4X8LA

Crystal structure of e. coli adenylate kinase p177a mutant in complex with inhibitor ap5a
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
214
structure length
214
Chain Sequence
MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAALIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for catalytically restrictive dynamics of a high-energy enzyme state.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transferase
molecule keywords Adenylate kinase
total genus 76
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4x8lA00
5SZIA 3GLHA 2ONJA 4GDFA 4JBXA 4B47A 5K8IA 1T5IA 1UADA 3SFZA 1KDOA 2C96A 3QVUA 2XZOA 1M34E 5DI3B 1CLUA 4YXWD 2GZHA 5G3YA 3PUWA 4JL6A 3HPRA 4A6PA 5AJXA 2N1BA 2ODBA 4CVNA 1U0LA 5FL3A 4W5HA 1G3MA 3B9PA 4B33A 1XEXB 2C04A 3GJ5A 3BB1A 4PSAA 4Q03A 1SHZA 1GP2A 3AKEA 5FBQB 2BKUA 2YWGA 5L3VA 4AYWA 4DEXA 3GLIA 4QG7A 4WW0A 2R6GA 1EX7A 2VSOA 3CNOA 5B30A 1G3QA 4US1R 1N0WA 3U2QA 3CWZA 5IHPA 3HWSA 2QT0A 5JHGB 4IW3B 1E6CA 2VF7A 3ZZUA 3CLVA 1FUKA 5AJWA 3UIEA 3NH6A 4NYIR 4RY2A 1SVKA 1OIWA 2IYLD 1P7CA 3LBHA 1JPNA 4PFSA 1DVRA 1G5TA 2WAYA 1E2MA 1R5NA 2GETA 4HLDA 5TDHA 2HYIC 5JJIA 4HZUB 5EUQB 4HAZA 1T9HA 4HSEA 4CW7A 1OF1A 1OSNA 1GRQA 3EPJA 1Z0FA 1NY5A 2QQEA 1OXUA 3R9XA 2IXGA 2B8WA 3K0CA 3DM5A 2QTHA 2DYKA 2VHUA 4QGAA 2Z4SA 3LNCA 2R8RA 2J7PD 4KYIB 4NYJR 2HXYA 3VNVA 4KI0A 1CR1A 1NY6A 1P62B 1G4AE 1XEWY 2WKPA 1AS2A 1G8GA 2ZVPX 2MMCA 3RS5A 5K8LA 4MA4A 1HE1C 4L15A 4Q1BA 4TMVA 4NDZA 5G40A 4DEYA 3EPHA 4D82A 2X8AA 1G21E 1LF5A 2ZTSA 3U7GA 4KLZA 3NDPA 4O25A 4DWJA 2RGCA 4LCBA 4NE2A 4A8JC 1CU1A 1KI7A 1JAIA 3Q5EA 4OHXA 2IF0A 3K53A 1G9XA 3AGPA 4TYQA 3NDBB 4RCZA 5A4JA 3UWOA 1JR3A 1P2UA 2P67A 4UNPA 3KZ1E 4YC7A 5KOYA 2EYUA 2O8EB 3QEOA 2QGNA 2EU8A 4Q4JA 1JR6A 3K0FB 1G5PA 2G1KA 4TQUS 4A82A 3PEYA 3RHFA 2C9CA 4JYBA 4WVFA 1P3JA 3SR0A 5FH9A 3EWAA 1CRQA 1E2EA 5EE9A 1XCPA 4CEJA 2XSZD 1A2BA 3ICEA 2ECKA 4HZUA 3IKJA 4DLYA 1N5IA 4WOPA 3Q7PA 3WNBA 3BFVA 2YHSA 3P26A 1N6HA 4UNRA 1OHHA 4C7OB 1E94E 4D4MA 1QHSA 2OLJA 1BKDR 2WMNB 1XX6A 4ERNA 2JA1A 5TVKA 2ZM5A 1QVAA 1XTQA 1GNQA 3JVVA 1SXJE 2JJ2D 1Q12A 2RGDA 5J4HA 3OF5A 1P6XA 2A5JA 1Q1EA 3DL0A 5B57C 2FSGA 2QP4A 1UKYA 1HY3A 1X3SA 2YOGA 2IYVA 3I1FA 1BO6A 5JWOA 4DCVA 3K0SA 2OCPA 1JR3D 4XTRA 3THOA 2GJSA 1XEXA 2ZRKA 2OBLA 2CK3D 4NBSA 3VAAA 2J59A 2QT1A 1NG1A 4F92B 3KXKA 2VLIA 1KJZA 1TL7C 4XTCS 2DCUA 4IOMA 3I61A 1YZNA 3NIBA 1R0WA 2PMKA 3R7WA 3EPKA 2QMOA 3K0AA 1W46A 3GD7A 2KI5A 2XB4A 3K9NA 4C7OA 3P32A 4MYHA 4NP6A 4ZCIA 1V5WA 4GZMA 4IXNA 1IN4A 4TMZA 1ZRHA 1N0UA 2D7CA 4AK9A 2ZITA 2YJTD 3R7WB 4DUGA 4GOKA 2DB3A 3W90A 1WXQA 1CR0A 3SBEA 4URVR 2BMJA 1T6NA 4EFNA 1CTQA 4M1OA 5GJVC 3TE6A 3R20A 4TZ0A 2AFHE 1AM4D 4A6XA 3P27A 5DISB 1QF9A 3ZS8A 2V1XA 1XCGB 1IY0A 4IJMA 1FUUA 3C5HA 3VQTA 4YLGA 3LDAA 4PC7A 2XX3A 5FPTA 5FPHA 5EXTA 2TMKA 2YINC 4U7DA 3CONA 3THYA 1AJEA 5C2JB 4LJ8A 4PANA 4CT4B 1Z0JA 3GMTA 3B2EA 2CCJA 3LAWA 1E9DA 2RGAA 5D3QA 1KSHA 6Q21A 3AEZA 4Q1FA 4OBEA 4D26A 3AV0B 1UKZA 4KFUA 2F7SA 4LI0A 1FP7A 1CJKC 4LZZA 3FTQA 2QP9X 1LVGA 2REBA 1P2SA 3UWKA 1N5KA 2QA5A 3A37A 1HA3A 2RGEA 4CEJB 4ACBA 4W5JA 5AJYA 1CXZA 3AVPA 3PG5A 1P72A 3BFXA 3FMPB 4PR0A 4R7ZA 1W4BA 1DOAA 4WBSA 3WNCA 2ZS9A 2GXAA 1F3OA 1L4YA 2KSQA 3QXXA 4ON9A 4Q7MB 2GK6A 2CK3A 1KO8A 1NJFA 2QL6A 4LX0A 1Z5ZA 4NYJQ 4Q9IA 5JCPA 2AXPA 3QF4A 2R65A 5JFGA 1IN7A 4KVGA 4XSGA 2ZUCA 2FU5C 3V9PA 1HTWA 4YXWA 5AK0A 1MABB 4ILEA 2FJUA 3SDZA 3AVTA 1NSFA 2GTPA 1GFIA 3IO3A 1YZKA 4QC2A 3KL4A 1KHTA 2CNWD 3H4MA 2JLXA 1KI8A 2HF9A 2PLFA 1ZIPA 4LY6A 4B74A 4BUJA 1RFLA 3IIMA 4JLVA 2ZRFA 2R62A 3KJIA 2QPAA 4KYUA 2Q9CA 3QG5A 4B73A 3I5XA 3T06B 1EXMA 3LXXA 4ZV4A 4D4JA 5J47A 2QGZA 3LBNA 5E7JA 2I3BA 2GILA 5KO2A 4DIEA 1XMVA 5EQTA 1G7RA 2V4ZA 1II8B 1ZCBA 2GZAA 3B1WA 3QF7A 5AUQA 1Z6TA 3ONWA 3S1AA 5KPJA 1J90A 1CR2A 1KK1A 2F3RA 1FQJA 1WDTA 2NO1A 3A1SA 4TLEA 1R8QA 2GXSA 4XIGS 2FX3A 1SVWA 2AD5A 5TMPA 2FWRA 1NLYA 4DLTA 3QNUA 3SU8A 4A0FA 4BGDA 2NO7A 3CR7A 1EX6A 4J0QA 3PQCA 2QEQA 4FMCF 5EXPA 3RNLA 2X1VA 4O2RA 2YWFA 4CDGA 5KYKA 1WCV1 3QG1A 2WOJA 1KDRA 1P5ZB 3L0PA 5LBIA 5H68A 5KSYA 1U94A 2N42A 3GLFB 3TUJC 3CPHA 1US8A 3ZLJA 221PA 1GTVA 3PVSA 3Q9LA 4AG6A 1ZAKA 1AZSC 2F9LA 5KSPA 2A78A 2XSZA 4O2LA 2GCNA 1E9BA 2PL3A 3KFVA 1B23P 2DFLA 2JASA 5BWMA 3ZS9A 2XOKA 3NHBA 1D8TA 3LWNA 3X1YA 1ZM3A 1U99A 1SGWA 4ZDJA 5KDOA 4E03A 4CGZA 1AS3A 1JXMA 4AURA 1G1MA 1G19A 3SJAA 4Q21A 1DE0A 3QIAA 5FTMA 2RCNA 2OE2A 4NCIA 2NPFA 4DKXA 2BV3A 2WIBA 1W0JD 5JEEA 3IEVA 2A9KA 2Q3HA 2H92A 2QMEA 1VYVA 1ELOA 2R6AA 2Q3MA 4A8JB 2ZRAA 4HAXA 2V7QD 4P4SB 4G5GA 4DSTA 2VSXA 4JT4A 1Z0IA 2A3RA 1GRNA 3EWSA 4KODA 1H8ED 1W0JA 4JS0A 4M8NE 4BECA 3NBZC 1KNXA 1D2NA 2CJWA 3VR2A 1SXJB 4IOLA 3SBDA 4E09A 4AG5A 2HCJB 4TLCA 4DLZA 3DKPA 1BMFD 2DWQA 5HKKA 2GHIA 5G3ZA 1Q1BA 2VP6A 4B3GA 3T1OA 2ODWA 1VG1A 2J7PA 1G8PA 3IHWA 3AUYA 1ZU4A 2WSMA 5FOUA 4OHWA 1GITA 1ZNXA 3ADDA 1RZ3A 2NZ8A 4JLPA 4F4CA 4TL8A 1BS1A 2PX0A 5C4GB 2C9YA 4D81A 1FX0B 4LBYA 1E99A 2ONKA 5C4MA 1SVOA 1XXHA 4JL8A 4GFDA 1CP2A 5FUXA 1TEVA 3N2EA 4I1UA 2IC5A 2IF2A 2QP3A 3KUCA 3BS4A 4GT1A 4M1MA 4Y0VA 4Q9JA 1B0UA 1IN5A 3OEHD 2JJ1A 3ADKA 4DCTA 2QBYB 5CJ2A 2BBOA 3IPXA 2CL7X 2VO1A 4MRNA 5FPSA 5KNDA 4CRWB 4EPRA 2J0SA 2PX3A 1W48A 3KDSE 4TYNA 1RRPA 1ZP6A 4NCKA 4FMCB 3JZMA 1RPZA 3C4JA 2HCBA 1M6NA 5JWHA 2GF9A 3V4FA 1ZIOA 3CRVA 4IOJA 2YC2C 4B3DA 1WP9A 2WHXA 4RD6A 2O0KA 3Q85A 3EA5A 3DPUA 2CMKA 2D4HA 4W7SA 5A0FA 3AF4A 4C0LA 3A58B 4XWOA 4JKYA 4PX9A 1COWA 1VG0B 1FTNA 4DC9A 1OXTA 1Z29A 3FKSA 5DIFA 1NBMA 1ZNWA 3CRW1 2UVQA 1KY3A 4HAYA 1EFTA 1HV8A 3FHCB 5CIQA 4MGYR 4AY2A 2GVDC 4BQSA 4C2UA 4RVCA 2CNWA 3U3KA 1LY1A 3F8TA 2ZRDA 5BYJA 2CEAA 4DT1B 3MJHA 2GXUA 1E2LA 2ZSBA 2JIZD 2ZR0A 5D3MB 4D4KA 4ZDIA 2GJKA 2GDJA 2IYTA 3TBKA 1UM8A 4QJ4A 2MSEB 2ZUDA 4TL7A 1E0AA 5D3MA 1E96A 2J5XA 3MD0A 3TW8B 1C9KA 4F38A 4LHWA 1MR3F 1QHHB 1S4QA 5GVSA 3L2OB 4JLNA 4BFUA 3CIOA 4HLUA 3AVWA 3P20A 1GL9B 1KI6B 4HI0E 2D2EA 4FMBB 3ZVLA 2G9NA 4AKEA 4JLJA 1OT3A 2O8BB 121PA 1E0JA 4HB2A 3BERA 4PQFA 4RJLA 1JAHA 4V03A 3RABA 1OIVA 5H8WA 1YZLA 4JLOA 2YVUA 4KJZA 3AP1A 2ZETA 1GOTA 4HUQA 3WRXC 3IIKA 3DKVA 3SS8A 4B2IA 2B8TA 1ZD1A 3I8XA 1AKEA 1QHNA 1ZM4A 3FDIA 2D2FA 5DI3A 2OBNA 2VP4A 3B1YA 4QBHA 5BW8A 1K5GA 1NN1A 2BBSA 3B82A 3ZD7A 4LPSA 3I4LA 1AQYA 1IAQA 3CZPA 2GESA 4DRZA 4EJSB 3ZH9B 3SNHA 2Q6TA 1RYHA 1JXOA 3ZVNA 1G6HA 1ESMA 1G3RA 3SHFA 4FCWA 4B2PA 2PZEA 4MYUA 5JBQA 1Z6AA 3PUZA 2B7BA 2LKCA 2OILA 4M9XA 3T61A 3TH5A 1KZ7B 4KBFA 4TMXA 4D6PA 4QNRA 4Q1DA 1I2MA 2BIFA 421PA 3P4XA 4TTPA 4XD7D 3A4LA 1BMFA 2KBEA 4TMTA 3MG9A 4HAWA 1HYQA 1NBME 4NMMA 2QAGC 2GVZC 1ZUIA 2C78A 4ZKDA 3L0OA 2I1VB 4JVSB 2QY9A 4K81B 2DFNA 3U61B 1CJVC 2IEYA 1S1MA 1OFTA 1AZTA 1DTSA 2XZPA 1KJWA 2QM8A 3WMFA 4EDHA 4KLNA 3REGA 5FUWA 2CHVA 4PPQA 5DHFA 5JECA 3KB2A 2Z5FA 1VCMA 3GLGA 4C30A 4TYPA 4L16A 1J7KA 1PLJA 5AJZA 4WAUA 1SXJC 3H1TA 3RRYA 1AGPA 5DN6D 1OB5A 1F2UB 5DSZA 5UKDA 3N70A 2XNSA 2BMDA 2VL7A 4UNSA 2A2ZA 3OHMA 1XXHE 2G77B 2JLWA 4K8OA 3I62A 1N0VC 1G8HA 4KHZA 2V8OA 3TLXA 3FWYA 1YJ5A 1OHHD 3AP2A 2PBRA 4QL3A 4EQ6B 4IRUB 1JI0A 2QMUA 3GLFE 1W36B 1FW6A 2VF8A 1R6BX 4ZI2A 2V3CC 5EZ5A 4JMPA 3DMNA 3FMOB 1K6MA 1ZYUA 3CH4B 3SZRA 2GCOA 3T1QA 1TPZA 2WWIA 3ZGXA 3KKNA 1TUIA 1XMSA 2BOVA 2G88A 1D2EA 3FE2A 1S8FA 2B21A 2JLUA 4IFBA 2HLDA 2R44A 3V4RA 4RZ3A 3TSOA 4V02A 3U3MA 5DI9A 4G01B 1GDDA 4GPTA 2GEUA 1HUQA 1W4RA 4LJAA 4PTLA 3QXCA 2VYFA 1W7AA 4HAVA 2J0QA 1UBCA 5EP3A 2ZYWX 3QKTA 5FR2A 1O3YA 3DZ8A 4B48A 5FI1B 2G0NA 3UXMA 4D80A 4KITB 4GBMA 5AJVB 2WKQA 1NN0A 5B64A 1I4DD 2KWIA 4ASUD 4DDWA 4AKIA 3MFYA 1VG9B 1ZJ6A 3RSLA 4M2LA 2X19A 1Q21A 4A0HA 4B32A 2ZRGA 4GOJA 4I1VA 1ZBDA 4TLBA 2YOFA 2CE2X 3C5CA 3QOFA 2D7DA 3ZJYA 1X8LA 1JB1A 4UQOA 2D06A 2VHQA 3TIFA 1YE8A 4DSUA 5GVRA 1T91A 1OW3B 4IVPA 1FTSA 3Q3JB 3E70C 4XOIA 1W36D 1XEFA 4IVQA 2XZLA 4PAMA 3ZVMA 1W2GA 2VHTA 4Q1AA 4NZYA 5K8TA 2E9SA 2YKGA 1VIAA 3OFND 3NKVA 4ZIRB 5SZJA 1XD9A 5TB5A 3AKDA 4S2EA 1N6KA 2VQSA 3VR1A 2BMFA 1CS4C 2RGNC 3CNNA 4OHZA 3ZYCA 1ZCAA 1GRRA 2J1LA 2CCGA 3VU9B 1G20E 1Z0KA 1G3UA 4KO8A 3QPUA 4FWIB 4QXAA 2GCOB 1KO1A 1C4OA 2OM2A 5JLJA 4CEIA 3EG5A 4MGKR 4PAOA 4D0GA 5G41A 1Z07A 4M1WA 3MGCA 4R98A 4DDVA 2K5UA 2VBCA 1IONA 1TX4B 3CX7A 2F3TA 4HAUA 1R0ZA 4LRWA 1UBFA 5FOXA 2GZDA 1VIYA 2FPLA 2UZ3A 4RD1A 5HCNA 1OFIA 4G5QA 2QRZA 1E9RA 3NC1C 2A30A 1FNNA 4ZI3A 3W6OA 3AF1A 1N3BA 4HLCA 2JCSA 1N6LA 1P61B 4TL9A 2XEXA 2PMDA 1H65A 2Z6VA 1NKTA 3AGQA 3U3OA 3ETLA 4JLBA 4ESVA 4JLDA 2J3EA 5TARA 3WHKA 4TYYA 5CJPA 3EARA 3CBQA 3OIYA 4H9GA 1O87A 1BIFA 4YDHB 2VP5A 1VCNA 4B6FA 2VHJA 3A4NA 5DYGA 5LD2B 1GILA 4LJYA 3DOFA 3T12A 2I4IA 2YC4C 5EJEA 2A5DA 3HU1A 3W9YA 2FDCA 5EE5B 1ODFA 2VSFA 4HZIA 1W0KA 3FFAA 2ZVQX 3QENA 3A6PC 2G83A 2ZJOA 1UFQA 1UEJA 1WF3A 2HJGA 4IKEA 4A2QA 5KTYA 1N2CE 4AKGA 1JNYA 3OEEA 5K8UA 1F48A 4EIWA 3UK6A 2IHBA 2LKDA 3CNLA 4CT5A 2IYSA 2NO9A 3HU3A 4LHVA 4AWXA 2BM0A 2QORA 3O47A 1A5TA 3GLIE 1G7CA 1F5NA 1U0HC 1N5LA 2LWIA 5HCIA 5H70A 4MRSA 4A2WA 4C0SA 1E2DA 4IHQA 3ADBA 4OHYA 2JJ2A 2C77A 2W2TA 2GF0A 3QQ5A 1KI3A 4Y0AA 3UKDA 4BFXA 2ZYTX 4OHVA 4Q18A 5CYPA 3B6EA 4XJXA 1NLFA 3B9QA 4LBWA 4NTZA 5M04A 2ZS8A 3C8UA 3NBXX 3W3ZB 4D2IA 4FI3C 2BBWA 3RDPA 3K9HA 1GZSA 2ZAOA 2AR7A 2BC9A 4BFWA 3U4QB 2HV8A 1SKYE 1ZNYA 4OQLA 1SULA 1XB2A 3GJ8A 1LF0A 4QBFA 3V00A 2W0MA 3H84A 4GP6A 1TU4A 4QKQA 3VHXA 5JEDA 3W3AA 4TN1A 2QRNA 4Q9LA 4DLSA 1QHHA 3OESA 2CLDX 1G3IA 1XEWX 3GFTA 4PSVA 3IPYA 4D25A 4B43A 3SOPA 1G41A 4EFMA 3OE7D 1QG4A 2WPDD 3GLGE 4F4IA 3U44A 3S1AB 4DT1A 4OQMA 2V55B 4HB4A 2FGJA 5DH9A 1YZQA 4B3FX 3U44B 3I72A 5LDDC 3RSOA 4Q7KA 1XRJA 3QKUA 4ZCLA 3SYLA 5CDFE 2ORWA 1D6JA 1QG2A 4KSCA 1A2KC 4RZXA 2JLYA 2D62A 2ZANA 2ZJYA 4HLUC 1NVUQ 1DADA 1G16A 3MRSA 3Q7QA 2IEZA 4P32A 2ZROA 4B75A 2JGNA 2XJ4A 4TT3D 3C15C 5E7MA 2HYDA 3W34A 5JZVA 1E1RD 2ZUBA 1U8ZA 2KB0A 4Q4HA 3PR1A 5FTNA 3TSWA 3JVUA 1YVDA 1PUIA 5KHOC 4KCGA 3ADCA 1MABA 2IUSA 3A1WA 4BFZA 4OI0A 1R5OA 4Q4AA 1LS1A 1HE8B 1ZINA 1OXXK 2KE5A 2QAGA 1RRGA 3IILA 3LD9A 4TZ6A 4BFTA 4U5XA 1CJMA 5BN4A 1W36C 3AUXA 4TTQA 4QJ5A 5HZKA 2JLZA 4P31A 4MRVA 4WA7A 3CB4A 3HPQA 5FBVB 3DDCA 3X1DA 3OIUA 4IDNA 3BOSA 4YMTA 3PCRB 2ZQ5A 1LTQA 4EAQA 1DARA 2P5SA 1LW7A 3T34A 4LYJA 3W6NA 1XP8A 4AYXA 4MRRA 2GAAA 2I1QA 5C46F 5AUPB 2HJVA 3B5JA 2IYQA 3UMFA 1LNZA 3SYNA 4AKHA 1OFUX 4B35A 1L7VC 4LUCA 4KSBA 4C3ZA 3D31A 1E2QA 2IYXA 1KO4A 3G82C 4QNMA 4LHYA 1P2TA 1I4LD 3NC0C 2IS1A 3RS4A 2ZSAA 1Z2CA 3KB1A 3MUFA 2VP0A 4C0KA 3KQKA 1HQYE 1TNDA 1VYTA 2W00A 5CK4A 3O8RA 5EE1A 3QSYA 1XF9A 4EPWA 1JBKA 2W6JD 1HEIA 1OYYA 4HLQB 1QRAA 1H8HD 1Q22A 1SZPA 3NBFA 2H7VA 1GWNA 3TRFA 1XD2A 4MRPA 1F6BA 1Q3TA 2GEVA 1KKMA 4JL5A 4A8JA 1RJ9B 1U8AA 2XITA 5KUTA 1DS6A 4JZKA 1S2MA 5IDVA 4IFEA 1TQDA 1DAGA 2GEDA 2NG1A 3SE0A 2P3SA 4GMDA 1NMXA 4YDSA 4D4LA 3EXAA 5IF9A 5BN3A 2C8VA 4P33A 3TSZA 2Q3FA 2XTNA 3THXA 621PA 1II0A 1SXJD 2F43B 2NO0A 4LJ6A 3LXRA 1AKYA 1UEIA 4PHGA 5EP4A 2FN4A 4LHXA 4II7A 3AVUA 1E9EA 4DCUA 1X86B 4JBWA 1A1VA 3KUDA 2FSIA 1KIMA 4Z8XA 2NO6A 1G291 3IBYA 2ZJAA 2IXEA 1HT2E 2VEDA 4ZDWA 4Q4LA 1XD2B 3QUSA 2AKAB 1E1QD 3VU9A 3C7KA 3GLFA 3RLFA 4QOSA 4F91B 4G5OA 4MUBA 5FBWB 2HXSA 1XMIA 1Z6XA 2FG5A 3QBTA 1DAEA 3QXHA 2Q0HA 5CIWA 3AVQA 2ERYA 2FPKA 3TW4A 2O8EA 1DG3A 2PEYA 2PH1A 2V9PA 3EIEA 4YMWA 4PHFA 2BM1A 1UKVY 1YZUA 2NZJA 2ZYUX 4GP7A 1XWIA 2AWNA 2EW1A 1DEKA 4V0LA 1WB9A 1DG1G 2ASEA 3X1XA 3U4QA 1MKYA 4PPFA 1FFHA 2NMVA 1J99A 4IEIA 4OJKA 4BZPA 1DELA 3H86A 5E95A 2FPMA 3VKWA 4DLRA 5IK2D 4ZKEA 3RVBA 3N5CA 2FFBA 3K0FA 4MYCA 2HDNB 3EC1A 4EJSC 1E3MA 1NVXQ 3C41J 2C2HA 3RRNA 4IOKA 1LFDB 2O0JA 1DO2A 1ETUA 5JCZA 2ATVA 4V0NA 3WBKA 4UXHA 3IQWA 1E2PA 3LA6A 3A8TA 3W5IA 1E98A 2BEKA 1E4YA 2AKYA 1XTKA 2QBYA 1LB1B 1E0SA 2AHOA 4TSFA 4XSHA 2NGRA 3OAAD 4M1SA 1KSGA 2FA9A 2D74A 5EXSA 2V6JA 5FTLA 2QAGB 3HYRA 4PHTA 1F2TA 3AF2A 1U2RA 3MWJA 2QAJA 2F6RA 2WWGA 1XFAA 3VX3A 3AKCA 3K70C 1BYUA 3R9WA 5EXXA 4FIDA 3W5JA 8OHMA 4US2R 1G5RA 3FHOA 5FPKA 4HDQB 5E4FA 1W47A 2VP2A 1NN5A 1YKSA 3CUEF 4OK6A 2ZRPA 1UAAA 2IL1A 3QF4B 1ZVQA 2RH5A 2EWWA 2O0HA 3GEEA 2OXRA 3K9LA 2QSYA 2ATXA 2OFWA 3CPEA 4MKIA 1YQTA 4H1VA 2O8FB 3B7GA 3GJ0A 3TK1A 5DE3A 1P2VA 1NKSA 3FOZA 3PJRA 5DO9A 2HF8A 5FL7A 5JI2E 1X1SA 3CPJB 2W6ID 1DPFA 1Z6GA 2FNAA 5IRCD 2X2FA 4G1UC 4RKFA 4ZCMA 1E2NA 1QHGA 4TLAA 2BEJA 1Z08A 2F55A 1XDBA 4LGMA 1EFRD 3QVVA 4MKGA 4UXJA 2DFTA 3O8DA 3FMFA 2WIAA 3ZQ6A 4BLQA 3LQQA 5L3QA 3AB3A 3G0HA 3K09A 2Q21A 3DMDA 3FPAA 5DHAA 3CKLA 3THYB 3KKMA 4XVUA 3B8HA 3FB4A 3X2SA 1SVIA 4FINA 4B3CA 2W6JA 1KZGB 3T5GA 2WSSA 3GFPA 1KNQA 4DLWA 2JLQA 1EK0A 1W4AA 1S9DA 4GNKA 3MLEA 4HEJA 4I1OA 4MQBA 4G3XA 1VCIA 3WMGA 1XNJA 2H17A 3BB4A 3PUYA 3DM9B 1RW4A 3GJ7A 4DLXA 1U81A 3IDQA 2J46A 1OH5A 1HT1E 3QY0A 3PEWA 4A36A 2OAQ1 3VR6A 2QE7A 1ZNZA 4PZLA 2XNDA 1IY2A 2MSDB 4IVRA 1MV5A 2IX3A 1US8B 1QBKC 1E0KA 2ZI7A 1Z47A 5GADl 3PEUA 1L8QA 5H1YA 2WM9B 4BEBA 1R7RA 5AUNB 1N6NA 1R2QA 4BZQA 1KKLA 2C9OA 4DB4A 1ZC4A 3QKRA 1QZXA 1Q57A 2ZE6A 2ZAMA 1OKKD 1OV4A 3EZ2A 2GJ8A 2VHCA 2ZR7A 2X2EA 4NH0A 1DAMA 2QM7A 3D7MA 4XWKA 5CK5A 3CM0A 1XTIA 4JT2A 1UKEA 2KJQA 5JI3E 3WYAA 4D0NA 2EFDB 1MRNA 2MSCB 3K8YA 2ZEJA 4OK3A 1XZQA 3HP1A 1II8A 4KVAA 1PVOA 2F1RA 1MT0A 3QI2A 3I32A 1RKBA 1IXRC 4NL4H 4TT3A 1G4UR 1M2OB 2DHRA 3GLHE 1A7JA 1MO6A 1T3LA 2XNDD 2P6RA 2ORVA 3TQFA 3EX7C 2N46A 2XTZA 2QSZA 3QKSB 4DCSA 3I5YA 2RKOA 3EA0A 1P73A 4JIMA 5FOVA 4MGIR 2GJ9A 2FFAA 4M22A 2EWVA 5TXGA 4X8HA 1HURA 2IK8A 3ZIAD 4EFLA 2ZXUA 3QPWA 2ANBA 5DLQC 1D5CA 1CRPA 4YMVA 1FOEB 3RRZA 2ZU6A 1E79A 1JEDA 3KXIA 4ARZB 3EASA 2WPDA 3J81k 4UJ5A 1DAIA 4O3MA 2IT1A 1LV7A 1JPJA 1Z06A 2FZ4A 4NCHA 5C1BA 5JJKA 3TJZA 2D3WA 1XCMA 1F2TB 1OKKA 1PJRA 2C03A 4I99A 2RGGA 1UJ2A 3KJEA 1GL7A 2BVNA 3BGWA 3LX5A 3D6TB 2WAXA 3CF0A 1A4RA 3LX8A 2F1JA 2BDTA 4CF7A 2FFQA 1J70A 3EZ6A 3PXGA 3CF6R 1L4UA 1QHXA 1IJEA 1YR9A 3K0EA 2IXFA 3KKOA 1MOZA 3LO5A 3CX6A 5LB2A 1SKQA 4DLVA 1XPRA 3PFIA 1FX0A 1DAHA 2O5VA 2ZE5A 5F9FA 4M53A 1CEEA 2RGBA 2PJRA 3EZ7A 4TMWA 5CDFA 1J8MF 1YRBA 3B1ZA 3JZAA 1MO5A 2ZE7A 4JYCA 3MMPA 1P9RA 4JLMA 4WXPA 3L0SA 4URUR 1M74A 2Z83A 4EPXA 4TQAA 4A15A 5F2EA 2Q9BA 4UNNA 2WJYA 5J5CA 4MKHA 4GOXA 4BWYA 3ND9A 5FUYA 4FMDF 2PLRA 1NJGA 4FD2A 3BD9A 4JBYA 4RSGA 1XD8A 4OL0A 3NVAA 4AD8A 4URXR 3FKQA 3LFUA 4I4LA 3K70D 4A92A 1SVSA 1AS0A 4Q00A 5KNBA 1AA9A 3SHWA 3P4YA 3RS7A 1BYIA 1NMZA 4NYIQ 3MWYW 1JQLB 1IXSB 5AR1A 1XJCA 2L0XA 4TSFD 1OLOA 2FH5B 3K9GA 3SI7A 3KJGA 4DXAA 4PHHA 2QU8A 2RHMA 3WYFA 3ICQB 4Q19A 5J4YA 2CHGA 2PCLA 4E22A 2VP9A 1JECA 4XD7A 3AM1A 1IBRA 3HJNA 2XXAB 2AK2A 3U3RA 4EPVA 2BJVA 5KSOA 2EFCB 4LV5B 1VDZA 1X8JA 3SN6A 1MRSA 4LJ7A 5FOSA 4MGZR 2EQBA 4Q01A 1RC8A 2XXAA 3QJYA 2O8BA 3R9IA 1IJFA 1N25A 2GBLA 4V0ME 1T8UA 4KV9A 5A5GA 3AKYA 2OCBA 5J40A 1WRBA 4LJ4A 1KI6A 3F3YA 1SVMA 1KI4A 4PO1A 4WIAA 5FPYA 1NVVR 4K46A 3C14C 3CZQA 4NYMQ 3THXB 4L8GA 3B60A 2VH5R 3UMRA 3BRWD 1TQ4A 1PV4A 1FL9A 3M0EA 2NPIA 4BZXA 1G7SA 4NCNA 2ZJ5A 2OO7A 3LH5A 4KFSA 1F2UA 2DR3A 3P1JA 4FCTA 4OYHA 4IDPA 2IS6A 2YWEA 4LV8B 3EZ9A 1IN8A 1T8TA 1XJQA 4C0AC 4P4TA 2OEPA 5HE8A 3Q8XB 1KY2A 4A0RA 4N3NA 3U5ZB 5HR5A 3WXMA 2DBYA 2YZ2A 4HB0A 4B34A 1XTJA 4G5RA 5IK2A 4Q4JB 2WJJA 4A0GA 3AF3A 2REOA 1E79D 1Z0AA 2H57A 5CLLA 3WYGA 1MH1A 3E1SA 2C98A 2OCYC 1ZUNB 3TR5A 2O8CB 1MO4A 5J4KA 1IY1A 2JLSA 3NHAA 2WWWA 3RANA 4BRWA 2DWOA 1QVRA 5AUOB 1KOFA 4N0EA 3RS3A 3PUXA 4GSYA 4XH9B 4BFVA 4FWTA 2FEOA 4LHZA 4DDUA 4DBLC 4CEHA 3GQBA 1OIXA 4LOAA 4FN5A 2ZREA 4PC1A 4Q7JB 1COWD 4YMSA 3EPLA 4C2TA 2O52A 4M21A 4Z1MD 2Z4RA 1Z2AA 3NWJA 3QXJA 1KI1A 3MCAA 4JJZA 3FMIA 1VHLA 3WMEA 2CE7A 3SFVA 2WWHA 3ZD6A 4GRAA 3FYHA 3GJ6A 5F98A 1Y3AA 1EWRA 2P6UA 4HYYA 3ZQJA 1Q20A 5AWFC 3IEUA 3ZVRA 4HUQB 3BK7A 3IHLA 1AK2A 5SZHB 4A9AA 3DVLA 3UPUA 4PZYA 1Q44A 1SVLA 1BOFA 2CCKA 2JJ1D 1R4AA 4ZO4A 2Y8EA 4Q7LA 2OAP1 4PXAA 3SYKA 5EUMA 4PQYA 5LPNA 1FZQA 2ZI6A 5BQ5A 3R8FA 4OJQA 1GKIA 4G0NA 1EFRA 1EG7A 1GIAA 2J45A 1E9SA 2QNRA 3HR8A 1E32A 3W8NA 4DB2A 2GBLC 4QHTA 2QE7D 1GG2A 2V1UA 2WICA 4A2PA 1M7BA 1TQ6A 2J9RA 2ZI4A 4LC1A 1E2FA 2A7QA 3D8BA 1ZC3A 2R6DA 3I92A 4LYFA 1U9IC 2OUKA 2ODEA 2JLRA 3B78A 2HT6A 2QROA 1IQPA 2REXB 1AQUA 1GKUB 3EW9A 3KTAA 1N6PA 1TMKA 3WY9A 4TYWA 2RGNA 4RZUA 2FEMA 2OXCA 5CITA 1XTRA 3CR8A 1ZD9A 1N6IA 2KBFA 1E9FA 2OV2A 2QPOA 2IYWA 2V6IA 1OH6A 3K70B 4W5WA 1EFHA 4MKFA 2F43A 4LC0A 1K8RA 4BRUA 1QHYA 4Z1MA 4NYMR 4S35A 5BYKA 2ZRHA 5HZHA 3A4MA 2UKDA 1NVVQ 2FSHA 4QFMA 3KFXA 3AVOA 2V7QA 2ZJ2A 1WBDA 3BAFA 3EAQA 1UF9A 4LBVA 2WJVA 1KI2A 2CHQA 3QKRB 4JLKA 4QRHA 1RJ9A 1OXVA 3DHWC 2ORIA 2ZJ8A 5CB6A 1NN3A 4C0QC 2OESA 2ZE8A 2IYUA 2QUZA 3TNFA 2IS2A 5TY0A 3PIRA 1KDPA 5FL7D 3CX8A 1ZW6A 2IUTA 3KKPA 4BEJA 5JWRA 4N1AA 2R6FA 3DOEA 1Z63A 3THWA 3H2YA 4L5BA 2XTMA 4DIDA 2IYYA 2VPPA 2EVWX 5P21A 3WBJA 1RIFA 5EE0A 3BC1A 5L3SA 1VKJA 1GAJA 3BH0A 5HTKA 2OSBA 4Q48A 1U98A 1SHKA 2BHRA 3BJIC 4KFRA 3WHLA 3RC8A 1NIPA 2ERXA 4PPNA 2WWYA 2W0SA 4RZ2A 2ZU0C 3LY5A 1M7HA 3IBGA 3QXSA 2EYQA 1XBTA 3LVRE 4NHOA 1VHTA 3OAAA 1FMLA 5ANRB 2IHYA 2ZSEA 1G7TA 1XU4A 2QTVB 4E5UA 2BCGY 2WKRA 2BBTA 1E1QA 3EZFA 3VHLB 1FNMA 3FGNA 4XWAA 3OE7A 5E7IA 3KXLA 1FP6A 1QDEA 3GJXC 3M6AA 2ANCA 5DYIA 1R0XA 3CF2A 4WXRA 4DVGA 2PT7A 1GNRA 2QTFA 4R2IA 2G6BA 2H8KA 2VA8A 1IM2A 3EC2A 1EWQA 2WTUA 1LS6A 4PSKA 1E2KA 1ZD8A 2EFEB 1E2GA 1UBGA 4DHEA 4EPTA 5F3WB 4C0JA 4U02A 2QN6A 3F0TA 4Q4HB 4HDOB 3CRMA 2O8FA 3PEVA 3RC3A 5CB8A 4MYTA 1EFUA 1TF7A 1NLZA 4UXIA 2AWOA 4IDQA 2R9VA 3TGPA 1E9CA 4P0TA 4Q5IA 3CRQA 3VFDA 2AFIE 3EIQA 3UANA 4LYHA 2FFHA 4L9WA 4DCNA 4JSTA 4M9QA 4R2HA 3T15A 4B3BA 3THWB 1KGDA 2P65A 3H0KA 3DEFA 4Q47A 3WNDA 1GUAA 1W1WA 4A1FA 1GL6A 2HUPA 3FKSD 4CEIB 4ACAA 1II9A 5FR1A 5J4VA 1OPXA 3EIHA 1P4SA 4TLDA 4ITRC 2J0UB 2WBLC 2OZEA 1HQCA 1T3SA 1XJ0A 3ND8A 2Z43A 5EP1A 2DPXA 4Q4AB 1AIPA 5CM9C 4DZZA 5G53C 1KSJA 2FMXA 3BXZA 4IDOA 3U6KA 2CXXA 2GKSA 4NPHA 3CWQA 4A4DA 2GNOA 4WZAE 2AD1A 3B1XA 4E07A 4RD0A 1L2TA 4R9UC 4LJ9A 4CZ2A 4V0OA 4RFSB 1W0KD 3SC3A 3OEHA 3KQUA 1ZMXA 4JSYA 4BLTA 4O0MA 2AXNA 5FTKA 4U00A 1PLKA 1Q0UA 4HATA 1IHUA 2G1JA 2DFKB 2XJ9A 3U7EB 4Z54A 1VECA 1TUEA 2J0UA 4IEEA 4Q1EA 3M1IA 2QENA 4RCYA 4EKDA 2IW3A 4QGFA 4DJTA 4I81A 1K5DA 5HE9A 3L82B 2NQ2C 1H8HA 1CF4A 1KK2A 2YOHA 2C95A 2OG2A 4GMXA 2SHKA 3T35A 3PV0A 3W8RA 4MH0R 1Q1QA 4B71A 2VTKA 3ZZ0A 4ZDKA 2OFOA 1NVWQ 1JR3E 2YNMA 3ZIAA 5HKKD 4M9ZA 1IN6A 2AK3A 3MWKA 4BLPA 4QM6A 3A36A 1P75A 2ZRIA 2WJGA 1NL3A 1VTKA 2F1HA 1KAGA 2WMOB 3GLHB 4F7WA 5DNYB 2ZRLA 5F9HA 2GA8A 4Q1CA 1TQ2A 2WZQA 4M1KA 5JRJA 4JKIA 1S0UA 1I2DA 4EPYA 1RVDA 5SZKB 3E5HA 4B2LA 4QBIA 3BE4A 2IWRA 3AVYA 1E69A 1ZUHA 4Z8YA 3NXSA 5GJBA 2J87A 2HT1A 2JLVA 4BFYA 1G64A 1Z6YA 2J7KA 5JSZA 3GLGB 2CVHA 3A1TA 1KI9A 3K0CC 3AVXA 1D9XA 1KO5A 1KMHB 3BORA 3L8YA 4LV6A 4LSGA 4PC2A 1G17A 3T1TA 3SJBA 2OCAA 4OQNA 5HPYB 1U8YA 2ZRMA 1TF5A 2Z0MA 4PO9A 1Z8FA 4OQXA 3U6BA 1JEEA 2O8DA 1XMJA 4PZZA 4Z51A 1YHNA 4M1YA 3SQWA 5L3SB 1KK3A 1OYWA 1J2JA 1RE0A 5IT5A 4URYR 3TAUA 1R5BA 2B92A 4BLOA 1CJUC 1OE0A 4RD4A 1YU9A 5KDDA 821PA 4D0LB 4F4JA 4JJKA 2XB2A 1ANKA 2QMHA 4KU4A 2ZRCA 5CM8B 2ZRNA 3L43A 4AYTA 2OHFA 2ZI3A 3B85A 1PLLA 4FW9A 2NIPA 2ZIAA 1TADA 2H16A 3KKQA 2JAQA 4RFVA 4WZBE 3BFKA 1D2MA 3GJ4A 4ASUA 1NSTA 3MWLA 4FCVA 4UJ3A 4KXFB 2IYRA 3GP8A 4BASA 1NG9A 4ABYA 1NNEA 1DO0A 4DSOA 4BLSA 2FV8A 2WVJA 3WP0A 3O8CA 1RRCA 3SEAA 1KMHA 4GI7A 5L3RA 2ZJBA 2GJAA 2GRJA 3LW8A 3TUZC 1KTVA 2BCJQ 2WSSD 5C18A 3SJCA 4P3YA 2ZRBA 3LQRA 3IIJA 1G8YA 4LWZA 4QM7A 1X6VA 2P0EA 2PZGA 2RAPA 2HLDD 3K0AB 2H1LA 3OIVA 1G6OA 1Y63A 4W9MC 4ESHA 4MITA 5E3HA 4CYMA 2YWHA 4LYAA 1OH8A 5KU1A 1UPTA 5GJCA 3U7HB 3PITA 1XZPA 2QZ4A 4M1TA 2DY1A 1WE2A 4OQFA 3KTAB 1SKYB 2CLSA 1N6RA 5FTJA 2OFXA 3LW7A 1YR6A 4B3XA 4CIDA 3FFBA 2OLKA 1UBEA 1NRJB 2RGXA 1OXSC 4BE7B 5DGXA 3TVTA 3GEHA 3IUYA 2PCJA 4DDTA 1E9AA 3A1VA 2GXQA 1WQ1R 3DZDA 5JMTA 3VR4A 3NTUA 2A5YB 3DO6A 3IQXA 3NH9A 2PEZA 1WMSA 5DN6A 5FOWA 3T5DA 2R2AA 1N5JA 3KQNA 5B2ZA 4PC3A 1JALA 1E4VA 3TKLA 5FI0B 1AGRA 3Q5DA 3HYTA 4C0BA 1JJVA 4M0LA 3NBYC 1RYFA 4B76A 3GLIB 3K1JA 521PA 4UNQA 2JATA 2VRWA 3ZDQA 1XTSA 4NKRA 3SJZA 4R71A 3OEED 5JS7A 4HDCA 4X8OA 3T1VA 2V54A 3CRRA 2YYZA 4Q66C 1U90A 2E1RA 1I4TD 1NMYA 4RFSA 3ASZA 4US0R 4L4UA 4NU0A 5KNCA 1W44A 1VCOA 1OJLA 4KBGA 3PENA 4EQ6A 3ECCA 5BN5A 2W58A 1EFCA 2F1IA 1SQ5A 3NEJA 3U7FB 3QEJA 3LLUA 2J41A 4PC6A 2BJWA 1C1YA 1FMJA 1QHIA 3KX2A 3N2IA 2OBMA 3VMFA 4MDFA 1EGAA 4YMUA 4RD3A 2B6HA 1HH4A 3NG1A 1FPMA 3AF0A 4M4SA 2AN9A 3UG6A 3X1ZA 4DSNA 2ZI5A 2JIZA 1BH2A 4JLAA 1W4CA 3GPLA 3KQHA 3BBPA 4YONB 2A5FA 2CL0X 5CLQA 3BWDD 4PAQA 4DUGD 1P9NA 3GEIA 1F60A 3TAHA 2FF7A 1T0JB 4CEHB 3HDTA 2F9MA 1YZGA 3FHTA 3BH7A 1J8YF 4C0HA 1OFHA 5FFMA 721PA 3U60B 1YR8A 1KYIA 4JVNA 3TMKA 3BH6A 2GWHA 2ZI9A 2ZS7A 4FMDB 3VTKA 4ARZA 3TUIC 4XVRA 3M4YA 5L3QB 2P2LA 3RYTC 1R10A 2FSFA 5FBRB 2IA5A 3AVVA 1GVNB 1W2HA 4QBGB 1GSIA 1WA5A 4OK5A 2CJWB 1V43A 2RHDA 3AP3A 4GL2A 1NP6A 1Z28A 4OI4A 3BB3A 4OKSA 1TF2A 3A1UA 5KDLA 3QKSA 3VKHA 2ZSFA 3UG7A 2WWFA 1Z22A 1ONBA 2MMGA 4TMKA 3OFNA 4V0MA 1T5LA 2W83A 3QBVA 3ZZTA 1OB2A 2CVFA 2QI9C 2AL7A 2B7CA 4OI2A 2P5TB 4QHYA 3QPVA 4AC9A 1VYUA 1VMAA 5KPDA 1CULC 2CDNA 3UATA 2XAUA 3U3JA 5BXQC 3I3SR 1TTTA 2LCFA 4KFTA 2CBZA 4QJ3A 4X8MA 2FZLA 4YQFA 1G18A 4C4PA 2GCPA 2IS4A 2Q9AA 3K09C 1A82A 3GFOA 2ZRJA 4P4SA 3IO5A 4IXMA 1DBSA 4PO8A 4C9BA 1Z0DA 2EFGA 1KK0A 2IWHA 4QGHA 3FVQA 1M8PA 1JJ7A 4LPKA 1S9HA 1XPOA 1ESNA 1W5TA 3NEYA 4RKEA 3KQLA 3CH5A 4PPGA 5LD2C 3VKGA 1IXZA 4MUAA 4BLRA 3O8BA 3R8CA 1YZTA 2GAOA 5GJWC 3RS2A 1M7GA 2WOOA 2CL6X 3RWOA 1VPLA 5ELXA 5LB4A 2WJHA 3RWMB 1Z83A 4DLUA 5JS8A 3AQ4A 5CYOA 1NF3A 4LDJA 5JHHB 3VR3A 4MDEA 2YV5A 2VIIA 1Q3HA 1CR4A 2HEIA 1H8EA 1UDWA 1VG8A 1KMQA 3TVDA 1T0HB 1CJTC 2C5LA 1KJYA 4M9SA 1NI3A 3CW2A 2JEOA 2W2XA 4ZIRA 4POAA 2WWXA 1XPUA 4H1UA 4HUTA 3I73A 3RAPR 1ZU5A 3CO5A 4X8LA 2FOLA 1NIJA 1CIPA 2H5EA 2JDIA 4LK2A 2XGJA 3AH8A 3RRMA 1G8FA 4TQ9A 2W6IA 5EZ6B 2RMKA 4EUNA 5FUVA 4Q9HA 3MJRA 2QPTA 1TU3A 2QG6A 2JJ8A 2WJIA 3VR5A 1TEXA 4NONA 4QHSA 2BKEA 1Q1ZA 3C16C 4TTRA 2G3YA 2XOKD 2H18A 3HU2A 3GJ3A 1E2HA 2IBMA 1R8SA 2GK7A 4G5SA 3REFA 4UKDA 3MAAC 2PT5A 1W5SA 3VX4A 1E1RA 3KJHA 3LBIA 3LVQE 1JQJC 2P6NA 4WZ6A 5JRZA 2JDID 4QGGA 3L0IB 2ZJZA 3I8SA 3WRYC 4B6EA 4I1SA 1KDTA 1N6OA 1IOZA 1T3HA 4AIIA 3OZXA 3GCGA 1CBUA 2BWJA 3B1VA 1P9WA 4Q9KA 3PUVA 1E2JA 1KSFX 4V0KA 3QE0A 1Z3IX 2NOAA 3BIFA 4BFSA 3SQXA 1X8KA 4Q02A 1U9IA 2UZIR 1OH7A 1ZM2A 1DAKA 2X77A 1AN0A 1ZM7A 2ZPTX 4F93B 2BMEA 1X1RA 2ZR9A 4KAXA 2J0VA 2QQ0A 4P4UA 2E87A 1E2IA 1KO7A 1T4GA 1UDXA 3X1WA 4XVQA 1GM5A 4BPBA 5JJLA 2WV9A 3LRPA 3IGFA 5J4LA 2PJZA 1M1YE 4TWZA 2R6CA 1EESA 2PZFA 1S3GA 5B58C 3L8ZA 1XXHB 2AX4A 2FE4A 1GNPA 1S3SA 4ZPXA 5TV2A 3D3QA 1P60A 4IDHA 1FQKA 1WBBA 3E2IA 4FXPA 2IUUA 4JVLA 4HB3A 3MSXA 1CKEA 3UMSA 4GZLA 2O8CA 2NTYC 1NBMD 2EFHB 4L9SA 4TL6A 5FOTA 2G0TA 2DWPA 2O8DB 1U0JA 3F5FA 2CLCX 3Q72A 1S1CA 1YRAA 2FGKA 3HR7A 4URZR 1W49A 3WP1B 4PQRA 3LLMA 1GKYA 4RD2A 1PZNA 4NCJA 3B13B 4LBZA 1ZM9A 5EP2A 3W6PA 2ZSDA 1TAGA 2IYZA 4EJSA 3G5UA 2OT3B 1R0YA 2ZYVX 1YR7A 3LV8A 5JSZB 1DAFA 1SXJA 2ODNA 2W2VA 4LJ5A 1S96A 4URWR 1PUJA 4JVMA 3TQCA 1D9ZA 5KSZA 3RS0A 5FBLB 1KAOA 4N0DA 5EE3A 4OI1A 1RRFA 1MO3A 2RB4A 2A5GA 3TR0A 5L8VA 3ASYA 4B44A 3VNUA 3OIWA 4AI6A 2C99A
chains in the Genus database with same CATH superfamily
1KH1A 4MQ5A 5SZIA 1H1TA 1GADO 1A7AA 1ODCA 1RWPA 4G5FA 1XZ8A 2ZJ4A 3K31A 5A4AA 4ZOLB 4OSEA 1T5IA 3SFZA 4BX9A 5F5LA 5HIMA 1M34E 3KYCB 4N41A 1YVEI 1OTXA 4K6OA 1CY0A 3LX4A 4YXWD 1OXBB 5KQGA 4A6PA 1YZYA 3ZHSA 5K6AC 1F7UA 4Z4QA 4UAVA 4CVNA 1FEZA 4CG3A 4BMNA 3SEFA 1G3MA 3GBSA 1WHSA 3B9PA 4B33A 3ASUA 3GJ5A 2EGUA 4HTAA 3BB1A 3GRYA 3IBSA 5F78A 4B8WA 5BV8A 5I7EA 5BQPA 5FBQB 3C4VA 4CMHA 2K7FA 3HXOA 2FOIA 4LOJA 2NX2A 4JUFA 4J1TA 3GLIA 2GPYA 4QG7A 1TTHA 3L7CA 3Q1KA 2R6GA 1C9NA 1EX7A 3CNOA 3DKRA 3C3BA 3VRHA 4CKCA 4ZYYA 5B30A 5L6LB 1N0WA 2C2ZA 1HPLA 3R76A 1CERA 1YNOA 1UBLS 2YUIA 3IMFA 4ZEXA 4CKCB 5M5BA 1H4SA 3CLVA 1JFTA 1T8WA 5I7AA 2CNOA 2Y1LA 3PSHA 4NYIR 1WSDA 2NUTB 1SVKA 1J2EA 2H1FA 2P6MA 3LL7A 3IJEB 4OF4A 4P3OA 1P7CA 4PLCA 4BL5A 3MRVA 2WFLA 2Y1EA 2EJCA 3DTYA 4G67A 5JJ5A 3OUTA 3BHNA 5LQRA 1M0WA 5AM1A 2JI7A 3EQZA 1RM4A 5EIWA 2VNHA 5D1NA 3T7TA 3UMBA 4WLEA 4ARVA 1PZMA 2COUA 2QZJA 3CISA 3M82A 1OLXB 2QY6A 4HKTA 1X9HA 1ESZA 4DILA 1GRQA 2PXAA 1Z36A 1J8QA 1GGVA 1OXUA 2CXSA 1M54A 1Z33A 1RWWA 3FNGA 4AXXA 3Q3GE 5AW3A 3GT3A 1BXKA 2DYKA 1C8VB 2QSJA 2QTHA 3LNCA 3Q40A 2R8RA 4XFKA 2J7PD 5BQOA 1P0CA 4KYIB 1ULUA 3H19A 3ENWA 3RUAA 4ZQEA 3KB8A 4IY1A 1E59A 1QX4A 1NY6A 4RA9A 3S2IA 3H5AA 1JIKA 5HKBA 2GPNA 2IH2A 3STYA 1XEWY 2D7JA 3CVOA 3OA2A 3OI7A 5IWAB 3DC7A 2VAXA 2D8AA 3WJ7A 4FMPA 1J21A 2QX4A 1TTPB 3Q8WA 2G25A 5C8VA 3OX4A 1L4GA 1EB9A 4MV0A 3JTEA 5EZQA 5TMEA 1TJPB 1VHQA 3J80A 1KQ3A 4LC9A 2HUNA 3NDPA 4IDBA 2Q46A 3IPCA 2RGCA 2PAAA 2WT4A 4BP1A 2BGGA 4MWOA 3WADA 1IZ7A 4ODIA 4M3NA 2VUIB 3RH0A 4WESA 4NENA 4KO4S 3K53A 3CLSC 3AGPA 1BDBA 3G9XA 3KEMA 4TYQA 5K3SA 3NDBB 4K0KB 2AH5A 2EZ9A 3NHYA 4FOLA 2M1ZA 5A4JA 3UWOA 4MA0A 1J9GA 1CDEA 2NPOA 4UNPA 4RMIA 2FDXA 1YJCA 2UZ4A 2IIBA 4OIFA 3R0QA 5TEWA 2O8EB 3QEOA 2D1RA 4Q4JA 1JR6A 1ISRA 4UPDA 1HEYA 4A82A 4REQB 3WGOA 1I7NA 4RNDB 4AG3A 3A2LA 3ZCPA 4OG2A 1CHDA 2B98A 4QTYA 1QNFA 2GX6A 3NHUA 2HMYB 4HDKB 1CRQA 3LHFA 3GRUA 4MROA 1NDUA 2XSZD 4GZ3A 1FXWA 3BGDA 3FSEA 4FTWA 1D4ZA 1XVVA 3ICEA 4N40A 2O7SA 2NU9A 4DLYA 4NG4A 5YASA 4DM3A 1YDFA 1I3LA 1N5IA 4HWPA 1XU9A 2W4MA 3WNBA 1FMTA 3C6BA 5IYZF 3IUBA 3UJ8A 2XNKA 3BUSA 4Q9DA 3D1VA 1OHHA 1E94E 1QYXA 3BVPA 1JHQA 5JMPA 4PSUA 2PQ0A 2QVBA 1QVAA 1PCXA 1QFYA 1ZIDA 2JJ2D 3CIFA 2RGDA 2QTRA 2VNAA 1RPJA 1KY5A 3U4CA 1UK8A 3DL0A 4J91A 3AERA 3L7JA 4GRDA 4KRFA 2YOGA 4PZPA 3UT6A 4BLUA 1V7QA 1PAUA 3KVYA 4TUYF 2OCPA 1JR3D 2PD4A 1M5TA 3ROFA 3GP8A 2ZKIA 4TM8A 1G6KA 4LXQA 2ZRKA 2OBLA 4NBSA 1NYRA 4L78A 4XLLA 1NG1A 2HJ9A 3IA2A 3KXKA 2VLIA 2ZSHA 2Q0XA 5EMJA 1IB6A 1MGOA 2J4CA 3QVKA 4KDEA 4XTCS 3SPXA 3NIBA 4DC9A 2PMKA 1NM5A 3R7WA 1REQA 2H9AA 2KI5A 3K2QA 1UZNA 3P32A 4PLWA 1KVUA 2VTDA 1YFLA 4YP5A 4GZMA 2I54A 1HEUA 1DEXA 1DBWA 2FRDC 2CHFA 4ZQFA 4OM8A 2D7CA 1RU3A 4DMKA 4GW3A 4L5CA 2ZITA 2XW6A 2YJTD 1V2GA 4QUEA 4ZOCA 5A6SB 3WZLA 3QU5A 4CMJA 5K4GA 3COJA 4YPOA 2AEMA 1SOVA 2FOXA 5CDSA 2ZAYA 3W90A 3X43A 3FWPA 2BMJA 4GDMA 3VI4B 3CGWA 1SBQA 1ESEA 4EFNA 5BRNA 3U7QA 4DHWA 1MVLA 1RWOA 1SOAA 2NUAA 3R20A 2AFHE 3PEFA 1YQQA 3NYRA 1RQXA 4KW7A 1PTJA 2XT0A 4LZPA 4Z5XA 1P45A 5HK8A 3NNSA 1LLDA 1QF9A 4JBLA 5DISB 3VR6H 5ALPA 4N18A 4B7ZA 5K0FA 1IQUA 3RIYA 5HIAA 1EGQA 1B8NA 4MQEB 4PC7A 5FPTA 1QFXA 2JCBA 5FPHA 2TMKA 4U7DA 5AESA 1UXJA 5C2JB 5HFJA 3CLUC 1OROA 1Z0JA 1ZLYA 4LZLA 5L7TA 1LBHA 2IELA 3LAWA 3GLVA 4QEZA 1E77A 2ARKA 2I33A 3RTDA 3AEZA 2CVOA 4WESB 3W4JA 2HMVA 3CRZA 3AEUB 4EJFA 4KFUA 4QOFA 4MW4A 5DKFA 5KOHA 2IHZA 1WMFA 1FP7A 2W48A 3P4UA 4K05A 4RX1A 3FTQA 2QP9X 1UFOA 5CG2A 5DTIA 1P2SA 1T2NA 5LBTA 2P4HX 4FFBB 4YR7A 1L5FA 3V2GA 1CXZA 2QN9A 1XCBA 3BFXA 4JI8B 2IPOA 1F3OA 3DBIA 4HPXB 5CGQB 4CR6A 4I2NA 1R16A 4CL0A 4ON9A 1PV2A 2CK3A 4OLFA 3FWKA 1SUFA 1JWBB 2O2ZA 3GUHA 3LECA 1W5EA 3MCUA 4LX0A 1SOWA 2R7KA 4NYJQ 3L4KA 2P2YA 1DC7A 4HGRA 4QYWA 1A72A 1QIFA 4MVYA 5IHXA 4CMEC 5ELLA 3V8VA 2FU5C 5IEJA 1QIEA 1HTWA 3PB3A 3TQRA 3EQ7A 3G0CA 1O94D 5AK0A 3DFFA 1J2RA 1M2JA 1FDVA 3C3EA 3SDZA 5ULLA 3ZDCA 1WZNA 3AVTA 1LPNA 2JHFA 4KLAA 4QC2A 4OAPA 3TINA 4WVLA 4AMZA 1ICIA 1KI8A 2HF9A 4EA9A 1F0YA 2ZPAA 1ZIPA 2YJ5A 7MDHA 1DRUA 4NZZA 5DGTA 3R6TA 4PX2A 3BHJA 3H16A 1FUEA 1NPTO 3IIMA 4JLVA 4LJLA 3M3DA 2G9ZA 1J07A 3UMJA 3I5XA 1C3JA 2XKBA 3T06B 1EXMA 4RQBA 3EQ8A 4WRRA 3RSFA 5J47A 1DC5A 3O8OB 4HLNA 4G86A 1OC4A 1W9HA 3PGJA 1J25A 4LXXA 2LDBA 4GQAA 4YRIA 5DM60 4DIEA 1XMVA 2X14A 2W37A 1G7RA 1VE1A 3F3SA 1II8B 3U4DA 2DHEA 5LZ4A 1BE6A 1K7CA 5TX7A 4GPBA 1FBTA 1KP2A 1J90A 1KK1A 3G85A 1WDTA 2ZSKA 4XIGS 3FZNA 1S6YA 1JHZA 1VDMA 3JY6A 2AD5A 5TMPA 1L5SA 1SIBE 1Q92A 4B4KA 3NTOA 4X95A 1Y3HA 2PNFA 5LMUB 4H31A 1L7XA 2JGEA 4BGDA 3CR7A 2FP3A 4ILKA 3PQCA 1RQNA 1W94A 4J0QA 4WNYA 3RNLA 1F6WA 3I9LA 3E5RA 3A26A 4OSOA 3HA7A 2PS9A 1JYEA 4GZ5A 4YAUA 3GZJA 2WYUA 2FQQA 4G56A 4RK0A 5KZMB 3X2EA 5KYKA 1WCV1 5DIZA 2WOJA 4NMXB 3BDIA 3KOXA 2J33A 3HEAA 4GEGA 4XJTA 5FIUA 4B3SB 1JT2A 3N2GA 5H68A 4YAWA 4N6OA 1IBKB 1MQ9A 2H4FA 3EA4A 4MV5A 3CPHA 1CC1S 5EWLA 1ZBQA 3I6MA 4XE5A 3TUJC 1DRKA 4CM3A 2EHJA 1PDVA 2PTGA 1ZAKA 1AZSC 1JNXX 2F9LA 4M76B 3PC8C 2V7XA 3T38A 1YUMA 5ELMA 3P9IA 2PL3A 4PBTA 1HWYA 2CYAA 5F7XA 1SUEA 4HL6A 2PPLA 2AFVA 5KYYB 4ND4A 2PE5A 1RHUA 1TDJA 1TK2A 1T5OA 3KT0A 1K3TA 2B5VA 3JASB 2VT3A 2I71A 1MU0A 2QT9A 5F77A 2Z8ZA 1AS3A 4MWGA 4E03A 5KDOA 1JXMA 4AURA 2GYYA 2HBRA 1KOLA 4Q21A 1DE0A 3C1AA 3URMA 3ZY4A 3BJZA 5FTMA 1QZTA 1KC1A 1UMDA 2OE2A 3L3BA 4R84A 3TRIA 2BV3A 2WIBA 4OXKA 4NU8X 3LPCA 3JTMA 4O4IA 2JI6A 3CKYA 3IVAA 4YIHA 3ZHVA 1Y9JA 4E6EA 1NRWA 2OKGA 1IZYA 2Y4NA 4GLOA 2INGX 2NU9B 2FPIA 1V9CA 3N39C 4A8JB 4D8VA 5A4DA 5A0VA 1SFRA 4DSTA 3CNQS 5DNEA 5GGXA 5LYYA 1UEXC 1UPFA 5ESXA 1Z8HA 3HFJA 5IJ0A 1NMSA 2A5LA 5DGIA 3R3WA 3EWSA 1H8ED 1W0JA 4K5QA 2DSNA 3E9CA 1KNXA 1Y4SA 3NANA 2X0EA 2CJWA 3OE4A 5F73A 3FOFC 4Z53A 2GQ0A 3S7TA 3FZGA 2HCJB 4AG5A 1TYDE 3DKPA 2DWQA 4X64B 1BE0A 3RSZA 1QDUA 2YNMD 1Q1BA 3ANLA 4IX9A 1IPEA 4ZT4A 2ODWA 4DKJA 1G8PA 1RTTA 2B35A 5LWHA 3TOSA 5IUKC 3AEYA 3SQOA 1ULAA 3FZQA 3LK7A 3A0UA 2WINI 3HMQA 1U65A 3VSAA 4ZYVA 3K5HA 3ADDA 1RZ3A 1QV9A 3MINA 5BR8B 4BAZA 1P1JA 3QTTA 2NZ8A 2R4TA 3GGGA 4XD2A 3WK9A 2Q6KA 3PD0A 4F4CA 4F4DA 4TL8A 3THSA 5DCYA 2H1CA 4ZU3A 1QG0A 2P78A 3QX3A 3OBIA 4D81A 1GPDG 2CKDA 5F1YA 1FS6A 1FFYA 4QNNA 4C7XA 2G5GX 4ND8B 1P7PA 4KN8A 1F1JA 1NM5C 2C7PA 1H5NA 4L3WA 3CZMA 4NCXA 5P8WA 1V8ZA 2WFMA 4GFDA 3H2BA 5ITSA 1C81A 2EFJA 5LQNA 4Q9JA 4Y0VA 3RRFA 1W96A 1VM6A 4ZYUA 2NWQA 4NAVA 1B0UA 4B9EA 1GGFA 4WHMA 3WB0A 3ER9A 4CHTA 3EMDA 3NVDA 5C1DA 5ADWA 1QIMA 5FPSA 4LVOA 4CRWB 1A95A 2FMFA 3O4VA 2VRBA 2HRCA 3UGJA 1W48A 5HBRA 4TYNA 1RRPA 4RS4A 3Q7EA 2WJPA 3OQPA 3JZMA 3C4JA 3D8RA 1SC6A 3NDJA 3EFOA 1M6NA 1Z4OA 3TZCA 2HRQA 3K35A 4IOJA 5E7QA 3HJFA 1KRWA 3FOAA 2PZJA 2O0KA 3ZDZB 1NF9A 4UMFA 3TRKA 2CMKA 3HEMA 5HHTA 2Y68A 3SIRA 1UBRS 4XWOA 4I50F 5CEEA 1NI5A 5AW5A 4JQCA 1NJ8A 2HR1A 3NPMA 1D4FA 1RYYA 1OXTA 1Z29A 1ZA1A 2OQRA 1NBMA 3FKSA 1ZNWA 1NQTA 3N8GA 3D6HA 1I5OA 1KY3A 3EDMA 1WB4A 2BZ0A 3EIUA 1HV8A 4EEKA 4D9IA 3EUWA 3VU8A 1I4EB 2BR5A 4BQSA 2N75A 1QBGA 4C2UA 4NV0A 2PY6A 1VHDA 1EUYA 3GLKA 2HA4A 1C3XA 1OUMA 2Q5HA 3BIWA 5BYJA 2NTJA 2CEAA 4IHJA 4JHXA 2BFNA 3WNZA 4DT1B 3VO2A 1AUXA 4PLFA 1LZLA 1TJ5A 4DZTA 3JCZA 1IU9A 4D4KA 3FZEA 3SQLA 1UM8A 1QF7A 1XFDA 1IZ9A 2MSEB 3CN9A 3H0EA 4OHKA 1VSTA 3VU1A 3WQRA 3KT8A 5D3MA 4UU0A 1D7AA 1E96A 1WKVA 2H5LA 3GT0A 3MD0A 3R5FA 4IIBA 1DNPA 5DTRA 5J2UB 3O9VA 4EGJA 4F38A 1U6IA 2P40A 3IP1A 3CIOA 1C3OB 1IZ0A 1VPWA 2HCRA 3JQAD 3BMOA 2WM2A 4E31A 4GI3A 1R9GA 4HI0E 2LRHA 1OZHA 3INRA 1E6WA 5J5VA 4PYJA 2BGLA 4OL9A 1CY2A 4O8ZA 3WLKX 121PA 1E0JA 4HB2A 4RJLA 1SCIA 4MARA 3RABA 4EMBA 1IWBB 4J2HA 3UYLA 5EC8A 5H8WA 1QRUA 4ZODA 2X9QA 2Z5GA 2YVUA 4JLOA 1KPHA 2ZETA 5TNXA 3DBRB 4O4HA 1GOTA 3SLGA 3SQDA 4HUQA 3IIKA 5IUJC 3SEZA 3RU2A 1VJGA 3MSCA 2B8TA 2VJAA 3I8XA 4JU9A 2XUIA 3Q9UA 1I5EA 2BGKA 2VP4A 4KNVA 2PH5A 3DHNA 4U7FA 5JCOC 2BEWA 3KHKA 4DRZA 3ZH9B 1RM5A 3ZK9A 3MIZA 4HPWA 3ZVNA 1DP4A 3LT4A 4B2PA 5JH7A 2PZEA 4MYUA 2BRUA 2A9VA 1Z6AA 3EEYA 3LY8A 3QV1A 5BSHA 2QJRA 2QMZA 4H4EA 4M9XA 4KUHA 1ZOIA 2VYVD 3OWHA 3F7TA 1Z37A 1CUHA 2ZATA 4IDFA 4XM1A 3OG9A 3DAGA 1JQDA 3FNFA 4HDMA 4R8RA 4N01A 4AQ7A 1YV9A 1WY7A 3T0GA 4HVCA 1RZVA 1BMFA 1FUIA 5B6JA 4W8GA 1DKPA 4X1YB 1HYQA 4S0ZA 4URHA 1QKKA 5AVUA 1ZUIA 2H5JA 1SUCA 4V0SA 2FYTA 2I1VB 3ZHXA 3DL7A 2DFNA 3VPSA 5TGDA 1CJVC 4D97A 5GPBA 1S1MA 2PD6A 1OFTA 4RH3A 4RVGA 4OM7A 2R7AA 4RTLA 1M0SA 2HXGA 3Q88A 3JYPA 1F4PA 5EFOA 1X77A 3UA3A 4EDHA 5KNDH 4FS3A 4GGPA 4IUYA 2CHVA 4LK3A 4PPQA 5FUWA 5DHFA 4EI9A 1HDZA 2Z5FA 3B2QA 4MB0A 2IY7A 1E89A 1QVVA 1E3IA 1QE3A 1WBJB 2VNIA 1PKEA 3GMDA 2VDWB 2WD8A 2WF7A 2ZWAA 5E2IA 1RNLA 5B3AA 1BHJA 2G70A 2FWNA 4Q1VA 4YPFA 5AJZA 4J0IA 4WAUA 2ZUEA 1WXHA 3H1TA 4FYVA 4CTJA 5I9SA 1AGPA 4P4NA 3WO1A 4BCCA 1X1TA 5DSZA 1MVOA 5C5EA 2J08A 2XMCA 4GYKA 4I5FA 4U5QA 1E0DA 1VQ1A 1VXOA 2BMDA 3E05A 4FVTA 3OHMA 4QATA 3AR8A 3V7UA 3W3AH 2ZZMA 3KQWA 3I62A 5KYVA 3DEHA 3KRTA 4KHZA 3FWYA 3LSYA 3G2LA 4YJHB 3QUAA 4BNMA 2GZ1A 2E5FA 3IR7A 4XQ9A 3VXKA 1W36B 5AI6A 3IAHA 4ZI2A 2VK8A 1H2AS 4OUKX 1T4BA 1P2FA 5COQA 4CM9D 8ATCA 1QF6A 1OXMA 2QF7A 3DMNA 4FD3A 3FMOB 1ZYUA 1JJBA 1N9ZA 3CH4B 3LF2A 4L28A 4YP6A 3SZRA 1TPZA 3T1QA 2IU0A 3KKNA 1TUIA 5GV8A 3CB2A 1GPUA 1XZGA 3EAFA 1IVNA 1TO1E 1S8FA 3O7WA 4BBZA 1MXFA 4K9OA 4EFDA 2HLDA 2IZ6A 3SXUB 2P79A 4FNAA 3TLZA 4V02A 3U3MA 1XE3A 1WCYA 1GDDA 1HDCA 1WVIA 1PK7A 4PTLA 3T3DA 1W85B 3TIVA 2J0QA 1Z5UA 1K3UB 4OBBA 1EFPB 1AKRA 2V6FA 3ULKA 1Q83A 3QKTA 3CLHA 4A7PA 5FYQA 4DUPA 3ABIA 3DZ8A 4ZAWA 4C87A 3FPJA 1SQGA 5FI1B 4ESEA 3VHQA 4Y18A 3F6RA 2WKQA 1NN0A 1RCUA 5ALOA 3Q5GA 4YJ3A 9LDBA 4M6WB 3M70A 2B1QA 1O6FA 2NAPA 1VG9B 5JNLA 1RC1A 4Q93A 2X0KA 4TWIA 3IQHX 3D3JA 1V6AA 2IPLA 3WAKA 3NKLA 4CKXA 3O8LA 1Q21A 4B32A 2HOQA 2ZRGA 1THTA 4QT4A 4NNJA 2CE2X 4RGBA 1ODIA 3VBCA 3GJQA 1WUIS 4MEAA 3DZGA 4CM7A 1MB3A 2D06A 2IUFA 4ZANA 1P8JA 5TQ2B 1USWA 1WNTA 4OGLA 5DGDA 2FUG1 2WVGA 3HVUA 4G4SO 5DNDA 3PC6A 4UHCA 1P0MA 1W2GA 2B4YA 3NBKA 4HNAB 1I1OA 1O77A 4HRXA 4Q1AA 1XTBA 4EO4A 2D2IA 3KT3A 2E9SA 2ZTUA 1G21A 1F20A 1X94A 2XGGA 2B2XA 2XODA 4RSMA 3A9WA 5BYBA 3MILA 4ZIRB 1GDTA 1T0IA 3M6FA 2FR1A 3VR1A 1CVLA 1T9KA 1QYDA 2CWWA 2HA2A 2RC5A 3X1MA 3I58A 3DE3X 2C5GA 3M6XA 1ZCAA 2VXYA 2J1LA 2HAEA 2Q8NA 4DIOA 4JELA 4DXDA 1Y34E 1ZHHA 3JRXA 3H2SA 1JHOA 4KO8A 4DJ5X 2AOUB 2II6A 3F6PA 3VZSA 5EQJB 1XKQA 1WCWA 4QXAA 1ZVKA 4ENSA 3D54D 2OM2A 3EG5A 4H0FA 4PAOA 4TWJA 4YBZA 1EUCA 3DFMA 1W4ZA 2XVAA 5A9TA 4R98A 1S2OA 2NTEA 4GBED 4JD5A 4X93A 2WYOA 1U1IA 1W73A 1WABA 3GFRA 1TX4B 1AGNA 3DB2A 1R0ZA 1U2PA 4UUAA 4CBVA 4CIAA 3A27A 2QZ9A 2C7VA 5BQFA 4RETA 1UBFA 2RSLA 2WG0A 2GZDA 1VIYA 1OAOA 5C35A 4M9UA 1Y3FE 1QO0D 3WGZA 2WYHA 3ROKA 5IVDA 3SZMA 1VSQA 1TUBB 3NC1C 2A30A 4DL9A 1E62A 3KETA 3EN0A 3I0MA 4ZI3A 4G0YA 3W6OA 2XQIA 1MNAA 2NXEA 2ZUUA 2HJRA 1JI3A 1N6LA 3EXG1 3ZBQA 1JZSA 2PMDA 2OYCA 4FLEA 2VPWA 1R27A 3U3OA 4M0MA 1N75A 1DT3A 1VI6A 1XP5A 3CEPB 3HJHA 1Y5MA 3PNVA 4F72A 2WJ3A 3GZ4A 5CJPA 5LP6B 1FXSA 3EARA 3ZOZA 3QYAA 5C0OE 5CB4F 2C4NA 5MN5A 4TLLB 1GN9A 1BIFA 1P4AA 2BLNA 4HFRA 1VCNA 3A4NA 2CUNA 1OX6A 1GILA 3G79A 3ZG6A 3IT3A 4LJYA 4CIBA 1MMFB 4AT1A 4E12A 1NWHA 4G4SP 5EJEA 2FDCA 3OCUA 3LKZA 3V1KA 2DR0A 5EE5B 2EHDA 5JANA 4HZIA 1W0KA 2W43A 3DFZA 1Z25A 3SLRA 3TTTA 4OHFA 2ZJOA 4ZGWA 1O97C 1OU4A 1UEJA 2IEDA 5THXA 4A2QA 4DV2B 3VSEA 5FNVB 3Q7RA 4G41A 5K8UA 4ZK2A 4L0DA 3FN4A 2OCIA 1B3BA 1BXGA 2IHBA 4V3CA 2ZFUA 3GH3A 2RH4A 3DD1A 4C3UA 4HS9A 4KMRA 1J4AA 3BGOS 2YRXA 1G7CA 4BLVA 4JN6B 5HCIA 5ILQA 3JD3A 2JFYA 1FJ2A 1L5KA 4LE0A 1MHPA 4D9MA 4FFLA 3ND5A 4IHQA 2GERA 4A6EA 2JJ2A 3QU2A 4HGOA 2GF0A 1PSDA 1M9NA 2VRCD 4XWTA 3IR6A 3UKDA 4Z86A 2ZYTX 4ZAZA 1BRTA 4Q18A 4XJXA 1NLFA 3BE5A 3RBVA 4DMCA 5CDUA 3T3NA 3D4NA 1L7RA 1RRMA 3HO6A 4G84A 3W3ZB 5IAAA 5LLDA 3K9HA 3UHJA 1R6UA 1VKHA 2G0AA 4BFWA 4Z4GA 2HV8A 1M1ZA 4FCCA 4IQ4A 3TZ6A 1K7YA 4EL5A 2XMSA 1SULA 4QBFA 4H1HA 4M88A 4GP6A 3L1VA 3VUEA 2O7RA 2XKJE 3W3AA 4TN1A 4U2DA 3RRXA 1GUBA 4Q9LA 4WL0A 3LCRA 2I2DA 2CLDX 3QX7A 5LOVA 1XTVA 4HGYA 1G3IA 1XEWX 3ESQA 5K0TA 3TFOA 4RF5A 1V8BA 2PKWA 2XVYA 1BD3A 3OE5A 4UUNA 5I5EA 4D25A 3SOPA 1PI3A 2JFUA 2WF9A 2WPDD 3HCAA 1ZZGA 2WHQA 3EVTA 3G2IA 3D2AA 4OQMA 1WXDA 2QG4A 2V55B 3PQ2A 4HB4A 5DH9A 3UBMA 4BKRA 3JVDA 2C5SA 2KS6A 3LUAA 1EZZA 2F62A 3WISA 4O4LF 5LDDC 1DFGA 1XRJA 1G0NA 5CNMA 4ZCLA 3SYLA 4YVFA 1UXIA 2VHWA 1CDZA 4GXQA 2E49A 1L5HA 5J23A 1JDZA 1A2KC 3P9QA 1X39A 1NUHA 3U0BA 2ZANA 1Q74A 4QOEA 1O0BA 4JFRA 2GN6A 3VGPA 1SC1A 4TT3D 4DF3A 1FFEA 3RF7A 4Q3AA 1V9LA 3L0CA 4D9NA 1E1RD 3TWOA 2P4UA 3PR1A 4Q4HA 3ZHBA 3GFSA 3PWZA 2VJOA 2WI8A 3GEMA 3DTVA 1MABA 4KCGA 1RXYA 2FWMX 5DOVA 1U7WA 3QVOA 1XEAA 3R5XA 2Q29A 4UASA 4CLXA 3E9QA 1HE8B 1DC3A 1KYTA 1Q7CA 4O4JB 1T1EA 2YHAA 2OLEA 3IILA 3EZYA 5JARA 5IM4A 2JLCA 1CJMA 4DBLE 3DAPA 1W36C 2NADA 4F0JA 4QJ5A 7YASA 4P3XA 3CKMA 4MRVA 1KAEA 3CB4A 3HPQA 1BN6A 3O8QA 4WA7A 1JLRA 5EZYB 3DDCA 3KEFA 2RI1A 1A76A 4IIUA 3U3ZA 2NV0A 2PXHA 4BNWA 2NYVA 3BOSA 4HEHA 1P9OA 5E1OA 4RK5A 1ZN8A 1KKUA 5JPDA 4MQEA 2PS0A 1CZNA 1SIOA 3HYSA 3LX6A 4OXIA 4WKCA 3OZTA 1V8DA 4LYJA 5DNVA 2IP1A 1U11A 1NZDA 3W7AA 1JDUA 1XP8A 3EYAA 1E8NA 1W5FA 2Q4RA 2VP3A 3AUKA 4JK3A 3GLFE 1VPEA 2HJVA 3LXMA 1M1NA 3HDVA 4IGEA 3UMFA 2JFFA 3TG2A 3R9XB 3DBLB 4AKHA 1OFUX 1W76A 2H7XA 2VAWA 5EG5A 4B35A 1PT8A 1YBAA 4D02A 2QUIA 3EOAI 3I30X 4P2GA 1SCUA 1HTBA 2FJ0A 4MUFA 4N5MA 4QNMA 3UHOA 4LHYA 2VPXA 5ERXA 1EDOA 1P2TA 4C07A 2BGUA 4F84A 3RS4A 2QW8A 3CV3A 1U0TA 4QAJA 1P8AA 2RBKA 1Z2CA 2IHJA 4HAIA 5DM2A 3H4VA 4L8LA 2IE8A 4MPJA 5D7NA 4C0KA 2NSLA 1R6AA 1NJSA 4TTAA 3RVPA 3H9GA 1TNDA 2W00A 1MTZA 1P9LA 5CK4A 1T2UA 5EE1A 4FZRA 2JIOA 3MW8A 3NAGA 3M6UA 4DWOA 1XXLA 2ECFA 2RK6A 2W6JD 1REQB 1HEIA 3CX4A 1OYYA 2YIMA 1U5BB 4LRYA 1QRAA 1H8HD 1HGXA 1Q22A 1SZPA 1TC1A 3NBFA 4MV9A 2P9CA 4PVCA 1GWNA 3G7NA 4MPPA 1SBHA 4H1TA 2QRMA 4GU5A 4B3MB 1HDXA 1KKMA 1KP3A 3M5PA 4P08A 3R74A 2VYCA 2CMDA 1X7ZB 4ICIA 1OLUB 3WFIA 3E9EA 5LU9A 2ZWVA 1TVCA 3VH1A 2NO4A 1S2MA 3FNIA 3QW2A 3ZK8A 4HWRA 4GMDA 4KIGA 4RFLA 4BMVA 1X74A 4JOQA 4D4LA 4BY9E 1A88A 1C4XA 3B89A 3THXA 2Q1TA 2OHXA 3DF7A 1SXJD 1GTJ1 1EVYA 1X7DA 2JFNA 4QGSA 3FLBA 1U5CA 4LJ6A 5EMKA 3MBKA 3U4IA 1A2QA 4YY3B 4LHXA 4II7A 4EYOA 4DCUA 1X9GA 1X86B 3IL2A 1FVHA 3KUDA 4RDIA 4Z8XA 1USIA 1DTEA 5AOBA 3TG8A 1XL0A 2VXBA 5CDYA 3Q7IA 2VDPB 1DFIA 2NO6A 3DTVD 4DQLA 1YGPA 3QSGA 1XQWA 2NZWA 2NT3A 2IXEA 2C7RA 3TW8A 3FNQA 4J4BA 4KWEA 3TECE 1XDZA 3S5JA 4LGVA 2PHZA 3VU9A 4W5RA 1N2GA 2ODAA 3LYHA 3RLFA 3ZV5A 3W77A 4F2DA 4F91B 4MS1B 3IAFA 3NBQA 1KDYA 5B1EA 2R79A 2FG5A 5NULA 1GYRA 1YFZA 3QBTA 1DIAA 1RRKA 4KUEA 4BVBA 3FCXA 2VHZA 5CIWA 2I66A 3RT7A 2V9PA 5HA5A 2PH1A 4HYQA 1DOZA 1JLLB 4YMWA 5NLLA 4M0DA 2I6SA 3RREA 3FPFA 4AMUA 3CKKA 4I3FA 1UKVY 2BGIA 3OOWA 3SIWA 4GP7A 4O0LA 1EG2A 2AWNA 4XUCA 1WB9A 3O8NA 4OP2A 3WIBA 3U4QA 2HV9A 1MKYA 1BFDA 1CD5A 1KFJB 4LQ4A 3W6UA 4IEIA 5IVIA 2YZMA 4OJKA 4EMUA 1V1MB 1V45E 1ZGHA 3PRJA 2FPMA 4GR5A 3C74A 4ZKEA 4MNTA 4RTNA 4KXXA 4F3RA 2FFBA 3K0FA 3KD3A 4BWFB 3ISTA 3EC1A 1WVMA 3G5TA 3H9UA 3I1IA 3UAGA 3RRNA 5JPCA 3K94A 4EZEA 5JCZA 5K09A 3IUEA 5B4VA 2ZDHA 4E5NA 3R7SA 3QSYA 3HZRA 2XXJA 4CQMB 3AM5A 3WZ2A 1L4HA 2BDEA 2C3PA 3OBBA 1E2PA 1NTRA 1NR7A 3A8TA 3F9CA 3PQEA 5K3FA 4I4TB 1FSPA 3QH4A 1E4YA 1L4EA 1XTKA 1GCOA 2AKYA 2A88A 4LHSA 1LB1B 5AKHA 1KSGA 5IG2A 1B8VA 1D6NA 1R8JA 3IDSA 3KVNA 3EE6A 5TQ0A 3FHJA 4KQCA 4O4IF 2IY9A 4GXNA 4ETNA 5KTOA 2QAGB 3ZEIA 5JS2A 3AF2A 3IJ5A 4HNRA 4BJ6A 3COSA 4ZEVA 3EDOA 3W0LB 2H4YA 3QWIA 2IEIA 1H0KA 1J9EA 1BJTA 3FPHA 3SIXA 1HG0A 1DQSA 1C4KA 3GCDA 4B2YA 5FPKA 1GCIA 3F71A 1C41A 3QE3A 2VP2A 1NN5A 3QLJA 1UPUA 1N92A 4PBSA 4CMAA 1UAAA 1FU4A 4IJWA 1G20A 3IERA 2OXRA 5K4HA 3MNFA 1WZ2A 2QJWA 3EXHC 2GAJA 3ZGLA 3HCWA 3HB4X 1P19A 2P9YA 2AFIB 4UTPA 4Y9RA 3RTAA 4UM5A 1YQTA 4H1VA 1O8BA 2DLDA 3LHSA 3B7GA 3TK1A 3QXGA 4INPA 1WUKS 1P2VA 2XUOA 1WQ3A 5HIJA 2GD0A 7REQA 5LQDA 5ED4A 3PEEA 2HF8A 1TA4A 2KQUA 1OAOC 3HM2A 3GELA 3CPJB 1PGQA 5CVJA 3WDKA 3WLNA 3O94A 4G0OA 1OFUA 1T4MA 2G36A 1NE2A 3TZQA 4EVRA 2C7GA 1WQ4A 1Z4JA 3HUUA 3V97A 5IRCD 1Z2NX 2FMHA 2IYNA 4G23A 3JQ8B 1OBFO 1NW9B 2CLEB 2BEJA 1Z08A 2VQDA 4TLAA 3REQA 3WK4A 2F55A 2F8TA 1PL8A 2O3RA 4CKYA 4R1UA 5GOZA 4UXJA 4HGQA 5AHKA 1VE7A 1FP2A 1Q0HA 2JIPA 3HP7A 2WIAA 3TTUA 3EVAA 3VBEA 4PG4A 4MP8A 4RLQA 4X6LA 3W2GA 3K09A 3LDUA 3FPAA 3THYB 2ZVJA 3CKLA 1ECCA 1HMYA 1YL6A 4IUDS 4MVJI 4OXQA 5C1IA 3SF8B 3X2SA 4E11A 4XR4A 1IDOA 1SVIA 5HW0A 2IYPA 3UWSA 3GLSA 1KZGB 3OURA 3DE6X 2W8BA 3EVNA 2V59A 2I67A 2NN3C 4MW7A 1EK6A 1ZL0A 4HDNA 3S70A 4NMHA 1QV7A 4I1OA 2BTOA 3GFVA 4G3XA 1ORRA 2XKAA 2BR4A 4QARA 3NHSA 1NP3A 5AI9A 3AESB 2UYCA 1M2FA 2OAQ1 3R23A 3AR2A 1ZNZA 4PZLA 1SNYA 5E0OA 2O3QA 2XNDA 2MSDB 2XR1A 4IVRA 1U0OC 4L5YA 2XQJA 3P52A 4QO7A 3TX2A 3JAMA 2QRHA 1VMIA 5FAXA 1E0KA 1Y8RB 5DTJA 2ZI7A 3LY7A 3O90A 1R0KA 5BWBA 1KDVA 1KRHA 2AOTB 2G40A 4MUXA 2WM9B 3D6AA 3MOIA 4JOCA 4WCDA 2MIIA 1KKLA 1A9RA 3CH7A 3OMWA 4BZQA 3VVMA 2L17A 4B3RB 2WUGA 3CY6A 3KV3O 3QKRA 2FETA 2ZE6A 3NHJA 1OKKD 3LZ6A 1OV4A 2OHHA 4TXNA 1CZOA 1B42A 4N49A 3CVJA 3IBCA 1BEEA 3D7MA 3NHWA 4FNGA 4RPGA 1NVMB 4XWKA 3CM0A 3ZCSA 4ZJUA 4Q9NA 2XE7A 2KJQA 3HSSA 3WYAA 1PD1A 1CK4A 4D0NA 1MRNA 2MSCB 1SKUA 4GM0A 3GUVA 4ED9A 2OD7A 2CC2A 1RXSA 1F14A 1V5FA 1D6MA 1B0ZA 2XBUA 1QJCA 4UMDA 3TEJA 1PVOA 1BU8A 3I6IA 1IXRC 2A57A 5KWIA 1W29A 4J9UE 4C5CA 1XQXA 1A7JA 5BSMA 5C8ZA 1E20A 2ORVA 4GNRA 1RTKA 3TQFA 2XTZA 3QKSB 3SX4A 3KDAA 2RKOA 3EA0A 1P73A 3NHRA 4I7EA 4MGIR 4O6VA 5HCUA 2OQVA 1BVRA 3WSWA 4AB1A 1JHAA 4YV0A 5DLEA 1M76A 3PQ5A 4D8TA 1S01A 2IK8A 3BWBA 5DBGA 2ZXUA 1R8XA 4IDAA 2VZ9A 2BSAA 4TLEA 1PG5A 6REQA 1ESCA 5DLQC 1D5CA 5B2FA 3OUUA 4YMVA 4PY2A 1E79A 1D0IA 2R6ZA 4ARZB 3EASA 4YCMA 2O5CA 3PE3A 4KN5A 2JIQA 1CS0B 2GD2A 5C1BA 2ZIEA 1YFKA 4JUIA 4S3MA 2IZZA 4TMFA 4S1OA 3FYCA 1P39A 1ACMA 1XCMA 1PJRA 2C03A 3A4TA 3IEIA 4FOOA 5IM5A 5EJ8A 1ZAYA 4G1EB 5JXWA 2C07A 3LX5A 2BVNA 5ILOA 1RXEA 1BW9B 1J8FA 1M2VB 3D6TB 5D5PA 5LZ5A 1IJKA 1LDEA 2Q6VA 3VSDA 4HCJA