4X8LA

Crystal structure of e. coli adenylate kinase p177a mutant in complex with inhibitor ap5a
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
214
structure length
214
Chain Sequence
MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAALIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylate kinase
publication title Structural basis for catalytically restrictive dynamics of a high-energy enzyme state.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transferase
total genus 76
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4x8lA00
4UKDA 5EUQB 2IXFA 2OLKA 3RRYA 2TMKA 3T61A 4ZIRA 4ILEA 4QBHA 5FPYA 2GA8A 3WP0A 1U98A 1PVOA 1NG1A 1G16A 1ZD1A 2D2FA 1S9DA 3FGNA 1VG0B 4DDUA 2WSSA 1EX7A 2ORVA 4K8OA 1U2RA 4OQLA 4TMZA 4YONB 1IN7A 3PUZA 3M6AA 2KJQA 3LFUA 5LPNA 3REGA 4HLCA 4G0NA 3MAAC 3QKSB 2EW1A 2F1RA 2XITA 3GFOA 3GLGA 1ZVQA 2AN9A 4G5QA 4NYIR 4I1OA 4WXRA 1IY1A 2ZYUX 3RC3A 3U7HB 1Z63A 2CHGA 2OFXA 4LSGA 2EWWA 3BJIC 2GEUA 1W36C 1ZW6A 1EFRA 2F3RA 2IEYA 2ZITA 4LJYA 3VQTA 1QVRA 1N6KA 4RD2A 1KDTA 1ZCBA 2QUZA 1KOFA 3N70A 3UMSA 2I1VB 4AK9A 1TEXA 4B2LA 1XMSA 4JS0A 1AZTA 4D6PA 1P60A 1SKYB 2HF8A 4ZCLA 3TUIC 3BB4A 3VHLB 1I4TD 1CJVC 2DR3A 2PBRA 1GTVA 2PZEA 4YXWA 4YMTA 4KSCA 1GRQA 2OE2A 4TYYA 2ZQ5A 3KKQA 2OBNA 1BYIA 1VPLA 2CJWA 1KNXA 3L8ZA 6Q21A 4NKRA 1G6HA 2ZUBA 3SHWA 2FF7A 4MKHA 5DYIA 5G40A 3T34A 1US8A 5GADl 4MDFA 3NBFA 4PPQA 3OE7D 1J70A 3DZ8A 3L0SA 3NKVA 3SI7A 1UBFA 1XD8A 2OESA 4L4UA 2OSBA 1VYUA 4OKSA 4Q1CA 3B82A 2XOKA 2ZREA 4IVPA 2I1QA 5JWRA 1H8HD 2REOA 2BCJQ 2JASA 1Z0KA 2V9PA 1GILA 2VTKA 4JBWA 3U3RA 3U7EB 3AKEA 3VR6A 5FL7A 3N2IA 4F4JA 5BYKA 4FMCF 4DCNA 1KNQA 4BEBA 1E9CA 1TUEA 4URWR 1LF5A 4RD6A 2ZE7A 5LB2A 4HB0A 4TTRA 4EPVA 2EYQA 4ARZA 3GFTA 2KBEA 4LYFA 1R5BA 5FR1A 3EC2A 3BIFA 2J9RA 1X6VA 2QQEA 2R62A 1ZU4A 2WKQA 3D3QA 2RGXA 3KDSE 4DCTA 4URYR 4M1KA 5DLQC 3AKYA 4PZZA 3J81k 2O0KA 3HU2A 1DAKA 4HZUB 4C0QC 4PR0A 4BE7B 1Y63A 2H16A 1IXZA 3PEUA 4D2IA 5M04A 1CU1A 1FPMA 2A9KA 4DEYA 1LF0A 3CBQA 3Q72A 4OI2A 5B64A 3AVUA 1E9EA 5KU1A 1E2DA 2LKCA 3AVPA 2QORA 1RE0A 3KKOA 2ZS7A 1JBKA 1DE0A 5J4HA 2OZEA 3GLFE 1HTWA 2IK8A 2WZQA 1RIFA 1RZ3A 2YV5A 4TTQA 2WJVA 2ZJAA 5JRZA 1X8JA 3K0FA 1JB1A 4D25A 2WOJA 4DBLC 1X86B 2GCOB 4K81B 1NVWQ 4KHZA 3HR7A 1CR4A 3OF5A 5HE8A 1EFHA 4P4UA 4JVMA 3ADKA 3TMKA 2NTYC 2ZR9A 1M2OB 5FPSA 3QXXA 4DJTA 3AVQA 3PEYA 1AGRA 4P4TA 2NO9A 4TT3D 1LV7A 3TLXA 4PFSA 4B3CA 3DMNA 3KQUA 3CWQA 1X3SA 3U61B 4I99A 3LO5A 3QXSA 1KDPA 4ZCIA 2P67A 3P32A 1JECA 1ETUA 2NOAA 2ZVPX 4Q7MB 5IRCD 2XAUA 2F6RA 1W46A 2OO7A 5E7JA 1P6XA 2JAQA 3CPEA 5LDDC 1L4UA 4H1UA 5AJWA 4QFMA 3ZS9A 4GBMA 2J0VA 1ZM2A 2G0TA 3TE6A 4D0GA 3GLFA 4BFTA 3QF4B 2H8KA 4C0BA 3A36A 3EPJA 1WQ1R 1OB2A 3TUJC 2PZGA 1AKYA 2ASEA 4Q9HA 3VKHA 1LTQA 1YZTA 1O87A 2VHCA 4JSTA 5DI3B 1UPTA 1F48A 1XTQA 2ZRBA 1SZPA 3TBKA 4L16A 4LJAA 4G5GA 4NP6A 2Z4RA 2WMNB 221PA 2OT3B 5TV2A 4H9GA 3BS4A 1KK0A 5D3MB 2QSYA 1S2MA 2G77B 2ZRMA 1Z0IA 2RH5A 1G7RA 3UWKA 4QKQA 1NLZA 2GHIA 1ZBDA 2HCJB 4RSGA 5JI2E 2OXCA 1OFIA 1RRGA 3OAAD 3HPRA 3R7WA 1M6NA 3UK6A 2PCLA 2QY9A 1R0XA 1GNRA 2NZJA 2QBYA 2X1VA 2DWPA 2KWIA 3KXLA 4LK2A 4B48A 3B9PA 3SJAA 4Q4LA 2BIFA 2KB0A 2X2EA 2FPLA 4C7OA 5E95A 3X1ZA 4ACBA 3ZD6A 4ZDKA 4X8HA 2JATA 5FTLA 4TLBA 1YRAA 4OHWA 4NCKA 5TARA 2IW3A 4NZYA 5AR1A 1BMFD 1AKEA 4EPRA 1AS2A 1P61B 1HA3A 1SKYE 1T3LA 4HDOB 4NMMA 4WZ6A 3U5ZB 1NMXA 1RC8A 1SXJE 1XXHA 3KQHA 5J47A 4J0QA 4BFVA 2H1LA 2QGNA 2F43B 3C7KA 4MITA 4M1MA 2ZUDA 5BN5A 1W49A 3E1SA 3LXXA 3NBYC 4LC0A 2ONKA 2QM7A 4R98A 5TXGA 3AVWA 1NY5A 4P4SB 4M1WA 4Z8XA 5FTJA 3X1DA 4B3BA 4EPTA 2ZR7A 4DIDA 1W36D 4PC7A 2ZETA 2BHRA 2AK3A 2O8DB 3LQQA 2DPXA 4FCTA 4O3MA 4PHHA 2CLCX 3B8HA 1E0KA 4A0RA 2A5YB 5LB4A 2J7KA 2FEOA 1E2MA 1ONBA 1WDTA 4OQFA 2Q9AA 1IJFA 2DFNA 4JJZA 3DO6A 4TQUS 4PO8A 5SZHB 2X8AA 3W8RA 2HCBA 3RS0A 4O2LA 1KO8A 1FX0B 3K1JA 5FUXA 1H8EA 1XD9A 2GXSA 2OV2A 5TY0A 3NBXX 3HWSA 2R6CA 4CGZA 2FSFA 3CR7A 1NIJA 4M9XA 3ND8A 1SXJA 4UNSA 1IONA 4WVFA 4AKEA 4CT5A 4E03A 2G1KA 1W2GA 1UKZA 1IM2A 2QTHA 3L0IB 1EXMA 2J87A 2ZS9A 4PSVA 5GVSA 4AI6A 1KZ7B 3FB4A 1ANKA 2D4HA 2WV9A 4C30A 1FW6A 5KSPA 3WYFA 3RAPR 2ZE6A 2VP0A 3AP3A 4JYBA 4JLMA 1QRAA 1Z0DA 3A1TA 2OXRA 2A5DA 4BLTA 3FDIA 1U0LA 4QNRA 1KY2A 3W90A 4XIGS 3IPXA 2C9CA 4M53A 4XTRA 1KK1A 4BGDA 3QKTA 2L0XA 1KDOA 3E5HA 4KLNA 2W83A 4EAQA 1JJVA 2V1UA 2QP9X 3A6PC 2DFLA 5P21A 1N5LA 1UFQA 3QPWA 5A5GA 2YHSA 3EIEA 3B6EA 1E1QD 1GITA 1SKQA 2W6ID 4IHQA 4WOPA 3DHWC 3O8CA 5KUTA 2GWHA 2WICA 4A92A 2ZU6A 3B1YA 2G1JA 1XPRA 4TZ0A 3LAWA 4M1OA 3ZLJA 2IXGA 1E2LA 2IYQA 2JJ2D 3AVTA 2ZANA 4LC1A 2ZRHA 1JR6A 3BC1A 4Q21A 4FN5A 4F93B 5J4LA 4WA7A 2BJWA 1UDXA 2PMDA 3EPKA 5HZHA 1U8ZA 5HTKA 4DCUA 1N0UA 2ZROA 2YWFA 2YNMA 2FE4A 4JYCA 2BKUA 5DSZA 1FUUA 4MGYR 3THOA 3ZS8A 4KXFB 4ITRC 3DOEA 2ZSBA 3PENA 4MGIR 4C0LA 2V1XA 1A5TA 1WP9A 2BMJA 4JSYA 5AJYA 3U7GA 4MRSA 3SFZA 5CDFE 5KNCA 4DDVA 1CULC 1B23P 2ORWA 1QG2A 4Y0AA 2EFDB 3X2SA 1P3JA 2ZE8A 5JLJA 4LPSA 3CPHA 2W00A 1CLUA 4IRUB 2YKGA 2YC4C 1ZMXA 3EA0A 3CWZA 1E4YA 1HQCA 4DLSA 2B92A 3CZQA 4ASUD 1DO2A 2FN4A 3QPVA 1P5ZB 3DVLA 1ZC3A 3U3MA 2JCSA 2QI9C 1JQLB 4Y0VA 2WPDD 1UEIA 2IYZA 1M7HA 2GZHA 3EZ6A 4BEJA 5JEDA 3CZPA 2LWIA 4WW0A 4UXHA 4A82A 4DSNA 2XNDD 2GCPA 1NIPA 4G1UC 2NMVA 3TQFA 2QSZA 3C15C 4TL8A 1QF9A 5DGXA 3TK1A 3SZRA 2D3WA 1VIYA 1E2KA 1FL9A 4LV8B 3K8YA 5CDFA 3IKJA 4Q7KA 5DI3A 2JDIA 4IOJA 4DZZA 3R9XA 1E2PA 1EWRA 3MLEA 3OEED 4DLRA 4OQXA 4OHZA 3SJZA 4FW9A 4B32A 2O8BA 3LVRE 4A8JB 5JMTA 3LH5A 4NCIA 1NKTA 1YR7A 5D3MA 4Q03A 2OM2A 1CR1A 4Q02A 4B6EA 4EUNA 2C96A 1KJZA 1A4RA 1CR0A 3WRXC 1DVRA 1DPFA 4F92B 3AV0B 2OILA 4TL7A 2VL7A 3RRMA 3MWYW 5L3QB 2HV8A 2BBTA 3EIHA 2IYRA 2Z4SA 3JZAA 3VR2A 1WB9A 1XP8A 3UATA 2W2VA 3SC3A 4NL4H 4MKFA 3PXGA 2D06A 4AYWA 1JPNA 4DLYA 5F3WB 1NMZA 1JI0A 2FPKA 1T91A 5CJPA 1IN4A 1XBTA 3TSZA 3TVDA 1OKKD 4ZIRB 1YR9A 2O8FB 1UAAA 1R0YA 4Q7JB 1Q44A 2IYUA 5HCIA 2XTMA 1COWA 1S3GA 5DN6D 2IYXA 4ZDWA 4POAA 4C9BA 4IDHA 2XZOA 2CL6X 3LW7A 4JKYA 3ZZTA 1G9XA 3I92A 1GL7A 4Q1AA 1XMIA 1AQUA 2F43A 1G64A 3FPAA 4AKHA 3K09C 1AK2A 3DPUA 2ZYVX 3NHBA 3P4XA 4HLUC 3VR5A 3W34A 3ADBA 2C5LA 4PX9A 3U44A 1M34E 4P4SA 3PCRB 2O8DA 5JRJA 5KTYA 5K8UA 4V0ME 1DG3A 3TR5A 4QRHA 5EXXA 4DLTA 1Z83A 5FBVB 4LCBA 2RGGA 1GRNA 5SZIA 3KL4A 1JEEA 3HU3A 2GESA 1R7RA 1M74A 4MDEA 4TQ9A 1KKLA 5GJVC 2R6DA 4JLBA 3VKGA 4PTLA 4OI4A 521PA 4MYUA 2R9VA 3CPJB 2AKAB 1HUQA 3FVQA 3PUYA 1N6NA 1VTKA 4KCGA 3W6PA 3A1UA 4D0LB 1US8B 1ZINA 2WWGA 3KX2A 1G7SA 5FPKA 4Q9JA 3B1XA 3O8BA 4TYNA 1T4GA 2BDTA 2IUTA 1WBDA 3KJEA 3BRWD 2Q0HA 1ZAKA 5HPYB 2ZTSA 1HEIA 2GXUA 4V0MA 3G0HA 2W6JA 4TYPA 3LVQE 2XX3A 3B13B 2WJHA 3PQCA 2GF0A 2PJZA 1AQYA 1XD2A 2A5FA 2A2ZA 1XEWY 3NIBA 1S1CA 5FI1B 5C46F 2QU8A 1GG2A 1Z29A 2WBLC 4IXNA 3RLFA 2NPFA 2HEIA 2JLVA 3CR8A 1UJ2A 2E9SA 2FFQA 4U7DA 1AGPA 2J0UA 1AN0A 2VIIA 4D0NA 1VKJA 3OZXA 2ZRPA 8OHMA 1KI2A 2GILA 3EZ7A 1PJRA 2CHVA 1MT0A 1J8MF 2CDNA 3PEWA 3EX7C 1SHKA 3RRZA 2G88A 1K5DA 1DAEA 1ZUNB 1HT2E 1ZM3A 3T5DA 3K0CC 4TL9A 3X1XA 3AGQA 1W4CA 3JVUA 4PZLA 1XJCA 3BB1A 2CE2X 3MCAA 4KVGA 1KI7A 1BIFA 1DARA 1MO3A 1RW4A 2YINC 3K0FB 4ABYA 1IN6A 2E1RA 3M0EA 4LBZA 1FQJA 2MSEB 4CZ2A 1ZM9A 4A6PA 4LI0A 1FQKA 2ZAOA 1E9AA 2F1JA 3GPLA 4RD3A 1E2NA 4M22A 2ODEA 1Z0AA 1K6MA 3BBPA 4FMDB 5HKKA 1G7TA 2BV3A 4NCNA 3D31A 4JLVA 2FOLA 5CK5A 2F55A 1UKEA 2ZIAA 2QTFA 3HR8A 4FMBB 1NF3A 2H17A 4KBGA 4TLAA 2ZI4A 3SJBA 2CXXA 4EPXA 4BZQA 1P2VA 1YZUA 4N3NA 3IO3A 4AY2A 4Q18A 1AJEA 3K9NA 4ESVA 2D7DA 3RWMB 4LV5B 4PC3A 3GP8A 3SR0A 2FSGA 2P2LA 1GSIA 1HV8A 1WXQA 2GEVA 1JPJA 5EP2A 2OAQ1 3RANA 2BBWA 5CIQA 4KBFA 1ZUIA 5JFGA 2J7PA 3U2QA 4JL5A 3RS7A 1VMAA 1E9RA 3AP1A 4NYJQ 3IUYA 1TUIA 4B35A 3K0SA 2WJIA 2ZRIA 3NTUA 1KJYA 2KE5A 4OL0A 1FTNA 3RC8A 5JCZA 2ORIA 2GJKA 3IHWA 1P9WA 1KI4A 3L2OB 3KQKA 2CCJA 1KMHB 1W2HA 5FI0B 4GI7A 4LX0A 5E7MA 4PC1A 2HLDA 4RZUA 1KI1A 3BOSA 5FUVA 1IY2A 3W8NA 1C9KA 3AF3A 3FMIA 4YMWA 3NVAA 4PZYA 1G8PA 3R7WB 4XWKA 3FE2A 4E5UA 4A8JA 2JJ1A 3ASZA 3ZQJA 1E2GA 4KFUA 2QBYB 3CX6A 5FBRB 3IEUA 3A4NA 2NIPA 2Q9BA 3IIJA 5FOSA 4V03A 2NO6A 2FGKA 3GMTA 4R2IA 2ZRAA 3KUCA 5L3QA 1E79D 1F60A 3KUDA 1MKYA 1E9BA 1Q57A 2WWYA 4MUAA 1R5OA 1RRPA 4YMUA 2FFBA 1YZQA 1LVGA 2VSXA 3I4LA 5HE9A 4B2IA 2H57A 2WWWA 4HUTA 2O8FA 1T0HB 1XU4A 4B3FX 1XXHB 2ECKA 4AKGA 1Z2AA 2QL6A 1FMJA 3W3AA 1KSGA 2CEAA 2ZRGA 3D8BA 4PSAA 1OE0A 2B6HA 3MFYA 2GXAA 4OK5A 1OJLA 2VHTA 1WRBA 1PLKA 4PHFA 1GIAA 3SQXA 1G1MA 1OSNA 4HB3A 1AZSC 2RB4A 4KAXA 3NDBB 4BFXA 4M8NE 1EK0A 3I5YA 1RKBA 2ZRFA 3P26A 4B71A 3KJHA 3WHKA 4A2QA 2FDCA 1LW7A 1KAOA 3JZMA 3LX5A 1OH7A 2A7QA 1Q0UA 5UKDA 2P65A 4IOLA 1FNNA 4HLQB 2FU5C 4ZI3A 1NKSA 3NBZC 1V43A 3AKDA 4LBVA 1RJ9B 1FZQA 3DZDA 3MJHA 3RS3A 2AK2A 1Q12A 2IWRA 1Z06A 3U3KA 3QXHA 1DAGA 1S96A 1SXJB 2CNWD 2VPPA 2X2FA 3RRNA 1Z6TA 2BBSA 3QI2A 3KQNA 1E4VA 2OCYC 4K46A 1CR2A 3QBVA 2OHFA 4C0AC 3B60A 3RSLA 3UG7A 2VO1A 4B34A 2JLUA 4DRZA 1ZM4A 1WBBA 1QDEA 2J7PD 1Z5ZA 1IQPA 1NLFA 1U8YA 2RCNA 5H68A 1T3HA 5FOUA 4DCSA 1Z8FA 2JLQA 5CIWA 3VX3A 4DKXA 4PAQA 1IXSB 2QENA 3GJXC 2ZYWX 2BMDA 1R5NA 1E2FA 2B8WA 3MG9A 1X8KA 4RCYA 3QEOA 1FMLA 2GEDA 1J8YF 4Q47A 4HATA 3KKPA 3CRRA 3S1AB 3RDPA 1XX6A 2OBMA 4Q9KA 1RYFA 2V8OA 1JXMA 2V54A 3DKVA 3R20A 2WKRA 4TWZA 3DMDA 2XZLA 2ZRJA 3MRSA 3FKSA 3GD7A 2ZEJA 1OF1A 3Q5EA 1L7VC 1L4YA 2RKOA 2I4IA 4P31A 1R2QA 4DCVA 5DHFA 3A1SA 2G9NA 3SE0A 5J4KA 4Q9LA 1OYYA 3F8TA 3R9IA 3I32A 4BQSA 1XCGB 4A0FA 3V00A 3BWDD 2HUPA 3LA6A 4FMCB 2LCFA 1VHTA 2QZ4A 4O0MA 3SOPA 3ZQ6A 3G82C 2XEXA 1OIXA 4JVNA 4XVQA 3C14C 4OQMA 5TB5A 1NN1A 3H4MA 3HJNA 3QG5A 1Q20A 1TQDA 4C3ZA 3L82B 4JVLA 3AVOA 5KDDA 2WSSD 2RGDA 1NLYA 4CIDA 3AKCA 3UXMA 1Q3HA 5BQ5A 2Z6VA 3TGPA 1M7GA 4A1FA 3WP1B 2OFWA 2ZJBA 2A3RA 2AR7A 2WHXA 5C4GB 2VLIA 3IQXA 1CP2A 1OFTA 5IK2A 4GT1A 4IOKA 1KK2A 1EFRD 1N0VC 4I1VA 1VYTA 1C1YA 4YMSA 4IJMA 421PA 2IF2A 4NH0A 3ZVMA 1YRBA 5F98A 5FTKA 1R6BX 1W44A 4C0KA 2YWEA 1Q1QA 1ZRHA 4URUR 1ZYUA 2VP6A 3H84A 4OJKA 4V0KA 1N5IA 4YXWD 1Z3IX 5EXTA 1E1RA 1KK3A 2CK3A 4N0DA 2FPMA 1N2CE 4LJ8A 4KU4A 2VP4A 2V6IA 1Z47A 4IVRA 3VFDA 4S35A 1GZSA 4QM6A 1SXJC 5EXPA 5AK0A 2F7SA 3TIFA 4EDHA 1JR3A 3NDPA 1Z6AA 2XOKD 3SU8A 2J0SA 2ZJ8A 3CX8A 1XXHE 3B7GA 3PR1A 3DKPA 2J1LA 1KMHA 4JLOA 3EIQA 5FL7D 3TVTA 2O8BB 1KO7A 3Q9LA 1NSFA 1WCV1 4B47A 2IC5A 4MKGA 3P27A 2PMKA 4QGGA 4URVR 1XTKA 1XCMA 4DSUA 1CTQA 1N25A 3LX8A 4M4SA 4ACAA 4ZO4A 1P4SA 2F9MA 4JL6A 2AWOA 4JZKA 1QG4A 3SN6A 3PUXA 1KO4A 4LYAA 1M8PA 4NYJR 3RVBA 1YJ5A 1D8TA 4ZPXA 2QAGA 3WNBA 4AWXA 3EZ9A 1P7CA 4GL2A 1KDRA 1KO1A 1ZM7A 2REXB 1XTSA 5FR2A 1XZQA 4B33A 4LHWA 2WWIA 4RFSA 4PAMA 2GJ9A 3GLIB 1KY3A 4Q4HA 3H86A 1TF5A 2EU8A 3N5CA 3QY0A 4QHTA 3HU1A 3RWOA 2XZPA 1G3IA 2IUSA 4QNMA 5JJKA 2IYTA 1GP2A 3GJ4A 3NC1C 3K9HA 1VYVA 5F2EA 4D80A 1E2IA 2WSMA 5IHPA 4G5RA 5SZKB 2MMCA 1ZNWA 3EARA 3REFA 3M4YA 1N5KA 5KNBA 3U44B 3K9LA 5H1YA 1TX4B 3QXCA 3PJRA 2NO1A 4WXPA 1YR8A 4BWYA 2PZFA 3C5HA 1U0JA 2ODWA 4PC2A 4X8LA 2BMEA 5E3HA 2H18A 3BE4A 1TPZA 4Z51A 1OIVA 5FPTA 2IEZA 3NEJA 4LJ6A 1KMQA 1Q1EA 5KPDA 4ZDJA 4TL6A 1G4AE 2WIBA 4E07A 5FUWA 3LQRA 1M1YE 1NN5A 2Z5FA 2RMKA 1RJ9A 3IIKA 3CLVA 4DDWA 1E96A 3M1IA 1QZXA 4B44A 3W9YA 3JVVA 1PZNA 1YR6A 2J5XA 3CX7A 3ZDQA 1EFCA 2A30A 2W0MA 3HPQA 5EZ5A 3RNLA 3EZFA 5AUPB 2BOVA 2BM0A 2IYVA 3ZVRA 2CL0X 2VEDA 4FXPA 4TTPA 3WNCA 2FSIA 2UZ3A 3EWSA 2VHJA 1LY1A 2JGNA 1W1WA 1XD2B 5EQTA 3UANA 3MSXA 1R0WA 4NYMQ 4O2RA 1N6RA 4OJQA 3S1AA 2R6AA 3CNLA 1BOFA 4US1R 1S3SA 2J0UB 1A1VA 4DLVA 1QHSA 3NC0C 3OIUA 3MWKA 5EP1A 1OT3A 3TSWA 1T8UA 5ANRB 1TF7A 1AA9A 5JBQA 2WMOB 3PUVA 4PAOA 1XFAA 3SEAA 3LXRA 3O47A 4U02A 1P72A 3BFVA 2QGZA 3ZGXA 2B21A 1NMYA 1Z6YA 5FH9A 3IILA 4C0JA 2P5TB 4HDQB 3SS8A 2QPAA 1OFUX 1MO4A 2GXQA 2X77A 2ZSFA 4BZPA 2OBLA 2Q3FA 5AUQA 3EZ2A 4NTZA 1KI6A 4JT2A 4D4MA 4L9SA 2ZJ2A 5IT5A 2NPIA 1MABA 1G3UA 1CXZA 2XJ4A 3KQLA 4XSGA 2BKEA 2QP3A 3FTQA 1E9FA 4JKIA 4LHZA 2VQSA 4Q4AB 1P62B 5KNDA 4HB4A 3E2IA 3PV0A 4JLJA 2AD5A 4RFVA 2IS6A 4AG6A 4D82A 4HAUA 4C4PA 4L8GA 1NNEA 5EZ6B 5EE9A 1TADA 5EUMA 5FBLB 2V7QA 1R8SA 4TYQA 1YZKA 1UM8A 5BXQC 4CDGA 1N6HA 4OHYA 2FZ4A 4R71A 3IHLA 4Q48A 4GFDA 1D9XA 2BMFA 2QE7A 4ON9A 3VR4A 3GJ6A 4FINA 4UQOA 1Q21A 1U0HC 2R2AA 1K5GA 1SVWA 3P4YA 1TAGA 1WF3A 4QGAA 3LY5A 2H5EA 5AJXA 2H92A 5CYOA 1R10A 1H8ED 4RY2A 5DHAA 1KI3A 3AEZA 4S2EA 4Z1MA 4OHVA 3I61A 3PEVA 4FWTA 2B8TA 1SXJD 1NSTA 3WBJA 1M7BA 3SFVA 2CL7X 5KSZA 2MSCB 1T8TA 3Q5DA 4V0LA 2V6JA 3LBHA 3AF2A 2N42A 1E0AA 5CYPA 4Z8YA 2P6UA 4TMKA 4M9QA 5FTMA 1XJQA 3GLIE 4YC7A 2EVWX 1E2EA 4HB2A 4IOMA 1PUJA 1TNDA 4WBSA 4KYIB 2QRNA 2VSOA 2GJSA 1ELOA 1UBCA 2AHOA 2PT7A 4QL3A 3T1TA 4D81A 4TQAA 5A0FA 3O8RA 4FWIB 1F2TA 3TW4A 4LJ5A 1D2EA 4P0TA 4RJLA 5JJLA 2VP2A 1ODFA 4F4CA 4II7A 1F5NA 1W4RA 1GDDA 3AF4A 3VX4A 1NBME 4DUGA 1BS1A 1SVIA 3VMFA 1NJFA 1FUKA 5L3SA 4JLDA 4PQFA 1JQJC 2F1IA 5EJEA 2ZRKA 2VSFA 4LJ9A 1TMKA 1SVSA 3HDTA 1P2UA 3CIOA 4Q1BA 2FNAA 3GLIA 1XEXA 4XWOA 5JJIA 121PA 1PLJA 3NWJA 1W0KA 2XSZA 2IF0A 3ASYA 4A6XA 4RVCA 3I8XA 4OHXA 2ZI5A 4QM7A 2HJGA 4XH9B 1NY6A 2J41A 3X1WA 3TAUA 1NN0A 4DDTA 3FWYA 4EIWA 1L8QA 4UNNA 1W48A 4HEJA 2QMEA 1KJWA 5B57C 5GJBA 3U3OA 3ZIAA 3UIEA 3VAAA 3RSOA 3QQ5A 5HZKA 2WOOA 2RGAA 2ZJYA 1NBMA 3ZYCA 4XJXA 4LGMA 4GP7A 3IDQA 1Z22A 4TZ6A 2W58A 4A0GA 4HAWA 3LV8A 4I1UA 1E98A 2YOGA 3A37A 1OHHA 4XD7A 1A2BA 1E0SA 3FFBA 5JS8A 2QRZA 3ECCA 2K5UA 1G5RA 2ZRLA 3EC1A 3OHMA 4MYHA 4PPNA 5DH9A 4LRWA 3TUZC 1XPOA 5IDVA 3R8CA 3GJ7A 1IJEA 1LS6A 1MRSA 2G83A 2EFHB 5KOYA 1N6LA 4HAYA 2PCJA 2AL7A 4B6FA 5CM8B 2VF8A 1CKEA 2KBFA 2OCBA 4DLUA 1MRNA 1ZNYA 3U4QA 2FZLA 3QNUA 2CLDX 5CLQA 3EWAA 1TEVA 3RS4A 4LDJA 3OEHA 2AKYA 3A4MA 3EXAA 4QJ4A 4A4DA 4D4LA 4LBWA 1NN3A 1WE2A 2N46A 1J2JA 4DXAA 5EP4A 3OFNA 2JDID 1PV4A 3VNUA 2YC2C 3BGWA 3UG6A 4HLDA 2GVDC 2BWJA 1U9IC 2WWHA 3HYRA 2R65A 4N1AA 1J99A 3LLUA 2QMUA 4EPWA 2YZ2A 4MH0R 3T35A 3A1WA 3KJIA 4ZI2A 2YJTD 4B3GA 4MKIA 3IO5A 2Q3HA 2ZSEA 4JT4A 1XB2A 1ZCAA 3L8YA 1PUIA 3QOFA 1GVNB 1YZNA 2GRJA 4A8JC 3AUXA 4BPBA 4DUGD 3CH5A 3R8FA 2BEJA 5FPHA 1GRRA 3GEHA 4AC9A 3FMOB 2CLSA 1OXXK 3PG5A 3I5XA 4LHVA 4Q66C 4KFSA 2VRWA 1F6BA 3BH7A 5B58C 1OPXA 4US2R 4IW3B 3BERA 2YOFA 1LS1A 2O0HA 4KLZA 2GAOA 4NYMR 3U3JA 4BLOA 1Q1BA 2UKDA 3LDAA 1E6CA 1COWD 1P9RA 2NZ8A 3EAQA 1I4DD 4CT4B 2FFHA 1KSFX 3QBTA 5LD2B 4BLRA 3DDCA 1P9NA 2EYUA 1XRJA 3MWJA 4Q4AA 3CONA 1E3MA 1OV4A 5TMPA 3QUSA 3THXB 4Q4JA 2GF9A 2FG5A 4URZR 3C4JA 1Z0FA 2WAXA 2IT1A 3I3SR 5E4FA 3MGCA 4FMDF 2RHMA 2SHKA 1YVDA 4QGHA 4BLSA 2I3BA 3GJ8A 3TQCA 4X8OA 4IEEA 5JECA 1E9SA 3GCGA 4BECA 1NBMD 2NO7A 3CF2A 1LB1B 1UBEA 1G3RA 1X1RA 5BWMA 4XWAA 3BAFA 4BFZA 5BW8A 4LZZA 1QBKC 2MMGA 4C0HA 1AS0A 1L2TA 4QG7A 3QSYA 1HY3A 2IUUA 1DAHA 2VYFA 1WA5A 2O5VA 3KKMA 3RS2A 4AIIA 5JEEA 1HT1E 3AVXA 2BJVA 4GMDA 3K70B 2FSHA 1H65A 4I4LA 3HP1A 3W3ZB 4AURA 5FOWA 4B76A 1SVKA 3I73A 3IQWA 1YQTA 1EFUA 1KGDA 2GBLA 1D5CA 4MRVA 3T06B 1FP7A 3BH6A 4HUQA 3F0TA 1RVDA 3RYTC 4GOJA 1IAQA 1U9IA 1KSHA 1RFLA 2Q3MA 3KFXA 3EPLA 1U90A 3VR3A 1DG1G 3AF1A 2W6JD 3ZZUA 2NGRA 3I72A 5HCNA 2OLJA 1XTIA 3AF0A 3TNFA 2ZRNA 4MUBA 3MUFA 1T5IA 3T5GA 2DCUA 3OE7A 3K0EA 3WBKA 4TLEA 2VHUA 2IS1A 4DVGA 3C5CA 4D26A 5CB8A 1SVOA 4KJZA 1G6OA 2QROA 1YHNA 4XVUA 1H8HA 1OW3B 4M2LA 3ZZ0A 3I8SA 2RGEA 3CF6R 4AYXA 1EESA 2E87A 1TQ4A 2VA8A 2QAGB 1G17A 3CO5A 4Q1DA 2ZM5A 1JAIA 5FOXA 1OXTA 4DSTA 1UBGA 1G5PA 1EG7A 3ZVLA 3UMFA 1XTRA 2A5JA 2B7BA 721PA 4HAZA 1TF2A 3NH9A 4RFSB 1GKIA 2HJVA 4DHEA 2QQ0A 2ZPTX 3AVVA 1QVAA 5JHGB 3ZH9B 3NEYA 4Q4HB 4ZV4A 2P5SA 4MYTA 1R8QA 3VHXA 5C4MA 1G8YA 3TR0A 2YOHA 3IIMA 2ONJA 3U6KA 4BFUA 4C2UA 1UF9A 4UNPA 5FFMA 4BLPA 3UMRA 4NBSA 4HI0E 2IXEA 4Z54A 4V0OA 5JHHB 2IX3A 2GJ8A 1NVUQ 2J3EA 2HXSA 4GZLA 3W5JA 3WNDA 4MQBA 4CEHA 4NDZA 4M9ZA 1Z6XA 2JLXA 4UJ5A 1X1SA 3IBGA 2ZYTX 1OFHA 2GJAA 2R44A 3QENA 5C1BA 1FNMA 2FX3A 1VCIA 2ZJZA 3LBNA 1VDZA 3QVVA 2GKSA 1CIPA 2F3TA 3BORA 1YE8A 3K0AB 3DOFA 5BN3A 3U60B 4F7WA 5EXSA 3FYHA 5HKKD 5LD2C 4DT1A 1XDBA 5B30A 1W5TA 4R2HA 1CS4C 3ADCA 4LUCA 1GL9B 2PX3A 3RABA 4GP6A 4B2PA 2F9LA 1KYIA 2QMHA 1YU9A 5SZJA 3TAHA 1OH6A 1OYWA 5A4JA 4PPGA 3Q7QA 4W7SA 1F3OA 2WWFA 4JIMA 4V02A 1SHZA 3GLHA 2GDJA 4M1YA 2C9YA 2IL1A 2RAPA 3CH4B 3SBDA 3CB4A 5AUNB 2HXYA 5KSYA 2UZIR 4TT3A 3GEIA 3OIYA 3H1TA 2R6FA 3AP2A 4TMTA 2ERXA 4LOAA 4UXJA 5DYGA 4KITB 1W4AA 2Z83A 3QG1A 1SGWA 3AGPA 3LWNA 4A9AA 1T6NA 2JLSA 1NG9A 3AB3A 4YMVA 1QHHB 2CBZA 5IF9A 4QBFA 3C16C 3K70C 4B74A 2PH1A 5H70A 3GFPA 4DLWA 2ATVA 2AX4A 4G5SA 2HLDD 2O0JA 1EX6A 1AIPA 1XNJA 2IA5A 1WMSA 2RGNC 4CEHB 5FOTA 1OXVA 3R9WA 1MOZA 2GAAA 4RD4A 4JLAA 4KO8A 4E09A 2YWHA 5FL3A 5B2ZA 1NI3A 5G3YA 2XXAB 3NG1A 1G4UR 1ZIPA 5G53C 2JJ1D 1T5LA 4F4IA 4CF7A 3A58B 4CVNA 4KFTA 4KSBA 4AG5A 4Q00A 2DBYA 1NJGA 3ZD7A 3VTKA 3IPYA 2PLFA 1W4BA 3MJRA 4NE2A 1ZC4A 2Z43A 2C99A 1ZIOA 2WTUA 3T15A 1F2UB 2DWQA 2N1BA 4B3DA 3ADDA 1XWIA 3OAAA 3PUWA 4FCVA 1KI6B 3MWLA 4IFBA 4KVAA 4RCZA 1G8FA 2QAGC 1DBSA 2OFOA 3OESA 1LFDB 1MABB 1GKYA 5H8WA 2HYIC 2A5GA 4WAUA 4WZAE 2OCPA 4KODA 1FP6A 4BFSA 4ERNA 2C78A 2IHYA 1FOEB 2BC9A 5D3QA 5K8TA 4U5XA 4DLZA 4PQYA 5AUOB 1BMFA 2CHQA 4RZ3A 3EA5A 2YVUA 3GJ5A 1N5JA 3KJGA 4BLQA 2GVZC 4YLGA 1JR3E 1N3BA 3THXA 4EJSB 4EQ6A 2D7CA 1QHNA 1G8GA 1G7CA 3B1VA 3ONWA 1QHYA 4CEJB 4MGZR 3AVYA 2O8CB 3KKNA 5G41A 5G3ZA 4ESHA 1XZPA 1BKDR 1GL6A 2JIZA 1OXSC 4TMVA 2GETA 5F9HA 1HE1C 1R4AA 4GDFA 1BH2A 1TTTA 5CB6A 4MYCA 2HDNB 1XTJA 1J7KA 3D6TB 1EGAA 1TU4A 3CKLA 5JSZB 2JEOA 1OH5A 3LNCA 4IDOA 1SVMA 4P32A 3GJ3A 2AXNA 3CNNA 1BYUA 1T0JB 3N2EA 5J4VA 1U94A 3B1WA 5J40A 4GOXA 1KO5A 1XEWX 3HYTA 2QM8A 3F5FA 1HYQA 4JL8A 5GJCA 4PSKA 4GMXA 4P33A 3FMPB 2RGNA 1UEJA 1CJKC 1MR3F 2QT0A 3SNHA 4LYJA 1JEDA 4CYMA 1KHTA 3W5IA 3D7MA 3FKQA 2FA9A 4HAXA 1AS3A 5J5CA 1VCMA 5KHOC 4OI0A 2CVFA 4Q9IA 2ZU0C 2A78A 2F1HA 4BFYA 1OB5A 4YQFA 1Z2CA 1IY0A 1F2TB 1ZUHA 5JWOA 3CNOA 2QPOA 5CITA 2XTNA 5DE3A 3X1YA 4KV9A 4AD8A 4JBYA 3FKSD 4BRUA 1KTVA 2FMXA 4LY6A 1IN8A 1NP6A 4TLDA 1G19A 1HQYE 5FBWB 4QXAA 2JA1A 2JLWA 1CJMA 5L3SB 3PITA 1VECA 3UPUA 4TN1A 2NQ2C 5J4YA 4PANA 4QOSA 3BB3A 3AUYA 1MV5A 2GNOA 4WIAA 4AYTA 2EFGA 1XEXB 4IXMA 1UADA 2EQBA 4A15A 4QGFA 4QJ3A 4FD2A 1E1QA 2W6IA 3ICEA 2BM1A 2D74A 5KYKA 3VU9A 4BUJA 2V3CC 3SYKA 4LWZA 1VCOA 3E70C 1FTSA 4M1SA 3BXZA 2IS4A 2JJ2A 3A8TA 4IKEA 3B78A 3FOZA 4D4JA 2P3SA 1A2KC 4C0SA 4ZKDA 3CRMA 2IWHA 2XB2A 1JAHA 4RD1A 4UXIA 2ODBA 4M9SA 5AJZA 4R7ZA 2DYKA 3GQBA 1ZNZA 3K0AA 2ZI9A 1DAIA 5DNYB 4Q7LA 4CEIB 1QHIA 5DI9A 1DS6A 1S9HA 1Z28A 2QG6A 5IK2D 2IYWA 3V4FA 1Q1ZA 3W6OA 2VBCA 2WM9B 4EJSC 2JIZD 2WJYA 5C2JB 4N0EA 5CLLA 2WWXA 3RS5A 3QKSA 2WKPA 5KPJA 3ZVNA 1ZD8A 2RHDA 3C41J 4U00A 4W5HA 3WMGA 1G41A 3P1JA 4JJKA 3SQWA 1NVVQ 3DM9B 4BRWA 2NG1A 4OQNA 3KFVA 2ZAMA 4HYYA 4EKDA 4MA4A 1E1RD 3U4QB 3AM1A 2OG2A 4URXR 1G8HA 2CK3D 2DY1A 3K70D 1DEKA 1T9HA 3BD9A 4HDCA 3O8DA 4OYHA 3QKRB 3THWB 4ASUA 1Y3AA 5EE3A 4A2PA 2ZJOA 1JR3D 1QHHA 2ANBA 2C03A 2CMKA 2OEPA 4XVRA 3F3YA 1XMVA 4JLPA 5KDLA 2J0QA 2WPDA 3PFIA 1B0UA 1GOTA 1KAGA 3C8UA 4CW7A 1DTSA 1Z07A 5KO2A 2J46A 4DB4A 2XNDA 1OIWA 2BBOA 2FFAA 5TVKA 1D2MA 5FUYA 4EFNA 1CRQA 3SYNA 4OK3A 3U6BA 2XXAA 5L3VA 2C95A 2ZI3A 4TMWA 2WJGA 1GM5A 4LV6A 1IN5A 2PL3A 3GJ0A 3OEEA 3KTAB 1GNQA 1MO6A 4NHOA 3NHAA 3P20A 1TQ6A 1TU3A 1BO6A 3IEVA 2IS2A 1NVXQ 4DWJA 1F2UA 2ERYA 2FGJA 3CUEF 4QHSA 1SQ5A 5FOVA 3TJZA 4PHGA 5C18A 2WIAA 1DOAA 2W0SA 3WY9A 4GZMA 4XSHA 3KXKA 4V0NA 3WXMA 2Z0MA 2PX0A 3TW8B 3KB2A 4M1TA 2KI5A 5L8VA 2AFIE 1D9ZA 1A82A 1KZGB 4I81A 4Q4JB 3DM5A 1UKVY 1OKKA 1VIAA 1E9DA 1S4QA 2NO0A 4IDPA 4RKFA 2DWOA 3B2EA 1IXRC 3THYB 3SBEA 4HZUA 1G5TA 1CJUC 5JI3E 4LHYA 5DN6A 4EJSA 5E7IA 3B1ZA 1N6IA 3H0KA 3SDZA 3V4RA 1ESMA 3DL0A 4CEJA 3G5UA 4B43A 2O8CA 4DB2A 2GTPA 2VHQA 2DFTA 1RRFA 3Q3JB 3B9QA 1MO5A 2C2HA 1VHLA 4Q1EA 1GFIA 4Q01A 2G6BA 2CE7A 1KIMA 1SVLA 4LJ7A 4TLCA 2ZSDA 5JSZA 1CF4A 4DC9A 2GCOA 2ZVQX 2WJJA 3A1VA 3DEFA 3MMPA 5BN4A 2LKDA 1P2TA 4B75A 1CEEA 2AFHE 2HT6A 4F38A 1GKUB 5CM9C 4CRWB 2D62A 2ZUCA 4HUQB 3Q85A 1YZLA 4L5BA 4B3XA 1EFTA 1TQ2A 3OIWA 1VG8A 2REBA 2KSQA 2WAYA 3AQ4A 3T12A 2BCGY 1IOZA 1G21E 3NXSA 3KXIA 2ZI7A 4RZ2A 3EG5A 2EFEB 2G3YA 1S8FA 4MRNA 5KDOA 5BYJA 2VP5A 4R9UC 1ZP6A 2JLRA 3CRW1 1VCNA 1OLOA 1NRJB 3QF4A 4JVSB 3AH8A 3IBYA 4QJ5A 4BASA 3CW2A 3FHCB 2EFCB 4A0HA 4ZCMA 2FH5B 1CBUA 3CRVA 1NL3A 5EE1A 1SULA 3SJCA 1KI8A 1ESNA 1YZGA 4MRPA 4UNRA 3PVSA 2QA5A 4EFLA 2DB3A 1P75A 2EWVA 5KSOA 2GK6A 4FI3C 3H2YA 2P0EA 3LW8A 4HAVA 4GPTA 4Q1FA 1W7AA 3U7FB 2C98A 1KSJA 2ATXA 4LJ4A 4DLXA 2IBMA 3ETLA 2ZSAA 2J45A 4F91B 1KKMA 1D6JA 1QHXA 3B5JA 1II8B 4LHXA 2PJRA 2FWRA 4NYIQ 4QBIA 2ANCA 4UJ3A 3VR1A 2IHBA 2H7VA 3K9GA 2O8EB 2RGCA 1E94E 4KI0A 3UKDA 2JJ8A 1PLLA 2FV8A 2XGJA 1P2SA 5JS7A 1ZD9A 1U81A 2VH5R 1E2QA 4OK6A 4X8MA 5EP3A 3BFKA 1LNZA 3QKUA 2OUKA 2C04A 1D2NA 3ZJYA 3PIRA 1HH4A 3ND9A 4DT1B 2V7QD 1P73A 3I1FA 4LBYA 2AXPA 3UWOA 2XNSA 2XTZA 1V5WA 2ZI6A 1YKSA 2QNRA 3FHOA 4OI1A 4CEIA 4L9WA 5GJWC 2QE7D 4P3YA 1IHUA 2ZE5A 3Q7PA 4IFEA 4YDHB 1N6OA 621PA 3GLGB 3I62A 5F9FA 4QHYA 1U8AA 3GEEA 1DAMA 3GLHB 2GK7A 1JXOA 2YWGA 1E99A 4I1SA 4EFMA 2QN6A 2D2EA 2P6NA 3FFAA 2PLRA 2Q6TA 2PEYA 1W47A 2Q9CA 4Q19A 4Z1MD 4O25A 1T3SA 1I4LD 4OBEA 1Z6GA 1O3YA 3LD9A 4G3XA 4GNKA 2OCAA 1XPUA 2PT5A 3EASA 5K8LA 1QHGA 3L0PA 2ZXUA 2P6RA 3CM0A 3T1QA 2IYYA 4PO1A 1DADA 1K8RA 1FX0A 2R6GA 3QKRA 3THWA 1W0JA 2CJWB 3BFXA 1GWNA 2W2XA 5JCPA 3V9PA 4TSFA 3KB1A 4IVQA 1N0WA 2GBLC 1TL7C 3RHFA 3KZ1E 2QEQA 3T1VA 4M0LA 1OH8A 2R8RA 2BEKA 1GAJA 1S0UA 2VF7A 4US0R 1II9A 1NVVR 1W5SA 4DSOA 3ICQB 4BFWA 4AKIA 2ZJ5A 3WYAA 4LYHA 2VP9A 4FIDA 1E0JA 5CK4A 5FBQB 4C2TA 1GNPA 5EE0A 2QTVB 3KTAA 3BH0A 1G18A 3K53A 4JLNA 4ZDIA 2MSDB 2Q21A 1RRCA 4YDSA 4Q5IA 4W5WA 3T1OA 3BK7A 2OAP1 2DHRA 3WMFA 4ARZB 3VNVA 2QPTA 2FEMA 4ZKEA 821PA 2AD1A 4PXAA 3WMEA 3QF7A 1JALA 2G0NA 1E79A 3QXJA 2GZAA 4DEXA 5ELXA 2AWNA 1C4OA 1E32A 4LPKA 2YYZA 1W0KD 2XSZD 4GSYA 3L0OA 1FFHA 2CCGA 4A2WA 2X19A 4MRRA 4HSEA 1I2DA 2IYSA 2C77A 2O52A 1U99A 4IDQA 4E22A 4EQ6B 1ZU5A 4EPYA 3NH6A 4PPFA 1RYHA 1G3MA 3SYLA 2QAJA 3THYA 3K09A 1S1MA 3ZIAD 4HLUA 2JLYA 4W5JA 2DFKB 2CCKA 2C9OA 2PEZA 5LBIA 2ZRCA 2B7CA 4KYUA 1JJ7A 3QVUA 4NU0A 1CRPA 3LBIA 1W36B 3WYGA 1A7JA 2W2TA 4M21A 4JLKA 5AJVB 1X8LA 3B85A 1AM4D 2ZRDA 4TYWA 1IBRA 3MD0A 3FHTA 4RD0A 3WRYC 2BVNA 1OHHD 4XD7D 1VG1A 2QP4A 1Z08A 5HR5A 3WHLA 1N6PA 4MGKR 4PHTA 3EW9A 4JBXA 2XJ9A 3QPUA 1DO0A 2RGBA 5L3RA 1E2HA 4H1VA 4FCWA 1R0ZA 5CJ2A 1DAFA 2IYLD 4QC2A 4QBGB 1G3QA 1II0A 1UKYA 4RZXA 4G5OA 1E2JA 1RPZA 1Q22A 2CNWA 3CRQA 5JWHA 4WZBE 3SHFA 3TKLA 2C8VA 3OEHD 1XCPA 4G01B 4HZIA 4RKEA 1EWQA 1W0JD 2QT1A 1Z0JA 3OFND 4GRAA 5TDHA 1DELA 1UDWA 1G291 4TSFD 5GVRA 3LLMA 3GLFB 5DISB 3EPHA 4A36A 1CJTC 5JZVA 4GOKA 1GUAA 2XB4A 1I2MA 4TMXA 4JMPA 3TH5A 5AWFC 2Y8EA 4PC6A 3OIVA 2GCNA 3QIAA 3TSOA 1XF9A 3CF0A 1G20E 1J90A 5DIFA 3TRFA 3W6NA 2FJUA 4NPHA 2JLZA 4NCHA 1HE8B 4PQRA 4XOIA 4D4KA 2QMOA 5K8IA 2V4ZA 2V55B 3L43A 4NCJA 2HF9A 3QE0A 1XEFA 1KI9A 5DO9A 2J59A 3QEJA 4KFRA 2ZS8A 1MH1A 3LRPA 4NONA 4DIEA 1OXUA 3VKWA 2GZDA 2ODNA 1ZJ6A 2WVJA 3GLGE 2HYDA 4UNQA 5FTNA 4BZXA 4IDNA 4IEIA 4XTCS 3GLHE 3VU9B 3A4LA 1XMJA 1VG9B 4W9MC 2HT1A 1JNYA 3IGFA 4PO9A 4C7OB 1HURA 3QJYA 1XJ0A 3K0CA 1II8A 4L15A 3Q8XB 2CVHA 2O8EA 2UVQA 1E69A 3FMFA 4B73A 1Q3TA 5EE5B 2ZR0A 1ZNXA
chains in the Genus database with same CATH superfamily
1J33A 5EUQB 3Q8WA 2KQUA 2OLKA 1Y3HA 4RGYA 3RRYA 3MOIA 2R8YA 3MGKA 1KA9H 1KJIA 1ZOLA 2ESRA 2K2QB 2R5FA 1U98A 4GEGA 5FPYA 4FWBA 1G16A 3QJ5A 1RM3A 3WS7A 1FSPA 1WXGA 3WGZA 2BLNA 4H35A 1S9DA 3JWIA 1PJSA 1TCBA 1VG0B 2NP6A 3LF2A 2WSSA 5BN5B 1T9AA 3OJCA 2X7JA 1M8GA 1ZKDA 2QZPA 1Z5GA 2QRGA 3ORRA 2ZUWA 2PWYA 3KJQA 3M9WA 1IN7A 3IUMA 2JGDB 3D54D 1YCHA 3LFUA 4O8CA 5LPNA 3IB3A 3HVHA 2JGIA 4YGYA 1BMQA 3PXXA 2OGTA 4M38A 3O91A 1C7FA 5PNTA 5EZYF 1EI9A 3GLKA 4R81A 2R84A 3MELA 3WLLA 4E1VA 8AT1A 2DU8A 1KH1A 3EBOA 2VYNA 5DSXA 2XB6A 3RC3A 1H3FA 3SN6A 4I6JA 2OFXA 2HIAA 3F4KA 4ZAFA 2EWWA 3WK5A 4F8JA 2GEUA 4UEWA 3W5UA 1U9JA 1EFRA 2IEYA 3VQTA 1U1EA 4L5IA 5CUQA 1NLMA 3ZE7A 1FDSA 4RD2A 1KDTA 3EQ7A 1ZCBA 5T6BA 4Q37A 1VGQA 2H7CA 1LK5A 4MWSA 2C7OA 1AZTA 4EFDA 1JMVA 3BTUA 4PLHA 1AHIA 4ND3A 2HF8A 4ZCLA 1F1BA 3BB4A 3DUFB 1I4TD 4N9WA 5AW5A 3VHLB 2OCXA 2PBRA 3KP1A 4YMTA 4TYYA 1GRQA 2ZQ5A 1BYIA 2CJWA 5FLXA 1KNXA 1Q6YA 5JPCA 3SEFA 5JY1A 3SHWA 3SVZA 2ZUBA 3ED5A 4P0PB 1JEQA 1BDBA 1ORHA 3T34A 1NBWB 3LDFA 4NBRA 4EL5A 4KRXA 4RVHA 3V1MA 2CFRA 4YJFA 3B7WA 4R9SA 4E51A 2B2CA 3L0SA 4PGFA 3UEOA 5JDIA 4GO1A 4OKSA 4Q1CA 1FPQA 3NTXA 4LTNA 4QYMA 5JAPA 3D0RA 5DX1A 1H8HD 3D2AA 3HCOA 2REOA 4TV8A 2JASA 2JH9A 5KNDH 5DIZA 2B1GA 3UOGA 3VR6A 1NMSA 1CT9A 4JBWA 4S1PA 3R7NA 2VRBA 1HDXA 4YJ2A 3A4TA 2VXCA 4F4JA 4KACA 3JD2A 5CLIA 4J2OA 4KQMA 5BYKA 2GZMA 3U40A 1SUSA 2D13A 4C3UA 5HJ7A 4IDAA 3DC7A 1TUEA 4URWR 2AKEA 4RD6A 3H16A 3PPXA 3T9BA 4KR7A 1RPNA 3QVJA 3AJEA 1G9TA 1JTVA 4LYFA 4OU4A 3FF1A 2AEJA 4BGEA 1VA5A 5FR1A 1YC5A 1KZ1A 3BIFA 2C5GA 4R83A 5B37A 2W71A 4AJ2A 4MEAA 4UMVA 1RE1A 4ZAVA 4DCTA 3VC2A 2DCMA 2PA3A 2W6MA 1U2TA 5DLQC 4L0QA 4Z7JA 3AL0C 3J81k 4C87A 2VDVE 1NPDA 3HU2A 3VH1A 4MV7A 3NV9A 3VV3A 3WWCA 5C1PA 4LZLA 4A2CA 1IXZA 4DMKA 1W8IA 4ZPJA 4F2HA 2A9KA 1EGVB 1Y81A 1PJLA 4OI2A 3RHZA 3NMUF 2Y27A 1JSLA 1ZUNA 2LPMA 5KU1A 4YRMA 4S04A 1C3OA 3H1PA 2QZ9A 5KAMA 3I1JA 5HUHA 1FTYA 4Z2YA 4J2TA 3KSUA 2NU6A 3DMTC 3ROPA 4P7BA 5EHNA 5BSRA 4NU6A 3MFQA 5IJZA 1YQWA 2Q0XA 3DGFC 3UMYA 3OA2A 2ZB8A 4Y2TA 4TTQA 3GMIA 2WJVA 3HBAA 3VYRB 2A9JA 1JHOA 3DXFA 4TXHA 5LKAA 1DJNA 4DBLC 3KQVA 1NVWQ 3U62A 1AKQA 1CQJA 4F12A 2O8VA 2A9VA 5I9NA 4ISCA 5HE8A 2IOYA 3U31A 1ZK2A 4CCYB 1NQWA 4JVMA 3O83A 2ZR9A 1H2EA 5FPSA 1C4KA 3DO5A 3A11A 4P4TA 3ZY3A 5IXYA 2ID7A 3TLXA 4B79A 4GOLD 5EZSA 1N0HA 1O03A 5CVEA 3VPAA 4EF4A 1DBPA 1GPWB 3N2ZB 1QGDA 1SXHA 3R3HA 5DZSA 3CWQA 5IM5A 4BN0A 5CBPB 3KQUA 1UBJS 3ZDCA 3EQZA 1K3FA 2IIVA 1ZLXA 2WUFA 4KQHA 3U61B 1KDPA 2WD7B 2QR5A 2P67A 2NOAA 2G71A 4U0KA 2PMCA 1DAOA 3MA0A 1OBFO 2VNSA 1F4PA 3IXMA 3QEAZ 5TMEA 3IERA 4DMRA 2CXRA 6NULA 4ZYXA 2G67A 1ZM2A 2VTVA 2OZVA 1AUPA 3TE6A 4D0GA 4IQ0A 5HS4A 1TXGA 4L27A 3MERA 4P7GA 2E4VA 2H0RA 3A36A 3BRCA 1B74A 4OGFA 5F64A 8MHTA 1OB2A 3TUJC 2JIQA 1AKYA 2CD7A 3O8QA 3LX6A 3VKHA 3PL1A 4EUEA 5DI3B 1F48A 4U3JB 3OEWA 2NXCA 3TBKA 1P9LA 3PNOA 3NDRA 4L16A 4LJAA 4XM0A 4KOAA 4DBLE 2EP7A 1H5QA 1X87A 2YQ5A 1QS0B 3NPMA 1OLXB 3TRJA 5JD5A 2VC2B 4H9GA 4WRRA 3JD4A 4JC5A 1KK0A 5EHQA 1YS2X 4COOA 4FEEA 1BHO1 2H00A 4RPKA 2O0MA 1W9MA 3H7IA 3UWKA 3SQOA 1HQDA 2GHIA 2GX6A 3L6DA 4G5HA 4O4IF 3UICA 4BVKA 4HAIA 3SC4A 1RRGA 4DLNA 2PIAA 4X92A 1VJ0A 2QY9A 1R0XA 3T99A 3KLOA 3L7YA 2X1VA 5B5SA 3KXLA 3IP1A 4BWGA 3V1NA 5JAHA 3EAFA 3V46A 1C14A 3EIFA 3QE9Y 1CQIB 1IUPA 2NTJA 2XYHA 3OT1B 3ZOZA 2D1FA 2CVZA 5JSUA 4CT0A 4ZDKA 3DONA 1D2CA 3H18A 5JC1A 1ESCA 4IF4A 4OHWA 2J85A 1D2GA 2B0CA 1E7QA 4NCKA 2IPOA 5IG2A 2JBAB 4L4XA 3DTVD 4R3UC 1CG6A 3GJSA 2NAFA 4BN4A 3NUZA 4EEKA 4F56A 5AW3A 4K0RA 1P61B 2WT8A 4HDOB 1SKYE 1T3LA 4WZ6A 4NMMA 4TKMA 2IP4A 1ZIXA 3UK2A 1ICIA 2JJYA 2V3WA 3A3PA 3NYQA 3PA8A 1T2FA 1SXJE 3OLQA 3UW1A 1U63A 2IYNA 5J47A 4J0QA 5L4LA 1FYEA 3CLSD 4CL0A 3PE3A 5J2UF 4LSWA 1NDUA 3C7KA 2WHQA 4UPDA 4LC0A 4LJSA 1HXHA 2ONKA 4LOKA 2CEKA 5TXGA 3ZBQA 4AG3A 3WADA 1NY5A 2MR6A 3HC7A 1BMTA 1YHYA 3B9BA 3KQYA 4J3JA 1NNUA 4M1WA 3X1DA 2O8DB 3IEKA 4U0JA 1XDSA 2ZETA 2BHRA 3DBHB 4IJVA 3RGWS 2D59A 3TQTA 5K3BA 4GR5A 4EI7A 5CT9A 4PHHA 4LXIA 3HO8A 2GJ4A 4NX2A 1PUXA 4QSHA 4YJGB 2A5YB 4A0RA 1E7WA 5DX0A 5LB4A 5C4IA 1WB4A 1B00A 2Q9AA 2DH6A 4UFNA 5SZHB 3DO6A 3VU3A 2JD0A 4PO8A 2XW6A 3WISA 5JYCA 5L6MB 3JQCA 3TSYA 2UUBB 7MHTA 1MJFA 3CHYA 5ENVA 4BKMA 3IDAA 4O2LA 4KN6A 5HIAA 1KO8A 4MRMA 2P79A 3T0GA 4OP2A 1FX0B 4FSXA 4GUAA 3WO1A 4WE3A 3BCRA 3A28A 4ZZ1A 2GXSA 4IIJB 2OV2A 4BKUA 2CJFA 4E4TA 3VRHA 2R6CA 3WA6A 4F5DA 1BS9A 3DB2A 4CMBA 2EZTA 3AYXB 1GTJ1 1C3XA 1NIJA 4GM0A 3ND8A 1I5RA 4E03A 1N8KA 4PZ9A 4CT5A 2RKBA 1SB8A 3FGPA 5DXAA 5KYUA 3N8DA 4ZZ2A 1N9KA 1IM2A 3L0IB 2J87A 1J0DA 1CIVA 2VPQA 5JUWA 4AI6A 3FB4A 1P1CA 3CH6A 5CR9A 3GX1A 3C3YA 1A72A 4FI3F 3NOXA 4WLNA 4C30A 5FWNA 2OD9A 5KSPA 1QTRA 3RAPR 4EEXA 4QXMA 1IB6A 4R51A 5LBTA 2JGMA 4AUMA 4WLEA 2OXRA 3BWCA 4G5FA 1B0PA 1YB4A 1U0LA 2G1AA 2C4MA 3K1AB 4FC7A 4Y3UA 1OWLA 3IPXA 2C9CA 3I9KA 4M53A 3ZWAA 1H0SA 1KK1A 1W30A 3UK1A 2Q6OA 1QB7A 1QH1B 1NPYA 3B1JA 1Y7PA 1U1FA 1XTVA 3M49A 3RVNA 1MHTA 4Q15A 1JJVA 1W75A 2QP9X 3BZBA 5P21A 4FGZA 2PZJA 1ISPA 5FWYA 1P0CA 1SK8A 2GERA 2MYTA 2X9NA 2CSUA 2YFKA 2YHSA 4DYHA 3B6EA 3O8CA 1SKQA 1J9GA 3BK2A 3E7DA 3FX2A 3KT0A 4IHQA 4WLFA 4WOPA 3AFGA 4AUKA 5CDYA 4A92A 1P4RA 2ZU6A 3FLBA 4HMOA 3A4VA 4M9UA 4TZ0A 3RVSA 4URFA 4L3WA 4OAPA 2IXGA 4MTCA 4KJXA 1MDBA 4AVYA 1GUDA 4W1QA 3PWKA 1E8MA 1ENZA 1O0CA 4RHCA 1USGA 2LZ0A 1KH3A 2PZAA 2I7XA 1JR6A 1E6MA 5J4LA 5EERA 3DV9A 3JYPA 4AO8A 2BSQA 4I3HA 1FXWA 3IELA 4FYJA 3W06A 3UK7A 3EPKA 1IK6A 5LR6A 3TO5A 4DQLA 1N0UA 3LK7A 4PQGA 2FR8A 1EWKA 4WSOA 1EM6A 5JMPA 4BFLA 5IKPA 1RKUA 1RJDA 4KQJA 3NALA 5DSZA 1FUUA 3L9WA 3SQMA 3TNJA 3THOA 4OFWA 1IEQA 5IAOA 4PLPA 3DOEA 2J3QA 3OVMA 5KX5B 3TZLA 2V97A 3ITDA 3M70A 2JGLA 1V25A 3C3DA 3HEMA 4C0LA 1U7PA 1A5TA 5AJYA 3U7GA 3EVGA 4LYDA 4TUYB 4MRSA 4ZICA 1PKXA 4YWHA 1R0SA 2ILTA 4ZEWA 4DDVA 3OO0A 1DWPA 2RJ3A 2WUDA 3COSA 3TIGA 4FX2A 1WSWA 4PR3A 5IKXA 2XCTB 1P3JA 4P8RA 2WC1A 5BNIA 2PKXA 4FFBB 2BONA 2I87A 3P0IA 5DTIA 5THQA 4QFDA 4L75A 3ZV4A 5CRIA 1BDIA 5IBQA 2XA9A 1YB1A 3ELYA 2D5IA 1ZMXA 2ZYAA 3ZIDA 5B3AA 4UUPA 2PYDA 3AINA 2B92A 4LGVA 5KVSA 1AQLA 2JIDA 3HACA 4PTYA 4R1MA 4I8IA 4WY5A 1K97A 1X7WA 2QVYX 3U3MA 3AG6A 1JQLB 4TZKA 4Y0VA 2XVAA 4AQ7A 4AZ0A 1Y6RA 2FVYA 5AKKA 5JEDA 3CZPA 3EHDA 4WW0A 4BS9A 4JB2A 3TCNA 4A82A 3FJYA 1Z36A 3PZRA 3P2IA 1NIPA 3RAGA 1DFIA 3W5VA 4DSNA 3TQFA 2QSZA 2Q5JA 5ER6A 5KJFA 4X1OA 3EPPA 1UJ6A 1SG6A 4F11A 3KU4A 2EZ8A 2RH8A 1FL9A 4JB3A 4D4IA 2OM6A 9GPBA 1GSHA 3VNQA 2UZ0A 5AM3A 4GQIA 4IOJA 1DQZA 2IZ1A 1EH5A 2DM6A 3CLRD 1V37A 3EUWA 5IDQA 1SUPA 3FWKA 1OZFA 2QJFA 1M1XB 3A3OA 1ISIA 2ZQYA 3CVWA 4AB1A 6PFKA 4Q3EA 3KHUA 2O8BA 3ZHSA 3TW6A 3LH5A 5D3MA 2C0QA 1XALA 2OM2A 4Q02A 2AEFA 4MHSA 1KJZA 4BMOB 5BVGB 1DVRA 3PGA1 4U2BA 3SDSA 4QATA 2OILA 1TU0A 2O5EA 3RRMA 3MWYW 3JS5A 2BBTA 4MEJA 2HMWA 1R9NA 2IYRA 1A3CA 2AH5A 3MJVA 3VR2A 2W2VA 5DASA 2Q4EA 4FYXA 4C4AA 4L07A 3N8KA 4AYWA 2W4QA 1WJGA 3QEMA 5B6IA 2RAUA 1WY5A 1JI0A 3INRA 3GV0A 5IM4F 1QHEA 1IN4A 4ZRNA 1YDMA 1JLRA 2YVKA 1NUSA 3SSAA 5KNLA 1UAAA 5FLEX 3MTJA 4L9RA 1P45A 2C7QA 3U4MA 3VOBA 4QXQA 2NX2A 3MJDA 2HCRA 1Y1QA 2RAVA 1GNTA 1DFGA 3RF7A 5DN6D 2FWAA 4YJHA 5LOVB 1UBSB 2DERA 2GN6A 1ND5A 4MMZB 3TLYA 2R6ZA 4TYMA 1G9XA 2I7CA 2JAPA 2P27A 3I92A 1EZZA 3KWJA 4PYJA 5K3CA 3O82A 4Z0TA 5LMUB 3WL3A 4LG1A 2AJCA 3O9MA 4M6WA 3AM4A 4NLLA 2BN4A 4WXYB 4EGJA 4IDCA 3K09C 1AK2A 4L8LA 4CFSA 4HLUC 2J5RA 1Y9EA 2C5LA 4X5OA 2EJTA 3FBTA 5A3RA 1P6QA 3IT1A 1EGHA 3BIWA 2Z3ZA 5EXXA 5FBVB 2CWDA 4IR7A 3S8MA 2J6IA 5KTKA 1E9VA 3PRYA 2I8AA 3HSYA 4I6EA 2P4SA 4IRXA 4WJKB 3EGWA 4D8TA 4JJAA 3HU3A 5KWIA 2JBHA 2GAFA 4TQ9A 2A9RA 2VAXA 2BFFB 3IESA 5JAUA 1H5NA 1JKJB 1ORDA 3ZU3A 5EJ7A 3L8DA 1V45E 3GH3A 2H2FA 2DVMA 3AUTA 3MMNA 4GI5A 2R9VA 3TQRA 4ERXA 2GYVA 3LUJA 3OQVA 1R0KA 3HUDA 3FPCA 3FVQA 3PUYA 5EPUA 2QZJA 4RJKA 4DQUA 2CV2A 2Q2VA 1J9EA 4DQ0A 4Z4IA 1V11B 4OGKA 1GPKA 1PZXA 1XYGA 2JK0A 2KMLA 3UA4A 1X15A 4EG7A 2BDTA 4JQOA 3KJEA 1JG7A 1KQOA 2R8EA 4G4GA 4MQEA 1M34A 4K6GA 4G41A 1J7JA 2ZTSA 3L06A 3MTQA 3QV2A 2XWQA 1KPHA 3G0HA 1ECFA 7REQA 4UAUA 1HFWA 4H7EA 3B13B 2HI0A 2WJHA 1XELA 2OHOA 3ILXA 5AXBA 2KLBA 1B3BA 1XG5A 1AQYA 1XD2A 2PJZA 4JZYA 4M8SA 4RK6A 2UUCB 3CLUD 1ODSA 2FQWA 3DG9A 1ESDA 1M2FA 1S1CA 4U5QA 2EKZA 1SAYA 1VHQA 2HEIA 3EUFA 2Q2WA 1K75A 4O5OA 1L4HA 4WN3A 2ZWOA 1EK2A 4Y9TA 5GM1A 4BMPB 2R68A 3PXAA 4KDFA 3TKAA 5CIYA 3T5AA 3BXXA 3FCEA 1SZCA 4IJ6A 1PJRA 1MT0A 5CT6A 1J8MF 1RYDA 2CDNA 3AERA 3T7CA 3V55A 4X94A 1XDDA 5EJ8A 3LS2A 3WX0A 1HLPA 4B7AA 5BPHA 2Q3LA 4JI1B 3C5WP 1R4MB 5IAGA 2Q2NA 2O9JA 2YTZA 3H8VA 4PPYA 4DZRA 3O0DA 4GXTA 2VUTA 4XWGA 3RH0A 2GBPA 1TPYA 2VS1A 3ZCUA 3CF4A 3AGQA 4DUZB 1CYDA 1DKOA 5CDSA 3FTDA 4M7PA 3QHAA 1XJCA 4PX5A 3W05A 1HL3A 2AE2A 3BE5A 4KVGA 5H4HA 1JFSA 1U7OA 4M0UA 1UXJA 5D51S 5K20A 1FRNA 3WIOA 4CFZA 1KI7A 2O2ZA 5FI5A 4UTPA 2YINC 2Y0BA 4R8KA 5AK3A 5BR1A 1UFRA 1E1NA 4PNEA 2AI1A 4LVOA 2V7XA 3V2GA 3CF4G 2W6CX 3AL2A 3D7SA 5C52B 1CNEA 2ZAOA 1EUZA 2CHEA 4DLBA 1VMEA 3GPLA 2Q6LA 2X8BA 3ZV7A 4IICA 4ZTUB 5EI5A 3ZHQA 5CEEA 2BV3A 4NCNA 4F97A 1K8ZB 3MD9A 5CK5A 2X9GA 5ALEA 1VLQA 2DF8A 5DT9A 3UA3A 1ZA1A 5A9TA 1YAHA 1FSSA 2QTFA 3RNOA 5EKSA 4C22A 4F9GA 2ROQA 4MZXA 3GGJA 4JJ4A 4ZEOA 3ZBPA 4EPXA 2FPWA 1C1HA 3JVIA 4N3NA 3RTCA 4MI9A 1MU0A 3BF8A 4Q18A 1T8YA 4YRIA 2DH5A 4KLRA 4RC9A 4I4TF 1SKAA 3ID6C 3GP8A 2P2LA 1HG0A 4GMFA 2QZZA 1LDEA 1AV7A 1JPJA 3OZAA 5CXQA 1JSCA 3QWFA 2H31A 1N2OA 4OUDA 4KB5A 4CIVA 2XQFA 4JL5A 1TMOA 1LBSA 3AP1A 4NYJQ 5AIAA 5EVJA 1MVNA 1IJKA 4X3CA 3WGJA 2EBHX 1NXQA 4GI1A 1E59A 5ERYA 5AVSA 2JD2A 2JGAA 4IZ6A 4N18A 2XMCA 3V6MA 3RC8A 4ENWA 1ENPA 3IHWA 4GLFA 2AG6A 1I14A 4J75A 3KQKA 3T7SA 2GPAA 3UAGA 3ESBA 3D6AA 3L18A 1P0PA 3GHHA 4IQ8A 4IRMA 4LJKA 2QX7A 2FPPB 3KQTA 3FWHA 2VNAA 1IY2A 2FJ0A 2XYGA 2CT8A 5L7WA 1C9KA 3FMIA 2IEDA 3FSEA 1G8PA 3R7WB 2XNHA 4RF2A 4B80A 4LXUA 3JYQA 3M8KA 4EDFA 3ICVA 3U49A 4KR6A 3WYBA 5FBRB 4ZHQF 1O5IA 1EE9A 3DLTA 5FOSA 1TLLA 4BMVA 5KOHB 2NO6A 3HLYA 2Q50A 3FGZA 1MFPA 1E79D 1GA6A 3RB8A 1DNPA 1MKYA 2C2KA 2QPLA 1C9NA 4TT8A 1N2CB 1E9BA 1RYBA 1BN6A 2Q6VA 1Q57A 1GQSA 2WZDA 4ZVTA 3SJUA 5JCXA 3TRHA 3AZOA 2W2PA 4Y6RA 1R5OA 3LRXA 4REQB 2WY2D 3PJGA 4G65A 4ZQFA 3MLAA 4FU0A 2VSXA 2P41A 3I4LA 1T1EA 2H57A 4B2IA 5BR8B 4U2FA 1IZYA 2O8FA 3I9OA 3NIGB 1PBTA 2OY0A 1OZAA 4B3FX 4EF5A 3N7UA 2YFYA 3L7JA 3IAAA 3WGTA 3PNBA 4DJ5X 1VJTA 4XYMA 1NURA 4UATA 1DQYA 2YJGA 5FV7A 2B6HA 1XC7A 1BJRE 3RU3A 3ASVA 3EE6A 1RXCA 2FUG1 3F6EX 1L9XA 2ADMA 3LL4A 2GZRA 1VMIA 3OPYB 4PLZA 3SQXA 4PQEA 3QU2A 5HXAA 5KTMA 1AKMA 5FLYA 4H0CA 1F4LA 2B1RA 5MFPA 4EG8A 3DLHA 3GB9A 3C97A 1ECPA 4P22A 5JSKA 1R0RE 2C9MA 1ZK3A 3L7KA 2PHZA 1J8VA 4ZT7A 2NSJA 2W11A 3VH4A 4IIEA 1KAOA 1R4NA 3JV7A 3QVOA 4QWWA 4BJ1A 1RAGA 3G85A 3KYCA 3ZTWA 2A7QA 4RDCA 1Q0UA 1E7MA 5UKDA 1OH7A 4HLQB 2FU5C 4RTSA 4ZI3A 4AP9A 1DO8A 1C7IA 3PRKE 3AKDA 4W8GA 2X9VA 3L93A 3PTAA 3K5PA 1Y1LA 3MXOA 4K3UA 4UVEA 3RVRA 1N34B 1WVMA 1ZJWA 1HRKA 1NW8A 1P39A 3DE5X 3M3PA 5EZYB 1DAGA 2FWBA 5ADWA 1H2HA 3ND5A 3KQNA 2OCYC 1P1IA 4E3ZA 1UK7A 1JG2A 3RUDA 1VP9A 1E1KA 2J3IA 2OHFA 2P7IA 5K3FB 3B60A 3E9ZA 3HDQA 3KETA 3CN9A 4B6QA 2VO1A 3QE3A 5B4UA 3FSRA 3HVRA 1B6RA 3KOWA 3S99A 3JPWA 2J7PD 4YUWA 2JIMA 1U8YA 2V8BA 2OSVA 5FOUA 1ID1A 5KYWB 4M7OA 1FMTA 1T3GA 2HADA 1OC4A 1IXSB 1T8WA 1Z2PX 2QENA 3GJXC 3WGMA 4DCGA 2PFSA 2ZYWX 5TJ9A 2B8WA 1NXTA 4BE4A 1UM9B 2LIVA 1OQAA 1A9XB 2RG7A 2O2SA 2ZDGA 3I2IA 1GGFA 1UMDB 3QEOA 4WBXC 2OWDA 4HATA 3CRRA 4MV6A 2Q29A 1JI3A 1XX6A 4JV5B 2OBMA 1YCFA 1V4VA 1MC1A 4NR0A 4K6MA 1NFRA 2H65A 1C2TA 3LUCA 3R20A 4INJA 4Q3LA 4Q7EA 4WERA 2O1XA 3PC6A 2ZRJA 1KE2A 5ICGA 5JJCA 2XZLA 4QOFA 3OWOA 1SA0A 1GL3A 2ZEJA 2I2FA 3DWEX 3Q2OA 1JA9A 3UJPA 3WQQA 1T3ZA 1JIIA 4V3CA 2XRFA 1EUDB 1SU4A 3CC8A 2I4IA 3HG7A 1R2QA 4KAAA 4AMBA 1KOGA 3RCBA 3H6KA 1NGSA 3SE0A 4OX9B 1TYEB 1EWTA 1KP2A 3BMCA 4Q9LA 3R9IA 4N3BA 3I32A 5LP1A 1XCGB 2NWQA 5CVUA 4A0FA 3LA6A 2QZ4A 4S0XA 4CLOA 2GN2A 4H0NA 3SOPA 7YASA 1OIXA 4PNHA 1VQ1A 3HJTA 5IMBA 4OQMA 2H2GA 1XHEA 2LVBA 3O0TA 2XQJA 1W2WB 1A5SB 3HJNA 3QG5A 4OMDA 2H9AA 4R9RA 1XLVA 5KHAA 3GJYA 3H4IA 4H7PA 2A84A 2W2NA 4GLOA 2XMPA 4AJKA 4EHAA 5KTOA 3DVRX 1UAYA 3OZDA 4G63A 4G89A 2RGDA 3D7KA 2VDOB 1KYZA 4QYIB 1PDWA 4ZANA 5AK5A 2LR0A 2W8BA 2ZB3A 3BHMA 5BQ5A 3UXMA 2Z6VA 3S40A 2ZBRA 1M7GA 4HWKA 4ER7A 3LYHA 3WP1B 1DX9A 2OFWA 2ZJBA 3KQMA 5BRJA 3EGVA 4DV0B 2I6SA 3F1LA 3O8OB 1TK9A 4MQLA 2NUBA 2YS7A 3IQXA 3HA3A 3JTMA 1OFTA 1T9GS 2FW8A 4R6WA 4BB5A 1U2SA 1XNRB 3F96A 2WIDA 3MYYA 2AUTA 4L9AA 1N5OX 2P90A 2JCXA 3L1KA 4GT1A 4IJWA 2ZAIA 4IILA 4IOKA 4P4NA 4BB6A 4I1VA 4LRXA 2IF2A 3GARA 3ZVMA 1W44A 4BO4A 1JDNA 1YJQA 5K6TA 4D8WA 2W2KB 4IZHA 4JEMA 3WQSB 4ES6A 3HCWA 1SXPA 1KEEA 3HJCA 4YUXA 1ZRHA 1JQ3A 4URUR 2VP6A 2P5YA 3H84A 4OJKA 4TX1A 5DLYA 4HS4A 4YXWD 5EQDA 3HADA 3TZ6A 4EUSA 4UUAA 4XQGA 2JFOA 1SUDA 2CMFA 1YTLA 3B6IA 5HGXA 4AO6A 5F2KA 4EVSA 2Z8YA 2IP1A 1TJ5A 1YV9A 3B53X 1JU3A 1Z47A 3BREA 1RZVA 1GZSA 2WD9A 3C0KA 3ESRA 3TEMA 2ZGVA 4XUCA 2X23A 1M6VB 2F7SA 4Q3BA 1C50A 1PG0A 1SHLA 1JR3A 2WLSA 1XKLA 2YQZA 1ZI6A 4HRAA 4JNKA 2XOKD 3KXPA 2IVZA 1QCDA 4KRYA 4RK0A 3SU8A 3W7AA 2I62A 2VQ3A 1MIHA 2I22A 3B7GA 3BVPA 3JQDA 3PR1A 1OOEA 3R0IA 4GYKA 4IO1A 4MPRA 2FKAA 1I80A 3W8EA 1ADBA 1Q14A 5C81A 4HGZA 5FL7D 4JCOA 5CXUA 2ZWAA 1KO7A 1VMKA 1YUNA 2Y1KA 1VL6A 1KDVA 5CA1A 3IUQA 2GMWA 1QAQA 3AFOA 1WCV1 2RBKA 3ZEIA 2LTAA 4MKGA 1TUBB 4HFMA 1EP1B 1R3DA 1MB0A 1XCMA 4GRDA 1VRCA 4X6LA 3BSFA 1CTQA 3LX8A 2PXCA 4M4SA 5EL0A 1WV0A 4QJIA 3CVXA 1RRVA 4R9NA 4C08A 1QRDA 3TXAA 1ZR4A 1M8PA 4JEUA 3IDOA 4ZXPA 3V1YA 3N53A 2YZKA 3GRFA 4NYJR 4W8OA 5AH0A 1NE7A 1YJ5A 4RH1A 5JNLA 1UAGA 1UOPA 3S2YA 1ZSYA 2Q07A 4ZPXA 2QAGA 3WNBA 3EZ9A 3QMPA 5KAPA 1P7CA 4GL2A 5GPBA 4N5NA 3U0VA 1KDRA 4KK3A 4F3KA 3EC7A 1XTSA 5B55A 5CJJA 4UMDA 1SUAA 2RFLA 4DSZA 1JIJA 1VI5A 4RFSA 3DXZA 4GMGA 1VBMA 2HK7A 3H86A 3NTQA 2EU8A 3LQKA 2IW1A 3QY0A 4QHTA 4XGKA 3J81A 2XZPA 4PCLA 5BRNA 2CV0A 2ZPAA 5JJKA 2PK3A 3E03A 3GJ4A 3UHAA 4PNZA 3GL9A 1VYVA 4C6TB 1E2IA 4L5YA 3QSYA 4G5RA 4YCBA 3REFA 2M6KA 3K4QA 5F2NA 3K9LA 1TX4B 3LLVA 1V9LA 3BGIA 2CVPA 2NO1A 1YKFA 2FR8C 3G2JA 5EKXA 5FO1A 1M6WA 3MM4A 3RADC 2H7YA 3C5HA 1EBUA 1U0JA 2VJBA 4ZAYA 4F4FA 3IKMB 3WSVA 4DIUA 4S1OA 5DCLA 2BMEA 5F7ZA 2WP0A 2CXSA 2ZRQA 1VM6A 2I9PA 1XP5A 3L8CA 3NWBA 5EIAA 5CVDA 1L4MA 3OY2A 1GZ7A 3FETA 4ZO6A 3VZCA 1OIVA 1KFBB 4QTTB 3BWMA 1FFWA 5FPTA 5HQJA 1Q1EA 2ECFA 5KPDA 2GF2A 4DWOA 2P9JA 2TYSB 4OHCA 3EXEB 4TL6A 5AK4A 4RULA 3CVUA 4KUGA 2VJPA 3NT5A 5D2CA 1Q2UA 2Z5FA 3AUJB 2RMKA 1KWGA 1V9SA 3IIKA 4TV9B 1NJ1A 3KVRA 3CLVA 1MJHA 5JNVA 2BGWA 3OOHA 4I50F 1ZHOA 2VHZA 5FBKA 1JDBB 2ZIUB 1K8QA 3JVVA 1PZNA 1YR6A 2HMVA 1G8MA 3BUSA 3LDUA 3CX7A 3ZDQA 4J2HA 4WA8A 5DMXA 2W0MA 1A97A 3HPQA 2IFTA 3RNLA 4FHCA 5FEUA 2BOVA 3Q3HA 3PDWA 1TT5B 4X24A 2BGKA 4CMGA 1DZ3A 3OZCA 2R79A 4IAOA 1NP7A 2CL0X 2QQGA 2QRJA 4MAFA 4MVJI 3UFXA 4F46A 1TTQB 4QIHA 2FSIA 4H1HA 3EWSA 1RLJA 1KOJA 3IT0A 1SPXA 4KNYA 2G70A 2APJA 1NUPA 1W1WA 1NNLA 1E5TA 4MPPA 1XYVA 3DOCA 1ZZGA 3DD5A 1J42A 3W6UA 5CTAA 2Z3WA 3DLIA 1DC6A 2JCBA 1ICEA 4NYMQ 1FK8A 3SBOA 1SXQA 5C7YA 3NUGA 2Y1FA 4JWTA 4LEIA 1M1YA 1Q2XA 1T13A 2J0UB 1DOHA 3BXHA 3HQ4O 3KEGA 2BFCB 2FCAA 4DLVA 1A1VA 4E12A 2XB8A 3HCRA 3GEDA 3ROQA 1QIJA 1ZO8A 3T54A 2JAUA 2YJ4A 1OT3A 1ZBQA 3D8TA 4V1CA 5DW0A 1A8QA 4L74A 4QGBA 4RPIA 3F2IA 4PAOA 2MJLA 4KPFC 2HSEA 1SVUA 4NDAA 4U02A 2PYZA 2UUAB 2QGZA 1U3UA 4RU1A 5BUQA 2JVKA 4JMLA 1DKNA 5ADUS 1USVA 2JJMA 2A5LA 2IH2A 2B34A 4IIHA 1R37A 5FRDA 2YICA 1N0IA 2OBLA 3C6KA 1QQBA 3LY7A 2Q3FA 2XVZA 3F6PA 1HEYA 3HBJA 1QIIA 4J7UA 4BEWA 3GA0A 3H2SA 4N7JA 2V6BA 1K7FB 4L9SA 2NPIA 4OHFA 5KVCA 5CCBA 1U2DA 1CXZA 2M1ZA 5AK6A 4DOMA 3KQLA 2E6KA 3DT6A 3OOWA 4IQFA 3FTQA 1ZUWA 4NECA 1L4FA 4IPTA 1U2ZA 2FUNB 2OB1A 3GJTA 1QU3A 4QBKA 4JLJA 5JE8A 1D5WA 1FNSA 3PR2B 5H3LA 4D82A 2HTFA 4XR9A 5EZQA 1V3TA 2JRCA 5EKTA 1YB6A 4MB6A 2V7QA 3P9SA 4TYQA 1YZKA 4EB6A 1P29A 2Z3VA 1UM8A 2A33A 1LBIA 4L6IA 4S3MA 4CDGA 3LDGA 4B3MB 3QX3A 4GGOA 4OHYA 2MYUA 5E2BA 1ENOA 2R7NA 3W4JA 2IXDA 1U02A 1D9XA 3EODA 4RETA 2WTXA 1RRKA 3MGGA 1UZMA 3GJ6A 1O0BA 2JFZA 1Q21A 3W78A 5KQPA 3COPA 1QAMA 1H94A 2PUFA 4QGAA 4KXYA 3CEMA 5CYOA 5TQ0B 4RY2A 1H8ED 4YALA 5HUJA 5JS1A 4ARIA 2IYFA 4C1BA 5AKLA 5FP0A 3NBKA 2X0DA 3AEZA 4S2EA 3W9UA 4N12A 2HF2A 4HDAA 3DT8A 2XKBA 2B8TA 4Y98A 5AKHA 4MYDA 5IU6A 3HBNA 3OJEA 4G36A 3SFVA 2X58A 1CZHA 4FNAA 2HPAA 3OQBA 4MQUA 3WGNA 2GOYA 4K9DA 4DAOA 3LCCA 2V0GA 4EY8A 2V6JA 4PGMA 4M0KA 4MIOA 5CCDA 3FOBA 3JRXA 4HL6A 5EUCA 2Y05A 3CZ5A 4QULA 4YQYA 1XJQA 5FTMA 1N77A 3U9SA 1A1SA 1U7UA 3RGGA 2R7KA 4BO0A 1BN7A 4LTDA 4HB2A 3BMXA 4IOMA 4WBSA 2QVXX 3UAZA 5IUJC 5IBPA 1T4CB 2VSOA 2HIMA 2QMYA 4PW0A 4DHWA 1UBCA 3T1TA 5AI6A 4D81A 1O94A 3NCTA 1RJWA 1WDMA 2H2AA 4P5EA 3TW4A 3CZAA 1D2EA 4MS1B 4RJLA 5T4BA 2J48A 3U9LA 2ZWPA 2O7VA 1ODFA 1XZLA 5AESA 3B7PA 4II7A 4OOEA 4K9LA 4R0NA 4Q16A 1GDDA 4MUKA 3AIMA 5EMJA 1GAEO 1BU8A 5E6SB 1BS1A 3HM2A 5C3UA 1SVIA 5CFLA 2OCGA 4W8HA 4KI7A 2PGOA 3E9RA 2XR1A 5CGZA 3WYCA 3BT7A 1JQJC 1TE2A 4I6GA 4HNHA 1YWGO 2XKAA 1FTQA 4UNIA 5DPMA 2W4IA 3VPHA 3FUTA 3KYJB 4MWZA 2A1TR 2D0PB 1P2UA 3CIOA 1Z7BA 1YNSA 4RHYA 3GLIA 1KPIA 4XWOA 2R47A 1XZDA 1NHGA 3H6GA 3CU5A 3NWJA 2HSZA 2YNMD 3A0UA 3OZSA 4A6XA 1NP3A 1OLUA 3WJAA 4B3JA 5I4IA 2O2YA 1IXYA 4L22A 2IY7A 2NZXA 4XH9B 4DNXA 3A04A 3NU1A 5JR3A 1KEZA 1ECLA 1NN0A 3R3UA 2WM3A 4DDTA 1S7GA 1ZD4A 2JKVA 1W48A 1ZH6A 3FCOA 1MX3A 4BX9A 5B57C 2Y2UA 3U3OA 1QGUA 2WWRA 4L0DA 2WFLB 1DLJA 1NTOA 3L3BA 3CNBA 4G26A 3RSOA 2QD3A 3QQ5A 1FDWA 4FE4A 4LISA 4QDOA 3LE8A 1JTFA 3ZYCA 4XJXA 3JZDA 4ENVA 3UMVA 1QJCA 4GP7A 2VPWA 3KPYA 3V7FA 2NUPA 3ZXYA 1V8PA 4BAZA 5JAMA 2IOFA 3WGVA 1L7EA 4I1UA 2VT6A 2VHWA 5H9WA 1BX0A 4YP7A 2GGSA 1FSZA 2QRZA 1HLFA 4MYHA 4PPNA 4WY8A 1C8BA 3ONEA 5IDVA 3R8CA 4QLBA 1U8TA 1YZFA 1LS6A 3LUGA 3DWFA 3WR5A 3VGJA 4U9IS 1PNOA 2OENG 1GNVA 1EFLA 2AL7A 3BSYA 3NTOA 4JBIA 2XTAA 4UM8B 5CM8B 3PXCX 5FHRA 5LIRA 1Z74A 4DLUA 1MRNA 3QNUA 1JT9A 4TV8F 1SPBS 2XIQA