1UFQA

Crystal structure of ligand-free human uridine-cytidine kinase 2
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
212
structure length
212
Chain Sequence
b'EPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine-cytidine kinase 2
publication title Structural basis for the specificity, catalysis, and regulation of human uridine-cytidine kinase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 68
structure length 212
sequence length 212
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.48: Uridine kinase.
pdb deposition date 2003-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00485 PRK Phosphoribulokinase / Uridine kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ufqA00
3KB2A 2E9SA 2ZU6A 1Q1BA 2J0UB 2VA8A 1EFHA 3PQCA 4QBFA 5FTKA 2GJ8A 4IDQA 4PSAA 4Q01A 2IS4A 2YJTD 2JEOA 1UJ2A 3CRQA 4MYUA 4R71A 5H70A 2GEUA 5G53C 2IYZA 1DELA 3FHOA 5F2EA 2RGNC 3OFND 2VP4A 1VCOA 2IS6A 5FOTA 3VNUA 2Q21A 3AP1A 3GFPA 2FZLA 2ZI3A 5ELXA 3H2YA 4V0LA 1LTQA 5HZKA 2D06A 1CXZA 4R2HA 2YOFA 2ZJ8A 2H18A 2WSMA 2BEJA 3GLIE 5JZVA 4W5HA 3FMPB 4QRHA 3NH6A 1KO7A 3U5ZB 2D62A 2F1RA 3GD7A 2GRJA 2XXAA 2QMUA 2ZXUA 5LDDC 2AK2A 2LWIA 3LBNA 5DH9A 2XTZA 4QXAA 1JJVA 4M21A 2HJGA 5DN6A 3ZZTA 3TUJC 1S4QA 4X8HA 1KO4A 3PITA 2NPFA 2CVFA 4ACAA 1TEVA 2LKCA 1IHUA 1IXSB 1SKQA 2O8FA 1VYTA 1W2GA 3OAAA 1XJCA 1GWNA 1LS6A 3PUYA 5L3RA 4IDOA 4JJKA 2ZE6A 4C0BA 1KJZA 2IWHA 4MGIR 3FKQA 2H8KA 3ADCA 3RLFA 4B47A 2BKEA 2VRWA 4MYHA 4ZKEA 1AM4D 4NHOA 1QHSA 3CR8A 2ZRJA 3LVRE 5HCNA 4DKXA 2V3CC 2J1LA 3VMFA 1UAAA 4PZLA 1XWIA 2H5EA 3QVUA 3VR3A 4QGGA 4L15A 3NC1C 4YONB 2XGJA 4LBVA 1E3MA 5EXSA 2D4HA 5K8LA 1M7BA 4B71A 5TARA 2W6ID 5DSZA 2ERYA 4LDJA 2NO0A 4LV5B 2JJ1A 4NDZA 5EUQB 2FPLA 2JJ8A 2FGJA 1M8PA 2QPAA 2GBLC 2XNDD 1KI2A 3J81k 1FL9A 1FTSA 5SZJA 1YE8A 2ZAMA 1W46A 4DWJA 8OHMA 3AVQA 4HB0A 1EESA 2ZSFA 2G1JA 2J45A 2GK7A 5JEEA 3A37A 3LY5A 2ZR7A 4BE7B 2ORVA 5CITA 1G4UR 1UDWA 4K8OA 6Q21A 3TJZA 3BXZA 1ETUA 1XNJA 4RZ3A 1E2HA 2ZREA 4IDPA 3VKWA 3QE0A 2B8TA 2KWIA 2RAPA 3I5XA 5J4HA 4MQBA 2PZFA 3GJ8A 4LPKA 5B57C 4AY2A 2ZYVX 1R6BX 4K81B 1WXQA 2N1BA 4OK3A 4DSNA 2PJRA 2IYYA 2FMXA 4IFBA 2FWRA 2MSEB 4HDCA 3ASZA 1ZM2A 5HPYB 1PUIA 4Q4HA 1M74A 3SJAA 4LHXA 2XNSA 2TMKA 4PXAA 3FHTA 2QA5A 1GZSA 1UKEA 2ZRCA 1G3QA 2OCYC 4JJZA 1I4DD 4HLDA 4HAUA 3QG5A 4QHSA 2J0SA 4P3YA 4L5BA 3VTKA 3GLHB 2IXFA 2ZE5A 3CIOA 1ZC4A 1PLLA 1N2CE 3FFAA 3W90A 4B2LA 4BEJA 5FR1A 3ETLA 3UMFA 4IRUB 1Z0KA 5TY0A 3WYFA 4DT1B 3EC2A 2OCPA 2QI9C 1FOEB 2Z5FA 4C0LA 2REOA 3WHLA 4B75A 4BFSA 2ZJOA 1NF3A 3ZIAA 3GLGA 1P9NA 2C9YA 3A4MA 3U3JA 2WKRA 3C4JA 3CNOA 1AZSC 1R0XA 1VG1A 4IEEA 1MR3F 4KSCA 3RNLA 1ZM3A 1BYIA 2OXCA 1XX6A 2QRNA 4MITA 2OFXA 5JSZA 4HYYA 1AQUA 4C0JA 5JI2E 5LB4A 3V4FA 1Z0DA 1W1WA 4AIIA 1CRQA 2WSSA 1E2LA 4JBXA 4NPHA 4ZV4A 3AKEA 3CZPA 1Z6YA 2QTHA 1PLKA 2ZJ2A 4V0OA 1YR9A 3GLFA 4PPNA 5LBIA 3AVXA 3UWOA 1JAIA 4GOKA 3ZS8A 1N6IA 5H1YA 3T1OA 4CT5A 4Q21A 1MH1A 4R9UC 3ZIAD 3AM1A 2R44A 3DKVA 4Q4LA 5JJKA 5DYIA 1KK3A 2NZJA 4OKSA 4M1OA 4IKEA 4W7SA 1UBEA 3A6PC 2G0NA 3QKSB 2ZSBA 4Z1MA 5J4LA 2ZAOA 2BBTA 2OBLA 2ZJAA 1XPRA 5EP2A 4IW3B 3BS4A 2ZS7A 2IXGA 2HDNB 4LYAA 2JIZA 1D9XA 4FWIB 1G8GA 1O3YA 5C18A 1AGRA 5KDLA 5FBVB 1C1YA 4HUQB 2YC4C 3QG1A 1YZKA 1U0HC 2OLJA 4JSTA 4BLSA 3RAPR 5TB5A 4RD0A 1VCMA 2V7QD 2PZGA 4E03A 1KI8A 3LO5A 2OM2A 3R8CA 1LF0A 4ZIRB 5C1BA 4M1TA 1NNEA 2ASEA 4P4TA 1NVXQ 3LX5A 1F60A 2YYZA 1CR0A 4TQAA 1S9HA 3CPHA 2Q3MA 3DEFA 2QP3A 4QHYA 3OIYA 3ZVLA 121PA 4IVQA 4O25A 2QQ0A 2RHMA 1U8ZA 2X77A 4ABYA 5GADl 1XTIA 3IUYA 4Q1BA 3ZLJA 1B0UA 3WMEA 4FMBB 1LFDB 4PQFA 4Z1MD 4PAOA 5JCPA 5LPNA 4BECA 2WWWA 4KYIB 4PANA 3A36A 2DFLA 3L43A 2W83A 1LVGA 3AVPA 5KHOC 4OHXA 1AKYA 4RZ2A 5HE8A 1E98A 1E2FA 1I4TD 2QMOA 1HUQA 3P26A 4HB4A 2HT1A 1E6CA 2J7KA 3AF3A 4FCTA 1NMZA 2Z0MA 2NIPA 5CM9C 1EGAA 1OXVA 1JPJA 2CMKA 4WXRA 3K0SA 1G64A 3WHKA 1Z47A 1ZIOA 2FF7A 3RS5A 4FMDF 4CDGA 2O5VA 4W9MC 2G0TA 3KTAB 2ZJBA 3C15C 1AKEA 1Q44A 1RVDA 4DLSA 1JR3E 1KY3A 4KYUA 4HLUA 4XWAA 3WYGA 3B8HA 3VU9A 2QORA 4EUNA 2IYLD 1YZUA 4LGMA 1ZP6A 4A2PA 1FNNA 4GNKA 4B34A 1XEFA 5HTKA 4ZDIA 4DLXA 1KMQA 3ZD7A 3AP2A 3OIUA 4HAVA 2D74A 3IIJA 4GMXA 5DE3A 3MMPA 3RS3A 1TX4B 2F9LA 3DPUA 4IDNA 4CYMA 3A1SA 1FQKA 1M1YE 3THYB 4TYWA 4N1AA 4B3DA 1Z3IX 3CH5A 2ZRMA 2Q3FA 4BUJA 5FTLA 1ZIPA 2GCNA 4Q7KA 1GKUB 4QGAA 4B76A 4QM7A 5C46F 3DZDA 3M6AA 3A1VA 1TUIA 4OK5A 4BZXA 2Q9AA 4P4SB 2BBSA 3RC8A 2LCFA 4L9WA 5FPSA 4PR0A 2GVZC 1FNMA 3TQFA 3F3YA 1HH4A 1EWQA 3RDPA 2H17A 3EG5A 4R2IA 4CEIA 3W8RA 5JLJA 1W47A 4JLPA 1RYHA 3KL4A 1J99A 3BAFA 3I1FA 2FDCA 2NO6A 4ON9A 2ZSDA 1E0JA 4NKRA 4DIDA 1FTNA 3AVVA 3I72A 4G5SA 1SGWA 1G7CA 1IXRC 5BN3A 4OHYA 2O8DA 2RGBA 3WNBA 2P67A 2A3RA 1YR6A 1F2TB 4CF7A 3T5GA 2ZRHA 4E07A 1YHNA 1T6NA 4HAZA 1JEDA 4X8OA 3X1XA 1TU3A 3K70C 3FMFA 1CJUC 1R2QA 2GKSA 1XZPA 4UNPA 1GITA 5AJVB 4ZI2A 3IQXA 3Q5DA 4TYNA 2F43B 4OHWA 2VLIA 4BFXA 3OE7D 1GILA 4M22A 2I4IA 2C78A 3REGA 1Z29A 2HXSA 1IM2A 3U3RA 4D4JA 4DCNA 3H86A 4EFNA 5AUQA 3KX2A 4EFLA 3KQNA 1SXJC 2P6NA 2HLDD 1N5IA 2ZI7A 5FR2A 3GPLA 2YINC 1X6VA 1MO6A 4DUGA 3NHBA 2FOLA 3NXSA 1W7AA 2F3TA 2PMDA 3F0TA 4DVGA 3LAWA 1OHHD 4AKIA 3AF2A 2WWIA 4POAA 5EP4A 2DY1A 4AG6A 2X8AA 5D3QA 1XTRA 4EAQA 4LHZA 2CNWD 3AB3A 2DPXA 3W8NA 4CEHB 3RHFA 2XX3A 4DLWA 4H1UA 2ATVA 3EZ2A 1EG7A 1RFLA 3LWNA 4Q4AA 3JZAA 421PA 3DOFA 2BV3A 1OH6A 2V54A 1YZQA 4I1UA 5JRZA 2VHCA 3AVWA 4DCSA 1S8FA 3RS7A 1OIXA 4LJ5A 2KE5A 2WICA 2HT6A 4AKEA 4HLCA 5EE5B 2JLUA 4A2WA 1DOAA 1T0HB 4BLOA 3AVTA 1E2GA 2EFCB 2UKDA 2PX3A 1W0KA 1UKYA 4TZ6A 3KJIA 2BM0A 4I1VA 4LJYA 1XMSA 2FSHA 2HEIA 4XTRA 2CK3A 1Q20A 3KXKA 2PMKA 5TXGA 4C7OB 2VP2A 4PC7A 4URWR 3RWMB 1H8EA 1XD8A 3IQWA 1TF2A 5E95A 1EFRA 4JL6A 3QEJA 3B9QA 1Q21A 3AF0A 3C14C 1GL6A 2UZIR 2J9RA 4Q9IA 3K09A 4ZDWA 2NO9A 2WHXA 3BORA 1IY2A 1E0AA 4G1UC 3TMKA 1HY3A 3CF2A 4Z8XA 3VQTA 3VR6A 4A6PA 1XBTA 4MKGA 2FG5A 4RCZA 4JLKA 4RVCA 5KNBA 1SZPA 5IRCD 3ICQB 4C2TA 4DSTA 2PCJA 1KI6A 4NYIR 1XD2B 2VSFA 5EE3A 5FL7A 3AVOA 2WWXA 3QKUA 4US1R 2A5DA 4EPTA 4Q4JB 3SZRA 1Z83A 3IEVA 1TF5A 3PXGA 1RE0A 3L0PA 4LI0A 5SZHB 3U44B 3BOSA 1JALA 5BN5A 1G8HA 1S0UA 2Y8EA 4C0HA 2ZM5A 4PPQA 1NP6A 4JBWA 2F1JA 4LJ6A 2V9PA 4IXMA 2GXQA 1U9IC 1FUUA 1ZM4A 2EYQA 2VTKA 1NLYA 3Q9LA 1T9HA 1NN5A 1NBMD 4HATA 1US8B 1W49A 3JVVA 4KFUA 2QPTA 3KQUA 5G3YA 3CH4B 3PG5A 2ONKA 3EPLA 2D2EA 4LYFA 4BQSA 2FSGA 3PCRB 5IF9A 1GG2A 1N6HA 1TNDA 1G19A 2FFQA 2O0HA 4E5UA 1G6OA 4JLBA 5FPTA 3CB4A 2FFBA 1H8HD 3VKHA 1XCMA 3KJGA 1NY5A 3DZ8A 1GKYA 5LB2A 3B5JA 3GJ7A 3OF5A 4IOMA 1N5JA 2JJ2D 3R9IA 4A92A 1RC8A 2JGNA 1NSFA 1P6XA 2VHUA 3BWDD 4NCNA 2XTMA 1KDTA 3ZJYA 3IILA 2Q9BA 4A15A 3K0CC 4V0MA 3I8XA 3WP0A 3U61B 2ONJA 1KI4A 3EA5A 4JKYA 4QBIA 4I1OA 2JLYA 5DLQC 2WV9A 3BH0A 1G3UA 1K5DA 4M9XA 4TL6A 1IQPA 4LK2A 3RS2A 4ASUA 2HV8A 1PUJA 4OBEA 5BQ5A 2CCKA 4QJ3A 1W36B 3BBPA 3K9HA 2ZQ5A 3CRW1 3FVQA 3P27A 4FW9A 3GP8A 4L4UA 2IHBA 2FGKA 2GAOA 2X1VA 4F91B 1OKKA 1RW4A 1FQJA 4IOKA 1G17A 2AN9A 3JVUA 3OEED 3O8CA 3BJIC 2G88A 1GUAA 4PO8A 1UBGA 5DO9A 2WMNB 1D2NA 3CM0A 3HU3A 1N6LA 5HKKD 1A1VA 1COWA 2D2FA 1II8B 2QTFA 3BH6A 3QKRB 3O8RA 1SVKA 1P5ZB 4Q7JB 1G3MA 4TMXA 2IXEA 3P1JA 5B58C 4UJ3A 1UM8A 4RY2A 4YMVA 4MA4A 1Z07A 4OQNA 2WIBA 3D6TB 3SOPA 2R6AA 2WOJA 3GFTA 1KO5A 1O87A 1GNQA 3TR0A 4AKGA 1DE0A 1ZM7A 4I81A 1WA5A 3BK7A 3HU1A 2O52A 5AJYA 4OQLA 1HE1C 3IHLA 5EQTA 1IJEA 2J0QA 4WOPA 1E9FA 1I2DA 1U98A 1KKLA 2VF7A 3THWB 4CVNA 2ZR0A 5A4JA 2CXXA 1EX7A 3KB1A 1SVSA 4OQFA 4ERNA 4RD1A 1E9EA 4H9GA 4WAUA 1E9CA 3TQCA 1KI1A 1R7RA 2A5GA 4NYJQ 2R2AA 3GLGE 4ZPXA 2YKGA 1KSHA 5GVSA 4KBGA 3EWAA 2IBMA 2IUTA 3THXA 1B23P 3FKSD 1E2MA 3CX7A 4CT4B 4YXWD 5F3WB 4WW0A 3PEVA 4G5GA 4PHGA 4Q48A 4B33A 5KPDA 1A7JA 4FMCB 5FUVA 3FGNA 1OSNA 3F8TA 4AYXA 4IVPA 3PENA 2RGCA 1W36C 2CEAA 1ZD8A 3OIVA 1LNZA 1R0WA 3HDTA 4TMWA 3AP3A 3B82A 3GLFE 1DBSA 1I2MA 1JXMA 4RD3A 5FUWA 4F7WA 1T91A 1S1MA 2HF9A 4XOIA 1KOFA 2FH5B 4TWZA 3HPRA 1QVAA 5D3MB 4DT1A 4HZIA 1OXUA 2JLXA 1VG0B 2CJWA 4LYJA 2ZRBA 5HR5A 3MG9A 1E1QA 3EZ7A 2I1VB 2CVHA 1W2HA 4JSYA 5HZHA 4ZCLA 2V1XA 1UKVY 4HZUB 3K0AB 4R7ZA 3Q8XB 4MKFA 4BFVA 3KFVA 1YR7A 1KJYA 5JBQA 2YWGA 3DMDA 5CK4A 3DOEA 3EXAA 5EP1A 1G4AE 4CW7A 1IN5A 1NN1A 4XJXA 3U3OA 2XB2A 1FX0B 4GZMA 1CP2A 4BASA 3CONA 2VPPA 3U60B 4NH0A 3G0HA 1X8LA 3FFBA 1SHZA 2NGRA 4W5JA 1OPXA 1U0LA 3A1UA 4EPYA 1JR6A 1G8FA 4AC9A 3U2QA 4O0MA 2W6IA 1JBKA 4F93B 4QM6A 4QJ5A 1W4RA 4YMTA 1DTSA 3K1JA 3LQQA 3X1YA 1KSGA 4EJSA 1SVLA 1A5TA 3UK6A 4QC2A 2XNDA 2N42A 1P61B 3QIAA 1MABB 1KYIA 1E1QD 2CLSA 5DI9A 3UMSA 4JVLA 4Q9KA 5FUXA 4XTCS 3GEHA 3BIFA 5KSPA 2ZRAA 1CJKC 3LLUA 2QBYB 1VPLA 3FPAA 4BLQA 1JECA 1J8YF 1GP2A 1GVNB 2FJUA 5EZ6B 1E2JA 3CZQA 3K0FB 1E79D 4UNSA 2RGDA 3GJ0A 1C9KA 3FHCB 1GKIA 2ERXA 2R62A 1ZBDA 1CR2A 1BH2A 1D2EA 3CBQA 4MDFA 1JPNA 3PVSA 4PHHA 1JI0A 4JLAA 4NZYA 4BRWA 3SJCA 5JEDA 3R20A 2BCJQ 2ZSAA 4AKHA 3FB4A 3QVVA 5FTMA 5IHPA 1WBBA 5BW8A 2EVWX 2AD5A 1VTKA 1DARA 3A8TA 3UIEA 1UPTA 1A2BA 1NLFA 4ZIRA 1BMFD 1DS6A 4XSHA 4OYHA 5BYKA 5IK2D 1KI9A 4TMKA 1ZAKA 3UG6A 1DG1G 4P31A 3GJ5A 2GCOA 3C7KA 1QZXA 3TH5A 4DDUA 5TMPA 3PEWA 4MUAA 3AGQA 4JL5A 1OB2A 1YKSA 3FTQA 4GSYA 3GJ3A 2RCNA 1VG9B 4DXAA 4C9BA 1LV7A 2WMOB 5DHAA 2O8EB 1OH8A 1RJ9A 4RD6A 2R6FA 4HB3A 2KSQA 4RJLA 2J87A 1CF4A 3KXIA 2CLDX 4WZAE 3QF4A 3EIHA 4F92B 2GK6A 1FMJA 1KSJA 3W6NA 3L0SA 2WJJA 1P2UA 3U3MA 1XEXB 2BHRA 3OHMA 1CR4A 3TSZA 2XTNA 4XH9B 2XOKD 1QHIA 4MRPA 2WKPA 3WRXC 2BCGY 2W2TA 1MV5A 2BDTA 1E94E 2JDID 3D31A 1HQCA 4GOXA 2NPIA 1TL7C 3OEHD 1YRBA 3Q7QA 4NCHA 1NVVR 3B85A 1ZD1A 4ESHA 3KTAA 4P33A 1OT3A 3WBKA 3W3AA 4QHTA 2ZVQX 5FBQB 4TMZA 4EIWA 1Y63A 1NY6A 3NKVA 1HV8A 1NG9A 4LOAA 3T35A 4FXPA 1NN3A 4GL2A 2IUSA 2V8OA 3ZVMA 1VIYA 1ZUNB 1UEIA 4URUR 1Z08A 2QP9X 3P20A 5E7JA 3KKNA 2GJ9A 1KDPA 3TBKA 5HCIA 1QBKC 2ANCA 1W5SA 4M2LA 1QHHA 1L2TA 1KI3A 1P4SA 4KVGA 4A8JC 2KBFA 3I4LA 4D0LB 2XEXA 1KZGB 2AR7A 2GEVA 4NCKA 2ZRNA 1GL9B 3V00A 3WBJA 2XZOA 4DB4A 3ADKA 2QAGC 5JECA 3VR4A 3MFYA 4B73A 2UVQA 2FZ4A 5JFGA 4GOJA 2Q9CA 3K53A 1Z8FA 3Q7PA 2OT3B 3DKPA 1GM5A 3CRMA 2L0XA 1M6NA 2PX0A 3BB3A 5EE9A 1E9BA 1NVWQ 3BFVA 2RGXA 3O8DA 1OE0A 1TUEA 1YRAA 1IN4A 3GJ6A 1W48A 4A0GA 1OV4A 2C9OA 5CIWA 1KKMA 4BFTA 4YMUA 1QHGA 3RRZA 1U0JA 3WYAA 2F55A 2AWNA 1KTVA 4TLEA 4RCYA 3QNUA 2AL7A 4WXPA 2AXNA 1NRJB 1U8AA 2Q6TA 1OH7A 221PA 5BWMA 1ZUHA 2V7QA 1Q1QA 1SXJD 4EQ6B 2J41A 4NE2A 2CCGA 5BN4A 2VF8A 2IUUA 2HJVA 1GRQA 2WJYA 1NI3A 2WKQA 2QMHA 4MYTA 1JEEA 3HR7A 1E9RA 2XXAB 3HU2A 4D80A 2PJZA 4C3ZA 4PZYA 1J70A 2IHYA 2FSFA 2IWRA 4CEJB 3LVQE 2EW1A 4I1SA 1ZJ6A 1F5NA 4A4DA 4QOSA 1HT2E 3UKDA 3E2IA 2GZHA 3JZMA 2A5JA 1ZM9A 3L2OB 1F2TA 1G5RA 2WTUA 3DDCA 4MUBA 1N25A 5FOXA 4ZDJA 4PQRA 1CR1A 2OCBA 5TVKA 2O8FB 2HUPA 2WM9B 2E87A 1S9DA 3SN6A 1WQ1R 2WBLC 3B1WA 1KGDA 3ONWA 4BWYA 4TSFD 1R5BA 3A1TA 3R7WA 2P2LA 4KFTA 4U7DA 1JQJC 2O0JA 2F43A 4KV9A 1V43A 3U3KA 1Z2CA 3NWJA 1KK2A 5FFMA 4US2R 4M1SA 2QNRA 2F1HA 4KHZA 3EARA 5L3VA 2JLWA 2OXRA 1KO1A 1XXHE 4EFMA 1UEJA 3LV8A 1XTJA 4HSEA 2OEPA 3EWSA 4AI6A 2EWVA 4G5QA 5ANRB 5P21A 2PT7A 1JJ7A 2J3EA 1N6NA 1VHLA 2MMCA 1VDZA 2IC5A 2ZYTX 2IYVA 4GZLA 4LJ7A 4EPVA 4V0NA 2KI5A 3AF4A 3HYRA 3U6KA 3ZVNA 2F9MA 4V03A 3SR0A 4HI0E 3KJHA 3SNHA 4CEHA 1IOZA 4B32A 2OHFA 2BM1A 1CU1A 2F1IA 2PCLA 3VR5A 4KI0A 1NG1A 4TLBA 2ZRDA 1II9A 4Q7MB 1P75A 1G6HA 2ZS9A 4U5XA 1MT0A 4PPGA 3KZ1E 5CDFA 1RZ3A 1AS2A 1KO8A 2IEZA 2ODWA 4O2LA 1NJFA 3ADBA 1AQYA 3K70B 4LJAA 4PC6A 2DFKB 1S3GA 2OCAA 1G8YA 4M9QA 2D7CA 2V1UA 4C30A 1AJEA 1L4YA 2Z4RA 1HEIA 4WVFA 4MGYR 4IJMA 1ZMXA 1S2MA 4TTRA 4D26A 1G3IA 2W6JD 1RRGA 2HXYA 2YHSA 4NCJA 2MSCB 3K9GA 3AUYA 2RGAA 1SXJB 2O8BB 2MSDB 4B2PA 4MYCA 721PA 4BFYA 1C4OA 1M34E 1TMKA 2CE7A 2Z43A 3L0OA 4RFSB 4QFMA 4Q4HB 3VFDA 5DIFA 5L3SB 3KQHA 3NTUA 3IKJA 3FMIA 3TAUA 2G77B 3NEYA 5EXXA 1XZQA 1XD2A 4BFWA 2NOAA 1CJVC 2GZDA 4KITB 2EFEB 3VHXA 4C0SA 1ZD9A 1P72A 4YC7A 5C4MA 1CS4C 2RB4A 3OZXA 3K8YA 2HYIC 2OAQ1 4TL7A 4AG5A 2AX4A 4DC9A 5J4VA 3DM9B 2J7PA 2CDNA 4M9SA 2ZITA 4IOJA 3U7EB 1VCIA 2FFHA 3CPJB 4V0ME 3QENA 3W6OA 3M0EA 1F6BA 3Q5EA 2YWHA 3MWYW 3NBFA 1OFHA 2ZI6A 4XVRA 3RS4A 3BD9A 3B78A 3GLGB 2P3SA 1XEWY 5FI1B 3OE7A 1US8A 1CULC 2WWHA 1GDDA 2VP5A 1A2KC 1E4YA 1M2OB 1VG8A 4Q9JA 2LKDA 2XSZD 3SHWA 2NTYC 4B48A 1T3HA 4FMDB 3FE2A 3HJNA 2GHIA 3NG1A 4BLTA 3QBVA 3A58B 2HLDA 4RFVA 4JS0A 5CB8A 2J46A 5M04A 4KFRA 3QXCA 1YZTA 2NG1A 4GMDA 1P9RA 1U81A 4CRWB 1OHHA 5AJZA 4P32A 4HAWA 2H7VA 3PEUA 5KO2A 1X3SA 3T1TA 2ZRFA 3TLXA 4GFDA 4FN5A 4D4KA 2ANBA 4KAXA 2CNWA 2DFNA 2VQSA 4KFSA 3GLFB 1R5OA 1VYUA 2FSIA 4QG7A 2BMEA 4ZO4A 2J7PD 5DISB 4ARZA 1E32A 2B8WA 4MRSA 1AIPA 5BXQC 3MCAA 2Z4SA 3TSOA 4KLNA 2NZ8A 2UZ3A 3CF6R 5JJIA 1YZGA 5J5CA 5KSOA 4UQOA 2GCPA 4IVRA 2GVDC 3I8SA 1Z06A 1LY1A 5CJ2A 1MRSA 1OFUX 3SJZA 5FPHA 4DLVA 4MRVA 4PQYA 4OI4A 5JI3E 3K9NA 4Q9HA 1DO0A 4EPWA 3A1WA 3UG7A 5AR1A 2PLFA 5E3HA 1G20E 4B2IA 3GLIB 4TZ0A 5JHHB 1KDOA 2F6RA 1VECA 3BH7A 4BGDA 1T8UA 4M0LA 5AJWA 1VKJA 1XB2A 3I92A 5FOVA 4Q47A 1A82A 4BZQA 3GEIA 3K0EA 1ONBA 5EJEA 2QN6A 4A9AA 5H8WA 1QHYA 2R6DA 2RGNA 4OI2A 2A7QA 1OIVA 1NKTA 3AKCA 1EK0A 4L9SA 1XU4A 4URYR 2IA5A 1ZW6A 4Y0VA 1G16A 3LXXA 2XJ4A 1E2NA 1VHTA 1ELOA 2IS1A 5E4FA 2ORWA 2ODBA 2OLKA 2W58A 3W9YA 3EZ9A 5DGXA 4S35A 3EC1A 3T61A 1WRBA 2D3WA 2OZEA 4NYMR 3WXMA 3T15A 2P6RA 5L3QA 3ZS9A 4DBLC 1PV4A 2G9NA 2CHVA 3IIMA 3IBYA 1W36D 4GT1A 3NBZC 1D9ZA 1W4BA 4UNQA 2P0EA 2R9VA 5A5GA 2AKAB 1L8QA 2HCJB 1XJ0A 2R6CA 3ZGXA 1T3LA 2VSOA 4MKIA 4M8NE 5KDOA 1F2UA 1Q3TA 2IEYA 1HTWA 1W0JD 2BIFA 3KUCA 4IXNA 4DEYA 1SVOA 1NBMA 2VIIA 4YDHB 4DLZA 1IONA 1ZCBA 2CCJA 4TYPA 3W34A 3RRYA 2VEDA 1DG3A 5JJLA 3X1ZA 5FOWA 621PA 5E7MA 1UBFA 2W2XA 3HYTA 2CHGA 3B1XA 1W5TA 1Z22A 2QL6A 4L16A 2WJIA 4PC3A 3BERA 1HT1E 1KNXA 3L0IB 4L8GA 1E99A 3WMGA 1GIAA 2GTPA 3I32A 2WJVA 2WIAA 4TN1A 1H8HA 3O47A 4Z51A 3GEEA 1P9WA 3I62A 3EAQA 2W00A 4URZR 1G7RA 1E9DA 3M4YA 2JJ2A 3UANA 2ZUCA 3U7GA 1ZUIA 4FWTA 3HR8A 2W0SA 4I4LA 3N2IA 4NYIQ 3TGPA 4FI3C 1T5IA 3AH8A 3LA6A 4DDTA 1DEKA 1U2RA 2J0UA 3CF0A 5AUNB 2WJHA 2W0MA 2YV5A 3TW4A 5J4KA 4A0RA 1E2QA 1UBCA 2QROA 4B3CA 1EX6A 5CYOA 3AUXA 3EZFA 5GVRA 4D81A 4B44A 4F4JA 1FFHA 2GBLA 4JYCA 3AEZA 3RWOA 4HLQB 3A4NA 3TR5A 4DSOA 2VHJA 1HYQA 4NU0A 3QXXA 5GJWC 4HZUA 3K0AA 4E22A 4JLNA 4IEIA 1YU9A 2ZTSA 2FX3A 2Z83A 4F38A 1U90A 1SULA 2WWGA 3OEEA 4RZUA 4BPBA 4OI0A 4Q03A 5JWRA 1P2VA 4G5OA 3C8UA 3T1QA 4JZKA 2C5LA 2QAJA 4CEIB 1QG2A 4M1YA 1E2EA 3AGPA 3IO3A 3WNCA 2HYDA 2R6GA 5HKKA 2QG6A 4LHVA 4B74A 4BFUA 4JLVA 2GXSA 4TQUS 3ZZ0A 1OYYA 3QXJA 4N0DA 1YVDA 1GOTA 2QSZA 3QUSA 3LRPA 3NEJA 2IT1A 3T12A 4PO1A 4BFZA 3SQXA 5JCZA 3KDSE 5EXPA 1RYFA 2EQBA 3B7GA 3OESA 2QP4A 2O8DB 1MABA 5DHFA 1E0SA 4Q1DA 4ZDKA 1QDEA 2C04A 3CRRA 1Z0FA 4RD2A 4JLOA 4XD7D 4E09A 1HE8B 4URVR 2QBYA 2IL1A 1G5TA 4LBYA 3G5UA 1F3OA 3C5HA 4N3NA 2CE2X 1YZLA 3RRNA 3V4RA 2ZJYA 5CYPA 2PBRA 1E1RD 4OJQA 4C4PA 3LD9A 2YOHA 2ZU0C 1OIWA 2C98A 4HLUC 1JR3D 4HAXA 1XCGB 3Q72A 4YQFA 3FKSA 1KNQA 4YXWA 3W6PA 3VNVA 3CUEF 2D7DA 2GDJA 2BMFA 2ZRPA 1Q57A 1N0WA 3U7HB 2ZYWX 4NMMA 3R9WA 1NVUQ 4D4MA 2ORIA 1E4VA 2IW3A 4Q66C 1TEXA 4D0NA 4XWKA 3X1WA 1DAGA 3IPXA 3LW8A 4LSGA 1N0UA 4XVUA 4HDQB 1OB5A 2AWOA 1GRNA 2ZSEA 2BC9A 3BGWA 4UXIA 3HWSA 3AV0B 3OIWA 3W5IA 1J7KA 1NIPA 3B2EA 4DCUA 2DWOA 3FYHA 2O8EA 3LQRA 4S2EA 5CK5A 2QMEA 1Y3AA 4TLAA 1QHXA 2ZROA 4D2IA 4UNNA 2O8CB 4QNRA 3AKDA 2X2FA 3SEAA 2PZEA 3NDBB 2DHRA 5GJVC 4LHWA 5AJXA 2AD1A 4A6XA 4DDVA 2CLCX 1GNRA 1T0JB 2RKOA 3GJXC 3NBYC 4B6EA 4C0KA 1VIAA 3CX8A 3BC1A 4YMSA 4AWXA 1XXHB 4DLUA 4KCGA 2DYKA 3VR2A 5KTYA 3UMRA 1GNPA 2NO1A 3FWYA 1QG4A 3ZD6A 2J0VA 2GAAA 2EWWA 4QL3A 1ZNYA 1SVWA 3SBEA 1A4RA 3S1AB 1D8TA 2QZ4A 3NBXX 2ZRIA 3QSYA 2CL6X 2ECKA 3K9LA 3UWKA 4RZXA 4LYHA 4A1FA 3X1DA 4NP6A 1KAGA 3GLHA 4URXR 1ZYUA 2C8VA 2QGZA 4GDFA 3U7FB 1KMHB 3MWKA 5EUMA 1ZVQA 1G9XA 1UADA 3SYKA 5B64A 3RSLA 1FW6A 5H68A 3CO5A 4R98A 3SS8A 1DAKA 3AKYA 3H0KA 4MRNA 5K8UA 5GJCA 1H65A 4A0HA 3PEYA 4YLGA 4KO8A 1J8MF 4OK6A 3CKLA 1ODFA 1GRRA 2B21A 2OBNA 4TT3D 1N5KA 1I4LD 1OXTA 2DFTA 1Q0UA 1MKYA 2FA9A 3N70A 5F98A 1DVRA 3AQ4A 2ZE7A 2YVUA 4G5RA 3A4LA 3CWZA 3L8ZA 2OILA 1E79A 3P32A 1T4GA 2A9KA 3N2EA 1UDXA 4Q9LA 2YNMA 1Q22A 1GL7A 5KSZA 4D6PA 1XF9A 4G01B 1IAQA 5CM8B 2FE4A 3EA0A 3ZH9B 1MO5A 1IBRA 3LXRA 2PLRA 1P62B 4TQ9A 5KYKA 4TLCA 2QE7D 5KPJA 1GFIA 1GTVA 1RIFA 1XCPA 1BMFA 2VSXA 4OHVA 5IK2A 4EQ6A 4KBFA 4HAYA 1RRFA 1WB9A 1R0YA 3VHLB 2QPOA 5JHGB 2VO1A 3PUWA 1M7HA 4RSGA 2PEZA 5FH9A 1G7TA 1XPOA 1XDBA 1SVIA 2PT5A 4CEJA 4AD8A 3SFVA 1E69A 4EKDA 1KK1A 2NO7A 3ICEA 3I3SR 2WWYA 3QKSA 2IYTA 2EFGA 2JA1A 3HPQA 5FOUA 3NVAA 3LDAA 4F4CA 5SZIA 4PSKA 2RH5A 1TTTA 1AA9A 1JQLB 2IX3A 4A8JB 4AYWA 4KJZA 1XEWX 3DO6A 4GI7A 1ANKA 3K09C 2QAGB 3KKOA 2PL3A 2VP0A 5DNYB 2O0KA 4HUQA 4JLDA 4YDSA 3TW8B 2DBYA 2OBMA 5CDFE 3BE4A 1FP6A 1QHNA 4UXJA 3QOFA 5F9FA 2XOKA 4V0KA 4GP7A 4B3XA 2I3BA 2JDIA 3NH9A 1XTKA 5DYGA 5EZ5A 3FDIA 1OH5A 1NLZA 3QEOA 3OEHA 4HEJA 2C03A 4DDWA 2IS2A 4B3GA 2QM7A 1L7VC 1U99A 3T5DA 2VYFA 2QENA 4JVMA 4WZ6A 3B1VA 1PZNA 5DN6D 1NKSA 1OLOA 2P65A 1N6KA 3MRSA 4QBHA 5HE9A 1E2KA 3I73A 2FU5C 2OAP1 2VHQA 5FBRB 4I99A 5FPYA 4DSUA 3REFA 2ZRGA 1VYVA 2CL7X 1MO3A 2JATA 3OAAD 1XMJA 4LPSA 5JWHA 4KVAA 2ODNA 2W2VA 4N0EA 1DAHA 2SHKA 3DHWC 4Q19A 2AFHE 2JAQA 1U94A 1TQ4A 3MWJA 3MGCA 2P5TB 4LX0A 3SDZA 2HF8A 2V55B 3EZ6A 4HUTA 4V02A 3U4QB 3QQ5A 1ZC3A 2GNOA 3MAAC 3ZQ6A 5JS8A 1AS3A 5FTNA 1BOFA 2FPMA 1ZCAA 2ZIAA 1G1MA 1M7GA 3AVYA 1T3SA 3LH5A 5CLLA 4P0TA 1LF5A 5DI3B 1Z5ZA 1GAJA 2B6HA 3MSXA 5FI0B 5UKDA 2OFOA 4AURA 2KJQA 1DADA 3CW2A 4UJ5A 5KSYA 4UXHA 4M1KA 2AFIE 2CHQA 3THXB 2GEDA 3RVBA 5F9HA 3P4YA 5KNDA 1Z6XA 1SXJA 3IDQA 2O8BA 1DO2A 2JJ1D 4OQXA 1NVVQ 5K8TA 4RFSA 5L3SA 4WA7A 2J5XA 3X2SA 2WZQA 3LFUA 1D2MA 2GF9A 4HDOB 3GQBA 1QVRA 1S96A 3SYLA 4JT2A 2BMJA 3BB4A 3QBTA 1TADA 3THYA 1EFUA 2REXB 4JT4A 2CL0X 2A5FA 4LWZA 4PC2A 2R8RA 3KFXA 3KQLA 4Q1AA 3K70D 5E7IA 5BYJA 4LRWA 2ZI9A 4P4SA 2CJWB 1G7SA 4TSFA 1HQYE 3B6EA 2QU8A 4FD2A 4UKDA 1IN6A 5KUTA 1ESNA 1X1SA 1AZTA 2AXPA 2N46A 1K8RA 1PLJA 2X19A 2IYXA 4LUCA 4A0FA 3FMOB 1NMXA 521PA 2WPDA 4PSVA 1GSIA 1N6PA 2JCSA 4D82A 1EFCA 1N6RA 4PHTA 2XJ9A 4QKQA 1RRPA 2QUZA 3QI2A 2ZUBA 3D8BA 2CBZA 2BWJA 1RKBA 4DJTA 4OQMA 1HURA 3CNNA 4DHEA 3FOZA 2NMVA 3T34A 2AKYA 4M53A 4EJSB 2BEKA 4JKIA 4CIDA 3TE6A 5C2JB 4LHYA 1EWRA 4DLYA 5EE0A 1Z6TA 5TDHA 1DPFA 4A82A 1TAGA 2OSBA 3GFOA 1AN0A 4DLTA 1L4UA 3EPJA 4B3FX 3SQWA 1Q3HA 3PIRA 3LBHA 2V4ZA 4B43A 1DAMA 1YZNA 2QRZA 2DWPA 5SZKB 1E9SA 4NBSA 2GILA 2WPDD 2XAUA 2IF2A 3QKTA 1Z6AA 1YR8A 1G3RA 1OYWA 3GLIA 1FZQA 1U9IA 1YJ5A 4OL0A 4UNRA 1Q1ZA 1NBME 2H57A 3LBIA 2WSSD 1SKYE 4A36A 5JS7A 2JASA 3PUVA 1UF9A 5LD2B 1SQ5A 1XPUA 3TUZC 1UFQA 4MH0R 1CJTC 2EFHB 2W6JA 3MD0A 2AK3A 1XD9A 2C96A 3VAAA 4D25A 1AS0A 3WRYC 5KOYA 3SHFA 5G3ZA 4KLZA 1ZNXA 2A2ZA 4Q7LA 4IHQA 4TTPA 1E0KA 3UATA 2GCOB 1S3SA 2WWFA 3WMFA 4U02A 3C5CA 3RANA 1IN7A 1JXOA 1DAIA 4RKFA 2V6IA 4JIMA 2GZAA 3KKMA 4G0NA 1RJ9B 3EPHA 2XZLA 4JLMA 1PJRA 3IIKA 2ODEA 3TRFA 2ZS8A 3TAHA 3QXSA 3WP1B 3H4MA 3K0CA 1KY2A 4GPTA 5FL3A 1FUKA 2C77A 3QF4B 4OHZA 4C7OA 3QY0A 2ZETA 1WDTA 4ZCIA 4X8MA 3PJRA 2OESA 4MKHA 2JIZD 4LCBA 4WZBE 2BOVA 3I61A 2XSZA 4NCIA 4QBGB 1KAOA 5K8IA 2QT1A 3CWQA 4KU4A 1IXZA 3RYTC 1CLUA 2H1LA 4QGHA 2WAYA 2FV8A 1II0A 3L82B 1ESMA 1KK0A 2VL7A 3PUZA 4BLPA 2ZE8A 4XVQA 2XZPA 4DEXA 2GJSA 4EJSC 4PTLA 3GCGA 5KU1A 2ZR9A 1P2SA 3SC3A 4BZPA 3DMNA 5GJBA 1P73A 4Q4JA 2GESA 3UXMA 1Z28A 1MRNA 1T5LA 4PFSA 3NDPA 3NIBA 4CGZA 1IY0A 2ZRKA 3U44A 3SJBA 3KKQA 1BO6A 1TQ2A 2A30A 2HCBA 5JWOA 4Z8YA 1R0ZA 4B35A 3CPEA 2BJWA 5G41A 1XMIA 1K6MA 1QHHB 5KDDA 3ZDQA 1Q12A 2RMKA 3QPWA 2EYUA 3P4XA 4BRUA 4RD4A 3L8YA 5LD2C 1BYUA 2PH1A 1CEEA 2GF0A 3LX8A 3EPKA 1ZRHA 3ZVRA 4DLRA 3AF1A 1PVOA 1FPMA 3RRMA 1Z0JA 4HB2A 5JSZB 1CKEA 3U6BA 1F48A 5B30A 1IN8A 1ZINA 3ADDA 4MGZR 1P60A 3EASA 4QJ4A 3T06B 3PR1A 2QSYA 2H16A 1X8KA 3N5CA 1OJLA 1NL3A 1W4AA 3M1IA 2B7BA 1TF7A 1R8SA 4PZZA 4AYTA 3IHWA 3PUXA 1XJQA 4P4UA 4Q1FA 4B3BA 1EFTA 4GRAA 1LS1A 1KI7A 3ZYCA 2A5YB 5AK0A 2IYWA 1OFIA 2B92A 3TNFA 3CX6A 1G21E 3B1ZA 4KXFB 1N5LA 3T1VA 3VX4A 3TSWA 4Z54A 4IDHA 4LJ4A 3KQKA 3LLMA 5A0FA 2IYUA 1OXSC 3E1SA 3MWLA 4XWOA 4X8LA 3KUDA 1VCNA 2YWEA 1QRAA 4Q18A 1JB1A 3BFKA 3TIFA 4KSBA 2YZ2A 3Q3JB 2GXAA 3MLEA 1EXMA 1G5PA 1SHKA 2A78A 2GA8A 4TTQA 5CIQA 3RABA 4AK9A 1P3JA 2ZJ5A 5G40A 2JLQA 1W0JA 4Q5IA 2FEOA 3F5FA 2BKUA 5J40A 3R7WB 4M4SA 4O2RA 3TVDA 4US0R 1KSFX 2DR3A 4G3XA 3RS0A 1JAHA 2Q0HA 2ZI5A 3QJYA 3QPUA 1Z0IA 1WMSA 4F4IA 2I1QA 1JNYA 5J47A 1KJWA 1II8A 4Q02A 3QKRA 3GMTA 3NC0C 4ILEA 2C95A 1XTSA 1Z0AA 4QGFA 5EE1A 1W44A 1YQTA 4K46A 5J4YA 3ECCA 2C99A 4PHFA 4LJ9A 2OO7A 1U8YA 1XTQA 3PFIA 1R10A 3CR7A 2WOOA 4LBZA 2RGEA 3EIQA 5CB6A 3CLVA 4D4LA 1J90A 3B9PA 3TUIC 1WBDA 5CJPA 5AUOB 2FNAA 4W5WA 4GP6A 1CIPA 2Z6VA 1D5CA 5AWFC 3MUFA 2RHDA 3GLHE 5IT5A 2QEQA 2OG2A 1G18A 3TKLA 3DM5A 4NYMQ 4C0QC 3THWA 3KJEA 1WP9A 3NHAA 1XP8A 4JYBA 4MGKR 3WY9A 4QNMA 1VMAA 1D6JA 5FOSA 1FMLA 2O8CA 4XIGS 3ZQJA 3QPVA 4II7A 1LB1B 3IPYA 1TQDA 3TK1A 2VP6A 2KB0A 1DAFA 2OE2A 2VH5R 2QTVB 3ND9A 3QF7A 4ITRC 5FTJA 3EW9A 4ZI3A 2H92A 4ZKDA 3IO5A 1XXHA 4GBMA 2GXUA 4MRRA 2ZPTX 4DUGD 5JMTA 4Q00A 4LC1A 4TLDA 1G41A 4DCTA 2J59A 3BFXA 2V6JA 1E2DA 4TYQA 3CRVA 3THOA 3KXLA 2ZI4A 2G6BA 2WVJA 4JL8A 3S1AA 4JLJA 4ACBA 1WCV1 3VU9B 1IY1A 1CRPA 2IF0A 4MDEA 3WNDA 2BBWA 2ATXA 3SFZA 1E9AA 1V5WA 2XITA 4PAMA 1KMHA 1ZU5A 3H1TA 2DB3A 4CZ2A 2EFDB 2RGGA 2G1KA 3MJHA 3E70C 4ZCMA 4WBSA 5L8VA 1AGPA 3R8FA 1E2IA 3H84A 1FP7A 2GETA 1G8PA 5D3MA 3W5JA 1N6OA 5KNCA 1CBUA 4DZZA 2XB4A 1HA3A 1W0KD 3Q85A 4LC0A 2YWFA 4Q1EA 4XD7A 2QQEA 2CK3D 1TQ6A 2IYQA 4FIDA 1KHTA 3ASYA 2ZRLA 4FINA 2G3YA 1G291 3MJRA 1H8ED 2OUKA 2JLRA 1K5GA 2C9CA 1ZNWA 3EX7C 4C2UA 1EFRD 4IFEA 2PEYA 1IJFA 1E1RA 3DL0A 1XRJA 2QM8A 2ZVPX 1FX0A 1JR3A 5AUPB 3LW7A 2FEMA 2ZJZA 1E2PA 1R4AA 2QT0A 4PPFA 2P6UA 1NMYA 4BLRA 2OFWA 1KDRA 3V9PA 1P7CA 5FL7D 2E1RA 1KZ7B 3SBDA 4PC1A 3EIEA 3VX3A 3QXHA 2IYSA 4Y0AA 5EP3A 3SU8A 4U00A 1OXXK 2JLZA 1NIJA 4LJ8A 4IOLA 1NSTA 1X8JA 2F3RA 2R65A 3B13B 4FCWA 4FCVA 3E5HA 5TV2A 4ARZB 4TL8A 1XFAA 1N0VC 4M1MA 3C16C 1XMVA 3B1YA 3AVUA 3SYNA 3K0FA 3PV0A 3ND8A 1RRCA 4JMPA 2DWQA 3SE0A 2KBEA 1TU4A 4NONA 4A8JA 4BEBA 3I5YA 4M9ZA 821PA 3VR1A 4TMVA 1R8QA 4OJKA 1ZNZA 2QAGA 4M1WA 2C2HA 5CLQA 3IBGA 1Q1EA 2VBCA 5FPKA 1MO4A 4DB2A 2BVNA 1BIFA 1X86B 3KKPA 4LZZA 3DVLA 4PAQA 1UKZA 1E96A 2G83A 3GJ4A 3BB1A 4C0AC 2F7SA 1X1RA 1KIMA 4JVNA 4NL4H 2FN4A 2IYRA 2BMDA 4ESVA 2AHOA 2B7CA 1WE2A 4FMCF 3D3QA 4Q4AB 1BS1A 3ZZUA 4EPRA 2VP9A 4Q1CA 1SVMA 2JLVA 2FFAA 2BJVA 2K5UA 1WF3A 2P5SA 3B60A 3LNCA 2ZYUX 4LY6A 3R9XA 1SXJE 4TYYA 4OI1A 3VKGA 2QY9A 3IGFA 3W3ZB 2DCUA 2FPKA 4DCVA 5L3QB 3D7MA 1N3BA 3TVTA 4ASUD 1CTQA 1QF9A 4NTZA 3RSOA 4TL9A 2JLSA 3C41J 1Z63A 1W4CA 4TMTA 1TPZA 3BRWD 3G82C 3O8BA 4RKEA 2Q3HA 2MMGA 4TT3A 1XEXA 2WJGA 4EPXA 4EDHA 1OFTA 2VHTA 1OKKD 4NYJR 1T8TA 4JVSB 1F2UB 4DRZA 4B6FA 3U4QA 2GJKA 1OW3B 1ZU4A 1SKYB 3CNLA 1BKDR 2BBOA 2YC2C 2IK8A 1CJMA 4XSGA 1MOZA 1P2TA 2WAXA 5FBLB 4DIEA 3UPUA 5JRJA 4LV6A 4PO9A 5DI3A 3OFNA 3SI7A 5FUYA 4JBYA 1S1CA 4O3MA 1COWD 2X2EA 1Z6GA 2OV2A 4LBWA 4WIAA 3RC3A 4YMWA 1R5NA 1Z2AA 4D0GA 2NQ2C 1DAEA 1KI6B 2QE7A 2ZUDA 4H1VA 4J0QA 2EU8A 2REBA 2GWHA 4PX9A 1RPZA 4LV8B 2GJAA 4A2QA 2ZEJA 2QGNA 1AK2A 2ZANA 1NJGA 2YOGA 1OF1A 1J2JA 3IEUA 5IDVA 5FBWB 5C4GB 1NN0A 1LW7A 4KODA 5B2ZA 5EXTA 3HP1A
chains in the Genus database with same CATH superfamily
1TOAA 2W2KA 4WCFA 3DB1A 2J0UB 4REQB 2XDQB 1BJRE 1Z7EA 3CW8X 4OXRA 1HE3A 4PZDA 1RZRA 1GGJA 1D7OA 2JD0A 3I58A 2OZVA 1PTJA 4H7KA 2JEOA 3ZQUA 2E4UA 4LDNA 2J0EA 4MARA 3HB0A 3RC9A 2JAUA 3VNRA 4R71A 2ZTVA 3AL3A 1PR6A 3LL7A 2IYZA 2YXPX 3OFND 5K0JA 1R0LA 1AN9A 2Z1MA 3CRNA 3KOYA 1FP4B 1HLFA 5FOTA 5I3ZA 5I9IA 2IS6A 3E3LA 4B8ZA 1C0PA 2H5IA 3HN7A 5KMGB 4CIXA 3UGJA 2FZLA 3MMXA 5LZ2A 5M34A 4NH4A 3FYDA 3FCAA 2IKQA 3H2YA 3L6OO 1N2EA 4M8LA 4MW9A 3QW2A 5HZKA 2D06A 2QRVB 5TIIA 4HS4A 1TCAA 1NU8A 5I7HA 1JQAA 2WSMA 2XBLA 3EXFB 4W5HA 1BOOA 3VC1A 3WWCA 3OOSA 3H42B 1I7SB 1ZZGA 3RBZA 2H9YA 4R5MA 2D8MA 3GD7A 3G8DA 3D81A 2I71A 4CTMA 2OD7A 3ODPA 3LBNA 1XKXA 3GB9A 5AVYA 2QD1A 2EKQA 5DN6A 3PXUA 4YECA 1S4QA 4LVCA 1DEHA 1KO4A 1U9JA 4G26A 1WPRA 2PVCA 3ER6A 4WK2B 2NPFA 3AYXB 5JC8A 3GARA 2R1TA 1KZYC 1IUPA 1IXSB 2YHIB 2Z2IA 4XGKA 4ZPJA 1VYTA 1YOVB 3UOAB 3OT1B 4DSZA 3VISA 2VN8A 1U04A 3AJ8A 3ZKWB 4N7RA 1T4MA 2CSUA 2PZ8A 4FFDA 2Q7XA 2X41A 2BFOA 2ZQZA 4JJKA 2JW5A 2VSYA 4G0PA 3R0JA 2YWXA 1E18A 1X7YB 3AI7A 3PFCA 4GGOA 4HP8A 4HRXA 4I3FA 2VDPB 3U4CA 4BFLA 5HOQA 3FKQA 2D5LA 2GN2A 3F98A 4XA8A 4CR8A 3STVA 4UTVA 1EKXA 4MYHA 1IWOA 3PPXA 4ZKEA 1AM4D 4Q34A 1J2EA 1SELA 2IDMA 5DTMA 1U7HA 1QHSA 1UM9B 1WDLA 4JOBA 2EX4A 3LUJA 3OZDA 3RAEC 5LMCA 3QBDA 2V3CC 4F5YA 1A50B 3VMFA 1K06A 4XR9A 3TZ6A 1CF9A 4PZLA 3TL3A 2FVYA 3H5IA 4UHCA 3WWDA 4B6PA 5AVSA 3JQBC 3VKFA 3TLKA 2PUAA 1WY5A 3CVUA 1E1MA 4NIMA 4PLHA 4Q12A 2E1PA 1E3MA 2D4HA 2AV6A 5BW6B 1VB3A 4FU0A 2WT8A 4LRTB 2W6ID 5H7XA 4BNNA 3MYYA 4LDJA 3QFCA 4AJNA 4BZWA 3EVAA 3BDAA 4AROA 4C20A 4IVNA 2VR1A 2FGJA 3O93A 3R6DA 1QP8A 1YA8A 2MR6A 3N2ZB 4UVHA 4A5OA 2V98A 1KI2A 1KH3A 3HBFA 3GDHA 1B7GO 1FL9A 1WSAA 4F86A 2OAEA 4DA8A 2UZ4A 2HBRA 1UMBB 1W46A 1V35A 2NSHA 1AHHA 3AFOA 1A9XB 2ZYHA 3H9CA 3KSZO 4G63A 2Y68A 4RHYA 4UZSA 1JZTA 1H1DA 2BISA 1Y8QA 2GYVA 5EJAA 5IVIA 3RGGA 2AJDA 4RNDB 5B3AA 3VVBA 2ZR7A 5JEEA 2NZYA 6ABPA 1G4UR 3UJPA 2WU4A 4K8OA 2EF1A 2VWGA 2QAIA 4X1KA 2BFMA 3BXZA 5JZSA 4GWGA 5FP0A 1L4MA 3HKBB 2WP0A 2PZKA 5CT9A 1E2HA 3DBVO 4NE9A 5A6SB 2PMEA 5DCYA 1UK8A 2I87A 3C7DB 3K9WA 3WIBA 3KSBC 2RAPA 1B3RA 3HB4X 3HE3A 4MQBA 3ZCSA 1HR0B 4KQ1A 1XP5A 1PJQA 3R0QA 4BEWA 5B57C 1R6BX 2ZJ6A 1WXQA 3KPWA 3T3OA 4AY2A 1MG0A 4NFSA 4O5AA 4AULA 4IFBA 2FWRA 4C2AA 2JZCA 4X85A 1R9JA 2MSEB 2X8BA 3ASZA 1TJ4A 4MO2A 1ZM2A 4YFYA 5HPYB 4EHKA 5JCOC 1C3JA 4LHXA 3MCUA 1T5BA 3QX9A 2XGMA 1FIUA 3WYNA 4HQ0A 2FG7C 2ONYA 3LXUX 4K1XA 4L5BA 1TAQA 3A1FA 4W99A 2RKBA 2ZE5A 3CIOA 3T94A 1N2CE 1P18A 1TT5B 2Z95A 1XL0A 4BEJA 1GPH1 5KKNB 1Z0KA 3I2HA 4CMEC 2K7FA 1QF7A 3FG9A 3G9TA 1BDHA 2PBZA 4E2FA 4RJ2A 3EC2A 4Z1OA 2Z5FA 2XUGA 2WUDA 2PAAA 3N74A 4OEHA 4G4SO 4C1BA 4BFSA 1Z5VA 5DX0A 3LJKA 4FX2A 3G7SA 4DQ0A 3Q8LA 4L4ZA 3ZIAA 3N1UA 4EGCB 3ACDA 3BDVA 3A4MA 4LSMA 3U3JA 5BMVF 4F9FA 5FNVB 2QR2A 4OBXA 5FA8A 1MA3A 2HF2A 2JFQA 5DBHX 1VG1A 2CDBA 2P8JA 1Z4OA 1OI2A 1LSUA 4OH1A 4UARA 2MR5A 2AQHA 2QRNA 2RGYA 4MITA 4UE6A 3V1YA 3HKDA 4A26A 1AQUA 1A4XA 4MHOA 5JNLA 1ZGCA 3LMKA 1GQYA 1RPAA 1SBHA 1V5IA 1RAEA 4UTOA 4Z4EA 2CLMB 1Z0DA 1W1WA 3V2UA 4MA0A 2WSSA 1QIMA 1KJQA 3EOZA 3PHJA 4QDUA 4YEDA 4JBXA 4NPHA 3RRBA 1Z6YA 2QTHA 4PX5A 1WUIS 3HBMA 3CVVA 2E18A 1E6MA 1V25A 3UT5A 1FA9A 5IJZA 3AVXA 2R00A 3RFVA 3AW8A 4QQKA 5AW6A 5EKTA 1J06A 3WX0A 1TQ8A 3JD0A 3RFCA 4GOKA 4I1IA 1CQJB 4I6EA 3ZS8A 1MB4A 4G1FA 2YJ3A 2W6NA 4WLNA 3MOIA 1KJ9A 1LLDA 2IPLA 3FYTA 4FYVA 1RWOA 3T1OA 3M3HA 3K6KA 4R9UC 1WQ3A 2R44A 1PZGA 1V8FA 5K6RA 3OVMA 1U0OC 3WICA 2GAJA 1C3OA 3ZE0B 3OM1A 1P4AA 5DB4A 4E46A 1IK4A 1F8XA 2QV0A 4D9MA 2G0NA 4E2XA 4XIYA 1KBOA 4MR9B 2AYXA 3M82A 4Z1MA 1LA2A 5JNRA 4PVCA 4PYRA 4TVOA 1Z73A 2ZAOA 2O8VA 2Q1YA 1C9JA 1ZEMA 3CEPB 3OPQA 1EUCB 4KGZA 5A1TA 6GPBA 2C8LA 1K27A 4C3VA 4EKYA 1Y9JA 2ZCVA 2IXGA 3V4VB 2IDKA 1PZXA 2A0FA 3HXPA 1X7WB 1SUWA 4KIFA 1KS2A 5I7VA 3BZBA 4FWIB 1G8GA 1QLWA 1Z39A 2QL9A 4NFHA 5FBVB 5LMNB 3KT3A 3B53X 4HUQB 3HFGA 4TLMB 1T5SA 1YZKA 3QG1A 1U0HC 2OLJA 2G70A 4EGAA 3SXPA 4BLSA 1P81A 1VCMA 4MW4A 4D9IA 3VPXA 1GUFA 2ESRA 2ZTMA 2OA0A 1NI4B 4ZIRB 4NNOA 2GX6A 1XLWA 3D2AA 4M1TA 5K51A 1NNEA 5BRAA 2ASEA 4X6UA 2RC5A 4P4TA 4FYHA 1NVXQ 3DLAA 3AX6A 4OH7A 1OH6A 1K2VN 1TVMA 2BSAA 2NQTA 3CPHA 2H1FA 1N5DA 2BFWA 1Q17A 1CSEE 1TK9A 2EKPA 2QMQA 3D3JA 1EXWA 3ZVLA 5BR4A 4IVQA 4O25A 2QQ0A 2RHMA 1E66A 4RHTA 2X77A 4BV3A 3PTLA 1XTIA 3ZGZA 4Q1BA 4MQEB 4ZK2A 4M98A 1ZA2A 1XMPA 2VK4A 5DRTA 5GONB 3L04A 2ACEA 3GRPA 4UEOA 1NT4A 1QJCA 3TBHA 4O2BF 4XQEA 2F4VB 5EKXA 2OSVA 3QLEA 4BHTA 2H2DA 3BXEA 3ZJ5A 4UU7A 3BFJA 3I2IA 1AKYA 1CWUA 3H6HA 2I62A 3S8YA 4N5HX 1OTXA 4MV5A 4J94A 2R6HA 1VE5A 4LE2A 1E6LA 1PR5A 3AETB 1DAOA 3B6MA 2J7KA 5C8ZA 4MWSA 4H18A 2NIPA 4S24A 2GZ3A 5A5EA 1J4AA 5CM9C 4J1NA 4WA8A 3IJRA 3T3HA 3K0SA 3ZUPA 4GZ5A 2YZKA 2WTBA 2AFVA 4Y6GB 1M0WA 2FF7A 4L0DA 4Y9SA 2FZKA 1JDBB 1U0BB 1JEAA 1TCVA 2G0TA 4M7PA 3F71A 1B26A 1HI9A 3C15C 1Q44A 3RKSA 1YQGA 3NOQA 2QB5A 4U7JA 1KY3A 2RHOA 3IAHA 1Q0LA 2ZDQA 4XWAA 1K89A 3BK1A 3VU9A 2QORA 4LGMA 3O4FA 1LRJA 4EMTA 4A2PA 1EFDN 3GEMA 4JCCA 3HO1A 4B34A 3MHPA 2DHEA 5K1ZA 4IYRA 4LDAA 4ZDIA 5I4BA 2OECA 3ZD7A 3WJ1A 2D74A 3JQ7A 1F9EA 1PHRA 3FLBA 1TX4B 2F9LA 5TQ2B 5TS2A 3ILXA 2Q50A 3ROFA 3ND7A 1FQKA 1M1YE 1XCOA 4EW6A 4N1AA 4TTVA 4K9OA 4JOSA 4LS3A 4BUJA 2WW8A 1ZIPA 2XGSA 2P7IA 4Q7KA 2ZUSA 3DONA 1XMOB 3RVRA 4OK5A 3A1VA 3DR5A 3OCUA 1NJ6A 5FPSA 3RC8A 4PR0A 4EY5A 4MVJH 1BAPA 3IUMA 4IGFA 5K20A 1VJTA 1Z45A 3UK2A 1MA0A 3CPSA 3FDXA 2M98A 5HMMA 1J0XO 2LP4Y 3DT9A 3RDPA 4R2IA 1NE2A 1EFVA 1NBWB 2PNFA 1YAHA 3QLJA 4QDJA 4XDYA 3N2KB 3PUIA 4Y2XA 3UXYA 2BDEA 3NKFA 4L76A 3WYBA 1RCUA 3BAFA 2IP2A 4B82A 1A8HA 1S6YA 3QBJA 3DXYA 1J8QA 3AILA 3UICA 2Q7OE 3FUCA 4KXUA 4WJLA 4NKRA 4QEDA 5BSGA 1GD1O 1BDIA 3NEAA 4K9RA 3RC7A 4D3XA 1RXWA 2A1UA 3H9EO 4EKGA 4G5SA 4IJQA 1SGWA 4JJFA 1GHTA 1MD9A 5BN3A 1EJ2A 2RGBA 2P67A 3TZQA 4GPZA 1F2TB 1LSJA 3T5GA 4QQFA 3IUJA 4MS4B 1YHNA 2BD0A 4C6TA 1IRIA 1TU3A 5I7AA 5ENVA 1PI3A 2GKSA 2XNHA 2RGRA 2HBQA 5KKCA 1EZZA 4RQUA 3GJZA 1YB4A 5EWJB 4UNPA 1G59A 2JG3A 5EPEA 1U2ZA 4IKOA 4OHWA 4MIKA 2HRQA 2I4IA 5KTKA 3REGA 1U7PA 1Z29A 3DUFB 1EDZA 2SKEA 4EFNA 5CFOA 5I6DA 5AUQA 1JG4A 2OORA 5ALSA 1RDFA 1AQIA 4XB1A 1E7SA 5D1HA 4QXRA 5FR2A 5I45A 3FR7A 1UJNA 3PX3A 1T4DA 4BQNA 1X6VA 3GPLA 3NHBA 3BMOA 4Y30A 3E5RA 3F0TA 4P58A 1L4KA 4POAA 1YACA 3AIMA 3RIEA 1NF2A 5BWCA 3LCVB 1LXCA 1RC0A 3T54A 4LSWA 3DS8A 5JD4A 1XTRA 2BGWA 4DIBA 4XUDA 5ILQA 3ZHOA 4F72A 2FLVA 2O7RA 4LOKA 4BAZA 2XX3A 3HABA 4CEHB 2BF4A 4LY9A 3EJWA 3EZ2A 1NBIA 1FFCA 1RFLA 2FN7A 3IXQA 4Q4AA 3WOVA 3T4XA 5A4MS 1A8IA 4H35A 1ODTC 3NTRA 2VHCA 2CFCA 4J0DA 4DCSA 1IHPA 2CLOB 3AM5A 1LLQA 4MUJA 1YA6A 5LIRA 1OY1A 2YDYA 2AG1A 1Z4MA 2DUJA 1V8PA 3HA7A 3ENNA 5YASA 4BN5A 1T0HB 1W96A 5EZYA 2FQXA 2NWQA 4EYGA 1PGJA 3AVTA 2Q8QA 4HRAA 3RSGA 1W0KA 4QYIB 4EO9A 1N2BA 3KJIA 3KOMA 1RXIA 4NAVA 5KTSA 4XTRA 3MB8A 2QE6A 3OU6A 4IH9A 4L72A 5C8YB 5JAZA 2PUCA 3SR4A 2JFVA 5TS3A 3GH1A 3V8NA 6REQB 4C7OB 2AOXA 3ZIUA 3KWLA 3QSGA 5FB3A 3IVAA 2BM9A 2Y71A 3FOWA 5E95A 4AFNA 1C9NA 4FR0A 1QRSA 4JL6A 4WNYA 3ADOA 3AF0A 4AMVA 2C4VA 2C94A 2Q6KA 2NV2B 1GL6A 4MIYA 2UZIR 3V9AA 1QYRA 3KB6A 1BDMA 3LRXA 3Q2OA 3DZCA 2FZGA 2WHXA 2BYTA 3HCRA 2R97A 3RODA 3VR6A 4A6PA 3GJQA 4F46A 5FO1A 2VRCA 5LSAA 1ADFA 4DLLA 3AIIA 4JLKA 3WDKA 4DA9A 5JDIA 2VBIA 4ZZ1A 3P9NA 5KNBA 1BU5A 4DSTA 1KI6A 1VPDA 4I4TF 1XD2B 4NYIR 3PDCA 1FEZA 4GPIB 3RAJA 1FU8A 4W82A 3SZRA 1OC2A 3P2MA 4QJBA 3IEVA 1JJFA 4L57A 4PZUA 4LI0A 3UUFA 1WAMA 1RYBA 1XN4A 2HU7A 3BOSA 4FGWA 5BN5A 2WF7A 5IABA 1S0UA 2Y8EA 4MXDA 4MI3A 1TJ5A 3QA9A 2R7AA 4G0QA 4OB7A 4PPQA 4UEKA 2H0QA 2VK8A 3O95A 1NP6A 3H1BA 3TGLA 4REQA 2GXQA 2XDQA 4YHHB 2VTKA 4UUMA 1JFTA 1WKCA 1NN5A 1Y8AA 2VCEA 3H5AA 3IAAA 4KFUA 1P1HA 2AN3A 1P5JA 1YE3A 3QMWA 3ZE6A 4IDBA 3PG5A 1TK3A 2EXXA 2MU1A 2FSGA 2ZSJA 1WXGA 2JIPA 4N6NA 3PCRB 4NBKA 4W8HA 4ZC8A 1QOZA 2W4MA 1W8IA 2BFCB 2HY7A 2QX9A 3N8KA 1N6HA 4AL4A 4E5UA 1ISRA 4WDQA 2HMTA 5CDUA 5FPTA 2NVUB 5IYZF 3CB4A 1J6UA 3NHPA 1H8HD 2CD7A 3OLWA 3KJGA 3QEKA 4IFIA 3UF0A 2PUGA 4KQKA 2BEWA 5A0TA 5JPIA 2FSVA 2QQGA 3EXFA 2ORYA 2HZ7A 4GPD1 1FSFA 1HE2A 1Q0PA 1N5JA 2JJ2D 3M8KA 2FHSA 3R9IA 4BNYA 3DZFA 2JGNA 3DLTA 2P2ZA 3PE4A 2C07A 4Z3DA 4BFCA 2XTMA 3GF4A 1D6SA 4WCDA 4YAKA 4A15A 2TS1A 3K0CC 1R37A 4V0MA 4HMPA 5FJJA 2AXEA 1YK0A 3IQHX 4ARAA 1PSDA 3OEYA 4PONA 2ONJA 3U61B 3EA5A 4JKYA 4DMKA 2IH2A 1ZN2A 4P35A 4LK2A 2YHIA 3G0DA 3JQGB 4YJFB 1YOVA 5EFZA 3I01A 2I3DA 4ASUA 4F6RB 1R9NA 1DJQA 1IXYA 3NGMA 1UXOA 3BIXA 1RAGA 2QRJA 1FDUA 2BFFA 3FVQA 1L8LA 4I8IA 1T2VA 2IHBA 1X7YA 2M6KA 4PGHA 2H4ZA 2W37A 5HDBB 4BBJA 4Z4CA 4F91B 2FY8A 1OKKA 1IXKA 4PIPA 1P0FA 2AN9A 4F2PA 4YRCA 4PO8A 1KAQA 1UBGA 1RWPA 4NY1A 5DO9A 5A9SA 2PGXA 3IURA 3T7CA 3K1AA 3D3KA 1TIBA 1D2NA 1H4VB 5IHXA 3OBIA 2PGJA 3CM0A 3FPEA 4BGUA 5DBIA 4CUKA 1VL2A 4YCAA 3C5WP 4WKBA 3ZLTA 5K99A 1N6LA 5HKKD 1I30A 4D46A 3LHDA 3C70A 3ZV7A 3QKRB 3M6MD 3OCYA 3UK1A 3O8RA 4K87A 4LYYA 4OP1A 5B58C 1ULUA 3DNMA 1BJKA 4JQCA 5CG1A 4MA4A 1UPAA 4YCDA 5JAUA 3A9SA 4RDIA 5KEIA 1TKRA 2OB1A 4BB9A 2R6AA 3AHDA 2CWWA 3B5EA 3OZUA 4JP1A 3GFTA 5AI8A 3U0BA 4DN6A 2DETA 1KO5A 1Q0RA 2H2WA 3ZGLA 1O87A 2XB8A 1RKXA 2XXBA 4H0CA 4U6NA 4H3KB 1IEQA 1FC0A 3QEMB 4JU9A 5AJYA 3W77A 1HE1C 3PQ2A 3A9RA 1DXQA 4M0KA 5SY9A 3SZ3A 4L78A 2WMDA 1U98A 2AMJA 1KKLA 5IZ4A 3F4BA 3BHMA 3THWB 2KQUA 4F3CA 2ZR0A 3ZE2B 2CFTA 3LHSA 3WLEA 1RYYA 3CC8A 3EQ9A 1XYYA 3R6LA 1M8KA 2IYOA 4G0XA 4OFWA 4ZXFA 3DCIA 4HH4A 3K6RA 1Q0HA 2D8AA 4WAUA 5D3KA 3HKBA 3U1VA 2PRJA 4P36A 1O77A 3BGVA 1GGKA 4ZPXA 1E3LA 3WSVA 4KBGA 2DPMA 3SC6A 1SG0A 3THXA 2HHAA 3BUSA 3FKSD 3CX7A 4HNQA 4CT4B 4DBLE 4I4CA 1XKLA 3PX7A 3ENKA 2CBGA 1TLFA 3NUZA 5T6BA 5JPDA 4URFA 2V7PA 4Y9RA 1IMOA 2XWBF 3IS3A 1MAAA 2YRXA 2WYHA 2WG2A 3OD5A 4FMCB 2FW8A 4V3CA 4EUKA 5AVZA 3FGNA 1OSNA 1TECE 2V7TA 2G9UA 4IVPA 2I7CA 2XF2A 3ANMA 3TEJA 1GZ5A 2RGCA 1OZ0A 3AFMA 1S7CA 3B2NA 5EMJA 3ZTTA 1MGPA 2MSWA 2VCHA 4JOCA 1W36C 1QRUA 2WTEA 3Q4GA 3H2GA 4RF5A 3MT0A 4TMWA 4RK1A 1D0SA 3HL4A 2V74B 5FUWA 3SIRA 3G1UA 4PLPA 3WRYA 1N4AA 4HYTA 3U1TA 4WFJA 5ER9A 1KTIA 2LVBA 3E81A 4IF4A 3UENA 3IESA 4RPKA 5G2OA 5FUQA 4QUIA 3P9PA 4ZEXA 1AA6A 1GQRA 1SBTA 1VG0B 2CJWA 2ODTX 3R9KA 5HR5A 5JOQA 4RLFA 3HHPA 1SUDA 3FSRA 3ZOZA 2CVHA 1WUKS 2PWPA 4LMAA 2W6OA 4B6RA 1UOQA 3CLSC 4ZCLA 3VJLA 4DJEC 4E1VA 3RQSA 1ZH2A 4HO1X 3SZOA 4FD3A 1AV6A 3IL2A 2J5RA 2GUWA 1U7TA 2WTNA 4LTDA 5CAEA 2FUNB 3VR2D 1VXOA 2PX2A 3IQZA 1J5PA 3UHPA 1KC1A 1ENZA 4CKCA 5CK4A 2JFOA 5FULA 5KJ1A 1YI8A 5LOVB 1IN5A 2HTFA 1NN1A 1SBNE 3U3OA 2XB2A 3NIFB 2GOYA 1L7BA 4GZMA 1YJXA 4L75A 4ZALA 3U60B 2XW6A 3G0HA 3EEOA 3IB6A 2NGRA 3BCSA 4EPYA 4XDHA 1G8FA 3OT5A 1NAIA 2I29A 4QM6A 1JBKA 4GQIA 3I04M 2Z57A 1G0OA 3EXIB 3H8VA 3LUDA 3E9RA 3UNXA 4RNCA 2COKA 2Q5HA 4QPNA 4YRZA 1R4ZA 2GK3A 1L1QA 4EJSA 5FIUA 1S4MA 1XZFA 2HSGA 3PTAA 1T1GA 1UZAA 1R3UA 2XNDA 4QC2A 2OHIA 4KWEA 1QKKA 3T7RA 1E1QD 2CLSA 2G9ZA 4F8JA 4YP6A 3V1NA 4TUYA 5K4GA 2VAWA 3GEHA 3LP5A 3UUWA 2OGTA 5KSPA 4BMYA 1O89A 1CJKC 1EZ1A 4ZYVA 1C30A 2NV0A 4OD0A 4UPVA 2QLNA 3FPAA 4ECEA 1JECA 3DPIA 1GVNB 4N5DA 3L8MA 4QULA 1KYVA 2EBWA 1U0FA 5C7IO 3LUCA 3M6XA 4ITUA 5JALA 2IH5A 2AMFA 2YWRA 2Q2OA 1MEOA 3FHCB 1YCDA 2DF8A 4XYMA 5IDYA 2VT2A 1PKEA 1ZBDA 2YNMD 3CWCA 2OHVA 1ZICA 3FAZA 3ZWQA 3SC4A 1M5UA 4XLTA 2A9FA 5CVJA 4AF8A 4K26A 5AYVA 5K3FB 4BLWA 3CCFA 4RV5A 5I4CA 3EEBA 3K6SA 1DC5A 4PLTA 5JEDA 2Q5IA 2BCJQ 1QH1A 2GERA 3FB4A 4WBXC 2NZWA 1KZ1A 4G09A 3F1LA 1B73A 1DQNA 4NENB 1WBBA 3WMEA 5C3UA 4ZK6A 1LDBA 4LRUA 2R60A 1NI4A 4ZIRA 1BMFD 3OD1A 4EQZA 4TMKA 2UAGA 3GVPA 3IEPA 2CV0A 2ECOA 1AF4A 3GJ5A 2GCOA 3V8VA 4AB1A 4GVXA 1KOJA 1XZDA 3UT0A 3IR5A 5FDFA 3AGQA 4DG9A 4I9NA 1HT0A 1NUHA 1LNQA 1Z5NA 1VG9B 3ESXA 5CP8A 3OOYA 4IMIB 5FOQA 1LV7A 2WMOB 1GG9A 2Z2YA 3M5DA 4JMLA 4RY0A 5DM4A 1KFBB 5EJGA 5K3CA 3VSEA 5IPFA 4J0GA 5GONA 3C3BA 2J87A 3H2JA 3I9V6 3ABZA 1D07A 4WN3A 1T9CA 5DW3A 2PL5A 4DIKA 4JA2A 1OAAA 3VA7A 3QF4A 4OUKX 5LDGA 2YBDA 4F92B 2WVGA 1F0KA 3JPYA 4R9NA 2JAWA 2YJNA 2GK6A 2OCLA 2ZBEA 3GUUA 4IWNA 1HZZC 2ZYGA 4ZVRA 5B6IA 1X7HA 3FNHA 5F3DA 3SSAA 4BZZA 1PJ3A 1UT5A 4WOCA 1LU9A 3AETA 2BHRA 4FFWA 4K3VA 3W5DA 1CR4A 2PYDA 2XTNA 3LYHA 4DJFC 4MRPA 2WA1A 3IELA 3QX3A 2BCGY 3D31A 4Y2SA 1SIWA 5A05A 4D45A 5JYEA 1G5HA 1M10A 2VTEA 1NVVR 3IE0A 4ES6A 4XWYA 4ESHA 2XZDA 1DMRA 5LP6B 1IZ8A 2CNBA 2FI1A 4TMZA 1Y63A 1RXYA 4L8WB 1KQPA 1RABA 4EOGA 1NN3A 4GL2A 2B34A 5FEMA 4YT8A 1RXCA 3HKEB 1LPAB 2QP9X 3TDMA 4WVLA 3ZCXA 5E1MA 5GZ3A 1WETA 2O06A 4O4LA 3WDMA 2J9FA 1R0KA 1PEYA 3ILSA 4ZVNA 1L1FA 5L6MB 5HCIA 2V65A 1QBKC 2GZSA 4Y1GA 2QGFA 4W8GA 3WLPA 4UTRA 1YVPA 5HZMA 3KKZA 1KI3A 4IUDS 4KVGA 3ROTA 2KBFA 2C3PA 1LTKA 3U80A 3VKUA 4DB4A 1JZQA 1GL9B 2BGRA 2ZRNA 2JL1A 4IIJF 2JJQA 5D6NA 6PFKA 3MFYA 4B73A 1EJ0A 1QKIA 2G7ZA 2QQFA 3VV2A 2PG3A 4XPZA 1Z8FA 2P2SA 4MR7A 5K6AC 4V24A 2OD9A 4RJIA 3FNBA 3NHZA 1M6NA 2PX0A 2QU7A 3BB3A 3PJDA 5CGQB 3ODGA 4ZO6A 1YE5A 5IP5A 3UC9A 1OE0A 2DC1A 1KRXA 4CMCA 4I50B 3UMGA 3M83A 4BQEA 4A0GA 4AY3A 3MWEA 5IT0A 4R8LA 1JJBA 4PAWA 2C9OA 2YIVX 1KKMA 3T0GA 3RRZA 4OYLA 1J00A 4MYSA 1G2IA 3MD9A 5CXSA 4TLEA 1PEKE 2AL7A 1NRJB 4GXTA 1U8AA 1H1LB 3G2KA 2VJOA 3N2KA 1OGJA 3E7XA 3I6YA 3UCFA 3DMTA 1M2FA 3DDZX 4AZ3B 3O0TA 3DBRA 4I36A 3KSRA 4AP9A 5LQMA 1RJWA 1X2EA 2HJVA 2QDXA 2VJCA 4J9UE 2Z1NA 2WKQA 4MYTA 3USCS 2PTGA 3PWSA 3R5HA 2PJZA 1P2FA 5JJ5A 1X13A 4HHEA 3LVQE 1ZOLA 3W78A 3L18A 3FZQA 1ZJ6A 2JGLA 4OHKA 4QOSA 8ATCA 3UKDA 4LF6B 2A5JA 3L2OB 3WGTA 1F2TA 1JNXX 2XD9A 2WTUA 1OWMA 2A33A 1Z7WA 3C1AA 3JQ9A 5AJUA 2Z2KA 5FOXA 2O8FB 1CY2A 3C6BA 3ZU5A 1T1JA 4EY4A 2J4CA 3I6BA 1JPUA 2O1XA 1E3WB 2F8LA 4RYLA 4TSFD 1R5BA 3PXDA 5EGSA 1C2YA 5EWJA 4KFTA 3LF2A 2DBVO 2R11A 5DT9A 3FX2A 2AQKA 1Z2CA 3KAQA 5BUZA 3DUFA 1KK2A 1L5WA 3HFJA 4QE3A 2F1HA 5B1HA 3EARA 4AG3A 5L3VA 1BH6A 2VBFA 1ISMA 1MJGM 2W2NA 2DMRA 2VNSA 1ULAA 4EFMA 1MTZA 2VS1A 3M5WA 4G86A 3QMMA 3P94A 1U3FA 1XTJA 2OEPA 2XUDA 3MWFA 3EK2A 3DAHA 2BT4A 3SQOA 1IBMB 3B7PA 4W5RA 2B2CA 5GWXA 1IPHA 4IH4A 1TQHA 5LYYA 2EJWA 2J3EA 2O5RA 3GA5A 4GZLA 2YV2A 2H0AA 3P96A 1V6AA 4GC5A 4IIFA 4V0NA 4XWWA 2WIDA 1Y7PA 2V45A 3AF4A 3WJ2A 1VKRA 3ZHZA 2GVNA 4HI0E 3U3ZA 3NNNA 1QIKA 2JCYA 4QUKA 4CEHA 2JHCA 1Q7EA 2OHFA 1BCRA 4JNCA 5KQMA 1CU1A 3PDJA 2F1IA 2PCLA 3GIWA 1SY7A 1Y5NA 3VR5A 3UBTA 1P9LA 3MELA 1ZXBA 2ZRDA 4BQRA 4E0BA 1II9A 2QZZA 1PQPA 2CF5A 3H9QA 4FQ8A 3Q10A 4YJ3B 4QELA 1YS4A 1ZS9A 4ML3A 2NX2A 3KZ1E 4JR0A 2VNIA 1DTWB 1E8DA 3QWFA 3TZCA 3WA6A 1IEXA 1KO8A 3ZR4B 4O2LA 3HRHA 4I14A 4BVFA 1AQYA 2WYIA 3BICA 3PC7A 4F4UA 3GUYA 3QXGA 2Y1DA 2G76A 2COEA 1UBMS 2OCAA 4QU9A 5EIFA 1U8EA 1G8YA 3SF0A 2MDTA 4B1FA 4DMMA 1Y0BA 1K3UB 2BHTA 1T0BA 3Q8KA 4W7HA 2V1UA 3STWA 4NCAA 4C30A 3BYZA 1LC0A 3MJVA 1CUGA 2WJWA 5BMOA 1S2MA 3WMRA 4AJKA 1ILWA 4NCJA 5AW8A 3JVEA 2MSCB 3RUHA 3TXXA 1YRLA 1TMKA 2Z43A 1Y82A 3O2QB 4RFSB 1RM0A 1IC6A 4QFMA 4Q4HB 4UEJA 5AW2A 3KQHA 3DSRA 2FK7A 2WYOA 3EWNA 3FMIA 4KPYA 4ZJYA 1XZQA 4J75A 1XD2A 2BW0A 2GZDA 1CJVC 1F9AA 3PXXA 4BWFB 4N0PA 4D8XA 3NBMA 1ZD9A 4WV3A 1P72A 1UWCA 1E63A 4GYJA 2GUGA 4YC7A 5EJ4A 2OAQ1 2O05A 3NPAA 2EQAA 4DDMA 2AX4A 4QXOA 1VP3A 3CW9A 1K8QA 1KP9A 2EFJA 2JFHA 4H6WA 3RS9A 4IOJA 3U7EB 1PWYE 4IQFA 5BSFA 1VZ3A 4V0ME 4M49A 5CB4A 2GJ4A 3W6OA 3AFIA 1S89A 3M6FA 5DTIA 4HDMB 2YWHA 1W1IA 3DTVB 3RS4A 1C9MA 2ZI6A 4TV9F 3V5NA 3ZDRA 3BD9A 5DNVA 1DBPA 3GLGB 1D7AA 3OE7A 1EQAA 3C5VA 1CULC 1Y1LA 3C85A 3L0CA 4DTCA 1E4YA 5F23A 1VG8A 2LKDA 1Z2OX 3TKAA 3CGWA 3ZK7A 3H3JA 4A8HA 4JB0A 5AM4A 2C3OA 3DVRX 3HJNA 4FZRA 5E4TA 3NG1A 3TIIA 3T3IA 4BLTA 2ZZMA 2VJPA 3QBVA 2DULA 2JBAB 4JS0A 2BFCA 4RH1A 5CB8A 3GT3A 5JUWA 2R8YA 1UEXC 2DJIA 2R86A 3LC1O 3QXCA 2NG1A 5JE8A 1QAQA 2HZBA 3WQSB 2NVUA 4FNGA 5AJZA 4EHBA 4PLFA 4ZVVA 4IIUA 3A05A 1X3SA 1BU8A 3OMXA 3T1TA 1LWNA 4FN5A 4XCQA 3QEBZ 1WP4A 4ZVKA 2DFNA 3S4YA 3IAEA 2ZATA 1KYWA 1CZLA 1JP7A 1R5OA 4M76B 3NAZA 4XB2A 4GZ3A 4NV0A 4B7UA 4DNPA 2A88A 4YCLA 3EQ2A 1FRZA 4G2NA 2P62A 1E32A 2B8WA 4E6EA 4Z3OA 1RXSA 1AIPA 1ISIA 3CHYA 4PFQA 1D4FA 1PAUA 2Q3BA 2NZ8A 2Z4SA 3FUVA 3HJHA 4C6RA 3R3SA 1RIIA 5A3VA 1U6KA 1WB6A 3HDGA 5KSOA 3CU5A 1O95C 1T29A 4UQOA 1CJBA 2JFGA 3WLIA 5DASA 4KE6A 1N34B 3JQGA 4LF7B 3ETNA 1BS9A 2GBIA 3SJZA 4F6RA 5FPHA 3KR2A 2EX1A 1HDOA 2X40A 3U7RA 1PGNA 1ZSYA 4Q9HA 1NXQA 1NDHA 3C8DA 4C0BA 4PYIA 3NS7A 2ZWPA 1JGTA 5AR1A 3RIGA 3VGJA 1YV9A 3KHUA 4LIPD 5CPFA 1EK2A 1CX9B 5AVKA 5EJIA 3ZGVA 4E15A 5A04A 4R51A 1SK8A 4BGDA 3BBLA 4K9NA 4M0LA 1AURA 3U16A 2EEZA 3H1GA 1DDIA 1Q91A 1PYDA 4I6GA 4ED9A 3K96A 2W2OA 1ZQ9A 4CJXA 2Q5FA 1AXEA 4IUYA 3GVXA 1XC7A 1R5JA 1LEHA 1JSXA 3MJTA 2Y0CA 1BEUB 1NKTA 4GMHA 3AI2A 1SNYA 1XU4A 4L9SA 4URYR 2IA5A 4Y0VA 1GR0A 2ZVDA 3F78A 2K4MA 3H97A 5FBHA 3GMSA 2XJ4A 3OZTA 1NLUA 1VHTA 1WCWA 4XDZA 3SBXA 4KNWA 3PD7A 2IS1A 1AQLA 5DOZA 2XUIA 1AT1A 3H9UA 3F6RA 1HTTA 2OLKA 3AFGA 4GR5A 5E4FA 1N5OX 3A3PA 1YTLA 2A1IA 3EXEB 1RLIA 1UR5A 3TQOA 1Z13A 1FYWA 3F7MA 4S35A 5B53A 3HGTA 3WXMA 1P80A 3KVRA 2P6RA 3C24A 1H42A 2CNKA 1JU4A 3H4IA 2VUTA 3H9GA 3IRUA 3GPIA 1I6WA 3JAWA 3IIMA 3NBKA 2OVBA 3RU2A 5DBOA 3NBZC 3TTTA 4ZGGA 1D9ZA 1NDQA 5A3SA 2ZBVA 1XJ0A 4IXDA 4G1MB 2J9YB 2H4YA 1DXYA 1IHDA 1T3LA 2AN1A 3JR7A 4M8NE 1JG7A 1F2UA 3HO8A 1OLUB 2YHUA 1HTWA 1MP0A 3D8RA 3FSJX 1LFAA 4MVYA 4DEYA 1SVOA 4YDHB 3CJRA 4WEOA 3S6JA 4DLZA 3WNZA 1H2EA 4UCFA 5E0KB 2VEDA 2B0JA 3FBGA 3M5PA 3UKJA 1ZIYA 3E0QA 4B17A 4QBTA 1O58A 1UBFA 2JGFA 3LZDA 1TXGA 2CHGA 1NMSA 4QXQA 3B1XA 1QRTA 1W5TA 3KE8A 4L16A 2BZSA 1APBA 1TYEB 1HT1E 1KNXA 1LW6E 2MSLA 1QGYA 5F52A 1TYAE 4HGQA 1GIAA 2VUSA 2GTPA 1C7RA 5I9NA 1JN0A 5ALVA 2WJVA 4Z51A 7GPBA 5KX5A 2FQ1A 1PZFA 5JMOA 3EAQA 2XD4A 3A25A 3LUHA 2AH5A 1CD5A 4OHCA 4PZAA 3ZDXB 3KK0A 1E9DA 2J3KA 1WPXA 3P45A 4I08A 1JL3A 1LLUA 1GAWA 1ZUIA 2QNIA 3HY6A 1YK1A 2W0SA 4I4LA 1EE9A 1NX9A 3JWIA 4ZOBA 3OIDA 5DTJA 4J6FA 1B6RA 1WKVA 1DEKA 2GARA 3CEMA 4IKPA 4V39A 2WJHA 4D9NA 4ZHQB 1NFQA 1XRPA 2I66A 1E59A 1XUOA 1DIRA 3BMXA 3KYJB 1UZUA 4ZQIA 3SAJA 3IA7A 1WOYA 1ZCJA 2IHKA 2Q0XA 5C8DA 1H4SA 2HWUA 3ZY5A 5B36A 1K3FA 2CUTA 4UTPA 2GBLA 2DUMA