA 3TK1A 4ZDIA 4F4IA 5JJIA 3KJGA 1U0LA 2F3TA 1EFHA 2A5FA 5DISB 4EFMA 2FFQA 2PCJA 4JVMA 4ASUA 2FSHA 1N6LA 1G18A 1FQJA 4HZUA 4ESHA 2IYQA 4WW0A 1DAHA 1YZKA 5KPDA 1ZW6A 1RW4A 3U7EB 5FPYA 2O8CB 3KKOA 4MKFA 4TSFA 1XD8A 4DLUA 4IXNA 1NMYA 3CPHA 1XPOA 3UMFA 3EASA 1YE8A 3VNVA 2B7CA 3LNCA 4W7SA 1UM8A 4BLPA 1AQYA 2NZ8A 5KDDA 4Z8YA 3UMRA 1UKZA 4ABYA 2ODEA 2NMVA 2C03A 3OEHA 3THWB 2GCOB 1SXJB 1VG9B 1A2KC 1MH1A 2GEVA 2VSFA 3TQFA 5A5GA 5ANRB 4JYCA 1CU1A 4HDOB 3K0AA 3EZ9A 1OIXA 4B2LA 1NLZA 4OQXA 1K8RA 3S1AB 1X86B 3OE7D 3TUIC 4R2IA 1DELA 3OF5A 4PC7A 4M1MA 1JAHA 4O0MA 2ZJBA 2QENA 4DT1A 3SS8A 2HJGA 3A1VA 3P4XA 3VHLB 1BIFA 3BORA 5GJVC 2WJIA 2PL3A 3LW8A 2JGNA 3TBKA 2IYRA 1N6KA 1HY3A 4GPTA 2V55B 4KXFB 4WVFA 5CB8A 1G5PA 1ZUHA 2C99A 3THXB 1KO4A 5GJBA 1L7VC 3RC3A 2VQSA 1JBKA 4NDZA 3UWOA 3DZDA 3FYHA 4XH9B 5FBVB 4LJYA 4KSCA 1G16A 1E3MA 3QUSA 3LBHA 2DWPA 3LVRE 2J87A 1A82A 1OFIA 1KNXA 1Q1BA 3GJ8A 4L9SA 5JRJA 4LC1A 2O8CA 4JLMA 2XOKD 5H8WA 2JASA 4YXWA 4YMVA 3AKYA 1G3RA 1G8YA 2PCLA 3TSOA 1N6PA 4I1OA 3U6KA 1XTSA 1OF1A 1W0KD 2ZRIA 5KHOC 4GL2A 3ZD7A 3THWA 2GCOA 1SXJA 5DIFA 3WMGA 1FQKA 5KYKA 2FGJA 2QI9C 1EFUA 3AVYA 4C0HA 1L8QA 1N25A 4IEIA 2C9YA 2J1LA 3S1AA 3P32A 1NSFA 4YMWA 4JLOA 1IONA 3SHWA 2WWWA 3AVWA 1U0JA 2A7QA 1X3SA 3FB4A 1TX4B 1N5IA 2HUPA 4CYMA 2IW3A 3K9GA 1VKJA 3Q8XB 2XTZA 4EJSB 5FBRB 1JXMA 2A9KA 3Q9LA 4UKDA 5EJEA 4QL3A 5H1YA 1KAOA 4LHWA 1A1VA 1TTTA 5JMTA 1KMQA 2J9RA 2JJ8A 3BFVA 1LF0A 4A9AA 2WAYA 2EFDB 1AJEA 5LD2C 2V3CC 4GDFA 4Q47A 1KJYA 2D7DA 5CDFE 4DDVA 2HCJB 2OO7A 3OFNA 4LJ7A 1TEXA 4PQYA 1DS6A 5FUVA 1UDXA 2ZPTX 1CR1A 4S35A 5J4HA 1JAIA 3AP1A 2EWVA 2C04A 2H16A 3A37A 3KXKA 3KKMA 5AJWA 1WBBA 3EA5A 2ZJAA 4L4UA 4Y0VA 4LBZA 4LV6A 3BRWD 1XEWX 2ZI6A 3N2EA 1U90A 1YQTA 3SZRA 2F3RA 1U94A 4LPKA 2QGNA 4A4DA 2AKYA 4BUJA 1RKBA 2W6IA 2ZI4A 4HUTA 2JATA 3HYRA 4JT2A 4UXHA 3HPRA 4L9WA 3VX4A 1OB2A 1Z0DA 3A8TA 2YKGA 1I4LD 2EU8A 2JLSA 3AKDA 3RS5A 2SHKA 1QHIA 5D3QA 1ZD9A 2CCGA 2DBYA 3RRYA 1W47A 4OBEA 5HZKA 1OH8A 4AI6A 1D2NA 2Q3MA 2W58A 3CRW1 4X8OA 2J46A 3DL0A 4GOXA 5JSZB 2R8RA 4F4CA 3GQBA 2OCBA 2F9LA 3NKVA 5CK4A 5AJXA 5HKKA 1CR2A 3SDZA 3RDPA 2ZYUX 3KL4A 1W36C 2RCNA 3NEJA 4LPSA 4I1UA 5FL3A 4YC7A 5LPNA 2WIBA 421PA 1U2RA 4Q1BA 4YXWD 5B30A 2BCJQ 3GJ0A 1Z07A 2WSMA 2IYUA 3IEUA 4B74A 1EESA 3GFTA 2ZRAA 5EP4A 1HQYE 1W7AA 1E2PA 1KZ7B 3W90A 4A0GA 1E79A 5AUQA 2BV3A 2HCBA 1ZNZA 2P0EA 3LXRA 3I32A 4LJAA 2JLVA 1AKEA 1P5ZB 4DLTA 1U9IC 2P3SA 2BVNA 2VTKA 1O3YA 2WKRA 4PZYA 3CH4B 3X1ZA 3PXGA 4LHZA 4D4LA 2BM1A 1RVDA 3K9LA 3L8ZA 1G5TA 2FGKA 3CO5A 5CB6A 1GL6A 4W5HA 3B9QA 2R65A 5JI3E 4P4TA 5EXPA 1FL9A 3BJIC 5CK5A 3RVBA 1YR6A 4FCVA 4BEJA 1R0ZA 5JSZA 3UPUA 4ZCMA 1E2EA 2GWHA 2O8DB 1F2TA 1SKYB 1ZD8A 3R8CA 1S96A 1GDDA 1VIYA 1W0JD 4MUBA 4AYTA 4KITB 2ZVPX 1DTSA 2FSIA 2GXSA 2IF2A 3B1VA 2ZRJA 3LDAA 3D7MA 3GFPA 3M6AA 3QKSB 3I4LA 1W5TA 4UQOA 4DXAA 2ZE6A 4HYYA 5JJKA 3ADBA 5E7JA 1U8AA 1UBFA 1OFTA 2F6RA 1MABB 5HTKA 2BKUA 1NN3A 3I5XA 1S9HA 1QHXA 1GM5A 1LS6A 3U61B 2ZUCA 1ZCBA 2PX0A 3MAAC 4QKQA 1GFIA 3VKGA 1WE2A 1GL7A 2VP2A 2NIPA 4UJ3A 3AVQA 4XD7A 5P21A 1CRQA 3K0CA 4LI0A 4RFSB 5JLJA 3IHWA 2CE7A 3X2SA 5CIQA 1Z0AA 4NCNA 4TMZA 3F0TA 4QBIA 4UNRA 2ZYTX 2OUKA 1CF4A 1B0UA 3AGPA 3W9YA 1E96A 4DCNA 3BS4A 4HAUA 4Q4LA 4B71A 2WJJA 4QJ3A 2G88A 3AF0A 4GMXA 2BBWA 3CONA 5C1BA 3AP3A 1VCMA 1NG9A 4MRPA 1ZNWA 2F55A 1OXTA 1OB5A 2C9OA 1IN5A 1G19A 2WM9B 1F5NA 3I73A 3L2OB 5E3HA 2HLDA 2ZI5A 1YRBA 3PV0A 5K8UA 4TT3D 4D80A 3A4MA 2IA5A 2CNWD 3B13B 1OH5A 1Z29A 2WZQA 1Q20A 2C5LA 2ORWA 4M1YA 1ZU4A 1GNPA 1HUQA 2WMOB 3DMNA 2BDTA 3KX2A 3QKSA 2XXAA 4H1UA 3AVTA 3I1FA 2QPOA 4GZLA 5G41A 2NPFA 2OEPA 1DARA 2AD5A 4PR0A 5HR5A 3N5CA 3T5DA 1XNJA 2GESA 1E2FA 1SVMA 1E32A 1M7BA 1ZCAA 1RPZA 4OK3A 3I5YA 1XMJA 1OFHA 5FUYA 3AVXA 2GF0A 4NU0A 3GLIE 4DCUA 1E0JA 1KY3A 4PPQA 4QC2A 4B47A 1JALA 1UJ2A 4MRNA 3AV0B 2CL6X 1FTSA 1GP2A 4RFSA 1GZSA 3C8UA 1G5RA 1X1RA 2Z43A 1DAEA 1OV4A 3BH7A 2Q21A 1CJMA 1IHUA 1KK3A 2GRJA 2RGNA 2ZSBA 3FFBA 4V0LA 4BLSA 4ZDWA 5BQ5A 2GJ9A 1VYTA 1E99A 3PEYA 2XTMA 3E2IA 2QRNA 4URZR 4Q5IA 1TUEA 1Q1EA 1II9A 1Z22A 2VP6A 5E95A 4BFTA 2DCUA 2AXNA 4IOLA 4Q9LA 2CCJA 1Z8FA 2DWQA 1X1SA 3FKSA 1W49A 3KFXA 5TV2A 3DKPA 1KIMA 4DLSA 2KBFA 4B73A 3QSYA 2OFWA 1E0SA 1IN7A 1UDWA 3CUEF 821PA 3AKCA 3RC8A 1SHZA 4I81A 2IC5A 4BFZA 4CDGA 1P4SA 4TTRA 3K0SA 2BEJA 1Z0IA 2FN4A 4UNPA 2DFNA 3QXSA 4QNMA 2ANBA 1P2SA 4PXAA 2JLZA 1HH4A 1EFTA 4IDQA 2WWFA 4TL7A 1IM2A 1ZVQA 4PC1A 4DB4A 1Z63A 4JLNA 4DVGA 4ZKDA 1NBMD 5FOVA 2H1LA 5FUXA 2XITA 4AD8A 2ZJOA 5KSYA 2IEZA 2PBRA 5FOXA 4DBLC 4M8NE 2BBTA 3TW4A 3VQTA 1CJUC 1F2UB 2ECKA 1WQ1R 2OV2A 5CJPA 4DIEA 4KU4A 1T3HA 3SYLA 4JT4A 1OH6A 4LX0A 5FUWA 1R8SA 1F3OA 3GEEA 3NBFA 3NEYA 1E9SA 3IQXA 3QEJA 2QE7A 4QHSA 4WBSA 3T5GA 1TADA 4DDTA 1HT2E 1P7CA 2NO7A 2RGNC 2YWGA 4HLUA 4LWZA 4Q02A 4AK9A 1DG1G 4B75A 5M04A 2HXYA 3BC1A 3FHTA 4GP7A 1DAKA 3RSOA 3TW8B 3KQUA 4PANA 2OILA 2Z4SA 1KI9A 1G17A 2R44A 3NBXX 4R71A 4XWKA 3THYB 2FG5A 3SOPA 3SR0A 2F43B 4CT5A 1PLLA 1VECA 4E5UA 2BIFA 1TQ6A 1GKIA 4DLYA 4DEYA 3MJRA 2AL7A 2AK2A 4FINA 1ZIOA 3RRZA 2XEXA 1JNYA 4XTRA 1EXMA 4I4LA 1UBGA 2JLXA 3QG5A 4MYHA 2YZ2A 4TN1A 3QF4B 4RZ2A 4EKDA 1PV4A 1E2QA 3VMFA 3AVVA 1DEKA 2J3EA 3BERA 1ZM9A 1P61B 5DSZA 1YHNA 5K8IA 4YDHB 3RSLA 1FW6A 1ZUIA 3FKSD 4E09A 2IEYA 2GVZC 2DR3A 3MFYA 3SN6A 5A4JA 2OXCA 2QTHA 5EE9A 4JLVA 4IOMA 3K09C 2BMDA 1HQCA 1F2UA 2GETA 2XAUA 2I1VB 3Q85A 4FCWA 5JBQA 5JZVA 3E1SA 1BOFA 1NKTA 2V8OA 4LJ5A 2XZLA 2D06A 4TLBA 2ZJZA 2WKPA 1M2OB 2JDID 4AURA 3EWAA 3AUXA 1FPMA 3RABA 1TPZA 2PX3A 3MLEA 3GLGE 2IS1A 1QHNA 3M4YA 1CRPA 1G8FA 1Z6YA 2LCFA 2PEYA 3NHBA 1G20E 2P5TB 5TMPA 2QT0A 4TL6A 3THYA 3NH6A 4ON9A 3DOFA 4HUQB 5J4VA 5KPJA 2ANCA 2O5VA 3KKNA 2ZEJA 3GD7A 5G3ZA 4F93B 3TUJC 4B3CA 1J90A 4KLZA 2VIIA 4N3NA 5FPKA 4XVQA 1X8JA 1XF9A 3NC1C 4FCTA 3QF4A 4EQ6B 2XNSA 3QKRB 1XRJA 4HLUC 2G0NA 2WMNB 4JSYA 4P4UA 2QAGC 3MCAA 2J7PD 1SHKA 1LNZA 3RRNA 3X1WA 4AKEA 2HYIC 3CX7A 1OHHD 5JS7A 2ZVQX 3GLFE 2O0JA 4CEHA 1JR3D 2RGCA 1V5WA 3IPYA 3O8BA 2XZPA 2PT7A 4AKHA 3BH0A 3OESA 4JVNA 4NKRA 5AUNB 4Q9IA 1P2VA 1UEIA 2ZYVX 1VCIA 2ZAOA 1R0YA 3NH9A 3EC2A 4CIDA 1KDPA 2OLKA 1UKVY 1MRSA 2H17A 3ZIAA 3PEVA 3Q7PA 3AM1A 2I3BA 4UNSA 1Z6TA 1JQJC 4KI0A 5TARA 2QMUA 1PUJA 3EIEA 4Q1EA 5DLQC 1P2TA 3IKJA 8OHMA 2WICA 4HAYA 1IQPA 3QPVA 3GP8A 4HUQA 1GITA 1Z08A 4DLVA 2WJHA 5FI1B 1I2MA 3LQQA 4Q9KA 2OXRA 4FXPA 1IAQA 2CCKA 4GFDA 4A8JC 1J7KA 3VR1A 4IFBA 1H8HA 1Z28A 5BN3A 3ZQJA 4B34A 4EQ6A 3QKRA 1XX6A 2VL7A 3KTAB 3BGWA 1G6OA 1CJTC 3QNUA 4MYTA 4NHOA 3O8DA 4PPGA 2WKQA 4HLDA 1DVRA 5AJVB 3ND9A 4JIMA 2ORIA 2KWIA 3BBPA 2CL0X 4P33A 4Q4AB 2FNAA 3U3RA 3AB3A 3WBKA 4TLDA 4C0QC 3L0SA 1NBME 5KSZA 1J70A 3AF1A 4BEBA 5SZIA 2O8BA 4QOSA 5DI9A 4JLJA 1FUKA 1JEDA 2J59A 4OHYA 1R2QA 3H86A 2G83A 3IDQA 4P32A 1G4UR 3TUZC 4DDUA 1TQ4A 1OKKA 4C2TA 2G77B 1BMFD 4RZUA 4WAUA 3E70C 1GILA 4Z1MD 1ZC4A 4UNQA 1VIAA 3AKEA 4ZIRB 3B85A 2GBLC 2GCPA 1OXVA 1Q3TA 2QPTA 3FHOA 2AX4A 4GBMA 5CJ2A 3UATA 1GSIA 4TMKA 2B21A 1DG3A 4CVNA 1GRQA 2Q0HA 1SKQA 4C0JA 3UXMA 4R7ZA 1JJ7A 5AWFC 3IIMA 5KDOA 2GXUA 3WP1B 1NLFA 4JLKA 1SVIA 1WMSA 3T06B 1RC8A 1XZPA 5F3WB 2RAPA 4DHEA 1X6VA 3B60A 2V54A 3KDSE 2RGBA 5IF9A 3VKHA 2ZS9A 3D6TB 3QI2A 4EFNA 3UG7A 1TUIA 3KTAA 1QF9A 2BBOA 3C4JA 4BGDA 5EE0A 2ASEA 1VTKA 3GLHE 4HB2A 4Q9JA 2VYFA 3NHAA 4Q4AA 2REBA 3A4LA 3ZIAD 5K8LA 5HPYB 3ADCA 4E03A 3P26A 1ZD1A 4JMPA 5KNDA 4O2LA 2H8KA 3A1TA 4RKEA 4F7WA 2ZJYA 4LUCA 1NY5A 1W44A 3VKWA 2JLRA 1AQUA 3ASYA 4ERNA 1LFDB 3VU9B 5J4LA 4LHYA 2Q9BA 3ONWA 4U00A 1E0AA 3SBDA 4PHGA 3CM0A 3HU3A 1IN6A 5BYKA 2Q9AA 2QUZA 3LXXA 2QROA 3QG1A 1OPXA 1ANKA 4GT1A 4HB3A 4DLRA 4ZIRA 4UNNA 4B6EA 4TMTA 4HAWA 1N6IA 4V02A 1NRJB 4ZCLA 2A5YB 2YC2C 4QG7A 3FKQA 3CH5A 1SQ5A 4M4SA 2FPKA 2R6DA 2VO1A 4Q00A 3DVLA 4URWR 3H1TA 3SJAA 2VP9A 5FFMA 4I1VA 2X2EA 1N0UA 4BZQA 5B58C 3LBIA 2QTVB 4C0LA 3FE2A 4RKFA 3EWSA 1W5SA 2PMDA 4IOKA 4MRSA 4Z8XA 4B3GA 1OYWA 3BWDD 3WMFA 3U5ZB 2B7BA 2FSFA 1E1RD 3K8YA 4PSAA 5FR1A 1PZNA 3GJ6A 4BWYA 2I4IA 5SZHB 5B64A 2ZI9A 2WJGA 5G40A 2ERXA 1E9AA 2PT5A 3DPUA 3K0EA 4C0KA 1OIWA 1Z6AA 1P9RA 1JQLB 4X8MA 3T1TA 4TYNA 3U4QA 1W36B 3IO3A 4UXIA 4KO8A 5DGXA 4AWXA 3SHFA 2BBSA 2W0SA 2FH5B 4QXAA 1SVLA 4TYYA 3DEFA 4KHZA 3VX3A 3X1DA 1Q0UA 4XVRA 3B2EA 5EUQB 3U3OA 1Z5ZA 4ZDJA 2GNOA 2UVQA 4KLNA 5EE1A 3IUYA 1C9KA 1IJFA 1E2MA 3O8CA 1MO3A 3RHFA 4BASA 4DWJA 2IS2A 2IYYA 3REGA 3A6PC 4D6PA 4Q18A 2B92A 3GJ4A 4DLXA 4C2UA 3CX6A 3GCGA 4NYIR 4POAA 1NVUQ 5A0FA 5FTNA 4LZZA 1P62B 5L8VA 4FIDA 3ZZTA 2C96A 4DCVA 4EPRA 5HE8A 2FV8A 3B1WA 1AS3A 2JAQA 4LHXA 3MD0A 5E4FA 2A5DA 3MUFA 3A1WA 1P6XA 4MGKR 4Q1AA 3KB1A 3V4RA 1T3LA 1DOAA 1KO7A 1N2CE 5JJLA 1E4YA 1E9RA 4EDHA 1N6OA 4LDJA 1Z6GA 2JCSA 2ZRBA 3CR7A 3IIKA 3QIAA 4ZDKA 1KNQA 3QVUA 3CBQA 2ZSAA 4GMDA 3PUVA 5L3SB 1PLKA 2OSBA 1N3BA 4D4KA 4G3XA 4YQFA 3IO5A 1RE0A 3FHCB 5D3MB 3RYTC 3BFXA 4MITA 4JBYA 2EFEB 4TL8A 4TTQA 4ASUD 2QORA 3CRQA 5CYOA 1IXRC 1VPLA 2VLIA 2MSEB 2WSSA 2E1RA 4Q7JB 1CXZA 3UMSA 2ZRPA 1EGAA 4JVSB 4TSFD 3EPKA 3K9NA 2CVFA 2KE5A 3WYFA 2ZROA 4IDPA 1ZU5A 2MSCB 1L4YA 2XGJA 4O3MA 4OI4A 3THXA 3EW9A 1K6MA 4JBXA 3U3JA 4RZXA 3VAAA 2AKAB 4B2PA 3K0FB 3OEHD 3QPWA 1J2JA 2CEAA 2V1XA 2IWRA 2IS4A 2ZXUA 1R5BA 1OJLA 4WIAA 1T0HB 3C41J 4EUNA 3CWQA 1M1YE 5E7IA 1AS2A 2QEQA 4JLAA 2FMXA 4GSYA 2UZ3A 4PC2A 3B6EA 4W5WA 2FZ4A 4BLRA 4L8GA 3LQRA 4Q1DA 3SQWA 3PUWA 3ZH9B 4HLCA 3IHLA 4AYXA 5JHHB 4M1KA 3OEEA 2K5UA 1ZBDA 3HYTA 4CEJB 5B2ZA 2HEIA 4J0QA 521PA 3LH5A 5L3SA 1RFLA 2N46A 2OM2A 2TMKA 4KBFA 1D5CA 1FTNA 5D3MA 1WBDA 1S0UA 3CZQA 2IYLD 1OXXK 2WHXA 3K53A 4OL0A 5GJCA 3RLFA 4M21A 1TU4A 2V1UA 4EJSA 1XB2A 2O0KA 1QG2A 5TXGA 4GNKA 5KUTA 1D8TA 1HEIA 1SXJC 2F1HA 2RHMA 3H4MA 3MWLA 4BE7B 3EPJA 5EP2A 3GLFB 2JLWA 3AVUA 2PLRA 2Q9CA 3PIRA 5CYPA 1OSNA 4QM6A 2IK8A 2JEOA 1XMSA 1EK0A 4IXMA 3KUCA 4RJLA 1SXJD 4IDOA 2P6NA 4M9XA 3W5IA 2XB4A 1ZNXA 4JKYA 1P75A 2Z5FA 1IY1A 1GKUB 4H1VA 2OCYC 3FDIA 4U02A 5LDDC 2IYTA 5FOSA 2Z83A 4GZMA 4V0KA 3CRMA 3NBZC 2D7CA 2DFTA 2LKCA 3CW2A 3F8TA 3FVQA 1R7RA 3CPEA 2W6JA 3TMKA 5TDHA 5KSOA 2XJ9A 3EG5A 2GILA 3NG1A 2BKEA 4JYBA 3DM5A 3V9PA 2CL7X 4EFLA 3CNNA 3ZZ0A 3NDBB 4AYWA 2BJWA 1IXSB 1J99A 1NKSA 4A0HA 1X8LA 4CEJA 3KQNA 4QHYA 4P4SB 1YZGA 2Q6TA 2CMKA 2FX3A 3OFND 3OZXA 3SE0A 3VR6A 2IUSA 1M74A 3HR8A 1OE0A 5J40A 3EAQA 2LWIA 4ACAA 4G5OA 4C3ZA 1S9DA 4PPFA 2ZRKA 4A36A 2VA8A 2NO6A 4LYAA 2W2TA 4DC9A 2EYQA 4R98A 1XP8A 3GMTA 3LBNA 2QQ0A 1NY6A 4F92B 2IL1A 3OIYA 3QBTA 1OT3A 1TF2A 1S2MA 3TKLA 2W6ID 1VYUA 2YYZA 3L0OA 4RSGA 1ESMA 3I3SR 1Q21A 1VCOA 4JVLA 4QBGB 4C30A 2G3YA 3JVUA 5JWOA 3K9HA 4JJZA 2EFCB 2YHSA 1AA9A 2IYWA 4W5JA 4B44A 4BFUA 4BLQA 1DBSA 1XMIA 4HSEA 4NONA 4URVR 1KDOA 1X8KA 1GAJA 2WWXA 1T5LA 1E2DA 3OEED 4D81A 3MMPA 3QY0A 4XWOA 1E69A 1GNRA 4EJSC 2G1JA 1FMJA 2N1BA 1G3MA 5HKKD 3U7HB 1DO2A 3SQXA 1R5OA 1ZP6A 3TAHA 4PAQA 4AG6A 4LBYA 2WPDA 4G5RA 3MWJA 4II7A 3QQ5A 4BLTA 3K70B 1G6HA 1YZUA 5H68A 2WV9A 4A92A 4P4SA 1TQ2A 4M1OA 3TR0A 2O8DA 5HZHA 1XDBA 1COWA 3N2IA 1Z0FA 4HLQB 4Q9HA 1E79D 1UEJA 4TLAA 2D3WA 2GK6A 3ZLJA 5JRZA 2IXEA 5CITA 2ZSDA 3EPLA 2WWHA 4Q4JB 3FFAA 2RB4A 3WMEA 3KJIA 1MABA 4PPNA 4TYWA 4RD4A 2DFLA 1T5IA 4BLOA 4CEIB 3MWKA 3GLHB 2IYZA 2V9PA 4R2HA 3R9IA 3RRMA 1EWQA 1GRNA 1RYFA 3UANA 2A78A 1YZLA 1G21E 3CRVA 3RWOA 2V6JA 5IHPA 3Q3JB 3CWZA 4KFSA 2PZEA 4RVCA 3F3YA 4H9GA 4JKIA 2XX3A 3B9PA 1XCPA 2J0SA 3R9WA 3KXLA 4Q4HB 1KI3A 1NG1A 1YKSA 1US8B 5FPHA 2ZQ5A 1AGPA 4XSHA 5AJZA 4TYQA 1FMLA 4NCJA 5FL7A 5IK2A 1L2TA 2J0QA 1CULC 3K0CC 5HCNA 3CF0A 2BEKA 3IPXA 4OHZA 3SYNA 3T1QA 3Q5DA 4MA4A 2VHTA 4B33A 4ESVA 4U7DA 4YONB 3I72A 4AKIA 1MOZA 4HI0E 4OKSA 2J5XA 3L0PA 4XD7D 4MQBA 4TTPA 1FNNA 2NO0A 4XWAA 2ZRFA 5CLLA 1G7RA 4G5QA 3NDPA 1QDEA 5JEEA 4QM7A 4ZV4A 4Q03A 4DSUA 1Y63A 2CLSA 2FE4A 2G0TA 3B1YA 4AKGA 2WPDD 1XXHE 2GXAA 1U8YA 3L82B 3BXZA 3RS3A 3WP0A 1G41A 2Y8EA 1H8EA 3LWNA 4ZCIA 4U5XA 5GVRA 2OESA 4A1FA 2D74A 3C7KA 5E7MA 2FDCA 2GVDC 2HLDD 2LKDA 3U44B 1EFRA 1SXJE 2RGGA 4PSKA 4V0ME 4Q7KA 1COWD 4IKEA 2EYUA 1LV7A 1T6NA 5FR2A 2GA8A 5TB5A 1D2MA 2IS6A 2ZJ8A 3IQWA 3H0KA 3NTUA 2GJKA 4G01B 4TL9A 2GJSA 5AUOB 1US8A 1JI0A 1Z0JA 2WAXA 1T9HA 3EZ7A 2VP5A 1KI1A 1PLJA 1Q12A 1KMHB 1LS1A 2OLJA 1J8MF 5C46F 4PAMA 3LAWA 4D25A 3K1JA 3W8RA 2JJ2A 3CF2A 3HWSA 1NP6A 3PQCA 1GNQA 3AH8A 4HATA 4Q1CA 2JIZA 3DO6A 1KOFA 4M1TA 4FI3C 4M9QA 3SJBA 4QHTA 1JR6A 3B78A 2R6FA 2QMEA 1S3SA 1PVOA 5GADl 2BMJA 4RCYA 3T1VA 1CEEA 2CHQA 3I8SA 4Y0AA 1YZNA 1YJ5A 1T0JB 1GOTA 2AK3A 1FP6A 2FF7A 1WB9A 4LJ4A 2BHRA 1D9XA 3NXSA 3SBEA 3HJNA 5TVKA 1KTVA 1SVOA 4DUGA 1G1MA 3U44A 1K5GA 5FL7D 3ICEA 2C77A 2X77A 1ZM4A 2ZI3A 1EX6A 2AHOA 3QKTA 3MSXA 4I99A 1NMXA 3T1OA 4LK2A 4Q1FA 1II8B 3C15C 4BRUA 1CP2A 4KVAA 4BZXA 1YZTA 2XB2A 1YU9A 3ZS9A 5F9HA 4D4JA 3C16C 3WY9A 4P3YA 2VHCA 4F38A 4OHWA 1KHTA 3KQLA 4OQFA 3U60B 4D4MA 4G5SA 1NNEA 1ETUA 1E9BA 1MKYA 4RD0A 1UPTA 4NYMR 2ZRHA 1GTVA 2CE2X 4LJ9A 1KK1A 1W48A 3PUZA 1ZMXA 1QG4A 2IYVA 4WXPA 3BB4A 1H8ED 1R8QA 3IEVA 5JS8A 4F91B 1TL7C 1T91A 2OCPA 1YR7A 1QRAA 5EZ6B 2F7SA 1EG7A 1G7TA 2P65A 3QF7A 3GJ3A 2F43A 3X1XA 4D26A 4X8HA 2JJ1A 4TQAA 4DB2A 1RRCA 4HAVA 3C14C 3N70A 3UWKA 2KBEA 2CXXA 1NVVQ 2BJVA 2YOGA 2L0XA 1BYIA 1VYVA 2X2FA 4FMDF 4LRWA 3PUXA 1O87A 4FWIB 1ELOA 1ZAKA 2QTFA 1YRAA 2GF9A 1ZM3A 4LCBA 2OAQ1 2QE7D 5CDFA 5FTMA 1II0A 1II8A 5CLQA 1N6NA 2ZI7A 2A5GA 4B6FA 2JIZD 2ZU6A 2WWGA 1CKEA 2OBNA 1VHTA 2PLFA 3P27A 4GOJA 4OI0A 4LC0A 1G3IA 2ONKA 3OHMA 3KKQA 3SJZA 3I92A 4NYJR 2KSQA 1NL3A 2FU5C 2GK7A 2RH5A 3WNCA 1MR3F 3AVPA 5FBWB 5L3QB 1P72A 2R6GA 1YZQA 2AXPA 3PR1A 5J4YA 4M22A 1LTQA 1E4VA 1Z2CA 2PJZA 2REOA 4OI2A 5JCPA 4XVUA 5KU1A 2DWOA 4N0EA 5G3YA 1NJGA 3OAAA 3MG9A 4DUGD 2ZSFA 2ZRCA 2CJWB 3RNLA 3BK7A 4O2RA 2HDNB 2VHUA 4EPXA 1KK0A 1S1MA 2ZRMA 2C95A 3U2QA 3ZS8A 1CIPA 2XSZA 5EUMA 1ZM7A 4PX9A 2AWOA 2A30A 2GZAA 4TMVA 2EFHB 3R8FA 3SFZA 1UF9A 2N42A 2EWWA 2IYSA 2VRWA 1R5NA 2UKDA 2IUTA 1NIPA 3TH5A 2HV8A 4DCSA 4ARZB 3QBVA 5C4GB 2ZTSA 5J5CA 4LJ8A 4W9MC 2DHRA 1IY2A 2FSGA 2RMKA 2E87A 4JLDA 3KQKA 1XMVA 1EX7A 4XOIA 2B8WA 2GJ8A 1VHLA 2C9CA 3DHWC 1SKYE 4RFVA 1T4GA 1L4UA 4RD3A 1YVDA 4IVPA 1RIFA 1RRFA 3LX5A 4L15A 4MKIA 3TE6A 3LA6A 1UKYA 4IOJA 4IW3B 4BPBA 1ZJ6A 1AM4D 2W00A 2WWIA 2A3RA 3OIVA 2ODNA 3AQ4A 4HB4A 4EPYA 3H2YA 4IJMA 5L3QA 2X19A 3MGCA 3B82A 4YMSA 5BN5A 1ZINA 2O8FB 3SFVA 3CNOA 1QBKC 2WBLC 4L16A 4GRAA 3LY5A 3VTKA 2ZE5A 1AZTA 1KKMA 3VFDA 3L43A 1E0KA 1DAGA 1VG8A 2FFAA 4LOAA 3ZJYA 4YLGA 4PAOA 1N5LA 3B1XA 3CR8A 5F9FA 1KYIA 2IBMA 5DNYB 4OYHA 4KFRA 4FMDB 3OE7A 2RGDA 1I4DD 1VDZA 2ZUDA 3DKVA 5FOWA 3SU8A 1R4AA 2CBZA 2QA5A 4LGMA 3W3ZB 5BN4A 1FUUA 3O8RA 1OXUA 4G0NA 1A4RA 1XCGB 1IN4A 1XD9A 3UG6A 1U8ZA 1KGDA 1BKDR 1TU3A 3B7GA 3ETLA 4DRZA 1ONBA 3QOFA 2NPIA 4TQUS 3WXMA 2ZRDA 1WF3A 4A6PA 1GWNA 1YR8A 1MO5A 4B3BA 4FMBB 1FNMA 3GLIB 3G0HA 2PH1A 2HF9A 5BYJA 1G64A 3CRRA 3LRPA 3KJHA 3TRFA 4QRHA 4EPWA 4BECA 2OZEA 4B48A 4BFVA 4NZYA 5LD2B 4RD6A 1KO8A 3CB4A 2AN9A 1P3JA 2XOKA 4OI1A 3NWJA 4Q48A 3V4FA 2O8FA 3QXJA 3RWMB 2O0HA 2P67A 1SZPA 3A4NA 4D0LB 1H8HD 3U6BA 4PSVA 1W0KA 4ZO4A 1NVXQ 2G6BA 1Q44A 2QNRA 1Z6XA 1CBUA 4FW9A 4L5BA 4WZAE 5B57C 1G7CA 3VR2A 3QXXA 4BQSA 2Z4RA 3EZ2A 4C7OB 2NO1A 2O8EB 3L8YA 2ZJ2A 4OHXA 1W4BA 2GDJA 4B32A 3NC0C 1UBCA 4XIGS 3ICQB 3UKDA 5DE3A 4IFEA 1IXZA 2YV5A 5EZ5A 5FTJA 1OLOA 5KNCA 2W0MA 4K46A 1SGWA 4XJXA 6Q21A 1OKKD 3EARA 3EZFA 2NOAA 4FN5A 4WOPA 2QT1A 1I2DA 1KI8A 1P60A 4F4JA 3GLIA 1XXHB 2QM8A 3ZVRA 4NMMA 4BFWA 2PMKA 1Z2AA 1JR3E 3BAFA 1AN0A 1N5KA 2QM7A 2IUUA 5KOYA 4MKHA 1F60A 4BFYA 3VU9A 1XJ0A 2REXB 5FH9A 4JSTA 3CF6R 4Q01A 2VSOA 3R7WB 3W6PA 1XBTA 3WRYC 3KQHA 5DI3B 1VCNA 1E9CA 1KSJA 2ZR7A 1FOEB 2IXGA 4NCKA 1NN0A 1R0XA 1W1WA 3PEWA 1G291 4MKGA 5EXSA 3ZVMA 3OIWA 3D3QA 3L0IB 4V0NA 2DPXA 2XNDA 3CIOA 1MO4A 2AFHE 4HAZA 4PZZA 4QGGA 1H65A 1XFAA 4C7OA 2RGEA 1E2HA 4EIWA 3TVDA 4M9ZA 4TWZA 2O8EA 5KO2A 4Q19A 4B2IA 2ATVA 5AR1A 5L3RA 1KKLA 1XTKA 3G5UA 2QP3A 2ONJA 4EAQA 4NPHA 5JWHA 3WNDA 1P73A 1TF7A 3HR7A 1Z47A 4IVQA 4BFXA 3LV8A 1WXQA 1IBRA 1LF5A 4KV9A 4MUAA 2W83A 1UAAA 1OH7A 1RZ3A 3QPUA 4JLPA 3GPLA 1LB1B 5JHGB 1E9FA 2W2VA 1XXHA 3VR3A 4IRUB 2MMGA 1LVGA 4NTZA 4JS0A 2NZJA 4PC3A 3VR5A 1P2UA 5GVSA 1W4AA 2P6UA 4B35A 1SULA 3QEOA 3EIQA 1RRPA 2BWJA 5DH9A 4JLBA 4V0MA 5TY0A 3R7WA 2HYDA 2BOVA 2FA9A 1CS4C 3TSZA 2YOFA 1QHYA 5L3VA 4OHVA 2E9SA 2GTPA 2R9VA 1C4OA 5DI3A 1KI4A 2A2ZA 1ODFA 5FOTA 2D62A 4G1UC 4MDFA 1R0WA 2ZAMA 2VBCA 4HB0A 2VP0A 3T34A 1U9IA 1P9WA 3ZYCA 1YR9A 4P31A 5JCZA 3MWYW 4QFMA 3REFA 4NL4H 2VH5R 4FD2A 2IYXA 3QXHA 3CZPA 2VSXA 3X1YA 2EQBA 2UZIR 1DAFA 3GLGB 1M7HA 3NIBA 1XTJA 3Q7QA 1F48A 4MYCA 1W0JA 3I61A 3U3MA 2GAOA 221PA 5H70A 1XEXB 3QE0A 1N0WA 3BE4A 4OJQA 4KFUA 1A2BA 2HT6A 1KSFX 1ZRHA 2YJTD 4GI7A 4C4PA 3TQCA 3QENA 4MGIR 2GKSA 1UBEA 2IHBA 2KB0A 2CK3A 2QSZA 4M1WA 1Z83A 4WZBE 1QHGA 4QGAA 1NJFA 1W46A 4RD1A 5SZJA 3I8XA 4DSTA 4P0TA 1S8FA 3A1SA 2XNDD 1QVRA 3RS7A 4A0RA 4KYUA 2OG2A 3BIFA 2R6AA 4JJKA 4HAXA 2FEMA 4EPVA 2DFKB 4YMUA 1F2TB 3HPQA 5EE3A 3WYAA 5HE9A 3K0FA 1E2KA 1GL9B 2J45A 4A6XA 3JZAA 1I4TD 3D31A 1DPFA 1D9ZA 4MGZR 1FFHA 1NIJA 2QP4A 1FZQA 2MSDB 1Q1ZA 3LD9A 3EA0A 4RY2A 1NF3A 4LSGA 4TQ9A 2JLUA 3AVOA 5CM8B 1W36D 2BMFA 3NBYC 4TT3A 5AJYA 3GLGA 4OK6A 1OXSC 2ZRGA 3GEIA 5EXXA 2GJAA 4PC6A 2CNWA 2WSSD 2YWEA 4Q66C 1GRRA 4OK5A 1AZSC 1BO6A 1IY0A 1XEXA 5EP3A 1LY1A 1UADA 3CPJB 4AC9A 2DB3A 1DAIA 1KAGA 4PHFA 4YMTA 2VF8A 1ZNYA 3ZZUA 3EPHA 1XTQA 2ZU0C 4MRRA 2WJYA 3KKPA 3KUDA 2ZIAA 3SYKA 1HTWA 621PA 3ADDA 2JLQA 3T12A 1JPNA 5HCIA 3TIFA 2F9MA 3GEHA 2NGRA 4K81B 1KO1A 2QP9X 1WDTA 4E07A 4PO1A 1XZQA 1BH2A 1HE1C 2GAAA 2QGZA 4B43A 3GLFA 2X1VA 4LYHA 1G4AE 4PO8A 4DCTA 5C2JB 1KO5A 1MT0A 1N6RA 3TR5A 5BWMA 1SVWA 4DKXA 2QU8A 4C0SA 4JBWA 4YDSA 2Q3FA 1E2LA 2XJ4A 1HV8A 2CVHA 2XXAB 4KAXA 2H18A 2H5EA 1G7SA 5CM9C 3BB3A 1OW3B 3EX7C 1ZIPA 2EVWX 3PFIA 3Q72A 1U0HC 1ZC3A 1XPRA 2A5JA 5FOUA 1CLUA 1E2JA 1G8HA 1M8PA 4DZZA 1NN1A 2BC9A 4D0GA 2OAP1 4TZ6A 2CDNA 1J8YF 4C0BA 2CK3D 2ZITA 1E1QA 4AIIA 5DHFA 3MRSA 4QNRA 4QGHA 4C9BA 4N0DA 2RGAA 2FPMA 2VHJA 3JVVA 1N5JA 4D82A 4OQMA 4PZLA 3LVQE 1DO0A 2GXQA 1G3QA 1TEVA 1JECA 2YWFA 1DE0A 3VHXA 3EZ6A 121PA 5KSPA 1S3GA 3H84A 1DADA 2QZ4A 3W6OA 2VHQA 1T8UA 3W5JA 2V6IA 3B1ZA 3R20A 1EWRA 2GZDA 1GVNB 3HU1A 2HXSA 1K5DA 2ZE7A 4QBHA 1XJCA 4LBVA 3KJEA 1XCMA 2J0UB 4JL8A 3W3AA 1TNDA 2ZSEA 4DLWA 3ZVNA 3I62A 1WP9A 1E2IA 2W6JD 1Z3IX 3AF3A 1Z06A 1NBMA 1B23P 4M53A 1AGRA 2IXFA 2ZRNA 2QY9A 1IOZA 1CR0A 3ZVLA 4US0R 3PUYA 1N0VC 3PITA 4DEXA 5IRCD 1AK2A 2VEDA 2P6RA 5EXTA 2J0VA 2JA1A 4MDEA 3VNUA 1XD2B 1P9NA 4NYMQ 2BCGY 2YNMA 4DIDA 4PTLA 4Q21A 2PZGA 4B76A 2FFBA 4XTCS 1W4RA 4KCGA 5KNBA 2QG6A 1SVKA 1AKYA 2FZLA 2QN6A 4NCIA 5ELXA 4M2LA 2ZM5A 2Z0MA 1G3UA 3DOEA 1IN8A 3EC1A 3AGQA 2D2EA 2J7KA 4K8OA 1KDRA 4BZPA 4M1SA 5DYGA 1E2NA 1N6HA 2NQ2C 3CX8A 3P4YA 3EIHA 2QSYA 3RS2A 2WIAA 1Q57A 1M34E 1R6BX 4HEJA 4HZIA 4KFTA 3BFKA 5K8TA 3ECCA 1UKEA 2HT1A 2DYKA 2W2XA 4KVGA 4Q4JA 3E5HA 1T3SA 3KFVA 4TMWA 4D2IA 3AEZA 4C0AC 2IWHA 2YINC 1DAMA 2J0UA 2ZS8A 4GP6A 3SNHA 2ZRLA 2DY1A 5C4MA 2OE2A 2PJRA 2C8VA 4CEIA 3GLHA 1G9XA 1OYYA 3UK6A 3ZGXA 1UFQA 2ATXA 1AS0A 4Q7LA 1E1QD 1GKYA 3OIUA 2CHGA 4NH0A 4QJ4A 3LLMA 3GJ5A 3D8BA 2CLDX 2IHYA 1E98A 2QAGB 2RGXA 2YC4C 4IEEA 5DHAA 3T61A 2H92A 3ND8A 4AG5A 5J47A 4NYJQ 2AR7A 1E9DA 5JEDA 3Q5EA 5JFGA 2EW1A 3LO5A 2ZR9A 4RZ3A 4MRVA 2F1IA 1XD2A 2G1KA 2OT3B 4KSBA 1FP7A 4A2WA 4DJTA 5BW8A 1RYHA 3CLVA 3K09A 2VF7A 2JDIA 3WRXC 3ZQ6A 4MGYR 3R9XA 4Q4HA 3PG5A 1QZXA 2KJQA 4BRWA 3QVVA 5JI2E 5KDLA 1SVSA 4KYIB 2ZS7A 3FPAA 2P2LA 1C1YA 2GEDA 1LW7A 5EP1A 1KK2A 2JLYA 1KSGA 1NN5A 4LYFA 2D4HA 3U7FB 4AY2A 2WWYA 1M6NA 5KTYA 2QAJA 3FMPB 5FBLB 3HDTA 1XEWY 3RANA 2CLCX 2ODWA 1FX0B 4WXRA 3B5JA 5FI0B 2IF0A 5DN6A 2WOOA 3P1JA 2H7VA 1KDTA 5JECA 4OQLA 1VG0B 4LV8B 1HYQA 4ZI3A 4BFSA 2AD1A 3W34A 1VG1A
chains in the Genus database with same CATH superfamily
4AICA 4Y2JA 3K70C 5C1IA 3USES 2R6CA 4US2R 2XY4A 1RAIA 1OHHA 2W70A 4PYNA 2X23A 4QG3A 4IGKA 2C1XA 4V0OA 3EG9B 1VMAA 2Q4TA 1BCRB 3RB8A 2QAGA 3PWSA 4WFQA 3IAUA 3RIGA 1TW2A 4KBGA 1NXTA 2MR6A 1F6BA 1SMKA 3BXHA 3C3XA 3FVTA 4X1OA 4XQEA 5ALYA 4ZKEA 4D9BA 4LJ6A 1QV9A 4F21A 4K86A 1OIVA 1P0MA 2HF8A 1QC5B 2WJAA 4HPJB 4R9VA 4N41A 3FW1A 5JXIA 2WIDA 3JQ9C 1HDEA 4B6PA 2UYQA 3ITKA 1HNXB 4DJJA 1CC1S 5J2TA 5I4CA 4BB5A 2QD2A 4QDJA 3U16A 3H19A 4FHGA 4A82A 3MJHA 5DASA 4LF9B 3H65A 5CNJA 1U6JA 1NAHA 5CVCA 3Q6MA 1IPFA 1JPJA 1Y3AA 2GZ1A 4KPFC 1NJ6A 2WYHA 3BQNB 3EXAA 3DR3A 1WDWB 4G9BA 4RPKA 3U3DA 3UWDA 4B6GA 2AMFA 4MI3A 1ISMA 1I0IA 4QGSA 1NUSA 2HX1A 3IIJA 1K88A 1DINA 4Y18A 3FCSB 1H42A 1XWIA 3HVKA 3P4UA 2BKXA 3HCCA 4CEHB 3OFSA 5C18A 4BJ1A 2PUFA 1N2CA 3L07A 3BHJA 3GARA 1FX0A 1NA5A 3FWYA 4WK0B 3W6UA 3H5LA 3WJ1A 5JS1A 3W4IA 3GK3A 3ONFA 2GZHA 2ZE8A 1Z33A 3WHKA 3JALA 4C2BA 4ZRNA 2P1RA 1IVNA 1GZUA 3LY8A 3B3QA 3QVWA 1HSOA 2DKNA 4C0XA 2Y0BA 4ZAVA 3DPIA 4RTRA 4QPNA 3DCNA 1C9DB 2HCFA 4ZMSA 2R84A 3FLAA 1PS0A 1WVMA 4WZBB 4X7MA 4XXHA 3O7WA 3RHSA 2OBMA 5JYDA 1RCUA 3IBYA 1T4DA 1CF9A 4FBLA 4B3XA 1I6MA 1GQQA 1UMCB 1KYWA 1XMXA 1M6HA 2H57A 4K88A 4M0PA 4QD3A 1U7HA 1J25A 2HA6A 4FBGA 1XNQB 5C7LO 1Y4DE 3O3CA 1VL6A 2OV1A 2ZYWX 2OBLA 5DB4A 3SR3A 3MRXA 4FMCF 3RIXA 4ALJA 3I6YA 2B2XA 7YASA 4DV2B 1Q3HA 3C1TA 1WCV1 1WU7A 3NORA 3EIWA 4IKOA 3BB1A 1E20A 1P4HA 3FWNA 3K96A 2AG1A 3MQ2A 1OGIA 4DRXB 5CFRA 3U5TA 3BMOB 2JFVA 1SCAA 3E9NA 4G0XA 2Q4OA 1DJNA 1YE3A 3F46A 1G2IA 3RJ5A 3M9LA 2JJYA 2C78A 1JPVA 1JP7A 3A25A 1VPWA 2LBPA 4GWGA 5BQXA 1H2HA 4U2GA 1RHJA 3V4SA 4YJHB 4HWKA 4PO9A 5EJ8A 4CF7A 4OJYA 5CH3A 1V5FA 3NJ4A 4JXKA 2Q5IA 4MVWA 1LPOA 1T2NA 2P0AA 4X91A 1TJ5A 3GDWA 4UVEA 2AEEA 5HYVA 1ZH8A 3AG6A 3CLRD 1A95A 4RQAA 1FMFA 5K3EA 1L7DA 1GGFA 5FHRA 3UFXB 4C04A 3IVCA 2PZAA 2BLLA 3AYXB 4PG6A 2XIJA 3UIEA 5GZ3A 2CSXA 1AUOA 2DKOA 3W9BA 4ZYXA 2H1VA 4TV8A 1U8UA 1IJEA 1TA0A 3EDMA 3HSKA 1E2GA 1H4VB 3NBAA 5G53C 4L5IA 2PXAA 3D4OA 3JQDA 4J0IA 2Q5OA 3FMOB 4MS1A 4TLEA 3T7RA 4ARAA 5BSGA 3SZMA 2QBYA 2QTZA 2IX3A 4YRMA 2BSAA 3QJYA 4L50A 2EFGA 1W581 2OP1A 2V96A 4DREA 2M98A 5EQTA 1NXVA 2JH8A 2CMDA 1Z68A 2O50A 1W4ZA 4X6UA 4XUCA 4K9PA 5LBIA 3CKLA 1JDUA 2IP2A 2JGKA 3DE7X 3EQ8A 1EWKA 1ZUNA 4Z3DA 1TUBB 3PDWA 3LT1A 4MGHA 3LX8A 1JB1A 2BFBA 3COPA 3G3EA 3GT3A 4MAMA 4OGFA 2QQEA 2X9GA 3ESQA 4WFJA 1NLYA 1SUPA 1ZHOA 2PUBA 1I3CA 1KJ8A 4OPMA 3TZQA 4ZYUA 1U2TA 4N3GA 5TMBA 2EG9A 1I5RA 3MHTA 3NETA 1CJVC 2ERYA 4QBFA 4I9GA 2FVXA 3NTLA 2H4YA 4KMRA 1VLVA 4LMBA 4YV2A 1MB4A 4PG5A 2E5LB 3IBGA 1RZRD 1E9EA 4X45A 2DULA 4R1PA 3Q88A 4CGZA 1XU4A 1WMFA 5ALTA 3M3HA 3RQSA 3WYBA 4G0OA 3BD8A 2VJMA 2PEZA 3FWPA 1PO7A 4MVJH 1JKJA 2VZEA 3PE3A 4RGYA 4X8LA 4Y98A 3ZHTA 5LU9A 2RBGA 3TLCA 2PFKA 2QRMA 3UM9A 1YI1A 1K2VN 1NQTA 3TJZA 1WTAA 4DMLA 2CJWA 2HBZA 3MTIA 3L7OA 4L4RA 3B7WA 3VOSA 2EDCA 4FJ2A 1SUAA 5F2EA 4TWBA 2D5BA 2ZR0A 3IT0A 4DLZA 2XTNA 2Z6VA 1EQ2A 3W8NA 3DDCA 2MINA 4EUKA 2GJ4A 3A58B 1L8LA 3IRUA 1W2HA 2YH2A 2ZJ4A 3ITEA 4LCJA 1TVMA 3LYUA 3T5TA 1S8AA 2PZFA 3TDMA 4FMCB 4FSDA 2PKRA 4R8KA 3E8SA 3H6KA 3L8GA 3RVMA 3TWOA 1Y5RA 3K73O 2X3YA 4ARZA 1KY2A 3AF2A 4JNKA 2ORVA 1UMDA 3DVQX 3UYLA 1RRGA 1BS1A 3I04A 2OAGA 4NQRA 4UUMA 5HIJA 2E3JA 3TW0A 4ZQGA 1JBQA 1VXOA 2H6EA 2VXYA 3ZDCA 4ND6A 5JC1A 1ZR2A 1B6RA 5KYXB 1U8CB 1ACLA 1QLWA 2FEOA 4GPAA 5EMLA 4L5AA 4QTUB 2QY6A 1WRBA 4WCDA 3H9EO 1A72A 4XVQA 1BVRA 3ZHYA 3N8KA 5CFQA 1DKRA 3IELA 3FTQA 4C4SA 4TMXA 3FOWA 3H13A 4MVJA 4F5ZA 1Z2OX 1FJGB 1TMKA 4RGBA 2QYOA 4Y2TA 5I7SA 2Z2XA 1N2JA 3FJOA 3U7QA 4H7EA 2WHPB 3D81A 3IQHX 4UE2A 2GHIA 4I5GA 3QQPA 3EFBA 3WBJA 4F8JA 5BWCA 3BPSA 3U4QB 2R7LA 2BGIA 2PD6A 1RYBA 1BXRA 1PUIA 2ZYIA 1NX6A 1U98A 4LXUA 4OIMA 2GN1A 3VSEA 4AO8A 1CQZA 2FW6A 1G8PA 3ZTWA 2H1IA 1N5RA 1GPUA 4C1BA 4QXOA 3ORYA 1LSUA 1UBMS 1K75A 4DR3B 4B6JA 1ZN8A 2IW1A 3MW8A 2F67A 3VV3A 2NZ2A 4KRYA 4WLEA 1U63A 3ZU4A 1XALA 2Z2KA 5KTPA 2ZUEA 1EFHA 1WNTA 3FCOA 2PCJA 3RYFA 3TZEA 1SWVA 4ASUA 3CSUA 5FWXA 2WFZA 3EDRA 3BBLA 4ESHA 4HZUA 3VDXA 2FWIA 3WA6A 3WI7A 2WF8A 1SBQA 2GH1A 4EA8A 4EGJA 1V37A 3UO8B 4E2FA 4OFBA 5C81A 3IAM6 2OOKA 4MKFA 1L5OA 5IKPA 3QLEA 2O8CB 3PNVA 1CUAA 4DLUA 3Q40A 4V2IA 4JHXA 3EASA 3UMFA 3T3OA 4KMSA 3F7OA 4BLPA 2XCQA 1QO9A 3P45A 3OHPA 3UMRA 1UKZA 1PNTA 1STOA 3NDRA 5CHYA 2J4DA 4FOLA 4PYLA 4Y2HA 2YVAA 3ZXYA 2XGOA 3DNFA 3OHSX 2GCOB 1SXJB 1CX9B 2VSFA 1MH1A 2BEWA 3DYBA 3OEHA 3TQFA 3ONVA 1KJIA 1SQGA 2WINI 4I5IA 5IBRA 3TRJA 4DCCA 3K0AA 4YCAA 5JZSA 2BFNA 5J3JA 3D7KA 4B2LA 4GR9A 3BRWA 3NS7A 3U0BA 1I13A 1M66A 2EXXA 3JQ8A 3UPTA 2F48A 1H2RS 2BRUC 2QENA 2ZJBA 3KJQA 4FSXA 4UVGA 3V46A 3VVBA 4Z7NB 3TQIA 4Y1GA 4QFCA 2Y67A 3L5OA 3A1VA 3A10A 3VHLB 1R4ZA 1UT6A 1V8ZA 4LZWA 1X0XA 1EFPA 2OD2A 3BORA 4UPDA 2EF0A 2PL3A 4DAOA 1SEPA 2HIAA 3NATA 4IGEA 4QYIB 2IEGA 1B26A 2X0NA 4R2JA 1N6KA 5M3BA 2JGIA 3TBKA 4RTKA 2JNWA 2J9ZB 1VI6A 1PKXA 4ABTA 1QNFA 2QZPA 2V55B 1M2GA 3X0DA 4MQMA 4ENQA 1EGMB 1G5PA 1ZUHA 2C99A 3HI4A 1Q50A 3I9V6 5GJBA 2QRKA 2VQSA 5E4YA 2O8NA 1W9MA 3Q0TA 4NDZA 1AF7A 3DZDA 4U3JA 2B83A 1PK8A 2P6PA 2YJ3A 3T5BA 3UGQA 1G16A 2EBWA 2JFNA 2PSDA 4YAUA 2W6QA 4XGKA 2XVXA 4NIMA 4ZVKA 3U9SA 3L7MA 3LVRE 4O8CA 1A82A 2WJ6A 3MSCA 1KNXA 1NBHA 1U7DA 3ZGOA 1O94D 4BYGA 3IP5A 5BSHA 5FWNA 1RAEA 4YXWA 3S40A 1WHTA 2HWUA 4RL4A 3AKYA 1SA0B 4D9MA 3ELUA 5I47A 1MBZA 5HZMA 1V8OA 4YCMA 2OGSA 2AYZA 3U6KA 1XTSA 1OF1A 1W88B 1C3LA 3QVGA 4JA2A 1QIIA 2O5EA 1NBEA 1H2EA 1O6ZA 1X2EA 2Y1FA 3ASUA 5DIFA 3THWA 2V45A 1GGJA 1SH7A 2QI9C 4WVLA 1USUA 2KPOA 1JMKC 1W94A 3I76A 4C0HA 4IEIA 2C9YA 2G8LA 4X3OA 1NSFA 2QHXA 4FM9A 1O7JA 4JLOA 2F2TA 3C1AA 5E8RA 3SHWA 3AVWA 4C4AA 2ODPA 4I6GA 1X3SA 1X9HA 3FB4A 3RF7A 1TX4B 2FZEA 1EPUA 4C03A 4TV9F 1T4CA 2FK7A 1THMA 4AP9A 2HWKA 4RMJA 1WWKA 2YMLA 3R5TA 1E77A 3F6EX 5HKLA 3NHKA 3Q8XB 1RTKA 4TKUA 5EJ9A 3FFXA 4UKDA 3WFJA 1E61A 5HZGA 1A1VA 1KAOA 2B4TO 2POCA 5JMTA 3WZ2A 1Y0BA 5I9NA 3PCTA 4H59A 2WAYA 2EFDB 2V3CC 4GDFA 2GARA 4YJ3A 1U0FA 4EA6A 4HN4B 2C2OA 4DDVA 1N2SA 3VVLA 5KBYA 5FUVA 1UDXA 4HNSA 4QECA 3KSDO 2Q2OA 3OJ0A 5J4HA 4OMDA 4RK4A 2ZTUA 3AP1A 3DA8A 3KXKA 2XADA 1WBBA 3HUFA 4GE0A 4ZC1A 1QH1B 8GPBA 5I9IA 2ZJAA 4RY8A 2O2HA 3O0TA 4Y0VA 3IP3A 1ZL0A 1AU9A 1ULHA 1RBYA 1XEWX 2YYYA 2N1MA 1YQTA 2NX2A 5ALKA 2F3RA 2P30A 4J2OA 4ZO7A 5EJFA 2O07A 3IBSA 3HKDA 3ZU6A 4DQDA 3I0ZA 3M33A 4B6SA 1RKBA 4P83A 5IARA 4BO8A 1V1MB 1BC5A 4QDKA 4ZQFA 2JATA 3BWBA 2XB9A 3HYRA 4MB6A 3CLSD 5EUBA 3GLQA 4EBBA 3AKDA 3HR4A 3MUNA 2SHKA 1PSDA 1YBVA 1KIFA 2I9PA 5D3QA 4D3FA 1I51A 5KTRA 3MC1A 1TQHA 2W58A 3REOA 4RBNA 4GOXA 1ILWA 4R8VA 4AY6A 5G02A 4F4CA 3ERCA 4N3BA 5BY2A 3DEYX 3NKVA 5EHZA 4MS3A 5AJXA 5E0KB 3MERA 1CZNA 4JYMA 5F1PA 3ZWAA 3VPHA 1V95A 3KL4A 5H16A 2RCNA 4LPSA 2Z57A 4TN5A 4YC7A 4AJLA 2X3UA 3VRHA 4ALIA 1X9IA 3GJ0A 1JTFA 3MA0A 3IEUA 4MEAA 4ITUA 4YP1A 1EESA 2J5KA 3MMNA 2F1KA 2R3SA 3GFTA 3SSAA 5EP4A 1HQYE 1NI4B 2CD7A 3KCQA 4ZTBA 4ZT7A 5IAJA 3W90A 3OBIA 3C87A 3PGKA 3VR5D 1TECE 1WSAA 2EWMA 2JHGA 3I32A 1K92A 4ZO8A 3NTQA 1T2VA 4CIVA 4GIBA 3OOSA 3DZBA 4KW7A 3GRFA 1RLUA 4WY5A 3VISA 1V4NA 4IHJF 4F0JA 2NP7A 3PC4A 1FFYA 3VYVA 3LPCA 3PXCX 3UUEA 3TTWA 4EO4A 2C1ZA 2Q0SA 4ZCRA 3W06A 3MNFA 1ZD5A 1GR0A 2Q6IA 4CE6A 1OROA 4D4LA 4FWBA 2CNNA 1H5UA 5FT9A 1AV7A 1H93A 3N7AA 3TD9A 4D9IA 5CB0A 3HZHA 1T9AA 2P9CA 1GR1A 1UDAA 1X7HA 2EX1A 2R65A 3DXYA 1BROA 2DTDA 1SZJG 5JI3E 1JSXA 5CK5A 2P9YA 4N9QA 1YR6A 2P11A 2YJNA 2JIDA 4J3NA 2IPLA 2YDXA 1F2TA 4ZWNA 5JNVA 4ZU1X 1KYTA 4G1BA 5IKXA 1G42A 4AYTA 4ZEVA 4QOIA 4D3XA 3B1VA 3BSFA 4IIGA 4CMKA 3LDAA 4KITB 3D7MA 3R0JA 3JVEA 3WKAA 5IMSA 1W5TA 1GL3A 1ECJA 2FG6C 5T7BA 3QVSA 2ZE6A 3AETA 1X19A 4CM1A 3U4IA 4Z99A 1OFTA 2GRUA 2X5NA 5EI5A 4EZBA 1S9HA 1ZOPA 2DG2A 5FQNA 4MCIA 4BNHA 1HWYA 1SM4A 1Z15A 2ZUCA 2HBYA 2IDKA 3BJMA 3UXEA 5I7FA 3ECAA 3O7MA 4RVHA 1PX0A 4OQDA 3RARA 3RTEA 4Q3CA 4DC1A 5KX5F 4F5YA 4EARA 2DT5A 1X7XB 2YYSA 1EMDA 4LI0A 4RFSB 4BQPA 5JLJA 3IHWA 1N8KA 1R8YA 2PD4A 2ISCA 2GYWA 3DDNA 5LQAA 4NCNA 5HM8A 4LF7B 1WB6A 1E6WA 5FADA 2JC3A 1XTPA 5U4XA 3WNVA 4JA0A 4UNRA 2OUKA 2WU1A 4U2FA 3UHAA 1I9CA 5TT1A 1C1XB 2JFPA 2EIXA 2HWXA 2Z8YM 3CKMA 4JROA 3W9YA 1T8YA 4FE3A 1E5VA 4IDGA 4Q4LA 4WH0A 2WJJA 2XTAA 4L7VA 2X5KO 5F3DA 4YIHA 3K6SB 4LNHA 2Z5VA 4HTFA 2NVUB 3CONA 3AP3A 1Z4OA 3JY6A 4MRPA 1F0NA 1OXTA 3VMMA 4EHFA 1G19A 1M6VB 3I73A 2AFIA 2HLDA 3O8LA 3ILYA 4KAJA 1JFTA 3ZWCA 1YZ3A 1TZMA 1GYQA 4B1FA 4FFRA 1YASA 1U8TA 1ZSNA 4RUKA 3B13B 4YO8A 2G4LA 1CZKA 1H2AS 2ORWA 3DJFA 1XTUA 2WMOB 1NXQA 1ZMRA 4GZ5A 3QHAA 4H4EA 5EJ5A 1XZEA 4RV4A 5KYUB 5BNZA 1N3LA 5LQKA 4PR0A 3N86A 5HR5A 3N5CA 1SN7A 1LGYA 4K6MA 2QTMA 1C7RA 5AIAA 2VBFA 2JI9A 2OTCA 3IB3A 3NYIA 1E2FA 1V41E 1E32A 1ZCAA 5AQ1A 1NJSA 4MQEB 3DDSA 5ES3A 3H1PA 3FYUB 1V8DA 1T9GR 2BFEA 2Q27A 2OORC 1CUUA 4IHJB 5FUYA 4EUFA 4NU0A 4OHCA 3GA7A 4PPQA 4WZAB 4DF3A 4B47A 1UJ2A 3QVXA 3DE6X 5IH3A 5FBZA 4HAOA 4IIJA 1GZSA 2YWXA 4EHBA 3C8UA 5I4BA 3IPAA 3PD7A 1CJMA 3QH4A 1KK3A 4W1SA 4W5NA 2PIAA 1I7SB 1LVHA 4QUGA 4YRJA 5DULA 1VYTA 3HA2A 3PGMA 3OLWA 3E2IA 3KZXA 4URZR 2J8ZA 1Z4KA 3BTVA 2D1FA 4G8CA 4HOYA 1QB8A 1BX3A 2YS7A 1AXEA 3H3XA 2OKCA 4RVDA 3KUXA 4YY3B 1CS0A 4TS4A 2CC2A 3H7IA 2LXNA 3WADA 4DV0B 4I9HA 2IHTA 4V38A 4XCQA 3ZOZA 1FS5A 2Y93A 2DWQA 1M1NB 4E2YA 2FZWA 4IRMA 1J5PA 1QKJA 1PYOA 3E82A 1R16A 1S2OA 2WPNA 5A2GA 4X24A 3QOXA 5ESDA 4V3BA 2V4UA 3HYLA 1RYDA 4I4TA 2KBFA 5TLSA 5C8DA 5FHQA 1E0SA 1OREA 3GGSA 2BI4A 5IT4A 3GUHA 3CUEF 4NZPA 3AKCA 5CB4F 4CDGA 3G7NA 2IC5A 3BD7A 3G49A 2JLCA 4UEOA 3LP5A 4UBNA 3CCCA 5KX5B 1YBHA 4TTRA 2VN8A 3OU7A 1N2IA 1VJGA 3P9IA 4HHEA 3KLMX 5AOVA 4G84A 3QXSA 4DG5A 2XAAA 4F72A 2VWHA 1ZMTA 4EMUA 1R6DA 4MUIA 2R86A 3M1AA 1QQAA 2ZJ3A 1QIHA 4WCFC 1U0BB 1L5YA 2CV2A 1SZCA 1X80A 4TL7A 1H2XA 4EI9A 1Z63A 1NQWA 1K7EB 2AOXA 3AUUA 4DPMA 1NVTA 3LBAA 1C14A 3R74A 3KZOA 1IEVA 3FGZA 2EJVA 2G67A 1KS2A 1GQ2A 1M2NA 1QGOA 3KZMA 5J5VA 2XITA 4AD8A 4D3YA 1LDBA 3WS7A 2ZJOA 2AZ4A 1SQ6A 3D8RA 3NJRA 5FRDA 3WIDA 2UYCA 4M8NE 1Y3DE 1Z2DA 3TW4A 1QR2A 1F2UB 3VQTA 1TKBA 1L5HB 1V96A 4DIEA 4UUPA 1T3HA 5IXYA 3FGOA 3NM5A 3P0IA 2G0AA 2GAFA 1OWMA 2RC5A 3U1TA 2PE5A 1R8SA 2YNMD 3EXG2 3NBFA 4J91A 2XUGA 3GEMA 2P3OA 1ZK3A 3IQXA 3QEJA 5AI8A 1FVFA 5TGTA 5IM4A 1O0CA 1TADA 4HWGA 2QB5A 2O54A 3UV6A 2NO7A 1P7CA 2HPVA 2VATA 1O57A 5EKDA 5ALRA 3BXPA 1DG1G 1X7ZB 5HIKA 5BO5A 1L4HA 3BC1A 1OASA 4G07A 4BTLA 1QZ3A 2QQFA 4Q3OA 4JITA 1RAHA 3LK7A 1H2WA 3N59A 4EUEA 3KQUA 2Z6QA 1G17A 2DWCA 1XQVA 2F3PA 3EXFA 3NBXX 1F12A 4QATA 4XRRA 1XE3A 1SHJA 1ZDMA 4HDNB 4PIVA 1KHHA 4YWJA 1QXSA 3RSCA 4E5UA 4C4RA 2X0IA 1GKIA 2QSJA 1PG2A 2ID7A 2WSBA 3ONEA 3IAEA 4FINA 1ZIOA 4UTOA 5CRIA 3K30A 1G4HA 4C4ZA 4XTRA 2LE0A 1UBGA 3HFRA 1OTYA 3KTFA 4I4LA 3A1EA 3I9NA 1CETA 2RGYA 2YZ2A 5DM2A 1LX7A 2EX0A 3TZHA 1RJWA 1Y42X 5ALSA 4ZAYA 1E9VA 3VMFA 1Q77A 5DGIA 1P61B 1SVUA 1YE5A 2OK8A 1ONNA 3HYNA 2XUFA 3AOEC 5CLIA 3GRKA 1FW6A 4JYAB 3I30X 2FRXA 2IEYA 2DVMA 4KE6A 2OVFA 2YFYA 1GSAA 2DR3A 1U7WA 2WSYB 3A3YA 3O0DA 4LI3X 2RGRA 3P19A 1NF2A 3HDVA 2OXCA 5A04A 4CMHA 4JLVA 2XCLA 3EGXB 4YUYA 2BMDA 2J0EA 1BWRA 3DUFA 1R4NA 4LF4B 4M0MA 2DQYA 2GETA 1MFZA 2XAUA 2I1VB 4FCWA 3D7RA 5F5XA 5A05A 4JJ4A 4ZEMA 1O5TA 4HVAA 4AW9A 5JZVA 2ZSHA 4LJ5A 4IUDS 1Y9ZA 2D06A 3EVGA 4TLBA 3ZJ4A 4AY4A 2ZJZA 2KMLA 2J9GA 3HVRA 5KHLB 1QU2A 2KW5A 4HQLA 1FPMA 2BHLA 3TLZA 5IFLA 5INTA 2FMTA 4PNZA 3EG9A 3RABA 5CB4B 1BCRA 1ONOA 2WDZA 4RVSA 1MENA 1YMVA 1VI5A 2X5XA 3PDIB 1QHNA 2PLAA 3M4YA 4XGQA 1G8FA 3C8HA 2LCFA 2QJTA 4ETNA 2FR1A 3QZUA 2OC4A 4RPLA 4EY4A 1QC5A 4N5DA 2O0LA 3D64A 5EINA 3ER8A 1C4WA 4HUQB 4CL3A 2PX2A 5KPJA 5BORA 2O5VA 4MWGA 3FBTA 1DKLA 4N4AA 2F17A 2ZEJA 1B41A 3OX3A 5G3ZA 4HVLA 3IHKA 2CJXA 3MB8A 2HRDA 4QJIA 5IH7A 1C0IA 3C7DB 4S1NA 1FSPA 5BN3B 4EQ6B 1ZXLA 3QKRB 1E3EA 4AJKA 4D3ZA 1L3BA 3BVPA 2IPOA 2G0NA 2JKZA 4MCJA 4NFSA 4P4UA 2QAGC 3ME5A 2J7PD 3X1WA 3ID6C 4AKEA 3WQSB 3ZCXA 1U7TA 3BJZA 5J1SB 4BL5A 1C9JA 2D1TA 4CEHA 3S68A 3I0MA 4EG5A 2XMZA 4HVTA 2V7TA 2XZPA 3HE3A 3BGOS 1Y1KE 2FLWA 3QGMA 3FB1A 1G9SA 4W7HA 4C3UA 4RTSA 4AKHA 4GXRA 4ZRMA 4HGQA 1FTGA 3TRHA 5JBNA 1M6EX 4Q9IA 3CWCA 3FI9A 4CV2A 3I2FA 5AW8A 5ALUA 4QTTB 2ZAOA 4B6QA 2BP7A 4AP5A 4XLLA 2B69A 5G0VA 3EC2A 1Y81A 2H11A 2X41A 3K7EA 4WZBA 3U81A 2VJKA 4D42A 3PA6A 4IIEA 1WSBA 2X0FA 1WCIB 1ISJA 2OB1A 3KQWA 4ENWA 2C9BA 2D3TA 3ZW8A 3Q7PA 3R7LA 4UNSA 3L41A 3HO6A 1Z6TA 1FQOA 4IS3A 1LKZA 4MARA 2DTXA 2IXAA 1U2QA 2QMUA 4YTEA 4LQCA 5TARA 3ZY5A 5L51A 4A3SA 1QU3A 1DIGA 3WMXA 1EB8A 2BGNA 2WICA 3JYHA 4M0CA 4RA9B 4IV8A 2EEPA 2WI8A 3FNBA 8OHMA 4HGNA 1PNQA 4GKAA 3IEMA 4JYZA 1XGKA 1ZA2A 1HG1A 2WJHA 2D8MA 3F5DA 4CMJA 4V1CI 4ID3A 2IXBA 1SVNA 2NYAA 5DTIA 4F1WA 4CMIB 2CT8A 3VR1A 2DXIA 5HRCA 2JGJA 3QELA 3RRFA 2PO5A 4IFBA 4DMGA 5B3KA 4B34A 2AC7A 1A50B 3E81A 4EG1A 3E15A 4F4DA 2VL7A 3D7SA 2X7JA 1G6OA 1CJTC 4C6HA 5IAKA 2WKQA 1G5FA 4HLDA 1XNHA 3ND9A 4TS3A 2ORIA 2QKYA 3CSSA 4BEWA 1V8PA 1DKOA 3AB3A 4TLDA 3JARA 4RHTA 1P1IA 3MBOA 3EYAA 2VDNB 4O2BF 4EFDA 5AW7A 3IR5A 4KN6A 3TSAA 2HGSA 4YI3A 1Z5PA 3DL2A 2H4FA 2WZBA 3R8XA 2D13A 1ZUD1 3AB7A 3DWFA 3GI1A 3QV2A 1FUKA 1JEDA 1ODKA 2KX7A 4U7PB 1UK9A 1RMTA 3ZE6A 4Y2QA 3W6ZA 2FEPA 1UR5A 4HUJA 4P32A 1VSVA 2ECPA 3TUZC 4M9RA 2ST1A 2GKGA 1TQ4A 4GPD1 4J4BA 3KOZA 1MOQA 4FHZA 1ID1A 2G77B 1BMFD 3IMKA 4DG8A 2VYVD 4HDRB 1PE0A 3IXLA 5DX8A 3SYRA 4QXRA 5D3KA 4BDTA 4QWMA 1Z7GA 4Z1MD 2ORED 2FUEA 1I3NA 3DQPA 3ST7A 5AVJA 4C7BA 2XYQA 4F9FA 3I4FA 2YRWA 4HQNA 5GINE 4INJA 1ECLA 3B12A 3KJNA 1XTZA 1L4EA 3GAMA 2YN0A 1TUBA 4GBMA 5H81A 3UATA 1XZDA 1GSIA 1OXKB 2EFJA 3ISVA 3JD1A 3D6UA 2B21A 1DG3A 4TMKA 1GRQA 1PFUA 4D5EA 1ADBA 4RMNA 5I5EA 2SNIE 4E32A 3KEFA 5AWFC 1NR1A 4MWDA 5KDOA 4K9MA 3RIEA 2I6QA 3WP1B 4JLKA 2RGWA 3UC5A 3BM5A 3K1ZA 1XZPA 1HMPA 3T06B 5I45A 2DPHA 1X6VA 3B60A 2RGBA 2ZS9A 2EZ4A 3D6TB 4P58A 3UBTA 1Y3IA 3L6UA 3RT1A 1SIUA 4FBMA 3IX7A 3WL3A 1EJ6A 3C4JA 2HK6A 2ASEA 3VSDA 1VTKA 3GLHE 1UK8A 4DQLA 4W5QA 2PQMA 4Q4AA 3ADCA 4G89A 5HPYB 4MTCA 4WI1A 4KNVA 1TGYA 2DUMA 4O2LA 3I34X 1T6ZA 1FC0A 1SK8A 1DBQA 1V45E 1ONPA 1Z5WA 4LUCA 1GDHA 1NY5A 1QWOA 2C0QA 1NW7A 3AT1A 3H4VA 4MK4A 5AYVA 1LFDB 4EGFA 2X6RA 5J4LA 3C3EA 4U00A 5CYFA 4CG2A 1EP9A 2JL1A 1T3GA 4PHGA 3CM0A 4YT5A 1E0AA 1M34B 5F77A 3WG9A 2QUZA 3E9EA 2H2DA 3LXXA 1XO1A 4G4JA 4WE3A 5G0TA 3LHSA 2F1OA 4BP8A 3QG1A 3QMVA 4DMCA 4F3NA 3OIDA 1K7FB 4WJZA 4GT1A 5ICGA 3L6OO 2G40A 4L73A 4UNNA 2OCXA 1QH8A 1Y8CA 4M1EA 4V02A 1NRJB 4NPCA 4R8MA 3T3IA 4OH1A 2E5FA 5AOCA 1BGWA 2OQRA 3CH5A 1SQ5A 1WIWA 4HK4A 4QA9A 3IERA 3OU6A 1CF4A 1KOJA 1PR2A 5LZ9A 3H1TA 3LUPA 1D2CA 1Q2XA 4N49A 1B0ZA 1XDWA 3R0XA 4AJEA 4BZQA 2PU5A 2OCDA 1JBEA 4EI2A 3OEWA 1DMSA 4FHFA 4C0LA 3FE2A 5KYNA 2J4FA 1RTTA 3EY9A 1J33A 1C8VB 3NONA 2V74B 1RLTA 2MIIA 5A3JA 2ONYA 3MUEA 1YQ9A 5A4KA 3PXEA 1WW2A 2X7XA 4TM8A 1YS7A 2Y3IA 4E5NA 1SR8A 4O2BB 1VCHA 2WJGA 3TECE 1MVLA 2A0XA 1OIWA 3WQRA 4A1OA 3RPEA 5CXQA 4X8MA 4Y6GB 4DARA 1W0CA 3U4QA 3F98A 4OHPA 4UXIA 4KO8A 4N0MA 1NJ8A 1I1QB 4QODA 3VR4D 4AWXA 2W0SA 4I0WB 2FH5B 3D5EA 1X42A 2FEKA 1I7DA 1JRLA 1XA0A 2NZWA 3DEFA 1VC2A 3VI4B 2W6OA 4I46A 4KHZA 5BP7A 2A9OA 5I48A 3X1DA 1Y8RB 1RWXA 3OQ6A 4L3WA 3U3OA 2ACEA 2C59A 3B70A 5F78A 3O92A 6LDHA 1XA4A 5K6RA 2CHFA 2UVQA 4KLNA 1Y9AA 3N87A 3R24A 4RPIA 4BVHA 3RTGA 3UMCA 1KPHA 2CB0A 3RSSA 1UIMA 3V1LA 4EMBA 3VBCA 5F2KA 4WLUA 2WVHA 3OJFA 3REGA 3A6PC 2IFTA 4ZVUA 3KNZA 1D2GA 1DIOB 3G5AA 4IJUA 4Q18A 2O8VA 5CU7A 5GONF 5T64A 3AFMA 3CX6A 3GCGA 3HEAA 2IH4A 1YS1X 5I7EA 1A9XB 5A0FA 5FTNA 3OIGA 2V7EA 1Z6ZA 1FU8A 4G24A 3ETDA 4RL6A 5ITZB 2JAQA 2ZB2A 4LHXA 3FCCA 2A5DA 2GPNA 4QUIA 4YT2A 3MUFA 1V4VA 4FJ0A 3ZH2A 4RVGA 5JJLA 3AR9A 1T3LA 1DOAA 4BBJA 5JC8A 1GZDA 1XPJA 2W4IA 4R0MA 5J5AA 1M2KA 3RK1A 5IZ4A 5KJCA 4LDJA 3QIAA 2GCIA 5LIPA 3IIKA 2UYGA 1W5BA 2FPGB 2YMMA 2ZVJA 2JD0A 2X6TA 2ZSAA 3CBQA 3KEGA 3Q87B 4GMDA 5U4QA 5HG0A 5ITSA 4AY3A 3VNSA 1N3BA 4D4KA 1P6QA 1E18A 1RE0A 2ZCVA 4LTDA 5D3MB 1J22A 3BFXA 3GEPA 4X1IB 4MITA 1EUCA 4JBYA 4PZUA 4TTQA 3WIVA 4YV1A 5I3ZA 4GMFA 2C7VA 3PRKE 4TLLB 5CYOA 2VLIA 2E1RA 4C6TA 4JVSB 1A2QA 1I4WA 4BVKA 2CVFA 4LSZA 4QQKA 2M2IA 2O0MA 3LBFA 1L4YA 3H2BA 5DK4A 2R8PA 1QM5A 4O3MA 4HL6A 3G9QA 1ENZA 1ODSA 3I0NA 4J9UE 2O05A 3U3JA 2E21A 5DBIA 3VNBA 1AB5A 1NOKA 3K0FB 4X95A 4L76A 5CD9A 2EZUA 4QE3A 3QPWA 5TRTA 2WWTA 1XZFA 3IRVA 2V1XA 4YLEA 1YNSA 4DNXA 2IS4A 2VNAA 3INGA 3AEUB 1EI9A 4W1PA 5AJHA 1KY4A 4EB6B 2D1SA 2G80A 3ILVA 2I1WA 3ND6A 3CWQA 4Q37A 5AMXA 1YVPA 1REQB 2C83A 1M1YE 3EZXA 1U04A 4M9CA 4W5WA 5LUAA 3GDGA 4RMGA 4BLRA 3TFQA 4EKEA 4Z9AA 2FFRA 4CFSA 4RTLA 3BT7A 1UPXA 4BNLA 2P2CA 3H1GA 1V39A 3MCUA 3AHIA 4CIWA 2XT9A 2C07A 2P9FA 1ZBDA 1EZZA 3HYTA 4CEJB 3KG2A 1VQ1A 3GJZA 1P0PA 3R44A 4GMHA 2R25B 3FGPA 4L28A 3AI3A 3OE5A 5PNTA 2EQAA 1A8HA 1CUXA 3I9FA 1J9ZA 4P53A 4WTOA 1XYYA 2IYLD 2WHXA 4GSLA 1E7MA 3PQEA 4IH4A 4LMPA 1TLTA 3VR6H 4M21A 1TU4A 3IMFA 5DNWA 5JXJA 5EIXA 3BL8A 1J5EB 4QGBA 4C29A 2XCRB 1YCHA 4J0JA 5CAEB 1RNLA 1QG2A 3D43A 1GAWA 1YJBA 3VNRA 1X13A 4RJ2A 1D8TA 1M2WA 3TCXB 2F1HA 3E3NA 3AVUA 1FBNA 5EP2A 1HDIA 4KMMA 1UJ4A 1W8IA 2Q9CA 4MP3A 1IOLA 4NJMB 5H7XA 4CM4A 4JI8B 5TQJA 3LL7A 3HVIA 1TCVA 3IBCA 1XMSA 1Y8ZA 1A2OA 4GD3Q 1IZ9A 3JWPA 5GONB 4GWKA 4IXMA 1TVCA 4MEJA 4RJLA 3R3WA 3FETA 1GKKA 2XB4A 1J39A 3F1KA 4LS3A 4EJ0A 1P75A 3FZQA 1IY1A 1VJCA 2DH6A 1WP4A 4U02A 2IYTA 4ENUA 4GZMA 5M29A 4OFWA 3SK0A 4RJIA 2D7CA 3AF6A 1QS0A 4JP5A 4KLCA 3SYTA 1R7RA 3KYCB 4QPPA 1XT6A 1HE2A 2ZUWA 2IY7A 2W6JA 1M72A 2KM1A 3LF1A 3PF8A 3D1JA 1X15A 4KQFA 4MVYA 2DQZA 4Q15A 2OSVA 5TDHA 4GXNA 5AXAA 5HCUA 4DLPA 4AJNA 1UPFA 2JIOA 2EARA 4LC9A 3RSFA 1G20A 2Q1XA 3A1NA 3LF2A 5DLYA 1NPYA 1DBVO 3P9YA 1P44A 4PIPA 3ZZ0A 1BX0A 1IXSB 1BFKA 1J99A 3FKJA 3QWBA 4ZZ1A 3ML1A 4L0MA 1P80A 1PKEA 3SXUB 1NW6A 4OXQA 2Q6TA 1T8WA 3OFND 2H2WA 2JEYA 1Y8QB 3VR6A 5KOIA 5I7VA 3JZDA 2V6GA 2AV6A 3QEMB 2OHJA 1OE0A 1WQ4A 4PLFA 1NULA 4AZTA 3EAQA 5KKNB 2ADOA 1YRHA 4L6AA 2Q1SA 4IYJA 5NLLA 3VAYA 3AIMA 4PPFA 5LQMA 4ES6A 3HY3A 4DC9A 2VK1A 4E5SA 2DUJA 4JUDX 5AM5A 1ORIA 1UODA 2VPWA 2W98A 1Q1GA 2IL1A 2WU0A </