1VIMA

Crystal structure of an hypothetical protein
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
192
structure length
192
Chain Sequence
HGGHMSLLRFLEVVSEHIKNLRNHIDLETVGEMIKLIDSARSIFVIGAGRSGYIAKAFAMRLMHLGYTVYVVGETVTPRITDQDVLVGISGSGETTSVVNISKKAKDIGSKLVAVTGKRDSSLAKMADVVMVVKGKMKQERDEILSQLAPLGTMFELTAMIFLDALVAEIMMQKHLTEKDLEARHAVLEEGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein AF1796
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
total genus 67
structure length 192
sequence length 192
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01380 SIS SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1vimA00
3I0ZA 1X9IA 4B3TB 4LF8B 4OX9B 3BCHA 4DR3B 2VQEB 2XBLA 3C3JA 2UUCB 2ZJ3A 2UUBB 2POCA 3BJZA 4GKJB 4JV5B 2J6HA 3FKJA 1XTBA 1U0EA 3NBUA 4X64B 4LF5B 2A3NA 3FXAA 4JI5B 2E5FA 2UXCB 1HNWB 4DV7B 2PGIA 3J81A 2ZM6B 4DUYB 1JLHA 4JI3B 2AMLA 4DV6B 2E5LB 4S12A 1X9HA 5I01A 2VF5X 5BY2A 4LF9B 4DR6B 4DV0B 2O2DA 1TZCA 4DR5B 4DR2B 3T1HB 1IBLB 4DUZB 1VI6A 2PUWA 4X66B 1X94A 4K0KB 2PUVA 1N32B 3EUAA 3IFSA 4LZJA 1GZVA 1I94B 1XMOB 4JI7B 3M5PA 1JXAA 4AMVA 1GZDA 3CVJA 3FF1A 2CXNA 2V4MA 1G98A 3TRJA 1N36B 3J7AC 2Q8NA 4JI0B 4AQYB 2UUAB 1MORA 5IT9A 1MOSA 2HHHB 4NXMB 4B3SB 4JI6B 2CXUA 2ZJ4A 3OTOB 4JI8B 1KOJA 1ZZGA 2F4VB 4DV1B 1N33B 3FJ1A 2CXOA 3G68A 1T10A 1C7RA 2XHZA 1N8TA 2VQFB 4JI2B 3LJKA 2DECA 1HNZB 1B0ZA 2WU8A 1N34B 4LFAB 1TK9A 4X65B 4YHHB 3Q7IA 4DV3B 1DQRA 2UU9B 5LL6P 2UXBB 4DR7B 2YVAA 1HNXB 4DR1B 4JI1B 4IVNA 3HJBA 4LFBB 3TBFA 3ODPA 4TOIA 5LMNB 4LF7B 1NUHA 1IATA 3PR3A 2I2WA 4X62B 4LF4B 1TZBA 4JI4B 1C7QA 1XNQB 2CVPA 2CXPA 2CXTA 3HBAA 4JYAB 5FLXA 1XMQB 4DV4B 3SHOA 4B3MB 1FJGB 2CXQA 2PUTA 3Q88A 3JX9A 2VF4X 4LF6B 3UJHA 4EM6A 3T1YB 2DF8A 1U0GA 2CXSA 4KHPB 2CXRA 4YY3B 5BR8B 1NRIA 4DR4B 5A2QA 1VIVA 1WIWA 4LFCB 3ETNA 1IBMB 1U0FA 2X3YA 1IRIA 4M0DA 4B3RB 2O2CA 4S1WA 1J5EB 5LMUB 1HOXA 1VIMA 3JAMA 4DV2B 1VI5A 4U6NA 3KNZA 4DV5B 4NXNB 5IWAB 3J80A 2I22A 1X92A 1IBKB 3QKIA 1M3SA 1JEOA 1HM5A 4GKKB 2UXDB 1Q50A 1J5XA 1JIQA 1HR0B 3OOJA 1MOQA 2CB0A 1XNRB
chains in the Genus database with same CATH superfamily
1X9IA 3NJ8A 3OM9A 2B35A 3KQPA 3OLZA 3R5FA 1QIJA 1WF6A 2QG6A 2YJ4A 2ZVDA 1JDZA 1SUWA 2AR9A 3KQOA 4HLNA 4RZ2A 3NHUA 3R7AA 3HYCA 4AICA 5I6DA 2UUCB 4PPNA 3TL6A 4CE6A 2IH2A 1O9GA 4DEXA 1Z4LA 2RB4A 4BU0A 4E15A 2VZEA 3VX4A 1KAEA 1AKNA 1BCRA 2O6HA 4AJKA 1UMDB 5LP6A 1JJBA 3OA2A 1PR0A 4GW3A 1Z07A 1G20E 1JHOA 3GGGA 2QP4A 3CNNA 1K5PA 2NT3A 3KHKA 3OQ6A 2QRNA 3PS9A 4KPUA 2P6UA 2QTAA 4CIWA 2CEKA 3EA4A 4L7QA 5IKPA 2P9YA 1DJNA 1NDUA 2NSYA 1RXVA 4RXUA 5FNVB 2J9ZB 1CBUA 1D4ZA 3F4KA 3DV0A 5B58T 4C3ZA 1GL3A 2G8LA 1EGHA 3BJEA 1ZR4A 1HE8B 2AFHA 3RIXA 3U16A 3KU4A 2YFKA 5HYVA 3TBKA 3QPVA 3GRRA 4D4KA 4B6EA 1XRJA 2XX3A 3A4MA 4MIOA 1RQLA 2BFBA 4ND5A 3NGLA 4P92A 2Z5VA 3OPNA 2P9HA 1U7OA 3KO8A 4EMBA 1CNMA 2HQBA 2WUEA 1H8EA 2GNOA 3NTRA 4L7VA 1YU9A 5CVEA 3TL3A 3IH5A 1F0YA 2Y1OA 5JTUA 1QNFA 1IXYA 1IK4A 3OPYI 1MVLA 2HIMA 5KYUB 4UTPA 2G36A 1S2DA 5G0SA 1CC1S 4M0CA 3C5EA 3PTLA 4EW3A 4DJFC 3CNLA 3WMFA 1ZM9A 4MS1B 3QJ5A 2X8JB 5FR2A 3EPLA 1IATA 3DULA 2X40A 1XQ1A 2RDMA 1E2HA 1FMCA 1FS4A 4M1QA 3ZD8A 4R8LA 3V1MA 2XRZA 1WHSB 4JLDA 5AJVB 5IMBA 4YPOA 2IFTA 4OMDA 3THWB 4KXQA 4S0ZA 3VO1A 4LRQA 2QN9A 2WT8A 3C41J 3QF4A 4BO0A 4X3PA 4WK4B 2J7PA 4KQXA 4MA4A 4EHNA 2PNJA 1TCBA 4QUEA 3EIEA 2HSZA 4HNVA 3TFWA 1CETA 3FCCA 4N6OA 5MN5A 1VPEA 3KOXA 2XOKD 3I01M 5GAJA 1M2EA 1KFCB 2PE5A 1Q7GA 2X6TA 4RAQA 5FFMA 2J4CA 1RS0A 4XWAA 1Y9ZA 3VZQA 4ZMSA 1G8HA 1HURA 1T5OA 3ZTTA 2Z8YM 3SEAA 4K2AA 1FDVA 2GCPA 4GPIB 3VRHA 1T8TA 1PWZA 5FJJA 1G5FA 2WIDA 3DPUA 4N5DA 5CDFA 2NU9B 1E5DA 1PR2A 1S2MA 1E4OA 3T5GA 1PUJA 1DG3A 4ARZA 4JXZA 1HEUA 3TTSA 3MERA 4EGJA 1UPAA 2A1TR 1G4HA 3K9WA 4S35A 2IY7A 4X3OA 3GG2A 3V7NA 5HUHA 2BGWA 1KRHA 5JAHA 3FKSD 1Y1QA 3DL7A 3KVOA 3FNBA 5A1JA 1A4UA 4PNPA 3AXTA 1X2EA 3QA9A 3D6VA 2C99A 3CF4A 4NFLA 3EBPA 2ILTA 3S1AA 1QYWA 3GU3A 4U6QA 1XTKA 4HUQB 3AJEA 3QHAA 1RLMA 1ZGGA 4DT1A 1YBHA 1G63A 3ADCA 4RY2A 4BNWA 3OIFA 2H5EA 2XOKA 4EPXA 1KI1A 2BRUC 1WNTA 2ZAIA 2XGGA 1FK8A 721PA 2IEGA 3PGMA 3LC1O 2E4UA 2EOAA 2QRMA 4DG9A 5KCZA 2LGJA 3CTMA 2WUGA 1BROA 1J2YA 2JD1A 4PSVA 2N75A 1H9CA 1SB9A 2ZWPA 4GOOD 3DVAB 4P2BA 5DX8A 5E4FA 3WMXA 2XE6A 5KNCD 3TX2A 1RKVA 3DLAA 4QYSA 2ZBDA 3DBHA 4G2TA 2G5CA 4OJKA 1KEPA 1AXGA 1SG0A 3BFPA 1QJ4A 1R12A 5EJMA 4C87A 3EDQA 2E6UX 2X15A 1M6HA 1Q0ZA 1ZG3A 2PAAA 3IUJA 13PKA 1G98A 4H4DA 4I9GA 3MGGA 1QSGA 4Z0HO 4RW0A 1G4AE 1JPJA 1I6MA 2IHBA 2PA3A 2WF7A 3E9RA 4TMYA 4BYGA 5AI5A 2HV8A 5HQTA 3WKBA 2I7TA 4F5YA 4BWFB 2IIBA 2QR2A 1MIOA 3R6GA 4JUAA 1EBUA 1MGOA 3IOBA 3L0PA 4LDNA 5AK5A 2Z4TA 5JY1A 1C4XA 1BVYF 3KVNA 1Q5PA 4QOHA 1N8TA 1FCJA 2ID7A 3Q41A 2FEPA 4RKYA 1L5WA 3HVJA 1Z8NA 1YRYE 3RT7A 5HW0A 3VOAA 5K0LA 4QZVA 4M0FA 4LSWA 1PR3A 2UXBB 3R7SA 1G5HA 2Z43A 3JALB 2HC9A 2P9FA 2JB9A 2P79A 1ZIXA 2PZLA 1KYVA 2WWTA 4NNOA 5EWJB 5DP2A 4OQQA 3S8EA 5K3EA 3UMVA 2XMRA 3R2JA 4KGXA 4M6WA 2YWDA 1HDZA 2IYAA 3FOCA 3NBAA 4Q4AB 3FMIA 2HLPA 1U0LA 5IAAA 3RG8A 2D2VA 1M1XB 3JQAD 1KO4A 3K8QA 3MBIA 4EATA 5JZ9A 3LRXA 4Q7MB 1C8VB 4HG2A 4CTMA 1PV1A 3DGFC 4UM9D 3I72A 2UVQA 2Z9BA 4FS3A 2RHMA 4NPAA 3UK7A 4C21A 3BHMA 1KK2A 4LDRA 5HF9A 3WOVA 3N7AA 4M88A 3TGPA 3VYTB 2W37A 3WQBA 4CG1A 4Z4EA 1C80A 4TL7A 1D9XA 1JQEA 5D51S 4F56A 3U60B 1E9VA 1P0MA 4J4HA 4WNAB 1QYXA 2I7VA 2X3YA 4JR1A 4MS4A 4R8KA 1EVKA 1YB5A 4NR0A 3THYB 4WZBA 2E48A 1FMFA 3M34A 1GARA 2Y68A 4MO9A 3G5UA 3QVOA 2C2GA 1DLJA 4K1XA 4M9QA 5DZSA 3QLTA 1SG6A 2O07A 2V98A 1Q0UA 2G9QA 3LBAA 5BSGA 5J47A 3JATA 4A26A 1NG9A 1WUHS 4UBIA 2P9ZA 2H0RA 3GFQA 1ZNWA 2JD2A 4G0MA 5TF4A 3TUJC 3T7JA 3ZX5A 1QP7A 2CNBA 1UKCA 2XEDA 1ECFA 2ZKIA 3RK1A 3CRQA 3ZNQA 4ASUA 5JJ5A 3AF4A 2Z3ZA 1FFDA 3AEQB 4JKYA 1LI4A 4QOFA 1U7ZA 1ZFNA 2QK4A 2PR7A 3HH8A 4MWBA 5JQGA 2POCA 2V0NA 4UDYX 5FUVA 2ORYA 2NU7B 1JWAB 4GGPA 2YWHA 4B7XA 3Q5EA 1OFIA 2BEJA 4AJNA 3K0BA 3RQSA 4RGBA 4WA7A 1HZZA 3IVCA 2NGRA 4O4LA 3S7TA 3UV6A 1UBUS 4F1WA 3UTCA 2CHUA 3B5EA 4ZAXA 4Q7EA 5IM4A 1OZAA 3DDOA 2XZTA 2C5EA 2N0SA 1HFKA 3CXUA 3KKMA 2WKPA 4YAWA 4MO2A 3SSNA 4F6RB 2WUVA 3ND8A 4J9UE 3CZ5A 2ZVQX 4XQGA 3MINA 2VTBB 1E3MA 3BB4A 1RXUA 2CLCX 2I6SA 2JD0A 1QYIA 3LBFA 1AS0A 1NQVA 4Q1BA 1JHPA 2AC2A 5THQA 2RSLA 4MWCA 1N32B 2LIVA 3BUSA 5KYYB 2YHIA 3GGJA 4WJKB 5DW0A 5F2EA 1IM2A 1PFWA 2K2QB 3BRCA 3GA7A 4UUBA 5C8XA 4K9OA 2YQ4A 4A10A 3EPJA 1GRNA 1H2AS 5C5CA 3DCNA 3KKZA 4IDAA 1EQAA 2EW8A 1G9SA 1P1KA 4I4TF 3UICA 1MJHA 3L7CA 3HDGA 4OM8A 3BWDD 1GLNA 2Q21A 4IIFA 2RHGB 5AUNB 1Q7EA 1NMEA 4HFRA 4WN9B 5TQ2A 3VAYA 4GD3Q 3BD8A 1KAGA 5TRTA 3AF6A 1CUZA 4A23A 1GCIA 3AJ8A 2IVZA 4F93B 3CINA 3VNQA 5EZQA 5AFSA 3A0RB 2OCAA 2K4MA 3I30X 4WINA 4E09A 1DQRA 3D0QA 4ZVTA 5SICE 4WWHA 4N41A 2VBCA 1Z6GA 1LV7A 1EEXB 3KZCA 3NHJA 3O5AA 4PANA 4DLNA 1QQBA 2AKYA 3BIFA 1Z7BA 2AC4A 3GJSA 3PPWA 1M6NA 2JFHA 1S2GA 4XQ0A 4ZXPA 3ROGA 2C4VA 4LI0A 1YE3A 2I5PO 5ERYA 1ID1A 2Y6UA 5BN5B 1NAIA 1I5RA 4C04A 5ICGA 1TM2A 3OIUA 1GU7A 2Q1WA 2W2PA 5AUPB 1C5KA 3Q11A 1WZIA 1FX1A 3DMTC 2GM9A 4NDNE 4E46A 3A70A 4N3AA 3FFAA 2IDZA 1ADYA 3ZE2B 3CO0S 3EHDA 2XDWA 3IP7A 2ZRLA 1CUJA 4I1VA 4MTCA 3GEGA 4UNSA 4QT0A 4GZLA 3FIJA 4GSYA 4QUHA 1Y7IA 2IHYA 3L0SA 2VAPA 2WM3A 4RMGA 3USCS 4EVIA 1AB6A 1T9GR 2D06A 3F97A 4WERA 4RSRA 3IT3A 5KYVA 3RI3A 3T7KA 4AY6A 2AXQA 5JAMA 4BLWA 4FT4A 1GVNB 3C3YA 5LMCA 3BGSA 5TPWB 2PKXA 4K46A 4L4RA 3AUYA 4UDNA 3FNRA 2B9VA 2CMDA 2EP5A 1MGPA 2GAAA 3HJUA 3OZWA 1DI0A 1H1TA 4UUMA 4CLRA 1G66A 3HTXA 1U3FA 2QUIA 2ZUTA 1SUDA 1C3XA 4O1MA 4C7MA 4EZEA 4WKCA 3KALA 4D4JA 1THGA 2PQMA 5H80A 4ZVQA 1KZHA 4HUTA 5I7RA 4HRVA 5H59A 3ZGZA 3KJIA 4YXWA 3JTMA 3TZKA 1TCAA 3WWYA 3I1YA 2DE0X 2QBYA 4EY5A 4O0LA 4NDZA 5HRCA 3AVVA 1OW3B 1QC5B 2MSNA 2DFTA 3NALA 5I7AA 3NCHA 2QZ4A 4DIDA 5B6PA 5SZHB 2G3YA 2GZMA 3TQOA 2XIQA 2Z0MA 5CXSA 1E2JA 2GEDA 4RFLA 4ZO8A 1EXDA 2NYRA 3H7IA 3K9BA 4N18A 1DAIA 3RRJA 2IHNA 2FLVA 4Z9YA 1CR1A 3GXOA 3RKRA 4MSUA 2OWDA 3SR4A 4CLOA 1U2GC 2J87A 2JCSA 1F9EA 2R8PA 3PC8C 2J8ZA 1FUKA 4O8CA 5ALXA 3MUFA 4DUPA 1PT8A 2Y1EA 3EZ9A 1ISMA 4OHOA 3E18A 1V39A 1GDTA 2PSFA 1NQWA 2B82A 1E18A 2B7BA 5DHUA 5I45A 4BNVA 3DDHA 4COOA 1GT6A 1N2HA 4MV4A 3WGHA 4BJ1A 5SV2A 5HKKD 4FYWA 4FOPA 1ST2A 2JFBA 3BORA 4LXXA 4QT4A 2UDPA 2OBLA 2D1TA 4MIKA 3LNCA 3N9IA 4BV2A 2QSJA 2VHVA 3PJRA 5FPSA 1JHVA 1A5SB 2W7TA 3RSZA 5BPFA 4ZDWA 3TAHA 1AQ6A 1QP0A 4TWIA 1I36A 4CCYA 3H2BA 5LQSA 4LEIA 3QOWA 1N8KA 4R83A 3TR5A 2B8WA 2AMYA 3AF1A 1H1DA 1BCSA 1ZJWA 4WKNA 2QRHA 1XDWA 4R6XA 2A0WA 4NYIR 3H87A 4RF4A 1ZOOA 5GGYA 3OBBA 5J5VA 5HMLA 2XI4A 1P8JA 3CEPB 1JMYA 5DGDA 5E6SB 3O4IA 5HVNA 1HT1E 1N6HA 5JSYA 5ECDA 2WHXA 3W1VA 2FXIA 4JX8A 1YUBA 4OXKA 2XUKA 4IGEA 3ENVA 4XOUA 4IO0A 5BOSB 1C3OA 1XA0A 5BQXA 1QDUA 3H17A 4AY3A 4KJZA 4U8GA 4AQ7A 3E9MA 4Y0NA 4LFBB 4PIMA 5GQSA 2AWNA 2IYQA 4Q7LA 3CUYA 4TXLA 4PZ9A 3P32A 2BUBA 4L3VA 3LXRA 2F3QA 3RS2A 4N03A 3RRYA 4EJ6A 2HRRA 4KXVA 2YIVX 1CUAA 1BHJA 1LK5A 1PR6A 2R6CA 3MFQA 1AK1A 2NV6A 3N8KA 1DBSA 4GSLA 1OFUX 1II8B 2HUPA 2NTEA 4PYQA 5CPBA 1EX6A 4N7MA 4BNDA 1GM5A 4X7RA 3H8SA 4FE4A 4Q9AA 3K0AB 5I7WA 3ZZ1A 4DNQA 2ERYA 4KO8A 2ZE5A 2QLFA 4HXGA 1N3LA 1BXKA 3SR3A 1GPUA 2DPGA 2JIRA 1IQUA 1B4DA 3LS2A 1WE2A 3WGOA 2IGTA 5HM6A 2RGGA 4EA7A 5BNFA 4FT2A 1RVDA 3OH8A 2RH5A 1A2BA 4H0CA 4J91A 3KOYA 2P6PA 1U1CA 1ZICA 2IP1A 2QRLA 4CUJA 1RM3A 5CM9C 3CZCA 1U63A 2OBXA 3FFWA 1JU3A 4DDVA 2VPQA 3ZDRA 3M9WA 1N6KA 3I04A 2WU0A 3K70B 3WFJA 4NNPA 2LCQA 2PUBA 2GPYA 3I9LA 4JY7A 4OHWA 2MYNA 2E85A 3UHAA 1PVVA 1ECGA 4CKCB 4G4SO 4CLEA 1A82A 3MWKA 2JFUA 3ZU3A 1WZUA 4F9TA 5LNK1 5AIAA 5D2CA 3A2LA 3K6SA 3O74A 4WJLA 4JLAA 3FVVA 3DOCA 2HTFA 1JDUA 4FR0A 3SSMA 5BXQC 1PK9A 2WSSA 3ADPA 2IYFA 3DHEA 3PUJA 3PWZA 4OO3A 2QMOA 3A6EA 1RC0A 4OXQA 4QSHA 5FOSA 2FSSA 3L7IA 4GLLA 1HFEL 2EW1A 4B85A 1HFJA 3UPUA 1QRSA 2YZ2A 2BSAA 4QDTA 3AP2A 1OF1A 5J59A 2H4HA 3HJRA 4RH1A 3RS4A 1P1BA 3EVDA 4NC9A 1JB1A 4GR9A 3WGQA 1UPBA 3K0EA 1IOVA 1LVHA 4HRYA 5DTJA 2OO5C 5TQ0A 4NQRA 1RZ3A 3T7IA 4OHFA 1MW9X 1ULSA 2F67A 3CH4B 1OZ0A 2XTAA 5FWAA 4B6PA 4LTMA 4BO1A 4F21A 4IQGA 1NYRA 3LO5A 4D0SA 5K0JA 1WEKA 1ZMXA 4BO4A 1MOPA 3A1DA 4JZYA 1A2QA 4KVZA 2EKZA 2MSEB 3K73O 1OZHA 1JLLA 4ZCQA 2Q4EA 3NVDA 1H42A 4W9NC 1TFUA 3DW3X 3QLVC 1A7KA 1EK1A 1M8GA 2SBTA 3R77A 4ID9A 5AM0A 4YC7A 5BQ5A 3PC6A 3N2KB 1J0AA 1LA2A 1MO5A 4FFNA 5AJTA 3RROA 2EBWA 4FB4A 3HA5A 3RQIA 3TNLA 3V4OA 1NQUA 4P34A 5LQDA 1SU8A 4JSYA 2ZAOA 4HWKA 2AX3A 1JR4A 3O94A 3M82A 1MD9A 2NO7A 3DP9A 3PD0A 1TGVA 4M1KA 4AB1A 2I0FA 5HF6A 3FDZB 4ZWNA 2JGMA 3VSCA 4H3KB 1TMYA 1PS8A 4NE2A 2N1BA 4GVXA 5FWXA 2EZ8A 2MSWA 3QSGA 5FNVF 2OQVA 5EMKA 3ROMA 1D2EA 1ZH0A 3EH1A 3GLKA 1SA0B 2HPHA 3HZOA 3LOUA 3QYFA 2ORED 4MI9A 4RHXA 4WY8A 5CH8A 2WJ6A 1PRYA 3FOWA 4GP9A 4YDSA 2WZQA 3RBAA 1JTVA 4OI0A 4PPFA 5KNLA 1XNQB 1M8JA 2DLNA 3DKRA 4BATA 1UBRS 3EXEB 5F5XA 2YOGA 5C46F 4ZV4A 4C4SA 3FYUA 2VT3A 3E8MA 1BDJA 1ML3A 5FI0B 4ZIRB 4XWOA 2HB6A 2M1XA 3Q4GA 4UHBA 4ECAA 2OCPA 4U9IS 3WA7A 2Q9BA 5CIYA 1SQSA 1BWQA 1QZZA 3R3UA 2O8EA 3GLHA 3E9YA 3HKCB 3RAEC 3F8TA 3KFLA 1IONA 1WJGA 2J9FA 3DG9A 3Q9LA 4HX2A 4LWPA 5JD3A 3CU5A 3EPRA 3PHJA 5JS6A 4BNFA 2D5AA 1Q0QA 1RRKA 3K96A 2H00A 3SYTA 4BKOA 3N75A 3I3OA 3OJ0A 1Z6PA 3OKPA 3PDIB 5K45A 3KYDB 1VBMA 4BE7B 1X2BA 2YMLA 5A4KA 2O6LA 4YUZA 1TVKA 4UNNA 2M2IA 4LV6A 3ZLJA 4HLUA 1GNRA 5LLDA 4FKBA 3WG9A 3TLAA 1IL0A 4NCBA 2GESA 3TTXA 2V74B 3O83A 1C9KA 4IZ6A 3BZWA 1E3EA 2IZ7A 5EQTA 4DQLA 5LNK6 3Q3CA 2WP8J 2VZLA 3B2NA 4ED9A 2DHRA 5CVCA 3TR6A 4QYTA 9ATCA 4NZNA 1NXPA 3AC0A 2FSVC 3G0BA 3RTEA 5JS1A 4LI3X 2EVWX 3D7KA 3WAKA 2DJIA 3O90A 4MW7A 2AN1A 4I9FA 1CQIA 1Y1PA 4FYYA 3WLAA 4CIVA 1UXIA 1VZ3A 2BFAA 3IAEA 3LUAA 2AE1A 2YV1A 3ED1A 3WTBA 2PZAA 3WRWA 3ZUPA 2HQ1A 1OHHD 1SPXA 1U94A 2L2QA 4AURA 4DQVA 4BGDA 1D3AA 1UBEA 2DBRA 2EWMA 4EI7A 5K3FA 4BVAA 2I91A 2VZ9A 3TRKA 8ABPA 3G17A 3HNPA 4PFSA 2D4HA 2RHHA 2PGXA 1UPFA 1NPTO 3D6TB 3KSRA 5FX2A 2Q1TA 1G16A 3ENKA 3BKXA 3FWNA 4G36A 1P8AA 1N8SA 4JJ8A 1D0VA 1Y6RA 3EGXB 1XI2A 1XZBA 4DBZA 3QKSA 1UJNA 2F1IA 3EODA 3ZXYA 1PDVA 3WDKA 2VRNA 3NUQA 4RVSA 1E94E 3HA3A 4LDZA 4FN4A 1KJWA 1MJ5A 1OLSA 4CM5A 2Q3MA 2FWBA 1OYOA 5CXXA 2IXGA 3D8RA 2OP0A 3E3OA 1QCDA 4DL9A 4G1VA 1TK3A 3WIVA 1UWLA 3H4MA 5JFTA 4DCOA 1KE2A 3GLFA 2QRVA 1LLDA 3D64A 4N12A 5LIPA 4K9SA 2X13A 2RHBA 1V6SA 2OSVA 4LUCA 1LK7A 1PBNA 4MGYR 2HK9A 2OLJA 2CMGA 4U9HS 5EE3A 5IKOA 3RC1A 2PVPA 1KEEA 4PRKA 1N6IA 2WSIA 4YRDA 1PK7A 1T4CA 4LJ5A 4PV7A 3C4VA 1OA1A 3VBCA 5M5BA 5IABA 3LUKA 1MAWA 3WGVA 1U1EA 1DFHA 1Q44A 4OI4A 4IDQA 2RG1A 3DDWA 3QEMB 4JDUA 2NU6A 2R6ZA 4MKZA 2F9FA 3OC0A 1L8QA 2HA4A 1ACJA 1DRWA 2XYPA 4QBTA 5F33A 2ZJYA 3ESYA 4MQFB 4TOIA 4ZU3A 4EYEA 3U4DA 1NUHA 1VG0B 4DEYA 1T5HX 1VJ0A 1G21A 3ZWPA 2NUBA 2CVPA 4JQCA 2AB0A 5IEJA 3HU2A 3GLIA 1ND5A 3GCZA 4FR5A 4AROA 4DBLE 2AFHE 1XYGA 4LX0A 5JBQA 1ICEA 4B5KA 3X2EA 3OFND 3V34A 1EX9A 2B4QA 2TMKA 4YNBA 1RJEA 4RTSA 1ADCA 4M1YA 4PEVA 3LYAA 4FILA 3I5YA 4TRRA 2CUTA 2J0UA 5FFNA 4B5LA 4LZOA 3ZCVA 2XVXA 3RC8A 4RTQA 4QFDA 1TKBA 5JDIA 3O2SB 4BCDA 3GB9A 4I19A 1T1EA 2X5KO 3A6DA 2PGNA 3K53A 2A4KA 5T41A 4YQYA 4BTLA 2VWPA 4G41A 2VWHA 4GIBA 1C9JA 2JIDA 1C9DB 1YJCA 4Y1RB 2C4NA 2IYZA 1C8KA 3EWIA 1QPGA 2I4OA 2M6LA 3RC9A 2HR1A 1EQ2A 4WXHA 4MEJA 1DWOA 4YMIA 4S24A 3VKUA 2C2XA 2FVXA 5K4GA 3ENWA 3MWEA 3N2IA 1SC6A 1AHNA 3OTGA 4GEGA 3WKDA 3ZWNA 3SIWA 3W3ZB 1O0BA 2KSQA 4AZWA 3HCFA 2J67A 2E87A 5IH3A 4F1JA 5L4SA 1PW7A 2P9CA 2IIQA 2XNDA 1JP7A 1VCMA 3A58B 1N9ZA 1QPBA 1R5BA 4O8ZA 3BWMA 4JP5A 3SXUA 1GXSA 2X42A 2O5CA 5J63A 1UJ4A 1U2ZA 3RYCA 2VO1A 2WSBA 4G09A 1CZRA 1QS0B 1U9ZA 2YZ7A 1NMYA 3ON5A 1VA4A 3QHPA 4OOFA 1MO2A 4I4TA 5H83A 5FAXA 4F8EA 4KU4A 1H4TA 4MQEB 2YV5A 3BWBA 3NOXA 1HSOA 4JI3B 2FWJA 4F9FA 4BFLA 2PUEA 1G8MA 1EDZA 5J4KA 2CBXA 3MG9A 1OPXA 1AQIA 1QG2A 1TA9A 2MMGA 3MOGA 5FADA 5CDFE 4H2DA 1FX0A 5EI5A 3WGIA 3R8CA 2B20A 2CZGA 2XKJE 2YC2C 4DRXB 1N4DA 1RBZA 4HDAA 4GPZA 1GP2A 2OCLA 2PG3A 3VDQA 5FUMA 3U61B 3ZC3A 1AKTA 1T0PA 2FUKA 2PH5A 1G18A 1TT7A 3JYLA 3QK7A 3T61A 4LRXA 4ZI7B 2Q4DA 3BMQA 2W6MA 4XIJA 4BQRA 4Q4JA 4J94A 4KZPA 3JVVA 4WEQA 2IPAB 1JKIA 4H4CA 2DBVO 4OH7A 4WA8A 4KO1S 3NIGB 4BV9A 2DSNA 3WHIA 1AUVA 5F7XA 1KEWA 3A26A 3NJ4A 4FFMA 5KYKA 2XDYA 3WMWA 1LH0A 3AXSA 4WESB 2NAFA 1CERA 5FEUA 1Q7TA 2J46A 1SC4A 3RJTA 3HB4X 2A94A 3L8FA 5DBEX 3RTDA 4JP2A 2ZAMA 3VO8A 2Q0XA 3AFMA 3W2HA 2QNBA 1MAHA 2H4YA 1T3HA 3L8MA 4V24A 4IICA 3EGCA 5KNDA 1WB6A 2DFVA 4RE5A 3RVLA 2JI6A 1BHO1 3RFTA 4A91A 3B1FA 5FT9A 3M6AA 2AYXA 4E1BA 2GN4A 4KIFA 3R3VA 4KLNA 4LKRA 5DTQA 4WLVA 1J9GA 4HDSA 4NARA 4P86A 3EH2A 5E0OA 1OBHA 4EPWA 4TKVA 5CVUA 5FBVB 4G0WA 3TKYA 4IKEA 5JE8A 3O4HA 4JI4B 3R5HA 3WLMA 1T2CA 3ENQA 3WS7A 3B9BA 2FZWA 1EXNA 2QE6A 3BGWA 3OZAA 4JYBA 2XUFA 3RSFA 5A06A 2BSQA 3HKEB 2ZJOA 4AG5A 3TEFA 5BQ3A 3EQ2A 2QTCA 4LBZA 4MKFA 1VMEA 3TRFA 1L7VC 1J6UA 4G1UC 2C92A 4H7PA 2ZM5A 4CDRA 3O3CA 3BPSA 2WF5A 3Q8MA 3T1VA 1CFJA 1JN0A 4YRQA 5BW4A 3EF3A 2J4FA 2NVBA 1GUYA 2PM8A 3PNBA 1G7TA 3VUEA 3ZU5A 3KG2A 3LP8A 4E31A 2E82A 1ESEA 2XF2A 2WVJA 2ZK7A 3PCXA 4P4LA 2W90A 3ABSB 9LDTA 1GQQA 2RHOA 3CSUA 4QOSA 3RS7A 3U5ZB 5DGXA 2XQIA 2V6GA 1XL0A 3D2CA 5A5GA 1GPKA 1AMNA 4D8WA 1RW4A 1LUAA 2NVOA 5FHQA 3D7MA 3D6MA 2P3SA 2PZKA 3PQEA 1KQNA 2B6HA 3QKRB 1RXSA 2YV4A 3H04A 5JROA 3ROZA 4RD1A 2Q2OA 4GUDA 4AZ3B 4EX6A 2RHLA 2ZTLA 1PX0A 2FUNB 4MR7A 3UCEA 1CP2A 1ONNA 1APBA 4H35A 4V02A 3ZBQA 1XNRB 3MBKA 4X7BA 3VQTA 3AWDA 4BL5A 2E3JA 5ER9A 4CW7A 1WR8A 4C3UA 1QU2A 3R9WA 2R1VB 2GCGA 5LQJA 5AI9A 4RIHA 7MDHA 3D6HA 4I9UA 1ANKA 1Z7WA 1T9HA 1M5TA 4G3XA 5CA0F 2UAGA 4KI0A 4UZFA 5A3VA 3OQOA 4YMSA 1E7RA 3VDRA 4DB2A 2DMRA 1XMQB 2WQZA 4NV0A 1BE1A 2O0HA 3C8MA 3GGSA 2HJSA 1LC0A 4P84A 2XF8A 4YIHA 1Z75A 3TPFA 2IZ1A 3CUVA 3H99A 1VG1A 3EVEA 1RYYA 3G8AA 1NYTA 2IW3A 1YDHA 3ROEA 1DXQA 1USGA 1NKSA 3C5CA 3LBNA 4ZAYA 3PXCX 4M8NE 2OB1A 8ADHA 1W4CA 5AK6A 3I5XA 4KXXA 3UH1A 3ZZNA 1ESMA 2AX4A 2OVFA 3E2IA 1NN3A 5JVDB 1UBMS 2H5LA 4RZIA 3K31A 4DA0A 2Z3VA 3GHYA 5JWRA 3P52A 4R9VA 1KFKB 3FPSA 4QWMA 1U2SA 4E5MA 1PYOA 5KMGB 3RR2A 3W4KA 6CHYA 3L41A 4YMGA 2OBNA 4NNJA 1FPMA 3B2QA 1AUQA 1NTOA 3KQWA 4BB6A 4XWWA 2XSZD 1C0LA 5IS2A 1XDUA 3HQ4O 2QMHA 4R6WA 3OWHA 2H2GA 1V95A 1VOTA 3GGPA 2XQJA 1MABA 4EHAA 2GJKA 2I4TA 3JZMA 3JQDA 2R97A 3WFIA 3OQVA 3A10A 2GO7A 1RBMA 1DX9A 4LF9B 5JIBA 2J0QA 3OU2A 1QZXA 3KYBA 3PVZA 1EYZA 3SCZA 2OR3A 1WRBA 2DECA 4HLCA 1JTEA 1HQKA 3LOQA 2IXTA 3KAPA 3KQQA 1DIHA 3BWEA 3DFKA 1CDEA 1D7AA 4NICA 2PFKA 4BOYA 2OZKA 4O3MA 3EBOA 3HCDA 3FI0A 5B3KA 3P9ZA 3PXEA 5HTOA 1M83A 1O77A 4F7WA 4F11A 4ZPXA 4E3ZA 1IN6A 4LNAA 1N7HA 2ZU0C 4O4IA 1KI4A 1SRQA 2IYPA 2O20A 3PK0A 4R8VA 4WCFB 5C1OA 1W2GA 1EQUA 1XEWX 1LFAA 4RABA 1N5OX 1KMNA 2FPIB 3ZHZA 3L1HA 1V16B 3IPRA 3ZY6A 1JHAA 3RKSA 3EEFA 1L7NA 2FPPB 1FMJA 3KZNA 5CPFA 1I3CA 3W7BA 1JU9A 5BR8B 2IU4A 1CJCA 3ETHA 2XDAA 1O1YA 1LPAB 5J1SB 4AY5A 3ZW7A 4C7OA 4GYWA 2V5AA 3EJ6A 1M33A 3ESDA 4B74A 5JDCA 4EHFA 4Y1FA 3DVSX 2MYUA 1PTKA 2R1UA 1JAIA 1UEXC 4Q48A 3BXPA 3ZLTA 4OP3A 1MQ9A 4ND4A 1RYEA 3DE2X 2BR3A 2WSMA 2ZYAA 4MPRA 1URPA 4PZPA 5HOQA 2PUDA 1QCYA 4DNPA 1SPBS 2A9RA 4LXTA 1Z2DA 3TGWA 4RA6A 4JJ4A 4L5JA 4UAGA 3VR4H 2WOJA 4GVPA 5BSRA 4EYOA 2SICE 3CW2A 1XBTA 4S2UA 5JC8A 2WSYB 4BLSA 4I1PA 3X1DA 4RNCA 1U7DA 4UVIA 2H31A 3ZEAA 4B3TB 5BV0A 5EIOA 3K3PA 2ZSFA 1QHEA 1ZDMA 3OT1B 5DM2A 1FQOA 4A0GA 2Q4OA 1SZPA 2XOEA 2ZJ3A 4QAJA 1NT4A 1GDHA 2ZXFA 3CT4A 3K6KA 4GSKA 4FJ0A 1B8VA 1VJ1A 1IUKA 2ES4A 4D0LB 1LWNA 4F2GA 4HQNA 4G0OA 1I2DA 2EV9A 4KWEA 4QDJA 2GXUA 1ZU4A 2Q27A 4C0HA 2OENG 4PG8A 2VI5A 2J0VA 2CL7X 2HRZA 2LDBA 1KAOA 1Z0UA 1UZLA 2BY4A 1JW9B 2C77A 3HSYA 4UM7A 4HGRA 4CLHA 4JJAA 3VAZA 1EZZA 4PYRA 3RHFA 3G0CA 3KXIA 3PF9A 1OWOA 2PS0A 4KX5A 1QHHA 3RABA 4EY6A 4NMLA 1EBFA 4Z4FA 4KLRA 4YQEA 2VF2A 1JKXA 4ZALA 4C30A 3P8ZA 1NVEA 3TJRA 4DBLC 4AO6A 1H6CA 2NXNA 1LBQA 2FFAA 3FWHA 2FGKA 3H2ZA 3HC7A 3HV2A 3PQ4A 2BTQB 4FSHA 2FMIA 4NYJQ 4ON9A 1CS0B 1P9RA 2QX4A 4WOCA 3ZV4A 2XRMA 2R4UA 4JEUA 4D7AA 1QQ6A 4JHXA 2REBA 1X86B 5LD2C 1NIJA 3LZCA 3IEIA 4NCXA 2H6EA 4P3OA 4YJFB 1OAOA 4YWJA 1NUPA 2J33A 2PXXA 2V1UA 4QHSA 1PDOA 4OPMA 3I6YA 4URYR 4BN4A 4PYJA 2AUTA 1R27A 4EPRA 3NOVA 6GPBA 3EMBA 4Q3NA 3BSYA 1FYDA 5LLTA 4DFDA 2A0UA 5KYUA 1YZVA 4KK4A 3URKA 4BIMA 2BFOA 1X14A 4B2PA 1C0PA 4BNLA 2ISCA 4LQ4A 4PZYA 2WQ7A 1D2CA 1B8PA 1F2DA 3IV9A 2FMUA 3SYKA 4D0RA 1J1IA 1NJSA 4D8YA 2O2YA 2G6BA 3MLEA 1M2GA 2MT9A 4MROA 4OQZA 2RKWA 1RPZA 2ZBVA 2W6ZA 3AIMA 1WHSA 4B33A 3OQBA 3PC2A 4Y8VA 1FNSA 2JVKA 3THWA 4COKA 1WB5A 4P54A 3ZK9A 1BW9B 4EMTA 4GGMX 3WO0A 2W9XA 4JL8A 1U8ZA 3WGLA 4E7PA 3EWAA 5K8JB 3AF2A 4IMPA 1S4MA 1C7ZA 4F91B 3JQ8B 1GTSA 3LHFA 4FOLA 4HC4A 3VHLB 1M34B 3O8CA 3GP3A 4D26A 3K2BA 2ODQA 3C97A 1L3IA 4MHOA 3BTUA 4DR4B 3V00A 1VBKA 2CVQA 4L02A 5H3HA 5HZHA 1HE2A 3LRTA 4YEDA 2JPDA 4I4NA 2IOYA 1JYSA 1B26A 2CDRA 2TMDA 3IR6A 2M9MA 1I7DA 3KZXA 1GPJA 2NU9A 4BJ3A 4J49A 1YS6A 3DWEX 1QBGA 3I9JA 2AUMA 3NBQA 1J8QA 3C15C 2RBKA 1C3JA 1R5JA 4WZ6A 3TD9A 4DIOA 4L9AA 4P4GA 5A02A 5C1PA 2GOYA 3WLFA 1C4OA 3H05A 5AKKA 3RRBA 4HNUA 2DT5A 1I1OA 2DPYA 3KUCA 1YZQA 1Y80A 4Y0VA 3S28A 1KMHB 2KHZA 4HY3A 2C3UA 3DMNA 4C08A 1YK1A 1HDOA 3A6JA 4JN6B 2KW5A 5IX8A 1KWKA 2WZCA 5THXA 3EPKA 1L7MA 3A14A 3M83A 2WICA 4AYXA 1FVOA 3KAJA 1JWBB 1FBTA 1I10A 2PKQO 2IELA 1XTQA 4KZKA 4I3HA 4JV5B 4NENA 1XTBA 3TMAA 4CKBB 1YZKA 4IGAA 4CMEA 2JAUA 4YDHB 1KDYA 4P5PA 3DKIA 2AOTA 1O94D 4P7JA 2W71A 1FRZA 3DVAA 1MAAA 5C31A 2FJUA 3LY7A 3A9VA 1MP0A 4MV6A 3BD7A 4K6HA 3PT5A 4JLUA 1NXOA 5FULA 4G67A 1JXMA 5IZCC 9ABPA 4F0JA 4C06A 4RXTA 3FSGD 3NVKI 2FQYA 3QVUA 4J75A 3I2HA 4MW1A 5EC8A 1PFVA 1H05A 1I94B 4WKBA 3B6IA 3NTOA 3TF5A 3KUKA 1L6IA 3FF1A 1RDFA 2I8LA 4XVCA 2AG5A 3RW9A 1ZJ5A 3QIAA 4FDUA 2O54A 1MORA 1V0JA 3NW9A 3L1UA 2IKSA 1DWQA 2HMTA 4KN6A 5IUKC 2OFOA 1JDBB 1E79D 5JAQA 1BX3A 3LP6A 4KQ2A 1YFKA 3ROFA 4L4YA 5LBUA 5GJVC 4CEJA 1LQTA 1A96A 1SGWA 2WQ6A 3H5WA 1UJCA 1Z35A 4KRXA 3L4KA 5BUZA 5ESXA 1ORHA 4J2TA 4HBZA 2VXBA 3FTEA 3OETA 4TS3A 2QTMA 3JALA 2W58A 3OJLA 5TQJA 5BWNA 3DOOA 1NLFA 2VSFA 3CZ4A 4QUGA 4X94A 3L0YA 3LFUA 4KACA 1KMCA 1U02A 3NDRA 4YP6A 5AIBA 1D7OA 4C0AC 4EJSB 3F5FA 3FSGA 4V0MA 2DUMA 5FUQA 1DSSG 3I0MA 3FPCA 4GYJA 4KN5A 1J2JA 5EWLA 3PGXA 1SHUX 4KQJA 4IFEA 2VP6A 2Q5HA 2WNHA 3MOIA 1WPQA 4MLDA 4X0EA 1PL6A 3JSXA 4U5QA 2P7IA 3JQ9A 3A1UA 3QWAA 4G0ZA 2OG2A 2WVHA 4DRYA 1TFRA 1Q7CA 2PRJA 4G01B 2CXSA 2WA2A 2PX5A 1DT3A 4CTNA 1CRQA 2JLCA 4KQIA 2OCGA 2AL7A 2PV0A 3CGWA 3VFDA 1CJVC 2GLUA 4YQZA 4Q82A 3THYA 3WKAA 1RFGE 3A32A 4KODA 1BX0A 2GVZC 3OE1A 1HZJA 2PZEA 4KYUA 1Z13A 4WJZA 5TS2A 4ESVA 3RAFC 3K72B 2PANA 2ZJ7A 1T6NA 4PRYA 4WCDA 1PG5A 2GPAA 4JLWA 3V8MA 3A4NA 3NYIA 3FCEA 1LJ8A 3HHPA 3Q7PA 1N9GA 3QEAZ 1KBOA 2C1EA 2ZPUA 2NVUB 1P31A 2LCFA 3G88A 2QY9A 1TJ4A 3R3HA 3UYLA 5L7YA 5L40A 3STWA 1FDTA 3S6JA 3GVHA 1JKFA 1E0JA 3MVEA 2CCKA 3AEQA 1Y8QB 1VE5A 3BE5A 3K0CA 1R7RA 2M6RA 2GFQA 3MRSA 4MCJA 4M1EA 3U3XA 2Y9MB 3VNBA 3OA0A 2N47A 5MN4A 4NRDA 1LRLA 3EK2A 3LYUA 1R4MB 1XJCA 2QJWA 1E60A 1P6UA 1Q15A 2NU7A 2ZUSA 2AD1A 2AG6A 3QV1A 4GGOA 1AQUA 3AOEA 2UYYA 2Z56A 1J99A 1GUDA 5BWOA 3SQXA 5CVVA 4GXRA 4FGJA 4OD0A 4RTNA 2GCOA 3BVPA 5IDQA 1J2RA 4L15A 3WKCA 1YF3A 1PJZA 1X8LA 1XJWA 4ZI3A 5SY4A 4NMXB 3H6KA 4KE7A 5FI1B 4F6RA 4X6LA 4IM7A 4TS9A 1EB9A 2VTBA 2AMLA 4DA9A 1H6AA 1ESNA 4P81A 4XIIA 5AHKA 4AM8A 3E9NA 1XCGB 2YHSA 3JYOA 1YR2A 2GHTA 3L6DA 3QYAA 3NEYA 2PKYX 3H42B 4H4EA 2VDPB 2GN6A 4IFTA 4MR9A 3SQNA 4M9CA 4BFXA 1TZCA 2A35A 4IVQA 3C87A 3I52A 3ZWAA 1DC8A 2Y2VA 5FBRB 1EJ0A 4F06A 5KYYA 3GFSA 3RG2A 1RKXA 1LJUA 4K28A 3TS1A 4JSTA 3UC9A 1NONA 3BB3A 1XRQA 4OQFA 3W4JA 3ZV3A 2DJ5A 4PRZA 5P8WA 5LWHA 4LZJA 2R8BA 3WAJA 3TCKA 4Q1CA 4ENSA 1GR1A 1T8YA 2VTDA 3PVSA 2I2CA 2PWYA 3BGVA 2IWHA 3UK0A 4B76A 4KR9A 1U3TA 1T9DA 4KR7A 4WN9A 5F3RA 3UJ3X 4IOMA 2PXHA 1TQHA 521PA 4B3BA 2XB6A 2QSYA 1CE8B 3O8RA 4OI1A 1YHYA 5EE5B 1A9TA 1I5OA 1NZDA 2RHCA 3VZBA 4TYNA 4MR8B 2HSEA 3VU9B 4ZO6A 1TEXA 1P2SA 2XUPA 3QMWA 5ALIA 1IWPB 3U13A 4ALNA 4ZI7F 2ZBQA 1QVZA 3HWX1 1KO1A 1G2PA 4DCSA 1K08A 2WU8A 3HP7A 4HI0E 1T9KA 4I1OA 2Q6TA 4MYTA 4PPYA 1FNCA 1M72A 2EL9A 2ZDGA 1WSBA 4HNTA 3PGVA 2AUNA 4UAJA 3E9QA 3P4XA 4HPJB 5BN5A 4EJMA 3CISA 2O8FB 3HJNA 1JDJA 2P4UA 1NHWA 2GKOA 4CF5A 4EKIA 4U02A 2R5NA 1KR5A 4MUAA 4S0XA 3EXAA 2B34A 2OB2A 4GU5A 4L8LA 3UNXA 7YASA 2VC2B 4LE0A 1RKUA 4QM6A 1VG8A 4YP5A 4XPZA 4RK0A 1GSHA 1F06A 4J8PA 4BLPA 1U3VA 2FZLA 1BZYA 4W5HA 1B6SA 1QH1B 2OBBA 4XASA 3QMMA 1DLIA 2LUOA 2QVGA 3CVYA 5EJIA 2Y0EA 2H1IA 4KLCA 2CYAA 2KE5A 3JZFA 1PUIA 1FNDA 2JI4A 3ZEIA 3ZE0B 4FHFA 2A9OA 4LJ8A 3NQ41 2GEUA 1TUEA 1YXMA 1NRXA 1N2JA 1W48A 1FLAA 1H2HA 2Q2QA 2YFQA 2PMEA 1W4RA 3L04A 3RNLA 1LRKA 4L2IB 1PFQA 1T9GS 2GAOA 4RSHA 3AHCA 5TPWA 1RQPA 2HKIA 4U6NA 2DPXA 4HDOB 4NWIA 1FE8A 3CNQS 1OD6A 2ZCUA 1G21E 1QIGA 3A4IA 2O23A 4BIIA 3QU4A 1XVUA 1ZONA 2FEAA 1QV6A 2EYQA 2HPZA 1FTQA 2QTBA 2W98A 4OSEA 1A8QA 4LHXA 1E1MA 3U9SA 2VLBA 1FXWF 4IIGA 3V4LA 5IPFA 2IT1A 1UBTS 3REOA 2ZSDA 1XRNA 3UG7A 1QC5A 1DEKA 5A0VA 1E1CB 4EQ6B 5FOUA 1YZNA 2PY6A 4QJ5A 2EQ5A 4F84A 5JRZA 1M1NB 2CKDA 1FNBA 1SHTX 1V26A 3BTOA 4I9NA 1JIKA 5ALEA 1QJCA 5ADVA 1TM4E 2YICA 3DWGA 5BOVA 3WGZA 2ZRJA 3EMVA 1VCOA 4B84A 3PFCA 4WFIA 3HUTA 4M60A 1GHTA 1SKQA 1XZKA 2EW2A 4HT3B 4I5EA 4DKXA 4Q9DA 2QG9A 3JWJA 4RJTA 1V47A 1E5TA 4DV6B 4URXR 1XCLA 3WWZA 5ECGC 3VYRB 4N0PA 4BNYA 3ELDA 3UB3A 1G8SA 2OVBA 5GY7A 1DT5A 3NFRA 2QRKA 4PGHA 3DYIA 1G9XA 1HOTA 2IEZA 4ZICA 5BY2A 4C2UA 5CNKA 2JARA 2O2DA 1IHUA 4E3WA 4E12A 1JKJA 3D5QA 1I2CA 3MBOA 5SYNA 4CEIB 1VC2A 3EB9A 1VHTA 1J7JA 2CKMA 2WFLB 4PSDA 3ZD7A 1QHXA 2QLMA 1Z0DA 1S9DA 1WXEA 1SELA 2GCEA 2J3JA 1MENA 1SK9A 1XTSA 5T4BA 1VPWA 1D2GA 3D7LA 1CJBA 3DOFA 4RBNA 1B73A 1ODIA 4RJLA 4GM0A 1WG8A 3T5DA 5CITA 5CMLA 5LBTA 2NW6A 3ZWWA 4R0MA 1EH5A 4NQZA 2GBCA 4KI7A 1Y7HA 1P5RA 1D4AA 3FVRA 3D0OA 2HCFA 3RS5A 1HDIA 4QTUB 2HSDA 1N5LA 1L1RA 2YZMA 3E61A 3LC7O 1L4NA 2EU8A 3EY9A 4IJQA 4Y2HA 4YJ3B 2LTAA 5E6SA 3M9XA 5BW8A 5JVDF 5KTYA 3U44A 2YS6A 1DIOB 1P7ZA 2O3UA 2H4JA 1O96A 3CA8A 4TT3D 1SU7A 2DFLA 3SC3A 4EF6A 4Z7NB 5B30A 5BOSA 1HX7A 4MI6A 2C4WA 4ZQBA 1RM5A 1RWVA 3NP9A 3R5TA 5B7NA 3NBFA 4M1OA 3K70D 4TTQA 3LXUX 1FL9A 4UUPA 2WWRA 4Z4GA 3P9YA 5B2FA 4DSNA 2IBSA 2JEOA 3G5TA 2BH9A 4X7PA 4YJGA 2MIIA 3LA6A 2X5JO 4RVHA 2YBDA 1II8A 2C2KA 1WEHA 2G5PA 3PU6A 3U31A 1KI6B 4PC1A 3K0AA 4LW8A 1QAOA 1ZCBA 3BEOA 3KJFA 3W5IA 3M5WA 4EB8A 3UK2A 1Z63A 1ZGCA 3PV0A 3LC0A 4PHHA 4RPHA 4WK2B 5DSXA 5A4JA 3ZHOA 2B83A 3O8QA 4BYMA 3SLKA 1BXZA 3JX9A 3C43A 2JAQA 4MJLA 1NNI1 1WDLA 3BL8A 3FIUA 4BQNA 5JAIA 1XNHA 4IWNA 3FG9A 1FDSA 4B4KA 1PZEA 2QQFA 1WIWA 4IDNA 1P3DA 4RA9B 4XQCA 4S2EA 1E1DA 1IWBB 3NC0C 4LCBA 4LY0A 3Q7SA 2CVFA 3THXA 3U2QA 4GWGA 3CB2A 5DH9A 1IYZA 2FWRA 5B1DA 2JBWA 4G23A 2HSJA 4BCBA 4N47A 2P8SA 2BKAA 3TTTA 5IXYA 3AJDA 5IF3A 2QY6A 1ZWKA 2O06A 3QWBA 1R0YA 1NQXA 4RVOA 4RMJA 3IJPA 3WX0A 4EPYA 2YTZA 1O6ZA 1DOZA 4RV4A 1E4EA 3NH6A 1XDSA 1SEPA 3O8LA 4US0R 2WHEA 3KT0A 1CZUA 4JCCA 4YRLA 2AS0A 2J7KA 4L8WB 3X3HA 4XUDA 4LFAB 1U3CA 2GI4A 4BVKA 2B1GA 3NWPA 4FMCB 4H17A 3E7WA 4KO2S 5AK0A 2YXLA 3F3KA 2HMVA 4G81A 4JS0A 3IQEA 4P4TA 2RBEA 4UVDA 4DABA 4ZCMA 1ZUWA 4V0OA 5FUYA 4TSFD 1HRKA 5HJ2A 3V8VA 4KFUA 3BFKA 5TT0A 4O2BB 5HGXA 1H23A 5ARCA 1KK0A 1AVTA 4FDMA 3HVRA 4D4LA 3NPAA 4Q03A 4BBZA 1KSHA 4O4HB 4E4TA 3C6QA 1PAUA 1W49A 1RZUA 1TVEA 3NZEA 3GCGA 1I4OA 3RAGA 5JADA 2CFTA 2RGWA 2LD4A 4G65A 5DOVA 5H5JA 1R0LA 3B3FA 5TGDA 3KHTA 3WFZA 1T4GA 3DDNA 5TMDA 4HEJA 5A4FS 2W6QA 3N2KA 4JX9A 1D2MA 2VL7A 3MEQA 2QSZA 2WJGA 3ETLA 3Q8LA 1P44A 1Y8RB 1W4ZA 1Z39A 4K8OA 3QLJA 5D00A 4J4BA 3B1JA 4BLOA 4XQEA 3K1YA 4JUIA 3FDZA 3ZGXA 3NUGA 4UU8A 1F5NA 4CFZA 2BZGA 5EL0A 3CIOA 5AVQA 3NDIA 1T10A 4HQOA 1I1HA 1SA0A 1P5ZB 3D7SA 4HEHA 1J90A 5I4IA 4TM8A 2EEZA 2WJPA 3H97A 1T9AA 2G67A 1SOWA 2YN2A 3LL7A 3ZDFA 3E2PA 4K3VA 4ZVOA 1H3NA 2B25A 2RGRA 1TC1A 3E3LA 1UP6A 3M81A 4UBOA 3P0EA 3RTBA 1HNXB 2QUAA 2C7BA 3AB8A 3JAWB 4UUOA 1YBFA 3LT2A 2R8RA 4JCOA 3SY8A 3MMSA 2WTMA 3FYUC 4ZIRA 3OTQA 4CM4A 2Z2YA 2IEYA 1R9JA 4AMUA 3G2HA 2CXTA 1VPLA 3M3DA 4DV7B 2JJ2A 3H8VA 3HKCA 1PT5A 3QITA 4G4SP 4BMDA 3I9V6 2GEBA 4MA0A 2FJPA 1VRVA 2QTNA 3ORYA 4M2LA 3LX8A 3MGBA 2V3WA 2VUTA 2EP8A 2DC1A 2XEXA 3B48A 3MMNA 4RVUA 3R7BA 4B9EA 5FOTA 2Y6VA 5IJXA 3WLHA 5KWSA 3GVIA 3PDIA 3V2IA 3KYDA 2Q4TA 4R0VA 3TZCA 3P0JA 3V7YA 2ZR8A 2JIPA 1QCZA 3Q3VA 1BDHA 1CUEA 2PS3A 4PAMA 1B23P 1QHIA 2F59A 3BREA 4GMGA 4E88A 3QG1A 4MPTA 1GTZA 4OHUA 1OLOA 1W88B 1ZO8A 4G25A 3VZDA 4B9AA 1OCEA 4LS3A 3BRSA 1S9HA 3GJ3A 2GWHA 3MGAA 4LAFA 4QBKA 2WMOB 4RV9A 1AN9A 3HRKA 3JRWA 3PKJA 4ZOCA 3LPDA 3LDHA 5EGSA 2NPFA 4KB5A 4MYHA 3IEPA 1TIKA 3CJRA 3V7UA 2CLIB 1UFOA 4KXFB 3FPEA 2H7CA 3WLKX 2MYTA 5JAZA 3PC7A 3TSAA 5FO0A 2OGTA 3G2KA 3P7MA 4GLJA 5K4AA 4LF8B 3WZMA 3SN6A 3DOJA 1QGAA 3H84A 4R1UA 3UGQA 1RR6A 1MRZA 2FOLA 1OX4B 1VPDA 2C1ZA 2VP9A 4BBAA 1PEAA 1XJQA 1A8PA 1I14A 1OFTA 4ZQCB 2IP4A 1U6IA 4X1YB 4F7DA 1T0HB 1QB7A 1XTJA 3OOWA 3EVNA 5FDFA 1GG9A 2GZ3A 3IMCA 2UZ4A 1YA4A 4IYJA 4EZBA 4MHSA 5TJHA 4JH0A 4RZQA 2GXQA 3MPOA 3LSTA 1CUXA 4YAGA 2VPWA 3BBLA 4R98A 1PT6A 5SY9A 4QU0A 3U9LA 2NSJA 3S2SA 5ENDA 5J2TA 3ICEA 4W7SA 5GOZA 1ZUHA 3KTOA 2R8XA 1Z15A 2ZE6A 4H1WA 2DY1A 1W6RA 2QZ9A 1UJ6A 3BT7A 1SD5A 4LZPA 2OP1A 4GNKA 1VYUA 3QXGA 3TNJA 1MX9A 5AJYA 4BMCA 1I7PA 2OZLB 4Q0MA 1KS2A 3PF8A 4BKUA 2PTHA 1W0KD 2PGJA 4OKIA 4MV9A 1KP2A 3TECE 1UC5B 3LIIA 4H59A 3ACCA 3AETB 4Z2YA 1W87A 2TRSB 2X0KA 1KZ6A 1FYVA 1AKVA 1B2RA 3WRYA 3EEBA 3VKHA 3GAFA 4EG6A 4ZVPA 4NL4H 1CZKA 4PX5A 5FEMA 3LP5A 4TQGA 1NXXA 1ZGZA 2QJFA 1QO0D 3SC2B 3DAFA 2F4VB 2GX6A 2ZCVA 3HBFA 2IU3A 1CF4A 2OGWA 4S1NA 3ABOB 3FLAA 1ADJA 2A33A 2XNCA 1ZI6A 3FZQA 4W63A 4XRRA 4RESA 3SYNA 1GRCA 2IZ5A 3UT5A 3ESBA 3HY3A 1UXJA 1Z25A 2O4CA 3UMYA 4CNBA 4MQFA 2F6RA 4FYPA 4PC6A 4QOJA 2A59A 3FWKA 3ZUGA 5IUNC 2DBQA 2O2HA 4INJA 4R2MA 4WX2B 4ZVKA 5E4TA 2H7VA 1ZCJA 3WLSA 4B31A 4BQPA 7ABPA 2BMFA 4IV0A 2VJQA 2I6QA 2Q1SA 3ZVNA 5CB4B 1ZEJA 4DUZB 3L7YA 1I9CA 2QJTA 1JB9A 1G20B 3HLTA 1U8TA 3W7AA 2CNNA 2IA5A 5HCNA 4XYGA 1IAVA 3SHOA 1O5IA 1KE1A 2BFNA 3DV2A 1Y5MA 5AJWA 1ULHA 4HO1X 3UJBA 1KBZA 3ZDZB 2Q5CA 5C32A 2P0EA 5JDIC 3G85A 3BRQA 1XEFA 1IN1A 2C7VA 3CSSA 3LQ4A 4B3HA 1G59A 1V5EA 2C88A 3E1GA 1FJXA 4Y1EA 5K3OA 4EYGA 2C8JA 1JEYB 5JJLA 4EG3A 2C5FA 3F49S 5HE8A 5I9IA 5ERGB 1Z5NA 3U19A 3AKDA 1RI2A 2WNSA 4IUBS 3SVZA 2O57A 3WK5A 3KYCB 1BQ3A 2OLEA 2OM6A 1DKOA 2E6KA 2JAPA 2CHVA 4MLPA 4NZZA 2HT1A 1K7EB 3PFIA 4W5QA 3O4JA 4MEBA 3TNYA 2VAXA 4LXHA 3QOYA 4DMGA 4LKOA 3Q7TA 4LRYA 5BP7A 1XZDA 2BF7A 4X5OA 3DKKA 2E5WA 5FA8A 5CD9A 3PD7A 1K5HA 4U0KA 2DSTA 4WY2A 4MI1A 4LWOA 4PX9A 1YBVA 3WGYA 4D5GA 4OA5A 4MIEA 5JWHA 1QS0A 2P35A 2FU5C 3IDZA 3GUVA 1TB4A 7ADHA 3C3XA 4FIZA 1IHXA 1L4MA 3ZHTA 1A1SA 3R24A 2YV3A 4BVHA 4ESEA 4YRAA 5KTMA 1BWSA 4EABA 4O6VA 1TAQA 3QX8A 1S8NA 1D6NA 1Q2UA 1AUOA 4Z9AA 4DRXA 4QOEA 2GM3A 4QNMA 4MB0A 2GASA 2WRZA 3ZHSA 3ITEA 4YPVA 1AF7A 4LDJA 3HDJA 5ADUS 2W4QA 1UL1X 2C5HA 3N2GB 3WYEA 4C88A 1K5GA 2IYOA 4ZI7A 1E3SA 1RMYA 1THMA 2XVYA 4YVFA 5CAEB 1AXRA 5LQRA 3ILYA 1UKVY 3VSAA 5HK8A 1ABEA 5E1MA 1ZK0A 3WB1A 4YAFA 4FMPA 3PFHA 4KAJA 3SOZA 2HMYB 1H2FA 1Q0HA 3PZBA 4PN7A 1MJGM 3NNNA 5BNIA 5K51A 1F12A 4TKMA 3RJZA 1IJFA 4UFNA 2V8BA 4BEVA 4ENPA 5HUJA 1UBNA 4NOMA 1YDEA 3PYXA 3NLLA 1W85A 3X1KA 4KOAA 3UC5A 4MRAA 4J0GA 2OXTA 4Q05A 1ZW6A 2V6IA 1D04A 2P3QA 4QBFA 4XOIA 1K2VN 2FI1A 3DE5X 4MVJE 1TX4B 1EK5A 5A9SB 5E7IA 1OIXA 3FHOA 4NBVA 2ZI3A 3ELUA 4ZC1A 4JNKA 3TRIA 3GJ4A 3AFGA 2O3QA 1FDUA 1VL1A 4IVNA 8AT1A 5FLKA 2FPSA 1TCVA 3HJBA 1YU6A 3NOQA 5FRDA 1HNNA 3KE8A 4GZ5A 5A6SB 2YY6A 5D5QA 3RSHA 2VCEA 4BB9A 1UMBA 5HK9A 1TYZA 1K66A 3NETA 4URHA 5CW2A 1E0SA 5EA2A 3VVCA 3VVLA 5K03A 4JYAB 1K06A 4GOND 1DELA 1ZVMA 4PNHA 1I2MA 1RVV1 2CFSA 2Q0SA 4IDFA 4EB6A 4OHVA 4B3DA 2ONCA 1VSBA 4K87A 1RRGA 2JLZA 2XVAA 4KG7A 3BL5A 3RUCA 4IUYA 1FXSA 2X7HA 1UPXA 4IFBA 4UU0A 1WZNA 3TO5A 4W1SA 3A3YA 5SZJA 1UBJS 4V1CA 2WOOA 1FY2A 4FI3F 4R7ZA 1U98A 3Q6NA 3KVVA 1EJ2A 4NPHA 4RCVA 4D4GA 4D99A 3NASA 1A8UA 2HIHA 2Y1LA 3RAPR 5ITVA 3P26A 3SHFA 4P4SB 1KOFA 1M8PA 1N1MA 3ISTA 3NIWA 1E2GA 5BSUA 1DCMA 3STHA 3GI1A 1KWGA 2IPLA 4OLHA 1Y5RA 1SFRA 1NFFA 2OE2A 3FPFA 4PLHA 4YUVA 3LOPA 3WGGA 1FQJA 3QKRA 3WMGA 4C2AA 3PFKA 4ZCIA 2B4YA 3K09C 1W1UA 4AZ3A 3DE3X 2XODA 3KQHA 1T1GA 4V0ME 5DLEA 4MVJM 4IJUA 1N92A 2X14A 2VQDA 4MUMA 3QRWA 4ER0A 4JC5A 5LOVB 2BMWA 2Q3FA 2OSBA 1Y7LA 3EAFA 4UMEA 5E1BA 4G4JA 2LRHA 2CV1A 3UAZA 2R1VA 5DLYA 2XWJI 3PWKA 4MYDA 4P38A 4ETIA 4GE3A 2R2GA 4WFKA 1IJEA 4BLQA 2VJLA 5FA6A 3CX4A 3L84A 2A7QA 5FWYB 2HHLA 5AKEA 3B6KA 3GZ4A 2XE7A 3NP7A 4NAVA 4H9GA 4GECA 1FA9A 2PMKA 2PGIA 1RXIA 3PQ6A 1DX6A 3R20A 3Q2KA 5ES4B 3CV3A 4MMYB 3EFBA 4MKRA 4F2HA 4ZJYA 1JLHA 4L57A 2IOQA 4YONB 2GZAA 3KSDO 4Z1MD 5JVDA 3MXTA 2A5JA 3LLSA 3ROPA 1NBOA 3WIUA 2WMNB 1L4EA 3AU8A 4JJKA 4TKZA 2R65A 4KEAA 4G07A 1UBLS 1Y1LA 3LF1A 4GH5A 1K7XB 1L7DA 4J7UA 5DTEA 5KMGA 1XU7A 3D8UA 1T6XA 1DKQA 3PQ8A 3AIOA 4NCIA 4BZZA 3K4QA 1NU6A 1ZUIA 3OX3A 4KNWA 4CCWA 4YV7A 5CLFA 2OILA 1SRRA 4Y6GB 5EXEA 5I4CA 4LYDA 3HVIA 1PD1A 4UCQA 3AK4A 1V48A 1AKQA 2G07A 2ZS9A 4G1CA 5C2JB 5TJ9A 5C18A 3IPXA 5DNYB 1ISPA 5HHTA 2RGXA 4Z4IA 2N1MA 2YL2A 4NMWA 3O1JC 4CIYA 2BR4A 3QVKA 4BP9A 1UZAA 4FE7A 5DOZA 4XGKA 4KGDA 4EYSA 4UOZA 2V59A 3LIPA 4DIUA 1C29B 3CS3A 2D2EA 3D3NA 1EFHA 1CVLA 4RD3A 4D8UA 3HU3A 4I5DA 1RABA 3UJAA 4OREX 4ZARA 4DJDC 2HA7A 4LA4A 5JALA 2VRWA 1MT0A 3B38A 1N0UA 3OCWA 4QLBA 2YRWA 5IC5A 4EFLA 1EG7A 3MWFA 1Y0BA 3F2IA 1FF9A 2AXEA 2IZOA 3L18A 4GBJA 4HWSA 2AMFA 4LRUA 3ILVA 5KTKA 1XPUA 2FPIA 1PI3A 2PZMA 4BKPA 1XYVA 1V16A 4YJ3F 3K2QA 1R0WA 4DM4A 1Y5NA 4KXWA 1UMKA 1MZVA 5C3MA 2R68A 4I5IA 4DJJA 4XDGA 1EVZA 3BMNA 4B1FA 3QGMA 3OOYA 1SVOA 1DAFA 2X0NA 1WUTA 4H7FA 4MAAA 4G5HA 4K40A 2ZSIA 3OPXA 1YS7A 2H9IA 5E9WA 4RDHA 5IFLA 3FB4A 4ZVSA 2G7MC 2YYAA 4JENA 1U7HA 4EA6A 1M2OB 2NTNA 2XNKA 5EMLA 3HDQA 3ZZ0A 3ETNA 1IEXA 2A30A 5BR4A 1HMPA 3GJTA 1JECA 1C30B 3EXG2 1DDIA 1L5RA 2XUZA 5KJ1A 1LSSA 5JS2A 4Q9KA 3PTAA 1MN6A 1U7XA 3AWIA 4OK5A 5EJFA 5B3JA 4BX9A 5LN1A 1XKTA 4WZZA 5MFZA 1P7CA 1A04A 2BGIA 4PGAA 4DJEC 2CLMB 2VATA 5AM1A 1ZRSA 3ZNNA 5KTSA 2BCGY 1Q1AA 2ATXA 4EUFA 2Z6AA 2BGRA 1GPMA 3T9AA 4YMHA 1BX1A 1QWOA 2YMMA 2E9SA 1KYZA 1F6WA 3OQJA 4GVLA 4CR8A 3ZJVA 4L27A 5CX1A 4DW8A 5G4KB 1SZCA 1Z2AA 4RV5A 4XX1A 2AIRA 4YB8A 3V3KA 4EUSA 3UENA 4Q37A 1OH5A 4HWTA 1H0KA 5I9LA 4Z6KA 2GF2A 3A36A 4QRHA 1H85A 1VG9B 2HCBA 3MT0A 1JJAA 1T35A 2CFCA 1BGXT 4RQTA 3ABZA 4TV9B 4BLTA 4LBWA 1YC2A 3N2ZB 3L82B 3OLWA 1NW6A 5DNCA 5CD1A 2HGZA 1LKZA 2ID9A 4PZDA 1MG5A 1UDXA 2OUIA 2FW9A 2P62A 4CF3A 2E5LB 1R6XA 2EARA 3MTEA 2QAIA 1I4LD 1U3GA 1VCIA 3OKAA 4IXMA 4H0NA 4N4AA 4Q7KA 3HUFA 4LYEA 4DVGA 3MYRA 2YN0A 3H2HA 4CM6A 4ZT2A 2NO4A 2NYVA 2CB9A 1CS0A 4FMCF 4RGYA 4X66B 3QBJA 2RKBA 4HOYA 3SDBA 1WPRA 1DQZA 3FTDA 4DWJA 1EK0A 1XTTA 4YJFA 1QQ7A 3V1KA 4EAQA 3H5NA 4Q1VA 4ZDJA 2A67A 4O2BF 1REQB 5DE3A 5JFGA 3Q0TA 3I4FA 1PQYA 3F6YA 1V1JA 1ONOA 3LUPA 4FFSA 4XYLA 2BFFB 1V5GA 3KIPA 4RPIA 3JASB 4O4HF 3RVBA 1KIAA 2IU0A 3BULA 4TX1A 3FJ1A 1J1ZA 2NG1A 1TYCA 3PWTA 1IG0A 2XYGA 4HMPA 4EPVA 3WBBA 5I51A 2ODNA 4HADA 1FQKA 2R2AA 3ETJA 5GM1A 2NACA 3U4GA 4HVLA 5T7BA 4YPFA 2VQFB 3WYFA 3UJ6A 1XTIA 3GEHA 4C7KA 1O5TA 4RTMA 4AIRA 1GQSA 3AR8A 2O8DA 3H6HA 1HETA 3PUKA 3W2IA 5AH0A 4Y9TA 2X0DA 4MXDA 2VYQA 3TBFA 4I8IA 4K26A 5WRFA 3U9TA 1O5OA 4YMTA 2FW0A 2VP3A 4F46A 2QB5A 4JIGA 1Z0KA 4NE9A 4DXAA 1V96A 2RAFA 4YMVA 1M34A 1M5UA 1ZNZA 1QGED 3DOHA 3E7XA 1PDWA 3C0KA 1NLZA 5G1OA 4BY9E 1NM5A 2I4RA 2IY9A 1I8TA 3OMXA 4AUNA 5JASA 4XM0A 2EAUA 3LDGA 1X0XA 3M6MD 5KVAA 3N2NA 5DI3B 3E1SA 1F4VA 2N3ZA 1N2EA 1WUYA 1NW3A 2VK4A 1GKYA 3BHJA 3B6ZA 4N0QA 5AOAA 5EXDA 3MK31 4Z0TA 1JNYA 1G55A 2A57A 4UHKA 1O95C 1RRCA 4A0SA 4DG5A 1BKYA 3AY7A 2AJDA 2V03A 4E1VA 4FSXA 1RP1A 1Z28A 4ETWA 4ZVUA 4YQFA 3BXZA 2BDEA 2JLQA 5L95A 4QARA 4JR0A 1IDOA 3ZH2A 1WF3A 1Z83A 3AJRA 1AGYA 3C3DA 3DMRA 3KRTA 5GZ6A 1KMHA 5DB4A 1TF7A 4MQBA 4OP2A 2V3VA 4LXYA 5CB8A 1JRLA 2J3HA 2GTHA 3CF6R 3HN6A 3IPCA 3LYLA 1YKSA 4HLDA 4NDAA 5LFAA 3SEFA 5EMNA 5KJFA 5F9HA 3S1SA 1Y81A 3NR2A 4BKMA 1FB5A 1F1JA 5FB3A 2ZANA 3O2NA 1FDRA 1Z06A 1KF0A 2G4LA 2XUJA 2BBWA 4CM7A 2IEIA 4FW8A 3GEIA 5CG1A 4CKBA 4HNAB 1KEKA 5IC4A 5TMEA 4H3HB 2PCJA 1KEZA 1T1SA 3ANSA 1W0CA 1OILA 4MQMA 3VR4D 4R7GA 2PGAA 4EARA 2FK8A 4FK8A 4FONA 5IJWA 1PR1A 3LQKA 3RU3A 2BFPA 4BQOA 4YYEA 2D00A 3OEHD 3NM5A 3GLVA 1CS4C 4LOIA 4Z3OA 5DEOA 3PCTA 1Z2PX 4EHLA 2I55A 5A71A 3STYA 1P2BA 3FI9A 1ZD5A 3ZI7A 1QPZA 1I4TD 1Z2OX 1ORVA 4X61A 1EHIA 1TE2A 2M6SA 5MDHA 4C0WA 1J5PA 1KNXA 3IUEA 3DWFA 3LI2A 1UQTA 1VE3A 2LE0A 4KQCA 2RAUA 5CNJA 5EGNA 2WHQA 2P40A 2EDCA 1BEUB 2PYIA 3WWDA 2ANBA 5HUQA 5HIAA 2XQKA 1G0NA 4FMDB 3V46A 4GDFA 1X7XB 4GZMA 3UMSA 2PXCA 2Z2XA 1AA9A 1RQ2A 2DHDA 2VFAA 3FAKA 1ZD4A 3I9FA 2QEQA 3KJXA 2ZS7A 3RIEA 3NDBB 5JMOA 1LDGA 4XB2A 5HZMA 3EIHA 4PG5A 3KB8A 4G5QA 2ZUVA 1T34A 3PE6A 3UWMA 1AX9A 2MINB 3VI3B 2FQQA 3W2FA 3QOFA 1MQAA 2ZTMA 4Y9DA 3Q9NA 4UEOA 4FDVA 4DDUA 3TW0A 2QE7D 5AKHA 1RWWA 5ALQA 2C7QA 3FAZA 2JIMA 2CLFB 3L7AA 2O5EA 2R3SA 1MA3A 2PBFA 1ONSA 3MNFA 5FPTA 1N34B 1LJLA 5DRYA 3WGTA 4P0QB 3LCVB 4GRDA 1T9CA 3FWZA 4LQCA 4OGFA 1KU0A 3K8OE 1FOEB 4B6QA 5JWOA 4G0QA 5E8RA 1VE6A 2N46A 4I99A 3HDTA 3EY4A 4AKHA 1EM6A 3PR3A 4KRYA 5HG0A 2BMAA 1RI4A 3L05A 3E6AA 5BNTA 1DAMA 4LNUA 4FU0A 3CVUA 1JH8A 1SVKA 4OXNA 4GHWA 4TMKA 2GDZA 1GTJ1 1TVMA 3V55A 1LU9A 1U9CA 3JD0A 3ZDCA 3VAAA 3RE1A 3PYMA 2CXQA 4QM7A 3IJEB 2ZXEA 3FE2A 5CVJA 4H1UA 4Z3KA 5F78A 1DAPA 2G70A 2QAGA 3N3BC 4HGNA 2PKQP 5AVWA 4Q01A 4HWRA 3CPEA 1TRKA 2TMYA 3V97A 4C9BA 4RHTA 1U0FA 1C7FA 1NY6A 5CB4F 2XCSB 1CY2A 1K98A 2EP7A 2HK7A 2NVUA 2WWVD 3X1JA 2P2NA 4HXYA 5CJPA 1X7ZB 1JR3D 3TSZA 4QJ3A 2Q29A 1ZA2A 4QOIA 3KQNA 3NC1C 2WG0A 4IH9A 1O3YA 1J24A 2ZIVB 2FMXA 2BFCB 1SAYA 5KNBH 3N58A 4M87A 1D4OA 2A9JA 1L1QA 5GOTA 3KQTA 2B0JA 1U28A 2JFYA 3DMHA 4J9VA 4UHJA 4YDQA 3ZOZA 5A7GA 1EFVA 4IIJB 2EC5A 4MDHA 3AOEC 3T99A 1KPIA 1ODCA 1YQEA 5J1TB 621PA 4GC9A 3PQCA 1Z9BA 2RMKA 2IODA 2VPPA 3B89A 5C5EA 2ZYDA 4WLOA 2FZVA 2VNJA 4MPPA 3FF4A 4DA7A 3LGAA 5AVZA 3S2UA 4HLQB 2PWPA 2AE2A 3PRKE 3FKJA 4MULA 5ARBA 2QORA 1V5WA 2GBPA 3KDSE 1DBVO 5FR1A 2HJWA 2BKXA 2B5WA 3HGTA 3H13A 1QLWA 2F64A 3ZU4A 2IXAA 4N0EA 3IKTA 2C2ZA 1Z4KA 3X0DA 1DAOA 4XTCS 4QDKA 1NNLA 2PLNA 4D41A 4MRNA 1YVRA 2FWAA 2QXUA 4LYJA 5C52B 5ENVA 1JR3A 4I8DA 1FSFA 2RGDA 1BGVA 3EXIB 3K32A 4RQBA 3V80A 4DV0B 1PX2A 4A8JB 3D5EA 5KYGA 4KLZA 4FBLA 3X1WA 5HF8A 4BCCA 5D5PA 4MUNA 1V3TA 2IUFA 1Q57A 3DF7A 4K0KB 1XKLA 2Z6QA 3EOAI 3RFXA 2OY0A 4R69A 3WYDA 1A5ZA 1OH7A 3P5BA 4TL6A 1ZJ6A 2QGZA 4FDLA 4ZCRA 1U2DC 2VHCA 4AQYB 1U8UA 4X00A 1CE8A 5CCDA 1NJ2A 4EHDA 5FPKA 3GUZA 4ZEVA 4MR8A 4HGZA 4FNAA 1ORWA 4POAA 2COEA 4CR6A 2VOEA 4MH0R 1V8ZA 1ATIA 2R8ZA 1GQ2A 2BMJA 4LJYA 2C8VA 4Y2QA 3U81A 1DPGA 1XWFA 4V3BA 2XHZA 3FHLA 2O1EA 3I8SA 3VHQA 4BECA 5J43A 4EG5A 1XPOA 4H3SA 2IHJA 5AXCA 1H2EA 1JR6A 4W5NA 5ALSA 2AC7A 2O8FA 1P4GA 4CN9A 1U2TA 2FX2A 1DAGA 4OF4A 3L6EA 2VP0A 3NI2A 1ZR2A 1J25A 4LYFA 1WQ3A 2G7ZA 3IMKA 3H83A 2QV7A 2KJQA 1VECA 3DFIA 4C14A 2IYSA 2OHFA 2BEVB 3PPIA 1BFDA 1RHUA 2AH5A 5CM8B 5B7QA 3MTJA 1JYEA 1TADA 3GRCA 2K6GA 4J1QA 1SR8A 4D0NA 2B36A 1IIRA 5BVHB 1G8JA 4MW6A 3O3MB 3F3SA 2V7XA 5A5FA 3EFHA 2AR0A 3IT2A 2WYIA 3JWGA 4OXXA 3O4GA 4YREA 1PVOA 2O19A 3LHSA 4HXFB 2VP2A 2Z1NA 2UZ1B 4OFXA 3KV3O 5EYPB 4ZT4A 3TLGA 4L2IA 4U3JB 2A3RA 1Z0JA 1AK9A 3AG5A 5AXBA 2R62A 3H3FA 5LYYA 3BJIC 4TXHA 3FPBA 5AUOB 2LZ0A 1DXHA 3ECCA 3DYVA 1S8FA 3ZBTA 3UH0A 3IESA 3F96A 2ZRKA 3KNZA 1HO3A 3H1FA 1C4KA 4D42A 3VH3A 2H9YA 1J70A 2CXHA 3B12A 3OZTA 4D80A 4ZT7A 3GPBA 3FETA 5F7OA 3QKWA 1I13A 2JNWA 1M1NA 3EG5A 3MUOA 4PR0A 2BLNA 4TZ6A 4AJIA 3E82A 1AKYA 3ELYA 3IQGX 4CMAA 4KPUB 5DWVA 3U40A 1M54A 3AQ4A 1YUNA 4RORA 3A0UA 1XLTC 2R86A 5B5SA 4UEJA 4I36A 5DX1A 5A05A 4CF6A 4O02B 3Q98A 4HDMA 1QIDA 2V7VA 3EYAA 1R16A 4FC7A 3TI7A 4EF4A 4BVLA 1EE1A 3PICA 5FOVA 2O7QA 3AUJB 3CG0A 4B3CA 4X1IA 2X2PA 3HU5A 2AFHB 8ATCA 3VGPA 4BHTA 1VHQA 3SKVA 5JANA 2Y0CA 3H9GA 2CVHA 3B60A 3IA2A 2CDCA 2PLFA 2BFBB 3W3AH 2VF5X 5LD2B 2WFLA 4FM9A 4YALA 3JVUA 2OAP1 1ABBA 1JILA 3TG8A 3HCCA 1TKRA 5DYWA 3TQTA 3CPJB 3ML1A 3OQHA 5CU7A 4DHWA 3OCVA 4PLWA 4D2IA 2GF0A 1CEEA 2A86A 3N70A 4RX1A 1S7GA 4IIBA 4EG0A 4ARIA 1S2IA 1BYUA 2FFBA 3GD7A 3FNHA 5JCJD 4ITUA 2G6TA 3O4FA 3U7RA 4MKIA 4IJKA 2HXYA 5DNWA 3UHFA 1Y9EA 2XWPA 3B7WA 2PDAA 4Q9HA 4FWTA 2BMDA 1E2PA 2ZJ6A 1YZFA 1KZ4A 2J31A 2OECA 4YJDA 1P4AA 2GH1A 3QBDA 4B3SB 3QNUA 2G1PA 1EBBA 4BVEA 1RPAA 5F1PA 1CJSA 3I3SR 3TR0A 3GEDA 1ADFA 5TLSA 2NOAA 4PBRA 4U2GA 2FA9A 5KKAA 3SMQA 1GGJA 4PNEA 3ZVMA 1DQNA 3P0RA 3AESB 1TGYA 1QHFA 3BXEA 3M6IA 4ICIA 3RS0A 2J5KA 3WV4A 3K16A 1R4ZA 2VPIA 6REQB 4UQLA 4LOLA 3ETDA 1QVRA 1RYMA 2H8KA 1U0NA 3ET5A 4D8VA 4YHHB 4QA9A 2WR8A 4D3ZA 2X0RA 1VHJA 1XF9A 4KYTA 2Y1GA 3OQIA 1DEXA 4TMZA 3OECA 4CR7A 2XV1A 1U7WA 1UDCA 1KI6A 4H6XA 4CV1A 5H1YA 1M2NA 1UINA 2XYRA 1ZI9A 3FR7A 4F04A 1BDMA 2G88A 1E99A 2WTXA 2WF9A 4IAOA 1H2YA 2PQ2A 4F5ZA 4X54A 4GOKA 2A9FA 2DPHA 1J2EA 3AUKA 1LX6A 4K86A 4ND8B 3JD2A 2ECQA 3PQ7A 3F9CA 3ZE8A 1XMVA 4GPBA 4YI3A 1W1IA 3A4LA 4G2NA 1V4NA 5FLEX 4HAVA 2GJSA 3PENA 3UAXA 4TWZA 4MVJG 2JIZD 4UQOA 3V6MA 1EGVB 2OO3A 4CVNA 1TEZA 5AKJA 4HTFB 4JVNA 2OHGA 3AP1A 1T26A 5BSVA 1BMFD 2X3FA 3CVXA 1IG3A 4FHDA 2YJ5A 1UWVA 5KU1A 1WXQA 2KM1A 3CM0A 2AOXA 2HI0A 1WO8A 3IV7A 1B8OA 1ES9A 3OWOA 1VI5A 5DYNA 3IEMA 1E69A 4Q6BA 2V7TA 5C37A 1XZLA 2BRUA 3SNKA 1UKAA 1ZI8A 1PT9A 3W8DA 1WCV1 3DLIA 3IQWA 3PNOA 2P2YA 4K9QA 1P17A 3U37A 1J0EA 3CNHA 2B4RO 4MUEA 2Y71A 2VP5A 1GG5A 1SCIA 1XZFA 1NVGA 4K9MA 5JO9A 3FNEA 1PS0A 3FZNA 3Q5GA 1OXVA 3CJTA 3DQQA 3F6PA 3IBYA 4O08A 3ZLBA 1NVMB 4QXQA 2QDXA 5KKNB 1NOKA 4M7OA 4LGYA 3RVKA 1VB3A 3OEWA 2P2ZA 3NHLA 3WZLA 4F92B 3HFSA 2B37A 1WVGA 1Z5UA 1PK8A 2GNPA 2JIZA 1YCHA 1F8YA 2J08A 3DBHB 3KSMA 4ONEA 3ZVRA 1NW8A 1SUIA 3LWDA 3FWPA 3DO5A 3PFFA 5LIRA 2XB4A 4B3XA 5SY6A 2VJAA 4Y2XA 5L6LB 1M75A 4YT4A 4NZ9A 2FJ0A 1R6UA 3I8OA 4A16A 2JKYA 2H3HA 5AKIA 3T5AA 2IE8A 4A0FA 2WG1A 2BGKA 5G3YA 1MIOB 3JSAA 1JIJA 5CLJA 2XUIA 1E4YA 1PV2A 1D2NA 4IV8A 1IULA 2AOWA 4HH1A 4N48A 5EKXA 2LCIA 3GNLA 2VJOA 1H1LB 4TV9F 3IEXA 2YV2A 1T4BA 5IDVA 3DT8A 4F45A 1XMOB 1Y8RA 1G8PA 4JJ6A 1LVUA 4R8SA 4QC2A 5D85A 2JH9A 1PGNA 4OP1A 5U1PA 3R9XB 3OCJA 2C57A 2IYTA 2VN8A 4F6LA 3HLYA 1P72A 5HIKA 1TAUA 4DIBA 3MCAA 4EITA 4MV8A 1PW5A 3CCBA 4OLAA 2YCLA 3K5IA 2E4WA 5T8KC 4DRZA 2BH2A 1D8AA 4LPKA 1R6BX 5JZSA 2Y4NA 1Q3HA 2DOKA 2JLUA 4CKWB 1XF1A 4RCYA 1XVLA 5B37A 1GKUB 2GMWA 3ZR4B 2PBLA 3JAWA 3GBSA 3D4NA 3OBIA 5DNAA 1P1HA 4BJ6A 4CBVA 3E3AA 1ZH4A 3M7IA 1QYVA 2VG8A 4EVQA 3UV7A 3D4BA 2UYCA 4DC0A 2HEGA 4R8MA 4X65B 1DCFA 2FPOA 1SULA 5COBA 3NDJA 1UKZA 4AWBA 2PRIA 4R2JA 1XA4A 1BJRE 1XMXA 2CZQA 3A2NA 4LGVA 4MAMA 4MS4B 4XD7A 1OI3A 5ANRB 4HJXA 4YWHA 1XTRA 2BM0A 5CH3A 2I6GA 5FJIA 4ZCPA 1BS9A 3F7MA 2PX6A 4ZK2A 4MVXA 3GYGA 1KIMA 5FNZA 5T3UA 3VISA 1NJ1A 4ITVA 1XELA 4NYIQ 1D1TA 2XDQB 1XSEA 2Q5JA 4ZC8A 4MQ5A 3MJVA 5CR9A 4DXDA 1Y1TA 1JA0A 4QGGA 4W7IA 1ZJ4A 3ITKA 3TM5A 3IUQA 4PZEA 1DP4A 4C3VA 5KJCA 1QTNA 2F2TA 3QHQA 1M6YA 1T2DA 1W88A 1TU3A 1LW6E 2UVPA 2VJPA 2ZSJA 2OHIA 3H5OA 3OQPA 3AW8A 3QEOA 4LFCB 1G6Q1 1M0SA 1MDBA 4II2A 1AQJA 3MTGA 3SSAA 4DCTA 4DLXA 1CB7A 4RIFA 1G3IA 1PG2A 2VDRB 3SQDA 3GJYA 3SYMA 5IRCD 3DL0A 4DY4A 1XDZA 3N53A 3SF0A 1WXFA 1R4NA 4B8WA 2J45A 1DWPA 1TVCA 3JY6A 3K92A 4CMIA