1UFQA

Crystal structure of ligand-free human uridine-cytidine kinase 2
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
212
structure length
212
Chain Sequence
EPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Uridine-cytidine kinase 2
publication title Structural basis for the specificity, catalysis, and regulation of human uridine-cytidine kinase
pubmed doi rcsb
source organism Homo sapiens
total genus 68
structure length 212
sequence length 212
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.48: Uridine kinase.
pdb deposition date 2003-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00485 PRK Phosphoribulokinase / Uridine kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ufqA00
3Q8XB 3FHTA 1Z22A 2O8FB 5KYKA 5LB4A 1NSFA 4XSHA 3J81k 3KJEA 3L0SA 4B2LA 4V0ME 1R7RA 1E2NA 1W49A 4R71A 4V0KA 2IYWA 5HR5A 4FCWA 2OFXA 1NN5A 1OE0A 4EKDA 2FEMA 2GVZC 2FGJA 1NVUQ 5FBRB 3U44B 4UJ5A 4ZO4A 4Q01A 3EPJA 2CMKA 1HT2E 2GHIA 2WWHA 1QVRA 3HDTA 2A78A 3ND8A 3NBFA 2WHXA 3RVBA 4HZUB 1KAGA 1J8YF 3I72A 3RS2A 2FJUA 4D0GA 1QHGA 1NIJA 4OKSA 2VP0A 2IEYA 1ZNXA 2I3BA 1ESMA 3OE7A 3QNUA 3REFA 1DO2A 4BLOA 2W2TA 3SYLA 3I1FA 4M1TA 2VP4A 4JLMA 5CK4A 3A4MA 2G1KA 4FWTA 2DFLA 1KI2A 4BLPA 3FGNA 3VQTA 2ZYTX 4P0TA 3U7EB 2GJKA 2OCAA 1QRAA 3BGWA 3EZ2A 3M4YA 4NCJA 4ERNA 1IY1A 1XXHB 4O25A 4UNQA 3NH9A 3OIUA 3V4FA 2P5SA 4D81A 4QRHA 1N5LA 4H1UA 1G20E 1A2KC 5AJVB 3TK1A 2RGEA 1CR2A 3PUWA 4B32A 2X2FA 1FP6A 1U2RA 5GJWC 4K81B 1P7CA 3LBHA 4XVRA 5CK5A 4LHWA 3SBDA 5JCPA 3KB2A 4FN5A 1W36C 1U8YA 1S96A 3X1YA 3DOFA 3I92A 4UNPA 2P0EA 1E9BA 1UJ2A 1XFAA 2W0SA 3TVTA 4C0AC 2ZRBA 1KMHB 2AFHE 4UKDA 1OHHD 3V9PA 1KYIA 1HE1C 3THOA 1EXMA 1GVNB 1XU4A 8OHMA 3KQUA 4TLAA 2WWYA 5J5CA 2GTPA 3VNVA 3KXKA 2GCPA 1JQLB 2GEVA 2QSZA 5G3YA 1KMQA 4D0NA 1NKTA 3WXMA 4W9MC 4GI7A 1CULC 2CNWA 1SXJB 3BERA 2O8EA 2ODWA 3AVXA 4PHTA 5C18A 3X1DA 4TL9A 2P6UA 3CRQA 3UXMA 1Z08A 3QVUA 4X8LA 3N2EA 1KI6A 1XD9A 2W6IA 2YOGA 2F1IA 3IO3A 3QBVA 3CWQA 2IT1A 2QT1A 4R7ZA 1HYQA 3C8UA 4PPNA 4YMUA 2FPMA 2YZ2A 3NBZC 5E7IA 3EARA 3FTQA 2G1JA 4GNKA 3R9XA 1X1SA 1YZNA 2REBA 3MWJA 4C3ZA 5JWOA 2Q9CA 2C77A 2ZI3A 1P61B 4B71A 2RH5A 4TLCA 4NCHA 4RKFA 2R6AA 3SBEA 4RSGA 1U99A 2CXXA 3GLGE 4NL4H 1SHKA 2D7DA 4CYMA 2BMJA 3NH6A 2XITA 4KYIB 3W6PA 3KL4A 1MO5A 1EFRA 2OE2A 3UMFA 3ZZUA 4AYTA 3L0OA 4FMCB 3CPHA 3CNNA 2J59A 2GDJA 1VIAA 1W0JD 3D7MA 2GJSA 3QKUA 4RY2A 4D4JA 4XWKA 3AF4A 1P62B 1NN1A 3DHWC 1KO1A 1TU3A 2EFDB 4DCUA 2Q3MA 2YNMA 1RKBA 2OV2A 1T5IA 3WRYC 3F3YA 1KDTA 2ZR7A 2IYXA 2NOAA 3VFDA 4DXAA 1L7VC 4MYHA 5BWMA 2GXAA 1II9A 2PCLA 4IOJA 4LI0A 1E9RA 4M4SA 5JFGA 1NVXQ 2FX3A 2KE5A 3K0SA 4US0R 4A15A 4L9SA 3EZFA 4G5RA 4Q9IA 5JECA 2ZJOA 4QXAA 1D2NA 2O5VA 2QU8A 3AP3A 2DFTA 1G4AE 1UF9A 2N46A 3AP2A 1MRNA 1HQYE 5KNDA 3CF2A 4BEJA 2ZSBA 2JIZA 5FI1B 3ZVRA 1C1YA 2X1VA 3GLHA 4URZR 3TW8B 2X19A 3CR8A 3U4QB 4NP6A 2D7CA 4TL8A 1YZLA 5TVKA 1FZQA 1JPNA 3VR2A 2RGNC 3ZZ0A 1G19A 3KUCA 1AQUA 4IVQA 4AG5A 2CCJA 3GJ5A 2P65A 3REGA 3RRYA 4KBGA 3GCGA 3O8RA 3HR7A 1XBTA 4Q02A 5EUQB 4TYPA 4Q7KA 4Q7JB 4M1WA 2BMFA 4XD7D 4AYXA 3AGQA 5HKKD 1PUIA 1Z83A 2CK3A 3FKSD 3O8CA 2OBMA 2MSCB 3SQXA 1HH4A 3L0PA 4A4DA 4MRVA 1M7BA 1QHYA 5AUOB 2QTFA 3AKYA 2GBLC 2PZGA 4HLUC 1KJZA 3AV0B 3DZ8A 3EIEA 1T0HB 1KJYA 3MG9A 4DLXA 4TMTA 1E2KA 121PA 3GFTA 4OI1A 1HA3A 2H18A 3K9GA 5F98A 1AZTA 3IQXA 2HV8A 5LDDC 1X3SA 4Q7LA 2DB3A 2F9LA 1TQ4A 1BO6A 3BRWD 4L9WA 2JAQA 3CO5A 1FW6A 2SHKA 3OHMA 3GMTA 3I32A 4DT1A 2WBLC 1XPOA 2IS6A 1HURA 3TR5A 1QHIA 1ZIPA 1XEFA 3KJHA 3SJBA 2FFHA 5JI3E 1KSHA 1Z3IX 3T35A 3AF2A 1TUIA 5EE5B 4JL8A 2R6FA 3SNHA 5FBVB 1R8SA 5FTJA 2QRNA 4IFEA 5E4FA 3UANA 2F9MA 5FL7A 4MQBA 5EUMA 3NBXX 1Z0IA 2CJWB 4LJ9A 5KSPA 2VHQA 1OT3A 1TQ6A 1XJQA 1OXUA 5KSYA 1U8ZA 2IUSA 2YHSA 2V54A 1ZUHA 2ZETA 1GZSA 5G40A 4FMDF 4TTQA 2ZSAA 1MOZA 3CBQA 5FUVA 2Z6VA 4URWR 2OILA 4I1VA 4NCKA 4OHYA 1W2GA 5FOVA 2IWRA 3RS5A 4MDFA 1E4VA 2JCSA 3BFKA 1H65A 2GZAA 4OK3A 2JJ1D 2UZIR 3Q72A 3R20A 4IDPA 4KO8A 3K9NA 3RLFA 4HEJA 3Q3JB 1F2UB 2V1XA 2J1LA 3W90A 1S3SA 3BD9A 1VYUA 3EG5A 2H7VA 4IVRA 1WDTA 3PV0A 3LW7A 4XWOA 5GVSA 4D82A 2RGBA 4QOSA 4CEHB 4LYFA 4BLQA 4WZ6A 2FPLA 3T15A 4WW0A 4CVNA 4BFTA 2ZJYA 1E96A 4LCBA 1DOAA 2ZQ5A 2REXB 3PEUA 3GLFA 1NN0A 1Y63A 1OB5A 2AK3A 2NO0A 4DIDA 3VHLB 2FWRA 4QFMA 1Z6YA 4ILEA 5DYIA 2XXAB 1UADA 2OCBA 1OFUX 4R9UC 2IXFA 1RVDA 2DCUA 1II8B 1YJ5A 5KDLA 1SULA 4IXMA 2H8KA 3X1WA 4BLTA 4PZYA 1G7TA 3CH4B 5FPHA 4LV8B 3SJZA 4YQFA 2GJAA 2ZRKA 2FMXA 1Q3TA 1IM2A 2WIAA 1Q0UA 1UDXA 5JWRA 1KDOA 2QSYA 3R7WB 2D4HA 2DWQA 3LQRA 4A0RA 1KI7A 4Q9KA 2VHTA 4B47A 1CR0A 1WQ1R 4HDCA 4MDEA 3VU9A 1KIMA 5FUXA 2C03A 4YONB 1PZNA 4B76A 2IS2A 1E1QD 3DL0A 4UXJA 5BYJA 3SE0A 1OXXK 2B21A 1WA5A 1LVGA 1Q22A 1YHNA 1XEWX 3MLEA 4BZXA 1Z8FA 4QGAA 1TQ2A 2FZLA 5HCNA 1VMAA 2HCBA 1YR8A 5J4LA 5GVRA 5FBQB 4ZKDA 5FH9A 2HT6A 1CXZA 1H8HD 3UKDA 3OIVA 4ZPXA 2QROA 1KI9A 1ZINA 1ZD8A 4M21A 4B6EA 4BLSA 4ZI2A 3QBTA 4EPWA 1RRFA 4KAXA 1KOFA 3ADBA 4PPFA 3QSYA 2JA1A 1PJRA 4FIDA 1N6HA 1CEEA 1RRCA 1NL3A 1P2VA 1SGWA 3T61A 5CB8A 4Q9JA 2ZSFA 1XPRA 1ZCBA 2ODBA 5IK2D 1Z2AA 1KI1A 3SJAA 2Q3FA 2C78A 3EWSA 3WY9A 4YMTA 5CJPA 3CB4A 5BW8A 2D3WA 2NGRA 1TF7A 4AURA 2OT3B 1GRRA 1LY1A 4HZIA 2KJQA 4MGZR 3UIEA 4YDSA 3FFBA 4JMPA 4KBFA 3ZS8A 3BORA 1IXSB 3C15C 1G3RA 2KI5A 4LGMA 2O8CB 2O0HA 4DLUA 4KI0A 1D2EA 3WBKA 1H8EA 1W0JA 1XTRA 1SVLA 4HSEA 1KK3A 4V03A 2VF8A 2MSEB 4KU4A 2FE4A 3GLIE 1JAHA 2IXGA 3NVAA 1CIPA 2QG6A 1EFHA 1T91A 3S1AA 3CUEF 1FTSA 1CBUA 3IIMA 1GAJA 3NHAA 3C4JA 4GBMA 4Q18A 3AF3A 4HAYA 1M7HA 4OQFA 1UDWA 2AWNA 4DKXA 1E0JA 2PX0A 2FFQA 3LX5A 3Q7QA 5BYKA 1T8TA 1OW3B 2ZYUX 5AUQA 1XMVA 1D5CA 1DAIA 5JS8A 2CDNA 2XZLA 1GNQA 1FQKA 2BKEA 4HLQB 2WJIA 4P31A 3CX8A 3AGPA 4L8GA 2GESA 4Q19A 3UATA 2IYQA 1CJMA 1IONA 3AUYA 4Q4AB 5B58C 4TZ0A 4US2R 2NO6A 4TL7A 3K0EA 3B6EA 2YOHA 3VKGA 2VSOA 4TQ9A 1DAGA 1RYHA 2VHCA 1QG4A 2QE7A 4WZBE 1P2UA 5G3ZA 1DADA 3PUVA 4NE2A 4WAUA 4E07A 4Q7MB 3T5GA 3LRPA 1XZQA 4QKQA 1VG0B 2WJYA 2IYVA 1ZM2A 3R8FA 1FMJA 1HEIA 4KHZA 2E87A 3SN6A 2OLJA 3OEEA 4G1UC 4RZUA 3JVVA 2NTYC 1J8MF 1LS6A 2IYSA 5HKKA 1K6MA 1RIFA 3FKSA 2GAOA 3BXZA 1T6NA 1TF2A 4K8OA 4GPTA 4Q9HA 1RPZA 1XTJA 1SXJE 5SZKB 1CJVC 1OSNA 4V0MA 2ZS9A 1Z0JA 4HDOB 4KFUA 1US8B 2FV8A 1PLJA 3WYAA 1PLLA 2L0XA 4A36A 5DI3A 1ZAKA 4RCZA 2BC9A 2RCNA 2VHJA 1U9IC 1RYFA 3D6TB 4AIIA 3IIKA 2GA8A 3E70C 5FOTA 2VYFA 4LDJA 4WA7A 3X1ZA 1LW7A 4EAQA 2WMNB 4TMKA 4DLWA 2WJHA 3BB1A 2NPIA 4KSCA 2FG5A 3A1TA 4D80A 1R0WA 4MYCA 3BC1A 2W6ID 4CT5A 1G64A 2QQ0A 2NQ2C 4FCTA 5KDDA 4XH9B 3CX7A 3SR0A 4LZZA 4GSYA 4QHYA 2ATVA 2Q3HA 3SI7A 4C0QC 1EG7A 2P6NA 3A1UA 1W4RA 2WWFA 1GFIA 3FB4A 4BFWA 3TJZA 4MGKR 1KI4A 1KSFX 1CLUA 2JGNA 1FUUA 3BFXA 2G88A 2WJJA 4EFNA 4F4IA 2QMEA 3AF0A 2EYUA 3ZQ6A 4AKHA 1WBBA 2H57A 4YLGA 3ZQJA 4YXWA 4KYUA 1OYWA 1ZC4A 3GQBA 2OFOA 4LJ8A 4MGIR 1P5ZB 1N5JA 2O0JA 4C30A 3M0EA 1SVKA 2BV3A 1EFRD 4KSBA 3AVPA 4QGHA 1GG2A 5HZKA 4HATA 4O2RA 5K8LA 2JLVA 4RZXA 1IJFA 4A8JA 1MABA 1QHNA 5P21A 2ZRAA 4P4SA 4ZDWA 2ZI7A 4WBSA 1QBKC 2PEZA 3BJIC 2EFEB 5DHFA 3GP8A 4EJSC 1X8JA 3HWSA 3M1IA 1GDDA 4PFSA 5DI9A 5DN6D 1KNXA 4JZKA 1JXOA 3BH7A 1SKQA 2J7PA 5SZJA 1YRAA 1GUAA 3D31A 1AS2A 1X8KA 3P32A 3ZIAD 5LD2B 1OXSC 1M1YE 2JIZD 2ZI6A 4LYAA 5EP3A 3PR1A 2ONJA 3RHFA 2ZE5A 2XTZA 3ASZA 4LOAA 3TLXA 2W2XA 1UKZA 1ZYUA 4QBGB 2ECKA 4D2IA 2O8EB 2WAYA 3LO5A 4LJ4A 1VHTA 1WXQA 2HLDA 3C5HA 4F4JA 4TYQA 1GKUB 2QP3A 3EA5A 5J47A 1G9XA 5F9HA 5JJKA 1W36B 1IBRA 5EE1A 3K0CA 2RAPA 4DLSA 2IF2A 2JEOA 3KKOA 3FMFA 1DBSA 2GK6A 2RGAA 1I2MA 4FMBB 2CK3D 2QMOA 3ASYA 4ZDIA 3RNLA 5J40A 2AD5A 1E1QA 1P9RA 1YVDA 1G8GA 2W2VA 4PTLA 2ZRMA 2P6RA 3QKSA 2BCGY 2BCJQ 1VG1A 1E2HA 1W5TA 1XWIA 4FWIB 2A7QA 3I3SR 4M1SA 3UMSA 4EPYA 4JVNA 5L3QA 4LHXA 1E2DA 4QJ5A 3IILA 4MH0R 1PLKA 2GKSA 4C2UA 2ANCA 3QG5A 4TT3A 1E9DA 1XDBA 2IWHA 4LPSA 2OO7A 1Z29A 3K0AB 3MAAC 4GOKA 4GOXA 4TTPA 3OAAA 1QVAA 1H8HA 4OHXA 3PJRA 4IXNA 2IXEA 4PXAA 2QTVB 3GFPA 4LUCA 1DO0A 1S4QA 2A5FA 4F7WA 1RFLA 4HUQA 4RFSB 3TKLA 4A0FA 1G1MA 3VHXA 1Z6AA 2FPKA 3BE4A 1I4LD 3B2EA 4O0MA 3RYTC 4BGDA 4G3XA 4M1MA 1VG9B 4IHQA 1PV4A 1NI3A 1ANKA 4TYNA 3IO5A 3DDCA 5FL7D 2VL7A 4RD1A 1JB1A 1G3MA 1ZP6A 1OH6A 1YZGA 2ZE7A 1GNPA 1NN3A 2D62A 2EFHB 2ZI5A 2ZRIA 1M7GA 4Z1MA 5C4GB 4DWJA 3CRRA 1E32A 1XTKA 5H1YA 3U60B 1U0JA 3SU8A 1IN8A 1FL9A 2BEKA 2R2AA 4JS0A 1NMYA 4EPTA 5M04A 2D2FA 2BOVA 3T1VA 4DB2A 1LFDB 2OZEA 3CLVA 2BM1A 2CEAA 3NTUA 1GP2A 1M34E 2ZSEA 1G17A 5IDVA 3AEZA 4GOJA 4H9GA 4NPHA 2QNRA 5DE3A 4JKIA 3X1XA 5B30A 2JATA 4DUGA 4MKIA 3TNFA 4HAZA 4CEJA 4JT2A 2QEQA 4DVGA 3T06B 1SVOA 1E94E 3NHBA 2OEPA 3QF4B 4B3FX 4R98A 3W6OA 3ETLA 1Q1ZA 4YMWA 3GLIB 3AVUA 2DYKA 1W44A 5FBWB 5J4KA 2OBNA 1NLZA 4DEYA 4TL6A 5AR1A 2ZROA 3B85A 2YJTD 5EZ5A 1NG1A 2I4IA 2IUTA 1PVOA 1AA9A 1BOFA 2V6JA 2EVWX 3QKRB 4PPQA 4X8MA 1E2EA 2BDTA 3LH5A 3EIQA 5LD2C 1GIAA 1W4CA 2WWGA 5CIWA 3CONA 5FPTA 2V9PA 2IS1A 4CGZA 2ZJ8A 5JJIA 1DTSA 1EGAA 2GF9A 4ZDKA 2CL0X 4PC3A 4ZCLA 2PJRA 1P73A 1MV5A 3KQLA 4C0HA 4XOIA 1Z0FA 3PEWA 4NONA 1FX0B 3M6AA 4DT1B 3GJ8A 2BHRA 2HJGA 1ZM3A 4AD8A 4NZYA 1GTVA 4LHZA 1AS0A 1ELOA 4LSGA 5GJCA 2JLZA 5GJVC 5JMTA 4IDQA 4F92B 2JDIA 4ASUA 1W1WA 3RRMA 2C9CA 2JLSA 1G6OA 4Q1DA 4IOMA 2JLXA 3LBIA 3P20A 2H5EA 4DSTA 5JRZA 5GADl 1ZMXA 3DZDA 4AI6A 1XP8A 721PA 3SDZA 2B7BA 5C2JB 4P4UA 4GP6A 4JBXA 1AGRA 2ZJ2A 4MGYR 1CRPA 4URVR 1E9EA 2J0QA 2QP9X 1DAHA 4TQAA 3OIYA 1T4GA 4OQLA 2B8TA 1P60A 2A30A 2BIFA 4W5JA 5KHOC 3EW9A 4C9BA 3QPWA 5FPSA 2RGGA 4WVFA 2ZAOA 2OSBA 1OF1A 2FSFA 2QPAA 3TVDA 5CDFE 3K53A 5A5GA 2H16A 2C2HA 1XMSA 1UEIA 4EUNA 2FSIA 3EZ9A 2QMUA 5B2ZA 5JJLA 2C95A 1NF3A 2BMDA 2XB4A 5FTNA 3FE2A 4NBSA 2PEYA 2ODEA 1N6IA 1XB2A 1P6XA 2PT7A 3FMPB 3BB3A 4KLNA 1XD2B 1IY0A 3LXXA 3SYNA 2R6DA 1ZIOA 2ZU6A 4PQRA 2C5LA 1S2MA 1GNRA 3QQ5A 3AM1A 1JBKA 2GZDA 3C14C 3Q5DA 3T5DA 4IDHA 4LBZA 1N5IA 1QHHA 3KTAA 1TQDA 3G82C 3GLFB 1D9XA 1XNJA 4DLZA 3DM5A 2VP5A 3EAQA 4B43A 4PSVA 4V0NA 3WMEA 4MA4A 1P72A 1DPFA 4QM6A 1H8ED 5FI0B 3FOZA 1I4TD 5CJ2A 3HPQA 3Q7PA 2KBFA 4I1SA 5FUWA 2HDNB 1IHUA 5F3WB 1JR3A 2IYUA 1OKKD 2WKQA 1KHTA 4W7SA 5HE9A 1EFUA 2HT1A 2YC4C 1HT1E 4M22A 1KZGB 2OESA 2D74A 2TMKA 2V7QA 5DN6A 3FKQA 1G3IA 4AC9A 4XVUA 3HR8A 3SC3A 1E9FA 3OESA 3U61B 3OEHD 2HF8A 4AG6A 3QUSA 3Q9LA 3ZIAA 2Q9BA 1XX6A 1DG3A 5D3MA 1XEWY 3N5CA 4NDZA 4PQFA 3ONWA 1UFQA 1CKEA 1EX6A 1D9ZA 2XOKA 3QXXA 6Q21A 4ZCIA 221PA 5K8TA 1AKYA 3FWYA 1KNQA 3L82B 3WNCA 3GPLA 2QE7D 3QG1A 4DJTA 5FUYA 2WWIA 3D8BA 2WIBA 4O2LA 1TEXA 3ZD7A 1N0UA 2VF7A 4D25A 2R9VA 2R65A 4Q66C 2N1BA 3OEED 2VP6A 3JVUA 3F5FA 1E1RA 2V4ZA 4LK2A 3GEIA 3WMGA 2WZQA 3GFOA 3ZVNA 1G41A 1OPXA 3GJ6A 4Q4JB 4HUTA 2P2LA 4B75A 1NY6A 3A6PC 4HYYA 3B60A 1XEXB 3U44A 2EFGA 2ZXUA 2PCJA 2ZSDA 4I99A 4Q1BA 1G6HA 3AKEA 2J7KA 2C04A 4IVPA 1K5GA 3P1JA 1CR4A 1OH5A 1Z6GA 2EQBA 4AKEA 3RC8A 4KXFB 4ACAA 3W3ZB 2QBYB 2PH1A 1KDPA 4M2LA 1WB9A 1W4AA 3QXSA 3MGCA 4IRUB 4Q1EA 4XSGA 2J0VA 5B57C 4HDQB 2IS4A 1T8UA 1Z0DA 3B7GA 5CLQA 2RHMA 1O87A 4AYWA 2W0MA 2KWIA 5EXTA 3TSWA 2O8BB 1SVIA 2PL3A 2DFKB 2VHUA 3RABA 3KQNA 3PEYA 2CL7X 1YR7A 3KUDA 2BMEA 4KVGA 5L3SA 1VHLA 5FBLB 1GRQA 1KSGA 3W5IA 1L2TA 4KITB 2ZRLA 4JVLA 1G3UA 3S1AB 1J99A 1XRJA 1XXHA 1SHZA 4Q48A 2JJ2A 4BWYA 4AY2A 5B64A 2EW1A 1XCGB 4IDOA 3T34A 3O47A 1IJEA 2AKYA 5AJYA 2EFCB 3CR7A 1ZCAA 5FTMA 2UKDA 1QHXA 1E2PA 2QPTA 3QEJA 3K09A 4YXWD 1G5PA 2OFWA 4FINA 5L3RA 3ZYCA 1KSJA 3AVYA 2ZANA 1E79D 4AWXA 3VKWA 1YRBA 1E9SA 2OUKA 3Q85A 5JS7A 1HTWA 2AX4A 3L2OB 2ZU0C 3ADDA 3BB4A 2Z5FA 4XIGS 2B92A 4UQOA 5EXXA 2QORA 5F9FA 4C7OA 1R8QA 4PAQA 5EE3A 4UNNA 1Z63A 3DVLA 4IFBA 3K9HA 2DHRA 4JLBA 4Q4HA 1SXJA 4UXHA 3EZ7A 2C96A 3LLUA 2AKAB 2J0SA 2GRJA 2J7PD 4LYHA 3H0KA 2O8DA 2O0KA 3KFVA 3MJRA 2NPFA 3RC3A 2P5TB 4CIDA 2H92A 4KCGA 2JJ8A 3ZD6A 1DE0A 2P3SA 2A2ZA 1ZNYA 1GRNA 1R2QA 3WHLA 4F91B 2DBYA 1E2JA 2WKPA 4Z8XA 1R0ZA 5HTKA 1N6RA 4A2WA 4Q00A 4N1AA 4N0DA 3BAFA 2MMCA 4LHVA 1XZPA 3V00A 2HLDD 2J0UA 1MKYA 2ZIAA 1R0YA 1QZXA 4PPGA 2VH5R 1OV4A 3CH5A 4GZLA 3MUFA 1VTKA 4LHYA 1V5WA 4FMDB 4IEIA 1YZQA 1ZUIA 4LBVA 4LJ7A 3H86A 5HCIA 2GAAA 3EC2A 3O8DA 2ORWA 3KFXA 3WMFA 4S2EA 2F43A 4QJ4A 2YKGA 3P26A 4LBWA 4F4CA 4CEIB 3R9WA 1JEDA 3B9PA 3RWOA 2J46A 3G5UA 2F1JA 2FH5B 2GXQA 3TGPA 4Q4LA 2WICA 3GEHA 1GL9B 2C9OA 5IT5A 2YOFA 3PXGA 3TAUA 1VYVA 2XTNA 2AFIE 4RCYA 4E5UA 3IEUA 3PUYA 1QF9A 4TSFA 2Q9AA 4M1KA 2R62A 4DLVA 3IHWA 4TT3D 3DEFA 5TDHA 1W0KA 3BIFA 5FTKA 3OAAD 1WMSA 3HYTA 4ACBA 1W48A 1DAEA 1MH1A 1S9HA 5FR1A 3W8RA 4X8OA 2A9KA 2CCGA 4R2HA 3U3MA 3KQKA 1JXMA 1MABB 4A8JB 1JJ7A 2QAGA 2UVQA 3VR3A 4P4SB 2A3RA 2F3RA 2MMGA 4EIWA 2QI9C 4Y0VA 1SKYB 3PITA 4MKHA 4R2IA 5H8WA 5C46F 2QENA 2GCOA 4QHSA 4HAWA 1NKSA 1U0HC 2R8RA 3CRVA 1N25A 4IKEA 3W9YA 4Z1MD 4QGFA 1KKLA 4NTZA 4C0LA 2A5DA 3A1WA 5TB5A 4A0HA 2ATXA 3LNCA 4N0EA 2WKRA 1NBMA 3HYRA 5E3HA 3CNOA 3TR0A 3IGFA 4MUBA 4FCVA 1A2BA 4MYTA 1OH7A 3SZRA 4FI3C 3VR6A 2AXPA 5KOYA 1W47A 4HI0E 2VTKA 2O52A 3T1QA 4B3BA 3WP1B 4C0BA 2V1UA 1AQYA 5E95A 4EJSB 4ESHA 1OKKA 1G8PA 2EWVA 2ZR0A 4DUGD 5BN3A 3CF0A 4D6PA 5FPYA 2BJWA 1Z06A 1IY2A 2CVHA 4NU0A 3VTKA 2DWOA 5G41A 1Q1QA 4C2TA 3QPVA 4I1OA 5CLLA 1CJTC 3X2SA 3QI2A 4NCNA 2R44A 4TMVA 4B6FA 4ZV4A 4HB2A 3OEHA 4WIAA 1CJUC 3B1VA 2C99A 4LJYA 2DR3A 2GNOA 2QP4A 1DEKA 3K0FA 2CHGA 3AVVA 1DVRA 4KVAA 4TLBA 3L8YA 3QKSB 4AK9A 4Q21A 2ZRFA 4JLKA 3FFAA 1VIYA 1S9DA 4OJQA 3THXA 1QHSA 3EA0A 4QM7A 4M9QA 1P75A 2GK7A 4TLEA 2FZ4A 4O3MA 4L15A 4DCVA 3EPKA 2NO7A 3QPUA 3TE6A 4YMSA 1R5BA 2ZAMA 5FTLA 2ZRCA 4E22A 5CITA 2LCFA 1AS3A 2KB0A 1YR9A 3A4LA 3LX8A 3AKDA 2OBLA 3P4YA 3BOSA 4OQMA 1R5NA 4RD0A 4A2PA 4ZCMA 4HUQB 1G21E 1NP6A 4PSAA 2ZM5A 2JDID 1Y3AA 2BBSA 3CF6R 3FHOA 4ASUD 5KPDA 3EZ6A 2JLWA 1DAKA 5JBQA 4POAA 2AWOA 2X2EA 2ZITA 3KKPA 5KPJA 1OIWA 4BZPA 4JIMA 4KFRA 4DCTA 1YZTA 2ZTSA 3W6NA 3KX2A 3H1TA 5JHHB 3MFYA 3TQFA 1XF9A 4W5WA 4Q9LA 3ZS9A 1FNMA 1GILA 1KI8A 2HYIC 3RRZA 3WYFA 3TSOA 3LA6A 1RC8A 2ZS8A 4NHOA 1XJ0A 3V4RA 5AK0A 5TV2A 3PUZA 3BFVA 3VMFA 3K1JA 4QNRA 4NYMR 1A1VA 4A92A 1J70A 5KNCA 2PMKA 3CZQA 1R0XA 3DKVA 2QQEA 2XXAA 1X86B 1E4YA 1KK2A 2IYLD 2REOA 4A8JC 4DSUA 1II8A 3GLFE 2OAQ1 4LJ6A 2GCNA 2QY9A 2ZVQX 4ZIRA 3CX6A 4N3NA 2DPXA 2OG2A 4JT4A 3PG5A 2FGKA 2Z83A 4I1UA 2WWWA 3MD0A 1F6BA 2Y8EA 4PO1A 3ZLJA 1A7JA 1JNYA 3ICQB 5LPNA 1SZPA 2ZRNA 4CW7A 1HE8B 4Q47A 1E79A 2BBTA 1AKEA 3U3RA 5A4JA 2IC5A 1FOEB 1P2SA 1CP2A 3P4XA 4RJLA 4XTRA 1FUKA 3U7GA 2VO1A 3JZMA 4HB3A 4EFMA 3SHFA 4U02A 1WP9A 4FXPA 1IOZA 1JR3D 4OI4A 3ADKA 1MO6A 2WSMA 2C98A 1NJGA 3NDPA 2WJVA 3SYKA 1BMFA 4GRAA 2OXRA 1E2QA 1SVMA 2V7QD 4B34A 1NVVQ 4H1VA 1DAMA 3OFNA 1JPJA 2QGNA 1RE0A 3K0CC 1EWRA 1A5TA 2BBWA 5F2EA 1FTNA 4IOKA 3ZZTA 1QDEA 1D6JA 1E0SA 4DDUA 1I2DA 3DOEA 3I5YA 2WPDA 2WOJA 4Q03A 5TMPA 3NEYA 4LJ5A 3UG7A 1KO5A 1RJ9A 3NXSA 2XOKD 4JSTA 5J4HA 1YQTA 4OHWA 1G8FA 2HF9A 2QM8A 4QC2A 1IN5A 3GJ3A 4JLOA 3IBYA 5DH9A 3U7FB 4Z54A 1ESNA 4HB0A 2XZPA 521PA 2ERYA 5G53C 2IL1A 4DLYA 1K5DA 2PJZA 3THWA 1VYTA 1IXZA 1XTQA 4NYIQ 5EXSA 5KSZA 1KI6B 1LS1A 1DELA 1ZC3A 2A5JA 5EP2A 4C4PA 2ZS7A 1E1RD 4V0OA 2QA5A 1GL7A 4EQ6A 1ZD9A 4I4LA 2NZ8A 4A9AA 2ZE6A 1AN0A 1R6BX 1Z47A 2ZUCA 5E7JA 1X8LA 1A4RA 2QT0A 2WM9B 3CWZA 1P4SA 1M74A 3GLGA 1L4YA 4JLDA 3IUYA 5FL3A 1U8AA 2GJ8A 5TY0A 2H17A 2BWJA 1JI0A 1P3JA 4BLRA 1E2IA 1AJEA 1LB1B 1CU1A 2NZJA 1NNEA 4Q5IA 3IHLA 4OK5A 5AJWA 1S1MA 2ZRGA 1G3QA 1E2MA 3KTAB 5TARA 3RSOA 2GEDA 3EIHA 2GVDC 3CM0A 1Q20A 5D3QA 1U94A 3RS3A 2AN9A 1TAGA 3SEAA 3TRFA 4DLRA 1NG9A 1E2LA 4BEBA 1Z6TA 2V8OA 2G6BA 4OHZA 2AR7A 4DIEA 2ZUBA 4A6PA 4G5SA 2VA8A 5ANRB 3VX4A 1UM8A 4Q4AA 3AH8A 1YU9A 2ORVA 1W7AA 1XPUA 4P3YA 3HU3A 2W6JD 4EPRA 3IPYA 1E9CA 4GT1A 2JJ2D 3NDBB 1T9HA 2ONKA 2J41A 4ARZA 3FMIA 3TAHA 4U7DA 1LV7A 3KJIA 4A6XA 2JLUA 2ZREA 1J2JA 2CLCX 2G0TA 1UBFA 3FHCB 1KK0A 4LC1A 1XMIA 3MRSA 3EWAA 4CRWB 1DG1G 2CE7A 1J90A 2FOLA 5AJXA 1UAAA 2GXUA 3VNUA 1M8PA 5LB2A 1ZVQA 3O8BA 3DKPA 1WRBA 421PA 1P9NA 3GLHB 1OLOA 5KNBA 4S35A 2RGCA 3NKVA 4TZ6A 4HAVA 2B7CA 4BRUA 2YWEA 1D2MA 1XCPA 3U7HB 3GJXC 4EFLA 1US8A 5KUTA 3IDQA 2QM7A 4JLNA 4P4TA 4QG7A 4YDHB 3RAPR 3H84A 1EK0A 3A1SA 4OI0A 1R10A 2F6RA 2VRWA 4LY6A 1LTQA 1S1CA 2IYTA 4BASA 4DBLC 1SXJD 2ZJZA 3GD7A 4AKGA 2VLIA 3AB3A 4Q1FA 4DDTA 3W34A 2JLQA 5FFMA 4ZDJA 1VKJA 3RSLA 1G7RA 3A4NA 3K70D 3B1ZA 4KJZA 2N42A 2ZEJA 2F1RA 1E98A 4OK6A 1IAQA 2AL7A 5FR2A 4W5HA 3SFZA 1T5LA 1Q57A 1P9WA 3AUXA 3HP1A 2QN6A 4DSNA 4X8HA 4JLAA 2ZUDA 1OIXA 4JL5A 2D06A 3IEVA 3LFUA 2FA9A 1YE8A 5FOSA 2VP2A 1ZM9A 1KAOA 1NLYA 4URXR 3ZVMA 3BK7A 3SOPA 1AZSC 4B2PA 5GJBA 4BFVA 2WOOA 1ODFA 3A36A 3WRXC 3PENA 1ZBDA 3I8SA 4IDNA 4HLDA 4KFSA 3W8NA 5L3SB 5KSOA 1GM5A 2C8VA 3LV8A 1ZU4A 1ZW6A 4MRPA 2FNAA 4NYJR 2VBCA 1JEEA 4QNMA 4A0GA 4B35A 5C1BA 2OLKA 1Z0AA 4DCSA 2J3EA 1HUQA 1KDRA 2YWHA 4U00A 4D4MA 1F2TA 1CJKC 4D26A 4NMMA 3I4LA 5AUPB 1MO4A 2V6IA 1QG2A 1G18A 1N2CE 3TMKA 4MYUA 4YMVA 3TUZC 3ADCA 2R6CA 2Q21A 4C0SA 3B1YA 2UZ3A 4TSFD 1AK2A 5SZHB 1JJVA 1R4AA 3B82A 3DPUA 2CCKA 4L5BA 1W0KD 2XJ4A 2XZOA 4LWZA 2Q0HA 2FF7A 1SKYE 4FMCF 3UMRA 3Q5EA 1GSIA 2AD1A 1CS4C 1TEVA 1DS6A 3AQ4A 4Z8YA 1YR6A 1DARA 3ZDQA 2BBOA 2VP9A 1JALA 1T0JB 3GJ0A 4G0NA 4P33A 4Q1CA 2HUPA 2F1HA 1ZRHA 2VPPA 4GMXA 3RDPA 3EPHA 4C7OB 1B23P 3BS4A 3THYA 3HPRA 1WE2A 4M1YA 1E6CA 2IYRA 4GMDA 4Q4HB 2ZJBA 4TMWA 4II7A 4GL2A 1G4UR 4V02A 1YZKA 4KFTA 2FEOA 2X8AA 5BN5A 3E2IA 3K70B 2OM2A 2O8DB 3CPEA 2BEJA 1JQJC 1NBMD 1Q1EA 1UPTA 4LYJA 3H4MA 4CF7A 1T3LA 5BN4A 5JLJA 2PMDA 1W4BA 2PBRA 2CLDX 1NLFA 3DO6A 1ZD1A 1N6PA 3KZ1E 1NVVR 5JWHA 1OFTA 1G8HA 2NO9A 1L4UA 2J0UB 2HXYA 3B5JA 3WHKA 4I81A 4G5QA 1GWNA 3VX3A 1NRJB 3CRW1 2PT5A 3LQQA 2XJ9A 1PUJA 1XJCA 3K0AA 4PSKA 3SHWA 4CZ2A 2IYZA 3KKMA 2F43B 2F55A 4JYCA 1XCMA 3VU9B 1LNZA 1NY5A 5EJEA 3KJGA 3H2YA 4RFSA 3QENA 5CYOA 1TADA 5JSZA 1G5TA 5TXGA 4CT4B 2IK8A 4IOLA 1HQCA 2OXCA 4NYIR 4QBFA 1NIPA 4YC7A 3ZH9B 2ERXA 4BRWA 3C7KA 1ZNWA 1Q12A 1COWA 2XSZD 2LWIA 2O8FA 2QZ4A 1F5NA 4B3XA 5KO2A 2CL6X 2XGJA 4BUJA 1YKSA 4GDFA 1CTQA 3TW4A 2FDCA 1KZ7B 4RD6A 3NG1A 2WTUA 4DB4A 3QXHA 4XTCS 1J7KA 4BFSA 2QAGB 1FMLA 1BS1A 1E9AA 1RRPA 2VSXA 2NMVA 2PZEA 2BM0A 4L4UA 4PC6A 2XNDD 1B0UA 4JLVA 4QHTA 1IN4A 4NH0A 2GCOB 2RGXA 3NIBA 4M9ZA 4JYBA 2OHFA 2Z4RA 1NJFA 2ZYWX 3CRMA 3PEVA 3NWJA 3AVWA 4DRZA 3ECCA 4HZUA 2WSSD 5DISB 4RFVA 4PANA 3RWMB 4B33A 4JBYA 2GXSA 1C4OA 3AVTA 2GZHA 4OYHA 1X6VA 3RS0A 2YYZA 5DIFA 4PZLA 3QF4A 3UWKA 2J9RA 2J5XA 3GLIA 1EWQA 4RD3A 3K09C 1A82A 1Z07A 3B1XA 5HZHA 3LW8A 4HB4A 3TUJC 4IEEA 4V0LA 1EFTA 3GEEA 2A5GA 1G7SA 3MWYW 1F3OA 5IRCD 2FSHA 2CHQA 4BFXA 1MRSA 3QKRA 3T1OA 2IBMA 3TH5A 3NC1C 2C9YA 5EP1A 2W6JA 2RGNA 1KO8A 5FOUA 5KTYA 1OYYA 1BYUA 2G0NA 4NYMQ 4IW3B 5JEDA 3NEJA 4WZAE 5JEEA 3OZXA 2XX3A 5EXPA 1W46A 4BECA 3C16C 2W00A 3CZPA 3TUIC 1IQPA 1FX0A 1SXJC 4B73A 3HJNA 3EX7C 1RW4A 5CYPA 2B8WA 4B74A 5JHGB 2G3YA 3K0FB 4MKFA 2AHOA 5DYGA 3EC1A 2GBLA 4DEXA 3K70C 4BFUA 1IN6A 4HLUA 3QXJA 2RMKA 3SQWA 3VKHA 2F7SA 2E9SA 4NKRA 1KMHA 2YV5A 4TQUS 2QTHA 3NC0C 3PVSA 3THXB 4RD4A 1FQJA 4OHVA 4B2IA 2XEXA 5C4MA 4UNSA 1OH8A 3QF7A 2ZR9A 3TBKA 1E0KA 4G5OA 5EP4A 1BMFD 2GEUA 1M6NA 3LBNA 3U3OA 1NSTA 2VIIA 3KDSE 5DHAA 621PA 1BIFA 4DDWA 2YINC 4UJ3A 4BFZA 3OFND 1T3SA 2XNSA 2ZRPA 4F93B 2OCYC 4HLCA 2ORIA 4TMZA 3UK6A 5AWFC 1KO7A 4A82A 2IX3A 1R5OA 2WPDD 4PO8A 1F48A 4PO9A 1GKYA 1UKVY 2PLFA 2YWGA 2ZRDA 1UBEA 1G5RA 1O3YA 1Z0KA 3EASA 3L43A 3QXCA 3E5HA 5HE8A 3UG6A 4E09A 1OB2A 1HY3A 4URUR 4ABYA 4G01B 5AUNB 5DI3B 1U81A 1UBCA 4JLJA 4Y0AA 1NMXA 1XD2A 3R9IA 3HU2A 1E0AA 2P67A 3QKTA 1N0VC 4M9XA 2WV9A 3IIJA 3CPJB 1ZNZA 3A8TA 1NMZA 4OQXA 1FPMA 4JVSB 5L3VA 3K9LA 5DGXA 3ZGXA 2QAJA 2WVJA 1E69A 5J4VA 4EPVA 2GJ9A 1N6OA 3DMNA 4JJKA 1AGPA 5DSZA 4M53A 1BH2A 2IA5A 3G0HA 1UEJA 3RANA 4M0LA 2QAGC 1G291 2E1RA 4DZZA 3IPXA 1I4DD 4ZIRB 5KU1A 4E03A 1EFCA 2LKCA 1VCOA 4BPBA 5A0FA 1T3HA 3KKQA 2W83A 5HPYB 2G83A 1XD8A 1LF5A 5JI2E 3UPUA 1MO3A 2H1LA 1JR3E 2F3TA 1XMJA 3IKJA 4NCIA 1OFHA 4P32A 2IUUA 3PCRB 3MWLA 4OQNA 1KJWA 4LPKA 4LBYA 2YWFA 3B9QA 3P27A 2RGDA 4RD2A 4CDGA 2V3CC 1OHHA 1CF4A 3QE0A 4QBHA 2D2EA 2KBEA 1GKIA 1ZM7A 2ODNA 3QY0A 3I62A 3EXAA 3LVQE 4LV6A 4XWAA 4A2QA 1E2FA 4DDVA 1U90A 5IF9A 3AVQA 3IBGA 2GILA 4PX9A 1FFHA 3UWOA 2DY1A 3U4QA 5E7MA 3RS4A 2WMOB 3F0TA 1VCMA 4DLTA 2QRZA 4JBWA 1JECA 3PIRA 3WBJA 2FFBA 3GLHE 4XVQA 4KLZA 821PA 4M9SA 4TTRA 5H68A 1TU4A 2B6HA 3T12A 4PAOA 5IHPA 1VCNA 4JKYA 1AIPA 2VSFA 1ZM4A 1E99A 4ITRC 4K46A 4Q4JA 1S8FA 2DFNA 1JR6A 4HAXA 4TMXA 1XEXA 2YVUA 1KKMA 1OXVA 2HXSA 1RJ9B 1Q44A 3AF1A 2QUZA 3LD9A 4MRRA 3KXLA 4JJZA 1N6LA 1M2OB 3OIWA 5SZIA 3SFVA 4ZI3A 3JZAA 2CLSA 4FD2A 1ZUNB 4M1OA 4TWZA 1Z28A 2G9NA 4TYWA 3QVVA 1SVWA 2IHYA 4WXPA 2QBYA 3THWB 3F8TA 1HV8A 3C41J 3E1SA 4LJAA 3MSXA 4U5XA 3WNBA 4D4LA 1SVSA 3NBYC 1OJLA 2CE2X 3VR1A 5BQ5A 4EPXA 4PAMA 3SS8A 4EQ6B 1OIVA 2BKUA 3LDAA 3ZJYA 1Q3HA 2O8BA 2RHDA 3OF5A 3TIFA 3GLGB 4HAUA 1BYIA 2J45A 4UNRA 4US1R 3AP1A 1FP7A 1XTSA 1EESA 5FOWA 4KV9A 1P2TA 3C5CA 3RRNA 2Z4SA 4AKIA 5L3QB 1NVWQ 4PQYA 5DLQC 4URYR 3FDIA 4BZQA 2Z43A 4Q1AA 4UXIA 2XSZA 2CJWA 1L8QA 2VEDA 5CB6A 1KI3A 3QIAA 4BQSA 3MWKA 3DM9B 3OE7D 4OJKA 1ZU5A 4B3GA 1E3MA 1XXHE 3W5JA 3LLMA 2OCPA 2QMHA 3DMDA 3KXIA 4IJMA 1FNNA 3I61A 4EDHA 1S3GA 3QJYA 1D8TA 3VR5A 2HCJB 1TTTA 2BJVA 3LXRA 1G8YA 2A5YB 2QPOA 1DAFA 1IN7A 1GITA 2IF0A 2R6GA 5EE0A 3MCAA 1TF5A 3N2IA 5CM8B 5FOXA 2NIPA 4JLPA 1N6KA 2XNDA 1TNDA 1UKYA 3VR4A 4GP7A 5KDOA 2KSQA 2HEIA 3CIOA 1SQ5A 1MR3F 4XJXA 2V55B 4ARZB 3EPLA 4M8NE 2WSSA 4NYJQ 3MMPA 1F60A 2MSDB 1F2UA 3U6BA 2Q6TA 4KODA 1E2GA 3WP0A 1EX7A 3LAWA 4JSYA 4CEHA 4XD7A 5EQTA 3FVQA 1WBDA 1IXRC 2ZI9A 4J0QA 1KTVA 3I5XA 2FSGA 1KY3A 3B13B 2ZRHA 4DCNA 3TQCA 1KK1A 5AJZA 2FU5C 1MT0A 2DWPA 2GWHA 4PC2A 3ICEA 4LV5B 4Z51A 4B3CA 5L8VA 5EZ6B 3K8YA 2YC2C 2ZPTX 1YZUA 4ZKEA 2XTMA 1UKEA 4D4KA 3WYGA 2QGZA 5H70A 1N3BA 2IYYA 1ZJ6A 1TUEA 3KQHA 4CEJB 3U3KA 3AKCA 3BWDD 1TX4B 2OAP1 5JZVA 2CNWD 4LRWA 4BFYA 3QEOA 2WWXA 1KO4A 1Z6XA 3L0IB 4PHFA 2AK2A 1S0UA 3LWNA 5FPKA 1W36D 2GETA 2EYQA 3I73A 4TLDA 1OFIA 3HU1A 3R7WA 3TSZA 1TL7C 2EWWA 1GL6A 2LKDA 3BH0A 1X1RA 3L8ZA 4RVCA 4PC1A 3N70A 4CEIA 3ZVLA 2JLRA 5K8IA 2GF0A 2J87A 4LX0A 3IQWA 3U5ZB 4QJ3A 3T1TA 2BVNA 2ANBA 5EE9A 4ESVA 5UKDA 1N5KA 4GFDA 3SJCA 4QGGA 1U9IA 1U0LA 1VPLA 2XAUA 4G5GA 5J4YA 3CKLA 3KKNA 4GZMA 4RKEA 2ZRJA 5JCZA 2IHBA 1K8RA 1KY2A 1ETUA 2EU8A 2FFAA 3BBPA 4B44A 4DSOA 4JL6A 1W2HA 4RZ2A 2ZJ5A 1ONBA 2VQSA 2ZI4A 3CNLA 2JJ1A 2RB4A 1F2TB 2W58A 5CIQA 2RKOA 3AVOA 3GJ7A 5ELXA 1Q1BA 4C0KA 3W3AA 4C0JA 1U98A 2AXNA 1RRGA 3B78A 3QOFA 5CDFA 3KB1A 1N0WA 4WOPA 2ZYVX 3GJ4A 1TMKA 1COWD 1II0A 2X77A 2I1QA 4L16A 3VAAA 3ND9A 2PZFA 4MRSA 4PZZA 3MJHA 2XB2A 5JRJA 2PLRA 4PHHA 1Z5ZA 5CM9C 3R8CA 3PFIA 4PR0A 2O8CA 2CHVA 5BXQC 2IEZA 4F38A 3B1WA 3FMOB 4PC7A 3LY5A 3D3QA 1NBME 3U2QA 3THYB 1G16A 1N6NA 1AM4D 2CVFA 4EJSA 4RZ3A 4D0LB 4OI2A 3I8XA 4QBIA 2JLYA 4B3DA 4TN1A 4B48A 4PHGA 3U6KA 2QL6A 1QHHB 3BH6A 2IW3A 4MUAA 1C9KA 2NG1A 2G77B 3PUXA 2JASA 4BE7B 1KGDA 4JVMA 1CRQA 1VCIA 4MRNA 2ASEA 4DHEA 2HJVA 4MITA 4FW9A 4WXRA 2NO1A 1LF0A 1WCV1 1JAIA 2ZE8A 3FPAA 1GOTA 1VECA 1VDZA 3FYHA 4LC0A 5K8UA 1TPZA 1WF3A 2WJGA 1W5SA 4A1FA 3A1VA 1BKDR 2ZVPX 2PX3A 1Z2CA 2Z0MA 3WNDA 1CR1A 5LBIA 2ZJAA 4ON9A 1VG8A 1Q21A 2CBZA 3A37A 1V43A 3CW2A 2FN4A 3PQCA 4DC9A 1XTIA 3A58B 3U3JA 2HYDA 3LVRE 5DNYB 4OL0A 2I1VB 5DO9A 5D3MB 3B8HA 4TYYA 1G7CA 1UBGA 4OBEA 4QL3A 5JSZB 2WAXA 1OXTA 3RS7A 1RZ3A 2K5UA 5IK2A 4MKGA
chains in the Genus database with same CATH superfamily
3AHEA 2QRHA 1RJWA 1ID1A 4PZ9A 2O8FB 2DC1A 1DUVG 1RI5A 3OEYA 4Y8VA 4XGRA 2WYUA 1N5RA 2HA5A 2P91A 4DG9A 1SBTA 1RTKA 1GCAA 1J0XO 3PZRA 4B2LA 1NBOA 1JPVA 3GJQA 4XCXA 4V0KA 4TTJA 5AM5A 4R71A 4UTVA 3AFMA 1N78A 3RC2A 4J3JA 3V1NA 4MPJA 2XUDA 2C3MA 3P2EA 3R0ZA 3PNQA 4RHUA 4M37A 1CFJA 3MOIA 4FKBA 4O2AA 4RMIA 3WIUA 5JD6A 3UXEA 3U44B 2I8LA 1UOEA 3LZCA 4B7ZA 3BHIA 4Q01A 2CMKA 5EVCA 3C2QA 2XMGA 3HDTA 1QVRA 1B0AA 5EJAA 1O7JA 3PD7A 3V7YA 3RVBA 1KAGA 3Q1KA 3ERCA 4PYJA 1ZOOA 3RS2A 3DOJA 3DD5A 1L3CA 1OWNA 3KEGA 4B6SA 4U9UA 1K3FA 4KHPB 3U9LA 2YQ5A 1C8VB 3PHHA 2IDZA 2VXYA 4TKZA 4B4OA 1ESMA 2WU8A 3OPXA 3LUGA 3ZLTA 3CUWA 1DO2A 1GZ5A 2ZQZA 1XLUA 5AP9A 4X41A 3ZYZA 1K3UB 1XRMA 3NIFB 4JQSA 5KYTA 1MX3A 1UBSB 4M1TA 4HGYA 4F3CA 1IBSA 1XKTA 5CK4A 5B3JA 2VJPA 2BGLA 3AIOA 3FGNA 2YXLA 4KLAA 2QTZA 5SYAA 1LRJA 3BVPA 1P3Y1 1LCIA 1MJGA 3CV3A 2AQ8A 3BCSA 3E9QA 3FUWA 4ODIA 4ERNA 2BP7B 3L7BA 4WY2A 4O25A 1NVFA 3NH9A 4RZIA 2CFCA 2NVUA 2NXEA 4TS1A 4TS4A 3RIMA 1YMUA 5H5JA 4H1UA 4BPRA 3V1MA 1G20E 1CEXA 4OOEA 5AJVB 2P68A 4U7JA 1XYVA 2OVFA 3H16A 5DJ5A 5IZCA 3USCS 3PUWA 4GLOA 3RUPA 2FJPA 1YJCA 3M6IA 1FP6A 4OIFA 1GPMA 1DINA 1Y1RA 3AWIA 3ZW7A 3PR2B 3LBHA 3I9OA 5CEFA 4RO0A 4DTIA 1HLPA 1K06A 1Y5NA 2ORYA 2J4FA 1FZTA 1XJWA 2J0EA 1MG5A 3DYVA 4UNPA 4C0AC 3DHNA 4DWOA 3SM9A 2ZRBA 5KQMA 1SU8A 2AFHE 1QWSA 3IOCA 4UKDA 4YPFA 3MINB 3G59A 2VRCA 2WMDA 3ORFA 4IF6A 2C2ZA 2VXOA 1LC3A 3NUGA 1KQNA 2AUMA 4OP2A 1XU4A 4MQEB 4AF6A 2ZSKA 2WWYA 3M6FA 3VNVA 5I8PA 1IUPA 4NZZA 4M7RA 3MB8A 3R5FA 1XDGA 2A14A 2CNWA 3PIDA 4CLOB 4W9MC 2O8EA 3IELA 1I2ZA 1AKRA 3TMYA 3CRQA 1H5UA 4ETWA 1Z08A 4EB0A 3QVUA 2W6IA 4K28A 5E6RA 2A1IA 4Z0TA 2F1IA 4XZ3A 5A71A 4C01A 1N1EA 2N9UA 2JB9A 2WUFA 4R7ZA 4C7BA 3DFZA 4JI7B 3ICPA 4YMUA 2FPMA 2YZ2A 3NBZC 1XYYA 2ZIXB 3FTQA 1L5FA 1O0CA 2G1JA 2XXJA 3WKBA 4Z3KA 1X1SA 4O4IF 3RIGA 3VR0A 4OMFG 1G2IA 3ECSA 5JWOA 4JFAA 2C77A 4G4IA 4UE3S 4W5TA 3NWEA 1Z5VA 2RIRA 5CW2A 4B71A 4YB8A 4XW2A 3AEKA 1JHUA 2BHTA 2O7RA 2G4LA 4MPRA 4RELA 5HUJA 4RKFA 4OQQA 2UXBB 1RI2A 2IODA 5E3IA 1WEKA 3IMCA 2CXXA 3FFXA 4D4HA 3EXG1 1CVRA 4HAIA 2OQRA 2D7DA 1DKPA 1MOPA 1Y42X 3A7EA 3JAKB 1Y98A 4G26A 4KV7A 5ERXA 4HVLA 3V42A 5CA1A 1U3CA 4KR9A 4M0DA 3M6LA 4L22A 1LI7A 1ISHA 4KYIB 3KL4A 1MO5A 3M6WA 3OVMA 3UMFA 4Y2QA 4AYTA 4DMCA 4FMCB 5T4BA 2DLCX 2QUKA 2I54A 3IAFA 3QV2A 2PLWA 2AFIA 2TYSB 4RANA 4OCZA 4RY2A 4D4JA 4FGSA 4GMGA 2JI8A 1YQDA 4S12A 3WRVA 3V1UA 4BV8A 4DJ5X 2Q3MA 3DONA 4REQA 4WOBA 1V9CA 4ND2A 3KO8A 2Q2QA 1C0EA 3VFDA 1X80A 4OHPA 1BSVA 1II9A 2QL7A 3ANMA 3MAGA 5KAPA 3WVNA 5AIBA 4CHGA 1GQQA 3QQPA 2ZKLA 2OG1A 4JBGA 3Q9UA 2PIDA 2E0IA 2IOFA 4G5RA 3DPIA 2I2XB 4Q9IA 4TM8A 4QXAA 4NZNA 1XDZA 2P78A 1JQKA 2RK3A 4FXOA 4X3CA 2N46A 4QQNA 2PQMA 5LZ9A 1MRNA 1EZZA 1F7UA 3ZJTA 4Z4EA 5DYTA 3GUYA 3ZVRA 2A9FA 4EJFA 2CSXA 2F1OA 1XTVA 1RPNA 3GLHA 1C1DA 1YQQA 1W76A 2ADOA 2GVNA 4FBGA 5DTEA 4X1OA 5JBIA 3IE0A 1C81A 2MINB 4XUDA 4Y6SA 1P1CA 4JZYA 1U1IA 2NZVG 4MEAA 4ZT7A 2Y1GA 3ZZ0A 3JPYA 3WFIA 3CVYA 2DFPA 5DBIA 2IS4A 4IVQA 1X7ZA 4EYGA 2P65A 2OBFA 2VWQA 1DBVO 5IF9A 1MGPA 3O8RA 4TROA 4F60A 3E7DA 2PPVA 1JAZA 3HR7A 1L7MA 4Q02A 3SQOA 1U2GC 4ZTUB 3GLQA 4Q7JB 4F96A 2AMLA 4AYXA 1X7XA 4JENA 5AO9A 5HKKD 2P2DA 1PUIA 3FKSD 3UCEA 4CT0A 2Z3ZA 3QKIA 4MA5A 3SYRA 4MRVA 3RHZA 1QHYA 1QK5A 2PWPA 2RH8A 2VDNB 2Y2VA 2GBLC 2JIOA 2R66A 5FAKA 4HLUC 1WZIA 3AJ9A 1OGJA 1PJ4A 1Y1PA 1KEZA 1SXHA 2GASA 3WOHA 4WSOA 5D3ZA 3OT4A 5LQNA 1TKRA 1OX6A 4HH4A 121PA 1AD2A 1V4NA 3KVRA 3MJEA 5JD4A 1GHTA 4P3KA 4YEDA 5JYCA 2UZ4A 1ID8A 3GFTA 4ZO7A 2QUHA 4LOKA 1DKUA 2BFWA 2V59A 2Y76A 3L4SO 5LDDC 2WPNA 4Q7LA 1KEKA 6AT1A 3PFFA 4Q3CA 1DEOA 1X38A 3BRWD 2A1UA 3LG2A 4YMLA 3ZWAA 1P1HA 3KWJA 4DT1A 4OL9A 4P7BA 5DOZA 1ZIPA 3D6AA 4MW7A 3LLVA 5ARDA 1TZMA 3FMGA 3SZMA 3B1KA 3T35A 5EIEA 1QANA 1Z13A 3EQ6A 3M5DA 2OGSA 2W8ZA 3TTVA 4LOLA 2GMWA 4F6CA 5ICSA 3U19A 2C5HA 3UANA 3OQMA 3K2EA 2F9MA 3KEMA 5EIWA 4W5NA 1Z0IA 2CJWB 2YFHA 4JITA 4X94A 1P1BA 1ZH6A 2P9CA 4UAUA 5DV9A 4WE3A 2VHQA 5KOJA 1G21A 2HMAA 3I42A 4G4JA 4J75A 3NYQA 1OXUA 1VRCA 5JZOA 5KSYA 3ND7A 1U8ZA 1XJ5A 3GK3A 5TSDA 2YHSA 2DUWA 2FXIA 3DTNA 4LVNA 3VH4A 2E4WA 3T4PA 3ZIDA 1COZA 4FMDF 2XLBA 2ZSAA 2D1QA 1NM5C 1XYGA 3KZVA 1ZQ1A 3VU1A 3U0VA 5DP1A 2Z6VA 2GCGA 4NCKA 4YRKA 2HJRA 2WM2A 2NVWA 1W2GA 1XZKA 3FHJA 1B8PA 4MDFA 3OCZA 1QRSA 4UVGA 5G0SA 3EEIA 4B85A 1H65A 3U39A 3KHSA 2JJ1D 1Z8DA 2UZIR 3AINA 3DJYA 3ZY3A 3J7AC 3A3NA 3RRJA 1XELA 2XT6A 3U31A 1EPUA 1JHOA 4KO8A 3K9NA 4NAUA 3VZCA 4IINA 4OXIA 1WCIA 4ENSA 4AAYA 4Z99A 1F2UB 4KO2S 4EHDA 3PDWA 3F2IA 1E1NA 3FYUA 5I9SA 1JHRA 4WLNA 4B6QA 4GI1A 1U6JA 4D82A 4CEHB 3DAPA 4IY1A 1BFDA 4JU9A 2Q4TA 1SNYA 1PVDA 1RJEA 1BWPA 4KW7A 4QSMA 1J8VA 4LCBA 1V3UA 1DOAA 2J3KA 1GRCA 2Q6KA 2REXB 3EG9A 3NGLA 4UBOA 3MGGA 4CM4A 2A3NA 2OCXA 2ZVDA 1FX1A 1Y63A 3U7JA 1FP4B 2PZ8A 3O1HB 3BREA 3ZJVA 1ATZA 1CE8B 1EXWA 1YKFA 2YIMA 3AR7A 4ILEA 3ZJ5A 1H4SA 2RD2A 4R9UC 2VDLB 3GFQA 1DTWA 4WY8A 5DWVA 1SULA 4IXMA 2R3SA 3M1AA 3X1WA 1WR8A 4BLTA 2C7GA 4ESEA 5BQFA 1CQZA 1YUNA 3JQDA 1RLTA 3CH4B 3FNQA 1DJLA 1A9SA 2X5NA 3DAHA 3NV7A 2GJAA 4NAHA 4Q6WA 1EB8A 4WACA 3ZCSA 2AQKA 2WIAA 4XPZA 5FBZA 4RTLA 1XRRA 3DL4A 5EJ7A 5JWRA 1F8GA 1KDOA 2OQVA 5BPHA 1I7NA 1AKMA 3T1YB 2QSYA 3PD1A 1OWPA 2H1FA 2D4HA 3C3YA 2DWQA 3LQRA 3NALA 3OOJA 4GBGA 4HWGA 4A0RA 4B4UA 3QSGA 4R8MA 4RESA 2PGOA 1QZ3A 4JX9A 3VSAA 2UXCB 3QVWA 5BV0A 2AW5A 1Z2DA 2C03A 1UP6A 3LWZA 4DS3A 1X70A 2PGIA 2IS2A 1E1QD 3DL0A 1DRUA 3DL7A 4QOIA 5I7AA 2D1FA 5J9FA 3T54A 4PONA 3OLCX 3ELUA 3SE0A 1ADBA 3B8EA 1E5XA 2RKBA 2DUUA 4FX5A 2E6UX 3BTSA 2PA0A 5DW0A 4A8TA 1Z8FA 3AILA 1KPIA 1TQ2A 3LCRA 4RC9A 5D01A 5HCNA 5BSRA 3SM3A 5FO1A 2Q5HA 1YR8A 2NUPB 2VNIA 3ZWMA 4A91A 5MHTA 1E6LA 5GVRA 5FBQB 1MB2A 1TVKA 5LKAA 1DV2A 2X9LA 1B6RA 1ZDMA 1LI5A 1IHDA 4M21A 4UE2A 1ZD8A 3NKLA 4ZARA 4B6EA 3FSJX 8MHTA 4G2TA 3WDSA 4D41A 2YXEA 1VL5A 1RRFA 1SOMA 2QMQA 2JA1A 1D03A 4YX9A 3DG9A 4FIDA 3MGAA 4I7EA 1RRCA 1RWWA 1SZDA 3T3DA 4A5SA 1N5OX 4QYMA 1K2WA 1BS9A 5IK2D 1D2HA 1Z2AA 1KI1A 2HU2A 1QLWA 4JSRA 1LI4A 1K8YB 1UANA 2JI4A 3F3SA 3LVBA 1KYTA 3Q6IA 4OD0A 5CJPA 2X0DA 3ZKAA 1ENYA 2CXPA 2BFEA 2VCEA 1K08A 3VM6A 1WULS 5A02A 5LIRA 1TF7A 2OT3B 1LY1A 4HZIA 5ALOA 1PEAA 1QGUA 1RAHA 4QO7A 3UIEA 1WOMA 3SGLA 4YDSA 5J1SB 5DGTA 5ALPA 4Y2HA 3BIJA 2IV2X 4M8SA 5AOAA 5JXHA 1J0DA 3C15C 4RMGA 1G3RA 1RQPA 3PNMA 5KNBH 1MEJA 2VNJA 3H2ZA 4DLUA 5FWYB 3V8EA 1U11A 4KI0A 5C34B 3WSWA 1B0ZA 2YYAA 3FGZA 1XTRA 1SVLA 3W1VA 3E58A 4OBXA 1BXKA 2VF8A 1C8BA 4NENB 3H19A 2IXGA 2M98A 2C2WA 4JP2A 1LDEA 1K92A 2IU6A 3BHJA 1YL5A 3D5QA 5FBKA 3UUFA 5BSHA 1EFHA 2BI4A 4B3RB 5F23A 4XB1A 1FS4A 1XDUA 4QYXA 4RHYA 3H8JA 3HJRA 4NNOA 4BBPA 4TV9B 3UKJA 4DKXA 1SUAA 1UC8A 1M7HA 2AWNA 1PR4A 4MV5A 3HY4A 1KJQA 2PX0A 5A5FA 3NYWA 1UBKS 1C3EA 5KTOA 1NXSA 3OTGA 1RNLA 2ZYUX 4EHNA 1HL7A 5GV7A 1XMVA 1JIKA 1CUSA 4BAUA 5JS8A 2Z2IA 1MAAA 2XZLA 1GNQA 5ILOA 4YLEA 1FQKA 4OJYA 2YFYA 2WJIA 4HLQB 1PJBA 4P31A 2RC5A 1DQPA 1EUZA 3IJRA 1GZVA 3PI7A 3L8DA 4LY0A 2W6NA 4PWZA 2B4RO 2G08A 5E6SA 3UATA 1QTRA 3NGMA 1CJMA 3NFRA 4US2R 1T4BA 3IQGX 4LQ4A 4J29A 4BRZA 4R05A 1SWVA 4BO3A 3K0EA 3RKSA 1WSWA 2AUTA 3B6EA 1GGKA 3TRDA 3VKGA 1H6BA 1K98A 2VSOA 1P3DA 4DBZA 1CDZA 4I3FA 4J2TA 1QG4A 4NE9A 1JKJA 1LRLA 5YASA 4CIBA 1X7HA 4QKQA 4S1VA 2IYVA 2CNBA 1T9KA 2W4MA 5ER9A 1UPCA 4ZQCB 5F7ZA 1E59A 3SN6A 1JBQA 4GPAA 4II2A 2VQEB 4A0QA 2QJOA 2DWUA 4RK6A 3TRHA 3WGQA 1NZJA 3M4XA 3H5OA 3FPBA 4OSOA 1LS6A 4F9FA 2IYSA 5JCOC 3T3OA 1K6MA 3AM5A 2BONA 1NQWA 3HJBA 4JR2A 1T6NA 4WGFA 3TD6A 4X65B 1IIBA 3IV7A 5LXTB 1MD9A 1XTJA 3R76A 3N76A 4RGVA 1P4GA 2SBTA 4M0PA 3RVOA 1OSNA 4V0MA 4JQYA 4KFUA 3CZMA 5BR8B 1PLJA 3WYAA 3T8YA 2SNIE 3UAVA 3I2JA 4D46A 4ED9A 3RROA 4HRXA 4A36A 2ZWVA 1ZAKA 4RCZA 1VL2A 2V6GA 3T9CA 2Q6LA 1E8NA 1A0OA 2IGTA 2QLMA 2VHJA 2WT4A 3N05A 1K66A 2C8LA 3D6TB 4XM0A 4AIIA 4BVLA 2OK7A 3E70C 4JJ7A 1TCBA 1D7AA 2XB6A 4NNPA 4LNUA 2CLFB 4RVFA 4BO7A 2FPOA 3VI4B 3GNTA 4TMKA 4DLWA 3BN3A 2NPIA 4QECA 5JASA 2VBGA 1I1QB 3OCCA 1OZFA 4CT5A 1H0HA 2B2NA 2JHGA 2V6FA 3V1YA 3U16A 2EW2A 1BE6A 3QW2A 5AW3A 1OFVA 2XOXA 3KJZA 3CUVA 3WLAA 1TAQA 4NS4A 3WDKA 4BMXA 1KJNA 2VT3A 4LMPA 5LUBA 3EGCA 4MPDA 1E20A 1SUBA 4C0QC 4E13A 4BNMA 1R12A 3FB4A 2I2DA 4FR5A 1WMBA 3TJZA 3EGIA 3JTEA 1T26A 2WNIA 2WNHA 3F5DA 3BF7A 4LAFA 5F3RA 2PKYX 2WJJA 4EFNA 2X13A 4YP0A 3AF0A 2V4MA 2EYUA 3I0NA 3J7TA 4NU5A 5D7BA 4C0WA 1F7VA 2H57A 2O3QA 4YLGA 4GDMA 3UWSA 4WCFB 1XZBA 2H1VA 1RRVA 4G1FA 4NH4A 1OYWA 1GSAA 1ZC4A 4F2PA 4ARCA 3GQBA 2OFOA 4IBOA 1P5ZB 4P3NA 3RSSA 1Z34A 3M0EA 1SVKA 2BV3A 1BHSA 2W6CX 4YT8A 5FULA 4RF3A 4F3NA 3AVPA 5EJ6A 1JE0A 3I53A 3KWLA 4G5XA 4GPIB 4LISA 4OHRA 4O2RA 4YALA 1DI0A 4BN5A 5CCEA 5HUQA 1O9BA 2W2OA 1IJFA 3PQDA 5A4IS 2VDUE 5P21A 2NVUB 2DQ4A 3LX6A 3WLSA 4P4SA 5HKLA 1AKQA 3GZ4A 1QBKC 3KPJA 4MCJA 2YNMD 3FZYA 4IH9A 1YCDA 1TO2E 1DV1A 1SIUA 3SQLA 3CVJA 4HX9A 3QYJA 4E33A 3M1IA 1GDDA 2GN2A 5CA1F 1Z35A 1QH9A 2CMGA 3ETGA 3OQPA 1YIOA 4B6GA 4CDRA 5CCXA 1EHYA 1KNXA 4I2NA 2PLAA 5I3CA 5AXCA 5K3BA 3LQKA 3O9MA 3KOYA 4NOJA 4S05A 4LTMA 3E35A 3GNLA 1KOLA 1GUAA 3WQBA 3ZK7A 3PL5A 4IJ5A 4JELA 3VPHA 4XDHA 1S8AA 2LTAA 3C5VA 3ZIAD 2QTWB 5BQ3A 3H18A 4C6RA 3EQ9A 4DMGA 3QITA 4WK4B 3VZRA 1C7JA 4AUMA 1A9YA 2H59A 3T3NA 3HUFA 3N8HA 5EP3A 2Q5CA 3AHHA 3PR1A 4BNZA 1GEGA 4WEQA 4LRXA 5J23A 3W0LB 3UAWA 1N2EA 3T7EA 2Q4BA 3ASZA 5EHQA 1M2EA 3TSYA 4D2IA 2O8EB 1WKCA 4CMBA 1VHTA 3I2HA 3UJ6A 1JKFA 3DMPA 1GKUB 2QP3A 1D0SA 2XKBA 2XZDA 1G9XA 3QVOA 1Z62A 1AHNA 1C2TA 2OY0A 2Q4OA 5JY1A 1KJIA 2GAJA 2JAUA 4CMCA 2XRZA 2JKYA 3KYCB 5DXAA 3FDZA 2I0FA 1STOA 1QRRA 1M9NA 3GAMA 4OHKA 2CKDA 3HP4A 4HBZA 2D2IA 1TECE 2JLAA 2FHSA 2YZ7A 3GRKA 2AD5A 1NI4A 3WYEA 3UV7A 2R25B 1JHVA 3AEKB 4CL0A 3W5AA 4KPYA 2A7QA 4HMOA 4WBNA 5BV8A 1I9CA 1ZGCA 4OKIA 1N8KA 3TTXA 2ZUFA 3AL0C 4YMHA 4IVNA 4MH0R 4N5DA 3QG5A 5CA1B 4DV6B 3QJ5A 4UAVA 4KNYA 4LPSA 3QVLA 2PUAA 3MAAC 4FE3A 1ZJ5A 3H4TA 4GOKA 3NRCA 2ZTUA 1JHAA 1QVAA 1H8HA 2Z2KA 1A2OA 3DSRA 3PJRA 2XAAA 4PXAA 2AFIB 3OHPA 4L4XA 3GFPA 3MW8A 1S4QA 1SK8A 4TUYB 2XWQA 1LTHR 2PRJA 4R3NA 4RFSB 3TKLA 5A7FA 2IHZA 4MWGA 3CH6A 1YOBA 5FFNA 2FPKA 1F0YA 4GR4A 3B2EA 4HWRA 4REQB 3RYTC 5JMOA 1JEYB 4M1MA 2GBIA 3AL3A 1PV4A 1R9JA 3I0MA 5ED4A 1R8JA 1QONA 2FZWA 1VPWA 1X80B 3IO5A 3NBKA 3DDCA 3HB1A 2VL7A 1JB1A 3SBOA 4WDRA 1OH6A 1GNPA 4ID9A 3ZOZA 4HRYA 3D8TA 3OFJA 5A3QA 5KJ6A 4ENWA 3CRRA 4Y1GA 4W5OA 4GD3Q 5H1YA 1U0JA 2GAFA 2QD5A 4HT3B 2QM0A 5DM2A 4BX8A 5C4IA 4NCAA 2HR1A 4J9UE 5CAEA 4AT1A 2QN7A 1YASA 1N9KA 3IOYA 2D2FA 5M04A 5CLJA 1C1DB 2QYTA 4R5HA 4RADA 4UCFA 4QG3A 3K9FC 2BM1A 4MQMA 5K3OA 4XFJA 2V8BA 4NPHA 1CUXA 3WIOA 3TEFA 2LE0A 1PZMA 2Q5QA 1LU9A 3NYIA 1UQRA 2JATA 1JSLA 1RACA 2Y0CA 4RHCA 1DOZA 1X1CA 2OORA 4BP1A 3PUIA 1NR5A 4WD3A 4UTNA 3DT6A 1T0BA 3F7TA 4KQKA 5DFAA 2J8ZA 3I2KA 2OBXA 3TFOA 2I7VA 3TBHA 3G68A 1Q1ZA 2ES4A 1X7XB 4IP0A 1OH5A 5HXAA 1CUCA 1OREA 1EG2A 5J4KA 1QZTA 3V3KA 3FMVA 3QHQA 4EATA 2GPYA 1YK0A 4H1WA 2Z3VA 1I7PA 3KOUA 4WXMA 4H6WA 2ONZA 5IYZB 1KQGA 2ZROA 1NQVA 2CDAA 2HLPA 1GTL1 4HN4B 4AO8A 1HXHA 5LBTA 3SSNA 3TKYA 5DHSA 4TS3A 3BUSA 5FWXA 5LD2C 3G2JA 2GPNA 3OKCA 4YJGA 5DRYA 2WWGA 3HC7A 5CIWA 3E0QA 3TD2A 3GVPA 3RRNA 4Q3EA 2BKVA 1KZ4A 5ESWA 2ZJ8A 4UZEA 1M6EX 1W6RA 1Y82A 2A6PA 1MX1A 1JU9A 2INGX 1DNPA 4U5QA 4ZCLA 4Q4DA 4YV2A 2FEWB 3L46A 1MV5A 3DKRA 3DCNA 4PE5B 5TEVA 2IUFA 5BR4A 2BTEA 2A1UB 1S2DA 1RE1A 1ZH0A 4XOIA 5ITZB 1T2DA 2XMPA 5JXIA 3I64A 1FX0B 2OHIA 3B36A 3I9FA 4NONA 4DT1B 1A77A 1ZM3A 2AXEA 4NZYA 5KJFA 3PFCA 5ERGB 3FDJA 3ONNA 1P6UA 1SR8A 4F92B 5KCMA 4ZVVA 3L79A 1IPFA 2C9CA 2RHGB 1V8PA 1CVIA 2VUUA 4G63A 1Z2EA 4Q1DA 4BWVA 1CEYA 5CCBA 2NV6A 3IOMA 3OFKA 4IOMA 1YI8A 4DMUB 2JLXA 2H5EA 1BQEA 4DNPA 3DZDA 3H2BA 1FRZA 3GUCA 1V16A 1XL0A 3EOZA 4QAJA 1MDFA 5ITWA 3QPCA 3RIEA 5KOJB 1CRPA 3HN6A 1E9EA 1G21B 2P6MA 4QYWA 1I80A 5EZQA 1L1RA 4AIRA 3E7WA 2QXTA 1B42A 2BIFA 4CQJA 4W5JA 1J0BA 4G41A 2LIVA 1PHRA 4C9BA 5CGZA 4ZVPA 1WDKA 5IUNC 5K0CA 3HBFA 4ZTBA 1POWA 1OF1A 4L5JA 2OQIA 3QU4A 1I6KA 4EKGA 4GZ3A 5EZYB 2IH2A 1WB6A 1S8NA 2H16A 2C2HA 5LQMA 3LT2A 5H9VA 2ZYSA 2FSIA 3EZ9A 3AOGA 3RUAA 1BS2A 4QLBA 5JJLA 3H3XA 3PXXA 2YIDA 3ILSA 3MHPA 4K26A 4OJNA 4HEQA 1WCIB 2LW7A 3P9RA 4K9QA 2QAIA 2BMDA 4RQAA 3DP9A 3FE2A 1NOJA 3JYQA 3CG4A 4Z9YA 4BKPA 5JJ5A 1JDJA 1P6XA 2YNMC 3BGIA 3FYUB 5K3EA 3IMFA 4KAAA 4KLNA 2FK8A 4PZ0A 4XJSA 5FX2A 1UUFA 3LXXA 3JARA 2R6DA 3MCWA 4FFNA 2MYUA 2C5LA 2AS0A 1GNRA 3ABSB 2QR2A 2Q7OE 3HMKA 2GZDA 2GPTA 3RT7A 5EWJA 3FNFA 1GADO 4P98A 5C0OE 4LBZA 1QHHA 5LUAA 4B3MB 1ORRA 3EG9B 1TQDA 3G82C 1IUKA 4J0DA 4UOEA 4RKQA 3W4JA 3DM5A 4D6YA 5A03A 5AM0A 5EJMA 5I8WA 1X0VA 4LY9A 2OMEA 5C8DA 1HLDA 1P72A 1DPFA 4LKOA 1DTWB 2PX8A 4M54A 5BP7A 3Q7PA 1YNSA 2KBFA 3JAWA 4BFLA 4QX6A 3I12A 5F3WB 1EFPA 3WL6A 1DLJA 3MK31 1PGQA 4W7SA 3DV9A 1R6VA 4TVOA 2HT1A 2CYBA 3NAGA 4GW3A 1QIHA 4ZGGA 5DN6A 4YYZA 5JS2A 4L28A 5FF9A 1C7QA 1TJPB 1XRSB 2CC2A 3ASUA 1FVXA 1AUXA 3LQ2A 4B5KA 3ZE8A 2IP4A 3U61B 2ZIVB 4EQZA 3B6KA 3FBGA 2HF8A 4YRLA 4LS3A 4AG6A 3Q9LA 3EXFB 5C8ZA 3DYIA 1UDBA 5JVDB 5D3MA 4HMQA 5I7EA 1N75A 3IHKA 4NDZA 2C88A 2KQUA 1TM3E 1WXDA 4CM1A 4YT4A 3SC2B 4FCCA 3REOA 5L53A 3PZBA 3DV0B 5K8TA 1AKYA 1KNQA 4GE3A 1YNOA 3QG1A 1JTFA 5F3DA 5EHNA 4MW1A 2RGWA 4F5YA 1IMOA 1TVKB 3C70A 1QO7A 3TL6A 5WRFA 4D25A 3KZMA 4M89A 4DMRA 3IXMA 3OEED 2G5PA 2CLIB 2PYDA 2VP6A 4INOA 1MXFA 4UUPA 4LDZA 5HQJA 4ZTZB 2HREA 2V4ZA 3FPKA 2XUPA 3WMGA 2VPXA 1GXSA 4HUTA 3GLVA 1RHKA 1UJCA 3LHIA 3GX1A 3OZEA 1E7QA 2AOWA 3PXEA 3QOYA 3A6PC 4CCWA 3INRA 1T9GR 1J09A 2EFGA 2GD0A 4HNSA 4CV0A 2PCJA 2ZSDA 2G70A 3OQJA 4I99A 3P45A 4FN4A 2J7KA 3VJMA 5EJ5A 3H5IA 4MIKA 1Z6GA 2BFEB 3CISA 3KT0A 1XVLA 4JGIA 4XE5A 5LZ2A 4R41A 1QGUB 3FDFA 2QBYB 1MFPA 1M3SA 4R68A 5IG2A 5IKMA 4G0QA 1W4AA 3QXSA 2BR4A 3MGCA 3G2PA 3JQAA 4MWDA 2FEPA 3VOSA 1ZOSA 5AW8A 1E6KA 1PVVA 2WFMA 1MFZA 1TVEA 4KN5A 1D1PA 2HFJA 3SKVA 1JAXA 1U5CA 2NADA 1SVIA 1OBFO 3KQNA 1LW6E 1W4LA 3U26A 1T5TA 4FLEA 2BMEA 3A9TA 1C3OB 4LMBA 5IXJA 2KS6A 4KPGA 5FBLB 4J16A 4NCBA 1MRZA 1RWMA 2CNNA 2ZRLA 2E5FA 2J48A 5L7TA 4KXNA 5HIIA 1XRJA 2YJ3A 4MKXA 2D7JA 3INGA 3GWZA 2P0AA 3IUPA 2EW1A 5LYJA 1U0BB 3NC4A 2ZIWB 3VYRB 4NG4A 3R0XA 3T34A 4GI5A 3O47A 1L5SA 2HFKA 1IJEA 2OV1A 3TOZA 3FPJA 4FHDA 4JD5A 1T4MA 1AF4A 1XDWA 3QEJA 3K09A 3SXPA 2E82A 3NIDB 5CP8A 5AW4A 5EAIA 3E27A 3UHJA 1G5PA 1U0FA 2Q4DA 2ZB8A 1BDBA 2OFWA 4YFVA 4H7DA 1KSJA 5E6SB 3U4AA 4C03A 1ULBA 3CCCA 4BMVA 3RO7A 2JH3A 3MTQA 3I9KA 1QPGA 2YN2A 3OLVA 4R2XA 5IUJC 4ITVA 2C5BA 3MCZA 4UTPA 5B1SA 3PX7A 3OZIA 3ED1A 4HQOA 2AX4A 2G7ZA 3ADDA 4F12A 1P0CA 1L7XA 2ZBRA 3IMEA 2GYUA 5G4LA 3JQPA 3EFOB 3DAOA 5DVZA 3E1KA 4D4IA 1R8QA 3WSTA 4LOHA 4IFBA 5H02A 1NFQA 2IXDA 3IULA 3QIVA 1DKMA 2DHRA 4JGGA 3QU5A 4JLBA 3X2EA 4XYLA 1WKBA 5JYEA 3H8SA 4JJ6A 1BXRB 3VSBA 3ST7A 1VSBA 3EZ7A 2C96A 3F7OA 2ZB3A 3K1AB 4WCDA 4GKJB 2J0SA 3PX3A 4BQOA 5IAAA 4MAFA 3H0KA 1C7FA 3UC9A 2O0KA 3KFVA 2NPFA 2F3PA 5MGBA 2WIGA 2P5TB 3OPNA 1DOHA 1R18A 3IKVA 5EXDA 2GGSA 3IEXA 2BLNA 4MUGA 2G4VA 5AESA 4FYHA 2D13A 2G25A 4GPEA 4L4RA 3WHLA 1BVHA 1E2JA 2VRNA 1O58A 5HTKA 1CK4A 4UMDA 2WJ3A 4PYRA 1XI2A 1YS2X 1JILA 3BAFA 3B1FA 3H8VA 1MC1A 3OQHA 1I2AA 4JJ4A 4WDQA 4ZEOA 3RV3A 4ZEVA 3HSYA 1KGSA 2XA1A 2EKLA 4LNUB 2BMAA 3V00A 4LVUA 4NPAA 5T5QA 2J0UA 5I51A 3S8YA 2YV2A 5A7GA 1QZXA 3CH5A 1OV4A 1T2EA 4GZLA 3MUFA 1V5WA 2XTJA 4GXNA 1ZUIA 2Y77A 2O1XA 1W96A 2OP1A 4FZ3A 1H2AS 5T64A 1XA3A 2ORWA 1BVUA 5H80A 3ZDZB 2E85A 3TLKA 4HTFA 4S2EA 4DJEC 2YKGA 2ORED 3RWOA 3RODA 3DHVA 4BQEA 1M1NA 1KDZA 1S3FA 2F1JA 1M5TA 3TGPA 3Q41A 4HDKA 4QJBA 3GOQA 4Q37A 5K3SA 4Q39A 1ZMOA 4UZSA 5DCWA 4KNWA 2CMHA 3A3OA 3WLFA 3I3OA 1BROA 2AFIE 3IEUA 3TW0A 2HSWA 5I9MA 1FY2A 4PLGA 1VP3A 3SF0A 1P2FA 1Q77A 3A4IA 5FAXA 3RF6A 2A57A 5TDHA 3GQBB 4KH0A 2FLWA 2PKEA 5DTRA 2GT1A 4ACBA 2JFBA 1DAEA 3G2MA 1OZHA 2QLTA 2PSJA 1KYWA 3MA0A 3NBAA 5KSWB 3NDJA 4R2HA 1U8EA 3U3MA 4D9JA 3KQKA 4Y1EA 1JXMA 3S2EA 3PNOA 1QB7A 4TX1A 3GXOA 4P4SB 2A3RA 4NULA 3GFFA 3N0TA 4IZHA 1PK8A 4WH0A 2FMIA 2EP7A 3HWX1 3W8EA 4CV3A 4S04A 3WBFA 2QI9C 3OC0A 4Y0VA 1WM1A 2I4MA 4R2IA 1QHFA 1YB1A 2QENA 1KBOA 1NKSA 4YNBA 1IWOA 2PD4A 1TQHA 3WKEA 4GWKA 4UCWA 4N76A 1V6CA 2X9VA 1M1YA 1IBCA 3W9YA 4LG1A 2B5WA 3EMKA 4QGFA 4AUEA 4C0LA 1L4KA 3T7SA 3LZDA 2WTEA 4A0HA 4N0EA 1FYWA 1XV5A 4FW8A 3CNOA 4R40A 2WUDA 3K9BA 4MUBA 4UM7A 1O2DA 2ZYIA 2R7MA 4KRXA 4R3UC 5IAGA 1PS8A 3SZRA 3IBSA 5IC6A 4YV7A 4ZI7A 1AG9A 3OQ1A 1K1EA 5JNWA 2HHHB 5HFJA 3PL1A 4IO1A 4P3XA 3SX0A 1QVWA 2VJMA 2EERA 1P77A 4LYYA 2CUNA 3T1QA 4UE6A 4YBZA 4B3BA 2QK4A 2RFLA 4FYPA 4MMXB 2V1UA 1V5GA 1AQYA 2H63A 4LZJA 3RAJA 4ESHA 2IELA 3KTOA 4HH1A 3VRHA 2CVOA 2HOQA 5KVQA 3TQHA 4GQBA 4IMRA 3UOWA 4KWTA 5HKAA 4KWHA 1A7UA 2CYAA 3TLMA 3DUWA 2IUYA 1Z06A 1WXIA 4NU0A 3AY3A 1XZFA 1ZA2A 5G41A 3TZ6A 1R74A 1C1XB 5CLLA 4E12A 1KAMA 3X2SA 2GM4A 2IKQA 3PYXA 2Z30A 3P2YA 3FDZB 2PX5A 3ZQ4A 1YQGA 3OEHA 1QV9A 1JHZA 1YGPA 4WIAA 4X7MA 2XDYA 4F21A 2JFVA 3FKJA 3K05A 1F9AA 3QYFA 1H94A 3GCDA 3QUCA 4LJYA 3SLGA 2DR3A 4WY5A 5JATA 1DEKA 1NI4B 1VIMA 3MTBA 1PAUA 2G76A 1ADCA 1E3WA 3R0VA 4H2DA 4BMZA 5HP4A 3X1KA 4TKMA 3LL4A 4Q21A 2BJHA 1VIYA 2ZJ0A 1ZOIA 2IU0A 3W04A 3W8FA 4K9MA 4OJQA 3OLWA 5HG0A 1QWOA 1CD5A 3MWGA 4EG0A 2RHLA 1TZCA 1WUHS 3F7NA 4KMMA 1P75A 4M9QA 1NZDA 4IQ4A 2ZJ7A 4S1WA 1K7XB 5EHXA 3UJ8A 4A16A 5AKKA 3ZE6A 4O3MA 1QTQA 2VWPA 4JK3A 2HM7A 3TE6A 3VJRA 3BQNB 2W22A 3I28A 1NHGA 4YMSA 4BB6A 1ENOA 5A3RA 3ZLVA 4LRTB 5FTLA 5H0IA 1KYZA 3A4LA 3EJ6A 4RD0A 3HTXA 3NTQA 3HNRA 1G21E 3OFVA 1VE7A 2JD1A 3GRYA 2A0WA 4PSAA 4WZZA 5I48A 1Y3AA 3FHOA 3LPLA 2WP8J 5LJIA 3OF2A 4OMCA 5C53B 1USKA 2OFPA 2X0RA 1BQ4A 1IEWA 3ZGNA 4P2BA 3OZAA 1P7YA 3QMPA 4TWBA 4JIMA 1YZTA 2ZTSA 4WCVA 4ZRDA 2X4DA 3TO5A 3KX2A 3N8NA 3P9YA 4HVAA 2E89A 5JHHB 5JPCA 3OWHA 3FPEA 3M81A 1TLLA 4W5WA 2EBHX 2JAWA 4Q9LA 1Z74A 1DIAA 4Y1RA 3RVKA 4G0VA 4YASA 1M33A 5CVJA 3Q88A 3TSOA 5CAEB 5EKDA 3F4BA 1N1DA 2EARA 1XJ0A 3PIIA 1YR2A 1A4IA 1ZD2P 3H6GA 3PK0A 3PUZA 4WXHA 3VMFA 3F49S 5SY9A 4QNRA 3MRVA 3T7CA 3EFHA 4MUHA 1GARA 3PJEA