1UFQA

Crystal structure of ligand-free human uridine-cytidine kinase 2
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
212
structure length
212
Chain Sequence
EPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the specificity, catalysis, and regulation of human uridine-cytidine kinase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Uridine-cytidine kinase 2
total genus 68
structure length 212
sequence length 212
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.48: Uridine kinase.
pdb deposition date 2003-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00485 PRK Phosphoribulokinase / Uridine kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ufqA00
3NBFA 1E1QA 1B23P 1MABB 4TMWA 3PUWA 221PA 2I1QA 3K9NA 3KJIA 4HZIA 4H1VA 4PX9A 4S2EA 3QNUA 2VSFA 4V0LA 2QNRA 2VTKA 2P6UA 5LBIA 4QJ3A 4OHZA 4ZDIA 1Z6AA 1RFLA 1VTKA 1Z6XA 4MDFA 3JZAA 4Z8XA 1SVIA 2QP9X 5JEDA 1C1YA 3M6AA 1PLKA 5B57C 2FF7A 3LO5A 1N6HA 1RIFA 4KODA 2LWIA 4RZ2A 4C0KA 1AK2A 1W5TA 4KJZA 1WA5A 4A6PA 1MKYA 4UNRA 1OH5A 2YWEA 3ZZTA 3RANA 4MRPA 5TY0A 2O8BA 2BC9A 5A5GA 2GAAA 2A78A 2FFBA 1GNPA 1RJ9A 1RVDA 1TUEA 3OE7A 4AC9A 3FGNA 4CT5A 2H8KA 4Q48A 1ZM3A 1M74A 2ZRNA 2BV3A 2ZSBA 4M0LA 4L8GA 1ESNA 5DI3B 3GCGA 2HCJB 2C9YA 2IW3A 2QRZA 2QM8A 3MJHA 3CNOA 3UPUA 1YZGA 1A2BA 4MH0R 3TUZC 3EW9A 1ETUA 1Z3IX 1BIFA 1P61B 3QSYA 2QEQA 4DZZA 2IEZA 2Q3MA 1OFTA 3K0CA 1QVRA 2OFOA 4X8OA 2ZIAA 4NCKA 3QENA 1JQLB 2QE7D 1NP6A 3TH5A 2OCPA 3AVOA 4BFVA 3CH5A 2GZAA 3DMDA 5DN6A 4AI6A 4HB4A 3M1IA 2GRJA 4HDQB 2ZI4A 3L43A 5DI3A 3FKSA 3FHCB 1KDOA 4TYYA 3BFKA 2ZETA 1JR3D 1DADA 3LY5A 3NBYC 4PHTA 4GL2A 1NKTA 1G291 2QMHA 2J5XA 2PMKA 2ZJZA 1U8AA 2Z0MA 3R9WA 1I4TD 1U9IA 3P4YA 4HLUC 5FTJA 4PANA 4UXIA 2YINC 1UKYA 3E2IA 2CK3D 1HY3A 5G53C 1KMQA 1AKEA 2ZPTX 1NLYA 2VQSA 4TYPA 3ZYCA 1LS6A 3AVUA 3RVBA 4I81A 2OLKA 4D81A 4YMTA 1OB2A 4PPNA 2Z5FA 1HEIA 121PA 1UM8A 5FTMA 5G41A 4BFXA 3C8UA 2OM2A 3CH4B 1J70A 1FQKA 4JYCA 1Q1QA 4DDVA 1NF3A 1MR3F 4OK3A 4IXMA 4IOKA 5IHPA 5AJVB 5EE5B 1YRBA 5TVKA 3ZIAA 2O8DA 3BXZA 3K0AB 3LX5A 4P3YA 1TUIA 3GFOA 4B6EA 2DYKA 4D0NA 4HB0A 4I1SA 1B0UA 2FX3A 1S1MA 2J7PD 1KAGA 4DLRA 3LQQA 3Q72A 1DAHA 1GFIA 3FDIA 1UADA 1BYIA 1N5IA 1NY5A 3ZIAD 1PZNA 1GKUB 4E03A 2FNAA 4FMDF 1J90A 2C96A 5JBQA 4R2HA 1SVMA 4BEBA 1AZSC 2B6HA 4B48A 4OI4A 1XTSA 1DAEA 1WBBA 4TMXA 4Q9IA 2FJUA 2DBYA 2O0KA 3QKRA 3QKSB 4RFSB 3U61B 1E99A 4TMKA 1KI6B 4OQFA 3RHFA 1EG7A 5CIQA 1G8GA 3CPHA 3QQ5A 4W9MC 4C2UA 4HLDA 4MKIA 1O87A 2GTPA 1HYQA 3P32A 4ZCMA 4URZR 2ZEJA 2QG6A 3CF6R 3L8YA 3C15C 4AIIA 3L8ZA 2ZYUX 2JGNA 4PHFA 5JSZB 1IONA 3UMFA 2GVZC 4M1TA 4XVUA 3H1TA 3A4MA 1XZPA 1XD8A 3DEFA 4TQ9A 5ANRB 2VHJA 2D4HA 4MRRA 2BM1A 3A4NA 3SE0A 2IYUA 1RZ3A 4D2IA 4RD2A 2EFHB 1KK0A 1JPJA 2WIBA 1E9AA 2XB2A 5CLLA 1AJEA 1LY1A 1W47A 2BKUA 4XTRA 4XD7A 1E9CA 4MUAA 1WE2A 4GT1A 2PLFA 1G8HA 1KO8A 1KAOA 4FXPA 2C04A 3X2SA 4QHYA 5KPJA 2HJVA 4JLOA 4JVLA 4Q9JA 3RS4A 4GFDA 3LW7A 3W34A 2PX0A 2JJ2A 3TGPA 1RJ9B 1KO1A 2ZAOA 3I1FA 5GADl 2NIPA 5KTYA 1P2UA 3K09C 2PT5A 3SQWA 1OXVA 1U0LA 4E22A 1GDDA 1RRPA 1SULA 4JZKA 1G6HA 4WXPA 1FX0A 1E2FA 4CW7A 2FFQA 3R9XA 2AK2A 4W5WA 4AD8A 5DO9A 3EASA 2Q21A 4M2LA 4NCNA 1R5BA 2EYUA 4B3GA 2WOJA 2BMEA 4BPBA 1VCMA 2BMDA 2VA8A 4GBMA 3LW8A 2BMFA 1OFIA 3PV0A 1OXSC 1OLOA 1FNNA 1QHGA 2CJWB 4F7WA 3I92A 4FMDB 2ONJA 1CJTC 1MOZA 1W49A 4R2IA 2DWQA 1UKEA 3PXGA 4A0HA 1DAFA 2XOKD 4RKEA 3IQWA 3EPJA 2GK7A 3A58B 1Q12A 1T5LA 2KBFA 5TARA 3WP0A 5KPDA 1C4OA 1IJFA 4WVFA 2QPOA 3A4LA 3H86A 4HAZA 4QBGB 3T1QA 4EFNA 2HV8A 3THYB 3X1WA 1DG1G 2J0UB 3PJRA 1P9WA 4MRSA 1U94A 5FR1A 5BXQC 2V7QA 1RE0A 2WMNB 4FI3C 1OKKA 4RD1A 2PJRA 3TSWA 3OAAD 3K53A 3AM1A 2I4IA 3JZMA 1P7CA 3SFZA 2OFXA 5CYPA 4XD7D 2OO7A 4C0HA 3D31A 3P26A 4LV6A 3I62A 1G17A 3DVLA 3W5IA 4P4UA 4BFYA 2ZE8A 2W2TA 3B5JA 3LQRA 4RD3A 1HT1E 2HLDD 3PITA 5EXTA 3OIWA 3ZQ6A 4EPWA 1HQYE 3VR5A 2WBLC 4W7SA 3GEEA 3EIHA 4NYMR 3MWJA 4D6PA 2CHQA 3BB3A 3OFNA 2CCJA 3KKOA 4M9ZA 1I4DD 3T34A 3B2EA 4FD2A 3B82A 5AUPB 1EWQA 1NNEA 4PZLA 2J0QA 3BOSA 1Z0IA 1G7SA 4XJXA 2JLUA 1E69A 3WBJA 1KZGB 4PQRA 4TTQA 1OYWA 1LF0A 1W2GA 3AUYA 1YR8A 5GJWC 4L16A 1VECA 1OXXK 1SVWA 3QXHA 3ECCA 5JCZA 1W44A 4W5HA 2WZQA 1RYHA 1DG3A 3T5GA 3WXMA 3GLGB 4DLSA 4RZXA 4KFTA 1OH7A 1EFTA 1G7RA 2A3RA 4UNNA 4LHWA 4M22A 2LCFA 1F5NA 3PUYA 4GSYA 4IVRA 4DRZA 3WMFA 1XP8A 2E87A 3U6BA 3F5FA 5J4VA 4B33A 2GF0A 3EZFA 3L0SA 2RB4A 5EJEA 1QHYA 5DYIA 4GP7A 3AF1A 3W6OA 3IGFA 5BQ5A 3UG7A 1GZSA 1P2TA 3U2QA 1NBMA 4BWYA 5AUNB 2RGNA 2PCJA 2Q9AA 2UKDA 3SBEA 1E1RA 1UBGA 1T9HA 3LH5A 5UKDA 3T12A 2IWRA 3IPYA 1GTVA 2REBA 1TQ6A 5DH9A 4ZKDA 4DBLC 2CVFA 2VBCA 3SR0A 2MMCA 4PPQA 1II8B 2WAXA 5AK0A 1NIPA 5FOWA 4J0QA 4JT2A 1U8ZA 2FE4A 5TDHA 1G7TA 2VH5R 1E4YA 4TLCA 3LNCA 3IHLA 2GVDC 3AV0B 2QBYB 1TADA 3QXCA 5CJ2A 1GWNA 2OG2A 4PQYA 4TLEA 1G8FA 4XWKA 1HV8A 5FUXA 1SVOA 2HLDA 3TRFA 1S8FA 2OT3B 3KXIA 3NG1A 1CF4A 4KHZA 3TUJC 4DDWA 2OBNA 2AXNA 4P33A 4WZ6A 4OQMA 1YZKA 1CRQA 3X1DA 1NBME 3OF5A 2O5VA 5DYGA 2P67A 4QG7A 1W5SA 4OHXA 3EZ2A 3QF4A 4YMVA 2FGJA 2QSYA 2V55B 2ZR0A 4DCVA 4A1FA 1KJWA 3NH6A 3QXJA 1OFUX 1DOAA 3R7WA 1KSHA 4V0NA 4IFEA 1FMJA 2V7QD 3ADBA 4NYIQ 2WKQA 4FW9A 1QZXA 2ZUBA 4C0QC 4F92B 4NYJR 4CF7A 4AWXA 1K8RA 4O0MA 4EAQA 3V9PA 2W6JD 4V0ME 4DSNA 4OKSA 3NHAA 3U3RA 3K0FA 2BBOA 4M9SA 1NVWQ 2FFHA 1NLFA 2FGKA 3W6PA 1ZNYA 2KI5A 4ZV4A 2WICA 3L0OA 4OI2A 1E2IA 1P72A 4NONA 4Z51A 5AJWA 2ZXUA 1FZQA 2GEUA 3KTAB 2GCOA 4HSEA 1CJUC 4HDOB 3KQKA 2ZRFA 1GIAA 3CZQA 4LBZA 1JNYA 2DPXA 3GLIE 3H2YA 2IYQA 4LJ7A 1DBSA 3VR4A 2IK8A 1ZM4A 2OESA 2ZI9A 3E70C 4BQSA 1F2TA 5JI2E 2J7PA 4LX0A 3UWOA 4LHVA 3U44A 1GRRA 5GVRA 3IIKA 3PUXA 1HUQA 4LRWA 4Q4LA 2P0EA 5J5CA 3NHBA 3AGPA 1K6MA 1Y3AA 1ZCAA 3OEHA 4PR0A 4XIGS 1MRNA 3GQBA 5SZIA 5E7MA 3GPLA 1XTJA 1P4SA 5H8WA 1XXHE 1ZUIA 2IYRA 1J8MF 1RRFA 2JIZA 1DELA 3BORA 4A8JB 4BFUA 3K09A 2XJ4A 1OXTA 3DL0A 2F1JA 3CKLA 1FQJA 4DB2A 2ZREA 3K0EA 3BH7A 5JS7A 4LUCA 2XXAA 3U7GA 5EP4A 1YR6A 4QFMA 1D2NA 3PEYA 1T6NA 4KU4A 2IF0A 3KQNA 3TJZA 3R8FA 2RMKA 3K9GA 2H7VA 2VP9A 2ZSFA 2QAJA 2ODBA 2GXAA 3UMRA 3EIEA 3B1WA 1ELOA 3VU9A 4B2LA 4NTZA 3AF3A 1GOTA 1R8SA 3OEEA 1ZUHA 2C99A 5FBQB 1L4UA 1XJQA 4JYBA 5KO2A 3F8TA 1XMVA 1Q44A 3OAAA 2QN6A 5FH9A 3TNFA 2A30A 4G5OA 4AYTA 2OBMA 5FL7D 1XNJA 3GLHB 3RWMB 2R2AA 1NVVQ 3GEIA 2C78A 3ZZ0A 2FPLA 3WMEA 1TF7A 5HR5A 1QHHA 2O0JA 3NEJA 4U7DA 5HKKD 1ZMXA 5C2JB 2X77A 2Z83A 2PZFA 5K8UA 2IA5A 2NO7A 1OT3A 2QY9A 2ZJAA 3EX7C 2F43B 2ZAMA 2WSMA 3B7GA 3O8DA 1X1SA 5GJVC 2V8OA 3CX6A 2FSGA 5TB5A 2QA5A 1G5TA 3UK6A 2G77B 3DOFA 2HF8A 4BLQA 3UANA 1VCIA 1J2JA 2QU8A 2CDNA 1ZCBA 3B13B 3MD0A 4LJYA 3LXRA 5FOUA 2ANCA 3GMTA 3LLMA 4YXWD 3GLGE 2C8VA 4DB4A 1KY2A 1E9BA 4BLRA 1NMYA 4LYHA 4LJ5A 1G3UA 1E2MA 2IYTA 2VSOA 1XX6A 1E32A 4D25A 2W0SA 1C9KA 1JR3E 4LJ9A 2IS6A 3TUIC 4HAYA 4RFSA 1R0ZA 4MYTA 3VKWA 1Z6GA 3LXXA 3I72A 1MO3A 3BC1A 4CIDA 3VMFA 1QG4A 4NH0A 1MV5A 3SJBA 5CK4A 1NKSA 3X1XA 4D4JA 4NYJQ 4DT1B 1XEWY 4PHGA 4NBSA 1KIMA 1II8A 3TVTA 2DFKB 3KXKA 4JJKA 5F9FA 3IQXA 4RFVA 4JMPA 1ONBA 4B3DA 3NKVA 3EAQA 2RGAA 1Z8FA 4AY2A 2J0UA 4A8JA 2YYZA 3W5JA 1DAIA 4Q1FA 3FWYA 4V0OA 3GJ8A 2F9MA 3A1TA 4A92A 1XMSA 2H5EA 4Y0AA 1Z63A 2Q0HA 1R5OA 2PEZA 4IDHA 3ZQJA 5JHGB 1G9XA 4M53A 2BM0A 421PA 1WRBA 4WW0A 2WJVA 5J40A 4DEYA 3KB2A 3ADCA 1GNRA 2WPDA 5EE9A 3QF4B 1AM4D 2ATVA 4PSVA 1E3MA 2BOVA 2RGGA 1S9HA 1KSGA 3F3YA 2HEIA 1P75A 3QEJA 4R71A 3W3AA 2DCUA 5J4HA 4NL4H 4KBFA 4PC1A 1M2OB 1QBKC 2HJGA 2GKSA 2X8AA 1OH6A 4NCJA 4L9WA 3FB4A 4BLOA 2R9VA 4M4SA 2X2EA 1GL9B 2GCPA 3BD9A 3B6EA 5CYOA 2TMKA 1Z0AA 4A2WA 3BB1A 5CB8A 3AF2A 2NQ2C 2CJWA 2VP6A 3A1SA 4L5BA 1A1VA 4C3ZA 2ZRLA 1XWIA 1ZNWA 1QHXA 1Z5ZA 3IHWA 2O8BB 4C2TA 4RCZA 1CJMA 1UEJA 3A6PC 4NHOA 1BMFD 1V5WA 3GJ5A 4QC2A 4A4DA 2NO9A 3I61A 1E0AA 3ZJYA 2FSIA 1NIJA 2R6GA 5L3VA 1NG9A 2PT7A 1ZM7A 2P65A 3CRRA 2HF9A 2JLXA 4CEIB 1E2LA 3QI2A 1PLLA 2W2XA 3N2IA 3QKUA 1XD2B 1Z6YA 3EG5A 2VLIA 3FMPB 3GLIB 4Q1EA 3TR5A 3QJYA 2WWGA 2ZSEA 3MMPA 5HPYB 3HP1A 1U2RA 4E07A 4MGIR 4JSYA 2QAGA 4V03A 2C77A 1II0A 3R8CA 4YMWA 4QBHA 5EZ6B 2DB3A 3RSOA 4I4LA 1Z0JA 4OHVA 3DM5A 2HXYA 3I8XA 5D3MA 4TSFA 4LHXA 1A2KC 4JLNA 1N0VC 3OFND 4N0EA 1E2HA 1YU9A 1NVXQ 1A4RA 3QKSA 4C0LA 1TEVA 3EPKA 1Q1BA 1Q21A 2ZS8A 3AVYA 3KKPA 2BBTA 2CLSA 4JLVA 1J99A 4Q1BA 4EPXA 3Q3JB 3AB3A 5FTLA 3O8CA 4EUNA 4IDNA 5F9HA 4DWJA 3IDQA 2YZ2A 2AL7A 3HR7A 3SS8A 4Z54A 2QT1A 3CRVA 4B75A 2IT1A 4OHWA 4QRHA 4A8JC 2BJWA 1L2TA 1AKYA 1E2PA 4D26A 2ZR9A 4XVQA 2H57A 2XB4A 4LJ6A 4LPKA 2A5YB 5FUWA 1P6XA 1UBFA 2SHKA 3VKHA 1KHTA 3RC3A 1ZD1A 3LV8A 4FCVA 1XTKA 3HR8A 3EZ7A 4KLZA 1ZM9A 4LI0A 2XJ9A 3DKVA 2G1KA 1AIPA 1JB1A 4KITB 1YKSA 2CLCX 3TE6A 3KKMA 4Q4JB 4HB3A 1R6BX 1SXJA 1M7HA 1E2DA 4MGZR 4C0SA 4EDHA 1F60A 2QSZA 1DO2A 1SKQA 1R0YA 4GOXA 5TV2A 1UFQA 3D7MA 2IYVA 4A0RA 3GLHE 4CEHB 4MQBA 1BH2A 2ZS9A 2YWFA 1Z0DA 3G82C 4IDPA 2VP5A 4EQ6A 3V4FA 4AURA 1L4YA 3B9QA 3THYA 2RGBA 3B85A 1DE0A 2ZJ8A 4JVSB 5B64A 2YHSA 3GLFB 4JBXA 1TF2A 1XCGB 3I73A 1FUKA 3IBYA 4QHTA 5J4YA 1Y63A 2BHRA 4TYWA 2YNMA 4GI7A 4JVNA 1PVOA 3KFXA 2D74A 5EE3A 1OE0A 2WAYA 5DN6D 2BBSA 2QMUA 1COWD 2KSQA 4PO1A 2GJ8A 4XWOA 1Z2CA 3IKJA 2NZ8A 1T4GA 1W0KD 3UKDA 2IXGA 3IIJA 4HAWA 4XH9B 3KUDA 4BRWA 5FTKA 1Q3HA 3O47A 2A5GA 5EP1A 3RDPA 4TTRA 1G20E 5KYKA 4K81B 3F0TA 3EARA 4IVPA 1LFDB 3GJ6A 4ARZA 1EGAA 2MSEB 5K8TA 1G3RA 1NSTA 1X6VA 3I8SA 3QBVA 5HTKA 1G8YA 4M1YA 2F43A 5FUVA 3BRWD 1R5NA 2V54A 4DVGA 5G3ZA 3DM9B 1M1YE 3SDZA 1ZINA 1VG0B 3FE2A 2W58A 2D3WA 4V02A 4F38A 4DDUA 5CDFE 1CEEA 4BUJA 3W90A 1PUIA 1ZC4A 1RRCA 1WCV1 2PZEA 1MRSA 1CLUA 1YZTA 1NVVR 2D2FA 3HPRA 1YRAA 2RCNA 4LC0A 3RRMA 4TMTA 2ZYTX 2ZJ5A 2XXAB 4A82A 1TAGA 1Q20A 1T8UA 2GJAA 3GJ3A 2FFAA 1E1RD 1FFHA 4AK9A 4PZZA 1VMAA 4DLXA 3RS3A 3QOFA 2N42A 4QGFA 3THXB 4UXHA 2ZUCA 1QHSA 2JJ8A 3PFIA 2O8EA 5IK2D 5CDFA 1ODFA 5B30A 4LBVA 3KQUA 3GFPA 4QGHA 4JLJA 4F93B 4PC6A 3SJCA 4B2IA 5BWMA 5IK2A 1SKYB 1SZPA 3PG5A 2J9RA 721PA 2Q6TA 1YZQA 2IYZA 3AUXA 3AKCA 1KJYA 4L4UA 1U9IC 4UQOA 1Z83A 2R44A 5CM9C 1E79D 1U8YA 3CNLA 3I4LA 1J8YF 4IOLA 4AKGA 1E4VA 3I3SR 5E7IA 4QJ5A 3RWOA 3KQHA 4BLPA 1VIAA 4HEJA 1E2KA 1KGDA 3LVQE 1ZRHA 1IN5A 2HT6A 1Q0UA 3PUZA 5AJYA 4N1AA 4LBWA 5DNYB 4BEJA 2VEDA 2EFDB 2ECKA 1IJEA 2ATXA 1N6LA 2ZI3A 3HU3A 1G3QA 3L82B 1KYIA 4ZDJA 2PH1A 4G5SA 2ZRDA 4A0FA 3K70C 1UEIA 1E0KA 2REXB 3OIYA 3IUYA 3VTKA 1WQ1R 3BERA 3MJRA 4M9XA 5FBRB 4IJMA 4A15A 2QQEA 2R6DA 4PTLA 2PCLA 4ZDKA 2F1HA 4UXJA 2BDTA 3SYKA 1ZBDA 4DJTA 3PEWA 1BYUA 4JLMA 2HDNB 2V6JA 4GOKA 1G1MA 2IF2A 5J47A 4DLZA 1JALA 1DS6A 3N70A 4GDFA 3G5UA 3PEUA 1EFRD 4HAVA 1AZTA 1E94E 4TLBA 3OEED 1FNMA 621PA 2Z6VA 4ZDWA 4HLQB 1L8QA 1NMXA 4MKFA 5E3HA 3HU1A 3NH9A 4UJ3A 2IS4A 3GJ0A 1HA3A 2RHDA 4C0BA 1DTSA 4WA7A 4IW3B 2E1RA 1ZD8A 2ZI7A 4LSGA 1T0HB 1IN6A 4FWTA 1AS3A 1NRJB 4Q7MB 3W9YA 4CGZA 1VG8A 2P5TB 2XITA 5JCPA 1KI7A 5KDOA 2DFLA 3EC1A 2NO0A 2VP0A 1W48A 1BKDR 2Z43A 3VHLB 2R6AA 2CCKA 3QE0A 1Q1ZA 4GMDA 2N1BA 4LPSA 5BW8A 3NBZC 4OK5A 1M7BA 2ZE7A 3QG1A 2OUKA 2QAGC 3K0AA 4RZUA 4M21A 4M1KA 4B32A 4Q4HB 4WAUA 1CRPA 1N6OA 1GRQA 3Q8XB 1E79A 2QZ4A 3ZD6A 2O8CA 3OZXA 4OYHA 4C0JA 5H1YA 5EUQB 4EKDA 4HUTA 4A2QA 2L0XA 2EVWX 2IUSA 3SEAA 4BFWA 4RVCA 3K0FB 3U3OA 5DI9A 2AHOA 4BRUA 3FOZA 5EP3A 3GJ4A 4EPVA 1GAJA 2VL7A 2XGJA 4Q00A 4BLSA 8OHMA 5FPYA 2OV2A 1UKZA 4KSBA 2WKRA 3RSLA 2AK3A 1G4AE 2VO1A 1OHHD 4Q9HA 2ZJ2A 1JEEA 2BMJA 1YHNA 3VHXA 3VR6A 3NIBA 2KJQA 2PJZA 1YZLA 2QM7A 4CDGA 3CM0A 3OESA 5ELXA 4YDHB 1CTQA 2GF9A 4ZI2A 2F6RA 4KO8A 4Z1MD 3GLFE 5JJKA 4EJSB 1CR2A 3Q5DA 1ZNZA 2G88A 5EE1A 1FUUA 2ZR7A 2FU5C 2AN9A 1TQDA 3NWJA 5E7JA 4D82A 3THWB 3DMNA 1S3SA 1YVDA 4Q01A 3B1ZA 2AFIE 4LWZA 4TSFD 3REFA 4MRNA 4KAXA 5CIWA 1D9XA 2ODWA 1SVLA 4Q4AA 4ARZB 3RS7A 1TMKA 3A1WA 1SXJB 4PSKA 3GLIA 2IHBA 2R8RA 1E0SA 4IOJA 2ZUDA 4HUQA 3KQLA 4PC3A 4LOAA 1TEXA 2XTMA 4LC1A 4B76A 1RRGA 4L15A 4ITRC 2IUUA 3AVWA 3KJGA 4JT4A 2BWJA 4DEXA 2JEOA 3QPUA 4UNSA 1TU4A 1RC8A 5DGXA 3WHLA 1R4AA 1T3HA 2BCGY 2C9OA 2W6ID 4G1UC 4Q03A 4ACBA 3SU8A 2V3CC 4GZLA 1FW6A 4GRAA 5DHAA 3RYTC 2GK6A 1UF9A 1F6BA 4KCGA 4RD4A 2OCBA 2FZLA 4IRUB 5FFMA 1F3OA 3ASYA 2VPPA 3QUSA 2O0HA 4OI1A 2I3BA 3QXXA 4JLKA 1Z29A 3TAUA 3N5CA 1W0JA 3MUFA 1IBRA 2VHQA 3LD9A 3VR1A 3THWA 1IY0A 1T5IA 1XU4A 4LBYA 1EX7A 2VYFA 5HE8A 1G4UR 2D7DA 3LFUA 3P1JA 4Q7JB 4TL7A 1JPNA 1EFUA 1UJ2A 1E2GA 4NCHA 3ZZUA 2FWRA 1W2HA 4NYMQ 4BZXA 4G0NA 1EK0A 2I1VB 1CULC 1D2MA 1ZIOA 2J45A 1SKYE 1VYTA 4WIAA 4EPTA 1EWRA 1N25A 2J3EA 2OEPA 4QGGA 4QOSA 5B2ZA 1NN5A 2YOGA 3LRPA 2JLRA 1P2SA 1JI0A 1Z0FA 1JAIA 2GCOB 1N6KA 5L3RA 1D8TA 4MYHA 4B3FX 3WP1B 2VRWA 1M7GA 2ZRPA 4NDZA 2EFGA 5CM8B 3I32A 4A9AA 5JRZA 3BK7A 1TQ2A 4Q4JA 1XCPA 4JSTA 2NG1A 2WWYA 1KDRA 4ABYA 3AP3A 1XD2A 4PHHA 4B43A 4Q18A 1SHKA 2PBRA 4U00A 2GCNA 2JJ1D 5HKKA 5GJCA 5CJPA 1H8HA 2QROA 1N2CE 3T1TA 1A7JA 2ZRHA 3T1OA 4E5UA 1EX6A 1NSFA 5BN3A 5KU1A 1U98A 4IKEA 1UKVY 4PC7A 5FPHA 1WF3A 1KI2A 5LB4A 4FINA 4HATA 2YJTD 3AGQA 4IEIA 2ZYWX 3TR0A 3H0KA 2AWOA 1W0KA 2KWIA 2OAQ1 5JMTA 2ZI6A 2QE7A 5AJXA 2GETA 3LAWA 1O3YA 3K70B 3S1AA 1I4LD 1XTRA 3U6KA 2UZIR 4O2RA 1JXOA 1WMSA 5AUQA 4IDOA 3EC2A 2AD5A 4FCWA 2WSSA 4BLTA 3FMOB 3JVVA 4HZUA 4HB2A 1JECA 3PEVA 1AN0A 2WJIA 4HAUA 4D4KA 1X8JA 2ZRCA 2GXUA 3HYTA 2ZE6A 3QVUA 2ERXA 4L9SA 1IAQA 1OSNA 1LNZA 2YKGA 5C4GB 3ZS8A 3QXSA 4P4TA 3U5ZB 2FA9A 1E9FA 3L2OB 2JLZA 1KNQA 2QQ0A 3NDPA 4US1R 3MWLA 1R2QA 4M1SA 1R7RA 2PL3A 3ZH9B 2KBEA 1NN1A 2IS1A 3ICEA 3VNVA 2X19A 2AD1A 1IXRC 5SZHB 2FEMA 2P2LA 4TN1A 3RRNA 4TL8A 2IYLD 1XBTA 3WRYC 4B34A 4EPYA 2V1XA 1W36C 1LV7A 2YWGA 4B74A 1IY1A 4TT3A 2YOHA 1RW4A 5TMPA 2AXPA 4KSCA 3RS5A 3NDBB 4NKRA 4BECA 1VCOA 3TSZA 1N5KA 1CBUA 2DHRA 4M9QA 2JDIA 1XZQA 2FG5A 3CR8A 4MRVA 5L3SB 1GP2A 2HCBA 4RSGA 1SHZA 2IWHA 4TTPA 3K9LA 1XPOA 2A2ZA 5GVSA 1IN7A 2FEOA 2XSZD 4H9GA 5CITA 3U7HB 3EWSA 2VP4A 2RHMA 3B1XA 3U3JA 4JVMA 2W6IA 4IEEA 2AX4A 4BFSA 3KX2A 2FDCA 4N3NA 3RS0A 3ZVLA 1FP6A 3KTAA 1DAKA 3CRMA 4EQ6B 2ZU0C 3QPVA 5JWOA 2A7QA 3C41J 2QMEA 3C4JA 1KK1A 2BVNA 2CXXA 1OV4A 2MSCB 2RGNC 2W6JA 1IHUA 1NN3A 4PO9A 4U02A 1GG2A 1ZJ6A 1QHNA 3KXLA 1WBDA 2JLWA 3ND9A 4F4JA 2ANBA 2A5JA 1E98A 2JJ2D 5JLJA 2VP2A 2XTNA 2YOFA 4Y0VA 1A5TA 4DLYA 3EIQA 4TZ0A 4YLGA 2NMVA 3QF7A 1JQJC 3GJ7A 1GL6A 3KKQA 1U90A 2ZU6A 1KK2A 1KI6A 4HI0E 5CB6A 1P9NA 3CRQA 2P6RA 5D3MB 4WBSA 3Q7PA 4YC7A 3LA6A 4URXR 1VYUA 2QPAA 2OCAA 4FMCF 2OXCA 4G3XA 3AVPA 4RD0A 3AKYA 1G18A 2JJ1A 3BS4A 3U7EB 3K1JA 4ESVA 4URUR 2OZEA 1QVAA 2AWNA 1I2MA 4GNKA 5AWFC 1JJVA 2GZHA 3WNBA 1XFAA 4BZQA 1A82A 3TVDA 1NY6A 4TT3D 4F91B 5KUTA 4PSAA 4EIWA 1UPTA 2PMDA 3WMGA 4FN5A 2F1IA 4DUGD 5KNDA 3AP2A 1YZUA 4PAMA 1FX0B 2JLSA 4G5QA 4S35A 1T3LA 2ZS7A 1YZNA 3CONA 3LVRE 4KI0A 3KJEA 1ZU5A 3MG9A 1CP2A 2LKCA 3H84A 4Q7KA 4XTCS 4ACAA 4B44A 3ADDA 1QG2A 3SHWA 4B6FA 2OXRA 4I1UA 4IFBA 4TL6A 4AYXA 2V4ZA 1OXUA 2NO1A 4V0MA 1GKIA 2JAQA 3FKQA 4NE2A 1UDXA 4YMUA 4P32A 2CE2X 1OIVA 5C46F 4G5RA 1J7KA 3T61A 2ZVPX 1W46A 2ZANA 2J0SA 1XDBA 1G8PA 3FFAA 3GEHA 4MGKR 4Q1DA 3FTQA 1GUAA 4ZKEA 1OYYA 2ZRKA 5J4LA 2J46A 4A36A 1H8EA 3D3QA 1K5DA 3CPJB 3M0EA 2IXEA 3T5DA 2WKPA 3ZD7A 1HT2E 5JSZA 1OJLA 1GL7A 3WY9A 4AYWA 4YONB 4DC9A 2BJVA 1AS0A 3LWNA 4Q47A 3T15A 3CWZA 4LJ8A 3ZLJA 1G3MA 1SXJE 1WDTA 1CIPA 1UDWA 2Z4RA 2ZRBA 4OJKA 5L3SA 1N0UA 1VG9B 3DDCA 4IXNA 1VG1A 4M1WA 4O2LA 3ZS9A 3TSOA 2HXSA 2GA8A 3SQXA 3SBDA 3TQFA 3IBGA 5AR1A 1BOFA 3P27A 3KZ1E 4DT1A 1US8B 2B21A 2WJYA 5C4MA 3SOPA 3I5XA 1QDEA 3P4XA 3SYLA 3HWSA 5BYJA 2CNWA 2OE2A 3VAAA 3CX8A 2F7SA 1G19A 4QL3A 3AVXA 1CXZA 4MUBA 4OK6A 1GRNA 5DLQC 2FSFA 3BJIC 4OQNA 2ZJBA 4IDQA 5EXSA 1N6NA 1HURA 2D06A 4FWIB 2J41A 2K5UA 5EP2A 4O25A 1XMJA 5HCIA 4C30A 1OFHA 3DZDA 2C5LA 3FPAA 1KKMA 4KXFB 3TBKA 2B8WA 3THOA 1W1WA 1CJKC 3VR3A 2C2HA 1EESA 4Q4AB 4TLDA 4YMSA 2V6IA 3DZ8A 4X8MA 3PCRB 3W3ZB 2ZJOA 2XOKA 1E9DA 4PO8A 4V0KA 3W8NA 2IEYA 4TQAA 3WBKA 3PVSA 2REOA 5FOXA 3UMSA 2QGNA 3WNCA 2D62A 1D5CA 3DOEA 4GOJA 5A0FA 1EFHA 5FBLB 3BH0A 2IYYA 4Q7LA 4QNRA 5DISB 1OIWA 1S2MA 1NJGA 2WM9B 2WPDD 2W2VA 2A5FA 5KSPA 1CKEA 3PR1A 6Q21A 4KBGA 3NC1C 1YR9A 4LHZA 3MGCA 3CW2A 1IXSB 1P9RA 1G5PA 4KFRA 3BWDD 5FI0B 5FL7A 2QBYA 2DFNA 3K0CC 3EA0A 5FOSA 1KI3A 3BE4A 2CMKA 1S3GA 4DCUA 1DEKA 5JEEA 4UKDA 1SVKA 2DFTA 3FVQA 1E2NA 2Q3HA 5BN5A 4X8HA 4K46A 2NTYC 1ZAKA 1ZM2A 4B35A 3T06B 4Q21A 4CEHA 3MSXA 4PZYA 3HDTA 3LX8A 5LB2A 3VKGA 4ZI3A 5L8VA 1YR7A 2ZSDA 1KDTA 1NN0A 5JHHB 1F2UB 1AA9A 4BZPA 5LPNA 4TYNA 3EXAA 3UIEA 2QORA 4D0GA 1G16A 4FIDA 3R7WB 5G3YA 4DCSA 3ZVMA 2D2EA 3AEZA 3QG5A 3CZPA 3KL4A 1OB5A 1XEFA 2GBLA 1DO0A 1S4QA 4A6XA 3AVQA 1DAGA 3Q9LA 4LK2A 1UAAA 4B3CA 3SI7A 2H16A 5LD2C 3MWKA 3TIFA 3AH8A 3G0HA 3D8BA 4NZYA 5JZVA 3ETLA 2GEVA 5BN4A 2Q9BA 3U7FB 5FOTA 4RKFA 4QJ4A 2YV5A 1SXJD 2NZJA 3N2EA 5F2EA 2FN4A 4QKQA 5KHOC 3Q85A 3TMKA 3AVTA 3X1ZA 4PAQA 3A1UA 4C9BA 3BFXA 5FOVA 4NU0A 3VQTA 3ZDQA 2B7CA 1NL3A 2WWIA 3AQ4A 4A0GA 1N6PA 1XF9A 4FMCB 2ORWA 1P2VA 2IYXA 3L0IB 3WYFA 4DIEA 5M04A 2JLYA 4LCBA 4C7OB 2BCJQ 4AKEA 2O8CB 4JKIA 1MT0A 4CVNA 4QXAA 3ZVNA 3LBHA 4LDJA 3ADKA 4ERNA 3EPLA 2IC5A 2WV9A 4RD6A 4ZIRA 5F98A 1IN8A 3W6NA 1XPUA 1CU1A 4JKYA 1XEXA 2XTZA 3HU2A 1KSJA 1VHTA 3AKEA 1QF9A 3HYRA 5H70A 1GSIA 4KVAA 1XCMA 1CJVC 1S9DA 2CK3A 4BGDA 1XXHB 2DR3A 1D2EA 3VX4A 5SZJA 3K70D 2QPTA 2WMOB 4B47A 1G7CA 2YWHA 3Q7QA 4CZ2A 1N5LA 2GXSA 2ZITA 1T0JB 1ZIPA 4P0TA 3VFDA 4EFLA 1EFCA 4URVR 5AJZA 4LZZA 3QKTA 1XB2A 3RRYA 1HE8B 2XAUA 4JL8A 4TMZA 3B1VA 1E2QA 3K8YA 2JIZD 4UJ5A 5TXGA 4MDEA 1KTVA 3VNUA 1TX4B 2GJKA 4KFUA 3DHWC 1H8ED 4QBIA 2PX3A 2W00A 3PENA 1VHLA 2A9KA 4P31A 4PXAA 4QGAA 2NPFA 2B7BA 4DSTA 2QENA 4ZO4A 1EFRA 5LD2B 4CRWB 1GVNB 5E4FA 2EYQA 2VSXA 1T91A 3X1YA 4BE7B 3QBTA 1KI1A 1UBCA 2QP3A 3NEYA 4OQLA 1X8LA 4R7ZA 4YDSA 2GJSA 4I99A 4Q4HA 5DIFA 1NJFA 4B3XA 3K0SA 1RYFA 3E5HA 3M4YA 2A5DA 1N6RA 4DLUA 2AR7A 2FPKA 4Q9KA 4XSGA 3OE7D 1WXQA 4Q5IA 3SJAA 2QGZA 2ZYVX 4D80A 4GZMA 1XJCA 1KY3A 1QHIA 2OCYC 5DHFA 2CNWD 1L7VC 2ASEA 3AP1A 3CB4A 3HJNA 2UZ3A 4PC2A 2V9PA 4Q02A 1M6NA 1W36B 3FMFA 4LHYA 4JLAA 4C7OA 2VIIA 5A4JA 4RZ3A 1HH4A 1LF5A 1LW7A 4AKIA 2ONKA 1N3BA 2BKEA 1FMLA 4LY6A 5D3QA 1P62B 1MO5A 2G3YA 3CX7A 4ASUA 4OL0A 4EJSC 3J81k 4KYIB 1DAMA 4F4IA 3C14C 1R0WA 3IEVA 1BS1A 3CPEA 4QM7A 5C1BA 1G3IA 2F9LA 4BFTA 2QP4A 4URWR 2OAP1 2WSSD 1VKJA 4DCTA 1W0JD 2EQBA 1XJ0A 4RY2A 4DHEA 4YQFA 2XZOA 3FKSD 1JR3A 4U5XA 2WIAA 4LJAA 5KDLA 1PUJA 1Z2AA 2XZPA 2BIFA 4GPTA 2WWHA 3RABA 4MKGA 2JASA 4JLBA 2XNDD 1GILA 3ASZA 4WOPA 1F2TB 2R6FA 3QY0A 2QI9C 4HUQB 2QTVB 4Q66C 1R0XA 2AKYA 2XNDA 1XEXB 2FSHA 5EE0A 1KI4A 2NO6A 2IYWA 4ZCLA 3B78A 1SVSA 2J59A 2G0TA 4MA4A 4Q1CA 821PA 4QBFA 1OIXA 4X8LA 2FH5B 3BGWA 1MH1A 1W36D 4TYQA 4PPFA 1W4AA 2FPMA 2IYSA 1NG1A 2QRNA 2EFEB 3UG6A 2GILA 2ZRIA 2O8EB 4Q1AA 5J4KA 1ZU4A 2Y8EA 5FL3A 5KSYA 4TMVA 2X2FA 2ZVQX 1X8KA 1U99A 2CL7X 4DCNA 1ZW6A 1ZUNB 4IHQA 5EXXA 2H17A 1V43A 4JL6A 2VHTA 4XVRA 5DSZA 3AKDA 1Q1EA 1P73A 4CYMA 3RNLA 2RH5A 1T8TA 5JWRA 4OI0A 1G6OA 2WWWA 2EW1A 2IHYA 1G21E 4CEJA 1S0UA 3CR7A 1S96A 1KMHB 3O8BA 3A36A 1Z06A 1G41A 3MCAA 3RRZA 2IX3A 4HLUA 4II7A 2HUPA 4OBEA 3UWKA 1VPLA 2VF7A 2RGEA 2C98A 3LDAA 4US0R 5K8IA 2G0NA 1US8A 1CR1A 1OKKD 1VYVA 1CR4A 2OILA 4EJSA 3DPUA 4JS0A 4Q19A 2RGXA 1KO5A 1OPXA 5FI1B 1TL7C 3R20A 2ZRAA 4DXAA 1ZC3A 1TNDA 1Z28A 4I1OA 2CLDX 3BB4A 4JJZA 2F1RA 4WXRA 3KKNA 3A1VA 2BBWA 3AVVA 3MFYA 3BBPA 2IL1A 3I5YA 3FHTA 2H1LA 1XRJA 3FMIA 2XNSA 3ZVRA 5EZ5A 2R65A 1FTNA 1Z07A 4HAXA 1IN4A 1AGRA 5EXPA 1ANKA 2ZQ5A 2NOAA 3GFTA 2G6BA 2QAGB 4ZCIA 2Z4SA 3IIMA 1XPRA 2JLVA 4DSOA 1X3SA 1N6IA 3QIAA 1W4CA 2ODNA 3B60A 3MWYW 3FHOA 4LJ4A 3T35A 1ZP6A 4QHSA 2ZE5A 3WHKA 1KMHA 3AF0A 4A2PA 5CLQA 1OH8A 1FPMA 2GNOA 1F48A 2ZSAA 5FUYA 3TLXA 4DLTA 4E09A 2F55A 4DDTA 1KKLA 2G9NA 3P20A 2GAOA 2F3RA 1KI9A 2EWVA 4ILEA 2O8FB 2G1JA 3VX3A 2IXFA 1D6JA 2JA1A 1KZ7B 4P4SB 1KO7A 2CCGA 2CBZA 4R98A 3R9IA 1E6CA 1AQUA 4KVGA 3LLUA 1Z47A 2ZM5A 2WWFA 2J87A 3OEHD 1XMIA 2CEAA 2DWPA 1TF5A 5L3QA 1JR6A 4TZ6A 3T1VA 4DLWA 2AFHE 5FPSA 2IUTA 3WRXC 1JJ7A 3KFVA 2FZ4A 4P4SA 1BMFA 4RCYA 2GDJA 4I1VA 4LV5B 4PPGA 2YC2C 1NVUQ 2JLQA 4AKHA 1U0HC 3TQCA 2ODEA 1GKYA 1W4RA 2ZI5A 3IPXA 4HLCA 1E9SA 3CUEF 1IY2A 4IVQA 2QL6A 4G5GA 1Z0KA 2E9SA 3TAHA 5KDDA 4HDCA 1P3JA 4LYFA 4GMXA 2UVQA 4LYAA 5JI3E 5L3QB 3UXMA 2EU8A 2P5SA 3A8TA 5FBWB 3OHMA 4ASUD 5FBVB 1BO6A 3S1AB 3E1SA 4GP6A 2NPIA 1JXMA 2ORIA 1LB1B 2GJ9A 4K8OA 1R10A 2PLRA 1E2JA 1KK3A 4BFZA 2B92A 4Q9LA 1KJZA 3GLGA 3VR2A 4TL9A 3OIUA 1II9A 3U60B 2ZROA 1NBMD 2W0MA 3SHFA 3ICQB 5KSOA 2LKDA 3UATA 4FCTA 2V1UA 4WZAE 1SGWA 5FTNA 3SFVA 2BEKA 1LTQA 1E9EA 3EPHA 2HT1A 3QPWA 2WTUA 5JJIA 3A37A 2GESA 2C95A 2X1VA 3DKPA 2RAPA 3SNHA 2QT0A 3NVAA 2WJJA 2JDID 5EUMA 4MKHA 2G83A 4W5JA 4LYJA 3GLFA 2KB0A 2ZRJA 4HYYA 5H68A 1FL9A 5KOYA 5JWHA 4QM6A 1E2EA 1WB9A 2JATA 3U4QA 1W4BA 2EFCB 4PFSA 4JLDA 1T3SA 2GHIA 3BH6A 4N0DA 4CEJB 5FPKA 2DY1A 5FPTA 3OIVA 1PLJA 2F3TA 3PUVA 1KI8A 2QMOA 3IO3A 1G64A 2R62A 1H65A 1HTWA 4CT4B 3SJZA 1R8QA 1WP9A 2N46A 2RGDA 1TTTA 3TW8B 5C18A 1W7AA 2FOLA 4KLNA 1Z22A 1X1RA 5F3WB 5JRJA 3TKLA 3CWQA 3PIRA 2GBLC 4MGYR 1IXZA 4MYUA 5SZKB 2IS2A 2ZRMA 4OJQA 4XWAA 2GZDA 1NMZA 1VIYA 1Q57A 3CF0A 4FMBB 5KNCA 2CL6X 3TW4A 5GJBA 1E9RA 2ZJYA 3IO5A 1RKBA 4ZPXA 4D4LA 4URYR 5P21A 3KDSE 3SC3A 4JBWA 5JJLA 2GWHA 1VCNA 3U3MA 3AF4A 3W8RA 1XXHA 5FR2A 3WYAA 3TK1A 3DO6A 4M1OA 1OF1A 3RAPR 3B9PA 4QNMA 4DIDA 2OFWA 3ND8A 4LGMA 5BYKA 4JIMA 2WOOA 1MO4A 2NGRA 3LBNA 4CEIA 5IF9A 3B8HA 5DE3A 1H8HD 4TWZA 3SN6A 4D4MA 3SYNA 1XTQA 2HYDA 4DKXA 4JLPA 3REGA 4POAA 3U3KA 5JS8A 2QTHA 2ERYA 1CR0A 3KJHA 3U44B 3RLFA 1U81A 2O52A 1ZVQA 2WHXA 3CLVA 1XEWX 1ZYUA 2QTFA 2QUZA 3BFVA 2JCSA 4UNQA 1I2DA 2J0VA 2HYIC 1M34E 2IBMA 4DUGA 2PZGA 1KSFX 2R6CA 1DARA 3CBQA 3V4RA 5CK5A 3CRW1 2C9CA 5JFGA 2YVUA 3NXSA 5IDVA 4B2PA 1N5JA 5B58C 2MSDB 3FYHA 4XSHA 1QRAA 1JAHA 1TU3A 3IILA 4HZUB 2O8DB 3SZRA 2CHVA 5G40A 4TLAA 1PV4A 3CF2A 4MITA 2J1LA 1ZNXA 3K9HA 1U0JA 1AS2A 3RS2A 4EPRA 2P6NA 2YC4C 3BAFA 1GNQA 3RC8A 3VU9B 1XD9A 1IM2A 1P60A 1GM5A 2OLJA 1HE1C 2FV8A 2GEDA 3D6TB 2WJHA 4B71A 2H18A 4PQFA 3EA5A 1E0JA 1P5ZB 2Q9CA 2Q3FA 3PQCA 1E96A 1OHHA 4ESHA 2OSBA 2VF8A 3KB1A 2RKOA 2ORVA 5IT5A 1EXMA 2CL0X 3C16C 4PAOA 2OHFA 1SXJC 1MO6A 5HZHA 3NC0C 2WWXA 3NTUA 4IOMA 2XEXA 2MMGA 2XX3A 5AUOB 1XTIA 1CS4C 3EZ9A 1HQCA 1Q3TA 1TQ4A 4KV9A 4NYIR 4RJLA 4ZIRB 1VDZA 1NLZA 2ZTSA 4YXWA 1Z6TA 5JECA 1ESMA 3QVVA 1IQPA 2PEYA 1QHHB 2CE7A 3CNNA 4KFSA 1DPFA 3JVUA 2XSZA 1FTSA 4DSUA 2KE5A 5KNBA 4BASA 2BEJA 1G5RA 1TPZA 2VHCA 4WZBE 4B73A 1UBEA 4R9UC 3QEOA 1IOZA 2DWOA 5KSZA 1FOEB 4TQUS 3IEUA 1E1QD 4NCIA 4DLVA 4C0AC 3GP8A 1D9ZA 3GJXC 2RGCA 2D7CA 2VHUA 3EWAA 2OBLA 1YE8A 1KNXA 3C5CA 3C7KA 3ONWA 4G01B 4AG6A 2XZLA 3KUCA 1KO4A 2C03A 3LBIA 4JBYA 3WNDA 4KYUA 5HZKA 4B3BA 1RPZA 2CVHA 4AG5A 1M8PA 4M1MA 5K8LA 1N0WA 1PJRA 3L0PA 5HE9A 2J7KA 3V00A 2FMXA 1X86B 1JBKA 3EZ6A 1KOFA 2GXQA 4NMMA 1MABA 3GD7A 1GITA 1DVRA 4F4CA 1NI3A 4XOIA 3U4QB 2H92A 4H1UA 3NBXX 1KDPA 3C5HA 4MYCA 1YJ5A 4Z8YA 5E95A 3O8RA 3MLEA 3H4MA 2CHGA 3WYGA 4D0LB 1FP7A 2WVJA 4NP6A 1LS1A 3CIOA 3CO5A 3BIFA 3THXA 4OHYA 4LV8B 1OW3B 2ZRGA 3GLHA 4NPHA 4US2R 1AQYA 4Z1MA 2B8TA 1JEDA 3HPQA 1AGPA 1ZD9A 1S1CA 4EFMA 2EWWA 4O3MA 1Q22A 5EQTA 5IRCD 4M8NE 1LVGA 4C4PA 521PA 5HCNA 2O8FA 1Z08A 1COWA 1K5GA 3FFBA 2P3SA 3MRSA 4ON9A 3B1YA 5LDDC 3QKRB 1SQ5A 4JL5A 2AKAB 3ZGXA 2W83A 4OQXA 3Q5EA 2WJGA 3MAAC 1YQTA 1F2UA 4UNPA
chains in the Genus database with same CATH superfamily
4I1YA 3F71A 3LG2A 4WFJA 3NHUA 1B23P 4KYVA 4L4YA 1QGED 3PUWA 3VH2A 3H2BA 2I1QA 2PGLA 3KJIA 4S2EA 2O2YA 3BTVA 4CL0A 1VKNA 2QNRA 2YYSA 3HJRA 2DRIA 4LN1A 2MYTA 3RVQA 3E58A 1H6AA 1Z6XA 5TC4A 3KYCA 4MDFA 1E1LA 4YHBA 3VPGA 4DDHA 1SVIA 2QP9X 3HH8A 3M6AA 5LYJA 5F78A 1PLKA 2BGKA 2VCYA 1MDBA 4JEHA 2JI6A 1AK2A 4RACA 3JQDA 4QU9A 4B6RA 4FD3A 1MKYA 2QX6A 2IGBA 4PLWA 5AM0A 3B1KA 3MUEA 3SZ3A 1TJNA 4POOA 4QOJA 3NRBA 2O8BA 1JIUA 4EKNB 3X43A 3FRJA 3AL2A 3QZUA 4DAOA 1BN6A 3UM9A 1ZIDA 4XA8A 4X1IA 3R0ZA 3VYTB 2ONYA 3DPIA 1TAQA 1FUIA 2C0PA 3R3XA 3D5EA 1A9QA 2QLBA 4GPD1 5CPFA 4DCPA 1CRLA 2JF0A 5EC8A 3PTZA 1FYDA 3UB4A 1ESNA 2AI3A 5DI3B 3GCGA 2IW3A 2LD4A 2QLTA 2QTMA 2AVNA 2X1MA 4ZOAA 3L7LA 3MJHA 2ERCA 3CNOA 3KSRA 3PKJA 3K20A 5TT1A 3W2HA 4YPVA 1A2BA 4C03A 3IPLA 1C7RA 1NF8A 2BFDA 1P61B 2HPVA 5T57A 3T7IA 1X9IA 2QEQA 3WIUA 3QBEA 3K0CA 3UWSA 2EGHA 1SIWA 4F71A 1KZ1A 3ZDZB 1C8BA 1LQUA 4X85A 3TH5A 3QUQA 1YF3A 3CH5A 2GZAA 4J4BA 4RAQA 5DN6A 4HB4A 3MCVA 3ROKA 3WQRA 3L43A 4KRYA 3FHCB 2VYNA 2ODPA 1KDOA 3U80A 3SR3A 1ZN2A 4WA8A 4D79A 1DADA 1JR3D 1KAHA 2ZSIA 3LY5A 3PT5A 4IQFA 4N8EA 1WMEA 1G291 2QMHA 3SXPA 3TL3A 1TO1E 3SKXA 1U8AA 1FYWA 3KZXA 1YQWA 2YQ4A 2PUHA 3P4YA 1ORTA 2MHCA 1Y9AA 1Q17A 2VYCA 4YRMA 1AGYA 4C29A 1HY3A 4HRAA 5JCOA 2HNBA 1NLYA 2VQSA 3OZCA 5I7RA 1LS6A 1PX2A 2NXEA 3V2UA 1PZMA 2IXDA 3CZMA 2IYNA 4A03A 4DLPA 5JD5A 4K6HA 3COWA 4BO8A 4R1OA 4YXFA 1HEIA 2O7VA 3UHAA 4EHKA 3ELUA 3G9UA 4RS4A 5CLFA 1RXUA 2NSLA 4AMZA 1X19A 1AV6A 5MF6A 1ZH2A 3KR1A 2MR5A 3HJBA 4PLFA 3K5PA 4CQMA 3DKKA 1MR3F 4DA0A 4IXMA 4IOKA 4YJGA 2OP0A 5IHPA 2JGDA 1YRBA 3TDNA 4H7IA 2H0QA 1C29B 1JRLA 1N32B 2O8DA 5HFNA 3G7SA 3MILA 1TUIA 3GFOA 5IJ9A 2DYKA 1V0JA 3FUWA 1IHYA 1BD3A 2YXDA 2OO3A 4F5WA 1B0UA 5AESA 5K0TA 3S2UA 2J7PD 1KAGA 4IQ8A 3LQQA 4QIHA 3G85A 4F5ZA 3EZLA 1UADA 1I7NA 1PZFA 1RWOA 2GX6A 5EXDA 5DTRA 3NZEA 4E3WA 4DR7B 1UMCA 2FNAA 3FWPA 3RG2A 4FMDF 4IL5A 2BTQA 1VFPA 3I53A 3RBVA 1SVMA 3G0BA 5A9RA 1AZSC 1P0FA 2B6HA 4I1IA 4AN0A 4D25A 3CNBA 2AMJA 2ESRA 3ZH2A 3W0LB 4NJEB 4ALJA 1G21A 2P9YA 2O0KA 1D07A 1KFCB 3H13A 3LT4A 3N2YA 3QKRA 3QKSB 1E99A 4NBNA 1YR2A 1O58A 3RHFA 4M0FA 1FTYA 2K7FA 1SC9A 3U4IA 5BOSB 1PV2A 4HLDA 5A03A 5GZ3A 1HYQA 5AM5A 1DJNA 2QLJA 2ZEJA 3CF6R 5HJ2A 1W581 2O5RA 5K6AA 3K3PA 5ALOA 4ZYUA 1VRVA 3L8YA 4NCAA 2BUBA 3L8ZA 4F2HA 1KEEB 2ZYUX 4ZZ0A 2I9KA 3Q3HA 3UMFA 4M1TA 1OZGA 3WIDA 4BB9A 3D8RA 2I7VA 1GPBA 2VUSA 3BM5A 5D5HA 2OCKA 4HDKB 3O03A 3A2KA 2UVPA 3AX6A 5ANRB 2JJQA 2XOXA 1VPEA 4TRJA 4DMKA 1YOBA 3JTEA 3SIRA 4KIUA 3M1AA 2IYUA 3RRFA 1E7SA 4RD2A 1HE2A 3VR1A 4EO7A 3T7DA 1VI5A 2JCYA 4AS1A 1WUIS 2CWDA 3UN1A 1SNYA 1CUEA 3WKBA 1REQB 5LNK1 1MAAA 4Q6BA 5D00A 1XQVA 4FZ3A 3T7RA 2IQIA 5K0ZA 2VT6A 1RM4A 1UK7A 2A1IA 4EJ6A 3V8VA 1F8YA 1P6UA 2GBCA 3ANYB 1YA6A 1PQPA 1P19A 2QZJA 2XXBA 3O8LA 5JD6A 3UHPA 3VC7A 4UPDA 3QXGA 4GFDA 4LOLA 3UHFA 2PX0A 3PZRA 1NE2A 4MA5A 3I05A 3RS9A 1YACA 3AI2A 4UVEA 2NIPA 5GADl 3S81A 4UZSA 3IOYA 5D01A 1A4XA 5JD4A 4W8GA 1IXKA 1RRPA 5HRUA 1T29A 5G0SA 3RVMA 4RO0A 3A9VA 5DBGA 3ZHTA 4C08A 3PD1A 2JIBA 4AD8A 5DO9A 4I5DA 2Q21A 2I29A 2Q3JA 4NNJA 4U6NA 5D2CA 3VPHA 2X0RA 4LKOA 3OT1A 4C14A 3AF6A 2V7XA 5KMGA 4B3GA 2RHOA 3EXEA 3LCRA 1Z5NA 4D8UA 2W98A 1EM8A 4GBMA 1UPUA 1M66A 3K5HA 1TCBA 2Q3LA 4UMDA 2AZ4A 3PV0A 2BMFA 1OFIA 3A4IA 1VL6A 2VAVA 4MCAA 3WC4A 4P82A 3WGOA 1CZHA 1FNNA 4F7WA 5FUQA 2XB6A 4O4IA 2ONJA 3F73A 2UXBB 6ABPA 3QU2A 4G0WA 4HADA 4R2IA 2WQZA 3GVIA 3VZPA 1N77A 2Q8NA 4DV6B 3I0MA 1P31A 3WISA 2H7XA 2VUTA 3IQWA 3K96A 3ONVA 4RKEA 2GK7A 1M54A 3JR7A 2I6GA 3PHIA 2CY0A 2G9ZA 1RQLA 3HXLA 2Z09A 1WB6A 3G1TA 3KR9A 5AQ1A 2DUMA 4RENA 4C4TA 1F8GA 4AJ2A 1MC5A 4N3CA 3THYB 2YBEA 3PJRA 3NV7A 1YRLA 2P41A 3EFHA 3P9RA 1U94A 3DULA 3QHPA 1N75A 2V7QA 1ECCA 2WHYA 2Z98A 3KAQA 3L8GA 4WZAB 1LI7A 4EEXA 3TSWA 3OAAD 1NRXA 1DDGA 3T5CA 2GB4A 1XZBA 2Z9BA 5LN1A 3AM1A 1EAYA 2I4IA 4JKOA 3JZMA 3TAXA 3JAWA 1P7CA 3ETJA 5B6PA 3GJTA 4AO6A 4Y7CA 4C0HA 1L3IA 1L4MA 3HYSA 3P26A 4LV6A 4E14A 3IEPA 2AG6A 4CF4A 4RS3A 1W85B 2XGSA 4CIWA 2F48A 3JPYA 1GG5A 2B5VA 3V1YA 4M0EA 2G5TA 3B5JA 1Z6QA 5EWMB 3TDKA 1IM5A 3NRCA 1ISMA 3L02A 4HTFA 4IF4A 3DB1A 3HRIA 1C14A 3PITA 4JDUA 3O8NA 1GN8A 4X7RA 5IM5A 1DIHA 3VV2A 4CV1A 5HKAA 2XMCA 4LXUA 2L17A 3OQ1A 3GEEA 4RFLA 4UCXA 4CCYA 3RVRA 4YCMA 1DC7A 2CHQA 3BB3A 1OXBB 2VTEA 3OFNA 1SQSA 4KXYA 1U8CB 2Z8ZA 1N7JA 3I01A 3KKOA 3B2EA 3QGMA 3VM6A 4YQZA 5JALA 2C61A 2O48X 3C1TA 2PSDA 4H77A 5KVSA 2J0QA 5CJJA 1C3OB 2RGRA 3ISVA 4JP5A 1X39A 4MVYA 4UHBA 4LQ4A 4UW9A 3RBZA 4XJXA 2PX5A 2OECA 2Q4OA 1LRJA 3SZLA 3RJMA 2P79A 4LE1A 3JWIA 3HEBA 1LTKA 2QJWA 3EC7A 5GJWC 5LZ8A 2RH9B 4QOEA 4TV9B 1RLIA 2DOKA 4F1WA 4ARCA 4Y6QA 2YJNA 1VXOA 5H3LA 2IY9A 5KQPA 5C5IA 2QN2A 4F3TA 4RZXA 3M9WA 1XI2A 5BUCA 4K9LA 2J5KA 2A3RA 2Q5EA 1PD0A 2WAAA 3MYYA 1YBMA 3PC6A 4TN5A 5KYYA 1JIXA 3OBIA 3WMFA 3JAMA 3EPRA 2XVZA 4MWSA 4BGIA 2WLTA 1V8ZA 1VL1A 4Y7DA 1WX1A 5I8PA 1NI4A 4ARSA 5ALSA 3D0KA 4N49A 3C4VA 3EEOA 2N47A 4FOSA 4GP7A 2JIQA 3AF1A 3IGFA 5IAKA 3OVMA 1BFDA 2NYRA 4B8ZA 2RGNA 2BFOA 1SKBA 1TA4A 3OJOA 2O3JA 5B3JA 5K05A 3SBEA 1E5QA 5CNIA 3HXTA 3T12A 2EOAA 4KBYA 3ILHA 4N54A 2AA3A 1GPDG 1GTVA 3FH0A 1J06A 4LVCA 5DH9A 2VNSA 3QY9A 4TTVA 4PPQA 2QUKA 2WAXA 3HC7A 5TDHA 4E70A 4JT2A 3T8YA 2FRDA 4CLOA 1JH9A 2V59A 3UJPA 2QBYB 1TADA 4MW9A 3BRSA 2VJOA 3LUDA 3QE2A 3QXCA 4RH1A 1GWNA 2DECA 5DLYA 4TLEA 4FEYA 4Z9AA 3ICPA 5CFOA 4TZTA 3NALA 4YV2A 4LF8B 4OHMA 3AEUA 4HWTA 2HLDA 5KMGB 1MXHA 1PJ4A 3IDAA 1I7DA 3MT7A 3QVOA 1DX6A 2Q1YA 5I9TA 1ONNA 3TUJC 1GAEO 2BHLA 3CV3A 3IERA 4DDWA 4RA9A 5CEJA 2ZDHA 4F72A 3SXJA 1YZKA 3UJ8A 5JNRA 2P67A 4QG7A 3D6MA 4WXEA 2IHUA 1UXIA 1B8VA 1ZDMA 3G1UA 3OX3A 4HN4B 4UM9D 5A1JA 3QNWA 1BG6A 5KB3A 3L04A 5AKYA 3OE5A 2CXNA 5DEOA 4LG1A 1JJBA 4DCVA 2QX8A 3NH6A 4MIKA 1R27A 3PSAA 1BCSB 1IZ8A 1OFUX 4ZI5A 4IGFA 3O38A 1NYRA 3BXHA 1MX9A 3OCUA 2Z3WA 2V7QD 2XWJI 2C0CA 2LXNA 3CISA 4JBGA 4V0NA 4WN9A 1F3LA 4GX1A 2GAFA 1VKZA 3LA8A 3FJOA 4QPNA 5ISMA 1QZXA 2Z1MA 3DMFA 1K2VN 3MLBA 1NATA 1YZ3A 3UH1A 3WLHA 4PYKA 1X13A 2PN1A 2NUPA 2WIKA 3V9PA 5DCWA 2W6JD 3K4PA 5EPEA 1JDSA 5K3DA 5CB4B 4KXQA 3VPAA 4LYEA 3DMTC 4Z0NA 3W6PA 2C2WA 2QDKA 1O6BA 1SB8A 5TGZA 2GFHA 4IXWA 4JA2A 4NBUA 2AFHA 4R2KA 4ZQFA 4OI2A 1DZ3A 4D4GA 4YUAA 1NZDA 4CMHA 3O4FA 2ZSHA 1KWGA 5AJWA 1P2DA 1KR2A 2EZUA 1FZQA 2HGSA 5J2TA 3QFHA 5DMXA 3KTAB 2ZXUA 1SUEA 1U2PA 1CJUC 1ZRSA 1B2LA 2COEA 2A58A 2H2FA 4OBWA 1KVQA 4JD5A 1POWA 1Y5NA 1RI5A 3D3EA 3EEFA 1RJEA 4R1MA 3W4JA 1CRWG 3VU0A 1JNYA 1JZSA 2DPXA 3NBAA 3GLIE 2E5LB 4LJ7A 4UBJA 1THGA 2GBPA 4H0CA 4LQDA 2ZI9A 2C42A 5F2OA 3SC4A 3HGQA 2Q3CA 4RULA 4TYMA 4LX0A 2W4QA 3MTEA 2R0QC 5DWDA 4R9RA 2YNMC 3U44A 5LDHA 4L76A 1HUQA 3UZUA 4ETNA 2ZUEA 4UE6A 3AGPA 1Y3AA 3OEHA 3P9IA 4YP0A 4R6WA 1XK6A 4UAUA 1EGVB 2FWNA 2OM6A 2VDPB 3IP5A 4G0QA 5AI9A 3GPLA 3EZYA 3I1IA 2B78A 5E1DA 1XXHE 4DWOA 2D54A 3WL4A 5JS2A 1ECBA 1I9GA 2JIZA 2QMZA 4L5IA 4RGBA 2XJ4A 2WYOA 1IFXA 4MXDA 3U62A 2Q7XA 3W5VA 2ZREA 1CHDA 4F3NA 5JS7A 3HVKA 5JO9A 4MOWA 4CCSA 1F7VA 1YR6A 3D1VA 4S05A 1Z34A 2ZXEA 3A1CA 4KU4A 3EXG2 1IQRA 4L95C 2GPTA 5C31A 3TJZA 4DMLA 2RMKA 4Q3BA 5KJFA 2IPXA 2ODBA 1VB5A 2H1RA 3B1WA 1GPAA 3CXUA 2O2ZA 3DG9A 1DQRA 1LLCA 1UQUA 2ZPUA 4I5EA 5LXTB 5T64A 3WYEA 3AF3A 4EDFA 1A2QA 4Y2YA 5D1NA 1SCIA 3KHUA 4G63A 3OEEA 4ZVTA 1ZUHA 3V7YA 5FBQB 5E3JA 1CB7A 2PQMA 3K1AB 3I28A 4QDUA 2P2ZA 4QXMA 4BLWA 1WZ2A 3PEFA 2VQ3A 2VPYA 1CP3A 4D74A 5FH9A 2LNDA 1PNOA 1KPIA 2A30A 3ACCA 3DGEC 3ITDA 4OB7A 3L49A 4RMNA 2BEWA 1XNJA 2NNLD 4C5CA 3RFUA 3I58A 4MR9A 1O89A 4L6AA 2OFFA 1CHNA 3C3PA 1AURA 1LGYA 2FPLA 4RABA 4QDKA 5HR5A 1XV5A 2FDXA 2O0JA 4D98A 4IV0A 4GX0A 4DL9A 2GF2A 5ADWA 2X77A 5K8UA 4Q16A 5DJ5A 5LOVF 2VYQA 1S7GA 2NO7A 1OT3A 3VVMA 2XQGA 2QY9A 3G79A 1UP4A 1DAOA 2DGDA 2WSMA 2ZAMA 3AR8A 1BCRA 2L82A 3B7GA 4FZJA 1LNQA 1Y9EA 1A0OA 3CX6A 5TQ0A 2QA5A 3DAGA 2IY7A 2RG1A 1G5TA 1SY7A 2NV0A 3DLTA 3DOFA 4HNSA 3UK6A 2QU8A 2CDNA 2XYHA 1ZCBA 3B13B 2GYYA 4LJYA 3LXRA 4E51A 5A3QA 3WA7A 2J3MA 1ORIA 3CC8A 2ZIFA 3EAFA 4IMIB 2ANCA 3ZHSA 4AX8A 3PGMA 2C8VA 3SSMA 4RM2A 2EJTA 4S24A 1C0IA 4LYHA 3E2MA 4B3HA 1JEJA 2AYZA 5K51A 3DTVB 4RZSA 1G3UA 2IVZA 3GEMA 2B61A 1JHRA 1T5TA 1A8PA 2CUTA 5KQGA 1NULA 2VSOA 2HRDA 3WK6A 4H3HB 4YB8A 1XL0A 2LP4Y 2XCUA 3ZXYA 2ZWIA 3IXQA 3ZE7A 1K3UB 3LXXA 1X42A 1E8MA 4X93A 2D3TA 2ZB8A 1HE4A 4G5FA 4DIKA 1I51A 4I4TA 1E0DA 4K1XA 3VMFA 4NH0A 3ACDA 3SJBA 4DM4A 4OMDA 4TZKA 3JAKB 2PT9A 4XI9A 2AFHB 2QZSA 4NYJQ 1XEWY 4C4AA 4HWGA 1RQXA 4NBSA 4TSKA 1G5IA 2I9PA 4UBNA 4JQOA 4CG3A 2QB5A 2XUIA 4Y2GA 3ECAA 3KJNA 4XM1A 4GRIA 1T0BA 3K94A 4BNXA 4FQ7A 3NM6B 3QPDA 5JIBA 4XQEA 2YYZA 3DEJA 1FJXA 1DAIA 2ECOA 4MVWA 4RVOA 1PJQA 2BGGA 1SCDA 1ZGZA 2PWBA 3BRCA 1O97C 4P5PA 4V0OA 3GD5A 2B2XA 5COAA 3GJ8A 2HKIA 2F9MA 4DC1A 4DILA 1XMSA 2A4KA 1JJIA 2CB9A 1DKMA 3K2EA 4BVGA 4IDHA 1U2DA 3TFWA 1TYDE 1S2GA 4AKSA 3ZQJA 4M53A 5JHGB 1KHHA 4HDKA 1TZMA 3ZCQA 2C9BA 1NYTA 2WJVA 5J40A 4DEYA 3L79A 4NNPA 4ZOLA 1YR1A 3Q8MA 5A3SA 3QF4B 5LQSA 3WGJA 1F7UA 1AM4D 1V2GA 3D6JA 1E6EA 1EIZA 1FMCA 1RWBA 4PSVA 2FSPA 3D3JA 4D56A 2F3PA 4DM7A 1SHTX 2D5LA 2EBFX 3BHMA 4IWYA 1C30A 1GHTA 1BH6A 1S9HA 1ICEA 2W37A 4ZVUA 3TXYA 2HEIA 3QA9A 4DE5A 4JOBA 2R8EA 4ZVQA 4ZGWA 1ZD5A 2I4RA 3S2GA 3COPA 1U3FA 1QBKC 2YV4A 5DX0A 5KNDD 4NCJA 1U2SA 2W90A 4EYGA 4L9WA 3AXSA 4Z4IA 1GL9B 3C7TA 4EZEA 1ADGA 1H23A 1ZXLA 2QR2A 1XC7A 1Z0AA 2W48A 3B6EA 4S3MA 4BMDA 3G3EA 3IODA 3AF2A 2YN4A 3E9EA 3K32A 2IUYA 2NQ2C 2VP6A 1KDZA 2YW9A 1HMPA 1TC2A 1RD4A 3JY6A 4WFIA 1BROA 3QPBA 1B14A 1QYCA 1IZ0A 3ETGA 3R7SA 1EZ1A 1DWUA 2C4KA 2NV2B 1JDNA 1Q1AA 2B4AA 1BMFD 5E6RB 5DK6A 4GE3A 4WOJA 1A8UA 1A72A 5ELMA 3RSGA 3M1YA 3WQQA 4UZEA 1E0AA 2FSIA 1P0CA 1ATIA 4N7JA 5L3VA 3ST7A 4EF6A 2V3WA 1XUOA 2XHEA 3CRRA 2XUFA 3WFZA 4YMLA 2ZXFA 5LMCA 3QI2A 4X3PA 2XCSB 1OUMA 3AEXA 5E2IA 3IBFA 2VWGA 1Z6YA 3T9EA 3NP9A 1O0CA 3GLIB 4IHJB 5HPYB 3EEIA 5E2AA 4ZHSA 2XGGA 1U3GA 4MGIR 3RTDA 4IH4A 1XELA 1YMVA 3M6UA 4JSYA 5CLHA 3VC2A 1IIRA 4W9NC 4F45A 1AKUA 3R8CA 4AP6A 1GAQA 3EUFA 1Z0JA 1XU7A 1RTKA 1RXCA 3HI6A 2H1VA 5FO0A 4JLNA 4XX1A 5LQCA 1QGDA 4QNNA 4C0LA 1Q1BA 3DMPA 3K1YA 3N87A 3LU1A 5JCXA 3NDJA 3KKPA 4JLVA 1VQ1A 2PKCA 5E0KB 2BE7A 2BI7A 4UHEA 2KPOA 3R24A 4LKRA 1JJAA 1A1SA 1PSDA 3OZTA 2JZOA 4JDPA 4EHHA 4ENTA 2YZ2A 3OZUA 3KEQA 2AL7A 2Y9MB 3EJ6A 2XUPA 1MU0A 3RARA 2IOQA 2ATCA 4Z54A 1BGVA 5HXAA 1HFJA 4QRHA 1VLMA 2BFBA 3A6HA 4PCUA 5EEGA 1NMSA 4ZANA 1L2TA 1Q0QA 4HYEA 1NXOA 2NYVA 3OT4A 4AQDA 1B73A 4BMCA 5LSAA 4DRXB 2FN8A 3I52A 5JG7A 3NBQA 3DFIA 1XCOA 3IP7A 4LJ6A 4CCYB 3PXEA 3TIIA 2G8NA 1LH0A 2WKSA 5JJCA 5A5EA 1CIJA 3HR8A 4U2KA 2QDXA 5G2OA 3CLSD 1NJ5A 3IVGA 1KKUA 5B55A 4UFNA 3DKVA 3WJ2A 4MI6A 3TQTA 3FD8A 1YKSA 5K8JB 1X7XA 1X1AA 2WWRA 1CDZA 4IILA 3C43A 4E3ZA 5C1PA 5LQDA 1IWOA 1T3ZA 4C4RA 5ALZA 2I54A 1YI8A 2QSZA 5TV2A 2JIPA 1SURA 3KE9A 4GOXA 3ORFA 4WN9B 5IG2A 1SKMA 4MQ4A 1IYZA 1O95A 3OKPA 2IYVA 4L9AA 4YNBA 4Q4CA 1UXKA 5DXAA 5M2QA 4R4JA 1XCLA 2VJMB 3TLEA 1KS9A 4EQ6A 2VP5A 3ZLUA 3V4FA 4AURA 1VPWA 4MS4A 2BGIA 1KFBB 5DU2A 4D97A 1DE0A 1LZKA 4PRZA 2ZJ8A 4D41A 5LIPA 4HP8A 4MV6A 3N8NA 4BO9A 4LF6B 4JBXA 3P9NA 5FOQA 1FUKA 1I36A 3GDOA 1EVYA 1JIKA 2EZ9A 3HKBA 2NX2A 4TYWA 1YJAA 2YNMA 3FAZA 4ETMA 5IU6A 3E81A 4X7BA 4HNAB 1CY1A 2D74A 3CWCA 2VAWA 1QG0A 2QMUA 1COWD 1M6HA 1UMBA 4TT8A 1Z2CA 1Y33E 4EF4A 3T4XA 5D6NA 1JMYA 4KDFA 4HXYA 3FROA 4I5GA 2WSYB 5EP1A 2WHRA 3PL1A 5H5JA 1EFKA 2P0YA 4ZAGA 5LQNA 2CNDA 4TTRA 4MX8A 2COKA 1G20E 3R09A 4HS9A 4HVTA 4PLHA 4QYIB 4AMYA 3AR6A 1V16A 4IVPA 3TO5A 3FUXA 1DJOA 1ZQ9A 3G2LA 1X9HA 3IBCA 1PGPA 1D0VA 2X5KO 2MSEB 1SG6A 2CKDA 2XUDA 4TRNA 1NSTA 1X6VA 4WPGA 4F3YA 3SQDA 4D45A 5HTKA 4YJFA 1EDDA 1G8YA 5FUVA 3BRWD 1VDMA 5ALRA 4KPUA 3BL5A 4TTSA 3SDZA 3AEUB 1YS9A 2BGNA 1ZINA 2VJKA 3ED5A 4GR9A 4IPTA 4RKYA 4BX8A 1EINA 1PL8A 4V02A 3HUDA 2VZLA 5CDFE 1FB5A 1IEVA 1FP4B 2FZGA 3S3TA 1ZOSA 2EP8A 5K0NA 3W90A 3O31A 4XGIA 4XOUA 4PQEA 1Y1KE 4TXNA 3HPRA 3HJTA 4HH3C 1Y7IA 4UMFA 1EVKA 3U9LA 3C5WP 3V7NA 1NNUA 2ZJ5A 1T8UA 2GJAA 5HVNA 3TTXA 1E1RD 3G9ZA 1FFHA 1PDVA 3EOZA 3OZAA 1PJ2A 1VMAA 1GU7A 2D1QA 2BZ0A 2HXGA 2JA2A 2ZR8A 1QGYA 3C70A 4DLXA 3PSHA 1OAKA 3THXB 2IZ0A 3ZCUA 4P3OA 3OQVA 4Y6LA 3EOAI 3GGJA 2O8EA 4RK7A 4MI3A 1ODFA 1BWPA 5CA1F 3LVBA 3R23A 4PSDA 3T99A 3TNYA 2FW0A 3GFPA 4F93B 4GKJB 4C22A 1N2IA 4C3OB 4TXHA 5BWMA 1SZPA 2FEPA 1V39A 2PWYA 3PG5A 4NFHA 1RVV1 3OEWA 721PA 3A25A 5CFRA 1GQYA 1XWWA 4DDKA 4PQGA 3QWBA 3P2OA 4R16A 5CM9C 1H69A 3WWEA 3CNLA 3AJ8A 2FG6C 2WFMA 1E4VA 5FYDA 1RXIA 1AKNA 1VE9A 4L28A 4CDNA 2BD0A 1VIAA 3WADA 1E2KA 4CKCB 4NJMB 2Z57A 1DUSA 1IN5A 2HT6A 4LQLA 4YREA 2VK4A 3VJMA 3HJFA 3HO1A 4LBWA 3WIEA 2VEDA 2EFDB 1FDWA 3H9JA 4MKZA 4PGFA 4U8GA 2ATXA 2G0AA 2ZI3A 1SUAA 4RXMA 3T7CA 1KYIA 4XFKA 5L4NA 2PH1A 1V8FA 2ZRDA 4A0FA 3L92A 2ETXA 1UEIA 3FLAA 2VDOB 4P53A 5FWXA 5DF1A 1JKFA 1IZYA 2B36A 3MJRA 1U11A 1N5MA 3H75A 1RWKA 1KEKA 2PCLA 2FWBA 1MCZA 2PPLA 5F3RA 4LY0A 1UT8A 3SYKA 4BWGA 1XJ5A 2ONCA 3V2HA 4DJTA 3ULKA 1AD2A 1HX7A 1AHNA 3GROA 3V32A 4DLZA 1JALA 1Q95A 2D5BA 4LXYA 3TTUA 3N70A 4GOLD 5DEIA 3CVVA 1GQRA 5EZSA 4GDFA 1H5NA 1SHJA 4NI5A 4TROA 4GBJA 5EI5A 1GKLA 2WAOA 3DHYA 3L1JA 3OEED 2IDZA 1WNFA 2E3JA 4UD2A 1Y34E 1L8QA 2AOTB 4QXOA 4D9BA 3QHAA 1NMXA 2KX7A 3TZ6A 2A1UA 5E3HA 3HU1A 4GE0A 2ZWAA 2PL5A 1J2EA 3RJTA 5EJAA 4GD3Q 1HA3A 4Q3DA 1G0OA 2E1RA 1ZD8A 3CJRA 4MR7B 4TXJA 4ZAWA 4ZVMA 1YTUA 2PANA 4LISA 1IN6A 2VPQA 4OBXA 3LSTA 4Q7MB 1NMQA 1U7HA 2H48A 3F8WA 2AGVA 1KI7A 5IZCC 4LE0A 2IS6A 2SNIE 3EC1A 3ZBPA 1Z2PX 4PHCA 1X70A 3G2MA 1XLWA 1FLAA 1W48A 2VHXA 3FDXA 4R1QA 4L57A 1AF7A 2AMVA 2EWMA 3VHLB 5KQSA 1WS6A 1PYDA 4N40A 4WASA 2HMSA 2G08A 1Q1ZA 4HR7A 2N1BA 4D1YA 5BW8A 4J49A 3NBZC 4BX9A 4NEQA 1M7BA 1P1HA 1UZAA 3L93A 3K0AA 5A9TA 2OHVA 4RZUA 3GY0A 3N86A 3RNOA 1ZJWA 1ODSA 2PZ8A 2AQIA 2YMLA 2ILTA 3R3YA 4FOTA 4WAUA 5DM1A 4AVYA 3KWFA 2FPIA 2DWCA 3A4VA 1EMDA 2GKOA 1SG9A 3C0KA 2K2WA 1B3RA 1EK1A 4FFBB 4F21A 2VOJA 3FTCA 3U3OA 5K4GA 1M34B 2XVAA 2VAXA 1TGYA 4JEIA 4PYQA 4RL4A 4XYEA 5EP3A 3GJ4A 4ZQCB 4EPVA 3FZYA 1LBEA 3PFCA 3VKVA 4E0BA 2B25A 3PC7A 3L1KA 1U2GC 8OHMA 3OZDA 3SR4A 3AR2A 3OJWA 1UKZA 3BXGA 4GLJA 2VJPA 4PWZA 4WKGA 3LL7A 4OLAA 2AK3A 4M60A 3O8QB 4HGQA 2K2QB 4Q9HA 2XMSA 3QWFA 2DFPA 1QZZA 3COZA 3SKYA 2C92A 1LLFA 3RYFB 3ZV4A 3QJGA 4CDGA 1SJ9A 3GX1A 2NO5A 2GF9A 1QFYA 2F6RA 2VUHB 3G2JA 3ZD9A 2VH2A 2QIPA 3TFQA 2H3EA 1C7ZA 4RTLA 1RKUA 5K6RA 4RA6B 3HADA 3Q8WA 5JAQA 5JJKA 4EJSB 1CR2A 4KH0A 1VB3A 1ZNZA 2JFZA 5F21A 5EE1A 4BX2A 4DHWA 4HH0A 1IOWA 2FU5C 2Q27A 3ZW8A 1JKJA 3EGCA 4UTZA 4C4OA 1TIPA 3LYLA 4Q01A 3B1ZA 4OBBA 1Y4AE 4X66B 4TSFD 5KEIA 3D54D 2ADFA 2PIDA 4MRNA 1QCZA 1QJ4A 1WG8A 3ZJTA 1OWLA 2YCLA 1RJWA 3VVLA 1TMKA 1SXJB 4YJHB 4PSKA 3KKZA 2IHBA 1T0IA 1E0SA 2WIGA 4OQDA 4BO0A 4OXNA 1F2VA 3HBJA 4PC3A 3Q9NA 2Y6VA 4MNTA 3VKFA 3GL9A 1KP9A 3HG7A 4MQFA 5KYXA 1RRGA 1X15A 3A6FA 4L15A 2X3YA 5K8VA 2KQUA 2VVTA 3KJGA 3PT9A 2ZKIA 1I0IA 1EFDN 1N8TA 4UNSA 1MD9A 4V0QA 4YRSA 4NBWA 4B4VA 4IUBS 5C80A 3BD8A 2TSYB 1Y9ZA 3UC9A 1T3HA 3K35A 2C9OA 5ED0A 3UMGA 1CUSA 3SU8A 2V3CC 3E5RA 4GRAA 2D0OB 1JHDA 1QZ3A 4WXYB 5DHAA 5I9BA 3RYTC 2GK6A 3T52A 1UF9A 2CMHA 3QM1A 3RVPA 1WBBA 5E6UB 5J58A 3T95A 1GJRA 3T5MA 4UE3S 1EGMB 2X9QA 4EW1A 2O0HA 2ZOSA 3N0XA 2I3BA 2CL5A 3AK4A 4OI1A 1Z29A 4JUBA 2YZMA 4ZAYA 1WMBA 1VC2A 2AE2A 4UEKA 5C4IA 2QX7A 2I2AA 1KPHA 3LD9A 3THWA 2V98A 4BNFA 4EF5A 2JGDB 4KXVA 3QLUA 1G4UR 5KREA 3RW9A 3LFUA 1FLVA 3P1JA 4Q7JB 1XRQA 1JPNA 4IDDA 4L75A 2ZBGA 4EA6A 2HGZA 3RH0A 1CUWA 2R96A 3VC1A 4WUVA 2P4HX 1W2HA 2MIIA 2PL9A 3F96A 4D3XA 1EK0A 2I1VB 1D2MA 1C81A 2GK4A 3ORSA 1RE1A 3VDRA 4WIAA 1VHWA 4Z7OB 1EWRA 1JLKA 4QGGA 2A1UB 1RKVA 2B94A 3SLGA 1PG2A 2OV8A 3LRPA 3O0TA 2I22A 1YV9A 1SA0A 3ZCVA 2CDAA 1JAIA 2GCOB 5C7IO 2UUBB 4HX2A 4MYHA 1Y8QA 1JDBC 1G55A 2YWRA 2VRWA 4NDZA 4WCDA 2V03A 1TK9A 2XTAA 4CQLA 1R18A 1X7XB 2HV9A 2NG1A 3V55A 1KDRA 1XD2A 1LLDA 4PHHA 1P77A 2UUOA 2C8KA 2AV6A 4P5EA 4QUKA 3RB8A 7AT1A 4H08A 2G82A 4YRCA 3L1VA 4C6TB 1JE0A 4WK6A 1L3BA 2J5QA 5HKKA 1H8HA 2QROA 3VR5D 1H2RS 1X7WA 1QVVA 3PNYA 4JX9A 1NSFA 5F2KA 4BJ5A 5JNTA 5KOIA 5KU1A 4XGQA 4IXTA 1N2ZA 4PGGA 4NG4A 3SXUA 1ONPA 4ZQGA 1SUPA 1RXYA 2E85A 1UKVY 3GUYA 3QK7A 3DE7X 1Z37A 2FUKA 3OTWA 4MWTA 4C1BA 3TR0A 2OAQ1 4MAFA 1IEWA 3TQQA 1DGQA 4V24A 1LWNA 1ZSVA 1Y9JA 2GETA 3SIPA 5CDHA 3BMNB 3U5TA 3LAWA 4RKWA 2AKEA 3PXXA 3K70B 4FYVA 2WB2A 3K15A 1F8FA 2ISCA 3M2TA 3V48A 1XTRA 3MTQA 1WMSA 3T0FA 2Q3DA 4IDOA 1UJCA 3V1KA 2IUFA 3FLBA 2AD5A 2ZDGA 5KNCD 4FCWA 2WSSA 4G2NA 3FMOB 3JVVA 4DMUB 1Q0LA 4HB2A 5FV7A 3RSZA 2C7PA 3DEKA 4HAUA 4HH4A 4ENPA 3HYTA 1TTPB 1GUFA 3L05A 4L9SA 3GUZA 1OSNA 4N7RA 5EHGA 2PBLA 2YKGA 3KXPA 5C4GB 1UINA 1ORRA 2WE8A 3QXSA 2XUOA 1URPA 3JYLA 3RUFA 2ZYRA 4K3UA 3OKAA 2JLZA 1KNQA 2J3IA 2QQ0A 4EBBA 2BHTA 4MUJA 1Y3HA 3ZH9B 5EG5A 2KBEA 3ICEA 3P0FA 2MTBA 4HFMA 4ZOCA 5G0TA 2AD1A 5FEUA 2JH9A 3KJZA 3FR8A 2P2LA 3M8KA 1SC6A 3FY4A 3RRNA 4FS8A 1I1OA 4EELA 3KTDA 3O92A 2JLBA 4JC5A 3ANXA 2GHRA 1LV7A 2YWGA 3OQIA 4AY4A 5JAOA 3KTOA 2W42A 5TMPA 4B6PA 5G1OA 3VNRA 1V3VA 3P9PA 5AKHA 3DOHA 4BECA 1VJRA 1JDBB 4Y6SA 1JFLA 2EBWA 4YYZA 2JDIA 1XZQA 2FG5A 2FPPB 4RMGA 2H51A 3PC4A 4ZAZA 5I9SA 1XZHA 2PQ0A 4RSGA 3K71B 1O4VA 1VFNA 2BYTA 4XWGA 4GOMD 3K9LA 4IV8A 1Y5LA 4FEEA 3U19A 2UZ4A 4BNNA 3FNHA 2DHDA 5DSTA 3D4NA 2RC5A 2CV2A 2A9JA 2FP4B 2XUAA 1L4HA 3EWSA 2D8AA 3C5EA 5EKDA 2RHMA 5ULLA 2G1AA 1SZDA 4WXMA 1A71A 1A7UA 3DAHA 1PJZA 4BFSA 3N07A 4DMCA 4LTDA 2WTAA 3PD0A 3RS0A 3ZVLA 5ALEA 4JI4B 2DPGA 2JI8A 1QONA 4YRKA 5IJ9B 4JYPA 1HQKA 4EQ6B 3OX2A 5JWOA 2RAFA 1SBYA 3SQMA 5B1IA 3MS4A 3KKEA 4A23A 2CGEA 3L8EA 4AN1A 2ODQA 5KX5F 3FVTA 2MSCB 3IR5A 1WZCA 3AHEA 3I9LA 3N0VA 1YI1A 3WG9A 1S2OA 5HQTA 4MPJA 1NN3A 3C3EA 4BJ1A 4U02A 2VP3A 1GG2A 1L8LA 3R7FA 1QHNA 1X1CA 5JASA 4KDEA 1B6GA 4LZOA 2I80A 2O8CB 1XG5A 3IJEB 3MJVA 1RPJA 1C9EA 1E98A 1X7ZB 2HF2A 4I6GA 3TLGA 3WLPA 5JLJA 2NW6A 4H27A 5F7OA 1A5TA 1K3TA 2LE0A 4IDGA 4DLYA 4DJDC 2YIDA 3REOA 2NMVA 4DSAA 2AF4C 3DBLA 3B6ZA 2A9VA 1Q14A 2H1HA 1JQJC 3JWJA