4X8LA

Crystal structure of e. coli adenylate kinase p177a mutant in complex with inhibitor ap5a
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
214
structure length
214
Chain Sequence
MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAALIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for catalytically restrictive dynamics of a high-energy enzyme state.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transferase
molecule keywords Adenylate kinase
total genus 76
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4x8lA00
4URUR 3LY5A 3EG5A 1D6JA 1TX4B 2ZREA 3IPYA 5CJPA 2ZSBA 4Q02A 1KSGA 3RANA 2FSFA 2UZ3A 3NWJA 5FTJA 2HJGA 2ORIA 2WKRA 3SZRA 4F91B 1YZTA 4QRHA 5D3MA 3QG1A 4OYHA 4TZ6A 2FJUA 1Z0KA 4C0JA 1Z6AA 2J41A 1G19A 4ESHA 4DT1B 5CIWA 1WF3A 4JZKA 3E2IA 4TQAA 3U7GA 1FW6A 4TLCA 1G5PA 1AZTA 1P60A 2GVZC 4HEJA 3CR7A 1E9SA 4Q4LA 4LDJA 3W3AA 3AUXA 4TYQA 1GL9B 1T0HB 4B3FX 2ZUCA 4C2UA 1BYUA 1E2DA 2PT5A 3I3SR 2AK3A 4G1UC 4C0HA 4ZCIA 1I4DD 4M53A 4BZQA 2X77A 1P2SA 3DKPA 4C0AC 2OEPA 2ZRKA 2JJ1A 2JIZD 4LYFA 5JI3E 2QGZA 2RHDA 4OJQA 2AR7A 2HYDA 3I32A 4TMZA 2AD5A 3U7HB 1AA9A 4PSAA 2GXUA 4UQOA 4PXAA 1CU1A 3SJCA 4G01B 3K0EA 5DO9A 4BFVA 2QBYA 1LFDB 1S4QA 3ICQB 2EYQA 2SHKA 3PEVA 1SZPA 4P31A 3IEUA 1IQPA 2A2ZA 2ZROA 1HTWA 2Q3FA 4CIDA 4FIDA 2ZRPA 1TUEA 3L43A 4P4TA 1V5WA 4RCYA 1NLYA 1KDOA 2ZS7A 4DLYA 4E03A 3Q9LA 5J47A 4JLVA 2ZRIA 2PEYA 1E2LA 2RB4A 4AKEA 2GHIA 1NN0A 1GRNA 4JBXA 2AHOA 1E9AA 1G16A 3QI2A 4DC9A 3ZJYA 4OI4A 4PC2A 5IK2D 2A9KA 1G8PA 5JMTA 4QHTA 5EZ6B 4A1FA 4DIDA 3BRWD 1FOEB 2JLYA 4QGHA 4FCTA 4JYBA 3KTAB 2GESA 1VHTA 1G3MA 1YR6A 3MWKA 2IUUA 1UPTA 1VDZA 3WYFA 2IYTA 1S8FA 1H8HA 1SVKA 4QJ4A 4B3GA 3SJAA 2R2AA 1CF4A 1E94E 2IEYA 1EWRA 1CR0A 2IHBA 3NBFA 1QF9A 4HDCA 4BFXA 1DO2A 3ND8A 3PVSA 1N6LA 1J99A 2A78A 2LCFA 1GZSA 4TZ0A 3SNHA 3AM1A 3RABA 4JVLA 2VP9A 2CHGA 3ADBA 1NRJB 3P4XA 4O3MA 1P75A 3WBJA 2CBZA 4DLVA 1PUJA 2ZE6A 2XITA 1LTQA 4V0ME 5AUNB 3VAAA 2AXNA 2DBYA 1CKEA 2IC5A 3E1SA 4Q66C 2IXFA 5DGXA 3E70C 4JT2A 1XF9A 2QPTA 3HPRA 3AVOA 1DO0A 1K5GA 2HDNB 1TF7A 1ZC4A 2V7QA 3SU8A 1KJYA 4Q9KA 3OEED 2XZPA 3MUFA 3KQKA 2EFCB 1DAIA 1XP8A 2Q9CA 3NDBB 3OAAD 3FKQA 4RD4A 3UATA 1L4YA 1XXHB 4PHFA 4MYTA 2Z83A 4D0LB 5JS8A 4A15A 2PL3A 2PLFA 1F48A 2DFKB 2JJ2D 4LJAA 3RS3A 3B13B 1EFHA 1FUUA 3NC0C 1T8UA 1OFTA 1YVDA 3T06B 4JLOA 4RKFA 1WA5A 1CR4A 1D5CA 1ZBDA 4NYJQ 4GBMA 2O0HA 2GJ8A 5L3SA 1KY2A 1G5TA 4KFTA 1OT3A 1S96A 1E2FA 4YMTA 1R0ZA 4URVR 5E7IA 5JWOA 2ZRCA 3GQBA 3FVQA 4LJ9A 3VMFA 2PLRA 5DNYB 1M6NA 3UG7A 2CXXA 3EARA 3QENA 1OIVA 1J7KA 5EXSA 3QY0A 5DIFA 3RRNA 1X3SA 3SYNA 1CBUA 2KSQA 1IJFA 3U6KA 4JLAA 1LS1A 1OW3B 1TADA 1TQ6A 3LX8A 3W8NA 2OCPA 1FPMA 4LYHA 2NZJA 1KI3A 2IYSA 3GJXC 1GKIA 2ZRMA 4TYPA 3LXRA 4NP6A 1E4VA 3EC2A 3VR3A 2WKQA 1XPOA 5TMPA 4M1YA 1BO6A 3ZVMA 1RFLA 3IIMA 2P5TB 2JATA 1KK3A 3ZIAD 4XIGS 3VR1A 1N0WA 3THOA 4IW3B 2XNSA 3A4NA 3QQ5A 3L2OB 4EFLA 3THXB 3LLMA 4BFTA 1E79A 3FFAA 4KCGA 4IDOA 1N0UA 4OI2A 1DBSA 5CYPA 3U2QA 4JJKA 1IXSB 1ETUA 1XCMA 3A6PC 4WVFA 4O0MA 1Z08A 2RGEA 2O8EA 4KITB 2IWRA 1Z29A 2L0XA 1NBMA 4NYMR 2IW3A 2CL0X 4C7OA 4TLEA 4OK3A 1KSJA 4BQSA 3LQRA 1J90A 3TUJC 4D81A 1GRRA 4B71A 3AUYA 2QN6A 1NVXQ 1EX7A 2FFQA 5JHGB 2D2EA 5FR2A 2FSIA 2C5LA 2OLKA 3AQ4A 1QHNA 1BMFA 2ERYA 2W83A 2XXAB 1NLFA 2CEAA 1T5LA 4AD8A 2B8TA 3AF2A 2JAQA 1QRAA 1VCOA 4A4DA 1G8GA 4RFSB 4CEIB 1R0WA 3ZD7A 3VFDA 3K1JA 1Q20A 2BJVA 5KHOC 4DUGD 5DI9A 1GDDA 2KJQA 4DUGA 2PBRA 5FPYA 3QPUA 3LVQE 5JSZB 4PSKA 4A2WA 5HZHA 2CCJA 4HLUA 3EAQA 621PA 1AQUA 4KBFA 4BPBA 4R2HA 2OBNA 4DLUA 3VKHA 3O8BA 4DDWA 3B78A 4G0NA 4DDUA 1EGAA 2WPDA 4K81B 2VP2A 5FBQB 5KSOA 2A5JA 4DDTA 5E7JA 2VHCA 2WJJA 3N5CA 1QHHB 2PCLA 4XWAA 3RRMA 3J81k 3LLUA 2QMHA 3VR4A 1D2MA 5FTNA 4D80A 2P5SA 4MA4A 1U94A 1S0UA 5DH9A 1MH1A 1X8JA 1H8ED 3GLIA 2WWHA 3LXXA 3FHTA 1KHTA 5CB8A 4AKGA 4UNSA 1E1RA 4JL8A 2IUSA 5IF9A 2HXYA 3SFZA 1UBGA 1P61B 4JLPA 2CL6X 5L3VA 1E2IA 1E2MA 1TF2A 2BV3A 4BGDA 1RE0A 4OHXA 3PUYA 4G5OA 3KJHA 5JBQA 1GFIA 4M4SA 4URXR 3GFTA 3WNDA 2FDCA 1Z6XA 1EXMA 2NO1A 2KWIA 1PV4A 1M74A 3KQNA 5JEEA 1XPRA 1E1QA 4NU0A 3GFPA 2O8BB 1XMIA 2QMEA 4M1MA 3IIKA 3W8RA 2IT1A 1E9FA 1OFUX 4CEIA 3R7WB 2GCOB 1W5TA 2JIZA 2GXSA 2P3SA 3FMPB 5FOWA 5EE1A 3ZYCA 3JVUA 3KQHA 3O8CA 1RIFA 2BKEA 3CF6R 4B48A 3QKSA 1TAGA 1BKDR 2P6UA 4JSTA 1JQLB 2E9SA 3IBGA 1L7VC 1OH7A 3TLXA 5D3MB 2CLSA 3N70A 3QEOA 1TNDA 3A8TA 5G53C 2VF8A 3QVVA 1D2NA 3U44A 2VSXA 3PJRA 1FX0B 2R6GA 4E07A 1N6RA 1AKEA 2P6RA 4D4MA 4X8OA 5E4FA 1QDEA 3PXGA 1NNEA 4XVQA 1GL7A 1QBKC 3M6AA 3AKDA 3WYGA 5IT5A 5AJYA 1Q1EA 4LV5B 1F60A 3K9LA 2IUTA 1Q12A 4NTZA 4LBVA 1S9DA 3L0OA 2WOJA 1CJMA 2ZM5A 3AVYA 1F5NA 2VL7A 3GMTA 3LRPA 2R65A 4PC7A 521PA 2PZFA 3W3ZB 5K8IA 4YONB 1L4UA 1VKJA 4ZI3A 3FHOA 1HEIA 4Q4HA 2N46A 3KKOA 3TAUA 1HQCA 4ESVA 4KYUA 3V00A 2OFXA 5KO2A 1ZIPA 3LW7A 4Q4JA 1ZYUA 3ZS9A 4DWJA 1W5SA 2XSZA 1XTKA 3F0TA 3ZIAA 4AIIA 1Q3TA 4Q5IA 3PG5A 4NYJR 4H1VA 2EW1A 3UMRA 3UMSA 2J46A 1S9HA 1BH2A 4OK5A 5B57C 3IGFA 1J8MF 4C30A 3IQWA 3PEYA 2WMOB 2ECKA 2XXAA 3NH6A 3LWNA 2QU8A 2O0KA 2R8RA 1XCGB 2FZLA 3NVAA 4BRUA 4Q47A 1E0KA 3KB1A 4FWIB 2IYLD 3U6BA 5FOTA 5KSPA 4TSFD 5JCPA 5DHFA 1UFQA 4NYIR 3VX4A 3C8UA 3MWJA 5K8LA 3EXAA 3AP3A 4PQFA 2HYIC 3AF3A 3D31A 3EZ2A 1R8SA 2C03A 5FL3A 1R0XA 5HE8A 1YQTA 4B73A 4CT5A 3A4LA 2Z43A 4YMUA 4W7SA 3ZZUA 1YE8A 2LKDA 2VP6A 3QPWA 1IXZA 1LVGA 2V7QD 3BE4A 4EAQA 3UPUA 1WE2A 2ZI3A 1DAHA 2Q9BA 5DISB 2NO7A 2IA5A 4K46A 5EE5B 3TJZA 4ZDKA 2D74A 3GJ0A 3W6OA 1ESMA 2CCKA 4P4SB 4AC9A 3EIEA 4CT4B 4F38A 3AV0B 5EP2A 1Z06A 1QHXA 2ZVPX 1A1VA 1MOZA 1JR6A 4TMWA 2GZDA 1XTIA 1KO4A 2GXQA 4HATA 1Q3HA 2VA8A 3CRW1 3I92A 2OCAA 4IVPA 1E9EA 1F2TA 4XWKA 2ZVQX 1RRCA 2QAGA 1UDWA 2C99A 4UJ5A 1UBEA 5DI3A 4LBYA 4B76A 2H7VA 2C95A 4RFSA 2R62A 4OI1A 1GG2A 4L4UA 3LV8A 3HU1A 2QM7A 2J0QA 2QRZA 1UKYA 1AJEA 5GJCA 1CLUA 1OB2A 4QBFA 5HKKD 2ZJ5A 3AGPA 4RZUA 1U8YA 2GNOA 2FN4A 1NIPA 1FQJA 2V55B 2ZYTX 1M7GA 1NVVR 3AVVA 1TTTA 2QORA 4DLTA 1G8FA 3Q5DA 1KOFA 3PENA 2OFWA 2AD1A 2ZSEA 4LC0A 1RRFA 1N6NA 1VIYA 3FYHA 2QAGC 4IDQA 3DM5A 1M34E 1Z0FA 4YLGA 5B64A 3GLGA 1JALA 1T91A 1TMKA 2IYQA 1U99A 4JS0A 4RD3A 4C4PA 3CKLA 1Q21A 1SVMA 1IY2A 1IOZA 4MGKR 1DS6A 2C98A 3RS7A 4JKYA 1P5ZB 2D4HA 3IQXA 2YWEA 4KAXA 2BJWA 2W58A 4RSGA 2RGNA 2ZI6A 2F1JA 2A3RA 2FG5A 3L8ZA 2BBSA 1Z6GA 2R6AA 2ZJ8A 4RZ2A 2IXEA 2JJ1D 1PLKA 2AFHE 2FU5C 4GOJA 5LD2B 1XB2A 3X1DA 5FH9A 1SVLA 1P9WA 1FL9A 2YKGA 4GI7A 2EFHB 3P20A 2OXRA 1EESA 2XOKA 4NONA 3K53A 2OCYC 3T1QA 2XOKD 4I1UA 3IO5A 4OI0A 2H5EA 4V0KA 4AYWA 1E69A 1GWNA 4OHWA 4GMDA 4HAYA 4Q7JB 5KSYA 2ZJZA 4J0QA 1VG9B 1G291 4MGIR 4OQMA 3ZVNA 2CCGA 3OF5A 1E96A 2XB4A 1SVSA 2BMJA 4KI0A 2DCUA 3TVTA 2VHQA 4WW0A 3PCRB 2QAGB 4JIMA 2QP3A 4LBZA 2ODWA 4JLJA 1G7RA 5JRJA 1JXOA 1W2HA 1YR9A 4PZYA 4JL6A 3BH0A 2H16A 4QG7A 1Z63A 2V1XA 5P21A 2XTMA 5JHHB 2NPFA 3BFKA 1NKTA 2EQBA 4LJ8A 1E0AA 2JLVA 2ONKA 2GRJA 1R4AA 2OAP1 1DARA 5FPHA 4TLBA 2ZRNA 4CW7A 2B7CA 2QI9C 1X8KA 4WZBE 4LY6A 4V03A 3X2SA 3IO3A 1KJWA 4B6FA 4URZR 1A2BA 2N1BA 2QEQA 4NMMA 4TLDA 4D0NA 5CLQA 3CNOA 4HB0A 3VNUA 2VSFA 1NSFA 4HZUA 1SXJC 4QBGB 5FTMA 3H2YA 2JCSA 4Q21A 1P4SA 3KXLA 3GLGE 4GP7A 4QC2A 3AGQA 2OO7A 5F2EA 1XWIA 1ZCAA 3PIRA 2FFAA 1FFHA 1R2QA 3D3QA 3HJNA 5KSZA 4IHQA 3ECCA 3FHCB 3I72A 5HTKA 2GETA 4ZCLA 2ZYWX 3FGNA 4JT4A 1II9A 1FTSA 4N0DA 2ZE7A 1MABB 5J40A 1MRSA 1II8A 5BN3A 2ZRHA 4DKXA 4HAZA 3QPVA 1S2MA 3VHXA 1VHLA 4MKGA 4DRZA 4BLPA 4OKSA 1KYIA 2B7BA 3CR8A 4AG5A 5GVSA 3MCAA 1TUIA 5CDFE 4PANA 4WZ6A 1R6BX 3SE0A 2ZJ2A 4QKQA 4S35A 3GCGA 4LOAA 1NMXA 1Z22A 2ZRLA 1ZNYA 4DCTA 2J0SA 1LY1A 3R20A 3WRYC 4GZLA 4S2EA 4XVRA 3PFIA 2IYVA 4WZAE 4O2RA 1E1QD 1KK2A 1ZNWA 3FMOB 5FI0B 2F7SA 4LI0A 1JB1A 2UZIR 1GNPA 2GEDA 3H86A 3L0PA 1HH4A 2J7KA 3K9NA 2IWHA 1TQDA 1KNQA 2NO9A 3EASA 1YR8A 2I1VB 2FFBA 5GJWC 3K0FA 2GDJA 3PUVA 1ZIOA 2W00A 3OIVA 1SXJE 2G77B 2WZQA 3UMFA 1GAJA 2J45A 3QBVA 4U02A 2RGXA 4PZZA 1IN6A 4B35A 3LFUA 1QG4A 5ELXA 1NBME 1EG7A 4A8JA 4HYYA 1A4RA 3MWYW 1NN3A 2FZ4A 2RGNC 3B6EA 1CXZA 2VP0A 3WP0A 3TMKA 2JLUA 2QBYB 3KQUA 4P3YA 5FR1A 3ETLA 1D9ZA 1E2HA 2VHJA 3EA0A 2BCGY 1YRBA 3RC3A 2HEIA 3KKPA 2FPLA 2CK3D 1DVRA 4CF7A 1ZU4A 2O52A 4KJZA 2KB0A 3BJIC 3OE7A 2PZEA 3DZDA 3T5DA 4DSUA 5IRCD 4U7DA 1CEEA 4M9XA 1QHSA 1U8ZA 4R98A 4E5UA 2A5FA 4L15A 1E6CA 2QROA 3WYAA 4ASUA 2D7DA 3R8FA 3ZGXA 2VP4A 5IDVA 4W5WA 5C18A 2XEXA 4EJSC 3DEFA 2FFHA 5BQ5A 1DAEA 4EPVA 3E5HA 3HU3A 5F98A 1N5JA 4HLCA 1CJTC 4Q1AA 2WWWA 5UKDA 4HB2A 3EZ9A 5EJEA 2O8FB 4QNMA 1DE0A 1K6MA 3T1TA 3W6NA 1JJ7A 2IYZA 2XJ9A 1G8YA 2YC4C 3OEHD 4DJTA 3ZZTA 3THWA 2VBCA 4I81A 1KMHA 2W6JA 4FMDB 4IJMA 1YRAA 1P2UA 5F9HA 1JPNA 2YZ2A 1W36B 1TPZA 3BGWA 5A0FA 4LPKA 4EFMA 2UVQA 4DLXA 3A4MA 4Q1EA 3SYKA 4CDGA 4Q4AA 2BC9A 1DG1G 4D82A 1HE8B 3GJ3A 4LBWA 4EDHA 3GLFA 1WXQA 2OESA 3QXHA 4ARZB 3DO6A 4TTRA 3A36A 5G40A 4ILEA 2GBLC 1RJ9B 4L16A 5AJXA 2FX3A 4QFMA 1PJRA 4I1VA 4XWOA 4GNKA 2H17A 3W34A 3C5CA 4PFSA 2IS6A 2D06A 3U3JA 2ZRAA 3BBPA 5J4KA 5JSZA 2W2TA 2RCNA 4HSEA 5FPSA 4MUAA 3RS5A 3WRXC 3X1YA 1CIPA 4MITA 2QT0A 1VCMA 1W4RA 1G21E 4NPHA 2Z4RA 4G5SA 1GP2A 3SJZA 1IBRA 4I4LA 1HT2E 3BB1A 3MAAC 4B6EA 4BRWA 1KAGA 4FCWA 4LWZA 4NCKA 1W4AA 3QKRB 3SHWA 1R5NA 4QGGA 4EPRA 3NH9A 2FH5B 3WNCA 2QSZA 3BIFA 1DAFA 2YC2C 5GJBA 2PEZA 2IYYA 4I1SA 4DB4A 3KFXA 4GZMA 1EFUA 3A1SA 1OIXA 3O8DA 1GITA 4V0MA 1H65A 3CZPA 3BD9A 2J87A 1NN5A 4RKEA 5FOSA 2GTPA 1V43A 1UDXA 2FEMA 2F1IA 1Z6YA 2FPKA 1BOFA 4PAQA 1RPZA 1US8A 4DLZA 3I61A 2RAPA 4MQBA 4QGAA 4JYCA 2YVUA 1KI1A 1KI4A 2VTKA 3SC3A 3MGCA 4TMXA 5EUQB 1D8TA 1NVVQ 2GK6A 3SYLA 1OKKD 1Q1ZA 2PX3A 2O5VA 2ODNA 3LVRE 4AYXA 2J0UB 1ZVQA 2PMKA 3NIBA 2J7PD 2EU8A 4PX9A 1F2TB 4RZXA 3W5JA 2OV2A 4AG6A 2VH5R 4ITRC 4MKFA 3TSOA 2FEOA 2QGNA 5LPNA 4L8GA 4Q7MB 1T5IA 3IUYA 4GMXA 1HV8A 2ZI4A 5JWRA 4B34A 2V1UA 1M7BA 3WMEA 4BFZA 2IK8A 1XEWX 2R6FA 5AUQA 1F6BA 1N0VC 3BERA 4DSTA 1M7HA 1NJFA 3SQWA 3V4FA 1GOTA 1G7CA 2X1VA 5AJWA 4LHVA 4LK2A 1TU3A 2CVFA 4LJ5A 3WHLA 3MRSA 4V0OA 4BLQA 1C9KA 2ZETA 4A92A 4TYYA 2JLXA 1JEEA 1W46A 5TY0A 1F2UB 3KUDA 4RVCA 1WBBA 1XJ0A 3B1WA 2GVDC 5DLQC 4D4JA 2CLCX 3RWMB 1G4AE 3AKCA 2EFEB 1NKSA 3PUZA 2QP4A 1A82A 1NY6A 2B92A 2R6CA 4ZIRB 2E1RA 2WJIA 4M22A 4TTPA 4Q9IA 4GL2A 1VYVA 2P67A 1T9HA 2Z6VA 3REFA 5C1BA 3KX2A 1QHGA 1BIFA 1XXHA 4JBWA 4LV8B 4B2LA 1CJUC 2NGRA 3OHMA 4HLQB 5BN5A 5K8UA 5CB6A 1ZM9A 2CMKA 1VCIA 2JGNA 3MJRA 2OZEA 1H8HD 4B43A 1KK0A 2F55A 4IVRA 2OSBA 2I3BA 3EZ7A 3KJIA 1X6VA 3V4RA 1Q1QA 3HR8A 3FPAA 4KSBA 3L0IB 4YDHB 3NDPA 1XBTA 2XTNA 4B32A 4NYMQ 4QGFA 4NZYA 4RD2A 5CK4A 721PA 2F1HA 1WBDA 2WWYA 2CHQA 3D6TB 1XXHE 1KDTA 4Q7KA 4PAMA 1ZM3A 5E7MA 2NOAA 2ZAOA 4N3NA 2ZSFA 5CIQA 1KDRA 1W0KA 3ADDA 4HAXA 4HB3A 2DB3A 1XTSA 1JR3A 1VPLA 1JNYA 3ZQ6A 4EPWA 1XJQA 4OHVA 4R71A 2AL7A 2YINC 4POAA 2OCBA 4TSFA 4F4CA 3CPHA 2NO6A 3NEYA 2DFTA 2WJHA 3NC1C 4H1UA 1GKUB 2OILA 5FUVA 2F6RA 3I5YA 3EPJA 2O0JA 3VKGA 1IJEA 1PUIA 5FUYA 3UWKA 4DCUA 5AJZA 4QL3A 3THWB 3VX3A 4PC1A 2IS2A 1Z8FA 5JJIA 2VEDA 3DOEA 4JVMA 4YMVA 1IXRC 1RC8A 3ZLJA 3A1UA 1YZNA 1E0SA 3F8TA 1NMZA 4HZIA 5JS7A 3CWZA 4URYR 3RS2A 1T6NA 3K9HA 2A5DA 2O8FA 5C46F 2HF9A 1Z0JA 2IHYA 3BB3A 2QTFA 4NCNA 2RGDA 4TMKA 1W48A 2DPXA 2ZJOA 3DMDA 2BBOA 1VG8A 2AXPA 1KI6B 3MWLA 4Z51A 5L8VA 1CR2A 3U4QB 2AX4A 2GJ9A 2QENA 3AF4A 3AKYA 5H70A 2GK7A 4FN5A 2NZ8A 2GKSA 1QVRA 1TU4A 1TEVA 4M1OA 5KDLA 2QE7A 4FMCF 4RD6A 3A1VA 2ZJAA 2WMNB 1KO7A 4O25A 2XGJA 4HI0E 4XH9B 4DCSA 1ZAKA 2DWPA 2NTYC 3BOSA 4MGZR 3W9YA 2QZ4A 3GP8A 3BXZA 1DEKA 3TSWA 5J4LA 4D26A 1VCNA 2HV8A 1COWD 3WY9A 4P0TA 1ANKA 1X1RA 4LRWA 4O2LA 2CJWA 1KZGB 3PUXA 2QAJA 2O8DB 5FOVA 4LYAA 2DY1A 3QKUA 4A8JB 4EKDA 4IVQA 4RJLA 1E1RD 4TL8A 3QF4A 4C9BA 3CX7A 4C0QC 2ZI7A 3DMNA 4DDVA 2Q0HA 2GCOA 1P72A 2YOFA 2ZU0C 3A58B 3C7KA 2CK3A 2IXGA 2IX3A 3ZZ0A 3MFYA 3KJEA 3ND9A 1OJLA 4YQFA 4RFVA 4HB4A 1XPUA 2X2EA 2D3WA 2F43A 4CEHB 2B21A 2GJKA 3F5FA 3I8SA 2QY9A 3P1JA 4EIWA 3UIEA 4C3ZA 3QKTA 221PA 4PPNA 3WP1B 3PQCA 2GJAA 3T35A 3GEIA 1G3RA 3BWDD 2WV9A 4MRSA 3ZQJA 1MO4A 1YZUA 2B8WA 4R9UC 4AWXA 4DHEA 3CH5A 4DT1A 1NIJA 1N5IA 2V54A 3I73A 1KSHA 3KJGA 3DHWC 2HLDD 4QJ5A 1YJ5A 3TGPA 1Z0AA 2HLDA 3OFNA 1Z0DA 4MUBA 3ZS8A 3RWOA 1Z2CA 2JLZA 1OH6A 1KJZA 1XZPA 5SZIA 3PR1A 2ZUBA 1OHHA 2GZHA 2TMKA 1CP2A 1MO5A 1OHHD 5CM8B 1KI7A 3TR5A 5KNBA 2LKCA 2WBLC 2G6BA 2ZJBA 1ZD9A 4MYCA 1XEXA 5B30A 3AVWA 1DAGA 2CJWB 2ZEJA 4FW9A 5HPYB 2BMEA 5FBLB 4KLZA 1R7RA 2BBWA 2Z5FA 2XJ4A 2C78A 3BFXA 3CH4B 1SXJA 4EFNA 5KTYA 5JWHA 4XD7D 3OIUA 1SQ5A 1KGDA 4XTRA 1VIAA 5FFMA 4F4IA 3V9PA 3HPQA 2HCJB 4PPFA 3ADKA 4OQNA 2V3CC 1MO3A 1XX6A 2VF7A 4HZUB 4ZDWA 4B75A 4EUNA 5HR5A 3QIAA 3I4LA 1U0HC 2ZYUX 1Q1BA 1P6XA 4ERNA 3W90A 3D7MA 2HF8A 3U4QA 4B2IA 3T1OA 5BW8A 2G0NA 1W7AA 1X86B 1E2QA 3L8YA 1G64A 1N2CE 3JZAA 3B5JA 1U90A 4F7WA 3NEJA 1OXTA 1CJKC 3GLHE 3KL4A 4AK9A 3BFVA 1KKMA 4OHYA 4Q01A 4X8LA 3CO5A 2CE7A 4JVNA 4BEJA 5L3QB 1CRPA 3GLGB 2CVHA 1OIWA 2WHXA 4HUQA 3HYTA 3RS4A 4QHYA 2VSOA 1I2DA 2OE2A 3DL0A 2RH5A 1WDTA 3MJHA 2JDID 3K8YA 1S1CA 2FGJA 1UBCA 4KBGA 4KODA 3VR2A 2OT3B 4IOMA 2ZSAA 3RSOA 2HJVA 1ZCBA 1NVWQ 3TVDA 1A5TA 5C4MA 1F2UA 1CJVC 2RGCA 2G0TA 4HUQB 3U3OA 2ZRDA 3PUWA 2DHRA 1Y3AA 2F1RA 1LS6A 1UKVY 3MG9A 2V6IA 4JLMA 3K70B 4QOSA 3VHLB 3EIHA 3GLFE 3FE2A 4TYWA 3U7EB 2K5UA 3U3KA 2GEVA 2KBEA 1OKKA 2AN9A 3EX7C 4BLOA 3PEWA 2WVJA 3LO5A 1K5DA 3M0EA 3UG6A 3THYB 3IKJA 3TSZA 1XU4A 5GADl 1IY1A 1ZU5A 2J1LA 3O8RA 2F3TA 2ZI9A 1UADA 3IHWA 4UJ3A 4LV6A 3C5HA 5B2ZA 5LD2C 1QG2A 1P3JA 2MSCB 3CX8A 1JQJC 4CYMA 3CUEF 4PAOA 2G1KA 5FUWA 5GJVC 1S1MA 1NSTA 2J0UA 3H4MA 4E09A 4KV9A 2C9OA 1QZXA 3LW8A 1LF5A 1E4YA 2BDTA 4BZPA 5BN4A 4FXPA 3Q7PA 4GT1A 3PITA 1KZ7B 3CF2A 2BMFA 3QJYA 4AURA 1E2KA 2J9RA 3HYRA 3CWQA 3NBZC 1ZNZA 2CLDX 1E9DA 3K70D 4Q19A 2XNDD 1SHKA 5KDOA 4Z54A 3LNCA 2XNDA 4A0GA 4WXRA 2YV5A 4P32A 3FTQA 4A6PA 4D4KA 2LWIA 2N42A 4N1AA 2IF0A 5JCZA 3DOFA 2H8KA 3SFVA 4TMTA 4UXHA 1W0JA 2Q9AA 3KUCA 4NE2A 1OYYA 5C4GB 2VYFA 1UKZA 4RY2A 3A1TA 3NBXX 4C0KA 1C4OA 2FA9A 3GJ5A 3NHBA 2V4ZA 4HAVA 5JLJA 1NN1A 3OE7D 1SKYE 3T61A 4W9MC 2W0MA 4I1OA 1AN0A 3GFOA 2JJ8A 4JJZA 1ZUNB 2Y8EA 5EXTA 1LF0A 2XSZD 2G83A 1G7TA 4MKHA 1J70A 4ASUD 4Q9HA 4ZDIA 4OK6A 2ORVA 1UJ2A 1JAHA 2WJGA 1P7CA 1TQ4A 3CONA 3VU9A 1MRNA 3THYA 1AGRA 2HCBA 2ORWA 3AEZA 1AGPA 3D8BA 5KUTA 3CW2A 4ARZA 1YZQA 3SBDA 1G3IA 4XJXA 5H8WA 4CEJB 1E2GA 1KSFX 1T3HA 1Q0UA 4NCIA 3I5XA 3LH5A 3QOFA 1HURA 2WKPA 2CL7X 4LPSA 1KI2A 1NBMD 3Q3JB 2W6JD 3AF1A 3AH8A 1OPXA 3TAHA 4A0RA 5A4JA 2WTUA 2RGBA 4DSOA 1OXVA 5DN6A 4BLTA 2D2FA 3WBKA 2W6IA 2ZUDA 5DN6D 2GF0A 5LBIA 3Q72A 3EA5A 4TLAA 1E99A 4TL9A 3K0FB 1KO8A 3NKVA 1FNNA 1EX6A 2IYUA 3K0SA 4X8HA 1W44A 2QRNA 1EFRA 2IBMA 1VECA 1UBFA 1YU9A 2FV8A 5JI2E 1SXJD 1XD9A 3VTKA 3EIQA 3TRFA 3QNUA 1PLLA 3LBHA 2PZGA 2EWVA 4WOPA 2MSEB 1T4GA 2F3RA 2ERXA 2JEOA 2H18A 2WJYA 2DYKA 1AKYA 2YWFA 4MDEA 2OM2A 1KK1A 4PPGA 2QNRA 4D2IA 1NJGA 2Q6TA 3RNLA 2F43B 4LJ4A 4CEHA 4LUCA 1G4UR 5FUXA 3EPHA 3M1IA 2ANCA 4A2QA 2RGAA 3OIYA 4Z1MD 1JECA 4ON9A 1P2TA 1OFHA 4Z1MA 5CK5A 5GVRA 5JJKA 1TEXA 1D9XA 2P65A 1XD8A 1HYQA 2ATXA 1AQYA 4WAUA 3QXXA 1AS3A 4M2LA 2QA5A 2RGGA 2ZRBA 3CB4A 2JDIA 5KNCA 3ASYA 4BECA 1E98A 2QT1A 1UM8A 3P4YA 1MABA 4DLSA 2C9YA 4ZDJA 4DCVA 1RRGA 1KMQA 4UNRA 3L0SA 2PJZA 3O47A 4JMPA 4R7ZA 5H1YA 4PC6A 4Q1CA 5KYKA 2W0SA 1Q44A 2VIIA 4OHZA 3B7GA 1Y63A 2ZTSA 2BCJQ 4IKEA 4QBHA 5AUPB 1JEDA 4AI6A 1OSNA 1T3SA 4OQLA 2FSGA 2IYWA 3AVPA 5FBRB 5M04A 1E0JA 3RRYA 1QHIA 4UNPA 1X8LA 4GOXA 1E3MA 2XTZA 2FNAA 3QE0A 4JSYA 4AKHA 4PHGA 1N5LA 4P4UA 2J7PA 2VQSA 5ANRB 1KI6A 4TQ9A 2ZR7A 4ZV4A 4LJ6A 5EUMA 1NF3A 4ABYA 3RRZA 5EQTA 1TL7C 2GILA 3RDPA 3SN6A 3MD0A 1JI0A 1O87A 3T34A 4KFSA 4UNQA 2O8BA 3FKSD 1U9IA 1DELA 1LNZA 2VLIA 3VR5A 4A82A 4IEEA 2C04A 1G3QA 3AVUA 4JBYA 1E2NA 3GJ8A 2CHVA 3LBNA 3KKNA 2QG6A 1NI3A 1MKYA 4IFBA 4Q1FA 3SS8A 1YZKA 3BORA 1SVOA 4MYUA 3W6PA 1WQ1R 3K0CA 3DM9B 1IY0A 2GF9A 2OFOA 3P26A 1N6IA 1II8B 2P6NA 4CEJA 2IF2A 4NKRA 1ELOA 1Z6TA 1OXSC 2R9VA 2WICA 5EE0A 4HDQB 4LJ7A 4Q9LA 5JECA 4PPQA 5BWMA 1T3LA 2V8OA 2OBMA 4OQXA 1HUQA 2ZS8A 1KI8A 1I2MA 1A2KC 1E9RA 4HDOB 5CDFA 2W2VA 2O8CB 4NCJA 4M21A 4DEXA 1CTQA 2AKAB 1XMVA 4DB2A 3UK6A 2HXSA 1P9RA 3VKWA 1QHYA 4FI3C 3RC8A 2GAAA 4EPTA 3CF0A 1ESNA 1ZM2A 4II7A 4C0SA 2QTVB 2NQ2C 3BH7A 3T12A 2BKUA 1KDPA 2BEKA 3K0CC 4KHZA 4URWR 2ZR0A 4JL5A 4A6XA 1U81A 1E79D 2JLWA 1GTVA 5JZVA 1Z0IA 3FDIA 5JRZA 1ZJ6A 1J2JA 4D4LA 2WWGA 5LDDC 1XNJA 2AK2A 3HU2A 3KKQA 4NBSA 1YZLA 1J8YF 4ZKEA 821PA 4FD2A 2NPIA 3FFBA 4KFRA 1JPJA 2QUZA 3EZFA 3G82C 3VQTA 2AWOA 1AS0A 1DOAA 1G9XA 1SKQA 4LHXA 1NG1A 5FBWB 1GM5A 1GL6A 2R44A 2YWHA 4GOKA 3ICEA 1ZUIA 4YMSA 4M9ZA 3JVVA 2BM1A 3CZQA 3K0AB 4TT3A 3C16C 4ZKDA 2JLSA 5BXQC 2WIBA 4HAWA 2GXAA 1A7JA 2VP5A 3AVTA 5G41A 2D62A 3VU9B 1FQKA 3IDQA 3HDTA 3P27A 5CLLA 4CZ2A 1XTRA 4YMWA 1Z47A 1JXMA 4QM7A 1OXUA 1UKEA 3B82A 5FL7A 3QBTA 4PHHA 4IXMA 1DAMA 4OBEA 5FL7D 3CPJB 3VR6A 4R2IA 1G1MA 2WAXA 2QP9X 1CRQA 1XEFA 2VRWA 4E22A 3RS0A 1KY3A 1P2VA 4F4JA 4MRRA 4IDNA 3UXMA 3U7FB 1ZM4A 4KFUA 2FWRA 5BYKA 3GJ6A 3GLHA 3MMPA 1E2JA 1RRPA 3DVLA 4QHSA 5HE9A 3WMGA 3IEVA 2FPMA 3LAWA 4WIAA 1OF1A 2VO1A 2YOHA 3BC1A 5KU1A 4EJSB 2QE7D 2WPDD 4BFWA 3UKDA 3KZ1E 421PA 3SDZA 2OHFA 3FMFA 1US8B 5J5CA 4BE7B 5FPTA 3AF0A 4V0NA 1GILA 2RMKA 3I1FA 1W1WA 5CITA 2HT1A 1KMHB 1G3UA 3CIOA 3GLIE 5B58C 1OFIA 1DTSA 2OUKA 4B3CA 4MKIA 1OE0A 2BEJA 2GZAA 1VYTA 2DWQA 4Z8XA 1RYFA 3KXKA 4P33A 4US2R 1RVDA 4DEYA 2C96A 121PA 1H8EA 1VG0B 4PO9A 3X1WA 5DYIA 1U2RA 2VHTA 3CM0A 2ZE5A 4HAUA 2BIFA 4U5XA 3TQFA 1FP6A 1KTVA 1X1SA 5L3SB 1HE1C 1FMLA 3DKVA 5SZJA 2FGKA 2ZRGA 1IN8A 2Z0MA 2ZSDA 2HUPA 4ZO4A 5LB2A 3FB4A 3LBIA 1TF5A 3JZMA 4IOJA 3PEUA 2ZU6A 4CGZA 4D25A 3GJ7A 1RKBA 4B3BA 1KKLA 4KYIB 4DZZA 4U00A 2I4IA 1S3SA 1ZMXA 2X2FA 3B60A 1M1YE 3IHLA 3KTAA 4JVSB 2ZPTX 5EXPA 1G6OA 3TK1A 5CM9C 4ZPXA 3TW4A 1G18A 2G88A 2OLJA 2C2HA 3A37A 5FBVB 2YOGA 3QVUA 1W36C 1PVOA 2DFLA 3SBEA 1XEWY 3K0AA 5DE3A 4Z8YA 4Q9JA 3KXIA 2H92A 3G0HA 2AWNA 3KKMA 5IHPA 1E2EA 3U60B 5TVKA 2NIPA 3HP1A 3TKLA 1Z28A 2MMCA 3OEHA 1Z2AA 2C77A 4GSYA 4RCZA 1SHZA 3L82B 1XDBA 2Q3HA 2PCJA 4ACBA 2GCPA 4ZIRA 4MRNA 3AP2A 3QXJA 1N6HA 4KU4A 3N2EA 3TIFA 4A2PA 4BWYA 5BYJA 1DADA 1ZUHA 3SQXA 4PC3A 3X1ZA 2JA1A 3EZ6A 1SGWA 2PMDA 4LGMA 1E9CA 4TWZA 4JLDA 4AY2A 5F3WB 3OIWA 4PHTA 2WSMA 2JASA 1SVWA 3B1XA 1EK0A 3OZXA 5L3RA 3ASZA 5KPJA 3QKSB 2XB2A 4EJSA 2KI5A 1HQYE 1CULC 2EFDB 1IONA 1DPFA 5G3YA 3NHAA 3ZH9B 3WMFA 2QMOA 3GEHA 4QJ3A 4F93B 4RD0A 5JJLA 3Q7QA 4UNNA 2WSSA 2YYZA 2G1JA 2AKYA 4B3XA 3R8CA 2REOA 4CVNA 2NO0A 1OYWA 4Q1DA 2A7QA 1AM4D 2IS4A 1G5RA 4M1KA 4JLBA 1YZGA 1XRJA 2X8AA 1U98A 3QXSA 3KFVA 2PT7A 3U3RA 1KO1A 2IEZA 1SULA 2QL6A 4JLKA 1EWQA 5EP4A 4Q4HB 2GJSA 2ZANA 3CRVA 4JLNA 4NHOA 4Q03A 3GEEA 3MSXA 5DHAA 4IFEA 1NY5A 1N6OA 3EWAA 1DAKA 2YNMA 3AP1A 4BLSA 3H1TA 3LD9A 4M8NE 5TARA 4L9WA 5KNDA 2MMGA 1U0LA 1XD2A 3QUSA 1NVUQ 1XZQA 2WAYA 1G17A 1YHNA 3CRMA 1XFAA 4KVGA 1GNQA 1AK2A 3B2EA 4HLDA 4UXIA 4ZI2A 4KSCA 3UWOA 2Z4SA 3Q8XB 3UANA 1ZD8A 5HCNA 5TB5A 3SOPA 1T0JB 4JKIA 2CE2X 5A5GA 1XTQA 2FMXA 1NG9A 5AJVB 4B47A 4FMBB 1ZRHA 5FI1B 5FOXA 1CR1A 1E2PA 2JLRA 1OH5A 1ZP6A 1LB1B 3K9GA 2WM9B 4PZLA 4DCNA 2PJRA 4DLWA 4TT3D 3AVXA 2NG1A 4H9GA 4DLRA 4HUTA 4M0LA 5HCIA 3K70C 2PX0A 3OEEA 1U9IC 3CPEA 3B8HA 4HLUC 3RHFA 1C1YA 1W49A 2FE4A 1IM2A 5TXGA 4A0HA 4I99A 2P0EA 2DFNA 3P32A 2ATVA 3OESA 5EXXA 1U8AA 3OAAA 3LX5A 1RYHA 5EP1A 5J4YA 3TBKA 2XAUA 1R5OA 2FOLA 2ODBA 5KOYA 3IBYA 4Q1BA 1GVNB 2HT6A 2JJ2A 1SVIA 1XMJA 2ZR9A 2GA8A 3TH5A 4M9SA 1WP9A 4OL0A 5DSZA 3C15C 1JAIA 1GKYA 4N0EA 1E32A 4NH0A 4AYTA 4IEIA 1SXJB 4EPYA 2DR3A 4FWTA 2ZIAA 8OHMA 3BH6A 1VMAA 2B6HA 1EFCA 1GIAA 1JR3E 1U0JA 3K09A 4US1R 4KO8A 4RZ3A 4KVAA 4QBIA 5AK0A 2XZLA 4Q4AB 4M9QA 3M4YA 3NBYC 1Q57A 3X1XA 4IDHA 2Q21A 4V0LA 5AR1A 4XSGA 1EFTA 4BFSA 2OAQ1 3DZ8A 3R9XA 1W0JD 1MR3F 1K8RA 3TW8B 2H57A 3U61B 2IYXA 4A8JC 2BVNA 1KAOA 1QHHA 4PQYA 5SZHB 1G20E 2QMUA 1XMSA 1Z83A 4C0LA 1XD2B 1ZC3A 3SJBA 5KDDA 3U44B 4XOIA 3THXA 5HZKA 4MRVA 4QXAA 3NXSA 2XZOA 3ZD6A 2BMDA 3AKEA 1CS4C 2C8VA 4G5GA 3PV0A 4LX0A 4C2TA 1GNRA 2G9NA 1W4CA 3NG1A 4M1WA 1IHUA 1L8QA 1OV4A 4Q7LA 1GRQA 1N5KA 4TYNA 2UKDA 3BK7A 1I4TD 3BAFA 4V02A 3FWYA 1T8TA 4ZCMA 1KI9A 2PH1A 3RAPR 1M2OB 3IIJA 3ZVRA 3SR0A 4UKDA 1ZINA 1W0KD 2WOOA 3OFND 3W5IA 4MDFA 3AB3A 3REGA 1FTNA 2BOVA 2JLQA 1MO6A 1F3OA 4PTLA 4EPXA 3FOZA 2IS1A 2ZE8A 3R9WA 1QVAA 2ZYVX 4TL6A 1MV5A 4LCBA 3G5UA 1P73A 3B1YA 4GP6A 1KIMA 4QM6A 4C7OB 2W6ID 3KB2A 1IN5A 4G5QA 2QM8A 1BMFD 4XVUA 3DPUA 2A5YB 2WIAA 1Q22A 1D2EA 5EE3A 2O8EB 4EQ6B 1B23P 2WWXA 5FOUA 2BHRA 5F9FA 1MT0A 4XD7A 3QF7A 3K09C 1N3BA 1L2TA 5IK2A 1FMJA 2WSSD 1OH8A 4LYJA 2ODEA 3QEJA 1PZNA 3KQLA 3S1AB 1G8HA 4A0FA 2CDNA 2F9MA 2ZS9A 1G6HA 2EVWX 3CNLA 3CX6A 4M1TA 4DIEA 2WJVA 3Q85A 4MRPA 1HT1E 4BLRA 4IRUB 4PO8A 1RZ3A 3AVQA 3QSYA 2RHMA 2FF7A 4DXAA 3IPXA 4D0GA 3F3YA 1OB5A 5JFGA 4BFUA 4B74A 1IN7A 3RLFA 2RKOA 4YC7A 2X19A 3IILA 3SEAA 2C9CA 4KXFB 3C4JA 1Z3IX 1G7SA 1R5BA 3H0KA 5D3QA 2ANBA 1Z5ZA 4IDPA 4C0BA 4PQRA 4G3XA 5AUOB 4RD1A 4LJYA 4LHZA 4TQUS 1W47A 3QG5A 3CBQA 1ODFA 4TTQA 1PLJA 3U5ZB 5K8TA 4Y0AA 4GRAA 4D6PA 4MYHA 3WXMA 5EZ5A 2ZITA 1FP7A 1UEJA 3CNNA 4PO1A 5JEDA 4A9AA 1BS1A 1NP6A 4AKIA 3BB4A 5E95A 2WWIA 1XTJA 1AZSC 4Q4JB 5E3HA 2ZI5A 5C2JB 4OJKA 5LB4A 4B2PA 1W4BA 1ZD1A 2EFGA 2W2XA 5CYOA 3GLHB 4P4SA 4PSVA 3U3MA 1IN4A 5CJ2A 3LQQA 1II0A 1UEIA 1P62B 2R6DA 1BYIA 2P2LA 3FKSA 3TE6A 3RYTC 1S3GA 2GWHA 3FMIA 3GLFB 3SI7A 1NMYA 2G3YA 1SKYB 2EWWA 3QXCA 5SZKB 4F92B 2ZRJA 3BS4A 3T15A 4B3DA 1ZW6A 1R10A 4MGYR 3ZVLA 1YKSA 1Z07A 3VNVA 2J3EA 4EQ6A 5J4VA 1ZNXA 2REXB 2J5XA 4Y0VA 3WNBA 1B0UA 2J59A 4XSHA 2GAOA 2QPOA 1UAAA 2IL1A 4A36A 4UXJA 4L5BA 1R0YA 3MLEA 2ZQ5A 1FZQA 4GPTA 5EE9A 4LZZA 4YDSA 3GD7A 4BUJA 3T5GA 1NLZA 1RW4A 2GCNA 1ONBA 4LHYA 2QQEA 2AFIE 1VYUA 5FPKA 1OXXK 4LSGA 4WXPA 6Q21A 5L3QA 4PR0A 3I62A 1O3YA 4IXNA 3EWSA 3RSLA 1N6PA 3QKRA 4FMCB 4IOLA 1WMSA 5TV2A 2ZRFA 2V6JA 4OQFA 1TQ2A 2H1LA 2MSDB 3A1WA 3KDSE 2OBLA 5DI3B 1GSIA 4FINA 2WWFA 2KBFA 3ONWA 1NL3A 3B85A 2BBTA 4DVGA 4DBLC 4MH0R 2I1QA 1FUKA 2V9PA 2OXCA 4FCVA 5H68A 2ONJA 1LW7A 1KO5A 1N25A 2QSYA 4LHWA 2IYRA 4M1SA 4QNRA 1XCPA 4US0R 4GDFA 2DWOA 1N6KA 1KNXA 3RVBA 4NL4H 3B9QA 2KE5A 2ZAMA 1AS2A 4DSNA 3S1AA 1P9NA 3R9IA 5FTLA 3H84A 4WBSA 2YHSA 3LA6A 4Q00A 4XTCS 2ASEA 2A30A 1E9BA 3N2IA 4BFYA 1AIPA 4W5HA 3Q5EA 3TNFA 4CRWB 4BZXA 4ACAA 2QTHA 1GUAA 2REBA 2NMVA 2D7CA 4NCHA 3SHFA 2OG2A 2GEUA 1JR3D 1JBKA 2BM0A 3TUIC 3I8XA 2ZJYA 3NTUA 5KPDA 3GPLA 1HA3A 2CNWD 4B44A 1FX0A 1WRBA 3B9PA 4WA7A 3CRRA 2CNWA 4YXWD 4NDZA 5AWFC 1JJVA 2VPPA 2YJTD 4TN1A 3C41J 4TMVA 4YXWA 2F9LA 1UF9A 1LV7A 2Q3MA 1FNMA 5FTKA 1WB9A 2XX3A 4LC1A 1EFRD 1ZM7A 3R7WA 3B1ZA 4FMDF 4BEBA 2J0VA 2BWJA 4NYIQ 5TDHA 3T1VA 2VHUA 2QPAA 5DYGA 3EPLA 1I4LD 5G3ZA 2E87A 3WHKA 3DDCA 5EP3A 1VG1A 4TL7A 3HR7A 1DG3A 1HY3A 2O8CA 3EW9A 4IOKA 3B1VA 4KLNA 3EPKA 1G41A 3CLVA 3EC1A 2ZXUA 4GFDA 4B33A 3QF4B 1IAQA 3TR0A 4Q48A 3C14C 1RJ9A 3GJ4A 3ZDQA 2GBLA 4BASA 3HWSA 4W5JA 3CRQA 2O8DA 4G5RA 3LDAA 1OLOA 4K8OA 1WCV1 4L9SA 1YR7A 1XEXB 1W2GA 2YWGA 1COWA 2A5GA 3TUZC 3GLIB 4Q18A 3TQCA 2FSHA 2QQ0A 5J4HA 1VTKA 2EYUA 5HKKA 3ADCA 1XJCA 1M8PA 1R8QA 1W36D 4X8MA
chains in the Genus database with same CATH superfamily
1L4FA 2JANA 1JH8A 1F9EA 3P2MA 1D2HA 4EW2A 2ZREA 1NDQA 2ACKA 3UY4A 1HNXB 5FTJA 4XDHA 3QVMA 2HJGA 2Q0SA 3SZRA 3FH0A 5CH3A 1YZTA 4I08A 1TO2E 3RJZA 4NMHA 1JGTA 4OB8A 4Y2XA 3HKCA 1CUVA 2J41A 2Z5VA 4UHCA 1GPH1 4DT1B 5ARBA 4BN0A 4K6OA 1PQYA 1XNHA 1J42A 2QMQA 3QELA 1RQPA 2GVZC 1KAMA 2VN8A 4FFVA 3CR7A 4ZYZA 4Z7NB 3VU3A 1E9SA 3R6WA 2VH2A 3BQMB 4WGGA 1QP7A 3AUXA 4TYQA 4PYNA 1T0HB 1U3VA 2O8VA 5TGDA 4B3FX 4DMFA 1L7NA 3IKTA 1I1HA 4LSWA 4G1UC 4GR9A 4YBRA 1N33B 2XTJA 2B4AA 4R9VA 1Q15A 4JENA 3PE3A 2Y05A 3SHVA 3FGPA 4NJMB 4OGKA 4C0AC 3I6ZA 2Q3JA 4D99A 2AR7A 2JFXA 3P9PA 2AD5A 3U7HB 4OLJA 3OM9A 4CTOA 1JBQA 4XGRA 1EDZA 2E48A 4LNUB 4EGFA 5L51A 3ESQA 1OYOA 5T6BA 3SJCA 4EKEA 1E60A 4G01B 3ZKWA 4BFVA 3QA9A 1LFDB 2QBYA 4WK6A 1R15A 2EYQA 3U4HA 3PEVA 4RH1A 1D1QA 1XQVA 4P31A 3WHIA 2PUFA 4HWOA 4M7PA 1RVV1 3MXOA 1ZXBA 2FSVC 2XMPA 2XUAA 4A91A 2ZRPA 3L43A 3H5WA 2Z2JA 3L4SO 4O2BB 5T4EA 3D02A 2ZS7A 4E03A 5JARA 5J47A 4JLVA 2RB4A 4FBMA 4AKEA 2J5RA 3GDGA 3WQRA 1GRNA 4E3WA 1P7ZA 4XD2A 3ZV7A 2OK8A 3ZJYA 4LMBA 1JI3A 3N8DA 1N4AA 3ZCRA 1AXRA 1ZD3A 1G8PA 1TXGA 3FFWA 1JHRA 1V6SA 2ZYDA 4MWZA 3H5RA 2C07A 2HDOA 4QGHA 4FCTA 2WY2D 4BX2A 1JEAA 2P2SA 3KTAB 2POCA 3LDHA 2QE6A 2X4LA 3MWKA 3UGKA 4OJYA 4JUDX 2P9ZA 2ZUUA 1RJWA 1MNQA 2EAUA 3ACCA 3N2LA 2XHZA 3O8QA 4MQ4A 4Y8VA 3TBFA 1JQ3A 1H8HA 4B81A 1TO1E 3W5DA 5F78A 1CF4A 1E94E 2IEYA 3LK7A 5AVUA 2R7MA 2IHBA 1IPHA 1I51A 1QF9A 4HDCA 1ZFNA 2B4QA 4HDMA 3VVMA 4BFXA 4ND8B 2PFKA 4BMSA 1SUEA 4Q82A 4QTZA 1UXJA 3IDOA 4E2XA 4HGOA 2LCFA 3F5MA 1GZSA 4WKPA 3ZE0B 4ZYVA 1ZHOA 4JODA 4GLJA 2CXQA 4A6EA 2BGJA 2RHTA 4R83A 2C7PA 1V0JA 3RABA 1B6SA 4H7PA 1NRJB 1OVMA 2ETXA 1FC0A 3WIVA 3EGXB 2W2QA 3AC0A 2CDBA 1ONPA 2WYHA 4BDSA 4DIKA 1NVAA 2KS6A 3K0BA 1PUJA 2BZ1A 2ZE6A 2D4AA 4PYOA 4RZQA 4IXDA 3V7FA 4A27A 1MX5A 3AEXA 2WP8J 2UV8A 5K05A 3OO0A 2WHRA 2P9YA 3D4OA 3VAAA 5FV4A 1CKEA 1SEPA 2O2DA 5A5FA 2OWEA 1G2QA 4NZPA 4PRZA 4QICA 4TTTS 2FN7A 3KC2A 4M0UA 4GLOA 5EEHA 4JNKA 3AVOA 1T1SA 3I9OA 5EAIA 3FCSB 3P52A 4C6SA 1U2TA 4I6EA 1K5GA 3DZIA 3ILVA 4B3SB 4CCYA 1CRWG 2HDNB 4DW8A 1V16A 5B3KA 2Y76A 2CZCA 3KQOA 1U2GC 2NXWA 1QAMA 3DOCA 3KV1A 4G1VA 1B1AA 5J59A 5B55A 4KHPB 4NMLA 3GC6A 4MNTA 4F21A 3STUA 1T0PA 3KD2A 2Q4BA 1EK6A 4DDMA 2Q4RA 1DAIA 1LDNA 1Q77A 1WDKA 3CG0A 4NV3A 1R4MB 3HZOA 4LGYA 5DBIA 4KWTA 2Z83A 1U8EA 5EZYA 1JW9B 4NARA 1SN7A 1WVIA 4MS4B 2Y6VA 5DYTA 1F48A 4AWBA 1RLMA 3HJCA 4LZOA 1DRUA 2B5WA 2QW8A 3B13B 3FCUB 4M83A 4TZTA 4UZFA 4HHEA 5LZ5A 1AKRA 2HU5A 2QT9A 3O94A 4JLOA 4XYEA 4D96A 2Q41A 4RKFA 1TVEA 4GBMA 1VJRA 4R3UC 3DGEC 1P33A 1JJAA 1G5TA 4KFTA 2QMYA 2XZDA 3G2LA 4MW5A 1AGYA 4URVR 1FNDA 2VDMB 2ZRCA 5E7IA 5DNYB 1KMCA 2PRSA 2PZ8A 5EQJB 1VLJA 4RENA 4OY3A 1Z4JA 4F5YA 1HM5A 4J76A 4ZQHA 4JLWA 2QL5A 2PX6A 5EXSA 1SBIA 3RRNA 1CQPA 5C8ZA 1JE0A 1X3SA 3O8LA 3SYNA 1IJFA 5JCOA 1CHNA 1FXWA 2GZ3A 4YQYA 2VJLA 5FNVA 3W0LB 5KU7A 3JU3A 1BDHA 1TQ6A 1XKXA 5IW8A 3UHJA 1BRTA 2VYVD 1YQXA 4LYHA 1DBQA 3LP8A 1TUBB 2X4GA 3W8NA 4Q16A 3GJXC 4MZDA 1GKIA 3S6JA 2QD1A 1U65A 4YV7A 2H5JA 4RZSA 1ISFA 5F73A 3CJQA 4DKJA 3NEPX 1RFLA 1G2OA 1NJSA 2P5TB 3ZIAD 3SZMA 2XCLA 4PLYA 4DYHA 1DAPA 4BJ3A 3W3AD 2EZ8A 4IW3B 1QZUA 4H6WA 1G5QA 2XKJE 3KT8A 1QU2A 1DEHA 3ZWXA 5EFOA 2NVUB 1THZA 1ISJA 2P11A 4TXNA 3K30A 5HS6A 5C1DA 5FWXB 4A0QA 4Q7EA 4KCGA 1UFOA 3DO8A 4IFTA 5CYPA 1ETUA 2AOWA 2GO7A 3A6PC 3TGLA 2O8EA 3I6YA 4KITB 2IWRA 1J4AA 3NTOA 2SNIE 5CCEA 4WNIA 3QK7A 3UJNA 4X6XA 1IMJA 4CCWA 1NW4A 2CL0X 4POOA 1Z4KA 1BXRA 4C7OA 3GI1A 5ES3A 3RFTA 1J90A 1F20A 2FUNB 4X90A 1SQSA 4HNQA 4UCWA 5JHGB 3ET4A 3ED5A 2D2EA 3KEGA 4KR3A 1WEKA 3V8EA 4DN6A 3I5UA 3RYIB 2ERYA 2Q8NA 1V7ZA 1XIVA 4BE4A 4ZRMA 5LR6A 2JAQA 3OQBA 4DDKA 3RRBA 2WD8A 4QQ8A 2Z2YA 3LXMA 2QRMA 3V2HA 3FCYA 3A2NA 2H85A 3E81A 1L7DA 3K1JA 2BJVA 4HWPA 4Y6SA 5JI3E 4J0EA 1GDDA 2B1JA 2FQYA 2GAJA 1U04A 1NUTA 4YBZA 1QMGA 2F00A 3DTTA 4OHUA 5JSZB 2VSYA 3C7DB 3Q3CA 4ENSA 4TXHA 3DWIA 1U3UA 4WCFC 5HZHA 3IXMA 1C4XA 3WK5A 3DCJA 4CLOA 4RSMA 1E1MA 4JASB 3WGMA 4BMZA 4BPBA 2EZ9A 1MHPA 4R1SA 1YASA 3MT9A 3O8BA 3BGOS 1MX1A 4DDWA 3TOXA 2A4KA 2O23A 3ZW9A 1EGAA 4JQOA 3UMGA 1ACMA 3PDIB 3NHYA 3PKIA 3C3CA 3E4CA 1JKFA 3GFBA 4FU0A 2VHCA 1QC5A 4M89A 3CZAA 4AKTA 3ZHRA 3ORYA 4KG7A 3J81k 1JG3A 3F9CA 4HN2A 4Q6WA 1D2MA 1N8SA 2E4XA 2P5SA 2XODA 3QE3A 4LTNA 4MA4A 4FSHA 1T5DX 1UBRS 1J56A 1W25A 3WADA 1RABA 4PGMA 4DQKA 2XCQA 3GBVA 4WK4B 4WLNA 3WOVA 4MKRA 6CHYA 1CUYA 4H0NA 4XE5A 5BVGB 1DLIA 1EEHA 5C7OO 2CYCA 3QFTA 2GH1A 3FDJA 1UIMA 4QO8A 3B89A 2C5FA 1PO7A 1UBGA 2JAPA 3I6BA 1P61B 4JLPA 4NBVA 3ZJ5A 1RE0A 3B48A 2ZBUA 3MPUA 4BO2A 1ZCJA 2N0SA 5DNEA 5JFOA 3QX3A 1GFIA 4F12A 4BNJA 3ZDAA 3MS4A 2G5TA 1EM8B 3T4XA 4NZ9A 1FVHA 1EXMA 2AVNA 3KEQA 5BQOA 2MR6A 1Z26A 1K9SA 1M74A 4Z0NA 2ACWA 3V1KA 2R6HA 4DR3B 2O8BB 2NPOA 1XMIA 4LF6B 2VK8A 4V38A 4ND1A 4X6YA 5JPIA 5GY7A 4JI0B 1OFUX 3EG9A 2UZ1B 3TZEA 5K09A 1W5TA 2XQKA 2PD6A 3FMPB 1CFZA 3DVAA 4TRNA 3JVUA 1XQ9A 1M6EX 1GPKA 4BJ5A 2UVDA 1IG3A 3J81A 4J2TA 1TAGA 1ND5A 3NI2A 4JSTA 5KOHA 3W2TA 1L7VC 2RI6A 1NQOA 3MA0A 3VZQA 3N70A 3WGKA 3ZKAA 1OH7A 1BGVA 1FFCA 1D2NA 5AKLA 1NASA 1RCTE 1FX0B 1W9MA 3DB1A 1PNOA 1YC5A 2PQ6A 2ID9A 2W6NA 5E2AA 2ILTA 1JA1A 2P6RA 3OZDA 1Z7GA 4V1CB 1NONA 5EESA 1QDEA 4B8YA 1ZCZA 4PLVA 2EF1A 4BAUA 5IT5A 2MYUA 2DBRA 3AKDA 3HSSA 5IAJA 3VSCA 2WC1A 1Q1EA 3N39C 3OC6A 1NRWA 3K9LA 1A9YA 5FBKA 3UW1A 1J1UA 1S9DA 2ZIZA 3BRSA 1RBQA 3AUAA 2GSWA 4H4CA 4DNXA 5K01A 5E4TA 1C1HA 1XN1A 2R65A 1F0KA 3IAS1 3WLMA 3W3ZB 1U5CA 5IXSA 1BOOA 5KMGA 2VNJA 1CPYA 1HYGA 3VISA 1GEEA 2A59A 5AQ1A 3KKOA 1T43A 3NYWA 3VOTA 2XYGA 2EQAA 2WZDA 3EG9B 1GVHA 3V00A 3ZX5A 1UOOA 3FNIA 3H2BA 5EMMA 4X64B 3GVHA 3DKKA 4EBBA 1HRKA 3ZS9A 3L1JA 2YHUA 3PNKA 2HRZA 2OO3A 2RHHA 3QHAA 3R1IA 4AIIA 4DF3A 1JKMA 4LRTB 1XQWA 5CA0F 4NYJR 5EIWA 4YP1A 1C3XA 3GEGA 2VATA 2J46A 3UMRA 4CMKA 4FHCA 1E3SA 1BH2A 3QWAA 4IDDA 4M7RA 5FEUA 3IQZA 1Y5NA 1ZNQO 3IGFA 3IIIA 2P1ZA 3UA3A 3PGKA 4C7BA 4PZPA 3AWDA 4QO7A 3PEYA 2WMOB 2ECKA 4JKOA 2XXAA 3NH6A 2TMGA 1XCGB 2FZLA 2Q5LA 2R66A 2WIFA 1K1EA 5HW0A 4Q37A 1N5RA 5DBGA 1FXUA 4HJXA 4I5IA 5HBRA 3DJFA 4PGHA 5AVJA 3BAZA 5KAMA 4B4UA 5DHFA 1UFQA 1YUBA 2OFFA 1TM7E 4EEXA 5JCPA 4KX3A 4CMGA 3A1EA 2OBXA 4JA0A 5AKZA 1ML4A 3ROQA 1EFKA 1RWPA 2VJQA 1X3LA 3C1TA 1A72A 1R8SA 3DDZX 4R2MA 3ZWVA 4F45A 1JEQB 1DBIA 2C58A 2Z43A 5CVJA 1K92A 1T4BA 3EVGA 4FB4A 1TVKB 4W7SA 1YE8A 2LKDA 4OMDA 1IXZA 3BE4A 2WG0A 3I83A 4TVSA 1G9SA 1CV2A 1M6VB 1OCEA 1WE2A 4XUEA 2Q9BA 5DYWA 2NO7A 4D98A 4K46A 8LDHA 4B3JA 4ECEA 2NZXA 3C39A 3ODGA 3TJZA 3GJ0A 1ESDA 4I50A 3PRHA 2BFDB 2GYYA 3B70A 1ULBA 4IUDS 4N7JA 4KQ2A 4MVJM 2PX2A 1RKQA 4DG8A 4M1ZA 4EMUA 4W9NC 5F1OA 2XDYA 4M0KA 3C5WP 4TRJA 3U3DA 2GZDA 4WKBA 4BQEA 1KO4A 1YH3A 1KOJA 1DWPA 2BFPA 2GA9A 5AOBA 3M6UA 4INZA 4L1KA 5KBYA 1U80A 3BQ9A 4XWKA 3KPYA 1JRLA 3UJ7A 5FBZA 2HAEA 3KYDA 1JR6A 4GPIB 5DI3A 5IYZB 2ZBRA 4B76A 2H7VA 3PEFA 5SY9A 3H3JA 2WMYA 2R62A 4XB1A 1Y9JA 3E9CA 4L4UA 3LV8A 4ETWA 1M0WA 1ONSA 2DT5A 3L7MA 2P4UA 2QRZA 3V32A 1UANA 3N59A 3R5HA 3KWLA 3TLGA 1CLUA 2FX5A 3GELA 1Z75A 1NATA 1FMFA 3ESCA 1U8YA 3Q6IA 3DZKA 1JIQA 5GOZA 3UOGA 1O54A 3WHPA 1EKXA 3V8MA 2H9AA 4AUNA 1PIWA 3G0OA 4DY6A 1TTTA 3UB3A 4DLTA 3Q5DA 2YYSA 2BR3A 3W8DA 3M5CA 1C0KA 2EHJA 3EDRA 2ZSEA 4ID3A 4ZODA 4ER3A 3BWBA 1RRFA 4IKPA 3ST7A 2RI0A 1DJOA 3BD7A 1LDYA 1QKIA 1J33A 1N6NA 4RH3A 4NU8X 2Q6OA 2QK4A 4IDQA 1H1LB 3D9QX 3OO1A 3DM5A 5DGDA 1A8HA 4IGFA 4EZIA 5EOVA 4C4PA 1M73E 1Q21A 4MQFA 3V8NA 1CQJA 1Y0BA 4DCPA 3PQ7A 4GMGA 2PR2A 2GB4A 3ETNA 4HQRA 1HE4A 4W9NA 4CM5A 1SXQA 4MGKR 4DJAA 4NENB 4EM6A 3G0GA 1D6SA 4JKYA 4XYMA 5K3SA 3GNLA 2X22A 2PFGA 4J2HA 2RBGA 4FFLA 2D4HA 3AM4A 3IQXA 4KAXA 1SEVA 2GBPA 3TS1A 2BJWA 4BN5A 1L5LA 1JEQA 2RGNA 2ZI6A 4DOMA 1PWHA 1LI7A 3OJ0A 1RLIA 1LVUA 4L6CA 4MSUA 4I55F 1WB4A 3CZRA 3KKKA 4GOJA 4PPYA 1ZG3A 2AFHE 2FU5C 1L5ZA 1SUPA 2JFFA 3BJZA 1EX9A 4RPIA 5E6SA 1P9WA 4CF4A 2YKGA 1YOBA 2EFHB 1EESA 2YMQA 5HK8A 1M6WA 3K53A 1I30A 2XOKD 4R81A 4R8KA 2H5EA 2C4KA 4V0KA 4K9LA 1RI2A 1E69A 4DE5A 5KSYA 5BVHA 3NMUF 3FPLA 4DRYA 3H7IA 4UAUA 4MGIR 1G291 1JTEA 4OQMA 4EJ0A 1POXA 5EHQA 2WM2A 4O4IF 1SVSA 2IY9A 5BMVA 1E5QA 3QBEA 2DCUA 3DEJA 2O19A 4FYKA 4E33A 3ZXXA 2VHQA 3GNQA 4D1YA 4YRTA 3WR5A 4JIMA 3AESB 2XXBA 3MEQA 4JLJA 5EJIA 4D97A 2JEZA 5CHYA 1AUPA 4K8RB 4YJFA 1PWZA 5JRJA 4JL6A 3BH0A 1YU6A 2H16A 5JW6A 1Z63A 1XLTA 4R0VA 3OSZA 1W35A 1POWA 2V1XA 3PS9A 4OYRA 2V7BA 3F3KA 3BKXA 4JB2A 5AI5A 1U6KA 1VJ5A 4MS4A 1JIKA 3DP7A 3NORA 1SKAA 1K2WA 1E0AA 2VZ0A 4WPGA 4TMYA 5ALGA 1UT8A 3NTXA 3SR4A 2WIJA 1BWRA 1Y1QA 8ABPA 2WT9A 4HXGA 1RP1A 4K9PA 3W77A 1RPTA 2B7CA 3A9WA 3X2SA 4WZBE 3HK2A 1MAHA 1GQ2A 1PT8A 2N1BA 3MIIA 2BFBB 3CNOA 4HB0A 5E9JA 2J3LA 2EZUA 4L9RA 2CW5A 4PYKA 4QQKA 5JQGA 3Q6MA 4ADSG 3H2YA 5AKJA 5LDDC 1KY5A 3OTWA 5JNSA 2BFOA 4AROA 1OYVA 4EGAA 1CUGA 2Z56A 3AUFA 3HXKA 3WGZA 2AFRA 5JS1A 1R2QA 5I9LA 4F5EA 3MUEA 2K2QB 1GYRA 4IHQA 4QOGA 2CXPA 2R86A 1GPWB 3MINB 1YA8A 1YFKA 1LDEA 2XVAA 3MQ4A 2GETA 3AQIA 3FGNA 4H7HA 4MKXA 2VQ3A 5EWLB 1FTSA 3UCFA 4N0DA 3KQTA 3R3UA 1JMKC 1OBOA 2OYSA 4BMCA 4IH9A 5JNUA 1P80A 3QPCA 4FZJA 1OWNA 2OHVA 1E9VA 1DX6A 5A3VA 3TTYA 3S0JA 2D1FA 4E94A 3DYIA 4EGCB 3SG0A 4OB6A 1OA1A 1E3LA 1V2GA 1S2MA 1WP4A 1GGFA 3M5WA 2I03A 2X9VA 4MV7A 1HWYA 1VHLA 4NK4A 1WZ2A 4BLPA 1OOEA 3W04A 1NAHA 2ZTMA 5A5DA 2B7BA 2C97A 1BVYF 3UMMA 1JHQA 3GUCA 3FOFC 5CDFE 2PWAA 4CKBA 2EEZA 1PX0A 2ZJ2A 1V1MB 4QKQA 1RJEA 2RHRA 2HSJA 2Q45A 3DR5A 3LYHA 4RZIA 2OKCA 4Y7CA 1NMXA 4XYLA 2J0SA 3RG8A 1Z4IA 1LY1A 2QD4A 3R20A 1L1FA 1B41A 3TD2A 1ZJ5A 2IYVA 1QQ5A 2VA9A 1ETHA 1JWBB 2NUPB 2BHLA 1Y9EA 4JI7B 2C3PA 3V4PB 1B00A 2A0YA 1QF6A 4AP9A 3FMOB 4PWZA 5DM1A 4KUEA 2F7SA 5ESDA 2QVLA 1GYQA 3QMMA 1L4LA 1S6YA 4LAFA 3HYSA 3ZHOA 2CNDA 2VT7A 3MRTA 4ETNA 3KOMA 3QP9A 1H3EA 3E3LA 1PTJC 4G0PA 5JDCC 4TS1A 1X1CA 1Y1SA 3ENQA 2F4NA 3K0FA 4RGBA 4C78A 1G59A 3HJRA 4RTRA 4L5IA 2W00A 2D1TA 1V3VA 2G77B 2WZQA 1PX2A 2YZGA 5DN9A 1U3DA 3ORHA 5AW1A 4V3CA 1N7JA 3VUFA 2YUTA 4RF2A 3LFUA 1GU1A 4PXSA 3F71A 3ZHCA 1EG7A 2YBDA 1D8AA 3TQQA 2VTEA 3MWYW 3MMXA 4A8JA 4U8HA 3Q4GA 1AKNA 2JJQA 2C7BA 4JIGA 3UB2A 4HNUA 4YCJA 4OPMA 1TVCA 3HEAA 4S3MA 3TX2A 1CXZA 3UVEA 3TMKA 4EB0A 2JLUA 2QBYB 3KQUA 4P3YA 1EBBA 2VK2A 1E7SA 4Y2VA 5FR1A 4RTQA 3ETLA 2F62A 1E2HA 1TFRA 1SBTA 2VHJA 3IP7A 4DUZB 2BCGY 3V55A 3I0MA 1MFZA 3RC3A 3FTDA 1D04A 2HEIA 1S8OA 2FPLA 3TOVA 4KJXA 4INOA 1Y1TA 2PZEA 3VPGA 4RWEA 5JQGB 4YUWA 3A2KA 4OGWA 4R51A 2P2DA 3H13A 3RASA 2P9TA 3D1JA 4L15A 4MJLA 1TECE 5EJFA 2PWZA 4F9GA 4X3OA 5KOIA 2D7DA 3R8FA 2PDAA 5IDVA 3DOJA 3L02A 2XEXA 1M33A 4CETA 5IULC 1OX4A 3RUHA 4KR7A 3GPCA 4RVSA 1DAEA 2GRAA 3E5HA 4FONA 1Q0SA 2ZDHA 4EPVA 4HLCA 5IBPA 2NP6A 4Q1AA 1L3CA 4NWIA 3BDIA 5EJEA 3LCRA 3W6UA 5JUWA 4E08A 4C06A 5C37A 1ESZA 4RPGA 3SC4A 3TRHA 1I7DA 4H7FA 3V3TA 1ZN2A 2V6FA 2XJ9A 1I7QB 2ZT7A 4DAOA 2J3JA 5DMHA 4BNHA 3PKJA 3THWA 1QZTA 3AESA 3RI3A 2C7RA 1EXDA 3R76A 2VBCA 1XPJA 3IUNA 3RW9A 4Y9TA 2PH7A 2BHNA 4J49A 1E20A 1YRAA 2YZ2A 3LMKA 4AZ0B 3Q0IA 3O4FA 4LPKA 1FYWA 4N39A 1ODTC 3R7NA 4DLXA 3F4LA 3PX2A 3DNPA 4CQMA 4X1KA 4D8XA 1PEYA 3G9XA 4IUCS 4HG2A 4NFHA 1XCLA 4J0GA 3Q9UA 2UYCA 3GJ3A 3GLFA 3QXHA 3WLQA 1JDUA 3QEKA 4TTRA 4AN1A 3CF4A 2BFCB 1DC4A 5LFAA 5MF6A 5BOVA 1H94A 1PJRA 1SWWA 2AH5A 4UVHA 4GNKA 2JZCA 2O2XA 1DBPA 5T8KA 3W34A 5CCXA 3S2SA 1DZIA 4E4YA 2ZRAA 1E61A 2Z8ZA 3BBPA 1WPXA 1ZK4A 3T3MB 4CL8A 5GONF 5J4KA 4S04A 1YHZA 2OZKA 2WP0A 4I4NA 1WV0A 4QTTB 4U7HA 4HSEA 2RH9B 1JQAA 2M6SA 4MUAA 5FPSA 3RS5A 1CIPA 3RVOA 3D6MA 5GQSA 1TLLA 1YOVB 5FORA 2VHZA 1G21E 2XQFA 3OG9A 4NPHA 4NENA 3T3PB 3LQFA 1GP2A 7ABPA 4G0WA 3BB1A 1Y8RA 2EFYA 1DC3A 1PWYE 3CE9A 2QR5A 1CUAA 3QKRB 1TOAA 3DUWA 4JX9A 2BI7A 2QSZA 1TGYA 4HQLA 4A0SA 3ZWMA 4NAUA 3RSCA 4BLUA 1DAFA 3L0BA 3NOXA 3S2ZA 4O08A 1CEYA 4DB4A 1CZHA 1WO8A 5AICA 4MI9A 3A1SA 4RL4A 1OIXA 3RUAA 2Q3BA 1EQAA 3O8DA 5DEOA 1GITA 4V0MA 5JXIA 1H65A 3RSSA 1A7UA 1XZDA 3RUDA 3ZJTA 1NN5A 3TL3A 4GOLD 3WC4A 1TJ5A 2G6TA 3G2MA 3HLKA 2HTEA 4R8RA 1BOFA 1PHRA 5IAKA 2OGTA 4MDYA 5JO9A 1XMQB 4YMLA 2N1MA 1N0HA 4DLZA 1RPZA 5EIHA 3PXCX 4JYCA 2A14A 1VL8A 3K4PA 1KI4A 4H7JA 4XVHA 3IKMB 2J33A 2P6OA 3MGCA 1AURA 2OV6A 4TMXA 4KXWA 4B2YA 3SXJA 4JJIA 2AI2A 3GFGA 2BEWB 1C0IA 1RLTA 2WKWA 3WIBA 4KOAA 4AYXA 2AG0A 4KK4A 3LJKA 2PMKA 2OBFA 4BNGA 3AKZA 1A9RA 2AZ4A 4IDGA 2J7PD 2EU8A 4PX9A 5LOVB 3W5JA 1YL6A 2RJNA 4R5MA 3GRCA 3X43A 2PRYA 3N1UA 1GAEO 4OU4A 3W1WA 2YFYA 3I52A 4RM3A 2BH9A 1FSZA 1E89A 5H4HA 1V6CA 5LPNA 2H4XA 2PV0A 1T5IA 1E1CA 3WSVA 1B0ZA 5FO0A 4JXKA 2FMIA 2VWQA 3EQ8A 3LOUA 4B34A 2CJYA 1M7BA 1Z5PA 3WMEA 2CT8A 4N76A 5BPHA 3O95A 2ZTHA 2ZZKA 1EQUA 4AJ2A 1HL3A 1XEWX 4KAAA 1F6BA 4X5OA 4C4RA 2FY8A 4RV4A 3TZHA 4OF4A 3RU9A 1JDNA 2DWUA 1M6VA 2AXQA 2CD9A 3SQWA 1KPHA 2I99A 5AJWA 2Q27A 3DDWA 4LK2A 1JT9A 3LZCA 3IUMA 4LJ5A 4QIHA 1ADYA 4R9RA 3EVEA 3MRSA 4JJEA 3L7YA 1C9KA 4BLQA 2I7CA 3QHQA 2P3LA 3ITEA 5EVJA 4C6RA 2QKYA 1P7WA 5JZBA 5SYNA 1WBBA 4O59O 1XJ0A 3EA4A 3Q88A 3ZDXB 1T0BA 2ZB3A 2CLCX 3RWMB 3U13A 1G4AE 1U11A 3A31A 4B0PA 2EFEB 1KR5A 4OYYA 5DW0A 2KPOA 5B4VA 1G42A 3NT5A 5J9FA 2B92A 3SM9A 1TK3A 5FWYA 1D4AA 4TTPA 4JCCA 4Q9IA 1VYVA 2RD2A 3L6BA 1CY7A 2P67A 3QOYA 4JI6B 2IU0A 4Y9DA 3I64A 3KX2A 5GPBA 3VV3A 3ER9A 4JBWA 4QPZA 1YWGO 4PS0A 3BFJA 4B2LA 3BMNA 4HLQB 1VJTA 2IU6A 3L01A 1DEXA 1NOKA 4BC0A 5I9NA 2JD0A 4HQ6A 1KEVA 1VCIA 5JNRA 1QGUA 1XNQB 3MJRA 3N3AC 2PZBA 4KQCA 4MRMA 1X80B 2FZCA 3D7RA 3ZBQA 4B43A 2DFVA 4X7PA 3TLKA 2OSBA 3RSZA 1RACA 3HTXA 1DX4A 1PTKA 1C80A 1X2EA 3JQRA 2NU8B 1D09A 4YDHB 1PBTA 3G9ZA 3L0IB 4W6ZA 3DZJA 3V4RA 2V0GA 3GRYA 7MHTA 4CIAA 3QX8A 4F2DA 5JE8A 3AW9A 1JLHA 4J4BA 4AJOA 2F1HA 721PA 4OUKX 1WBDA 1LSUA 1JF8A 5IJ9B 4MUKA 4Q7KA 4B45A 5E7MA 4CTJA 2ZSFA 3HCPA 4HLNA 3ADDA 1ICIA 4HB3A 5E9WA 1XHEA 1XTSA 1JA0A 3VYUB 2CJPA 5BN1A 3ZKWB 4RJJA 3F9RA 2JL1A 4EPWA 5JSUA 5K0CA 2YWJA 3I9V1 2GN0A 4OHVA 4W1RA 5TF0A 4UAVA 4LI3X 4BWGA 2VQEB 2V98A 2YINC 3COSA 4POAA 4F4CA 3CPHA 2RK4A 4R01A 4MZXA 1E7RA 1NP3A 2DFTA 2GBFA 1PFKA 2HMUA 2WJHA 3MJDA 1GKUB 2OILA 3BD6A 4N65A 1ABEA 2F6RA 9LDBA 1YCDA 2O0JA 3R8XA 1IJEA 1PUIA 1F1JA 3ZJVA 4W4TA 5AW2A 2VZEA 4BB0A 4DCUA 4QL3A 2ZQZA 3HDVA 4PC1A 4QGBA 2JIPA 2VEDA 3I2KA 4HTAA 4JVMA 2OXIA 4YIHA 1GUZA 1YZNA 1Q0HA 2QVXX 2NU7B 1HZZC 1TD9A 4HZIA 5ALDA 1THMA 4BGVA 2ZPUA 5LMCA 2O8FA 3K9HA 4N8EA 3PXBA 3DAGA 1EHYA 3WLIA 4LDQA 3CYFA 3E35A 2PZJA 4NCNA 1UWKA 4TMKA 2ZJOA 3LGAA 1GRCA 2HO5A 4BWFB 3ML1A 3PR3A 4YQEA 5L8VA 1RYNA 3LU1A 1K8QA 2AYYA 3AF4A 5H70A 4XX0A 2FWMX 4FN5A 1HEYA 1T1IA 4OQZA 3B6MA 4O8CA 1BXKA 3RC2A 4ZMSA 1UM9A 4RACA 1QGED 1Q19A 2ZJAA 1KAEA 3NT2A 3DYVA 3JRWA 5CVVA 1GUYA 3S55A 3ZK7A 2JIOA 5JR3A 2XGJA 2CYBA 1O9HA 5K0ZA 1DJMA 2FPRA 3LG2A 1P0CA 2VPQA 2IPNA 2DWPA 1GYPA 3BOSA 3FG9A 3EQ6A 4ITVA 5J4LA 5H02A 2FPWA 4HN9A 4P0TA 1QIEA 1W52X 3NTRA 4PGGA 2AT1A 2YQ5A 1UEXC 4REOA 5F1KA 4FLFA 1GSAA 1WCXA 2LDBA 3IPCA 3EGDA 2OCIA 1NU6A 2J9YB 2XECA 3DE4X 4KC0A 1MENA 1J1ZA 3KBOA 3RVNA 3QKUA 3ROTA 1XZJA 3N2KA 3OCZA 4IVQA 1E1RD 4RJLA 1GPAA 3EAFA 3QF4A 3Q9NA 3UAWA 3G5AA 2KLHA 1ISIA 4H0FA 4DLPA 4L08A 3BMQB 5EKSA 1J06A 2G04A 4J6FA 2ZU0C 4W6QA 3T9AA 3ABIA 2IX3A 3DL4A 4RF3A 4YQFA 3F46A 3V2UA 2X2EA 3MOIA 2GCEA 3KL2A 5ECDA 4CEHB 4NRDA 2BP7A 3U3ZA 3UIEA 5AXDA 4UTVA 1XE3A 3QKTA 5G0TA 4CWAA 1MAVA 2QN1A 5LMNB 1Q2UA 1ZK1A 2B94A 3GEIA 3MOSA 4OX9Y 3ZQJA 1MO4A 1YZUA 2HGSA 2IOFK 2O3UA 2R96A 2JG3A 2B8WA 1F12A 3K32A 1UXOA 4R9UC 3CH5A 5M2QA 5CP8A 5DK6A 4DZTA 1J8DA 1QJ4A 1N5IA 1B6RA 1BFKA 1BNCA 2WFZA 2PSJA 3DZHA 1HFKA 1O6FA 1C7JA 2HLDD 3DVQX 4RIEA 4EKYA 4Z4IA 4TWRA 5HEKA 2HQBA 3OFNA 1ZDMA 2OXEA 4RS3A 1HTTA 4L5YA 1H2HA 4RK0A 3WLAA 4ENRA 1P9OA 1Z2CA 5JY6A 3SYTA 4AMYA 2Z3VA 5A03A 5HX7A 2FPUA 2C7QA 4PLHA 5DWQA 1E0DA 1RBZA 4A26A 2TMKA 3NJRA 3UJ3X 4BZZA 1OHHD 5CM8B 3FN4A 3MC1A 3WRXA 5KNBA 2LKCA 2WBLC 2G4VA 1N8KA 3P9RA 5B30A 1SCNE 1XAJA 4JX8A 4C20A 2XMQA 1TKAA 3QYAA 3JARB 4GH5A 4EMSA 1OU4A 1T4CB 4UFOA 1RC0A 3OOYA 4YACA 4YT5A 5FBLB 4F85A 5JDIC 4ZK6A 1ONOA 4WX2B 2RONA 1WXEA 4JDUA 3BFXA 3MCWA 4P5EA 4MGHA 1SXJA 3OCVA 2OQVA 2XA9A 5KTYA 3OUUA 3E82A 1LJ8A 3D2LA 1J6UA 1SQ5A 2IZ7A 1BWQA 1I10A 4XD7D 5FFMA 1PEAA 3D0RA 1C5KA 3H1GA 9ABPA 3G68A 4ILKA 2YIMA 2R6JA 5LA6B 2ZWVA 1XX6A 4HF7A 4HZUB 1Y8AA 5I8PA 4EUEA 4EUNA 4C6TA 4ODIA 5B4TA 3QIAA 4B3RB 1WSBA 3V7WA 3I4LA 4LWQA 3QHPA 4FI3F 1UBHS 4CMBA 4ERNA 3W90A 3D7MA 4KYTA 1Q0TA 3DLCA 1UXKA 1A4IA 1H4SA 1W7AA 4KH0A 5HUHA 3JZAA 3GUUA 4E70A 2QUJA 3OT4A 2XE4A 1I7NA 4FFWA 1QCYA 2H2IA 1VP3A 3KL4A 2J08A 1FY2A 1P7PA 3O91A 3PXUA 4X8LA 4CT0A 5L3QB 4JVNA 2IV3A 3JTMA 3GLGB 3RS4A 5BSFA 3HYTA 2G08A 2VSOA 4LVOA 1A27A 1T2VA 4R0NA 5TPZA 1K7XB 3DL0A 2HHJA 1I6WA 3K8YA 1S1CA 1DDGA 3MTIA 4KODA 1UBCA 2VHXA 1Q0LA 4QPDA 4RLQA 5EMHA 2B3DA 3RSOA 5JANA 4NU6A 1NVWQ 1XJ5A 2CKMA 4NE9A 1RYMA 1RRVA 3TVDA 2PX5A 3DV2A 1MT3A 2VNAA 5C4MA 2G0TA 2ZRDA 3ZXIA 1TRKA 3A6DA 1LS6A 1O96A 3ISVA 1UKVY 1CY1A 2Q0QA 5DWVA 3TTTA 2Z8XA 4JLMA 4PICA 4QOSA 4F2WA 2IQIA 1U02A 3FE2A 4DY4A 2DE0X 1R12A 3U7EB 4UTXA 4N0MA 2KBEA 5EWMB 2AN9A 1BD4A 1FDIA 5BORA 3R77A 1JFLA 3M0EA 2YW9A 5BV8A 4D8TA 1ZGCA 2KX7A 1YZ3A 3DDOA 2HLPA 3NHUA 1XU4A 2XWSA 5FLYA 4H16A 1ZU5A 2J1LA 2NZVG 3DMRA 2Z08A 2B4RO 2VT6A 4MV3A 5DX1A 5EKDA 2C1EA 4JITA 3BZUA 1BXGA 4UJ3A 4LV6A 5LYJB 3C5HA 3LL4A 2QD5A 1FTGA 2R6R1 2MSCB 4EGSA 5KJEA 1ODKA 1Z4PX 2H1RA 2D1SA 4MRMB 2J67A 3CUEF 2G1KA 1A8UA 4QU9A 5D7BA 2XT9A 1H0SA 1SBHA 3OJOA 3UUFA 4EH1A 1W75A 1IB6A 2J6BA 1Q50A 2C9OA 2XIQA 2Y92A 2EEPA 2HCRA 1GAQA 4MV5A 3TOCA 4PBTA 3AJ8A 4QREA 2AJBA 1J39A 4F6CA 2YMPA 1KXJA 4K9DA 5DXJA 3Q7PA 1AQIA 3QPDA 3DS8A 4AURA 3JATA 4RVFA 1E2KA 1LJUA 2EL9A 1GR0A 1K7CA 1UUFA 1BSVA 1EZZA 1L4MA 3QZUA 3FNBA 3PNYA 5LQJA 2ZSKA 5KDOA 1M0SA 2DQ4A 1HMPA 2R5WA 5EIXA 4A0GA 4WXRA 3EFEA 3GR6A 1GSHA 2IF0A 1CCWA 4Y1GA 3DOFA 2VSQA 2H8KA 1ECLA 4R8SA 4F3CA 1SCUA 4E6PA 4K87A 2Q9AA 3LPNA 3D3WA 4RMJA 4YAOA 4WLOA 2UVPB 4BCCA 4PFKA 1KP9A 2XKAA 3A1TA 2W70A 4XEUA 2C84A 4JFRA 5KOJB 4HAVA 1CVLA 1LU9A 3OE7D 3VR3D 2IYPA 4BXOB 2FPGB 3AONB 2ZAGA 4JELA