1UFQA

Crystal structure of ligand-free human uridine-cytidine kinase 2
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
212
structure length
212
Chain Sequence
EPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the specificity, catalysis, and regulation of human uridine-cytidine kinase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Uridine-cytidine kinase 2
total genus 68
structure length 212
sequence length 212
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.48: Uridine kinase.
pdb deposition date 2003-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00485 PRK Phosphoribulokinase / Uridine kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ufqA00
2DHRA 5FUVA 4GDFA 4KAXA 2FZLA 2GXAA 2ZS8A 1HY3A 5KYKA 2HYIC 2QRZA 4M22A 3IBYA 4LHXA 1E0JA 1PJRA 4L9SA 4NONA 2YKGA 2QL6A 4Q48A 4LI0A 3KTAA 5H1YA 3KUCA 4NKRA 4HDOB 1M7GA 1TUIA 1MO3A 3EG5A 521PA 3VR4A 2GAAA 1M8PA 1XEXA 5L3QB 1ZC4A 1U8YA 1FW6A 1UM8A 2OM2A 3F0TA 1IN4A 4KLZA 1X8KA 1W4RA 1F3OA 4MDFA 4I4LA 2B7CA 3SYKA 3W5IA 4BASA 2GCOA 2NO7A 1E2KA 1MT0A 2HT6A 1AS2A 1RC8A 2GCNA 2V7QA 2BKUA 4HB3A 2AX4A 2HXSA 1OB5A 2JGNA 4QM6A 1G7SA 3T1VA 2C99A 2WHXA 1G5TA 4DB4A 3THYB 3T35A 2EQBA 2FMXA 3SOPA 2IK8A 4A36A 1D6JA 1DAMA 3D7MA 5FUYA 3VAAA 4DLUA 1E2EA 3QBTA 3P4XA 3IIMA 3DL0A 2BDTA 3K9NA 1ZRHA 1WXQA 2ONJA 4Y0AA 2V9PA 2NZ8A 4PPFA 1KDPA 1N6PA 1R8SA 1SXJC 2AXNA 4V0LA 1N6HA 2VIIA 4JLPA 2Y8EA 3KL4A 4OQMA 4UXIA 1XEFA 4URUR 1G3IA 3RS0A 3OESA 4DXAA 5JLJA 1IJFA 5FPSA 1RRCA 3CB4A 3RS7A 2I3BA 2JLWA 4V0OA 2CMKA 3B5JA 4HZUA 2L0XA 1IONA 2ZSFA 4ZDJA 4XSGA 3KFXA 2XGJA 3B1ZA 2OFXA 4JBXA 4CGZA 2FA9A 4JLKA 1SVSA 5IK2A 1G1MA 5D3MA 5J5CA 4A6PA 3EIEA 2REOA 4E07A 1NVWQ 1N0WA 1TQ4A 2XNSA 5BYKA 1M7BA 4G0NA 3RYTC 2QP9X 4UXJA 4OI0A 3AF0A 3CWQA 3X1YA 1XNJA 2BIFA 3U3RA 1OE0A 4FMCB 1CJVC 1XMSA 4L15A 1HTWA 4Q66C 5DN6A 5EXPA 1XPRA 1JJ7A 1BS1A 1M34E 2IS4A 2D3WA 3Q3JB 1UKVY 2H57A 2H7VA 1QF9A 3GLFE 2MSDB 4NU0A 5AR1A 3UANA 5J4LA 1X8JA 2B8TA 5BXQC 2QTVB 2RKOA 3PR1A 5EE9A 1Z5ZA 3GJ4A 4JLBA 4KFUA 2F9MA 5G3YA 1T0JB 3GLGB 5KSYA 4NPHA 2BJWA 1OJLA 1RKBA 3W3AA 4MRVA 4V02A 2PZFA 3U6BA 2ZUDA 3GLIA 4JYCA 1T8TA 4HSEA 4WW0A 2R6GA 3B2EA 3PVSA 2GXSA 2ZJOA 3O8DA 4JVLA 4QJ3A 1JR3E 5BQ5A 1UF9A 4ZIRA 1SZPA 2ZRIA 4LWZA 5EE0A 5HZKA 3QKTA 5IF9A 2FF7A 3E70C 1T6NA 1VCMA 1UEIA 3AB3A 4KBGA 4TQUS 4KITB 1JNYA 1KI6A 4PO1A 1IHUA 3FMFA 4IOJA 2ZSDA 1EXMA 3WNCA 5EUMA 1DTSA 3H1TA 1P72A 3WYGA 2XSZA 4RKEA 4Q9IA 3ZZUA 2Q9AA 4LCBA 1MO4A 1EFRA 2FN4A 4NYIR 5E7IA 2WWYA 4BLSA 2D7CA 3Q72A 4GZLA 2VSFA 4LGMA 3I4LA 4IEIA 2R65A 1XX6A 3PIRA 4XVRA 3I32A 2X2FA 3BFKA 1GNRA 5EP2A 3QE0A 1Z3IX 2PT5A 4IOLA 1S4QA 1N6RA 3ASZA 4D4LA 3CZPA 1D2EA 1DAIA 4F91B 4LZZA 2FZ4A 2BM1A 3A1WA 3G5UA 4NCKA 4IFEA 4FXPA 1FX0B 1KAGA 2OCPA 2IYVA 2WWIA 4CYMA 4B3CA 2C96A 4TZ6A 3MAAC 4MUAA 1ZUIA 1J90A 2ZJ2A 1JQLB 821PA 5HKKA 3CRQA 3LFUA 4UQOA 3KJGA 4AG6A 4PZLA 4A1FA 3X1DA 1YR7A 3O8CA 1OXSC 1P61B 2OILA 2PL3A 2EVWX 2R2AA 2VP4A 2VSXA 3AGQA 4A8JB 2ZRKA 3FGNA 2DFKB 1W36D 4TLAA 4TLEA 3ECCA 2WMNB 2ZRMA 3L8ZA 4QG7A 1E1QD 2G0TA 5JMTA 5FFMA 2P2LA 2JLSA 1FOEB 3TGPA 3WRXC 4OBEA 1RRPA 2J7PA 5KSPA 3ZJYA 1G20E 3SHWA 2IUTA 2XZOA 4QGGA 2IBMA 4MUBA 4YMUA 1XMJA 4PXAA 3ZDQA 1G7RA 4XWAA 2OE2A 3NKVA 1LS6A 4HLQB 2CJWB 4RD2A 3JZAA 1GRQA 1Z0DA 5FPKA 2R9VA 1KI6B 4LBVA 5FOXA 4RD1A 2FSIA 4C0QC 4MGZR 3DVLA 2GK7A 5KDDA 1HE1C 1G3MA 3FYHA 3Q8XB 4CZ2A 3HU3A 1NL3A 2VHTA 4P33A 3QJYA 3GLIB 2YVUA 5LD2B 3SNHA 3F8TA 2OV2A 3HWSA 1US8A 3SBEA 1JAIA 5D3MB 4AWXA 1QRAA 3L0OA 2ZE5A 2UVQA 4F7WA 4NCJA 4LRWA 2WAYA 1FUKA 2H92A 1Z0IA 4XVUA 2QBYA 1NP6A 2XX3A 1GUAA 2ZQ5A 3LX5A 1E2IA 2AFIE 1MO6A 3GJ5A 2QT0A 3QXJA 1J99A 5CM9C 1KK3A 4P4SB 3VHLB 3I8XA 3MLEA 4KFTA 2O8BA 3JVVA 1E9DA 1KO4A 1TUEA 3WBJA 2C9CA 2I4IA 5LB2A 4X8OA 1XTRA 2BWJA 4YLGA 5F3WB 2O8FB 4M53A 1C1YA 1QHYA 3IO5A 1DBSA 3QY0A 4N0DA 121PA 2AD5A 4TTPA 2R8RA 2NO0A 5FTJA 4RZUA 5HR5A 2CVFA 3UPUA 1HYQA 3BOSA 3TW4A 3QSYA 4CVNA 4HLUC 1XTKA 1OF1A 1KSFX 2QM7A 2W58A 1SHKA 2YC4C 2VHJA 4NBSA 3WP1B 1OIWA 1ZMXA 3QKRA 2V6IA 2N1BA 2R62A 3GCGA 4OK3A 4B3DA 2PLFA 1RRGA 5CIQA 5FOWA 5AJYA 5FR2A 2W0SA 5FBLB 2YWFA 1W0JA 1MABA 1JB1A 2W6ID 1EX6A 4DDTA 3Q7QA 3H4MA 2J41A 5IHPA 1F2UB 3R7WA 2HJGA 3IBGA 1E2NA 4KV9A 1TMKA 1N5KA 1U94A 3Q85A 1N5IA 4MYTA 2WV9A 4G5GA 1W4CA 3SHFA 3CX8A 4DC9A 4B47A 1G8GA 3ADKA 4TLCA 4QNRA 4EJSB 4OI4A 2K5UA 1FPMA 4WAUA 2C03A 5C2JB 5LPNA 3C16C 4N0EA 5AUOB 1QHGA 2X2EA 4IKEA 4YMWA 5JJIA 3VNUA 3TR5A 2D4HA 2OZEA 2WTUA 3WMGA 1I4TD 2H18A 2YJTD 2Z4SA 1Z6GA 3BB3A 3GQBA 5K8UA 4XJXA 3FHCB 3BWDD 1ETUA 1NKTA 1HE8B 3K9HA 5FBWB 3T1OA 1C9KA 3WNBA 3K9GA 4F4IA 4D4JA 3IDQA 1ZIOA 2EFCB 1II8A 1OPXA 1XD8A 2HJVA 2AKAB 3LDAA 4GI7A 4LY6A 4NL4H 1AK2A 1I4LD 4UKDA 4BFYA 2A5DA 1YE8A 1L8QA 3NVAA 2FGJA 1U9IA 3L2OB 3GEEA 3FKQA 3LWNA 4JLMA 2MSEB 3N5CA 3KXKA 4YMSA 3BS4A 4JLOA 4Q1BA 4LPKA 3A1UA 1QG4A 1W2HA 3MWYW 4TTQA 3SJBA 3TNFA 5FTKA 3I5XA 4P3YA 5IDVA 1KDOA 3W6NA 1ODFA 3P26A 2WJJA 1Z6XA 2RH5A 1E99A 1R7RA 1TEXA 2HCBA 2XNDD 2FPMA 4KBFA 4AKIA 3B1VA 3SFVA 2GA8A 2IXGA 2GJKA 1P75A 2J0UA 1YRBA 2WZQA 4N1AA 3QVVA 1OSNA 3HYTA 5KPDA 3DMDA 4M1KA 3FVQA 1NNEA 2KWIA 2ZJBA 1Q21A 5TV2A 3P1JA 1F6BA 4ASUA 4OQLA 1Q57A 4CW7A 4GZMA 3LBHA 1Z28A 3ND8A 2VF8A 3AF1A 3U7HB 4BLQA 3OZXA 2FGKA 3NC1C 1GG2A 2RGNC 1GITA 4LOAA 2GF9A 1NG1A 1P5ZB 1ZW6A 2VP9A 4HB4A 3CPJB 1DEKA 2QAGB 4UNQA 4RD0A 2IYYA 3EC2A 2IS2A 2BC9A 4URVR 1E9FA 4TLDA 4DKXA 5KDOA 1TX4B 1MV5A 1WB9A 4URYR 4M1TA 1GNQA 1LV7A 4JT2A 4WZAE 4PSVA 4FMBB 1BYUA 4QNMA 4ZCIA 2J0QA 3NWJA 1Z6AA 1X1SA 4IOMA 3QXSA 2D2FA 1D5CA 1E1QA 2OSBA 3WY9A 3GJ8A 2J59A 1NN3A 4HAWA 2W2XA 2NMVA 3NIBA 4TMTA 2X8AA 4PTLA 1VCIA 3LQRA 4HLUA 4L9WA 3SC3A 4U5XA 1E69A 1SXJA 2YOFA 3FKSD 1CRQA 2Q9BA 3TUJC 1S96A 3V4RA 3FE2A 2CK3A 2QN6A 3Q5EA 3CNLA 1KK1A 5CITA 5B64A 5LDDC 1MO5A 3VR2A 1K5GA 1GKUB 2OBLA 2ZYUX 4POAA 4TWZA 2ZI9A 5AWFC 2ZU0C 1VYVA 1Z2AA 2QNRA 1ZUNB 2QGZA 4JS0A 4M9SA 1T91A 3KZ1E 4WBSA 1LF0A 4LJAA 5DHAA 3QPWA 1AQYA 4NCHA 2R6AA 3A37A 3PENA 4DLZA 2KB0A 3QENA 3EIQA 4M9QA 2QU8A 4L8GA 4QGAA 4A2PA 4MYUA 5AJVB 2V1UA 1P6XA 3ICQB 3C5CA 1KI9A 1Z07A 4CEJA 2WKQA 3PQCA 2BCJQ 1CULC 5FTMA 4AKGA 5FBVB 3JZMA 4Z1MD 1R2QA 1XJ0A 4TMVA 3U7GA 3IQXA 1E9CA 4BLTA 4ZCMA 1PV4A 1G3UA 1DAFA 4GSYA 1E94E 4CRWB 3R9XA 5BN3A 3B1WA 2GEDA 2HLDA 2VF7A 1XMVA 1YZKA 4DLRA 1RIFA 5FTLA 4B44A 1JEEA 4P31A 4NYJR 5EZ5A 1NIJA 1NSFA 3AGPA 3IEVA 1KJZA 2QP4A 4HB0A 1P7CA 2CEAA 2QSYA 2Z6VA 1AZTA 4I1VA 2ODWA 4EJSA 1JPJA 4W9MC 4BFUA 1Y3AA 3FKSA 4I81A 2CL0X 2VHCA 4DLTA 3ZD7A 1AGPA 1OHHA 3AV0B 3E5HA 3GP8A 1WP9A 4LJ4A 1N0VC 2R6CA 1GSIA 1QHXA 4KI0A 2J3EA 3QF4B 2ZRPA 2C98A 5JI2E 2VH5R 4PQRA 2ZSAA 3OE7A 2PH1A 4NDZA 2BVNA 4JKIA 3AM1A 2QBYB 4M1WA 1UEJA 4BQSA 2B8WA 3X1XA 1XB2A 1NY5A 1QVAA 1J8YF 4IDOA 1GILA 4D82A 2OCBA 2DWPA 2W2VA 3K0FA 1FFHA 3UWOA 3DKPA 5JECA 5EQTA 4IVQA 3LLUA 3QG5A 1JPNA 4FMDF 3A1VA 5JCZA 4U7DA 1CR0A 1Z29A 4W5HA 4L16A 1JQJC 1R4AA 2JJ1D 4C2TA 2O8CB 3U3JA 4JJZA 1ZNWA 2Z83A 5CB6A 4XH9B 2CDNA 2JLRA 3CR7A 4A0HA 1NVXQ 1L4YA 4PX9A 1IN5A 4G5RA 4BFSA 1J8MF 1VG8A 2F3RA 1ZP6A 2IC5A 4TQ9A 1EFUA 2EU8A 3EZFA 5GVRA 3VTKA 4D6PA 3KKOA 1D2MA 4OI1A 5TDHA 5HTKA 5DH9A 5C1BA 3VKWA 5F9FA 4Q21A 1JXMA 1IOZA 4NYMQ 2ZVPX 1IXRC 1KMQA 1KZGB 3C8UA 1T5IA 2JASA 3LW8A 4YMTA 1NVVQ 4WOPA 4A6XA 2WJIA 1YR6A 4JSTA 4A2QA 2WAXA 3WMFA 5E7MA 1GP2A 2ZETA 1S3GA 1ZC3A 3OIWA 3BC1A 3FPAA 3QEJA 4TT3A 4D2IA 4GOKA 3KXIA 1KI8A 1XWIA 4LHWA 2A3RA 4E22A 4F4JA 5C4MA 4BFXA 4CF7A 4QJ5A 3LBIA 4AG5A 2AXPA 4LJ7A 4MRRA 2EFGA 4JLAA 3DDCA 1G5PA 1II8B 5JHGB 2O8EB 5AJWA 1XXHE 4RY2A 3AVYA 3THWB 2GDJA 2WJYA 4BEJA 5DE3A 3O8RA 4MDEA 5CK5A 3K0CC 1SXJB 4P4SA 2ZI7A 1N6IA 1N6OA 5BW8A 4US1R 1G4AE 1P62B 1Z08A 3AF3A 1U0HC 2B21A 3OE7D 4FCWA 4GNKA 4JSYA 2RGCA 2VPPA 3GLGA 1Y63A 2IF0A 1M2OB 4Q1DA 1D9XA 1KOFA 2MMGA 3RSOA 2JLUA 3G0HA 1WDTA 421PA 3T1TA 1TEVA 4FWTA 5LD2C 2NO9A 2PMKA 1DO0A 4JVSB 2RGDA 3AUYA 4JBYA 2GK6A 3U61B 2J0VA 1QG2A 3IILA 1NN0A 2F43A 2NGRA 2QE7D 4DIDA 3TMKA 2ZROA 5FI1B 4TT3D 3KB1A 3T15A 3WNDA 5KTYA 4PPNA 1E98A 3A1SA 2GEVA 3N70A 2WJGA 3RWOA 1MH1A 4HDCA 1G8PA 3MSXA 4KJZA 3ZIAD 1AN0A 2VP2A 1JBKA 3X1WA 1P73A 2AFHE 4Q4AB 5G41A 3ZH9B 2D7DA 2GJAA 1S1CA 2O8FA 5CB8A 1T8UA 4KFSA 3B82A 1NLZA 4UNNA 3NBYC 2HYDA 2E87A 2IWRA 3U7EB 1S9HA 1WQ1R 2GTPA 4GOJA 5CYPA 2ZE7A 2BBWA 4M2LA 5KSZA 1AS3A 3I73A 4C0JA 1OW3B 5KHOC 4ZI3A 3GEIA 1VIYA 4Q7MB 4JVMA 4LJYA 3TSZA 2QMHA 5DIFA 3A36A 4EQ6B 4IHQA 3IGFA 4KSBA 4XSHA 4URWR 2ZAOA 3NH9A 2YNMA 2BOVA 1ZM2A 3TUZC 4NTZA 2OEPA 1NBMA 1E0KA 2O8CA 1W36C 4Q7JB 4TL6A 4TYWA 1NRJB 1SVWA 5AK0A 3VKHA 2PZEA 2IUUA 1NJGA 1WRBA 2YWHA 1XCPA 5E4FA 5HCNA 4IDHA 1TADA 2ZU6A 1W5TA 1WBDA 1E79A 3TR0A 1TF2A 2QENA 4DIEA 2FFBA 1DG3A 1DAGA 1I2MA 1SHZA 2KE5A 4HZUB 5EUQB 2ZJ5A 2A5YB 3LO5A 3RC3A 1T3LA 5FR1A 2GBLA 2ZRAA 1KMHA 3BD9A 2ZR0A 1RW4A 3KUDA 4GFDA 3E1SA 5TY0A 1SVMA 1BH2A 2EFDB 2O0KA 1XTSA 4ABYA 1F2UA 4V0NA 4OHXA 3R7WB 4DCSA 1NG9A 1J2JA 2F55A 4MKHA 3N2IA 5FUXA 1QHNA 3G82C 2GZAA 2EWVA 1DO2A 3K70B 2AN9A 1KKLA 2DWQA 4OI2A 5J4YA 1J7KA 3CNOA 2J5XA 3L0SA 1NY6A 3VFDA 4BWYA 3U4QB 3PEUA 1DE0A 1G6HA 4A0RA 3KQLA 2OXCA 4LUCA 2R44A 4ZDWA 4OHYA 2Q3FA 4W5JA 3K0AB 2KI5A 3QPUA 4JYBA 4KXFB 1G64A 4A8JC 4F93B 5KDLA 3RS3A 5L8VA 1G17A 2JIZD 1WBBA 1AS0A 4PC2A 2RCNA 4DB2A 4MQBA 1W36B 3RAPR 3U3MA 2UZ3A 1R0YA 2JEOA 1T3SA 4GL2A 1T3HA 3CF0A 2F43B 5EJEA 1E6CA 3CRW1 4JL6A 1MRSA 4AD8A 1EFRD 4Q1CA 1GL7A 4XIGS 2YHSA 2YYZA 3NBFA 3NXSA 2AWNA 3A58B 4OJQA 2WWHA 4TMKA 4BFWA 2IYTA 3TUIC 3BH0A 4FD2A 2OLKA 2G3YA 4JVNA 4BZXA 1SKQA 2NG1A 2RGAA 4AIIA 3R9IA 4V0KA 1K8RA 3RWMB 2PEYA 1ZM9A 2IYLD 5JFGA 3WXMA 1TQDA 5SZIA 2FNAA 4F92B 2JLZA 3OAAD 721PA 3HU2A 5J40A 1Q20A 1KIMA 3RHFA 5B58C 3GLFB 3MG9A 3K0AA 4ZKEA 4Z54A 1PZNA 3C41J 1G8YA 1YZNA 2XTMA 2BMEA 2NOAA 2OLJA 3PUWA 4HATA 4JLVA 4OK6A 2JIZA 1GVNB 2OCYC 3IHWA 4ERNA 3EZ6A 3B6EA 1E0AA 4XWOA 1B23P 3C14C 3CONA 4P0TA 1GTVA 4TMXA 1U8ZA 5FOSA 4BGDA 2QPOA 4O25A 2IS6A 4ON9A 3JVUA 4HAVA 1I4DD 1NN1A 3DKVA 2BMJA 1EFHA 1ZJ6A 4MA4A 1U2RA 1XMIA 3UIEA 2HXYA 2A5FA 1KHTA 3ZZ0A 4DVGA 4NCIA 1W44A 2FFQA 5F98A 2GWHA 2OFOA 2BMDA 4QBGB 3HPRA 2HF9A 3EXAA 5F2EA 1E2PA 2I1QA 1P2TA 4OQNA 3HP1A 3RS2A 1OH8A 2VP6A 3B7GA 1PVOA 3AVXA 2IHBA 3ZVNA 1S3SA 1G3RA 5E7JA 1VECA 1DG1G 3HR7A 3B1XA 2VEDA 3KQNA 5JEEA 2PJRA 4BECA 2QORA 1FX0A 2I1VB 2FPLA 4EPRA 2C78A 5E3HA 1XBTA 2D62A 3CNNA 4V0ME 5A4JA 3UATA 4DSUA 2IW3A 2A5JA 3B9PA 3TJZA 2HF8A 3K0FB 5FPHA 4BZQA 1RJ9B 2XTZA 4I99A 1G7CA 3EIHA 1IXSB 4HLDA 1IN8A 1TF7A 2G6BA 4OJKA 1VMAA 2IYZA 3CKLA 2ODEA 4BPBA 3VKGA 1G3QA 4D4MA 5JHHB 1PLKA 1J70A 1G9XA 1F2TB 4BZPA 1W48A 4PO8A 4URZR 1MRNA 5C18A 1KTVA 2RHDA 5DHFA 3KQKA 1YKSA 1US8B 5FPTA 2O8EA 1YZQA 4ACAA 1OXTA 5JRJA 1Z6TA 1AKYA 1H8ED 4OL0A 3H84A 4Q4JB 3R20A 4D81A 1Q1EA 4Q19A 2ZRCA 1U98A 4US0R 1Z8FA 4WVFA 2WSSA 5J4HA 1M1YE 3LRPA 4JJKA 3AVPA 4A15A 3K0CA 4NYMR 3L0PA 1X3SA 5JSZA 1OFUX 4B75A 3UG6A 3QIAA 2IUSA 3I62A 5TB5A 1ZAKA 3UMFA 3MD0A 4HAUA 3SQWA 2EYQA 1GRRA 4BLOA 3GEHA 2LKDA 2VYFA 4D80A 3W5JA 1LW7A 1SGWA 2VO1A 3SR0A 5L3QA 4QKQA 4CT4B 4D26A 1ZM7A 1O87A 2RGGA 4LJ9A 4DLXA 3RSLA 4ZDIA 2RGNA 3SDZA 1VCOA 1Q3HA 4B6FA 2QAJA 1Z47A 1MR3F 2A78A 2F3TA 5JCPA 3UKDA 3U6KA 5H8WA 2P6RA 5B2ZA 4BRWA 4DT1A 1AGRA 1RZ3A 1SVLA 5FH9A 1F60A 1VTKA 4PPQA 3ZQ6A 3FMOB 2WPDA 1Q22A 3GJ7A 3LLMA 4JIMA 1XEWX 2GETA 5EP3A 1Z6YA 4TL8A 5DI3A 4C9BA 3GLGE 3L43A 4B32A 2V7QD 2ZIAA 5EE5B 1XXHB 1UKZA 5JSZB 1GFIA 2KBFA 2OFWA 3DEFA 3B78A 5HPYB 3AVOA 1KAOA 4PZYA 2CE7A 1AZSC 1CRPA 2OBMA 4QGHA 5GADl 1PLJA 2JDIA 3OFNA 5AUPB 3KFVA 4PQYA 3VR1A 1TU3A 4ZV4A 1ZYUA 4EQ6A 4QL3A 5EXXA 2OO7A 1R5BA 3SS8A 4L4UA 4LPSA 4TYNA 2ZR7A 2J7PD 1KY3A 2IHYA 3EARA 4LJ6A 1XU4A 4DUGD 4Q9LA 2HLDD 2VA8A 4WXPA 1QBKC 2O52A 2WSMA 5BWMA 2GZHA 2PBRA 5JZVA 4JL5A 2PX3A 1SKYB 5KNBA 4RFSA 3CUEF 4KCGA 1UADA 2ZI5A 2ZJZA 1IQPA 4L5BA 4OHWA 4OQFA 5H70A 3U3OA 3LD9A 5LB4A 4CEHA 2CHGA 2AR7A 2G9NA 4C2UA 4ZO4A 3UMSA 4R71A 1AIPA 4NH0A 4US2R 5KPJA 1ESMA 2UKDA 4UNPA 3BIFA 2IL1A 4KVAA 3WMEA 4EFLA 3GLFA 3RC8A 1DAKA 2ZE6A 4RZ2A 2VBCA 1YZTA 3CPHA 4PANA 4Q02A 1KO8A 5G3ZA 1HH4A 2CCJA 221PA 2QY9A 1LNZA 4B76A 3NHBA 1XPUA 1JXOA 5AUNB 2NO1A 4JLDA 2O8DA 3S1AB 4J0QA 2ZJ8A 3U7FB 1EK0A 2BJVA 4N3NA 1ZD8A 2ERYA 3BK7A 1XJQA 2FG5A 3EW9A 2QA5A 2ZRLA 3LVRE 5AUQA 5K8TA 2V55B 4IVPA 2RB4A 3CM0A 5K8LA 4BFZA 2EFHB 4EPXA 2P6UA 2H5EA 5JEDA 2OAP1 1OH7A 5G53C 4GBMA 3KJHA 5DSZA 2H16A 4XD7D 5DYGA 4FN5A 3UWKA 5DNYB 1CJTC 2P3SA 2ZSBA 4DEYA 1HT2E 2VRWA 3GLHA 3EPHA 3CX6A 2CLSA 3C5HA 3BH6A 5KU1A 3B1YA 1H8HA 1Z2CA 3IIKA 2IWHA 1EFTA 3T34A 2O8BB 3A4LA 3O47A 2DFTA 1P9WA 4LC1A 2QPAA 3SYNA 3IUYA 4A92A 2OESA 4RJLA 3PITA 5CK4A 1E2MA 2IEZA 3EPJA 4Q18A 3EPLA 1XJCA 1NBMD 4K46A 5K8IA 2WOOA 1II0A 2EFEB 4GMDA 2XXAB 2H1LA 2DFLA 1CBUA 5FBQB 2XJ4A 5AJZA 3MWLA 4DBLC 1D8TA 3NC0C 4QHYA 3W3ZB 2KSQA 2C95A 1LY1A 3EA0A 1KMHB 4EUNA 4C0KA 3R8CA 1Z06A 1DAHA 1TNDA 1E9EA 3I3SR 4NCNA 3THXA 3RRNA 3FHOA 4GP7A 1CJUC 1TQ2A 2QSZA 1W49A 1KK2A 2AWOA 1OXUA 1JALA 4EDHA 1FUUA 3FMPB 5EP1A 4RKFA 4B6EA 2C77A 2FSFA 3K0EA 4X8HA 1RYFA 4LHYA 4K8OA 4Q1EA 3PUVA 4MRSA 3UG7A 3V4FA 1ONBA 1XXHA 1GNPA 2IXFA 3VU9B 1FP6A 2BBTA 4XOIA 2WVJA 1TTTA 1OFIA 4OK5A 3KKMA 4WXRA 5TVKA 3DM5A 4U00A 2CL7X 3ASYA 1QZXA 4FCTA 1E1RD 5J47A 5FUWA 1AQUA 1N3BA 2G77B 4DCUA 3LNCA 2YOHA 4LSGA 2WMOB 4GPTA 2NPFA 4JT4A 1ELOA 4ITRC 3HPQA 4URXR 4PC6A 1OYWA 4C7OA 3MGCA 2CHQA 2WWWA 3LH5A 3GJ0A 3ND9A 3EC1A 1XF9A 3T5GA 4CEJB 4CT5A 1SQ5A 1U0LA 3MMPA 3PEWA 3CBQA 4TMWA 1MABB 1S1MA 2J1LA 4R98A 4A0FA 4QXAA 3EZ7A 3KB2A 1DAEA 4R7ZA 4DDWA 2CLDX 5DISB 3VR3A 4ARZA 3OIVA 1IY1A 2F1IA 3KJEA 1SVKA 1UKEA 4CDGA 2FPKA 3FHTA 1UBCA 3DM9B 3BBPA 3VQTA 4B2IA 3U60B 4MGYR 3TVTA 1E4VA 2EYUA 2Z5FA 3PG5A 3RS4A 2VHQA 1E9RA 5FL7D 1GL9B 2GNOA 1OFTA 1ZNXA 2ZRJA 2QEQA 1ZCAA 4OQXA 4JLNA 1T5LA 3KKPA 2ZVQX 1KO1A 1N0UA 3BFXA 1X6VA 2ASEA 4IEEA 3TSWA 1SXJE 2W83A 4RZXA 3QKSB 2RGBA 3AKCA 4AYXA 2QAGA 1IN7A 2JCSA 3AP1A 3PV0A 4S2EA 4IXNA 4EJSC 2BKEA 1CXZA 1L4UA 1G4UR 4PSAA 1G16A 1BOFA 4XTCS 4LX0A 1HV8A 4YC7A 2FDCA 3V00A 2B7BA 1G291 2REBA 3D3QA 1UJ2A 2NIPA 4Q9KA 3VR5A 5EXTA 2RMKA 4R2IA 2IYSA 3GD7A 2F7SA 4RD6A 2HEIA 1YU9A 1GOTA 4JLJA 1EX7A 1IAQA 2Z43A 3GJ3A 4KHZA 3TQFA 4DLVA 3U44A 2QE7A 1BKDR 2ECKA 4TTRA 5TMPA 1M7HA 2O0HA 2QMUA 1NVUQ 1VPLA 5UKDA 5SZKB 3CH5A 4Q00A 4ZI2A 2ORVA 1G18A 1KSHA 2X19A 2GILA 5C46F 3SJCA 2XSZD 1U99A 3LVQE 3RS5A 4I1SA 4LBZA 1Q1BA 4BFVA 1W47A 2OBNA 2WKRA 2P6NA 1CP2A 1A2BA 1H65A 2PMDA 1JECA 1U9IC 1X1RA 2HCJB 2ATXA 2G0NA 4PAMA 3M6AA 2X1VA 2F6RA 1CR2A 3T61A 2QQEA 5AJXA 2AKYA 2FEMA 4FW9A 2PZGA 4LYJA 4LYAA 5DGXA 5L3VA 2GCPA 3AKEA 6Q21A 3AP2A 2PT7A 3BERA 3OAAA 4WA7A 1KJYA 5EE1A 4B3GA 3C4JA 1YR9A 2Q6TA 4DSNA 3ADDA 4PPGA 1XD2B 3B60A 3BAFA 2LCFA 2JATA 4IDQA 4M1OA 4R9UC 2E1RA 1UBFA 2QMEA 1FNMA 5G40A 1VG9B 2YWGA 3PEVA 2QGNA 3CR8A 4QJ4A 4IDPA 3OIYA 3M0EA 3VX4A 1GRNA 2ZPTX 4B48A 4DEXA 2P0EA 1OIXA 4PHHA 2GJ9A 3W9YA 3QOFA 4KLNA 1N6KA 1OKKD 1EESA 1KY2A 3WYAA 2FFAA 1NIPA 3LY5A 2F1HA 4CIDA 1YJ5A 1KI1A 5J4VA 5IRCD 3QXCA 4JL8A 4HUTA 2VP0A 1CLUA 3MWJA 1KDRA 3CRRA 4AC9A 3NG1A 1IY0A 2OHFA 3QUSA 1G41A 2IT1A 4Y0VA 3MJHA 2A5GA 4PC1A 4WIAA 3MRSA 4H1VA 4V0MA 3PFIA 1T4GA 2YWEA 2XB2A 1T0HB 4EIWA 3I72A 1HQCA 2SHKA 2VTKA 4XVQA 1XTQA 4B43A 2DCUA 2BV3A 1W2GA 1UDWA 1R8QA 1UAAA 2QUZA 1VDZA 5HKKD 4RSGA 1ZNZA 4B2PA 4LV5B 1L7VC 3OEHD 2ERXA 4LJ8A 4DRZA 4V03A 1S2MA 2V3CC 1TU4A 2RHMA 2FEOA 1E0SA 1E32A 1KK0A 2CJWA 4DSOA 1LFDB 3KXLA 3LBNA 4TQAA 4YONB 3OEHA 5DO9A 1E9BA 1W0KD 2Z0MA 2WBLC 3K53A 3T5DA 4ESHA 3DPUA 4DDUA 2QRNA 2P5TB 2XZLA 2FH5B 4QGFA 1A5TA 1HEIA 4EPYA 4Q1AA 1X8LA 4XWKA 3RABA 3QBVA 4F38A 2DR3A 1CJKC 2DY1A 2JJ8A 4IVRA 3KJIA 4FI3C 1LS1A 3AF4A 2LKCA 3CPEA 3LX8A 3OEED 1CR1A 1LF5A 4DCVA 3AEZA 1Q44A 2C04A 2C9OA 3B85A 5D3QA 1CTQA 1IY2A 1EGAA 3THOA 1VKJA 2W00A 1P2UA 4BLRA 4LK2A 1GZSA 5CLQA 2IYUA 3PUYA 4C0SA 1HT1E 4C0LA 4YDHB 3AVWA 3PEYA 5JWRA 1ZU4A 4X8LA 2P67A 2YZ2A 1KI7A 2CL6X 4A82A 2OT3B 1ZUHA 1IJEA 1YZGA 1R5NA 3GFPA 4Q9JA 5J4KA 1E1RA 2VQSA 5CDFE 3PCRB 3SN6A 1F2TA 4QBFA 1WCV1 3TK1A 3N2EA 4K81B 1W0JD 1ZD1A 3P32A 1RPZA 5LBIA 1BMFA 1NMYA 2JLXA 1OYYA 2VP5A 1E2QA 1K6MA 2OAQ1 4P32A 3SJAA 4DLWA 2JLYA 4G01B 3TBKA 1OHHD 3QKSA 5FOTA 2EW1A 2ZRFA 5JJLA 2XOKA 4HAXA 3S1AA 2ZYVX 4B3BA 2Z4RA 2VHUA 2ODNA 4GOXA 4LJ5A 3ZZTA 3L0IB 4HYYA 3Q7PA 2JAQA 3FFAA 4M8NE 3D31A 2XTNA 1N6NA 1NJFA 4UJ3A 2GJ8A 5SZJA 4KVGA 1MKYA 2CNWD 3BE4A 5IT5A 3U4QA 2CE2X 3BORA 3SI7A 5E95A 4C0HA 4Q03A 1KKMA 1ZM4A 3O8BA 4PHTA 4M9ZA 1EWRA 3DOEA 4LBYA 1P2SA 1X86B 4MKIA 3OFND 4HAZA 3I61A 2FSHA 4LV8B 4RZ3A 3FWYA 3SYLA 1CEEA 2W2TA 3GLHE 3K09A 2WWFA 1GL6A 4Q7KA 1QVRA 4FWIB 1C4OA 1AA9A 1NMZA 1IXZA 4IDNA 4DCNA 5L3SB 4DT1B 4TZ0A 2QTHA 2G88A 3QXXA 3FTQA 3BXZA 3IHLA 4EAQA 4A8JA 1HQYE 4BLPA 1YZLA 4DLSA 1P4SA 5GJCA 2J0SA 4P4TA 3KQHA 2VLIA 1CS4C 1U81A 4W5WA 5JS8A 3L8YA 4AYTA 2C9YA 2QMOA 1DPFA 1SULA 3CW2A 5FOUA 3IPXA 3HJNA 3H86A 1U8AA 1Z63A 2ZTSA 1NSTA 2BEKA 3F5FA 3ONWA 1NBME 2QI9C 3NHAA 2HDNB 3NTUA 3TAUA 4Z8YA 4D25A 2QPTA 3GFTA 2DBYA 2ORIA 1G6OA 4C30A 2ZSEA 1JJVA 2BCGY 1G21E 2N42A 1XEXB 3EA5A 2ZUCA 2TMKA 2IYQA 5KNCA 3B13B 4M4SA 3K70C 5IK2D 5ELXA 3W6OA 2DPXA 2G83A 1TAGA 3RRZA 3BGWA 1XCGB 3TIFA 5L3SA 1BO6A 2QP3A 2ZANA 2ANCA 4YDSA 3ADBA 1OXXK 1QHIA 1A82A 1KI4A 1WA5A 3NH6A 4Q5IA 2BHRA 5FL3A 2XNDA 3SBDA 3TRFA 2IYXA 3I8SA 1OKKA 2ZRHA 3AQ4A 3HDTA 1S9DA 4DWJA 4G3XA 3QQ5A 4XTRA 2ZITA 3A8TA 4IXMA 4QFMA 4DJTA 4MRPA 3R8FA 2XZPA 4KU4A 4G5OA 4DUGA 1YR8A 2PLRA 4TN1A 4I1OA 2QTFA 1JEDA 3EASA 3UK6A 1P9NA 2DYKA 1Z0FA 3RNLA 1GKIA 4HUQB 1XCMA 4HI0E 2GJSA 4FCVA 3FFBA 3W34A 4RFSB 4TYQA 2FFHA 4PZZA 1W4BA 4C0AC 4NZYA 4LYHA 4PAQA 1R0ZA 2P65A 3K9LA 3I5YA 4IFBA 5GVSA 4MYHA 5KSOA 2WIAA 2HT1A 1KSJA 3Q5DA 4QHTA 3AP3A 4Q47A 2HUPA 1FNNA 1ZIPA 3KKNA 2KBEA 2XITA 5HCIA 1YQTA 1R5OA 3SFZA 5JRZA 1E79D 5KOYA 1KYIA 3KDSE 1JAHA 2FOLA 2NPIA 5KO2A 2MSCB 3CLVA 2GRJA 3Q9LA 1E2DA 4G1UC 4JZKA 4C4PA 2C2HA 1G8HA 4MRNA 3ZGXA 4MGIR 1OV4A 4IJMA 1KNXA 3MUFA 3B8HA 3TAHA 2YINC 2R6FA 2GCOB 2VL7A 4AKHA 3T12A 3AUXA 3AH8A 1N5JA 2ZE8A 2V6JA 2REXB 2A30A 4HUQA 2PCLA 1YVDA 4IRUB 4PFSA 3SJZA 1KZ7B 5CJ2A 1WMSA 4U02A 2WIBA 4UNSA 5TARA 1U90A 2RGEA 1P3JA 2ZAMA 1E2LA 3THYA 1TPZA 2CVHA 4HEJA 1KNQA 2W0MA 3TQCA 2WJHA 2W6JA 3NBXX 3RANA 1JR3A 4R2HA 1Q1QA 2UZIR 4A0GA 1XDBA 4LHZA 2DFNA 2ZR9A 3WHLA 2ZI6A 1YZUA 4TYPA 2WWXA 2H17A 3OHMA 4YQFA 1Q12A 1RYHA 2G1JA 3EWSA 1VG0B 1Z0JA 3P20A 5JWHA 3TE6A 3TSOA 3QNUA 4PQFA 3IKJA 3L82B 3FOZA 1ZD9A 4B71A 1IN6A 1DS6A 2O0JA 4G5SA 4PC3A 1VHTA 3DZ8A 3A6PC 2D74A 2PJZA 2CLCX 4B34A 3D6TB 5HE9A 1BYIA 4O2LA 4BUJA 1KI2A 1A2KC 3ETLA 2PEZA 1FMLA 2JA1A 4TMZA 4QHSA 4CEHB 4E09A 1W5SA 1XEWY 2XAUA 5CDFA 3RLFA 3WBKA 4B35A 2CXXA 2YC2C 4II7A 5FTNA 1E96A 2IX3A 2NQ2C 4Q7LA 4PSKA 3WP0A 3ZIAA 1A1VA 4QBIA 4FMCF 1FTSA 3GLHB 3SQXA 3WYFA 1ZINA 5C4GB 5A5GA 2AK2A 2F9LA 1BMFD 2BM0A 2DWOA 2GZDA 1COWD 1HURA 3EPKA 1XTIA 2G1KA 3AF2A 3DO6A 3B9QA 1ZVQA 2HV8A 2P5SA 2WPDD 2QROA 1E2JA 4LDJA 4M0LA 2V4ZA 2W6JD 3EZ2A 2WKPA 2X77A 2IEYA 3V9PA 5EE3A 1HUQA 4Q4HB 5CM8B 4XD7A 2B6HA 1ZNYA 1E3MA 1E4YA 4CEIA 4P4UA 1W4AA 3KQUA 1FP7A 2QZ4A 1UDXA 5FL7A 4A2WA 2EWWA 3QEOA 4IOKA 5P21A 4PR0A 3X2SA 3OIUA 4Q1FA 4QOSA 4QBHA 1D2NA 2GBLC 4A4DA 2ZEJA 4BRUA 2E9SA 4EFMA 1W46A 3QXHA 1PUJA 1XPOA 2Q3MA 2GXUA 3ZS8A 3DOFA 4M1SA 2ZRBA 3THXB 1II9A 4ZIRB 4UJ5A 1FQJA 4B74A 1VYUA 1SVIA 1Z0AA 3OEEA 2GF0A 4LYFA 1R0WA 4BE7B 4EPWA 2ZS7A 2ZRNA 1XD9A 3W90A 1COWA 1KDTA 4HAYA 2J46A 5CLLA 1QDEA 2D2EA 4H1UA 4JKYA 4Q9HA 3AVUA 4GT1A 2JJ1A 1O3YA 1F48A 2BBOA 2ZYWX 4YXWD 3GJ6A 4M1YA 3EX7C 2ONKA 3P4YA 5A0FA 1PLLA 3NBZC 2GESA 2XEXA 5FI0B 1NN5A 3DMNA 4RCZA 4S35A 1CF4A 5FBRB 1SKYE 2GEUA 3SEAA 4WZBE 2WSSD 3U44B 2JLVA 2A2ZA 1UBEA 2ATVA 2R6DA 3U5ZB 2V54A 3I1FA 1M74A 3U2QA 3J81k 5BN5A 3R9WA 4LBWA 2C5LA 1ZU5A 4NE2A 1S0UA 1Z83A 1L2TA 1GWNA 4LV6A 1JI0A 1AKEA 2ZXUA 4C3ZA 4D0LB 1A7JA 1I2DA 4KODA 2ZUBA 3E2IA 4TL7A 1TF5A 5BYJA 4DCTA 4ZDKA 5JS7A 1H8EA 1F5NA 3DHWC 1RRFA 5JBQA 4ESVA 1XZPA 3BB4A 4QRHA 1OLOA 3MFYA 2VSOA 4RVCA 5EXSA 3T1QA 1FL9A 3ADCA 5GJBA 3M1IA 4OYHA 3QI2A 4NYJQ 2OG2A 5ANRB 3NEJA 3LXXA 4KYUA 4LHVA 4UNRA 1IBRA 1KGDA 2QT1A 4QC2A 1NLYA 1R0XA 3D8BA 4PO9A 4Q4AA 4JBWA 2BMFA 5DN6D 4MH0R 4C0BA 1DVRA 4Z1MA 4FMDB 2IYWA 4YXWA 4EPVA 2BEJA 2QQ0A 3W8NA 4KSCA 1XD2A 2JJ2D 3CRVA 2CCKA 1CU1A 4TSFA 2H8KA 3VNVA 1TQ6A 1U0JA 4B73A 2FJUA 2YOGA 4NP6A 1TL7C 1XRJA 3U3KA 4O2RA 4Q4JA 3TW8B 2W6IA 4ZKDA 3MJRA 1B0UA 1Q0UA 2B92A 3AKYA 3LW7A 4CEIB 4B3FX 5L3RA 5FOVA 1IM2A 1NKSA 1P60A 2ZREA 3CF2A 2PCJA 2NO6A 1ZBDA 3EAQA 2ZI4A 1CJMA 4PHFA 5CJPA 3IIJA 3K8YA 2FWRA 2XXAA 3CWZA 4NYIQ 2CNWA 2QM8A 2F1JA 1N2CE 1Q1ZA 1ZM3A 5KUTA 2NZJA 5JI3E 4NHOA 4D4KA 2O8DB 3K70D 4AKEA 1KJWA 1GKYA 1NMXA 3REFA 3QVUA 1KO7A 1KSGA 1GDDA 3IO3A 1G8FA 3LAWA 3LV8A 2IYRA 3A4NA 621PA 4TLBA 1W7AA 1CKEA 3RDPA 2CBZA 4AY2A 1VIAA 4D0NA 3GJXC 2J7KA 1EWQA 1AJEA 1GM5A 1G5RA 4MGKR 2NTYC 5JWOA 2AL7A 4AURA 1Q3TA 2GXQA 5M04A 2FSGA 3CRMA 4HDQB 4EPTA 1VCNA 1W0KA 3TLXA 5B57C 3CO5A 3C15C 1H8HD 4MITA 1OFHA 1E2FA 3NEYA 1ESNA 1QHHB 3SU8A 3QKUA 4TSFD 1XFAA 5EP4A 1E2GA 2Q21A 4KYIB 3PJRA 1RFLA 1DOAA 1EFCA 2CK3D 1XP8A 3QF4A 2WM9B 3GMTA 1M6NA 1MOZA 1UPTA 4DSTA 3C7KA 4KO8A 3NDBB 3HYRA 2IA5A 3RRMA 2FU5C 3AVTA 1N5LA 3WRYC 3CX7A 3CZQA 4C7OB 3W6PA 1VHLA 4H9GA 3I92A 2JDID 2ZJYA 1Z22A 1JR6A 2Q9CA 2YV5A 3QPVA 3T06B 2AD1A 4ASUD 1G19A 3BJIC 4HLCA 4KFRA 4Q01A 4M9XA 2XJ9A 1KO5A 3NDPA 4B33A 2V8OA 2OXRA 1P2VA 3FB4A 3KX2A 1Z0KA 1OH6A 5DYIA 1T9HA 1QHSA 3SE0A 2MMCA 1E9SA 4NMMA 1K5DA 1LB1B 3CH4B 2C8VA 4Q4LA 5F9HA 3QG1A 4OKSA 4ZPXA 3PXGA 2N46A 3X1ZA 1OT3A 1FZQA 2ZM5A 3LA6A 2ZS9A 5BN4A 4AYWA 3A4MA 5FPYA 3PUZA 3MWKA 1PUIA 5CYOA 1HA3A 1YHNA 4BFTA 3ICEA 1RE0A 1SVOA 1VYTA 2DB3A 1V5WA 4X8MA 1CIPA 3TH5A 4E5UA 3LQQA 3IPYA 2ORWA 3KKQA 2RGXA 1UBGA 1LTQA 4IW3B 2XB4A 1FTNA 1A4RA 2Q3HA 4W7SA 4Z8XA 3VU9A 1OH5A 4M1MA 1CR4A 5DI3B 1S8FA 3PUXA 4PC7A 4F4CA 4B2LA 4HB2A 4QM7A 2AHOA 1WE2A 4G5QA 8OHMA 1QHHA 4GP6A 1E9AA 3ZQJA 1UKYA 1ZCBA 2XOKD 1P9RA 3QKRB 4FIDA 4EFNA 4BEBA 2GKSA 4ACBA 3RVBA 3DZDA 2ZRDA 4FINA 3IEUA 4UXHA 1YRAA 2CCGA 4HZIA 1W1WA 4O3MA 3P27A 1OIVA 2GHIA 4OHVA 4PAOA 3VMFA 4ARZB 1KI3A 2FE4A 4DDVA 4RD3A 3SZRA 4GMXA 2F1RA 4I1UA 2OCAA 5TXGA 5CIWA 4GRAA 5SZHB 2ZJAA 1NLFA 2IXEA 4JMPA 4AK9A 3ZVMA 2LWIA 2OUKA 4A9AA 1VG1A 1NF3A 1LVGA 2IF2A 4YMVA 2D06A 4OHZA 3HU1A 3BRWD 4DZZA 1UFQA 2ZI3A 3F3YA 1GIAA 5KNDA 4MKFA 4ZCLA 1AM4D 3VHXA 3H2YA 2GVZC 3BFVA 3KTAB 3FMIA 3M4YA 5GJVC 3A1TA 4RFVA 2WJVA 3K0SA 1D9ZA 3GFOA 2PX0A 3EWAA 3IQWA 3K09C 2ANBA 3W8RA 1FMJA 1OB2A 5EZ6B 4AI6A 2WOJA 2V1XA 3UXMA 3THWA 1GAJA 5DLQC 3ZS9A 3HR8A 2WICA 3CIOA 4EKDA 3RRYA 3ZLJA 1N6LA 1WF3A 3UMRA 2RAPA 2BBSA 2ZYTX 3LXRA 2O5VA 4LC0A 4E03A 1G7TA 2A9KA 3BH7A 2J87A 1NVVR 5GJWC 4Z51A 4B3XA 4Q4HA 3TKLA 1BIFA 5B30A 3K1JA 4TL9A 3H0KA 1E2HA 1V43A 2GAOA 4M21A 1DELA 1JR3D 2WWGA 4WZ6A 3AVVA 3EZ9A 3AKDA 5HE8A 2A7QA 1RJ9A 3ZYCA 2J45A 4RD4A 3GPLA 2ODBA 2ZRGA 4DLYA 1XZQA 3REGA 4D0GA 2J0UB 3OF5A 1R6BX 1RVDA 2FV8A 4MYCA 4ILEA 1DADA 3AVQA 5DI9A 2Q0HA 5H68A 3MCAA 2IS1A 2JLQA 3VX3A 4MKGA 1XTJA 4TYYA 1R10A 3CF6R 3BB1A 1ANKA 3ZVRA 1DARA 2QG6A 2FX3A 2CHVA 3WHKA 1EG7A 1OXVA 4PHGA 3TVDA 1SXJD 2GVDC 3QF7A 2AK3A 1FQKA 3FDIA 1NI3A 3GLIE 4RCYA 3VR6A 4DHEA 1N25A 3ZD6A 2J9RA 2JJ2A 4O0MA 5HZHA 5JJKA 3ZVLA 2KJQA 2QAGC
chains in the Genus database with same CATH superfamily
2A94A 1FSGA 3ONFA 5FUVA 3T7SA 3PFWO 2QJWA 3UCFA 5HGXA 4JOBA 3S2GA 1WZEA 3AOEA 5B4TA 4CHGA 3V1UA 4I5EA 3HRHA 3WAJA 2AG5A 2QRZA 3UJAA 3DXFA 3A9CA 1PJRA 1WZNA 4L9SA 5BUCA 2QL6A 2YKGA 1GZ6A 4Y1FA 1PDWA 3KUCA 2FRDA 2P4HX 4YLEA 13PKA 4B45A 4LECA 4DMFA 1A8HA 3S1LA 3PHBE 3WHPA 2H63A 1XEXA 2Y1XA 1XJWA 3HVIA 5FEUA 2E4WA 3OOEA 1EX9A 1ZA2A 1CQIA 1IN4A 2JEYA 2OM2A 5CFQA 3EWIA 3KLMX 2PL9A 4ZYYA 4X97A 1DCKA 1S6YA 2GM9A 3N58A 4L3WA 2I6TA 4BASA 3EUFA 1KKUA 2FAXA 3G0CA 3QVWA 3ZXIA 4DQLA 1TECE 2HT6A 1AS2A 1R5JA 4UD6A 4MRAA 1P17A 2XPCA 4JNKA 2PSJA 3V9AA 3OI7A 1WO8A 1M1UA 3MF4A 2WHXA 3THYB 1T26A 3AIKA 2FMXA 4URFA 5K45A 3M70A 1JUDA 1NU6A 1DAMA 1RNLA 3D7MA 1Y6ZA 1C7RA 4O4IB 2OMEA 1NJ5A 2BTQA 4DLUA 5EZYB 3AJRA 3IKTA 3C3DA 2BDTA 2G1AA 1JKFA 1WXQA 1DC5A 2Q5QA 4HGZA 1KDPA 2VZ8A 1E61A 1QZTA 2C88A 3HJCA 4U3JB 3TZCA 3RS0A 4URUR 4DXAA 3NW9A 5JLJA 1CERA 1FP4B 1I80A 3UB3A 1RRCA 1AE1A 1EP9A 3IUPA 2CMKA 3B5JA 3CCFA 3GL9A 4CM5A 1MT3A 4CV3A 5IWCA 1PL8A 3CVVA 2XGJA 5BP7A 4X65B 1MIOB 4JLKA 4R40A 2YJGA 3CMMA 3DZGA 4H7DA 5D3MA 4BQPA 4COOA 1K3UB 2FWBA 4KQIA 3KWJA 4OSEA 3KVVA 4E07A 5AQ1A 1IU9A 3MJFA 4RU1A 2QP9X 3RCBA 3WK5A 3AF0A 1EYZA 2X5OA 1Q7GA 3X1YA 2BIFA 3K31A 4IF4A 3GFSA 1OE0A 3FTPA 1L7NA 4FMCB 1CJVC 4Q66C 2IPXA 3A6ZA 5G4LA 3JD4A 1JJ7A 1BS1A 1HGXA 1EK5A 1M34E 1QWOA 4S1WA 4BXOB 4JP3A 2XA1A 3Q0IA 5E7QA 5GZ6A 4EI8A 1R9MA 3UANA 3CLSD 2W11A 3GCWA 1QO7A 2B8TA 4B0PA 2IYPA 2RKOA 2VJCA 1UBTS 1EGVB 2AS0A 2WF8A 5A5VA 1E2UA 2XYRA 4JLBA 1MU0A 4KFUA 2VRBA 3P2OA 5G3YA 3E9CA 2QK4A 5CVJA 1ORWA 5I48A 2BJHA 3TX2A 1U2EA 3VC7A 5FJJA 3CQ9A 4V02A 1CWUA 1FP4A 4ARUA 3JZDA 2PZFA 5FLEX 4OSPA 2KLBA 2OZKA 2X8WA 4P22A 1TD1A 4GBJA 3GLIA 2XWSA 4BC0A 2PUEA 1XZAA 3PVSA 3RVRA 2B4RO 3R0VA 5IEBA 4D56A 4HPWA 4BX8A 4UTRA 4JN6B 1JR3E 1JHYA 1AQ6A 3LY7A 3PHGA 2P2ZA 1GTZA 1TKBA 4OQQA 1OWNA 3TI9A 1A8UA 2XCTB 3JQ7A 1O96B 2FFRA 3T7CA 4RVSA 4F96A 2Q3DA 2JGAA 4IOJA 3WNCA 4L5AA 1M2EA 5EUMA 3JWGA 1PWXA 1TM5E 3H1TA 2V7WA 2RKWA 4L57A 3SZGA 4A8TA 2F2TA 4WEOA 3MC1A 10MHA 2XSZA 3ZZUA 5IXSA 1EPUA 2B99A 4LCBA 1MO4A 4G09A 3BBLA 5E7IA 4FD3A 3JAKA 4UDNA 2YR0A 4DNFA 1PDVA 2PQ6A 3KAJA 1SIUA 3I4LA 5K0EA 4HNQA 4WL0A 2LPMA 3PIRA 1HFWA 4FE4A 3DOHA 4YRPA 3VH4A 4AKSA 4LFCB 1P1BA 1ZA1A 2PT5A 4JJIA 1N6RA 1O6BA 2OWEA 2GN0A 2KLHA 2TMGA 2VCEA 3JWIA 4HRAA 4ZODA 1GCGA 1YASA 2GOYA 3MUOA 3T5CA 4E31A 3BXFA 3FTDA 1ZVKA 5AVWA 1UUFA 4YJFA 1A8IA 3SP1A 2C2WA 1DWUA 2FZ4A 4LZAA 1B16A 1C0IA 1PV2A 3E27A 1QNFA 2Z2IA 2AXEA 5J63A 3J81A 1K63A 1KTIA 4R0NA 4C1NA 2OCPA 1KAGA 2IYVA 2WWIA 4TXLA 5E4JA 4CYMA 2C96A 3P2YA 1H6DA 3MAAC 821PA 3L8FA 1FVFA 4RC9A 1MGPA 4L4XA 3FOAA 3R7SA 4UQOA 4WLOA 2RHGB 4H6VA 4XX1A 4EUFA 1JHQA 4AG6A 1QDUA 3EUWA 5F1YA 4NXNB 2D2XA 1TIBA 2AFIA 1YR7A 1JVSA 1CIVA 1SBQA 1VMIA 4HNHA 1P61B 2PL3A 2R2AA 5ALXA 1QS0B 2VSXA 4QELA 2HRCA 1L4HA 4A8JB 1R0CA 5B3LA 1RHRA 2W2QA 3FGNA 2X6RA 4WKOA 4F4DA 3V5NA 3ECCA 3VHXB 3SKVA 3OA0A 4FT2A 1D6NA 3GFVA 3H5AA 3ROMA 3HSYA 4TKLA 1YCDA 4GXTA 3O74A 1UM9B 2P2LA 4MW0A 5I7SA 3TGPA 5ICCA 1HNXB 3WRXC 4YO7A 4OX9B 2KPOA 3ZJYA 2H2HA 4E88A 3SHWA 4JU8A 1CEYA 3P0JA 1HI9A 4ILKA 2BFFB 1TA4A 2IBMA 4G0XA 5KREA 4WBNF 4MUBA 2QAIA 3LDGA 4YMUA 2BMVA 4FQ8A 1G7RA 4O1IA 4BKPA 5HQ3A 3LMKA 1U8EA 1LS6A 4O2AA 4RD2A 1K08A 1YQ9A 3BMNA 4RD1A 4B3RB 2O2EA 3GAMA 1MX1A 4BKUA 3DVLA 3D6MA 2DKOA 1ZD5A 4DCOA 1HE1C 1V47A 1G3MA 3L0CA 5AOVA 3TZ6A 3ZY3A 1UP4A 1MJNA 4CZ2A 2ZB7A 1A8PA 1RP1A 1ISGA 3N75A 2R1TB 3KFLA 5CDGA 1JFFB 1WHSA 2ZDGA 5I5GA 2VHTA 2EQAA 3SNHA 1ZZGA 4MV1A 3OPVA 3KZVA 1US8A 3SBEA 1JAIA 3CJTA 4AWXA 3L1HA 2BRUA 2AUTA 4FOPA 2UVQA 3FDJA 1HT3A 4RORA 3OSUA 4F7WA 2FR1A 1GPJA 4Y2YA 4YAWA 3MBKA 1ABBA 2I7TA 5MN4A 1FUKA 4BKMA 4RZSA 2QBYA 4UTPA 1NP6A 2XX3A 1LBTA 2AFIE 2QSUA 4GX5A 3P9SA 4LW8A 1J99A 4QU5A 4P4SB 3VHLB 1QU3A 4R8LA 4NMWA 4AO7A 4NFYA 3MLEA 4NU6A 3IHTA 2VPZA 3FIJA 4HQ6A 1KP3A 2GD2A 4I4CA 4J7AA 1GY8A 4H4DA 5K3FA 1KO4A 2OBYA 2C9CA 1DDGA 3GMIA 4IV8A 2VR1A 3LDUA 4HF7A 2I4IA 1GUBA 1HQDA 1KXZA 3SVLA 5IVPA 5F3WB 3G1TA 4NPCA 1WHTA 4YBZA 2IY9A 3IO5A 4N0DA 3WFJA 4GYKA 1HYQA 1NXSA 2DH5A 4JSRA 4CVNA 2ACVA 1XTKA 2PT9A 1KSFX 4HLUC 2YC4C 2HMYB 4NBSA 4NH0A 1HTBA 3TLCA 3R75A 2VCHA 4PQGA 3V4PB 1Y4ZA 4OK3A 1GSAA 1Q0QA 1J09A 5BR7A 5WRFA 1Z15A 3AB7A 1HDZA 5TPWB 2GCEA 2PZMA 4HWRA 2XWJI 4RY9A 4LVUA 1UBKS 4B09A 4N0MA 5FR2A 1TYZA 1N4DA 2W0SA 5FBLB 3DBHA 4R51A 2EAUA 1JB1A 2XTAA 3EBPA 3H4MA 1FP2A 4DMRA 3MMXA 5IHPA 5EXDA 2HJGA 3IBGA 1HKHA 1HDIA 2WU1A 1NF9A 4KV9A 4UUOA 3Q85A 3B12A 1ONNA 1N5IA 1YUNA 2WV9A 4MYTA 4I3HA 1UKBA 2WYOA 4H6WA 2WHRA 3UUGA 2HIAA 4E08A 5JAQA 3SHFA 2IXTA 4P92A 4TKZA 1QSGA 5HRCA 1BROA 2JFNA 3M6UA 1OASA 3ZV3A 4EJSB 3U9SA 2RARA 2K5UA 3DWIA 4B6GA 3ZK7A 2QL9A 1PWYE 2CWWA 1NVTA 1ORHA 2IPNA 1QHGA 4MW1A 4YMWA 1R64A 2O23A 4BY9E 2A57A 4Y3UA 2OZEA 3U1VA 4GD3Q 3PGMA 5D1NA 5L45A 2Z4SA 3BB3A 1Z6GA 3O38A 4OFBA 3TI7A 1UPUA 2PX4A 3BWDD 4ZOLF 2YJNA 3B6MA 5FBWB 4YRTA 3BDVA 1A4XA 1SG0A 1YR3A 1C9KA 2AN5A 3C3AA 2C1XA 4RHEA 1NVDA 4QXQA 3S44A 3TLJA 4TKVA 1I51A 1XD8A 3ZVKA 1PG5A 4HNAA 4IJUA 4IDGA 3INRA 4L02A 4UUPA 4BFYA 4F3YA 3U1BA 4WXEA 1TEZA 3NVAA 3NFRA 3L2OB 1NPDA 3OZSA 4DCGA 5DM60 3GEEA 4CKZA 3ER6A 1OWMA 3LWNA 2H7YA 4YT5A 2HIHA 3I9MA 1WCYA 3JR7A 3N5CA 2CXRA 1MB2A 3ONDA 5AXBA 5A04A 3A1UA 4PLZA 1PGOA 5C3MA 4CCYA 3LWZA 1N5DA 3SJBA 1WD7A 3I5XA 4QQ8A 2JIRA 3HEMA 2P9ZA 4G97A 2JFOA 5JG7A 2QLMA 4TTSA 4XJVA 1ODFA 3O92A 2BMAA 1GZ5A 1O08A 2QUIA 1E99A 1R7RA 2XNHA 3GAAA 2VC2B 1E1YA 4XIFA 3R7AA 2YWJA 2ZSIA 4AZWA 2GJKA 1UPBA 4G81A 3VSDA 3L06A 2X8LA 1FE8A 2QKYA 3BXOA 3JX9A 3R7DA 4H60A 1GV0A 2V5AA 3N3BC 1BCSB 1QJCA 4M1KA 1KJ9A 1TM7E 4UTZA 5FXMA 1OXMA 4BO0A 2CWDA 1QC5A 2JZNA 3P1JA 3FTCA 1WLYA 2JFYA 1F6BA 1JILA 4HDRA 3ZHZA 4J3NA 1Q57A 1O96A 2LP4Y 2NT4A 3LBHA 4B5KA 2GBFA 1QC5B 5TGTA 1R50A 3OZXA 4CMIB 4NV3A 4K6FA 4OIMA 4D9JA 1WVMA 3QLTA 1I33A 5BUQA 1EFVA 3R6TA 3ZHOA 3KSRA 1SU4A 3C8MA 4JUAA 5JASA 4L5JA 4RD0A 2XF2A 5DMHA 5I6DA 4HWKA 1R4MA 2CNBA 1JEQA 1SU7A 2PPVA 1MAUA 3R5FA 4IICA 3IBSA 4NNJA 5COAA 3BN3A 5DZSA 5K0BA 1MV5A 2DE0X 5KQRA 4URYR 4JQCA 1WB9A 2HR1A 4OGWA 4AZVA 1JIKA 1GNQA 3E22B 4LF4B 4WZAE 2X0JA 4PSVA 4ZCIA 2J0QA 3FLBA 3A9RA 1GCUA 1LWOA 2R7LA 3DXZA 4IOMA 1KRWA 1OX4B 1E3LA 4CKYA 1YQXA 3RARA 1YVEI 3EN0A 1ZIYA 3S2YA 4BV9A 1D5CA 3B5IA 1TTHA 4HAWA 3WXBA 3ZXYA 4BU0A 2DHQA 4PTLA 4G1BA 1RHMA 3AMVA 3AHEA 2P2YA 4L9WA 2DR0A 4OHPA 2A0WA 3BE6A 5BQ3A 3R23A 3GDOA 1RBQA 4ITVA 1HDEA 3FKSD 1CRQA 1CFZA 3W04A 1S96A 1C8KA 2HF2A 3MCTA 2OHJA 3CNLA 4FBLA 4B4UA 1QFJA 5LDDC 3ZU2A 1XDSA 2XMRA 3ZDZB 1K5GA 5IAOA 3PJFA 4TWZA 3JVIA 4QBKA 3CLRC 3U7QA 3L79A 2ZU0C 1VYVA 4D3YA 3BPSA 3RTEA 1MAHA 1H2XA 2QGZA 2B78A 1MO2A 5EPEA 4B85A 1ZICA 4M9SA 5BYKA 5HRAA 2RD2A 1LF0A 1ZQ1A 4GRIA 3INTA 4NCHA 2QT9A 3CS3A 1KBQA 2ZIFA 3EVBA 4OA8A 3QENA 4IJQA 4BMDA 4RL6A 4M9QA 4BNDB 1AQNA 4L8GA 4B4OA 4A2PA 2V1UA 3GRFA 3ICQB 1P6XA 3BCHA 1KI9A 1OA1A 3C5CA 5LP6C 5TQ0B 3VGJA 4CEJA 2HHLA 1QAQA 3K4PA 1E0DA 1RKUA 2CLLB 4AKGA 5EIAA 5FBVB 2H1IA 4GNRA 5L6LB 3W9BA 1HRKA 3HA7A 1E9CA 1WJGA 4OSOA 1MAWA 1T2NA 1VKZA 2X3UA 2MYNA 4L8VA 3OZIA 4RDIA 2X0FA 1E94E 1AGNA 1FS4A 4JUDX 3ZWPA 2C3MA 2WMDA 3O21A 5BN3A 2GEDA 2E6KA 2VF7A 1XMVA 1ENZA 4PLCA 2YJZA 5ALYA 1YZKA 1YO6A 4M7PA 1RIFA 1W6UA 5J23A 1ZXXA 2VUUA 1A9TA 5FOQA 1JEEA 1M2KA 4R6XA 3VZCA 1UFRA 3U7QB 1G98A 1GG9A 1KPIA 1NSFA 2JRLA 2W6MA 4JGBA 4TS4A 5J43A 2ODWA 2X4DA 4MROA 4B0OA 4FHEA 3KYJB 5ALFA 1Y3AA 4BFUA 4B7AA 4J90A 2NYAA 2R1ZA 2ZKIA 1AGPA 1Z62A 2JCGA 3B6ZA 1Z56C 4MMYB 3A1DA 1XHFA 4F5DA 2XECA 3IAS6 4BFLA 2BCEA 2R6CA 3VOAA 4BMVA 2QTRA 1QB8A 2H29A 3QNWA 1PBNA 2PR2A 1KEKA 1DV2A 2VH5R 3CBGA 3OE7A 1L5VA 2I6UA 4F9TA 4NDZA 3ZC3A 1QANA 2W2LD 5CA0A 5SV2A 4JKIA 5JSYA 1LQTA 4XOUA 1P1CA 4FN4A 2VF5X 5TMDA 2B8WA 1N7HA 5E3IA 5ALVA 1NY5A 4W7IA 1BGWA 3ETCA 4CL3A 2OCBA 3IQEA 4RANA 4TV8B 3SJ7A 4EEKA 4Z99A 1T5DX 2W2VA 3LHDA 3VYTB 3MT9A 3K0FA 4FS3A 3WK7A 4AJIA 4CM8B 3GZJA 3LLUA 2QL7A 4P3NA 2QR2A 5ALIA 4BNFA 5CDYA 3EGIA 1ENPA 3LKBA 3KTOA 1TK9A 1FFEA 1LPNA 2FG7C 2WVAA 3DZIA 3MCVA 4W5HA 4C2TA 1PR9A 2ZTLA 2PUVA 1ZNWA 4MQUA 2Z83A 1NMQA 4JA0A 1L4MA 3FR7A 5CB6A 5KIAA 2INGX 3DEIA 4K9MA 2HCTA 5JO0A 1FRNA 1KYQA 1NVXQ 2XQVA 1L4YA 5MN5A 2CVQA 2AT1A 3QX3A 1VG8A 2F3RA 2IC5A 3LF1A 4PSCA 1EFUA 3R3SA 1WDMA 3EK2A 4O0LA 3CJQA 5D3ZA 5HA5A 2DT8A 4BEWA 1D2MA 4JY7A 5TDHA 2XQJA 3SHQA 3E35A 3NT5A 4MW4A 5NLLA 3P4UA 5FAKA 1TAUA 4YX9A 5F9FA 2R1VA 1LQUA 1TGYA 3IV9A 5C4IA 2WRZA 3R6DA 3ZEIA 1AX9A 1V1MB 3C8UA 4MINA 2DGDA 4MIEA 2O2JA 2EJTA 5AWFC 1NVVQ 4XEUA 4C22A 4C6HA 4FZ5A 1YR6A 4F3KA 4JSTA 3RU3A 3WMFA 3N8KA 1FYWA 2A9QA 2G7MC 3HCDA 4WXHA 3DDWA 1GP2A 2ZETA 3H2JA 4UBNA 4CDNA 4W5NA 4UDYX 4D92A 2APJA 2X15A 3JCZA 3FETA 1Z26A 4XYEA 4IJ6A 3W5SA 4Z4FA 3RHSA 4LHWA 1SC1A 4JGIA 1HORA 4Y2VA 5EMMA 4D96A 3CZ5A 1JQKA 5JAPA 3O2NA 4AG5A 3B5EA 5AW3A 4QYMA 5LSAA 4JLAA 5KYTA 3V8VA 2BAGA 4LNUA 2R6ZA 1G5PA 2WNHA 1WL8A 1XLVA 4I8DA 5AJWA 1C7FA 3VI4B 4YRJA 3RSFA 1RQ2A 3THWB 2F8SA 1X0VA 2WJYA 3QIVA 4KO3S 1IJBA 3T5TA 3VJRA 4DAEA 4QUAA 3GT4A 5IVDA 2ZI7A 1JSLA 2II6A 2W4MA 1BCRA 1C3VA 3FUCA 4MHTA 3OQIB 2O1WA 2PSDA 1U2GA 4L0MA 3FRIA 1JVNA 1P62B 1U0HC 2B21A 5LUBA 1EB9A 3RTAA 2RGCA 2VPPA 4NZZA 4EA6A 3GLGA 2IF0A 2N47A 4J0CA 3VTFA 1SQSA 1V3UA 3GRZA 4P82A 3G0HA 1ND6A 3NPMA 421PA 2XUKA 1NXTA 2W22A 1ATIA 4WESB 2YHUA 4ZAYA 3WL6A 2FR8C 2NO9A 3W5DA 2ONZA 1MC1A 2VJMA 3LCUA 1T0PA 3IAEA 2RGDA 4RSMA 2GK6A 5AT1A 4BNTA 5B2EA 3U61B 3DNMA 1M2WA 5KAMA 4JR0A 3HZZA 1GNLA 2F43A 3B6JA 1X19A 5K0LA 3WHIA 4Y6LA 3NNDA 2ZBQA 5ERYA 3Q8LA 2QG4A 3TL3A 2DLCX 2JCVA 5KVVA 2Q6IA 3MTBA 1UIRA 2QRUA 3SC6A 4NH4A 1OZFA 2CXUA 3K32A 3EMDA 4QVKA 4PPNA 2P7IA 3NYQA 3D0OA 1SOWA 2QD4A 3A1SA 4CTNA 3LZ6A 1BDIA 1PJCA 3JZFA 3RWOA 1MH1A 3F2IA 1G8PA 3MSXA 1PR2A 1QZUA 1EAMA 4KJZA 4DQUA 4GC9A 1H9CA 3H16A 4NC9A 2D7DA 3RTBA 4BQRA 2AN1A 2FW6A 2R6HA 3MWEB 4KFSA 1PN3A 4WINA 4WHMA 4UNNA 1RXUA 4DLPA 3DT6A 2HYDA 2IWRA 2EHJA 2VAWA 3GV0A 4NOKA 3U7EB 3DZBA 2FMUA 2L82A 5FFFA 3O95A 4FOTA 5KSZA 1B6SA 4G0QA 4FX2A 2I66A 5T8KC 1U9ZA 2A9RA 1VIYA 1H42A 2GBGA 5KOIA 1NWHA 4JVMA 4LJYA 1JA0A 3RU9A 4MVJI 2EG5A 4IS2A 3TSZA 1OR8A 3B51X 5K0NA 1SURA 3IGFA 4KSBA 4XSHA 3L3BA 1D2HA 5FPQA 3QVTA 2VG8A 3ETHA 4GVPA 3RJMA 1QKIA 5LP6B 1DX9A 1CHDA 2OEPA 4EATA 2C2MA 2O8CA 1BJRE 1W36C 1XUOA 3N8HA 4MYDA 2E4YA 2X4GA 1O2DA 1X77A 2PZEA 4NWIA 4XQ9A 2YWBA 1WRBA 4RNDB 5EJ9A 4IDHA 2DH6A 1W5TA 1UMKA 2FCAA 2G82A 4QFDA 5E8RA 1TF2A 5HF8A 4DIEA 4XWWA 3QLUA 1DG3A 1I2MA 1SHZA 3ZDXB 3L8GA 4QGBA 3TCXB 2HA0A 2XY4A 1IJKA 1EGMB 1I0IA 1T3LA 1WDWB 2ZYDA 3BD9A 3O2JA 4JB0A 2O4CA 3EXEB 5THQA 2B8NA 2G6TA 2G36A 1UJBA 2DPYA 1QXSA 1OAKA 4GFDA 2UYHA 2Q29A 5KNDD 1GAXA 2PMWB 4KDEA 3DV0B 3M6MD 3NGXA 4U5QA 3WLRA 5FYDA 3HCAA 2YXLA 3U9TA 3GW8A 4BB6A 3ZW8A 4ABYA 3GIDA 4XRGA 3ZY4A 4GGPA 1F2UA 1R18A 1WD5A 2XE4A 3P7MA 4HO1X 1J2JA 3GLQA 1SUBA 2YW9A 5E0KB 4N39A 5EZYF 5A9TA 4MKHA 3N2IA 5FUXA 3WLQA 4O4HA 1ZCJA 3IQZA 4LE1A 7YASA 1U9CA 5CMLA 1XQXA 2GZAA 3Q9SA 2PUWA 1SXQA 3M6IA 4KIUA 5IUKC 2VQDA 3A1FA 3RRFA 1J7KA 3L0SA 2AW5A 2KMLA 5TQ2A 3VFDA 3U4QB 2EERA 3CG0A 3UH0A 5TS2A 2JJQA 2OXCA 2HQOA 4F7DA 4BX3A 3L46A 5IM4A 2Q3FA 3OFSA 4PG4A 3STUA 2EX0A 2KI5A 3I9FA 1C1DA 4KXFB 4UAJA 5ARDA 3K9FC 1S8AA 2VUHB 1G17A 2V3VA 4GICA 3PPIA 2B37A 3IOYA 5D01A 5BYAA 1L5ZA 2G28A 4LS3A 4ND4A 2UZ3A 5TX7A 1YIOA 2OYRA 1ZZEA 1T3SA 2VHYA 3CF0A 3GRPA 3ND5A 3MOGA 1VPVA 5AK3A 1SM4A 3VBCA 3O82A 2VN8A 3I23A 5FLKA 4XIGS 1GL7A 1TCUA 3DV0A 4MWBA 5FRDA 5K0GA 3UHOA 4JP8A 4W9NA 4DV6B 2DQZA 2BTEA 3KSZO 1GEEA 3A7DA 3KXDA 2IYTA 2DBZA 2POQX 3F6EX 3HB7A 3NHJA 1TA9A 4LXXA 9ATCA 1S2GA 4Q16A 4PVDA 4JVNA 3QTBA 4OL9A 2NG1A 3EXG2 4AIIA 4V0KA 2QXUA 2R97A 1H69A 2PEYA 3E03A 2JD1A 4FFBB 4KFCA 5JFGA 5KYYA 5A7GA 4N7JA 1U2ZA 3OAAD 5G4KB 3KEGA 1FZTA 1NQAO 1AK9A 1Q20A 3NHMA 3OCJA 4PYMA 1ZD4A 5ECYA 3KZXA 1F2VA 5I4CA 1H6BA 1BD3A 3MG9A 3GLFB 3HSKA 4G4IA 4R84A 3C41J 3PXUA 3FNFA 1XKLA 3K6SA 4HATA 1KQ3A 2NOAA 1V7QA 3LF2A 5BV1A 3NHWA 3OQPA 2IUYA 2OCYC 3IHWA 4BVEA 3JQBA 4IAOA 3CUUA 3O2SB 3R7LA 2GM5A 4YCBA 1QIMA 3TZQA 4TMXA 1GTVA 1CE8B 4DOMA 3EEOA 2AE2A 1VE1A 2TMDA 4MQ6A 3BMCB 2OORA 3NOQA 3TX6A 2Z2ZA 3NANA 2TMYA 5FQOA 4YMGA 1CUUA 3DKVA 1NN1A 2YS6A 4DA6A 1PVVA 3KJQA 4N54A 4QUHA 1U2RA 1XMIA 3WJ1A 5DB4A 5FWNA 4KVZA 3WLOA 4JXXA 2A5FA 1W5EA 3BSSA 4E13A 2BEVA 4L5IA 4NCIA 2FZVA 2PU7A 3EGEA 1U5CA 1W44A 1UM9A 4P35A 3R7BA 4QBGB 5D6OA 3HPRA 2HF9A 3EXAA 3FCXA 1DLJA 1IOVA 4JP2A 3LPCA 1BVUA 4CTMA 3C3PA 3F71A 2IEIA 2BI8A 2ECPA 3G5TA 5A3QA 2ICAA 3B7GA 1ZRNA 4RFLA 3GC6A 1NOJA 2F3UA 1LLCA 1S3SA 2XDYA 2P2NA 4KH0A 2QN8A 4GWKA 3HR7A 4J1NA 4OHMA 4ENVA 3GZTB 1MFPA 4WBXC 4C21A 2VRCD 3NHUA 2BFFA 2QW0X 2GEKA 3VV2A 1JA9A 2G4LA 3JYQA 1FJHA 4FSXA 2WHQA 4BVKA 3A9TA 3ER9A 3IXQA 5E3HA 3G17A 5IKMA 3CNNA 3OZWA 4V0ME 1LUAA 3M4JA 4OXNA 4WCFA 2VQEB 4DSUA 2C0QA 3B9PA 1NNI1 1PK7A 1PT8A 2XUGA 3K0FB 1AK1A 3SZMA 4DIFA 2A33A 1FS6A 2GFIA 4DM7A 5AFSA 1GUYA 3W2IA 1SD1A 4TLLB 2Q4DA 5JE8A 2R8EA 1TF7A 2G6BA 3LT5A 1DKNA 3RVOA 3VKGA 4O4LA 5DSXA 1G3QA 3REOA 1A7UA 1PLKA 3OLWA 4ALIA 2VRNA 2XXJA 2DY0A 4HFRA 4F5YA 2P9QA 3JASA 4X61A 2YV3A 5C18A 2IZ5A 5GGXA 2D0IA 4UVGA 1DEHA 1HTTA 2MJLA 5DHFA 3KQKA 4FNMA 1YKSA 1EUCB 4RDCA 3V8PA 3VR3D 5FPTA 3UTDA 4ACAA 4QREA 4YJ2B 2XMQA 4A5OA 3B48A 2BW0A 2OOSA 3A31A 4IIVA 5KQPA 3MS7A 2VP3A 4Q15A 4BE9A 5AVJA 5KSWB 4UPEA 2D3TA 3R20A 2WD9A 3N05A 2VT7A 3OZGA 1W35A 1QFSA 3NZEA 1P80A 3MOSA 3QHAA 5T4BA 5CX1B 2W6ZA 1Z8FA 5FQNA 4FK8A 4WVFA 2R1UA 5J4HA 3I9KA 3GNSA 3F3MA 4JJKA 3AXTA 4A15A 2FTKE 5L7WA 3EOZA 1KYVA 1CZHA 1A72A 1V25A 4G4SO 3I62A 2AF3C 1TO6A 5TB5A 3LPLA 4MUGA 4RMJA 1R37A 3T38A 1NR5A 2J6BA 3WLSA 1WOMA 3MOIA 1TYDE 3FAKA 4GZ3A 1ODSA 4R1MA 3U26A 3HYNA 3IDZA 2BGLA 3DPSA 2QRGA 4G8BA 9LDBA 3DEKA 1J00A 2VO1A 4ZARA 1AUXA 2J3MA 5CVCA 4C07A 2RGGA 1O87A 2FX5A 2I99A 3EQZA 3P19A 3UGKA 4CM6A 3VC2A 2HK6A 1Q3HA 4C89A 4B3MB 2A78A 3K5WA 4R3NA 3RUDA 3FNEA 5IVIA 2HCRA 3PLNA 3L7NA 4O2BA 4DIMA 1VJTA 2H5JA 5FH9A 2O59A 2ZAIA 1SWWA 1UWVA 3AUKA 3I6QA 4R69A 1QAOA 2R48A 4MSUA 4PPQA 1Q22A 1O57A 3GJ7A 4JIMA 3O8NA 3TLEA 1XEWX 3ZDRA 5KTOA 1SUWA 3FPFA 4CETA 4TL8A 4F04A 3L43A 3MT8A 2V7QD 4NENB 5EE5B 4IIUA 4N4AA 1N7JA 3T7AA 2GKGA 2Y4OA 3F49S 4D98A 1KAMA 1O89A 1MIHA 4PZYA 2CE7A 1AZSC 4ETMA 4OBBA 4IHJB 1JVBA 2COUA 4IIJF 4EVIA 1AO3A 1PFKA 2WTBA 5GADl 5C31A 4E4YA 5AUPB 3VR1A 7REQA 4HX9A 2WY2D 1YDWA 1ZYUA 4S0XA 3QEMB 4O8CA 4X6UA 5EXXA 3SX2A 4EQ6A 4EKEA 3SDBA 1ZJ4A 1XMXA 3UV6A 4UTNA 5JQGB 3D6HA 1FY2A 2EP7A 1UBRS 2YWCA 4Q9LA 1MVNA 3I37X 1QBKC 5LP1A 2FYTA 2VPTA 2FUEA 1XSEA 1E3EA 1WCXA 2PBRA 2PX3A 3ORQA 3P0RA 3BX1A 5FORA 3SVZA 3RRBA 4AMZA 4PLVA 1FXWA 2OKGA 2ZI5A 3SLGA 1EVQA 3EZNA 3MGBA 4AO8A 4OHWA 4L5BA 5H70A 2QD3A 1RLOA 3ND6A 3MRTA 3QVXA 1WUTA 3BJRA 1BN6A 4BX0A 2E5LB 4CEHA 2AR7A 1OX5A 3SF8A 4XGIA 1UANA 2VA9A 3H83A 3IT3A 4EY7A 5LOVF 5KPJA 1WMFA 4YRIA 3BIFA 4ZVSA 4EFLA 4HDRB 2ZE6A 4RZ2A 1P81A 3CPHA 4PANA 4Q02A 3Q2KA 1VSTA 3P9NA 221PA 2Z5VA 4PYKA 3N59A 5LYJA 2FPSA 5ALOA 4ODIA 2NO1A 3T7IA 4JLDA 4U2DA 2XCSB 1TQ8A 2H1CA 4J0QA 1EK0A 4N3NA 3O73A 1ZD8A 3NTRA 3BK7A 4LRSB 4Y9DA 5FA5A 3RAGA 1RM4A 3TLAA 5IUJC 5K8TA 2C5BA 2EJVA 3T6KA 5B5SA 2RB4A 1JX6A 7AT1A 5IFLA 1L9XA 4EPXA 2P6UA 3L0YA 4D02A 2IUEA 4Z3OA 4ND6A 1OX4A 4Y2SA 5JEDA 2ZW9A 1HEUA 2WYIA 4JC5A 5G53C 4ZEOA 5DSZA 4RYDA 4FN5A 1CJTC 4RKRA 1FYFA 1OAAA 2CLIB 2EKZA 4BRSA 5A4KA 4PG8A 1HT2E 5KOJA 1EGHA 3T9CA 1LDYA 2QVGA 3SEZA 3B70A 5KYNA 3EPHA 5ITWA 3F6YA 1J0XO 2LTAA 2AHRA 5J2TB 3WZMA 1E66A 3AIMA 2WTEA 2C20A 3N2GA 4TROA 2K7ZA 3C5HA 1CVRA 1H8HA 2RGRA 1OBFO 4PLHA 2O8BB 3K35A 1USGA 1CUGA 4KXLA 5ED0A 4ARSA 3G13A 3A4LA 1E3WA 1T1IA 1KU6A 2PGAA 3P5SA 4FEYA 3RFTA 2R8ZA 1ZXLA 2OAGA 2Q5EA 3L8HA 4DC1A 4EUHA 3ERCA 1V6AA 2PKQO 3IUYA 2XRFA 4A92A 3RADC 3OMLA 4JX9A 4DNXA 3RK4A 2O2ZA 4W9NC 4YPFA 1PL7A 5DBEX 4EF4A 1II0A 2EFEB 3QWHA 1U11A 2H1LA 4EO4A 2XXAB 3UGTA 2IP2A 5K8LA 3KEOA 4XR4A 3UAYA 5CH5A 3PHHA 2BFDA 1GGKA 2HFKA 3HFSA 5AJZA 4BCBA 2Z6UA 4CLOA 5KQSA 1ULTA 5H7XA 4DBLC 4I9UA 1N75A 3E7PA 4HQNA 1G0NA 5G0VA 4HQ0A 3I4CA 5CH3A 1BJTA 3BXHA 1NX9A 2W4QA 1X94A 2ATIA 3ZTTA 4C0KA 3REQB 3PE3A 1UZNA 1UOQA 2H6EA 4NOMA 1DAHA 3HY3A 4NCNA 2A1IA 1IUKA 2IZ1A 3RRNA 4H16A 3CISA 4CKBA 4E5YA 4R1TA 5DYNA 1CJUC 4RTSA 1TQ2A 3GA0A 5H80A 4DQVA 3MT7A 2PUAA 2AWOA 1UZAA 4EDHA 1E4OA 1ITZA 3FMPB 2BGIA 3M1YA 2W37A 4QOIA 4RGVA 3ID6C 3WL7A 1SG6A 4X8HA 1W2WB 1Z2DA 2VJQA 3KEMA 5CP8A 3T0IA 4BNMA 3FOCA 3DLBA 2Y0BA 1ONBA 2B61A 1GNPA 2WC1A 4HYQA 5LQJA 1FP6A 4JOCA 4XOIA 3TQTA 3QQPA 3LA8A 2WVJA 1L7MA 2ZCUA 3R6GA 4PLTA 1H1LB 1EK1A 1JLKA 1GU7A 1L7RA 2I4TA 3KKMA 4WXRA 3V4OA 4I5GA 1W94A 2B3DA 1L4EA 1GGEA 1L5QA 3RIXA 1FJXA 4EB6A 5KYXA 3L4EA 3A3OA 3AZPA 4IDAA 1KZYC 1Q0HA 5ARCA 3B3QA 4DCUA 3AW9A 4LSGA 4FVTA 2NPFA 1PS8A 3ENVA 2UXBB 1ELOA 4WDQA 3RKUA 1WPQA 2BI4A 3CNBA 3EODA 4HEHA 2QRVB 2CNLA 4MCAA 4MUYA 1YJCA 3C6MA 4S1OA 2YFKA 1ZH4A 2CL5A 3MGCA 2H1VA 3LH5A 2GM4A 3AFHA 3ND9A 1YT5A 1XF9A 4MR7A 1URPA 2PQMA 2XYPA 3NI2A 3W6ZA 1SQ5A 4CT5A 2GEJA 3WIOA 5ADWA 3VU8A 1MABB 2J1LA 1R9GA 1FFCA 3F5MA 3QE3A 4R41A 3RV3A 2ZVDA 2P77A 4ND5A 4RF2A 3UJ8A 2C4HA 2VTBB 5EFZA 1JU3A 3LC2O 3ZU4A 3V3TA 1C8BA 1LI5A 1WXGA 1SVKA 3L7OA 3F90A 4CDGA 3BCUA 1JDJA 3DM9B 3A3KA 3BBPA 3VDNB 1ODKA 1S01A 4MGYR 4Q7QA 2R7MA 4INJA 5E0OA 5FL7D 2IPLA 1NW9B 4P98A 3THSA 4HDSA 2FRDC 2NO5A 1OFTA 2ZIXA 5E6SB 5TS3A 2OVFA 1DKPA 2SKCA 4I2NA 1ZCAA 1JG1A 2DQYA 4GPZA 2MSWA 2EX4A 1CY1A 1T5LA 4KR7A 1NRWA 4XGRA 5LKAA 3MGGA 1YB6A 2CFSA 1B74A 2YUTA 1OZHA 2PKYX 1YXMA 2DP4E 3K6JA 4EA8A 1W75A 3QKSB 4OA5A 4LTDA 2RGBA 5A0VA 2X1LA 1IN7A 1EDBA 1GXSB 1PJAA 3PTZA 4WQMA 3RIGA 4E12A 1TVKA 1EI9A 4KDRA 4EJSC 2BKEA 5ITZA 1CXZA 4K7JA 1DKOA 1L4UA 1TD9A 3HUTA 4FW8A 5LC1A 4G8JA 3IT1A 2OECA 3FCYA 3IUBA 3AR8A 2HCFA 1LQ2A 2PQ2A 3PDHA 4MYSA 4LX0A 4QDZA 5EN4A 3UOGA 5I8PA 2FDCA 4ZV7A 4IFTA 4OCZA 1GA6A 4DAOA 3EB9A 1UJ2A 2O48X 2WJ3A 4Q9KA 3VR5A 5EXTA 3IAXA 3JR3A 5AI0A 2PZJA 2OGUA 3O7MA 1YA8A 3WADA 2QRPA 3FWZA 2R6R1 4X20A 1YU9A 4WFKA 2R8OA 4D8TA 1GAQA 4ARIA 1EX7A