1VIMA

Crystal structure of an hypothetical protein
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
192
structure length
192
Chain Sequence
b'HGGHMSLLRFLEVVSEHIKNLRNHIDLETVGEMIKLIDSARSIFVIGAGRSGYIAKAFAMRLMHLGYTVYVVGETVTPRITDQDVLVGISGSGETTSVVNISKKAKDIGSKLVAVTGKRDSSLAKMADVVMVVKGKMKQERDEILSQLAPLGTMFELTAMIFLDALVAEIMMQKHLTEKDLEARHAVLEEGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein AF1796
molecule tags Structural genomics, unknown function
source organism Archaeoglobus fulgidus
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
total genus 67
structure length 192
sequence length 192
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01380 SIS SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1vimA00
2VQFB 1XMQB 4GKJB 4LF5B 1FJGB 3Q7IA 3HBAA 4JYAB 2POCA 3ODPA 1N32B 4LF7B 4DUYB 2CVPA 3EUAA 2DECA 4DR1B 3KNZA 4GKKB 3J81A 2E5FA 1J5XA 4DR7B 5FLXA 3OOJA 2AMLA 2I2WA 4DV6B 4KHPB 4X64B 1G98A 4B3RB 2A3NA 2UXBB 1B0ZA 4DV1B 2UUCB 4LFBB 1VI5A 3M5PA 3QKIA 5I01A 3TBFA 4JI7B 1J5EB 2DF8A 2VF4X 3PR3A 4DUZB 1IBLB 1IBMB 4X66B 2ZM6B 1HR0B 4YHHB 4JI2B 1XMOB 1X92A 1X9IA 2O2CA 2UU9B 1MOQA 1JEOA 1I94B 1MORA 4DR6B 2PUTA 4LZJA 4S12A 1JIQA 2UXCB 3ETNA 4DV0B 1HNXB 4JI5B 1KOJA 1MOSA 1VIMA 2CXQA 2O2DA 5IWAB 4DV5B 4JV5B 4DR2B 3FXAA 1JXAA 4X65B 4B3TB 4AQYB 3JAMA 1XNQB 1NUHA 2Q8NA 3NBUA 4JI6B 4K0KB 1HNWB 2CXTA 3BJZA 4JI1B 1WIWA 4NXMB 4LF4B 1TZBA 1X9HA 1XNRB 1N33B 1IATA 4LF8B 2X3YA 3FKJA 3C3JA 4LF6B 1TK9A 2ZJ4A 1C7RA 4YY3B 1U0GA 3LJKA 4M0DA 1Q50A 3FF1A 4JI8B 3CVJA 1DQRA 1U0FA 2UUBB 2CB0A 2V4MA 4JI4B 4JI3B 1U0EA 2WU8A 3TRJA 2XBLA 4B3MB 2UUAB 3IFSA 3I0ZA 4IVNA 1VIVA 4U6NA 3JX9A 2E5LB 2PUVA 1N36B 3FJ1A 2VQEB 2CXRA 1ZZGA 4JI0B 4LFAB 1GZDA 4NXNB 2F4VB 2CXPA 4AMVA 5A2QA 5IT9A 1NRIA 4S1WA 2UXDB 3T1YB 3HJBA 2CXOA 2J6HA 1C7QA 3UJHA 1T10A 5BR8B 2VF5X 5BY2A 1M3SA 1XTBA 4DR5B 3T1HB 1HNZB 3Q88A 3OTOB 4DV7B 1IBKB 4DR4B 3J7AC 1GZVA 5LMUB 4TOIA 3G68A 1HOXA 2PGIA 5LL6P 4DV4B 2HHHB 2PUWA 1N8TA 2CXUA 2YVAA 1N34B 1JLHA 4DR3B 3SHOA 4X62B 1X94A 4DV3B 1VI6A 2ZJ3A 4B3SB 4EM6A 4LFCB 5LMNB 3BCHA 3J80A 2CXNA 4OX9B 2CXSA 2XHZA 4LF9B 4DV2B 1IRIA 2I22A 1TZCA 1HM5A
chains in the Genus database with same CATH superfamily
3QXSA 1XRMA 3ZBPA 3X0DA 4CQMB 5CBKA 1EI9A 1FJGB 5G4LA 3A6KA 1XMIA 3BULA 1X38A 3GBSA 2OM6A 4GP9A 1JSRA 3N39C 4H7PA 3T7DA 3LUHA 4NS4A 5FOUA 2D7DA 1LSOA 2B5WA 4ZEOA 4KPFC 4I9HA 1DHTA 1JHYA 4PNPA 4XYMA 2GAIA 2HXGA 1Q57A 5AVTA 5KS2A 1Y7HA 4OVKA 4EUEA 2A5YB 4UM5A 1E3IA 2BKVA 5KTPA 3WWPA 2E49A 3BFJA 3P2OA 3RT7A 2VWQA 2G9NA 4CLDA 3M5PA 2BFDA 4A4DA 3R77A 1F5NA 4DJDC 1GLVA 4P9NA 3G8AA 3RPEA 1AQIA 1IG0A 5BOSB 1QIDA 3R7LA 2EHJA 2FYTA 4BO9A 4CKWA 1ZD1A 3RK4A 5TT0A 1UDRA 2PTGA 3M89A 1JHQA 1YZUA 2ZRPA 4DPMA 1TLFA 4ZEXA 5GPBA 2WIBA 1Y33E 4Q39A 1SK9A 1P73A 3EVBA 4FMBB 4ZAYA 3WMGA 1AKMA 1V6SA 3GEDA 1LXCA 4GMXA 1SOMA 3UMMA 4YRJA 5DI3B 3TIFA 3L0BA 3OMLA 4Z5XA 1YRHA 3R3HA 4EUHA 3GLIB 4YRKA 5GVSA 2CLMB 3FOFC 2ZUEA 4KH1A 1TKAA 2IEBA 2OZKA 3G2NA 4GX5A 2HMVA 2IS1A 1I0LA 3C6MA 1RXWA 4MWEA 1JHMA 4OL0A 3COPA 1CJVC 3TNLA 1VPWA 4ZYWA 2RDMA 3H1FA 5AW1A 4O4LF 2WAYA 2NXEA 4QPPA 3KVVA 4YGYA 4QASA 3TCXB 1DU4A 2JFUA 4BB5A 3EA4A 2VZ0A 5IAOA 2OBBA 4UUQA 5A9TA 3WBKA 3MWDB 3Q41A 1T5TA 1DLJA 1GAJA 1X1RA 2IUEA 1R1DA 4L9WA 4NH4A 2EFGA 3COWA 1R9JA 3MWGA 4EY5A 4ILEA 7GPBA 2BKLA 2NNWB 1PV4A 5EIHA 1M34E 3HRIA 3IO5A 2UUBB 1LLUA 3MINA 1TF5A 3W5UA 5JPIA 3ANSA 3KEGA 3L1HA 1K8ZB 1YQXA 3NC1C 4P33A 1P7PA 4P4SA 5G4KB 2GJKA 3ZI0A 5C5CA 5JO0A 3ZV4A 3L6CA 4Q9DA 4LXYA 1ESDA 4PO9A 3IEXA 2I2CA 1KFBB 2FEPA 1T9GR 2ATVA 3FKSD 3HA7A 3M2TA 3L84A 1L5GB 4MO2A 3S27A 3ABIA 4AF7A 2F7SA 3T5AA 4C29A 2ZVJA 1ZIXA 5F2KA 2XOKA 3W5CA 1F4PA 2P9FA 2RIRA 3DEAA 5GVRA 1HLGA 2O2JA 3MUOA 3X1KA 4K9NA 2G5TA 1EHCA 2MJLA 2O7NA 3PUXA 4YVFA 4CMCA 3SZLA 1XX6A 5IDXA 3QOFA 1ZA1A 1H8EA 2DFTA 5JY1A 4KJZA 1ZK0A 2A9OA 3WDLA 1B3RA 1NHGA 4ECAA 1X19A 2P62A 3OAAA 1Y9AA 1G21B 1JE0A 4TOIA 4ADSG 2W8BA 4HH0A 2KBEA 4YRRA 5HDBB 2O8FA 2X6QA 2B4TO 2NZWA 4KHZA 2YN4A 5A02A 1SD5A 3IYLW 1NQUA 2ZJOA 4EKYA 4D0SA 5LOVB 2W22A 4M53A 4GBJA 2BMWA 4IZ6A 2HREA 2JGNA 5AKXA 1Q0SA 1XKXA 1C0EA 2GD6A 3DO5A 4RTNA 2J6IA 3MEQA 4WOKA 3PQ2A 1WCIB 1DL5A 1WF3A 1IONA 1FPQA 2HK8A 4GG1A 1BZYA 1NF3A 4ENTA 2BEUA 1UKBA 3SBDA 5JNSA 4ZT6A 4R8LA 3UFXB 2OQIA 4D4GA 1AQJA 2PLWA 3EOZA 4DLXA 1LU9A 1Y8RA 3FX2A 4HATA 4M1YA 1U90A 3IQFA 3P2KA 3BE6A 4BWYA 3BZBA 2NG1A 4KXLA 1RE1A 4WY5A 5BV0A 1AKRA 1W44A 5CMLA 5FD8A 4IFIA 4KN9S 1MEJA 4DV1B 4V0QA 1XZGA 2HDWA 3C5EA 4EUNA 2PK3A 2C2OA 1PU2A 4QEKA 4CUJA 2ZJAA 3LLVA 5L51A 1NFFA 5DTMA 2WSSD 3K6JA 2RAPA 2WU0A 4D6YA 1UC4B 4LI3X 2XQKA 2IPNA 3ANLA 4D3FA 3DM5A 3SBOA 1GN9A 2JLQA 5FPTA 1NRJB 1NX9A 2QN9A 3UMVA 4KQXA 1ZYUA 3SN6A 3C3PA 1SVKA 4YDSA 3LY8A 3HKEB 4U7JA 1G60A 4MO9A 1SXQA 2JLWA 1E5LA 1NFQA 1ZEJA 4QAJA 2DTEA 4TL8A 2ROQA 2GCOA 3LHFA 1U4NA 3AHDA 3GJRA 2JFVA 3H04A 3K1AA 5CNIA 4JEHA 3U3RA 2R7KA 3VAAA 3ZGLA 1FNNA 2KX7A 2C54A 1ORTA 4N49A 2DPHA 4C1BA 4JP8A 1O58A 2VQDA 3K1ZA 2C2HA 1QE5A 4YK7A 4DDHA 3O84A 5AUOB 5J4HA 4I4TF 1JU4A 2UVDA 4RPIA 1M7GA 2EX1A 2NZ2A 4RZQA 2DFDA 4V39A 1VXOA 3RG2A 1SNYA 1AKNA 1QVAA 1I30A 2QLNA 3B38A 2X58A 2ZBEA 3AZQA 1QQ5A 3RVOA 3AEKB 2O2SA 1Q1BA 1I51A 4YCCA 3OZBA 5CYFA 1ZUIA 4LIPD 3BERA 4WBXC 1T2EA 1EVKA 4YJ3F 1LK5A 2PKRA 2CMKA 1NX6A 1B2LA 2YZ7A 4Q01A 1J7JA 3I5UA 3ZHZA 2WD7A 2XD4A 1H4VB 5FA6A 4EGCB 2YVUA 2Q6KA 4CIBA 2C0QA 3BC1A 5I7FA 4LBVA 4MS4A 1Q0LA 3LOPA 2O2HA 4F9EA 3FAKA 2UUAB 1DHRA 2CDNA 3N7TA 4ZV9A 5F4ZA 3TECE 1R6TA 3FNRA 4TWRA 2ZRFA 2W2TA 4RSMA 1OZAA 3N07A 1PL6A 4BUCA 3MELA 5FOSA 4CT4B 5HKKD 4D44A 5CXQA 2LKDA 2N46A 4P82A 1XFAA 4Y9DA 3A3PA 5JJKA 2CFCA 1WHTA 4RS4A 2WJYA 2WKRA 2XYQA 2QMOA 2I5PO 1Y4AE 2OMEA 1VGQA 4P5PA 2QL7A 4BDSA 4MWTA 4QD3A 1Q2XA 3NASA 2CSUA 1EB8A 4TLLB 3IODA 4IJ6A 3ROTA 3URKA 2P8JA 1ZUNA 3PNLA 3L6DA 3B1JA 3IO3A 3VKUA 4DG9A 1IVYA 3K53A 1U9IC 2DWQA 2ZUSA 2QLMA 4Q05A 3NEAA 4QEZA 4WLFA 5B4VA 4D9IA 5A6SA 2Q6OA 2H63A 3P45A 1IHUA 2RFLA 1E2FA 1O3YA 3TLJA 1H2HA 4TV8A 2WG2A 2NN3C 4C4PA 1X77A 4UUNA 5JD4A 2XITA 2QZZA 3JWEA 4UVDA 1RJEA 2PNJA 3VI4B 2I71A 4IWXA 1KY5A 3EARA 2BHNA 1EB9A 4DILA 5D3MB 3ZVLA 1VE3A 2ZAYA 4DS3A 4NDNE 1E96A 3CF6R 1NLMA 4BX2A 1P33A 4OXRA 4Q37A 3LQRA 1KRXA 2A30A 3H2HA 3NIWA 3PNKA 5U4XA 1XXHE 4XDYA 4JJAA 2C8VA 4FI3C 1ZAYA 2YWDA 3KZOA 1NC3A 2F2TA 4XEUA 3EOBI 5JXHA 1XO1A 1I9CA 4QQRA 2ZI7A 4TWAA 4X85A 3UCEA 3VDRA 3QK7A 3VV2A 3ZTWA 1Z15A 4NCIA 4ASUD 5IULC 1DWPA 3LI2A 1LY1A 5C7OO 1WB4A 2FUG1 2JI9A 2WJGA 3NYIA 1T1IA 5ESWA 3F2VA 3BORA 1GG5A 3VR3D 2CL5A 5ESRA 3CMMA 2I2BA 4PX2A 1IBMB 1TKBA 2CJYA 2JBAA 1Z0FA 3EGOA 3TTVA 1NN3A 4E94A 5H8WA 1XRPA 1N92A 1C9EA 1TVCA 3T1NA 4Z4HA 1W48A 1F6WA 3FPEA 1BSVA 4FS3A 5FPSA 4AY3A 1GD1O 1PR9A 3QJ5A 2PBLA 1QRSA 1KJJA 3WWEA 1CNFA 1AB6A 1IEVA 1OFIA 3QMVA 1K0FA 2R6R1 3G5TA 2FAXA 3AEUB 4FE7A 1M6EX 2FOIA 4FONA 1N8NA 1N0HA 4HC4A 4ED9A 1GL3A 2VUSA 4MRAA 3AB3A 4YJGA 3I8SA 4MWBA 2CHVA 3D4LA 1XAIA 4G1VA 2W6QA 4H77A 4B6SA 4OB8A 2GEBA 1JYFA 2QMUA 3GEPA 3U56A 3CLTC 5LQKA 3HDYA 4L9RA 3CVWA 1TYEB 1OKKD 4IDNA 3IKJA 5CB0A 2V0GA 1AUQA 4BEJA 4JIMA 3TOCA 1W19A 3GD7A 2VJMA 3Q11A 3MXOA 1FNBA 4TTTS 1I6LA 4NCBA 3Q3JB 4M88A 5KBYA 4NTZA 1GSIA 4XTRA 3UA4A 5EE9A 1A50B 5K3FA 3S7TA 1DEXA 3AH8A 2M1XA 4HB4A 4GLJA 4UEKA 3HZOA 3C5WP 3PFNA 1AH2A 1N2HA 4Q19A 2AMJA 1WNFA 3SOPA 4Y6RA 3GAFA 3OU6A 2J6BA 3UHJA 2RHCA 2H2AA 2P2DA 2JEOA 4R8RA 2CXRA 3DM9B 5CYPA 3SFZA 1T3HA 5JASA 2Q27A 2PY6A 3MGKA 3EVZA 4O2RA 2AI3A 1QG4A 2G7MC 4OUDA 3TKLA 3VR4D 1FLAA 4IIHA 4UD2A 5KAMA 3T0GA 2PV7A 2L18A 2UZ3A 2FG6C 2ZB2A 2GBLC 4J2OA 1EXMA 4H6XA 1EJBA 1S96A 1SBIA 1PS8A 1SG0A 2GAAA 3O8NA 4G9EA 1E9BA 3O4JA 2WC1A 5FH9A 3PB3A 4IIBA 9GPBA 5AW4A 3ZHUA 3JWJA 4MV4A 1RLMA 1M1YB 3EC1A 3VH1A 2AK2A 4GT1A 4LVUA 1UKCA 2X0DA 4Q1FA 3U3JA 5C5DA 3HVUA 4H0NA 2H1FA 3KR0A 4IWNA 2P6RA 2X15A 1GO2A 1HMYA 1D1QA 4Q9LA 3JY6A 2DHEA 3KJHA 2AN3A 1EFAA 1FS5A 4F3CA 3R7NA 5K6AA 4KR7A 2D0OB 5KPDA 1B1CA 5FTJA 3ZWKA 1ZSNA 4HQRA 4FNAA 1DKRA 3ONDA 4LGYA 3I9NA 4D6XA 1C30A 1WXDA 1J33A 2DFPA 4DLYA 3FY4A 3STHA 5IDWA 2RHTA 5LYJB 5E6UA 5DKFA 3DGFC 1QNFA 2WV9A 4K3VA 2A1UB 1C0IA 3KB2A 4WBNB 4UJ3A 5FDFA 4G0OA 2JEYA 4O8CA 4MUIA 1YRWA 4RVSA 4BECA 5KWVA 5DOZA 3J81A 4HNSA 5JVDB 1Y6FA 1V3TA 3A4VA 5ES3A 1N2OA 3ONEA 3OOJA 1Y1SA 4L28A 4WHMA 1ND5A 1Z4OA 3IOMA 4Q4CA 1VHQA 3ES9A 2C7PA 1PZFA 4JEIA 2PZEA 3HO6A 4DANA 1YZQA 3MWLA 3QHPA 4ZHQB 4GX2A 5D1HA 1XCGB 3ZZ1A 2W2QA 2FG5A 4B6EA 1V1MA 3ZHRA 5JHHB 1I4DD 1MX3A 3NCHA 2O0HA 1P5FA 3BWVA 3IGFA 5F3RA 1E5XA 2PE5A 1FMCA 2X22A 2WYIA 3KS9A 2JJYA 4RHFA 4KI0A 5HILA 3WOHA 4QQFA 2VCEA 3HRKA 3KLOA 4LZJA 2XUOA 4H08A 3QVGA 1WDTA 5KNDH 7ADHA 2AZTA 5GGXA 3OZIA 1D5WA 4HDSA 4LBYA 4WI1A 2J3LA 5FWXB 3ABRB 5JO9A 3TSOA 3R9XA 1QE3A 2FPXA 5E7MA 1PJZA 3INYA 4DDVA 5JOQA 4TS9A 2CFSA 2FDXA 1XZJA 1RADA 3RS8A 4GZLA 3JATB 2I7XA 3LCUA 2VUTA 1CLEA 4BKQA 3Q9LA 4Q1AA 4EA6A 3EW9A 2EZTA 1TZBA 5TE9A 2X3FA 2NXWA 3MCWA 3OZDA 1MRNA 4JR1A 4YJ3A 4CM5A 2X3YA 3NIDB 3QVJA 1IOWA 3QP9A 3ZXIA 5E8JA 3M4ZA 3M6IA 5DTJA 2VDVE 5F5LA 1C7RA 2D1SA 4WERA 5ELLA 4Z0NA 2YN2A 3IUJA 5HF9A 1BFUA 1QVWA 3FJYA 4WKNA 2ILTA 4G1CA 4P4SB 1E7WA 5G4KA 3QEAZ 3EH1A 2B2XA 3PXUA 4GVXA 2O50A 2V1UA 3IT1A 3IEVA 1RI2A 3IERA 1FFWA 1LNQA 4S04A 1UMKA 2OPBA 5CB4B 1XE3A 3B85A 3FHCB 3L1IA 2JGLA 4QHTA 1C41A 4QARA 1HE8B 4Z7OB 5KNBA 3TZHA 1W6RA 2HMSA 3IJ5A 4YV0A 2E3JA 1E3SA 3NTXA 4QPNA 4D4HA 3BHNA 1U8YA 1ODIA 2P9QA 3O7WA 4N3AA 4ZU6X 2VLIA 5I5EA 1JMYA 5JJLA 1UH5A 2OESA 3I5MA 3O03A 2WF8A 1M54A 3B8EA 5EWLB 3UWKA 1H9CA 1LJLA 2OEPA 5JD3A 5DLDA 4DV7B 2VXYA 4I1YA 1UT6A 1ZBDA 3MQ2A 4OQZA 4RV4A 4NICA 2V54A 1KSGA 4GRIA 1ACLA 3AMVA 3UCXA 4F4IA 5FI0B 3FOEC 4REQA 5G3YA 1Q22A 2VEDA 3PQFA 1RHKA 4IFBA 1YS4A 4L3WA 2JFNA 3GUYA 2HTFA 4EB3A 1MQ8B 2CLOB 2F55A 2HF2A 1MENA 1ISPA 2F3PA 1KY2A 2A8YA 4HQ0A 5CW2A 4BFTA 1UDXA 1LZKA 2NO6A 3N05A 4XRGA 3PHHA 2RCNA 5F1OA 4F2HA 4L2IB 2IXGA 2XT9A 5I4BA 4OXKA 4PYKA 4I66A 4PS1A 3BYZA 3GW8A 4Y7DA 1YKSA 3UJ8A 1EWRA 2P5TB 5TR9A 4BN4A 4CM1A 4GO1A 4R84A 3O95A 1T4BA 1ZUD1 4D1YA 2XJ9A 3R2JA 1PN3A 4BMPB 3K9FC 4QXRA 1DIBA 1DX9A 4R31A 1L7OA 2ARKA 4B6JA 4DB4A 1E59A 1NMXA 5HBGA 4WJLA 2HYIC 4ZCPA 1CUJA 1U5BA 4ENWA 4YJFB 4CKEB 2FI1A 3WKEA 1RWXA 3VQTA 1IZZA 1MV8A 2MSCB 4CN8A 2ORIA 2AEJA 3DQQA 3OIWA 5AIBA 1XFDA 1VA4A 3CUKA 3T4EA 4BO3A 4BLQA 4QT0A 1FXSA 4II2A 4I3HA 4X54A 1JQJC 3PDWA 1H1TA 3PTLA 3I9OA 3RO7A 5LD2C 4H31A 5DFAA 4B73A 4KQWA 1BMTA 2TMKA 3M1LA 1RP1A 2CNLA 3C1TA 4HEA1 4UMFA 5HIMA 1G66A 4EF4A 2Y1WA 4AKGA 3QV2A 1PX0A 3P20A 5AR1A 4DV0B 5HQJA 4ZQCB 3BB3A 2A0UA 4KQGA 3ITEA 1Y7PA 3IAM6 1G8AA 4D9BA 3D7RA 1TYCA 2VSOA 2ZJ8A 4IM7A 4MKFA 1KFJB 3Q8WA 2HF8A 3WRVA 2ONYA 4MUNA 4YDQA 3AOGA 1KYZA 2AQIA 3OA0A 1VC2A 4BWGA 1ZCFA 3ONNA 1XKLA 3FCEA 3A6EA 3PNBA 2HPZA 3AFOA 4WOJA 3MJDA 5EYPA 1R88A 3AOEC 1V4NA 2QG4A 4GOLD 1VA5A 3H4TA 4LWOA 4WUTA 5TQ0A 4Z7NB 4O3MA 4QZVA 1FW6A 5J59A 4ZZ3A 4TPKA 1UXGA 4FWTA 4GBMA 2FMXA 1SCNE 4MR9A 2YMPA 4DRYA 2IEAA 3RHFA 2P65A 5KJFA 3LO8A 4RVCA 2R9VA 4BVGA 3P8ZA 1ZHOA 1W1WA 5CG2A 1DDIA 1HRDA 4OHKA 1GL7A 3B1KA 2KLBA 2QN3A 1FCJA 3MT0A 1ZDMA 3F6SA 4HHEA 5F1YA 5J3JA 5EYPB 1D4ZA 2A33A 2IPXA 3R6GA 5AHOA 3SF8B 4G0MA 3VU9B 5L7TA 3W7VA 2Z8YA 2FPIB 5DK6A 1CHNA 3E7XA 3C5CA 4TV8B 1EVJA 1LLFA 3V4FA 3W7BA 4DHEA 4DPKA 5L45A 5CNKA 3CH5A 2R6DA 1BN7A 3PIDA 1DJQA 3GGJA 4NOLA 1UMBA 1RLJA 2QVCA 2WSLA 4IHJF 1XUOA 1G6OA 3VTZA 4JOBA 1NOIA 2YASA 4U5QA 3OPYB 4AZ3A 1J0CA 1XKQA 1CP2A 3RTGA 1D8AA 1VP9A 3BN3A 3ZOZA 1W4CA 4BNVA 2C2KA 2L42A 1Z4IA 1CRQA 4TRJA 2A5JA 2XSZD 1Y5IA 3EGWA 4MQMA 2JH9A 4C01A 2RC5A 1WHSB 1JWBB 4XW2A 4F1KA 2RHBA 4QUIA 3HL4A 3OZTA 4RFSA 4ZVUA 3TKYA 2B8WA 4CG0A 5K0ZA 4XR4A 1MP0A 3WKBA 1DC5A 3L41A 2WWFA 4DDWA 2UYHA 1PL8A 4CTMA 3NM5A 3C7CB 4LF9B 2O5CA 3SFVA 4RPJA 3ZCTA 1KZ6A 4GKJB 4R2HA 1TECE 3STXA 2IYRA 4OYYA 2R25B 5JZ9A 4W5QA 3VYWA 2W6IA 1ODTC 3I05A 1X9GA 4RA6B 1AXEA 3GGDA 4K2AA 3FVTA 3WL4A 1CFZA 1E4EB 4NAVA 1OYYA 3G0OA 1GGMA 5LCXA 4EITA 6Q21A 1KFCB 5DGDA 1QFYA 4KH0A 3IAAA 2WMDA 4UBMA 3R8XA 3A6HA 2Y4OA 1TL7C 2GUWA 4TUYF 4G0WA 4XYGA 2AL7A 2JIDA 4O3FA 4WNAB 1OLUA 1RMYA 1E0KA 4XOIA 4DZTA 1W4ZA 1YB2A 1CTQA 2JD1A 2QTAA 3GGPA 4GDMA 2OECA 2FF5A 2OTCA 1Z3CA 1IAVA 1PHPA 2W6OA 2IU3A 2YBDA 5AW5A 4EI7A 1BJRE 3OCUA 3EMKA 2C58A 4MCIA 5F2EA 2Z95A 2HAEA 3ZHXA 4F4FA 4H6WA 5JADA 3BQ9A 4WW0A 1C3OB 1ORIA 4IMJB 4GBGA 4PQGA 1LSSA 5FTLA 1J8FA 4ZK2A 3UPTA 4NONA 2J85A 2P78A 4GPZA 1P4GA 2RGNC 3EQZA 4MQ6A 4GQBA 1L5HA 4GMFA 4P83A 3B3QA 4DDUA 3MW8A 2C84A 1MAHA 1U2EA 2CDAA 2XRFA 3OQMA 2IOFA 3NBZC 4NJMA 4OHXA 4PLYA 4R8MA 4RF2A 5AXBA 1OYVA 1W2GA 3IDQA 4BVJA 5TQJA 2I6UA 2PNFA 2COUA 1U1IA 2ZJFA 3CKKA 4CI0B 1PQ4A 4XFJA 5GONF 1FFBA 2ENUA 1ISGA 2YXDA 4IWYA 1EP2B 4WN9A 3UK2A 1F9AA 2H31A 2OA0A 3TQTA 2X40A 3I9LA 4HAZA 3FW1A 3G1UA 3IRVA 4F93B 5IN4A 2W6NA 5AVOA 3VPCA 5KOJA 1USGA 2E21A 2ID7A 3N0XA 5IT5A 4GWKA 4NX2A 1P2BA 4KFCA 1NQVA 5AYVA 1AKWA 1RXYA 5TIIA 5IF3A 4XIJA 8ABPA 5BW4A 3DCIA 1SUIA 1GKKA 5K6RA 2VJQA 1O6BA 1JQEA 1L3BA 4W9NC 1U31A 3QWHA 3W8DA 1VKOA 3PX7A 1UXIA 3CZRA 2OD7A 2OGWA 1HV8A 3B1FA 3M33A 4MI9A 2G6BA 5DBIA 3SEFA 4QICA 3V8EA 2R5NA 3JTEA 3OZXA 4U4AA 1XCMA 4RVHA 3D3QA 3NTVA 1NKTA 3TAUA 3PYMA 1JBQA 1YQWA 2I4NA 1NBAA 2Q3HA 2B34A 5HTKA 1YVUA 4GYYA 4BJ6A 3FNQA 1FQOA 1U3FA 3SZ3A 4C76A 5CG1A 3UJHA 3JATA 3M4YA 4UCWA 4XD7A 3WK7A 1N0WA 2QMQA 3LE8A 4FNOA 2O7RA 1G21A 2X86A 3DVRX 2ETVA 4HDMA 4ARIA 5IBPA 1J09A 2IZ0A 3AI7A 1TNDA 4KQIA 3RH0A 4Q7MB 5C37A 3C87A 3GFOA 4JX9A 1O96B 3IXMA 1AS0A 4NESA 1AZTA 5LMUB 1NURA 4LJ8A 4ISBA 5WRFA 1MO2A 2CHEA 3EEFA 3EBOA 3KQNA 1K08A 4YDRA 5REQA 4YMLA 3LWZA 4KO3S 4XX0A 3L3BA 2WZDA 4MGEA 3RCBA 4CM4A 1THMA 4DL9A 2PRSA 4TTQA 4C0KA 1CZUA 4FSXA 3V2HA 1E7YA 2QTMA 2JLCA 4INAA 5DNUA 1OMOA 4KAXA 2HF7A 4BVFA 1ZXXA 4JEUA 3GQBB 1R64A 1KI6B 1WLSA 4D6PA 4LRUA 4RL4A 4FMDB 1MHPA 1BG6A 2I4MA 4X3OA 1ZEMA 2HJHA 1C7EA 1CQJA 2FWRA 1I2ZA 4L85A 1XK7A 5B58T 5MHTA 1GPAA 2OBLA 4G81A 2OLKA 4PZYA 2VJOA 2YRWA 4YCNA 1GSHA 2EAUA 1RPZA 4QJ3A 5JZOA 2Q46A 3MWDA 1QTQA 1GPKA 2C94A 3HFGA 3W9UA 2O0JA 1TCVA 1G64A 4HZUA 5DNWA 4B87A 1N6NA 3BGSA 1KPHA 4L15A 3REOA 4WK4B 1U8ZA 4X1IB 1NR1A 5D2CA 1HE2A 3CINA 1BMQA 2QU8A 2VOEA 4M89A 3ANXA 3ZU3A 3OIGA 3IP8A 3FTNA 2ZIUB 2W4IA 1VYTA 2REOA 1YBVA 1TQHA 4HLNA 1LH0A 1ESZA 3DR5A 3MT8A 5IM4A 4MRMB 1EVZA 3PNYA 4Q1BA 5M2QA 2GXQA 3DZDA 4HQLA 4GLOA 4NFSA 4GP6A 1L7MA 3A37A 1T3LA 1WQ1R 4RMHA 4UCFA 1QB7A 2WPDD 5CAEB 1NAHA 2YFHA 2YV2A 3R9KA 3AKZA 3OJOA 2WOOA 1RW4A 2IHTA 2L19A 2R8PA 2GEJA 1ISHA 3REQA 2E0IA 1LDMA 1Z16A 1FYEA 2D4AA 4FNMA 4J0HA 1Z29A 2E6KA 3CT4A 4PYIA 3GEGA 4WCVA 4BLSA 5EJ8A 2RMKA 3HM2A 4MDEA 3SMVA 3U6BA 3BMCB 4OV6B 4D80A 2FFQA 1R6DA 2IY7A 2B0JA 1YTUA 2AG6A 3F1LA 4RIFA 4G9GA 4L0QA 5J5AA 1ZJJA 4ENSA 4W99A 4FCTA 1V71A 1XA0A 2OSBA 3TLGA 1USIA 4DADA 5CLFA 4PQFA 3UG7A 4UUOA 2FPWA 3CW8X 3DW1X 4QA9A 4LECA 5JZVA 4PX5A 3BT7A 1KPGA 3PCXA 1WPGA 1YZNA 2HIGA 1YRAA 2Y9PB 3H7IA 5KNDD 1U7PA 2E4AA 4JJKA 4HEQA 5BOVA 3LQ2A 1ZUHA 4M1KA 5HM8A 2W48A 3S1LA 3D6AA 1MDFA 1G42A 4FW9A 1RHRA 2DKNA 5I9SA 3L1UA 4X1IA 4UPDA 1IY9A 3T1YB 4QUHA 2Q4TA 5IS2A 4EO7A 1JDBB 4D4JA 4FEAA 5ALYA 3QIAA 3D5EA 2IITA 5LLTA 2C42A 5CLLA 1QYIA 4AYWA 4YQEA 1X7YB 1JG6A 4ENQA 1K8XB 2PMKA 4NYMR 2DWOA 1S2NA 3QOYA 2ID8A 3S5JA 3FPSA 2G28A 1V7CA 4J07A 4W5WA 3OTGA 4BFUA 2PGIA 4MVWA 4R0NA 5EUMA 3PUKA 1PFYA 1HO3A 2I4RA 2EXXA 3AL2A 3ENWA 4AF6A 3GLFB 3VR4A 2XODA 1KH1A 2P8SA 1Z12A 3DE3X 5EMJA 1ZMOA 2ZIEA 5HZMA 1N77A 5IKXA 4PTLA 2V7PA 5K0EA 3AEXA 2FW0A 3FVWA 5IKMA 1P9NA 2XHZA 3A0UA 1THGA 3ZWAA 5LU9A 1XTIA 4RK4A 1FX0A 2IYNA 3PXGA 3RRYA 3IQZA 3T4UA 4JYAB 4MR8B 4QSMA 1XTPA 1XOIA 3FFAA 3DUFB 3NM6B 5CDHA 5FA5A 3UAZA 1KO8A 4AL4A 1PR2A 1FUUA 3ICPA 3EAGA 4GYWA 4TSFA 5G1PA 1YJXA 3FE2A 3BICA 1V37A 3EW7A 2PBRA 3L01A 1JLKA 3LBNA 4LBWA 4G4SP 1BQEA 3OZVA 4C6RA 1S7GA 3LVQE 2OFWA 2QD5A 3D6MA 3EFEA 3IUYA 1NVBA 1GU0A 2VDQB 1QSGA 3GNLA 1C1XB 3NHPA 3N8GA 1HTTA 2EJTA 4J0QA 4MUEA 4ZRNA 3VAYA 4DRXA 5ITZA 4RD3A 1TCUA 3KYIB 3DE5X 4ZQIA 2FWPA 4MRRA 4Q16A 3ZWOA 3PLAE 1H42A 1K6XA 3DR3A 2M6KA 2ZBGA 3K4PA 5U9CA 1RI3A 4XSHA 4D99A 1XP8A 4FGJA 3OMWA 1YVPA 2Q1TA 3LZCA 4D98A 1R10A 4ZHSA 4RWEA 1JR6A 2A9QA 3TUZC 4B33A 2JH3A 3Q2KA 3LVBA 1KQ3A 2ORYA 4EHDA 2VRBA 1HY3A 4G8JA 4LV5B 5UKDA 4A0GA 3K9BA 5EP1A 4E11A 1R9GA 1J5PA 1J23A 3IV7A 4WH0A 5CXSA 3VNAA 3AXTA 4CN9A 2O3JA 4ENVA 3BSFA 2WOJA 1KAGA 2UYOA 4O4JB 4YCBA 2NUAB 4O5AA 4UTVA 3IQDB 3LH5A 3TCKA 3ZKWB 1T9GS 4R3UC 5LQSA 4BEBA 2NU6B 3PJGA 3W8FA 2GQ0A 1ZRMA 4BNMA 4U39A 3RSHA 5AXCA 4K9LA 1T1RA 2IU0A 5CVUA 5LKAA 1VL0A 4K8RB 2OBYA 3F4BA 3F3MA 3CRZA 3H11A 3LAWA 5SZKB 2GPNA 2NLOA 2VP2A 3OLCX 3USCS 3TNYA 4IEEA 2GZMA 2ID9A 1JIIA 1N0UA 4KIFA 2V58A 4S0XA 1JIKA 4TRRA 2X5OA 4HK4A 3KG2A 4RQBA 1EP3B 2YJ3A 4WJZA 2PL3A 2Y1OA 1I80A 2YYSA 4Y8VA 3PR2B 1GJRA 3L7BA 3ZDZB 4DLVA 4HH1A 3OO0A 3HP1A 3ND7A 1GSOA 1RAAA 3ENNA 5EJ9A 2DLCX 3LWDA 1P9WA 5HKBA 1C9MA 3RS9A 1WZCA 3RKUA 4C0XA 3V4VB 5KSZA 4HH3C 4HX9A 4NCXA 3HM9A 1DKUA 2I7VA 2WKPA 2YHUA 5B30A 4YPVA 3BJEA 4A2CA 4DN6A 5JAZA 1QU2A 3HJBA 4QNNA 3V00A 1PK7A 2C3UA 4QUAA 5A3VA 5FKJA 2XAUA 5JE8A 5K03A 2Q28A 3L6RA 5AI8A 3BA1A 3SGLA 2QVGA 1VBNA 3C45A 2VBIA 2NZJA 1KGSA 1MEOA 1ZLYA 1T0UA 4Q34A 2B7CA 4RMGA 1RWQA 2WNIA 1XJ0A 4GPTA 3TX2A 3ROEA 1TVEA 2FLKA 4IV0A 4OLHA 1H2YA 2VS1A 3C3DA 4RLSA 1UXJA 2GSWA 2JZNA 3CH6A 3ICWA 2Y1LA 3PNMA 3VNQA 1JDZA 2J30A 1EUDA 1Z5PA 5E1OA 1HH4A 1ZHHA 4HAYA 1QH9A 4UUMA 3TINA 3PFIA 3AJRA 1W85A 1Y6ZA 4JYMA 2WIDA 4URZR 5SYNA 1GG2A 4AFNA 1DDOA 3PS9A 3NYRA 3QY9A 1A9QA 1RWOA 2AF4C 3CRVA 121PA 3GBVA 5EMNA 3WL6A 2IDJA 4LXGA 2RGYA 1L5SA 3PEVA 1U04A 3EXFB 3R5KA 3VU8A 2PKWA 5TSDA 1IUPA 1D0IA 3O2NA 3C4QA 1E4OA 1SHJA 2XJ4A 3V8BA 4DWVA 2R97A 3OI7A 3WNDA 1EZ1A 5LDGA 3RRXA 4XSGA 4V0SA 2NTNA 1WMSA 1KY3A 4XEHA 2V6FA 4XSVA 4TMTA 4NU8X 2L69A 3RI3A 1ZMRA 3KR9A 4AMGA 1Q15A 1XRRA 2R11A 2YWBA 4IQFA 8ATCA 1AX9A 1V3QE 1I3OA 3HB7A 1HDIA 3P9IA 2VHZA 4DLWA 5IABA 5KYGA 3WLIA 5KTTA 3RS5A 3A1UA 5C3UA 1XCPA 2VUIB 5GZ3A 4MX8A 3ENZA 2OUIA 2QT9A 1CETA 1A9RA 3ZU4A 1W5EA 1HFJA 1ZRHA 5ED0A 5G53C 1RXEA 2I6SA 3N0WA 2WVHA 2X8AA 4DSNA 2N42A 2XVAA 3NEJA 4QEDA 5H9VA 5B1SA 2R1TA 5D7NA 2AMVA 2HA2A 4YROA 3RNOA 3HN7A 3N2LA 3S29A 3NBAA 4DNFA 3WA7A 4YLYA 4MB2A 1BKYA 8MHTA 1TQ4A 2FP4A 2WV7A 5BSWA 3NFRA 4HD8A 5LR6A 1Y42X 4IH1A 3CHYA 2DMRA 2Z1NA 1VJ0A 2G76A 1S9DA 3C5HA 1TM1E 1NM5C 3R3XA 1L4BA 5TGTA 5CIQA 1YDMA 3TNDA 1DJNA 3IVGA 5FBHA 4MRMA 2REBA 1SG9A 4CGYA 3CUYA 2H5EA 4PXAA 4NYIQ 3C6BA 4M1MA 3W5SA 2CHQA 2AMYA 2E4ZA 5JDCA 1TQDA 1EAYA 4NZNA 4BLTA 1Z5VA 3BXZA 1FFXB 4TRMA 1Q1NA 3AUKA 3PWTA 1EVYA 3TW4A 4EABA 5DRTA 2FPPB 1U3GA 5JECA 1QXSA 3LX8A 4MGZR 1FE8A 2AEFA 4D43A 4YY3B 3FCYA 4DA6A 3K0AB 3FVQA 1U81A 4V1CI 5HW0A 1J9EA 3LF1A 3P5BA 1U0FA 1G1MA 4G5YA 1S3SA 3BE5A 3DTVA 3GIWA 1PR0A 3FTDA 2GDZA 1AQLA 1W0JA 2XBLA 3QZUA 4A27A 3UGJA 2REQA 4BNDA 2G36A 1DBPA 1FFHA 1XSEA 2CUKA 2HZBA 2YV5A 4FYHA 4IOJA 4IXWA 2AIRA 3WLKX 4B48A 1LLQA 1DAFA 2QLFA 5DISB 2O2YA 1Y4SA 1JJ7A 4R6WA 3WYAA 1S5PA 3VR6A 2Q1SA 1MVOA 4XUGB 3IE1A 3R9WA 1Q95A 1ONBA 1OGIA 3OZFA 2BGMA 1QIGA 3MTGA 3C3YA 2GD2A 1RYMA 3A3YA 2B78A 4CQMA 1KI3A 2JVKA 1BX1A 3IP3A 1BROA 5F77A 2ATXA 5L8VA 4WY8A 3GVPA 4AN4A 4GRDA 2WJWA 3BDAA 1VRWA 3KJQA 2H00A 3TLGB 1N2JA 1AKUA 3I1JA 4H1TA 4MCAA 1KI8A 3FPCA 3L8ZA 3QXCA 4D4IA 1D2GA 2QRUA 1A95A 2YY5A 4RYDA 1RP7A 4ZK6A 5KVVA 4OHRA 1SWVA 1X70A 1XN4A 3MUFA 1OVGA 1LTKA 4JN6B 2FEMA 2ZUWA 3FSJX 3N2GA 3OTWA 2PMWB 1FUKA 4E51A 3KJEA 2W6JD 4RK1A 5GY7A 3GEIA 1N2CE 4K6GA 4WA7A 4A8JB 4O1HA 4OI2A 2QQGA 2XNDD 3D7SA 5ER6A 4HPJB 2AH5A 1TUBA 4EG0A 1G20A 4ER6A 1CUYA 1GTL1 3NHZA 1N9ZA 3ND9A 4TLBA 5IAEA 2ZSJA 4PN7A 1N9GB 5J9FA 1Z3IX 2ZP1A 5U4QA 5ER9A 3SFTA 4FNGA 4BNZA 2ZB7A 3B1YA 2CWDA 2EJUA 4FDMA 1XZPA 2FQYA 5D84A 3M4JA 4CF5A 2A7XA 2V6GA 4IQGA 4KWCA 5TT1A 2XTNA 4GI1A 4W4TA 5ERGB 3IVCA 1V8ZA 2XF2A 4RCVA 3RVKA 3FOWA 3X44A 4YRMA 2JGKA 3BXOA 5EIAA 3I1FA 1NPYA 1DBSA 5KOJB 4EG5A 3UJCA 3V3TA 2XNCA 3T06B 5DX8A 3LYHA 5JSYA 2FQ1A 4RELA 3UGKA 5KOHA 2EW8A 2R5WA 4NU5A 4RVNA 3FF4A 5JNUA 5BSTA 2Y68A 3N8NA 1PE0A 4KMRA 4OHWA 1M2WA 2XVYA 4A5SA 4AN0A 4AROA 4GWLA 4GEKA 1EDDA 1ICEA 1U9IA 2IP4A 2K6GA 3K0BA 5A4DA 1QOPB 2GHTA 3DH0A 2ZVQX 1QPZA 1SFRA 3A3OA 3C14C 5H80A 4R9RA 4B2PA 4Z4FA 3BH0A 2BE7A 3WQSB 2CXXA 2G17A 3AIOA 4GZMA 2XMZA 3NBUA 5H59A 5FV4A 3GRKA 3BK7A 3P1JA 3VNBA 1DG9A 1OLUB 5TQ0B 2OBFA 3NORA 4NJEB 5FO1A 3F8SA 4KOAA 4ESEA 4YRFA 4TZKA 2NTJA 3CGGA 4MEAA 3HJTA 5EQTA 4BUZA 1H3EA 3FYUC 2UZ4A 1R6AA 4EVIA 4AWAA 4HN4B 1Z38A 2C8KA 3EBPA 3Q2OA 4JI8B 1GTJ1 2QD2A 2XYHA 3QVXA 2BMVA 3NHMA 2OV4A 1BE1A 3PDJA 4CM7A 1KARA 1EVIA 2P4UA 1NY6A 1L4YA 4B8YA 1TI7A 1S2GA 1WUTA 4WFIA 1ZI9A 2JHAA 2VH1A 4OTZA 5K8CA 1A72A 2IQIA 3L0ZA 1Q91A 3FHJA 4GPBA 4YRCA 3WYNA 3RHTA 1NNUA 1IE3A 3IMGA 5IK2A 4LV8B 1FA9A 3O93A 1MO4A 3V6LA 4CKBA 1JT9A 2J9FA 3QEMB 1KGDA 2B6HA 2WJHA 1ZW1A 2XEDA 3ETJA 3QELB 1H22A 2HX1A 2NOAA 2UXDB 1ZD3A 2KS6A 1CRZA 3S2FA 1NP6A 1M75A 3H87A 4MW4A 4J1QA 3KKKA 5LLDA 1Z28A 4TVKA 5IZ4A 4WDQA 2VF5X 2VDKB 1E20A 3HI6A 5K3EA 3Q0TA 1W0JD 4YCJA 3SCZA 3PC6A 1OTYA 3FSGD 5AP9A 1WLYA 3OA2A 3R3ZA 4RGVA 4ZVOA 2JA2A 1G6Q1 3JYHA 1RZVA 2AUTA 2V0NA 2O8BB 2D0PB 5TNXA 1UMBB 3RSQA 3ZVNA 5C81A 3C6XA 4I4TA 5HP4A 1CZLA 4IZOA 2WFLB 1COWA 3GRYA 4UAGA 3NH6A 2XADA 4OBWA 4OM8A 3ZWBA 4E3ZA 3PF9A 5KX5F 1XZQA 4GPAA 1NSYA 4B83A 3F67A 3NTOA 1UK7A 4MCJA 4OYLA 1JKJB 3EZYA 3UZUA 521PA 4DZRA 1F7UA 4J1TA 5I9IA 1L5LA 5FWAA 5HIAA 2YV3A 3FUUA 4GM4A 2B9VA 1PWZA 4HGZA 1M6VB 5AJTA 4MQEB 1SVNA 2BRUC 2OFFA 1C1XA 4DRXB 3OP4A 1MB9A 4RPLA 1VHTA 2D8MA 4AJKA 1WW2A 4BB9A 1UOEA 3PHGA 5FF9A 2MR6A 1Q1QA 2Q4DA 3B5EA 1ZC3A 3F46A 1DQYA 5COQA 4CCWA 1GCAA 3W3AA 4IICA 4PG6A 5I51A 2EJVA 1OX5A 3HGQA 1ZWKA 3RS0A 4CTNA 4OHCA 5JS6A 2YWRA 1XU4A 2EL7A 3SYMA 1S8AA 4URWR 1HDGO 4J0JA 2HK7A 5A9RA 3TAXA 2VAPA 1FX0B 4R8KA 3VFDA 3BD6A 3OUUA 2VTBB 2HMYB 4BMOB 3THWB 5DGXA 3DE6X 5MF6A 4PYQA 4WZAB 1A96A 2YHAA 2RG7A 3PCRB 5H9WA 4F9TA 1BDHA 1PR5A 3FDFA 1E4YA 2ZRLA 5BRNA 4PC7A 1YKGA 3M6AA 1N5KA 4K9OA 4DNQA 5SY4A 3ZXXA 4D8UA 1BU8A 2JD2A 4PZ9A 3AFNA 4YRBA 2UXCB 4L74A 4UASA 1IUNA 1E2LA 1KDRA 3E8MA 2Z2ZA 5IRCD 1EFVB 2OT3B 3A0RB 4M1QA 2QGNA 4J90A 5ENZA 2WTMA 2B4RO 4X7MA 4LZAA 3KAPA 2O2XA 3PDIB 3P2MA 4IYRA 2DGDA 3PLRA 1UXKA 2HRDA 1HTBA 3N58A 4FYXA 4TKUB 3WWCA 2VVTA 4DMGA 1UF9A 2JCGA 4EJFA 2PH1A 3LVRE 4G4SO 5LA6B 3AYZB 1O5OA 1SY7A 2D3TA 2G40A 2VDUE 3A32A 4H6PA 4LF4B 2YYZA 1LQUA 4HX2A 4UE6A 5E1DA 4OOEA 5DCWA 4QHSA 3RVPA 3SZRA 4BRSA 1K06A 4YTEA 4DCGA 1XXLA 1Z39A 2Q1UA 4PRLA 5AKIA 3F6CA 3JZAA 4J0KA 4RENA 4FCCA 5HJEA 2PLNA 3ZJVA 1CK4A 4J6FA 3EOAI 2ADOA 4NNJA 3RDPA 3RUDA 3KD3A 4EYGA 3HA5A 2Z6AA 1Q7BA 1ULAA 1K89A 3I01A 4R3WA 2QEQA 3DTYA 2EZ4A 4U8HA 3RS4A 5IH7A 2SCUB 3LDFA 1R4AA 2NAPA 1JHUA 5EHXA 1LK7A 5DM2A 1K3FA 3NT5A 1GADO 5B7GA 2D06A 1JEJA 4D3SA 4S1WA 4YCSA 1PFWA 1C80A 2XMBA 3J81k 3KSUA 4H35A 1CWUA 4QU5A 4YAJA 5D8DA 4V2UA 5B4TA 2JLXA 2E6UX 2PKQP 4BYMA 1MZPA 1RBYA 1GKLA 5BR8B 2MSNA 2OV2A 4QFDA 3V3KA 3UAXA 3BKXA 3T7SA 1MJNA 1B6GA 5D51S 5KU7A 2D7JA 5TEWA 1QGAA 3DNMA 3O8BA 3PV0A 2I66A 4ER0A 4XGIA 3WGJA 1A2QA 5KJ6A 1M2EA 4R6XA 1NU6A 5GONB 1K5PA 3ISVA 3D6JA 3EIQA 1IWPB 2UUPA 3KC2A 4GXRA 4KYTA 3STWA 3D4PA 3R7WB 2GZ3A 1K75A 3KOXA 3N3BC 4D57A 3T95A 4REQB 4H17A 1T3GA 3M3PA 2ZJ3A 1XD2A 4QQKA 4G07A 4MW6A 2A58A 3TG8A 4LFCB 2EBUA 1BMFA 3R76A 1AF4A 1ODKA 5F5NA 4NMHA 2H1WA 2IA5A 3UT5A 1Z2OX 3GIDA 4N3NA 1BN6A 1WETA 4Q3KA 4ZIRB 2EFJA 3AKEA 3KWFA 3Q7EA 3TTSA 3QE0A 3QEBZ 2WUGA 2GBCA 3SJAA 1JDUA 4JQCA 4DG8A 2GZSA 4LZOA 3IHTA 1JA0A 2FPRA 2JKYA 4JXXA 3BMNA 4ALKA 1XPOA 2XCSB 3QMMA 2CNKA 1NUQA 2QHXA 1RR6A 1VLZA 5LA6F 1QTIA 1BNCA 4G5OA 4ARSA 3K9WA 3N8KA 4KFSA 1TMYA 2B21A 2GK4A 4O4JF 4U63A 3U7QB 3LUDA 3GMIA 4ZVVA 4C03A 5MFZA 1KVRA 5ALEA 5YASA 3MSXA 5DM0A 3TGPA 4U2DA 3CJQA 2PN1A 1VJTA 1LCIA 3LOUA 3NPAA 4HLUA 4PNZA 2X5KO 3ZE6A 4B4UA 1GWNA 3HCEA 3H2ZA 4M49A 4IMPA 3Q72A 1U3WA 2XUGA 4K2HA 1N5DA 4E5KA 1VMIA 3E5HA 3WGHA 3KUCA 1TOAA 4L8FA 1EDOA 3P96A 1O2DA 3GJZA 1Y1KE 4YJ3B 1OX4A 4TSFD 5IJ9A 4DR6B 3FA2A 3C3BA 2HJRA 2A9RA 3QF4A 4YA6A 5L3SB 5FTWA 3D4OA 4QE3A 1S2MA 3JYOA 1X7WA 2PH7A 4FGWA 3M5WA 4DSAA 1HNXB 2PJUA 4KGXA 1AA6A 3DC7A 2V6BA 1X87A 1O96A 2JLSA 2H0QA 3G2JA 3FXAA 1Y7TA 1Q3TA 1TB4A 1SXHA 3PL1A 1SVOA 1WXEA 4KR6A 2CLDX 3LHSA 4EELA 3LUAA 1TEVA 1AMOA 4OMDA 4AKEA 1R5JA 1T9DA 1OX4B 4ZHQA 1IEWA 1CE8B 2XMDA 1BCRA 1YZYA 3LS2A 4X9XA 1TRHA 1Y89A 4RK5A 4IHJB 4GAEA 5AW0A 1TXGA 4KQMA 3OAAD 3PT5A 5EINA 3QFFA 4FGUA 4EUFA 2NUTA 2NP7A 1EHIA 1UPBA 5KWIA 2ZB3A 3K94A 4ECEA 3QA9A 2G5GX 4ZYXA 2BV3A 4Y2JA 2IPLA 4Y7CA 4WEOA 4WKPA 4BJHB 4BQOA 4MA5A 4ETNA 3PWSA 4HLCA 5KX5B 1XHLA 3IX7A 3K4HA 4O2LA 1JSXA 1M74A 4EY4A 3IBTA 2FPPA 1OAKA 1PWXA 2PZJA 3KXIA 3EGXA 1GZSA 1UEJA 3O73A 621PA 3AM4A 5KVSA 2BGJA 4TM8A 3OWXA 3KV3O 4C3ZA 1MVLA 4WAUA 4WCDA 1T10A 2Q4EA 5HUQA 1AKTA 4L8WB 4N12A 5JCPA 4ZFNA 1NVMB 5A0TA 1F14A 3GVXA 3IUMA 4MS3B 2FHSA 4KO4S 2C7RA 3RU3A 3KOZA 1E2MA 3EA5A 4FPXA 4UZEA 1AKVA 4RHYA 3OQJA 4E5UA 3GDWA 4LYJA 1HOXA 3O4HA 3RS7A 5JZBA 2BR3A 3R74A 1WMAA 2A57A 2GZRA 4TUYB 3IULA 4RPKA 3KDPA 3BDIA 2BF4A 2RHMA 2E4VA 3LKVA 1Z63A 4QOGA 3FI0A 4UVGA 4BHTA 1JR3A 1NP7A 4NATA 2GRJA 3KVOA 2ZIGA 3PYLA 1P2VA 4FJ2A 2WHPA 1TT5B 3LXRA 3SKYA 1QYDA 4UPVA 5LJLA 1XJQA 3CRQA 4RTSA 4LMRA 2QX6A 1PJRA 2H16A 4MUKA 3GBPA 5L53A 1O0BA 2WJVA 3G02A 3L5OA 2C2MA 3IOYA 1EXNA 2BUCA 2UVPB 4JCOA 3T3PB 3U39A 2VJYA 2X4GA 5KYWB 4DUGA 4V0KA 5KNBH 4AY6A 1XRQA 5LKRA 2CDCA 4BNXA 1PZGA 4TMKA 3SX2A 1GKIA 2ZPUA 1E4EA 2IXDA 5IVKA 1GXSA 2NVUB 3C3EA 2WHQA 4QYTA 2O8BA 2XA9A 4DCVA 2Y99A 3IUNA 2QY6A 5B7PA 4IIEA 3U3OA 4CW7A 3LBFA 3DXXA 4I8DA 4QOFA 4ZEVA 4JP1A 3CR7A 1FFGA 1W85B 1AHHA 2BHRA 2JGEA 2AFHB 3E1KA 4KDEA 5EVCA 5CVJA 2WDPA 1OYOA 5IKOA 3MT9A 5KIAA 4F6LA 2FK7A 5DK4A 1P0MA 5CA0F 2I7DA 3QPDA 1DINA 4UOEA 2FX2A 2VTVA 1CY8A 3H97A 4L08A 1SVIA 1FVXA 5DM4A 3QBJA 3ZZUA 4UCXA 2JAPA 2AX4A 1MOZA 4XB2A 3TSAA 3STVA 2HBYA 5T4BA 5EQDA 3TYXA 2H08A 4YALA 2FUCA 5ENDA 3UPDA 2BAGA 4L16A 1H2EA 3E15A 4GI2A 4Q24A 4YMUA 3O8OA 4O0LA 3O4FA 2JLUA 3RAEC 1WBDA 3QEOA 2AR9A 4JJ7A 2OXEA 1U5AA 4KKXB 4NK5A 4QBFA 4DIBA 5LQMA 3ZLJA 2Y6UA 1RYDA 2VXCA 4JQZA 5FNVA 5ECDA 5DYYA 4X6XA 2PUCA 2AXPA 1HFEL 1H8HD 1KEEA 3DCYA 4O4IF 4I5FA 4NMLA 1B41A 4WZAA 5AI4A 5CYGA 3LV8A 1HG1A 3AR6A 2VP3A 5FOVA 2QR2A 1KVTA 2V9PA 3GLIA 1BHSA 1K3TA 3W6ZA 2H9AA 1E8NA 2H4HA 4F8YA 3O0TA 1Z83A 4E2FA 4JBNA 3QBDA 2OXCA 4Q4DA 4XGNA 2PQMA 1Q3KA 2JK1A 1B74A 2EW2A 2FW7A 1G291 3F7TA 1WXGA 1QDLB 2XDQA 3EASA 5JFTA 2AC2A 1U7HA 3PP8A 2V65A 4TLAA 4TWJA 4WOCA 3TH5A 1J90A 2CT8A 3TQFA 1YDEA 2VT3A 2SCUA 2FLWA 1CDZA 1EGMB 4MAFA 1C8KA 4EPTA 2PYIA 3EGXB 1RKBA 2OCKA 2PGOA 2WRZA 1OX6A 3AY7A 3G5AA 5ALSA 3TRFA 1YFJA 4ZV7A 3SC6A 5CFPA 3M8KA 5EMKA 3DFIA 1RJ9B 2HU7A 1BDMA 2RB4A 4GI3A 4C04A 3J7AC 1WMBA 1EINA 4KE9A 3JR7A 3N9IA 1D2NA 2PS1A 3DZCA 3Q6IA 4YQYA 3LRXA 4ZQHA 4E15A 2CV2A 3D1VA 2B69A 3EXG1 2JGMA 1DCTA 4JLAA 3BTVA 4R7ZA 3NTRA 3MRVA 3UA3A 3RIXA 1ESNA 3EODA 4RD0A 4B5KA 4DY4A 5JRZA 1NULA 1JLHA 2AJBA 1CIJA 1SCQA 4BMXA 1KJQA 2CCKA 2FUEA 4IFEA 3C3MA 4Y1RB 1YC5A 3QFSA 3I04A 2GTPA 3SHQA 2OB2A 2GCPA 1FX1A 1GOTA 2CHFA 3BOSA 4M7RA 3OLQA 3PE3A 3UTDA 3RJ5A 1UPFA 1XDWA 3GZTB 2QA5A 1AKEA 2WK1A 4A6PA 4UAJA 4TXHA 1UXHA 1DC7A 4MWOA 3VH4A 4BO1A 3K30A 1KVSA 3I9V6 2FOLA 2O8VA 3L6OO 2OCIA 1IBRA 2HQOA 1ZPDA 2O4UX 4LRTB 3GNSA 1QGUB 2WFMA 3HEAA 4QULA 2B36A 4Y2GA 3K0CA 5E4YA 5C1OA 1T8YA 5H3LA 5K0BA 2XB2A 2F9FA 1MMFB 1PUIA 1VZ3A 1TFRA 1YTLA 1YH3A 2PVCA 2EFCB 4J2TA 3FWZA 1D2EA 3NXSA 4YR7A 2A3NA 1NW9B 3TZEA 3AWIA 2JRLA 2IU6A 2P2YA 1AD2A 4NJEA 1S4MA 1KSFX 1NT4A 3AOEA 1SUPA 4DF3A 2V6JA 3ZNNA 4RVFA 2ODWA 1JMKC 1NP3A 4EYQA 2ORWA 5B55A 5LIPA 4WOPA 4EYEA 1HR0B 2IIBA 1RWNA 4TTVA 2I3DA 3CZ4A 3JYQA 4LDZA 1ZH4A 3L02A 2PMDA 3F9CA 4RH1A 2ZGVA 5A4MS 1NDQA 1L7QA 4BASA 2R1VA 4P0TA 4D0RA 4XARA 5J2UA 4CU2A 2F43A 1VJGA 3T3EA 1K9VF 1JPUA 2X4IA 5CVCA 3OUTA 5JVDF 2R6CA 3AHFA 3UMJA 1GCGA 1FTWA 2X42A 4BO4A 4YJ2B 5C34B 4HQNA 2WIFA 3ZX4A 3PRHA 1RXSA 1BHO1 4RUKA 1I9GA 2FSUA 3PGVA 2FLVA 1LWNA 1PUJA 3IJPA 2ZU6A 3RANA 3FNGA 1GUFA 3CEPB 2P3LA 1DJPA 4A0QA 3S8MA 3ZZNA 4KR0A 1U1DA 3WLNA 4XQCA 1PGJA 1FSGA 3C8ZA 4PGAA 2RK3A 1SEVA 1G5FA 4MS1A 2CFRA 3L1KA 3TPCA 3PC4A 2CHGA 4B8WA 1U3CA 4MUAA 3RWMB 1EM8A 4CM8A 5A62A 2V4ZA 2QJRA 2W83A 5L4LA 1MT3A 1JDBC 3CNLA 2JCSA 3IMKA 1U7XA 2HO4A 4K40A 3BL8A 1NV9A 2OPHA 4GRAA 1K4YA 2P5UA 5IUNC 1TFUA 3JQFC 1B26A 2Q6VA 4KMSA 4UDXX 4CMBA 5EZYA 2WU8A 1E1YA 3OWHA 1KDPA 3G2HA 2X0JA 4AK9A 2F62A 4ZYVA 1N7GA 3NAZA 1M1YA 4PC1A 4C22A 4I1PA 1YZGA 2BM1A 2DVMA 2VDWA 3GFSA 5CDTA 2FPGB 4GXNA 3H5VA 4QTUB 2RARA 4LCJA 1J20A 5F2NA 2QTCA 3Q8XB 3FPKA 4MI6A 1M2GA 2C04A 2KYRA 2R2AA 5DIFA 1C7QA 3EXEA 1J0BA 1VYUA 4UBIA 3HMQA 4JMLA 1RQPA 2A9JA 3GP3A 4YECA 4S35A 2Q7DA 4RK6A 2R62A 3W2EA 3F6YA 2RH4A 2C9YA 4HN2A 4OLAA 2XUQA 2WAXA 4RHUA 4KXWA 3R23A 5FPQA 1F0NA 5EI5A 3TS1A 1M8FA 4KITB 4DV4B 4W9MC 2R87A 6REQA 1KAHA 3I6MA 4GW3A 4AJNA 2J32A 4KQFA 4YAUA 1DXHA 3ANYB 1W4AA 3AHIA 2ZJ7A 2MT9A 3NHLA 4FJ1A 2PZFA 1EDZA 1Q21A 2C99A 1CQZA 2GA8A 2WMOB 3HZHA 4KNVA 2X5NA 2ILVA 1Z18A 5DSXA 5JXIA 2AZXA 3G82C 3V8PA 1H4QA 1FFDA 1JQ5A 2FSSA 1I6KA 3E1SA 4WSOA 4DSZA 2O9JA 4G2TA 5A4AA 1WOYA 4NBRA 2IGBA 3OTHA 4MGYR 4Q00A 2PX8A 2YICA 3LL4A 1Q44A 3K1AB 4DY6A 1OA0A 3RQIA 4CL2A 4R1QA 1KI9A 1KEKA 1QWSA 4V38A 1J5XA 5BWNA 4TL7A 1YHNA 3EGIA 4DB2A 3CRW1 4EG3A 1WV0A 4LQLA 4WCFC 1PJ4A 2O6LA 2GKOA 3RIGA 2OMKA 2RHOA 4RF5A 3OLZA 1GAEO 3DXZA 1QBGA 4MVJF 2P2LA 1P19A 1U2QA 4QUGA 1R0KA 2CDRA 3D7MA 3DFKA 3FLMA 4YJKA 2D5LA 5TB5A 1YI0A 3BFVA 4Z9FA 5CFRA 4HVTA 3PGLA 1L7BA 2ZM6B 2ZTUA 3E03A 1U2ZA 2WM8A 5A0FA 4PFSA 1JFFB 3L43A 5DRYA 1WNTA 1KYQA 2D5IA 4G8BA 5AMXA 3UPUA 1RBZA 4BV9A 4WBNF 1XRSB 1X7ZB 1U28A 1OXUA 1S0UA 2NTEA 3TLCA 1U9YA 2IYFA 3UJAA 1G4UR 1KR5A 3G2OA 1IXRC 1KERA 2QTTA 4JXJA 3O8CA 4MW1A 1HUQA 3L1VA 5LMZA 1KWKA 3PFKA 2IT1A 4HAWA 5KTMA 3TPFA 3JAWB 5DI3A 2AG1A 1P75A 1KMCA 2VUHB 2C57A 2WJ6A 3QWAA 3GUCA 3AUAA 4FDLA 4NF2A 4NNPA 3ZK8A 5B6PA 1RMQA 1A71A 4TQUS 1FDTA 5EPOA 4OJKA 3X1ZA 3U3XA 2O5VA 4RZIA 2G4VA 2QTGA 4P2BA 3O94A 1EBFA 1SA0B 2CCGA 5H68A 1W7AA 3H18A 1CFJA 1YS6A 3T1VA 4XVRA 3N7AA 1FBTA 1Q6YA 1VKRA 2VBCA 2M6SA 1HDYA 2VBGA 4ZOCA 3HXKA 5TMBA 5TGZA 2Y05A 3O9ZA 1F48A 5K2OA 1OWLA 5KYXB 3S0JA 3G0BA 5CCXA 1N25A 4PQEA 2CLKB 2PIDA 3K16A 1OXMA 1M66A 3P4XA 3Q40A 3K6SB 5AK4A 3EEQA 1Y3HA 1ZZGA 4F7WA 4OHOA 4IILA 5E6SB 2W2VA 4J3FA 2AEMA 2ENWA 3EWNA 4MRNA 4EJSC 1ZN7A 3AHCA 1W30A 2ZIAA 3UY4A 4LCEA 3R8FA 2Q41A 3EXFA 1GNTA 4QLAA 3AUUA 3DWFA 5KSWB 4YRGA 4TYYA 4E5DA 5K6AC 2PUAA 2QKYA 4ETIA 4B3DA 3W9YA 1EQUA 3ZLTA 3V4RA 5ITZB 5I9MA 4H4CA 5KO2A 1GDTA 4DQ0A 1OCEA 1BVRA 3GDFA 3O2QB 4GC9A 1T2DA 4N5IX 1WSWA 5T4FA 3FYHA 3NFYA 3HWSA 1YHYA 3M7IA 3F5DA 2VDPB 3JWIA 1OC2A 3FNEA 4KWEA 4EARA 5CITA 3S44A 3GAMA 4Z8YA 1XCJA 2ATIA 4FFBA 3OE4A 4LE2A 4KQ1A 3FZNA 2PL9A 3BIOA 2CLSA 2LTAA 3W77A 2VRNA 1S89A 3L6UA 4Q3DA 2XYPA 1BRMA 1YB6A 5IJWA 1XMXA 4Q1CA 3RBVA 2XCIA 3FG9A 1YVRA 4MEBA 3EBLA 3RUPA 3MGBA 4P7BA 3IAEA 4LVOA 2VQ3A 1E1MA 2QUAA 2QE7A 3J7TA 1ZESA 3BHMA 2NYUA 1XHFA 3KELA 5ALDA 5K3DA 3RS3A 4AWXA 4BX0A 4DV2B 4JSTA 5FHRA 3HYCA 5F7XA 5CDYA 3V33A 4K87A 2JBHA 1F06A 2FP4B 3EB9A 3VMFA 3U2QA 4Y6LA 4ER7A 1KZ1A 3PXCX 2WA2A 4B6RA 1R4MB 4YMGA 1BWRA 4OK6A 2VLBA 4IGAA 1QCZA 1UUFA 3FUXA 2JFZA 2NW6A 4D9HA 1SQ5A 4BQIA 5DXAA 5F21A 4KB5A 3ZDBA 3N8IA 2O3UA 3KUKA 2VUUA 1CRLA 1U8FO 4GBED 3JXEA 3E8XA 1G4AE 3VUFA 4CDRA 1E0JA 1FVHA 2FPLA 3D3WA 3AY0A 4TT3D 2BM0A 4Y1RA 4H3HB 2JAUA 3I30X 3HCBA 3AW8A 3H11B 1SUDA 2YWCA 3LPCA 1COWD 2I99A 4XZ3A 3H6GA 4QJ4A 3B9PA 2CSXA 1D6SA 1K7EB 1R4ZA 4O2AA 2I6XA 1EWVA 4JVNA 2D62A 4YUYA 3DZFA 1UMDA 2ZZKA 4X91A 3TSCA 2JJ2D 3RD5A 4F7DA 1P29A 2AFIB 4OJTA 3MJFA 3K0KA 2JLYA 1H0HA 2HH9A 4XPIB 3D4IA 5FBVB 1PFGA 1W4RA 3NIGB 3JVUA 4UQOA 1Z8HA 3BXEA 2B1JA 1C3VA 3CG0A 2GPBA 3D1LA 3IT0A 2NSHA 2AOUA 5AXAA 1LI5A 4BO2A 1D2AA 4K05A 5GV7A 1SXJD 1DFIA 1NRXA 2MCFA 1K0UA 2XQJA 1QQ7A 3CUTA 3IE2A 4LTMA 3UO8B 3RUEA 1XVTA 1JG1A 2E87A 5FTKA 3Q9UA 3D6TB 4BU0A 4O1MA 3RF7A 5JNWA 2IP1A 5LM3A 1N6HA 2VTKA 4EJMA 1QGZA 4HXGA 4IFTA 3U7HB 4Z0HO 1G38A 2ZKLA 1R5OA 2F43B 3ESCA 3U3ZA 4KBFA 5T41A 2WD7B 2YXBA 3DNFA 1GPWB 2ODTX 4JCCA 2F4VB 1SIOA 5IJXA 1NLUA 2GETA 2GI4A 2GXSA 2YY7A 2ZT7A 2X0FA 1KQNA 4AMBA 4ZU1X 3G3EA 1RSZA 2XZTA 2OGUA 1MG5A 1C8VB 1UBEA 3GAZA 3GPBA 1WX1A 3HV0A 2H8KA 3HDQA 4E33A 3OJWA 5FEMA 3RYFB 1M3SA 3A2LA 4HNAA 3UOAB 1HNZB 1ULSA 3IIKA 4C4OA 1K9SA 4HTAA 4EFNA 3JQBC 4P7KA 2KW5A 5F4BA 4E08A 2JGDB 1GTRA 1G8GA 3A9SA 4HMQA 2J3JA 1QF9A 3JQ7B 4R4JA 2YXNA 2AOUB 1FU4A 2FW6A 2JW5A 1AUVA 2UZAA 3HR7A 3OEHD 2VSNA 3MIZA 4LXTA 1CZHA 5ITVA 2V7TA 4BVKA 3K09A 3E5MA 4HFJA 5EHGA 1P2TA 1NW6A 2O3QA 1UFVA 1D6MA 3IXQA 1S02A 3P4YA 4O4LA 4KYVA 5CA0B 2UUOA 3KETA 1Z56C 5EUBA 4D3ZA 3WB2A 4I2VA 2UZIR 2I1WA 4OQQA 1G8MA 1QVRA 3VU3A 3K92A 1KA9H 4E4YA 1QO0A 5TDHA 4DA0A 5DZSA 1XCOA 1DADA 3DKRA 2RAVA 4TTJA 4FFMA 2X41A 1CR1A 1RRVA 4QRDA 4MHSA 4KREA 1EESA 4Q93A 1P5JA 1OBHA 5I48A 1VMEA 1Z6XA 3QX8A 2DULA 2WHYA 3OLYA 1Z7GA 1EFKA 2VA9A 2QIOA 3PSAA 4JLSA 4RZ2A 4XR9A 3THSA 3UWMA 5JR3A 1YQ9A 2C8LA 2YQZA 3PJEA 4M0MA 4EDFA 4MP8A 2R7NA 2OFXA 2Z2KA 4PPNA 3PE4A 4JKYA 4RSRA 4YLGA 1OY1A 4IKOA 5G0SA 2ACVA 3DHYA 1VE7A 1RE0A 1MORA 2J8ZA 5J4YA 3FR7A 4V02A 2XBUA 2YHIA 4EL5A 2V3VA 3LUPA 3T3DA 4Y2XA 1BTOA 4A2WA 3QUCA 3NT4A 2REXB 1P44A 1T8PA 3HWRA 5DEOA 4HQOA 4PBRA 3L7JA 4WE3A 2YZGA 1Z08A 5EAIA 4D26A 2JHFA 3UWPA 1FFCA 2GWRA 4ND7A 4E13A 3U48A 4M98A 4H7FA 2QS9A 5EKSA 1GRQA 3KLPX 4B81A 1NKSA 3ZWQA 2PZLA 2VJKA 2APJA 3SP1A 4K9KA 3LL7A 4IDDA 4RD1A 3ZIAA 4P36A 1HKUA 4IJQA 3DO6A 1APBA 4PHTA 5HE9A 2F8MA 4IIDA 4C7OB 4D82A 1L5NA 5CBPA 4XYLA 2GCGA 3TE6A 1PNVA 1DQRA 5CDUA 4ER3A 4NPAA 1P45A 3E05A 1NC1A 4KQHA 2A9KA 3C1UA 5L7WA 3IKMB 3UHFA 4CF6A 5IBRA 3PC8A 2BM9A 3ACBA 3CV3A 3OIUA 4FHFA 2WEKA 3Q2IA 4N9QA 4TTRA 1T26A 3GVIA 5ALXA 3UW3A 4FN4A 1MIHA 1P7CA 1R4NB 2FX3A 2PSEA 3AONB 3FGPA 4ZMRA 3EHDA 2FUG6 2HM7A 2QR5A 3H2GA 3IAS6 5AKHA 3U3MA 1SG6A 2N1BA 3GVHA 1CR0A 3ED5A 3GJ5A 1OXVA 1RD4A 3BA6A 1JA9A 3WY9A 3QF7A 4ZVNA 2Y1KA 3PPIA 3THXA 3BRCA 5E0OA 3MJHA 1JEQA 4GVLA 3KQKA 4EQZA 3Q88A 4LHWA 2Q6LA 3ET5A 3KYDB 3L9XA 4QGGA 3UKJA 5AW7A 1NSFA 1F1BA 4GM0A 1KRHA 4YBRA 1BE6A 1PIWA 3L8DA 4US1R 5J5CA 5BMOA 1KO4A 3HR4A 4EAQA 2JI7A 2QTNA 4YH1A 5L3ZA 1MGOA 1UC5B 2ESRA 4N48A 4R69A 4NV1A 3H0EA 5ALTA 3SJZA 1JX6A 1UP4A 2HD4A 2HJWA 3C7AA 1ISIA 5AICA 1MO5A 1ZKMA 4N0EA 3ZE2B 1Y3CE 1ISRA 4O02B 4DC1A 2ZTLA 3AM1A 1N7JA 2EIXA 3VXKA 4BKMA 4OHBA 2A2ZA 1ITZA 3BH7A 1K8YB 1XEFA 1ZD9A 3H5NA 3LBIA 3RYTC 1YQTA 2GNPA 2YMLA 3DL4A 4NYMQ 4U1RA 3AVWA 1VMDA 3WL7A 1J39A 3BS4A 3S68A 1STOA 2WTXA 4AJHA 1QR2A 2QGZA 1N4AA 4EYOA 1HLFA 3HJRA 1EFRD 1YCDA 1NW4A 4IDPA 2C7BA 2CYAA 1T6NA 1EFPA 1E1RA 1FSFA 2EFEB 1XTJA 3EUEA 2W2PA 1WXQA 3Q12A 5FOTA 4RTPA 5JPCA 2HBRA 1A77A 3DTVD 2WYHA 3OJ0A 1Y6RA 3T3OA 2NQ2C 1K88A 3K5WA 1V1RB 2IH2A 2GN0A 2JGJA 1C4KA 3H9UA 2ONJA 2J1LA 4MSUA 4FFPA 4X0EA 2DRIA 1NU8A 3QEKA 2HR1A 1OLXA 3N5KA 2AKYA 2FEXA 1NPDA 2OZLB 3RB8A 1RWKA 3V8QA 4ZOLF 1N5LA 1RM4A 2XT0A 3DL7A 2KBFA 2CE7A 1UM9A 2YXEA 4QWWA 4JITA 4BKUA 2BEVA 4XM2A 3TR0A 1HDRA 2QLLA 5BSKA 4CM9D 3UGQA 2CEAA 5KHOC 2OV8A 1SBYA 4UBKA 3COSA 1ZVVA 3FHTA 1PVDA 3F7MA 5K1ZA 4BTVA 4H2DA 5ALQA 4H0FA 1RRMA 3G0GA 4FT4A 4G85A 1DG1G 2NZ8A 2VYFA 2GEFA 3O2SB 2FE1A 4D3YA 2DB3A 1TVKB 4Q7JB 2WTNA 1RTKA 1N5OX 5K2MA 2J5BA 3T9DA 3I92A 1K5DA 3IP5A 2FR1A 2GBFA 5TARA 3WK4A 3WMEA 1UOPA 3EK2A 4RJIA 1P4HA 2IP2A 3ELBA 3OZGA 4DMFA 5BYKA 3M9WA 3NCTA 4IGEA 3OIFA 3NALA 2C5HA 1H6CA 2ADFA 2FJUA 1ZMTA 4M0DA 4HLDA 3B6JA 3FIUA 1SC9A 3HB9A 3NWJA 4IJUA 5I8WA 2D3WA 1TAQA 2YVKA 3AQ4A 4DBZA 2BFFB 2BBWA 3DAPA 2RBEA 2IDMA 3FH0A 3H1GA 1HOTA 3JQGA 3IMFA 1IY2A 3BUSA 1J25A 1QZZA 3H65A 3PFWO 4PBSA 4QTYA 1CULC 5ILQA 1HQYE 1NXVA 4WX2B 4KG7A 3RYCA 2QN7A 1H2AS 3GLUA 3QY0A 3UXEA 1TCCA 3WK8A 3I5YA 1X1DA 3NWOA 1T5SA 4HGPA 1XWFA 1MBZA 2FSIA 4LOHA 2M32A 2GZ2A 2QOEA 2GBGA 5DHTA 4DYHA 3EEOA 1O0CA 1YUNA 1T0PA 1U7TA 2H2IA 2J6HA 5ETJA 1L7NA 1A04A 2CKDA 4ZT7A 1DI0A 2Q62A 1OU4A 1M7BA 4PY2A 1ZMXA 1A5AB 4DIUA 1T0JB 5J4KA 3KU4A 1E2BA 5I4IA 3CR3C 3SVTA 1JYSA 4OU5A 1ZLXA 3GDHA 2ORVA 1RS0A 1X1AA 1WHSA 2XKAA 3D8TA 4KE6A 3QI7A 2NYRA 1CJUC 1GGVA 1LPAB 1QJCA 2D13A 2IK8A 3G68A 1CUEA 3FDZA 4N6OA 4TTSA 3SD7A 4B7CA 1FC0A 1IJEA 1Y63A 3HU2A 3CPEA 2W00A 2F6RA 2JAOA 2J9XB 5LYJA 4CV3A 2FRDC 3NJ4A 2H0RA 1A8HA 1QFZA 3HDHA 4MQ4A 4RD6A 4P1ZA 5EEGA 1BHJA 1PT9A 4L0CA 2JJQA 5DPMA 4KZPA 4CL3A 4FQ5A 3N2KA 3J80A 3Q7QA 3S4YA 3WKDA 1UWLA 4YWJA 1E9CA 1H6DA 1MC4A 1MJGA 2XB8A 1G5HA 3WE7A 4CVNA 5ALVA 4UNIA 3OCYA 4KLAA 5EIOA 2BKUA 3UMSA 4D9GA 3RC1A 2Q6TA 2EGHA 3AEQA 3JAWA 2COEA 5KREA 2EF1A 3F6EX 4FK8A 3DZKA 5BNIA 1KK2A 2BMAA 2NIPA 4LW8A 3RVBA 8GPBA 4CKCB 1B73A 2PZKA 3OT1B 1JDJA 2PRKA 3CSSA 3D3JA 4OHPA 1T9KA 1V16B 1VKJA 2HXSA 2VSXA 2FQWA 1IHDA 3F5MA 4B43A 1O54A 5A7HA 3E3NA 3GGGA 5CXXA 4CHGA 2IZ6A 1JWLA 1BOOA 2H8GA 1DIAA 2C9ZA 3HDTA 3PA6A 3TBFA 3U4QB 4ZTUB 1PGPA 3ZE9A 1E63A 1N6PA 4YMIA 3HVKA 2OD9A 4URHA 1OC4A 4JROA 4K6FA 4P3YA 3A9RA 5B57C 3ZW7A 2GN9A 5CVEA 1ZVJA 3T12A 4DVGA 3GH3A 5D5HA 2AJDA 1UWCA 3OPYI 3OFJA 1IHOA 1NLFA 2HHCA 3AUJB 4FC7A 2AQ8A 4R51A 5JW6A 5KX5A 2VDJA 2QL9A 3RFVA 3I9V1 5K0GA 1NVXQ 3QYFA 1FMLA 4KQ9A 4HQFA 4MVJP 5DNVA 5AJWA 4HNTA 3OESA 3IKTA 3PEEA 3ORQA 1JP7A 1L1EA 2D0IA 4TWZA 5BSGA 3BE8A 3L7DA 2YW2A 1QAMA 2HK6A 3DTNA 1SQ0A 3QWIA 5IFKA 5AI5A 3ILXA 2ZI5A 1V5WA 2VWHA 2I6GA 4PIMA 1KDVA 5B7NA 1NN5A 5C9ZA 1SQGA 5G41A 2WUWE 1OJLA 3G9QA 2IYUA 1UJ2A 1QMPA 3FUVA 3G1TA 1SH7A 2XRYA 4JBGA 4BFVA 3STTA 2DHDA 4I6GA 4ALNA 4AO7A 4CDGA 3WBBA 4V3BA 1SIUA 3P9YA 4UD6A 1AS2A 3WZ2A 2KSQA 1NE7A 3A6JA 4G86A 1LVGA 3WO0A 3TTUA 2CBXA 2GF9A 4QDXA 6CHYA 5JNVA 5L40A 3A28A 2HL6A 1PNOA 2F1OA 3E7PA 4KX3A 3T5TA 1E2HA 3IOEA 5EA2A 3VPAA 2HMWA 3KFLA 1P91A 3CF2A 2QNBA 3AF0A 4F11A 5HQ3A 1VTKA 1ZITA 4PZPA 1FFAA 2JJ1A 2IZ1A 2YFQA 3MTAA 1PLKA 2ASEA 5AKZA 3V32A 2C5EA 3WIUA 4ARAA 9MHTA 1RIFA 1LDBA 4WXEA 1XPRA 3ZY3A 5BQXA 2BGWA 1GT6A 1C0KA 4UNRA 4O2BF 3PUIA 2GVZC 1V9CA 5CT9A 1T9AA 2PSHA 3CG4A 3LKDA 4AB1A 4MWGA 5JXJA 1BEUB 1NR7A 1GFSA 4FP9A 2CFTA 4LHVA 2GZ1A 5MDHA 1HDCA 2A0XA 2XUIA 3M9XA 3CKMA 1A9TA 3TZBA 3KLNA 4UNQA 2ZFUA 4R1NA 4M8SA 2IXAA 4EI8A 1PJTA 3C8HA 3PGKA 3EZ6A 1ZCZA 2BBOA 3PGMA 5CEJA 2WQ7A 4H3VA 1CF4A 2I6TA 4XM0A 2ZYAA 2FTKE 2FMHA 3EUFA 1XJ5A 5E8RA 3KXKA 3RBAA 2FWMX 1K8RA 1RM3A 2QRHA 3MLBA 2BJVA 4H7DA 2C4MA 2QB5A 4ZCTA 3SC3A 2A3RA 3QVUA 4NOJA 3P94A 3KKLA 2JIQA 4RKQA 3N76A 4WCFB 1UBTS 1VRCA 4BZPA 4E5MA 4NBNA 3Q3IA 3LCJA 3HP7A 2EEZA 2VSQA 1C4WA 4MVJG 5DWQA 3U16A 4I2NA 1M33A 3QW4B 4L0DA 5F35A 1MJGM 2G0NA 3PXAA 1NJGA 3CB2A 4R0VA 3O31A 3V1YA 1QRRA 2LIPA 4BC1A 3ADCA 4EUKA 1VHWA 1RHQA 1VDMA 2GN6A 2V7UA 3U4DA 3CBQA 4HXYA 3A58B 1ECFA 1NXPA 3DFMA 4IHJA 5JANA 4GKKB 3KHTA 1E3WA 2VN8A 2ZG6A 3HFSA 4X7PA 3QTTA 1POWA 1XNHA 1M83A 5JZSA 3BDVA 3IPLA 2P69A 1ECGA 1HGXA 4HO1X 1WCIA 1WTAA 2CNOA 2VPWA 4LN1A 4RPCA 4DMCA 1UZMA 4UNPA 4QYIA 2VDRB 3JWGA 3GLRA 1L7PA 3BCSA 3PD0A 3BRQA 1VKNA 3I53A 2Z0MA 2GK6A 2UDPA 2WWXA 4YGXB 3DAHA 1LRLA 2W4MA 1NI3A 5CT8A 2BT4A 2IWRA 1FJXA 3RARA 3FRJA 4URXR 2YZ2A 4J0EA 1GZ6A 1K66A 1P6QA 5BR1A 4W9RA 3IV9A 4NJOA 4DFDA 4MPJA 3MZ0A 5JYEA 4KW7A 1KOLA 3TL3A 4DT1B 3KTAB 1PGQA 3DXFA 1GPJA 5IWAB 4KWIA 1RAGA 4K88A 1QK3A 2P1ZA 4WUVA 4CV2A 2C9BA 1NBIA 2C1EA 1GQRA 3DCNA 4B17A 3RSFA 3DEFA 2W98A 3EWAA 3W2TA 1FNDA 1WSBA 3DHWC 2KQUA 4BNYA 5MN4A 3OURA 4I1VA 4AJJA 2WQ6A 1UBLS 4M55A 3W5AA 2QXTA 5BORA 4NBSA 3TBHA 4FDAA 5CEFA 2AQHA 3KBOA 1R0BA 4MP3A 2PGLA 1HYQA 1NOKA 5ALOA 3HO1A 3AEZA 2C1ZA 1JKIA 2Q5FA 3LJKA 5ICEA 2AXNA 3KL4A 1WXFA 3GGSA 3ORFA 5TVGA 1OH6A 2G67A 1N6KA 1RAIA 1GGHA 3GFGA 3KPJA 5AJUA 3FI9A 1BEZA 3L05A 4NV3A 5H3HA 2BP7B 3WSWA 5JJBA 1VJ1A 1NJ2A 4MPDA 3I39X 3LT0A 3VJKA 3FJ1A 5DGHA 1ZA2A 4E5SA 5J1TB 5A5FA 4OI1A 4D3DA 3QH4A 5JQWA 3RTDA 3RSLA 2GO1A 4OJNA 1T36A 1KAEA 4TS3A 2I3AA 5CLQA 5IASA 2GZHA 5JT1A 2BCEA 2PWYA 4PCAA 4PRZA 4F3KA 1ZVQA 1Z8DA 3EMDA 3TL6A 4CFYA 2JVIA 2OGTA 3CEHA 2PR7A 4YPOA 3K8ZA 1TCAA 5H7XA 5BY2A 1PJLA 1V4BA 3GNQA 1DTEA 4I7EA 5GONA 4XVQA 4G8DA 5AM3A 1E66A 2ZI9A 4C6HA 4KK3A 3SE7A 2NSDA 3EVAA 3HJGA 2L82A 5DE3A 3UAVA 1SHUX 3ROXA 4AZWA 1QYRA 2LUOA 5DI9A 2VJNA 2YZNA 4IQ0A 2Q3CA 2H1CA 1V9LA 3I1IA 4E6PA 2R00A 3IDAA 3CQ9A 1E3QA 3BVPA 2ZVPX 4OGKA 3R7SA 3SJUA 2YR0A 3K9LA 1QKJA 1RQNA 4IF6A 2F1IA 3HV2A 4GPEA 3SJBA 4E12A 2XMQA 2LCIA 3C48A 5AW9A 5E6RA 2ZIXB 2GCIA 3P9ZA 1IRIA 1QO7A 2X1MA 1GV0A 3WZMA 4G4IA 3TD6A 4E22A 1V7ZA 1UEIA 3R7AA 4P8RA 2Q21A 1YRYE 4LOLA 4C7MA 4HNUA 4Y1EA 2B1QA 2GBPA 2CK3A 3AVQA 2XMGA 3KZ1E 1ENOA 2Q49A 4WASA 3VO2A 3ZBUA 2RONA 2O1XA 3BWDD 5AVJA 3WTBA 4DAEA 5IAAA 4JYBA 5SY9A 3QNMA 3ZJ5A 1QKIA 2JD0A 3WGZA 3ZXYA 1MDBA 3WFIA 3WXMA 1G98A 3WHPA 3ZCXA 3IDZA 1T0BA 4BY9E 3F3YA 2UXBB 1VLMA 3EMBA 1ZJ5A 4YT5A 3BBPA 2KJQA 2P7HA 5K51A 1OU0A 5DLPA 1JQDA 5B5SA 2BZSA 5IANA 4DEVA 4FHZA 1A4RA 2W90A 4A6EA 1XKTA 1J1ZA 1F2UB 3TSWA 4FE4A 4NENB 1JLLA 2N3ZA 1IU9A 3UJBA 3OBIA 3ZX5A 4JODA 2JVJA 3I12A 4XWAA 2FV8A 2QVXX 1YE5A 3QFHA 3I6QA 1L5ZA 2I65A 3DA8A 1TYBE 3DGEC 3RVRA 3ETGA 4AP6A 4TZ0A 1U98A 4J1TC 3EQ2A 5G1OA 4DXAA 2J3QA 4PYMA 4IHQA 5AH0A 1BJTA 1E9RA 3H5AA 5CIWA 4YV1A 2ZM5A 3RS2A 2DH6A 1W0KA 3BB4A 4UBJA 4XOUA 4Z1MA 5CX4A 4PG8A 3DLPX 3MNFA 3MM4A 2DUUA 1IHPA 3THWA 4PW0A 5FR2A 1N75A 4YONB 2GD0A 3B89A 1MCZA 4DMRA 3ZH9B 1T1EA 3R0IA