2F7SA

The crystal structure of human rab27b bound to gdp
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
186
structure length
179
Chain Sequence
DYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-27B
publication title The crystal structure of human Rab27b
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 51
structure length 179
sequence length 186
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2f7sA00
1H8HA 3VMFA 3O8CA 5J5CA 1GOTA 5DNYB 1II9A 2ZJ5A 2P5TB 3RABA 3ZIAD 2FOLA 3CPEA 1G41A 2OBMA 1E3MA 4OJQA 3DDCA 1WBDA 2CLDX 2WPDA 2CK3D 5L3SB 2JAQA 1W4RA 1TMKA 4FW9A 1AZTA 1XTJA 3KJEA 3VTKA 2GZHA 2OBLA 3LA6A 1AZSC 1UKYA 2Q3MA 5EZ6B 4B6FA 2HDNB 4YMVA 2GDJA 1FTNA 3HR7A 3IGFA 4A2WA 5F3WB 5JWRA 4ZI3A 3G82C 1OXSC 5KDOA 1G6OA 4BLOA 1CRPA 4W9MC 1G19A 2JLVA 1Z06A 3B2EA 1XMSA 4XVRA 3A1TA 1D6JA 2QPOA 3PR1A 3NVAA 3WBJA 4YXWA 3THWB 1ZP6A 4Q19A 3O8RA 2YOFA 1VYVA 2PLFA 4BZPA 4DLUA 221PA 5LDDC 5B30A 3AF1A 1HE1C 4NZYA 4DT1A 4LV6A 3AV0B 3C5HA 5JHGB 5JFGA 3IBGA 1DARA 2GNOA 2PL3A 5BWMA 1XX6A 1LS1A 5KDLA 4G5GA 3NKVA 3MG9A 1R4AA 2GJSA 2HV8A 4RKFA 2VP6A 1WA5A 4A8JA 2CNWA 2IYTA 3WNDA 1UBCA 5LD2B 2W58A 1GZSA 4FWIB 2Q0HA 1QHHA 2CCGA 3ADDA 1T8UA 2KI5A 3CX6A 2CE2X 2BV3A 1E99A 3B1YA 4G5OA 4IRUB 1W1WA 4HAVA 2VP4A 5CM8B 4OQMA 4NU0A 3U3JA 4MRVA 1IQPA 2RAPA 3QPVA 4URYR 4NMMA 4QBFA 1K5DA 3M6AA 3AKDA 2HXYA 1KMHB 1TX4B 4C0KA 3B60A 1GITA 2AFHE 4ERNA 1XPOA 2P3SA 2R6GA 1TAGA 1VG8A 2JATA 4DDUA 3CR8A 2ZJ8A 1G3UA 4G01B 1W49A 2JA1A 4A6PA 5FL3A 4WBSA 3HU2A 4OK5A 1HH4A 4OQFA 4F4IA 2GHIA 2W6JD 2J5XA 4HB3A 2YYZA 2IYZA 2J46A 3TSWA 1ZD9A 1A4RA 3M4YA 2KBEA 4OJKA 1KHTA 5LBIA 1H8EA 2ATVA 4EJSB 5JBQA 2BIFA 2A78A 4DKXA 1IAQA 1L2TA 2QTFA 3P20A 2H1LA 4M4SA 3BORA 3AUXA 3UXMA 1P9WA 2C8VA 3T5DA 3B5JA 4UXHA 1A7JA 3CRVA 4IHQA 3B1ZA 4EQ6A 4F93B 3IQXA 2GJ8A 4ZKEA 1WMSA 5JWOA 3W90A 2ZM5A 3KFVA 2XAUA 3T1QA 5FOUA 1KDTA 4AWXA 1W5SA 5JHHB 4LGMA 1BS1A 2FA9A 2PZFA 3FFBA 4OL0A 4NYIR 3PUXA 1NP6A 1KI7A 2FPLA 3U6BA 1NMXA 4B3FX 2FEMA 3AEZA 1JR3A 4B3BA 4ZDJA 3VKGA 1TQ2A 2R9VA 1CLUA 3FWYA 4XTRA 1S3SA 3VR1A 2EFEB 3KKMA 1R5OA 1RRFA 3O8DA 5FBWB 2C2HA 2RGXA 4BZQA 4LHZA 2JGNA 4AIIA 1UBFA 3H0KA 5SZJA 1KDOA 1U0HC 5KDDA 3Q72A 2AXNA 4ESVA 3EC2A 4BFXA 4R2HA 4JJKA 3EARA 5HKKD 5EQTA 1W7AA 2CHGA 2O5VA 3I4LA 4BEBA 2FGJA 1I4TD 1XZQA 3DM9B 4FI3C 3SBDA 4DLZA 1UEJA 1L4UA 3EASA 1OF1A 3I61A 2ZIAA 1II8B 3LQQA 4DCUA 1U81A 4GOXA 4LJ8A 1GNRA 1T4GA 2ZJAA 4BLTA 4DT1B 1BMFD 2X77A 3EZ2A 4Q1BA 2YVUA 1SKYE 3QF7A 2WMOB 2H8KA 2YC2C 2R6CA 2B8TA 4PR0A 1OXVA 1S3GA 4TMXA 2HCJB 4A8JB 4KLZA 5CYOA 1S9DA 2OXRA 4PO8A 4DDTA 1AQYA 1DAIA 2D2EA 4XWOA 1KY3A 1QHHB 3K9LA 4KSBA 4WIAA 3NC1C 3DL0A 2K5UA 3A4MA 2G0TA 2BEKA 2PT7A 3Q8XB 3IHLA 5LD2C 3ZZ0A 2WKQA 4KLNA 3LAWA 4DLTA 3VKHA 4ZDIA 1A5TA 2ANCA 3AUYA 2ZSAA 5LPNA 1G3IA 4NONA 1X6VA 4BFVA 1SVMA 1XWIA 1JQJC 1PUIA 2QN6A 1UBEA 2WICA 4HZUA 4M2LA 1S1CA 3K8YA 1BYUA 1G9XA 1Q44A 3CWZA 2QP9X 1VDZA 2JLYA 5FUWA 3BB4A 4KYUA 1KNQA 4JIMA 2WOJA 5EXXA 2H18A 1K6MA 2ZEJA 2O8DB 1CBUA 3QUSA 4DBLC 1NY6A 1ELOA 5IF9A 5IK2D 1W4CA 1AKYA 2N42A 4Z8XA 4JLOA 4KHZA 3LXXA 3GLHA 2V55B 1U9IA 1Z2AA 2ERYA 5TVKA 2WWXA 2A5DA 1DAFA 1YZKA 1NF3A 3AF3A 4JVMA 4QC2A 4EQ6B 4EFLA 4JBXA 4BLPA 3OEEA 4ZV4A 4LV8B 1F3OA 4YMUA 1XTQA 4Q1FA 3ZVNA 1WB9A 4TYNA 3N5CA 2IYYA 4DJTA 4PX9A 4B47A 1MOZA 2WMNB 3WY9A 4B3CA 4AYWA 2VRWA 3RS5A 3N2IA 3K9GA 4G3XA 4RZUA 3X2SA 3QE0A 2ZSBA 4B35A 1QZXA 3AKCA 2IYUA 3AVOA 3LLUA 3PG5A 4H1VA 4URVR 3SBEA 1CR0A 1KO4A 1NNEA 4GBMA 1KO8A 2OCYC 3SI7A 3QEJA 2VEDA 4OHXA 4ZIRA 3AM1A 4HLDA 2E87A 1C1YA 1YZGA 1X3SA 1ZW6A 1AN0A 1N5JA 5DIFA 4HYYA 5EZ5A 3ZJYA 2HT1A 2ORWA 3EWAA 3RVBA 3TK1A 1L7VC 1NSFA 4M53A 2ZAMA 1JI0A 4PQFA 4DSTA 4L4UA 3LFUA 2F3RA 3ICQB 5G41A 1EFHA 4MA4A 1RYHA 2FV8A 3FKSD 2J7KA 4AYTA 2WSSD 4V0MA 5D3MA 5TXGA 1GL7A 4HDCA 4A9AA 2FSIA 3VU9A 5BW8A 2VHQA 3B7GA 5KNCA 3SFVA 2NGRA 2GZAA 5KUTA 3KQLA 3VQTA 4BE7B 4JVNA 4DUGD 1E2NA 4KYIB 1Q22A 1M1YE 1SVKA 2ORIA 1R0WA 2VHTA 1KZGB 1UKVY 2WKPA 4HAYA 1P61B 1VG0B 2IA5A 2PCLA 4EPVA 4YDSA 2YWFA 2YJTD 5JI3E 3CPHA 1RYFA 2JJ1A 3IBYA 3C4JA 3MAAC 3K0FA 2ERXA 4A8JC 1CJUC 3BERA 1NIJA 1ZINA 4Z8YA 2FX3A 1KTVA 2QPTA 3BS4A 2ZANA 4LSGA 4JBYA 3TIFA 2C95A 1T0JB 3GJ0A 3BD9A 3VNVA 3OZXA 2GJKA 5JEEA 1QHSA 1FNMA 1QHXA 3TLXA 3K70D 3L0OA 3RSLA 4HAUA 4BASA 3L8ZA 1ZC4A 1K5GA 1T5IA 2ZJYA 2IT1A 1PVOA 2HXSA 1SXJA 3WYAA 2CXXA 2FWRA 4N3NA 5FTLA 3GJ8A 2NG1A 2B8WA 3L0SA 5A4JA 3I3SR 2OV2A 2JLRA 3CNNA 3PJRA 1FTSA 2IYXA 1O87A 3QKTA 4ZCMA 1E9FA 5FTJA 1JEDA 2ZROA 2GK7A 4RFSA 1LV7A 3TVDA 2RGEA 1ZNXA 3IILA 5E7IA 2OZEA 3VFDA 2JLXA 2ZRMA 1AGRA 1JBKA 5LB4A 4RKEA 4Q4JA 3U7GA 3GD7A 1YR7A 1W5TA 1NJGA 5J40A 4BLSA 2NTYC 1TQ4A 2QQEA 1U8YA 1D9ZA 4G5QA 1ZNZA 4FIDA 4B3XA 2VYFA 5KSYA 1AA9A 1Z0JA 2IYQA 3QXHA 3PV0A 5B2ZA 4MDFA 1E9DA 1IM2A 1DPFA 4OI2A 2ZJOA 4D81A 3EPJA 1P2VA 2GAOA 5IDVA 5UKDA 3CONA 3I32A 2IUUA 2NO7A 4FMDF 4ZIRB 4IDOA 4YC7A 1EWQA 5EP3A 1I4LD 2QROA 4QRHA 1E1RA 2GK6A 2ODBA 2WJGA 4Q1AA 3Q9LA 2IS6A 1XNJA 2PX3A 1AS0A 3B82A 5KTYA 3AVTA 5FOVA 4URZR 4C0QC 3GEHA 1OW3B 1KO5A 4CT4B 1GRQA 2A7QA 2JIZA 2AKYA 3TR0A 4GI7A 3A4LA 1JPNA 1N6LA 2YINC 4F4JA 3BAFA 2DHRA 2QAGB 2GESA 4B43A 3EWSA 5EP1A 1NY5A 5D3MB 5JEDA 3TJZA 2Q9BA 3GEEA 3OAAA 2EW1A 3VR6A 1LS6A 1YVDA 4IOKA 4TMZA 4E09A 2OCBA 3TE6A 1R0YA 5FPYA 2GBLA 3DVLA 4AY2A 1RE0A 3LLMA 3KFXA 2LKDA 1J90A 4K81B 2GTPA 4Q02A 2ZI5A 3K53A 4N0DA 1IBRA 1VIYA 4W5HA 1E2FA 2AK3A 5TDHA 4Q1CA 4B71A 1OKKA 4QHTA 3DMDA 5AJWA 1YR8A 3EIHA 2IEZA 1W47A 3L8YA 2WWGA 4OHYA 3Q7PA 1IJEA 1DEKA 1OIWA 1TADA 2Z0MA 2AX4A 2KJQA 3KKOA 4MUBA 1WDTA 4HB0A 3RSOA 4BECA 2G0NA 3GQBA 4LJ7A 4PXAA 3TH5A 2VP0A 4A2QA 1JAHA 1G7TA 1QDEA 3H84A 4QL3A 3RS7A 2AWNA 1DAKA 4B3DA 1YR9A 1MKYA 1JALA 1W0JA 4KVGA 4OI4A 1F60A 3WXMA 1V43A 1VPLA 1FP7A 4TL9A 5JJLA 3LY5A 4QOSA 1GM5A 3Q5DA 5JZVA 3TGPA 2FPKA 1SXJB 4DLXA 3PUWA 1P3JA 1Z0AA 5FL7D 1G8HA 3DMNA 1OV4A 2MMGA 2VL7A 3T35A 5KHOC 1OYYA 2V54A 4GMXA 1GKUB 4RFSB 3KZ1E 4X8OA 3B85A 3FGNA 1DO0A 1Q1EA 2WJVA 1SVIA 4C0HA 2E1RA 4A92A 2IYWA 2WJJA 4LX0A 4LJ6A 1N6PA 1U9IC 1TQDA 4Q4JB 5E7MA 3IIMA 4JSTA 2W0SA 4MGIR 4V02A 2CE7A 2OE2A 3MWKA 1U0LA 1XMJA 3N2EA 1JR3E 5FBQB 1KZ7B 5B58C 1UF9A 2NZ8A 3WMEA 2RH5A 4LJAA 1CTQA 4V0LA 1OJLA 1A2BA 3TNFA 2ZVQX 4TWZA 1Z0IA 3IPXA 4JMPA 4ON9A 2REOA 5KNDA 3SZRA 2PMKA 2G77B 1XZPA 4LUCA 4A0GA 4LWZA 4FCTA 1G17A 3TMKA 2O8BA 4KCGA 4C7OA 4UNSA 3VHLB 2V3CC 1QVAA 2HJGA 2NOAA 4AYXA 4ZDWA 5ELXA 4PQYA 1F48A 1CP2A 4EKDA 5F9HA 4QFMA 1NLZA 1P75A 4PZLA 1KI9A 3GFPA 2FU5C 5L3SA 2VTKA 4DCTA 2Q9AA 1AGPA 2OT3B 4IDQA 1OH6A 2QSYA 4TT3A 5GJBA 4EPYA 3A37A 1ZU5A 2ZU6A 4KFUA 2WSMA 4GZLA 4KSCA 4R71A 1GRNA 2J45A 2ZE6A 2PZGA 4RD4A 2DFKB 4I81A 4PAMA 5FTKA 3SNHA 4B32A 5JSZB 2D06A 4RZ3A 1W4BA 3EG5A 5HZHA 2QY9A 2ZRJA 2QRNA 1II0A 4Z1MA 1Q0UA 2GXUA 2RCNA 4KI0A 3TSZA 1FMJA 4NCHA 4IVPA 1GFIA 3PEYA 4GNKA 5CB6A 4TLBA 1XTIA 4IDNA 2ASEA 4S35A 4OI1A 1CF4A 1P4SA 3THWA 4Q9HA 2GXAA 1CXZA 4TLEA 4B6EA 2OHFA 2A3RA 3Q5EA 5HZKA 3X1XA 1WQ1R 1COWD 5FPTA 3UKDA 3WYGA 3D31A 5EXPA 4W5JA 1GILA 1D2EA 2WJIA 3ZH9B 1KOFA 2ZRFA 2JDID 4RCZA 4KITB 5AJVB 4LBVA 1B23P 3R8FA 3ZQ6A 4DEXA 2ZYTX 3JZAA 5AUOB 4BLQA 4FINA 1K8RA 4N1AA 4H1UA 4ZKDA 3KJHA 4B75A 1TQ6A 2QE7A 4RY2A 5SZHB 1PZNA 1QF9A 3A4NA 3BWDD 3CX8A 3IIKA 4EIWA 4FWTA 2QEQA 1TF7A 2D7CA 1GKYA 4LJ5A 3RANA 3QKRB 3VR4A 4B34A 4NYMQ 1DO2A 3GEIA 1E79D 1E4YA 2QGZA 3B6EA 4K8OA 2BCGY 3ASZA 1Z2CA 2ODEA 3PEUA 5AUQA 2J1LA 3UWKA 4Q7JB 3REFA 2XZOA 2YV5A 1JXMA 2QORA 3KUCA 4L15A 1GP2A 4QJ4A 3C14C 3NBZC 5EP2A 1SXJC 4IOJA 4TQAA 4D0GA 1PUJA 4NL4H 3RRNA 1WRBA 3TW4A 1KI1A 2ZI4A 1TEXA 4D6PA 1P7CA 3CUEF 2OBNA 4DZZA 4Q48A 4JL5A 4LYJA 2QZ4A 3TBKA 3QG5A 4N0EA 5CK4A 1UM8A 1HQCA 1MO5A 1FZQA 3WRYC 2PJRA 1IOZA 4TMVA 4TSFD 5GJVC 3DZDA 2QTVB 1U2RA 1W36C 4A15A 2P5SA 2ONKA 3BFVA 3K9HA 3OEHA 3W5IA 4LHXA 4NYJQ 1DG1G 1N6HA 1ZRHA 2FNAA 2O8BB 2V7QD 1KSFX 1XCGB 1E2QA 5C18A 4C7OB 2MSDB 5KPDA 4DIEA 4BFTA 4PC2A 3BH6A 1ZAKA 4I1OA 1E2EA 3DO6A 5JMTA 5H8WA 3F5FA 2ATXA 4V0ME 4AI6A 2HT6A 1NRJB 1KO7A 1T5LA 4PC1A 4LHWA 4Q5IA 1G8YA 1ZCAA 1ZM3A 4ZPXA 1E2KA 1PLKA 1XJCA 2V8OA 4Q00A 2BBSA 3OIUA 2WZQA 1G7CA 4WOPA 1M7BA 4QM6A 2G1KA 3ADKA 2J0VA 1W44A 2AN9A 1BOFA 3JZMA 2FE4A 3GMTA 3U3MA 4ACBA 3CM0A 5GVSA 1NVVQ 3TAUA 3QY0A 5CLLA 3A1WA 4D4LA 3T1VA 4W5WA 4BLRA 4FMCF 4DWJA 1E2IA 4NBSA 2FSFA 2VH5R 1F6BA 1II8A 2WAXA 4KBGA 2QQ0A 4MYTA 1FUUA 4XD7A 2OFXA 4PANA 4X8MA 1ONBA 2GBLC 1EGAA 1GNQA 3RNLA 4GL2A 4KVAA 1AJEA 1KJZA 2QG6A 2ZS8A 3RS3A 1E2GA 1SHKA 2D4HA 3VNUA 4HB2A 4BPBA 1S1MA 2DFNA 5JWHA 2WIAA 3SC3A 3MJRA 4LBZA 3HYRA 1JR3D 4NE2A 4ZCLA 3AVUA 1DELA 1F2UB 2CL6X 3SJBA 4WZ6A 4D80A 4U5XA 4PZYA 4GRAA 4Q9KA 5EP4A 3VKWA 2NZJA 3O8BA 2DBYA 1P73A 1SXJE 3BIFA 3ONWA 3ZQJA 3UPUA 2HLDA 1J70A 1EFUA 4EFNA 5FH9A 1TUEA 2ZI9A 1DS6A 1GKIA 2JASA 3SQWA 5F9FA 2A9KA 4GZMA 2QMOA 2O8FA 1QG2A 5G3ZA 1ZC3A 3HDTA 4TMTA 4IDHA 4LJYA 3U7EB 1W46A 3X1DA 1KI4A 5HCNA 3SHWA 3I5XA 1DAEA 2W2VA 1G16A 2LKCA 4FD2A 4NCJA 4JLVA 2W6ID 3ZZUA 1SVWA 2ZU0C 3C7KA 4G5SA 2A5GA 4NHOA 4POAA 4HEJA 1NVWQ 1A82A 2CVFA 5CB8A 5EE5B 5GVRA 2IWHA 3U7HB 1OIXA 2QT0A 3PUZA 1KSGA 3V4FA 1E9BA 5HE8A 2UZIR 2JLUA 5BQ5A 4DCSA 1NLYA 4JLKA 4A0RA 2GVZC 3TQCA 4LK2A 1W0KD 3TAHA 3BB3A 3MMPA 4DLRA 2WJHA 1IN5A 1VTKA 4X8LA 4BFSA 1XD9A 3P27A 2NO1A 3A1UA 2PH1A 2F7SA 2ZI7A 4TMKA 4RJLA 1RRCA 1FPMA 5AJZA 4KFTA 4O0MA 5EE0A 4LY6A 3EZ7A 1FNNA 4Q4AA 3A1VA 4AKHA 3I1FA 4C9BA 2WBLC 4HDQB 2REXB 1JJVA 4YMWA 2R2AA 2Y8EA 3F3YA 3EPLA 4G0NA 4PTLA 2RGBA 4A4DA 3ZS8A 4Q7KA 3LQRA 1ZVQA 3WMGA 1GL9B 3OE7D 2H16A 1HT1E 4HLUA 1G8FA 1G5RA 1MRSA 1Q1QA 4KU4A 4B2IA 2C04A 1LNZA 4D0LB 1OIVA 2WWWA 2GWHA 2RGGA 1R5BA 2QPAA 2ZRAA 4PHFA 3MCAA 5J4LA 1AM4D 2BEJA 4OHVA 2HYIC 4PAQA 1LF0A 1XF9A 1E1QD 3AF0A 2CLCX 2WV9A 1JQLB 2PMDA 1W2HA 3C41J 3OEED 3OF5A 1Q12A 1IXZA 4ACAA 2REBA 5AR1A 2EFCB 3CO5A 5FUVA 1ZUNB 3CWQA 1ZMXA 4B2PA 4U7DA 3W8NA 3U5ZB 1KAOA 1E96A 2KB0A 3B78A 5CYPA 2IHBA 4IXNA 4O2LA 2OILA 2EFDB 3R7WA 1HTWA 4X8HA 4TYQA 1TPZA 4TTRA 2CHQA 2L0XA 4YLGA 1NN3A 1N6NA 2CDNA 1E0JA 4QM7A 2A5YB 2F6RA 3W34A 4ABYA 4M21A 2DB3A 3DM5A 1CR2A 1KNXA 4QG7A 2IF2A 5FOTA 4MRNA 821PA 4I1VA 2W6JA 1XRJA 4MDEA 4Q1DA 3IDQA 2OESA 2BBTA 1KSJA 4FMBB 2ZE5A 4HAXA 5FPHA 1ESNA 3KB2A 2O8FB 1YKSA 2JJ2A 5JI2E 3SYLA 1RFLA 1P6XA 4L8GA 1R0XA 4M1KA 1XCMA 3B1XA 5FR2A 3LH5A 2BWJA 2GCPA 4KFSA 5DN6D 3CW2A 1G20E 2JEOA 3MLEA 1R7RA 4O25A 2CCKA 3GP8A 3GJ7A 1UAAA 4M1WA 1TU3A 2XJ9A 4R7ZA 2D7DA 3E5HA 3EIQA 2VP5A 2X19A 3CB4A 3HPQA 3RS0A 1OHHD 2F9LA 2IEYA 3QVUA 1E2PA 2G3YA 5BN4A 2RGNA 4PHTA 3LW7A 4EJSC 2XTMA 3ETLA 4PPQA 3ND8A 1B0UA 1M2OB 2AK2A 1KDRA 5FBRB 3THXA 4WA7A 5CIQA 2FSGA 1NMYA 2XOKD 4A0FA 2ODNA 3C15C 3QVVA 4OQXA 3U44A 4Q4AB 4FMCB 4IOLA 3KKQA 3QENA 4PC6A 3FMOB 2ZYVX 4TMWA 4CDGA 2ZR7A 3PITA 4DC9A 4WXRA 2TMKA 2YWEA 1MH1A 1NKTA 2VO1A 5HKKA 2ZRNA 1OYWA 3A58B 2PLRA 5A5GA 2FH5B 3LWNA 4O3MA 2GCOB 2OFWA 3LNCA 5FUXA 3SYKA 3MSXA 1BMFA 3SS8A 1ZM4A 1G5TA 1CR1A 4BFUA 4PHGA 3BFKA 4TLAA 1J2JA 5H1YA 3IO3A 4ILEA 4QGAA 4BFYA 2QNRA 1VHLA 2QAGA 5G3YA 1XB2A 1CEEA 2B21A 2ZSEA 4AURA 121PA 4HI0E 4MGYR 1G64A 1S9HA 1VIAA 2VLIA 2IYLD 1E0SA 4AG6A 4NCNA 5KYKA 2O0JA 1W36D 1I2DA 4C2UA 5DI9A 1N2CE 4EPTA 1E9AA 1UBGA 3C5CA 3CKLA 4IEIA 4JT4A 3R7WB 1KIMA 4TTPA 3QPUA 3DKVA 3CX7A 2NQ2C 2ZUBA 3KXLA 3TR5A 3AKEA 1IXRC 4EDHA 3FHOA 1LVGA 4TLDA 2R62A 4U02A 1E1RD 2FFHA 4AD8A 1UADA 3QKUA 1CULC 3T5GA 2ECKA 3CF0A 1XXHA 3Q7QA 4M1YA 4OQNA 5GJWC 5FFMA 1Q1BA 5KSZA 2CHVA 3LBIA 2J87A 4GOJA 5FBVB 2PX0A 1N25A 5DGXA 1EXMA 1P60A 2JIZD 1Z08A 3EZ6A 4CT5A 3SJAA 2B7CA 1DBSA 1QHNA 4Q4HA 4DSNA 3LVQE 1QHGA 1P9RA 1N6OA 3PCRB 5F2EA 1Z6GA 1R10A 3CNOA 1S2MA 3OAAD 4US0R 3BXZA 1YU9A 4M1OA 2SHKA 3FYHA 3HR8A 4GSYA 4C4PA 3ZDQA 2KE5A 5AUPB 2R65A 2P0EA 1G8GA 2J7PA 3L82B 4B74A 4AK9A 2WWFA 3A6PC 1XD2A 2IXEA 4PSVA 3GLGA 4P33A 1JNYA 1OKKD 4KODA 4PSAA 5AJYA 1P2SA 4PHHA 3TQFA 3RC8A 2QP4A 3QG1A 3T34A 5K8IA 2ZE8A 2AD5A 5CJ2A 5BYJA 1XJ0A 4JVLA 2XX3A 3QXJA 4DDVA 4XJXA 1RRGA 5KSOA 3GJ4A 3CZPA 4YMSA 3FMIA 4US2R 3THXB 4XVQA 5CIWA 1M74A 3U44B 4UNNA 2IBMA 3KKPA 5BN3A 4G5RA 1VKJA 2R8RA 3U3KA 1SQ5A 1GTVA 2FN4A 3T12A 2OLJA 2AD1A 3KKNA 1XEFA 3M1IA 4JLMA 1GUAA 4Q4LA 3LXRA 5GJCA 4AKIA 2HF9A 2ZQ5A 1F5NA 3BC1A 3FKSA 3OFNA 5P21A 3SU8A 1OLOA 4KV9A 1MV5A 4BUJA 2ZAOA 3LDAA 4Q21A 1E94E 1XMIA 2VP9A 3DEFA 2F55A 5BXQC 1TF2A 4TZ0A 1EK0A 4P4TA 4XTCS 1FQKA 2WOOA 3UIEA 4TL8A 5HPYB 2HCBA 1GNPA 4HLUC 2ZXUA 3I92A 4Q9JA 1GDDA 1R6BX 5E3HA 1VMAA 4Q7LA 1KJWA 6Q21A 1WF3A 4Y0VA 1RW4A 4C30A 4PPNA 5DYIA 5KSPA 4NH0A 5CDFA 2FGKA 5HCIA 3UK6A 2AR7A 5JSZA 1NN5A 4I99A 3MD0A 1OT3A 4RD6A 2IYRA 1P5ZB 1ZM2A 3BB1A 621PA 4NCIA 3HWSA 1Z22A 1I4DD 4WZBE 3WNBA 4ASUA 1EESA 4TQ9A 3LBNA 3A1SA 3GCGA 3QIAA 4PFSA 4JLBA 1M8PA 2AFIE 3CRQA 3DOEA 2XNSA 1ZUIA 2J9RA 4RZ2A 4YMTA 3CPJB 4OHWA 4TL6A 4LOAA 1DOAA 2ZRHA 3U61B 2BHRA 3NH6A 2IX3A 2WWYA 4JBWA 3W8RA 1X1RA 2O8EA 2OAP1 1XXHB 1ZCBA 1RC8A 1J7KA 3NTUA 4DEYA 2ORVA 1G291 2QU8A 3SJCA 1RJ9A 5FR1A 1N6RA 4OK6A 1NL3A 5FOSA 4KO8A 3EPKA 2H5EA 1Z07A 2HYDA 2GAAA 2HJVA 2ZI6A 4Q4HB 2V4ZA 3F0TA 5E4FA 4IKEA 2F1HA 2Q21A 4IVRA 1KI6B 4JZKA 1Q1ZA 3JVUA 1BO6A 5KPJA 2J0UA 4C0JA 2RGAA 2IW3A 3ZD7A 1FFHA 4JLPA 3ADBA 3QKRA 4I1UA 4BRWA 4Z1MD 3Q3JB 2P2LA 4M9XA 1XFAA 2FFQA 1KI8A 5DI3B 5HTKA 1DAMA 1XBTA 1MABA 2GF0A 1OXUA 1D2MA 2AXPA 2ZYWX 3HPRA 1EFRA 3MWYW 4M1TA 1R8SA 2IWRA 1XD2B 1ZBDA 1AQUA 4MYHA 4MYUA 3GLGB 5D3QA 5DLQC 1YZLA 1D5CA 2BVNA 1CJVC 1G21E 2G1JA 2NO9A 4LCBA 4LZZA 4F91B 2CVHA 3X1YA 3FE2A 2RGNC 1E0AA 3LD9A 4F4CA 2I3BA 1US8B 1EX7A 2PEYA 3L0PA 3R20A 4B3GA 1X8KA 3R9XA 5DH9A 2QRZA 2Q9CA 2V1XA 4KAXA 3TVTA 4JLJA 1X8LA 1HYQA 4KFRA 1NKSA 4TL7A 4ZCIA 1IY0A 2RHDA 2P67A 1CS4C 1JECA 2WM9B 3HU3A 2GF9A 4JL8A 4QBGB 721PA 3THYA 4FXPA 1AS2A 2ODWA 3P26A 1SVLA 3I62A 3BJIC 2XNDA 1KKMA 1FP6A 3AP3A 3U6KA 4C2TA 2JCSA 1G7RA 3P4YA 2NIPA 2VQSA 4M1SA 2XSZD 4D2IA 5E7JA 3NBFA 2IC5A 3ASYA 3MUFA 4UKDA 5FBLB 4CVNA 1J99A 2P6RA 2QM8A 4WW0A 3RC3A 2WTUA 4LJ4A 4IJMA 2JLSA 3K0CA 1XEXA 3D6TB 4LI0A 2YC4C 5EXSA 3U4QA 1N0VC 4Q9LA 2V6IA 1IXSB 2EU8A 2G83A 4RVCA 1N3BA 3P32A 3KQUA 1CR4A 2J59A 2NO0A 4LPSA 3QXCA 4Q47A 3B9PA 1CJTC 2A30A 3WP0A 2D62A 2ZRDA 4Q9IA 1OXXK 2IYVA 4R9UC 1BIFA 1PJRA 2QAGC 4URWR 1Z28A 4NP6A 2CL0X 4EPRA 1HEIA 5BN5A 4AC9A 4MRRA 1KO1A 2IYSA 1P62B 2F1JA 2FEOA 2VA8A 3E2IA 1YZNA 4OK3A 3V9PA 4NYMR 3NEYA 3KDSE 4HLCA 2XTNA 1H8HD 1OH8A 4BGDA 3TUZC 5IRCD 3B8HA 3K70B 5K8UA 2O8EB 1XU4A 4A1FA 3ZZTA 3ZVLA 4PQRA 3SHFA 1G4UR 4LC0A 4MGKR 4TQUS 3T1OA 5B64A 1Z3IX 5M04A 2ZS9A 3ZLJA 1RJ9B 2IUTA 3DHWC 2Z5FA 4D26A 2WPDD 3NBYC 3BBPA 1G3RA 2WHXA 1GIAA 1Z5ZA 2AHOA 1YZQA 1T3SA 4TLCA 2Z83A 2OAQ1 1F2UA 4C0BA 4ZI2A 1ETUA 3GFOA 3GJ5A 1E2JA 2QI9C 3FTQA 1YJ5A 4A6XA 4DSUA 8OHMA 2AWOA 2C96A 4RCYA 2BBOA 2J0UB 4W7SA 1CJKC 3D7MA 2PZEA 3QXXA 3DZ8A 5FI1B 4E03A 1E2LA 2MMCA 4QBHA 2KSQA 1E9CA 1PLJA 3P4XA 3RWOA 3BH0A 1MABB 2ZTSA 2C98A 4G1UC 4V0NA 4YXWD 2IS2A 1OB2A 4XVUA 2D3WA 3AF4A 1TEVA 1MR3F 4UXJA 2ZRKA 4XD7D 2J0SA 4MKGA 3K0EA 5JRZA 2GA8A 3PUVA 2PT5A 1E32A 2ZR0A 3VR2A 1BH2A 2Q3FA 4ARZA 2YOHA 4HLQB 2CNWD 1E2MA 2GEVA 1MO3A 2ZE7A 5J47A 3NH9A 2VBCA 4GOKA 3SFZA 3T15A 3AVVA 4MYCA 3DPUA 3GLFA 2RGCA 4QGFA 5HE9A 1AK2A 1FL9A 1T9HA 2WIBA 4Q18A 3NHBA 4LBYA 4NKRA 2JLQA 4ITRC 1NVXQ 2P65A 2QMHA 4HATA 3TRFA 4GDFA 3IO5A 4M9QA 1XP8A 1RPZA 3THYB 1NVVR 4B33A 1QHIA 2HLDD 4BZXA 2X1VA 2YNMA 3K09A 4C0SA 4C0LA 4Q03A 3ZVMA 2CLSA 1X1SA 5AK0A 5C4MA 1YQTA 3FB4A 4P4SA 2C9YA 2R6DA 2FPMA 3AB3A 3CRRA 5CK5A 1AKEA 2MSEB 1DE0A 2XGJA 1XEXB 2W2TA 1U94A 3CF6R 3D8BA 5DHFA 3U4QB 5CLQA 2Z6VA 4S2EA 4ZO4A 2GILA 1ZM9A 3H1TA 1VCIA 1XJQA 3HU1A 1G7SA 3ZS9A 1NG9A 4RSGA 3CZQA 1ANKA 1FQJA 2BCJQ 1NBMA 2H17A 1H8ED 3NEJA 4US1R 1SULA 1COWA 2XITA 4JLDA 421PA 3SOPA 1IY1A 4EPXA 1LF5A 1CIPA 4TYPA 4TZ6A 2ZREA 2F1RA 3E1SA 3GLIA 4IDPA 3D3QA 5DHAA 5IHPA 3I8XA 2JDIA 3AVPA 4DSOA 1Z63A 1E9RA 3AVXA 5CJPA 5G53C 1XXHE 4Q7MB 2E9SA 3IEUA 3W6PA 1R5NA 4BEJA 2ZVPX 3QQ5A 4V0OA 4D0NA 2DWOA 5A0FA 3AVWA 1SVOA 1HV8A 4FCVA 3UMFA 3RS4A 4DLWA 1V5WA 1E79A 1C4OA 4URXR 3K0SA 3P1JA 2N1BA 4Q1EA 4V03A 1ZD1A 3K70C 4IFBA 1TF5A 4LYFA 1HUQA 1U8AA 3B1WA 3FHTA 1MT0A 4IEEA 2GCNA 2OUKA 3RAPR 3MFYA 4OKSA 3U3OA 2VSFA 4EFMA 5EUMA 3I73A 3K1JA 1N5KA 1ZD8A 2QMUA 4EAQA 2ZSFA 1JJ7A 1VYTA 4QNRA 3EAQA 4LBWA 3GLGE 1TUIA 2D74A 1R8QA 3KL4A 1EG7A 1OFUX 2AL7A 3REGA 1BKDR 1EFCA 2FMXA 2EWVA 2BMJA 1NG1A 5JRJA 3S1AA 4TSFA 3PENA 3G0HA 4MKIA 1VECA 4UNQA 4U00A 5DSZA 2ZRGA 4KBFA 3VX3A 3L43A 1VG1A 4ARZB 2W2XA 2HUPA 2V7QA 4P31A 4JLNA 1DAHA 2J3EA 2OCPA 2KBFA 2JJ8A 4PC3A 1E4VA 1FUKA 1BYIA 3GLFB 3WNCA 1OFTA 5EE1A 4PZZA 2ZUCA 1G18A 3ZIAA 3O47A 2O8CA 1XD8A 1DVRA 3Q85A 4F7WA 1D2NA 3QF4A 5FPKA 4H9GA 4D4MA 2GVDC 1PLLA 4BQSA 2CK3A 3CLVA 3I72A 3VHXA 1E2DA 2DFTA 4B2LA 5J4VA 2BC9A 5ANRB 3WYFA 2VSOA 1LTQA 2FDCA 1Z0DA 2XB4A 3VX4A 2BOVA 5H70A 3QPWA 1NJFA 2JJ2D 4FN5A 1Q21A 1ZIOA 2ZETA 1KI3A 4P4SB 2JLZA 5CDFE 1HE8B 2ZI3A 3LV8A 2J0QA 1SZPA 4M22A 3GJ6A 1MRNA 1TTTA 1GWNA 4CYMA 1J8YF 1HURA 1M7HA 4A2PA 3V4RA 4JSYA 1KKLA 3KB1A 1NSTA 3SJZA 3OIVA 4B73A 2OM2A 2ZSDA 2YZ2A 1Q3TA 5JCPA 1OH7A 1N6KA 1W48A 2GCOA 5G40A 1KGDA 2X8AA 3K0CC 3CRMA 1P9NA 1YZTA 2KWIA 4CEHA 1WP9A 1IN4A 2UVQA 1E9EA 1T3HA 1QBKC 4NDZA 4LYHA 5L3VA 3FFAA 3GLIB 1ZM7A 5C46F 2FSHA 4BRUA 1UDXA 3BH7A 2B7BA 4MRPA 1U90A 2ZYUX 3EC1A 3BRWD 5IT5A 4J0QA 4JYBA 1ESMA 5K8TA 1VG9B 3R8CA 3UMRA 1IN6A 3F8TA 4HUTA 3EXAA 4UQOA 5C4GB 2ZJZA 2BBWA 3GFTA 4WZAE 3MRSA 1ZNYA 1A1VA 4CEIA 3R9WA 3NG1A 4QGGA 3AF2A 4JT2A 4NYIQ 521PA 3B1VA 5H68A 4TYYA 4RZXA 2A5JA 5L3QA 4JKIA 2OXCA 3KQNA 4MH0R 4B76A 4I4LA 4XSHA 1Q3HA 3PUYA 4LRWA 4HSEA 2F9MA 2WJYA 4PO9A 5JJIA 2W6IA 4LDJA 1N0WA 4RD1A 3NHAA 5JECA 1L8QA 3IHWA 3K9NA 3LRPA 4MQBA 1P2TA 3A36A 1VCMA 4GPTA 1YHNA 3NWJA 2W83A 3W3AA 4Q66C 3EIEA 4XIGS 4YDHB 5EXTA 3PVSA 2NPFA 3J81k 4I1SA 3KUDA 4P0TA 3S1AB 1FW6A 1W0KA 2RMKA 1UEIA 2EVWX 4PC7A 5KU1A 2OLKA 4QBIA 3RYTC 3ZVRA 4M9SA 3H86A 1N5IA 1KY2A 2GETA 2WWIA 3IUYA 2DPXA 1P2UA 2C99A 4QXAA 1JPJA 1T3LA 2DFLA 1DTSA 2ZS7A 3RRZA 3T61A 1T6NA 3VR3A 1E0KA 2JJ1D 2O8CB 2O8DA 1ZU4A 1NIPA 3QF4B 4DRZA 2RKOA 3AQ4A 3NXSA 4QHSA 2WKRA 5HR5A 3OE7A 2VHJA 3FOZA 1E69A 3L2OB 4R98A 3DKPA 2P6UA 3KXKA 2BDTA 1IN7A 3R9IA 1UKZA 1GVNB 2BJVA 2NO6A 2W00A 1UKEA 2XEXA 3ADCA 1CU1A 3W6OA 1VHTA 3K09C 4M9ZA 1NLFA 2VPPA 1G5PA 3UANA 2FG5A 2D2FA 1N5LA 1T0HB 5FTMA 1E1QA 2VSXA 4IVQA 4Z54A 1RZ3A 4D4KA 4E07A 1KK3A 1GRRA 2Z43A 1NMZA 1O3YA 1SXJD 4QKQA 3AKYA 4CZ2A 4HB4A 4CRWB 2DR3A 3UMSA 2ANBA 4IOMA 4B44A 2OEPA 2VIIA 2BJWA 2ZUDA 2J7PD 1G6HA 4TYWA 1TU4A 3X1WA 1FOEB 1LY1A 4GMDA 1P72A 1N0UA 4OYHA 1Z83A 4K46A 4AKEA 2IL1A 4RD3A 3C16C 1YR6A 4RFVA 2R6AA 3TW8B 1OH5A 1ZJ6A 1S4QA 2DWQA 4HAZA 2XZPA 2QMEA 2ZRIA 3NC0C 2G9NA 4AG5A 4L16A 1WBBA 1J8MF 2V9PA 2A2ZA 4UNRA 1Z0KA 1N6IA 2ZJ2A 4HUQA 1HA3A 1M6NA 1Z6XA 1G4AE 1H65A 1YE8A 4GT1A 1XCPA 2RGDA 5KNBA 2R6FA 5CM9C 2GXQA 3BOSA 3EA5A 3BK7A 2HF8A 3OFND 4CEIB 1IN8A 3FKQA 4R2IA 1U98A 1Q20A 3W5JA 5C2JB 3CH5A 3OIYA 1IJFA 2GKSA 2DCUA 3NDBB 1X86B 5L3QB 1Q57A 1CRQA 1XEWY 2IXGA 3AGPA 3QNUA 2OSBA 1ZNWA 2IXFA 5DN6A 3TUJC 4DB2A 2NMVA 2C03A 2A5FA 5GADl 3KTAA 1LFDB 3AGQA 2OFOA 2EFGA 3VAAA 2JLWA 1HQYE 2IS1A 4P4UA 3H4MA 1TNDA 5SZKB 3U60B 3UG6A 5CITA 2YWGA 5IK2A 1XPUA 2O0KA 3IPYA 3SEAA 1JAIA 1KI6A 3PQCA 1M34E 3QJYA 4LPKA 1OSNA 4MKFA 1OHHA 4XH9B 2IUSA 3PXGA 4B48A 3K0AA 4LC1A 2XTZA 4DIDA 3IQWA 4PPGA 4BWYA 1XDBA 4DDWA 4IFEA 3GLFE 4DCVA 2ZR9A 4QHYA 1UDWA 3ND9A 3NIBA 4MRSA 3RWMB 4ASUD 5DI3A 3PFIA 2FF7A 2H92A 4QGHA 3NBXX 4XSGA 4F92B 2XOKA 4HDOB 3ZGXA 4DB4A 1MO6A 3MJHA 1I2MA 3B13B 4DLVA 2PBRA 3I8SA 4JLAA 2C5LA 1RIFA 4P3YA 4JS0A 2C77A 4QNMA 2B92A 2ONJA 1ODFA 5EE3A 2BKEA 1G3MA 4L5BA 5EE9A 4ZDKA 3BFXA 3M0EA 5JS7A 2GRJA 2VF8A 3W3ZB 3SDZA 3AVQA 4HZUB 4L9WA 5KO2A 2CBZA 3W6NA 1XMVA 5SZIA 5FOXA 2OCAA 3RRMA 2YKGA 3RS2A 1KMQA 4OBEA 4Q01A 1US8A 1PV4A 2IF0A 4EPWA 4FCWA 3HP1A 1JR6A 3GLHB 1NBME 4JVSB 2GEUA 1W0JD 4LYAA 2UZ3A 3QBVA 4PAOA 2BKUA 2ZPTX 3QXSA 1KK0A 4JKYA 5KOYA 2PCJA 3QEOA 3UATA 1NN0A 1OFHA 2EWWA 3FMPB 3WHKA 1X8JA 4OI0A 2WSSA 3EZ9A 1IONA 3IKJA 3GLIE 5C1BA 1AIPA 5FOWA 1JXOA 1AS3A 3TSOA 2QBYA 2ZITA 2BM1A 2HEIA 3QOFA 4LJ9A 4PPFA 1U99A 2J41A 4UJ3A 1F2TA 3U2QA 4QJ3A 1Y3AA 1T8TA 4UNPA 1RVDA 3OIWA 5DYGA 1EFRD 4LHVA 4DUGA 3AH8A 2QGNA 3UG7A 4DXAA 2YHSA 3LW8A 3W9YA 3DOFA 3RDPA 3WRXC 1S0UA 3RLFA 2FZLA 3LBHA 3U7FB 4CEJA 1KYIA 1CJMA 2IK8A 1Z6AA 4GFDA 4HZIA 5TB5A 3HYTA 2CCJA 2WWHA 3EW9A 4XOIA 2EFHB 2CEAA 3T06B 1OPXA 3EZFA 5J4KA 4XWKA 5DO9A 5FUYA 2RHMA 4DHEA 2NPIA 1JB1A 1Z6TA 3KXIA 4OHZA 4CIDA 1L4YA 2PEZA 4HUQB 1UPTA 1LB1B 2LCFA 2YWHA 4CF7A 4PSKA 1WE2A 2OG2A 1DG3A 1A2KC 3EX7C 2YOGA 2CL7X 3G5UA 3NDPA 4JL6A 2XNDD 4UXIA 3VU9B 1Z0FA 3T1TA 3B9QA 4IXMA 1G3QA 2DYKA 2F43A 4MGZR 3LX5A 1RKBA 5B57C 4CGZA 1UJ2A 2XZLA 1M7GA 1Z47A 5LB2A 3RRYA 1Z6YA 4A82A 5F98A 3KTAB 1XEWX 3THOA 1VYUA 2BMDA 1ZIPA 1D9XA 4M1MA 4TT3D 4MUAA 3V00A 1QG4A 1DADA 2FJUA 3SQXA 5TY0A 2ZRBA 4D25A 1Z29A 3K0AB 4A0HA 3K0FB 4LV5B 1YZUA 2BMEA 3SR0A 2I4IA 3X1ZA 3KQHA 3CH4B 1Z8FA 4BFWA 4WXPA 2V1UA 1E98A 1OE0A 1FX0A 3H2YA 1QHYA 2IS4A 1GL6A 1R2QA 3E70C 1IHUA 3VR5A 3AVYA 2G6BA 2VHCA 1SVSA 4NCKA 4TN1A 1HT2E 4CEHB 2CJWA 1JEEA 2C9CA 1E9SA 2FZ4A 2QUZA 2VP2A 3L0IB 3GJ3A 5J4YA 5TMPA 2H57A 2UKDA 3FVQA 3CRW1 3LO5A 4D4JA 2GJ9A 2XXAA 4NPHA 3MWJA 2MSCB 2F1IA 5K8LA 1QVRA 1KSHA 3FDIA 1E6CA 4HAWA 4MITA 3TKLA 5TV2A 1VCNA 1S8FA 3KJGA 2QE7D 3N70A 1KK2A 1MO4A 5AJXA 3SN6A 4P32A 1ZUHA 1SGWA 2R44A 1G1MA 5L3RA 3A8TA 4DCNA 3QKSA 3CF2A 3PIRA 4A36A 3ICEA 2F3TA 1NN1A 3FPAA 2FFAA 2ZRCA 2QBYB 1W36B 1Y63A 2OO7A 2EYQA 3OHMA 2Z4RA 4D82A 4O2RA 1F2TB 2IHYA 2WVJA 3UWOA 2X2EA 3BE4A 4MKHA 4Y0AA 4F38A 4YQFA 1RRPA 4XWAA 1D8TA 3C8UA 5AWFC 3WBKA 4CEJB 4RD0A 2EYUA 5DE3A 4UJ5A 2DWPA 1XTKA 4DVGA 4TTQA 3CNLA 1SKQA 2LWIA 2DY1A 4M8NE 1SHZA 2I1VB 4OQLA 2GEDA 1KDPA 1NVUQ 1EWRA 3CBQA 2H7VA 1QRAA 3ECCA 1YRAA 1OFIA 3JVVA 3OEHD 2BM0A 4L9SA 3OESA 2VHUA 5EJEA 2BMFA 2I1QA 2WAYA 1U8ZA 2EQBA 1CKEA 1VCOA 1XTSA 5FI0B 3QSYA 4E5UA 4KJZA 2ZRLA 5FTNA 5TARA 1OB5A 3CR7A 2RB4A 4PO1A 3BGWA 3TUIC 4C0AC 1KJYA 2F43B 4JYCA 4WAUA 5E95A 4IW3B 1IY2A 1GG2A 2X2FA 1GSIA 2QM7A 3LX8A 2QENA 4LHYA 4ESHA 4EUNA 1ZYUA 4NTZA 5JCZA 5FL7A 1GAJA 2C78A 1G8PA 2GXSA 3GJXC 4II7A 2P6NA 1NBMD 2VF7A 3FHCB 1WXQA 5BYKA 2V6JA 5JLJA 1EFTA 4M0LA 1U0JA 1T91A 1W2GA 3HJNA 3WP1B 2C9OA 2N46A 3AP1A 3CIOA 2ZRPA 1FX0B 1LW7A 1KK1A 2O0HA 4NYJR 2GZDA 2QAJA 1SKYB 2Q6TA 2CMKA 1E2HA 2CJWB 4CW7A 2QL6A 2W0MA 3QBTA 5FPSA 1EX6A 3MGCA 2ZJBA 4E22A 3GLHE 4URUR 5AUNB 2XXAB 3EPHA 3WHLA 1KMHA 1HY3A 2XSZA 3PEVA 4FMDB 3AP2A 5JJKA 4RD2A 3SYNA 2Q3HA 5DISB 5L8VA 1TL7C 4V0KA 1OXTA 3LVRE 5JS8A 3ZD6A 1NI3A 2PJZA 1FMLA 3I5YA 1XPRA 4AKGA 1W4AA 1S96A 3QKSB 4GP7A 4KXFB 4C3ZA 3KJIA 3RHFA 3U3RA 1UFQA 3KQKA 5J4HA 4JJZA 2QTHA 3SE0A 4EJSA 2XJ4A 1C9KA 4WVFA 3IEVA 2QP3A 2QA5A 4YONB 1KAGA 1XTRA 4DLYA 2QT1A 3GPLA 1YRBA 3EA0A 2B6HA 2G88A 2FFBA 2Z4SA 1DAGA 5EUQB 4DLSA 4BFZA 1WCV1 3QI2A 3ZYCA 2XB2A 2AKAB 3MWLA 3WMFA 1R0ZA 2O52A 4GP6A 4QJ5A 3KX2A 3IIJA 4Z51A 2QSZA 2GJAA 3PEWA 1KI2A 3FMFA
chains in the Genus database with same CATH superfamily
1H8HA 1U6JA 4PBTA 1GOTA 2X9LA 4UEOA 1II9A 2ZJ5A 1WU8A 2CD9A 2PFKA 2FOLA 3CPEA 1G41A 5DNCA 4Q3NA 2C2WA 3LWDA 3O8QA 3PT9A 1NNSA 2XI4A 1XJ5A 2CLDX 3DDCA 2G36A 1O9GA 2WPDA 5AK6A 4G0MA 1WBDA 2WWTA 4PNHA 2JAQA 5KOHB 1W4RA 4KLAA 2XXBA 3VTKA 3S6JA 1W6RA 2OBLA 2QX4A 1FCJA 3HL4A 1F20A 2G07A 1FFXA 1YS9A 3GWGA 4YRMA 1ZJWA 1K6XA 3TFOA 5SYAA 1YVRA 1PT6A 3HR7A 5JSQA 3DT9A 3G82C 4HK4A 5ULLA 1G6OA 2FP3A 1QHEA 4BLOA 1Z5UA 4CMBA 7GPBA 1Z06A 2AE2A 2I2DA 1HE3A 1WUJS 3CUWA 4XVRA 4HQNA 1D6JA 3W8EA 4EYOA 1P9OA 1TZKA 2QPOA 3K9CA 4FEYA 5FWYA 3NVAA 3WGTA 4FFVA 2B4QA 5K0NA 1ZP6A 4BZPA 4LS3A 1D07A 1NPYA 2QRLA 3BD7A 3FD8A 4J8PA 2GPTA 1HE1C 4NZYA 4TWIA 4NBVA 2R8OA 4IX9A 5I5EA 3AV0B 1N3YA 5BOSB 3EC7A 1BXRB 1DARA 5BWMA 4EF5A 1LS1A 2IHKA 5LJLA 3TXAA 1GO2A 2Z8YA 4ZARA 3KLNA 2OL4A 4F2PA 1R4AA 3RV3A 3IX7A 4RKFA 4A8JA 3OC0A 2CNWA 2IYTA 3WNDA 1UBCA 2C97A 1X13A 2WD7B 2UUOA 1GZSA 3PE3A 4G81A 3PNPA 1P77A 1Q0SA 3UAOA 4DA8A 3DYBA 1GGKA 2CCGA 4DG9A 1SXGA 5LA6A 2DH6A 3RC7A 4UHFA 5A3QA 1TCAA 3X3HA 4DA9A 1M1YB 3M49A 1XKXA 3B1YA 3ESZA 1XKLA 2VT7A 4G5OA 3HVHA 3KM0A 3O75A 3F6BX 4PG6A 3DMFA 4J07A 1GV0A 1IB0A 1P5FA 2D1TA 4FJ1A 3MLBA 4QOIA 4YIHA 1IQPA 1SBHA 2RAPA 3QPVA 3AR4A 4URYR 3M6AA 3WGNA 7REQA 1HLPA 3MT9A 1GKKA 2G7ZA 1KMHB 2VPQA 3AKDA 4ERNA 3B60A 2AFHE 3UJ6A 1HETA 1B1CA 2GN8A 3QVJA 4D6YA 5L4LA 1OMOA 3F98A 3T4XA 1IZ9A 2CJXA 3K6JA 3CR8A 2QX9A 2Z8ZA 1OWPA 1L4MA 2P4UA 2QJRA 2ZJ8A 3DD5A 3DAYA 2JA1A 4A6PA 3V4SA 1UUFA 2XDQA 3GA0A 5FL3A 2B20A 2PGNA 2FPGB 2Z98A 3C5VA 2PKEA 4Q3LA 1SCDA 2BR4A 2NVWA 3ODGA 1C8LA 2NTVA 3OECA 2J46A 5C5DA 1W5FA 1WV0A 1AC5A 1LDGA 2IYNA 2OO5C 3IDAA 2WT9A 2IHZA 1KHTA 3JQRA 2XLCA 1RWMA 4OJKA 4CTNA 4EHDA 5C3MA 5JBQA 3RC9A 1IAQA 3HB0A 4M4SA 3UGKA 2WK1A 3AUXA 3WA6A 3LX6A 3TB6A 5ISMA 2C8VA 4UXHA 1YDGA 4BO4A 2GMWA 3C6BA 4IHQA 3I58A 3B1ZA 3TJRA 2FX2A 1G6Q1 1PFVA 4O08A 4B0OA 4HRYA 5ICFA 2CVOA 3JYHA 4TKVA 3AJDA 4NNJA 1F17A 3QVWA 2VYVD 4LYEA 4F93B 1CR6A 4ZKEA 2XUZA 1VL0A 1WMSA 9LDBA 2J0SA 5KYTA 3KYDA 3R0VA 3AUAA 2XAUA 4P9NA 2QUAA 4RK5A 2CNLA 1XN1A 4I6EA 3OTIA 5K0LA 2EP7A 1SQGA 4KQJA 3FFBA 3RC2A 4DM3A 2CYBA 2J8ZA 1NP6A 1EB9A 2YIMA 5TIIA 2A0FA 1JR3A 2PVSA 2P2ZA 3PQDA 2C4NA 2F48A 1U5AA 3FWYA 4XTRA 2GFQA 5T64A 1K7FB 2EFEB 2JH8A 1R5OA 1RRFA 4OV6B 5GOTA 2C2HA 7AT1A 4FK8A 1T26A 1DSSG 3FPBA 4KRFA 2BFDB 4PGAA 3WIUA 5T6MA 1QV9A 5SZJA 5EMKA 1HKHA 1TVMA 1T2EA 2GX6A 2AXNA 3Q72A 4ZA2A 3WGJA 3Q6IA 4OXRA 3ZBTA 3DM9B 1XZQA 5ALEA 4FI3C 3EASA 5DSXA 4A27A 4EQZA 5ETJA 2ZIAA 1UH5A 3LQQA 4Q82A 4GOXA 4K6MA 4Y2UA 7ADHA 4DY4A 1T4GA 1WXDA 2ZJAA 3NLLA 4HN2A 2E6UX 5F33A 1JPVA 4KPUB 4Q1BA 3IULA 5JZBA 1U0RA 1SKYE 3QF7A 1FUYB 2H8KA 1GTG1 3UHFA 2R6CA 4M83A 1KP3A 1S3GA 2LDXA 3O4FA 2HCJB 4MPJA 1XAIA 3NFRA 3MMXA 5DNUA 4B3HA 2J9XB 4NFHA 1AUQA 1YZHA 3ENNA 1X94A 5CMLA 2OCXA 3ZJUA 2OBBA 4EEZA 4CM8A 5KWJA 4W5NA 1AQYA 1DAIA 3DQPA 4XWOA 1LPBB 2H1IA 3RYHA 1DRVA 3ONDA 3T9FA 2PRZA 1XZAA 2G0TA 3LP5A 4W82A 4HDNB 5I7EA 2D2XA 4ZYUA 2VYND 4U7PB 2WKQA 1QKIA 1T8RA 4JUIA 3K5HA 4DLTA 5TMEA 5EHZA 2ANCA 4GXNA 3G8DA 5E0KB 5EJ9A 3K6RA 2H06A 2ZSAA 2WG2A 3K8QA 4NONA 4MI1A 1M8JA 3MOGA 5C7OO 3JQQA 4CLDA 3ME5A 1Y9DA 2VXBA 5AVXA 4G1MB 4IQ4A 2O48X 1I3MA 4RH3A 1SVMA 4HMQA 1R74A 4OUDA 2GTHA 3DVSX 3S2FA 2LR0A 2IPMA 2DULA 2WUWE 2QN6A 5DW3A 2VJQA 1Z68A 1CRWG 1FYFA 3G88A 4ZOQI 1QDUA 3ZE1B 1FTWA 4HN4B 1G9XA 1EWKA 3CWZA 1CD5A 2JLYA 2EBWA 2XE7A 5FUWA 4AJ2A 1KNQA 4KIWA 4U6SA 2A1TR 4BAGA 3URMA 3G8AA 3EVBA 5EXXA 4OGGA 4WN3A 4KK4A 2WF7A 4ZEWA 4R9NA 1Y42X 1K6MA 4L0CA 9ABPA 3IQHX 4DBLC 3F8WA 1ELOA 1CQPA 1QFJA 3KTOA 4FQ8A 1M2WA 2N42A 3Q7SA 4QXQA 3QA9A 4ZJUA 5LQDA 3KYCA 1BE6A 3E7WA 3KDPA 4CCSA 3BJRA 3CLUC 4DV0B 3BRQA 2H4FA 3LYAA 3O4RA 3AF3A 4QC2A 2ZZKA 2XYRA 3PQ7A 1ODKA 3OEEA 4NV0A 2Q5JA 2QVXX 1F3OA 2WJPA 4M0UA 3NBQA 5ITZB 4KE7A 3DVAA 4J7CA 5FO0A 5IH3A 2NQTA 3GUUA 3ZVNA 4X0EA 1UZAA 2BI4A 4J7XA 1DXQA 1HYEA 4IIEA 2ZXEA 3WY9A 3SVLA 3DWGA 3WLQA 2CKMA 3FHLA 1UPBA 1RI5A 1GUFA 4G3XA 4RZUA 4F1JA 1JW9B 2EDCA 1TCVA 5F5XA 1Y98A 2IYUA 4H1VA 3V8NA 3TLEA 3PUIA 3ROFA 2FPOA 4EY6A 4GBMA 1YB5A 4JWTA 2YMLA 4DMFA 3VKFA 2P79A 4TKMA 3FNRA 5BV1A 3MN1A 1YH3A 5EZ5A 5BUZA 1VMDA 3KJXA 1K4YA 3CY6A 1YOVB 3WIDA 2HT1A 2IYFA 1KMCA 3CFYA 3K6SA 4M53A 3DBLA 3R3VA 2GHRA 2Y76A 4RPGA 3D43A 1WCWA 4DADA 1YI1A 3LFUA 2F3RA 1YVEI 3GYGA 3ETJA 4BQEA 2CLKB 4YN3A 1V37A 3MRXA 4WKCA 3V1YA 1W1UA 1F8FA 1J6UA 1ONSA 5HUQA 2WABA 1RYHA 1ZONA 4CIVA 3PF8A 1T5HX 3M5PA 2OC4A 4AYTA 1UBTS 1SUDA 2ZJ0A 1GL7A 3J7TA 1YULA 2FSIA 5BW8A 4WJKB 4KX5A 5AKGA 4AN0A 3B7GA 1I3LA 2B78A 5ALJA 4HR7A 2XB9A 3IAS6 3LU1A 1C4WA 5BRAA 4OHPA 1NFFA 3NHZA 4C4AA 1MEEA 1OC4A 4RZSA 4F85A 1BCSA 4UM5A 2IVFA 1GA1A 1YZ3A 4KYIB 3K8OE 1YBFA 3MJFA 1UKVY 4HQLA 3IVCA 4HAYA 5WRFA 2PCLA 3BXOA 4JJIA 3EF1A 3DKKA 3HJTA 3MGBA 1CVRA 2CKDA 1Q15A 3PHBE 2YWFA 2VRCD 3CPHA 3AY0A 4HGPA 4MQUA 3O8LA 5EXEA 4YS6A 5J5AA 3SAJA 3U7JA 4WCFA 4A8JC 4QREA 3ZWKA 1E1CB 5ALFA 1VSTA 3A6FA 3PKZA 4JEUA 3D5EA 4MV1A 1YGPA 4Z8YA 3T3MB 2DQSA 2DEUA 4PVDA 1YS4A 2Q99A 4Y2SA 2AA3A 3C3WA 1T1GA 1ZGJA 5AVOA 3LY8A 4I9HA 4LECA 1XDGA 2R4QA 1T0JB 4H0CA 3ZEIA 2OWEA 3OZXA 4JEHA 3VNVA 3T0IA 1MQAA 2IYEA 2PZLA 4MIOA 3I6IA 4ZQBA 1QHSA 4LE0A 3VKGA 1QHXA 4ZVUA 3TLXA 3K70D 3WK5A 3L0OA 1GGEA 3GDHA 2HBZA 2ON6A 2IEBA 2XMPA 1IDN1 4ITVA 3TNYA 3CVUA 1K5GA 4N76A 1FFEA 4CLHA 3KP1A 2GN4A 3RSCA 3I4FA 2V6MA 2P9JA 5CLFA 4IBOA 2IT1A 2AYXA 4BNVA 1SXJA 3WLRA 3WGGA 3GNLA 1VI5A 3KD3A 3GJ8A 1TYAE 4JU8A 2B8WA 5A4JA 2OV2A 4RBNA 3B9RA 3EZGA 3N59A 2Y0CA 1MJFA 5HM8A 4Z4QA 2GH1A 2ZJFA 4ZCMA 1E9FA 3TFQA 2Z2YA 1M0SA 2ZROA 2ZAGA 3EQ2A 2RGEA 3PU6A 5E7IA 3P9IA 3ZE7A 5E6RA 3D7KA 5A4MS 1G4HA 1TGVA 3HP4A 3PSAA 2IGTA 2ZRMA 4OREX 3UMJA 2ZYHA 5DTIA 2JLXA 4KQ1A 5H4GA 1G59A 4Q4JA 1HDEA 1YR7A 3E35A 4PGMA 1MFPA 1NJGA 1O8CA 2QQEA 3JRXA 3VR5D 1LVHA 2O05A 1NJSA 3IE1A 4FIDA 2HHHB 4TZKA 2VYFA 2ZBQA 1Z0JA 4IICA 2IOYA 5B2ZA 5I9SA 2D4AA 4OI2A 1IM2A 1DPFA 2WWRA 2ZJOA 4N7MA 3TQSA 3UAXA 1BQ4A 1LNSA 3WHPA 2GAOA 3LKBA 4D81A 3W5AA 1JUDA 2IUUA 3AI1A 3CN9A 3FDJA 5DDIP 5JBNA 4YPOA 1EWQA 1QYVA 1USGA 5IMBA 4JJ4A 4QRHA 4RLSA 4E5VA 3Q7TA 4RDHA 1XNJA 1Q7BA 1DQNA 2BLNA 2WMDA 4N5LA 4RXMA 3HB9A 5K3BA 1N7IA 5KTYA 1RQNA 2NU8A 4URZR 4F86A 1I13A 3VOTA 1OW3B 3V8QA 1KO5A 3DKRA 5K3SA 3HBNA 4Z6KA 4PQEA 5IKEA 2A7QA 1XZJA 2VUUA 3EDYA 3EZLA 3H16A 4QODA 2Z56A 2A1TS 1JJIA 3A4LA 3AHDA 1JPNA 3I2YX 1MXHA 3BAFA 3LCMA 1M33A 2ZQYA 4COKA 4GKVA 2AG0A 2WNIA 3H3JA 3QUAA 1NY5A 3TJZA 3ZCPA 1I10A 4GQBA 1ZZEA 2ISQA 4QDZA 4KC0A 1X7XB 4F9GA 2G0AA 4I46A 3AFGA 3CGGA 1C3LA 1F9AA 1LS6A 4NQZA 5C7IO 3ZVKA 2IRWA 1BKYA 1YRWA 5BW5A 2CXHA 2OCBA 1XZDA 4C0XA 1T8YA 2BUAA 4P7BA 1DC8A 3FWKA 1QWSA 2AS0A 4BN5A 2NSDA 3THRA 2OPBA 1YCFA 1NDHA 2E49A 2ZI5A 4Q02A 2VI5A 1NW6A 1Z35A 4N0DA 1H3EA 1ZXLA 1XL1A 2QOEA 1VBFA 1E2FA 3LLCA 3E9MA 4W5HA 5IM5A 2VT3A 4EB6B 3UQZA 4QHTA 3QE2A 3DMDA 1Z4KA 1ZIDA 3WK7A 4KMSA 4KEAA 5E9WA 3RLIA 5BUSA 1T1IA 2ILVA 3TR6A 4BP1A 4ERXA 3BXFA 3WGIA 3ZH2A 3KR1A 4YAFA 4BJHB 5AHRA 3QVLA 5JYBA 3IALA 3LFTA 1DEKA 4Y3UA 2EKQA 4MP8A 3DT8A 5JJ5A 3BF8A 4J3JA 2VFAA 1GTSA 2CMFA 4NE9A 4LJ7A 3V33A 1BNCA 1SH7A 2VP0A 3VO2A 4A2QA 1JAHA 4XGRA 3ELWA 3RS7A 5AW6A 1YR9A 5D6OA 3UAYA 1V5EA 4KVGA 3DBHB 4DE5A 4X20A 3VPFA 1A9XA 1SOWA 1LJUA 1QKKA 4XJTA 4BVBA 5LOVA 1FP7A 3MELA 1GPNA 1QVWA 4F5ZA 3W8DA 1AZLA 3LY5A 3T4PA 4Z2AA 5BWCA 5IJ0A 3P0RA 5BSGA 3CJTA 3P2MA 1Q83A 2KM1A 1A8QA 1GPUA 3DMNA 4G63A 1OV4A 2MMGA 3IP9A 4XB1A 5FL7D 3FUXA 5EJ8A 2VL7A 2WU1A 3JS5A 4FSHA 2WM3A 2ZATA 3Q6NA 1LTKA 2WMYA 2PSSA 1GKUB 2XE8A 3NUGA 4RFSB 1UAGA 1E3LA 1UXJA 4UUBA 2AJTA 1DO0A 3KOWA 2VAXA 1YC5A 5JVDB 3AXSA 3M34A 2IYWA 1N5DA 2PO7A 4HGOA 1OOEA 2E1PA 2UUPA 2YJZA 4JAVC 4JLUA 4LX0A 1TQDA 5GOZA 4FUQA 4YREA 5BVHB 3IIMA 1X1EA 2OE2A 1X0XA 1C50A 3AC0A 4PN7A 1TK2A 5G1NA 3L1HA 3O4VA 4S1WA 4GC5A 1CTQA 5TEVA 1UJBA 3BSYA 4XE5A 4FR5A 2J9YB 2J9FA 2QTVA 4F04A 2V9CA 2ZVQX 2WKSA 3ET4A 3OE1A 4X94A 4ON9A 1KARA 1M6WA 2REOA 4G8BA 1JA9A 2H4WA 5AXCA 3H11A 3VNBA 2G77B 1JQAA 4LUCA 2JKYA 3LQ1A 3IQZA 1VI2A 1WD7A 2GPNA 3GEMA 3DAFA 1VGRA 3IP6A 4ZTBA 2VXYA 4HNQA 3VHLB 3BICA 3NBKA 1OTYA 3PZRA 2VNSA 2HMTA 2D1FA 1NBWB 2NOAA 3HP7A 4FT4A 4RJ2A 4TPKA 2XCTB 3VTAA 3WGKA 4MR7B 1VOTA 4G24A 1CP2A 1G8AA 3IOEA 5F9HA 2HRZA 3RK0A 1AY0A 4HFJA 4PZLA 2ZSJA 1KI9A 4P3XA 1B76A 4LG1A 5C1OA 3ZDRA 2VTKA 1RZUA 5L3SA 1AGPA 3I6BA 1RWPA 1SCNE 2ZDQA 3WDLA 1B6TA 3ZHBA 2QTWB 2RBGA 2ZSUA 4TT3A 4D9MA 2B69A 2AR0A 2DLNA 1O9BA 3L1IA 2YIVX 1NHWA 1NR7A 4KFUA 5EZYA 1IQRA 5HF5A 1D4AA 2J45A 2IU4A 3ZHUA 5FTKA 5JSZB 3DQQA 2OOSA 2UXDB 1UBJS 5HZHA 1GPBA 4JQOA 2QY9A 4AN1A 3TRIA 3DWEX 4GI1A 1XHLA 3ORQA 3TEJA 2GXUA 1D1PA 3CURA 2PE5A 2BGJA 1Q16A 1EGHA 2ZCUA 1AUXA 1O54A 3FDFA 3GIDA 1HF3A 4IVPA 4NCHA 5REQB 4TLBA 5CB6A 3S8YA 3PEYA 3SSMA 3LM8A 4I2NA 1P4SA 4OI1A 4A8PA 4M6WB 2GXAA 1QLHA 4GWGA 4B6EA 2EZTA 4ZD6A 2H9YA 4INAA 5HWSA 3R6GA 5HVNA 3X1XA 4X6XA 3ZGYA 2OHOA 3EUEA 5EXPA 4W5JA 2GN6A 5FI5A 2RHOA 2UZ4A 2HPHA 3M9WA 3ZH9B 2D13A 4IFTA 4ZHQF 4TV8A 2AOUB 5J2TF 5D86A 5HIKA 2HU2A 4KITB 4R41A 1B23P 4LBVA 1BN6A 1D09A 2RONA 3BQNB 1HBJA 3QX8A 3QV2A 4LVUA 5LYYA 3WMWA 5JRDS 1VQ1A 4GUDA 5JPIA 4WCFC 1T6ZA 5IULC 4RMIA 1X9HA 1E3WB 2F00A 4ZKDA 2YJ4A 3KJHA 3RCBA 1TQ6A 3L7KA 4JC0A 5DXFA 4AN4A 1QF9A 1RLMA 2Y3IA 3BWDD 4F4IA 1JQDA 3ZEAA 2B5WA 1JR4A 4Y98A 4FYKA 2JFVA 4D02A 3M82A 1EK6A 1VE7A 5LNK6 4BATA 4XX0A 1UR5A 4PF1A 2J1LA 3UWKA 2XE4A 5CG1A 3CLSD 2QORA 3MTQA 1R64A 3M1YA 3ZE8A 2LBPA 2ZWMA 3NBZC 3UT6A 3VPGA 5EP2A 4WHMA 4RFLA 1SXJC 3RSHA 1I4WA 1QTIA 4TQAA 5MF6A 4EGSA 4EEXA 3H9GA 4LDPA 1MB4A 1OZGA 3AL2A 1QYCA 4EA9A 2N3ZA 3TCKA 2OBNA 4ZXFA 4P4GA 3TRHA 1ZLYA 4UHKA 4KO4S 4N0EA 5CK4A 1SC4A 3D4NA 1H3FA 2WQ6A 1MO5A 2Q5FA 3ENQA 3MT0A 3T3GA 1NJ1A 3DBVO 4P4LA 4TMVA 4U8HA 5GJVC 2EKPA 1ZR4A 5I45A 1W36C 3F46A 3GGCA 2WNHA 4UUPA 3BFVA 3K9HA 4BZZA 4A15A 3ST7A 4CKYA 4RORA 4RM2A 2BFBB 5ADWA 3EDRA 2BGGA 1XKTA 4CLXA 1ZRHA 4D74A 2D1YA 1I32A 3KPUA 1XCGB 5C18A 1A76A 2MSDB 1EVYA 1R0CA 3ZXSA 3PD0A 4UOEA 4UU8A 1I2BA 4I1OA 5AYVA 3BM5A 3ONNA 1RLOA 2ADFA 2HCFA 3DO6A 4M1ZA 3WDSA 3AZOA 2ATXA 4V0ME 2E5FA 4FEAA 4BIIA 2UUBB 2HT6A 2OGTA 5DYNA 5E1DA 5AXBA 5BV7A 3JQDA 1T5LA 2NU6A 4MIKA 3G5LA 3A9RA 4MVJF 4NZNA 4R0NA 3MPUA 4HGZA 1RU3A 4GGPA 1G8YA 1ZCAA 1ZM3A 4I5GA 4LHWA 1SWWA 1PLKA 1XJCA 2V8OA 4Q00A 3PNYA 3OIUA 2BR3A 2YWJA 1M7BA 1Y4ZA 1XYGA 3K4HA 3M6MD 2G1KA 3EWNA 1GR0A 5JE8A 3ZHCA 4FS8A 3HCFA 1MC5A 2AN9A 3WB1A 3T95A 1QH1B 3GMTA 4ACBA 3M3DA 1GSAA 1DC4A 1VGQA 3ZQUA 1K68A 1NVVQ 1H1TA 2GAIA 4FZJA 1R3DA 2INGX 1PF7E 3SYLA 3T3HA 4IDDA 2C59A 2BGWA 4U3JA 1DXYA 4FMCF 1KP9A 3BE6A 4Y2JA 1QYWA 4NBSA 3I9LA 3ZQKA 5JC1A 5ALMA 4CIXA 3B3FA 3LK7A 3H65A 4AS2A 4W5QA 2OFXA 2JIOA 6PFKA 4X8MA 1ONBA 3NHPA 4R68A 3W05A 1T2NA 3SF8B 4FOPA 1EGAA 1QO0A 3RNLA 1Q1AA 1BWPA 1JDVA 2FETA 1AJEA 1UXIA 1KJZA 3GBPA 1UMDA 4PRZA 2B1RA 1N77A 3BGOS 3RS3A 3W5HA 3VNUA 3GPDG 1PJZA 2H8GA 3TX2A 2DFNA 2I7DA 1S89A 1T2VA 2MINA 1MJGA 3ZWDA 2XGGA 3AVUA 4UHBA 1HYHA 1E20A 4WZBA 4LYDA 4Q9DA 4IIJA 4XIFA 4HX2A 2IU6A 3EGVA 1HEUA 4GRAA 1WBJB 1HE2A 4CODB 1MX1A 1Y4AE 3BIFA 2CXOA 1PX0A 2QLFA 2XYVA 3CZMA 3ZQJA 2XA2A 1J70A 3AK4A 3BREA 3USES 3TZQA 2GQ0A 1DS6A 2ZI9A 4M9CA 1D4OA 1GGHA 3D6UA 2HCTA 4R7GA 5F9FA 1JMKC 3FMVA 5FYDA 4OATA 5G3ZA 3TLGB 5F77A 1YA6A 3CB2A 4K9PA 1NTOA 5EQFA 4IH1A 3KQWA 1G0NA 3FDZB 3NP7A 1MVNA 2G5GX 1TM2A 3PXCX 1K3UB 2YXBA 3IKLA 4YLEA 4BNNA 1JIQA 1UM9B 4MPPA 2HRQA 4DREA 3ZDFA 1SVWA 2GZRA 3GLSA 3ZZUA 4G5SA 2WJZB 3JD4A 1FS4A 2D0DA 2J4DA 2Z3VA 2JGDA 1HG0A 3AEQA 4E88A 1JEAA 1NVWQ 1A82A 1U9CA 1LBIA 3AM5A 4J16A 3LZ6A 4NU8X 5EE5B 5HF9A 5CFQA 1LLCA 1OIXA 1G0OA 3PUZA 5CDUA 3I0ZA 1E9BA 1YRLA 1NVGA 2UZIR 1W5EA 2WC1A 3F71A 4JLKA 1T2AA 3HSKA 1LDNA 1VZ3A 2I76A 3FJYA 4MS1A 4BO1A 2G1AA 4AZVA 1QB8A 4QLOA 2OP0A 1D7OA 1XD9A 2DX7A 2NO1A 1N33B 1M2OA 5DOZA 5L53A 1WXFA 1OWOA 3HNOA 5AJZA 3QWHA 3H9UA 3KNZA 2ZBPA 3IH5A 4KFTA 4ZAZA 5EE0A 1BEZA 5THQA 4WL0A 7ABPA 2HH9A 2YCBA 3A1VA 3BE5A 1SUSA 3KD2A 4GQIA 4C9BA 2WTEA 4GNRA 4ESOA 3UJNA 4LFCB 3B6IA 4EKIA 4G0NA 2HO5A 1XNGA 4D79A 1L1QA 3GHHA 4A4DA 4WWHA 4AO6A 1OYVA 1P0MA 2G8LA 2P1DA 3WLHA 1EBBA 2UZ1B 2ZB4A 3GG9A 1GL9B 2CLMB 4XW2A 4WBXC 3DZGA 3D8NA 1HT1E 3RYFA 4I1RA 4QEKA 3CJRA 1G5RA 1RBQA 4FDUA 3UAWA 4ZHQB 3R0XA 5J2TB 5U1PA 3H18A 4D0LB 1OIVA 1TT5A 1OGIA 3AR6A 2WWWA 2O3QA 2RGGA 2ZBUA 4JVOA 4PHFA 3OCZA 4Q3OA 5G4LA 5HOEA 2FMFA 2BEJA 2ASVA 2IDMA 3G2OA 3HB7A 3QKWA 4HBZA 2VQ6A 3L7AA 4LZNA 2P0YA 3GRPA 5ITVA 2V4MA 4CCYA 1NF9A 3D0RA 3E53A 1GTZA 1B4DA 4I4TF 3A6ZA 4OBBA 3HZRA 4CMIA 3H83A 1Q2UA 1EFVA 4YGYA 4G9BA 2JFWA 3AEYA 4KPGA 2WV9A 3NKLA 1W2HA 1U0GA 3RTCA 3N0TA 3OF5A 2Z3WA 1FTQA 3D6JA 3NATA 5AKLA 4F9FA 3QM1A 2EFCB 3CO5A 1DDOA 3G23A 5AR1A 3CWQA 3IIIA 4B2PA 4RE5A 1KAOA 2OB1A 3A2LA 4WMLA 5CYPA 1RYBA 5TPZA 3FXAA 1RADA 3L92A 2OILA 2BSQA 2IELA 3GUHA 4HYEA 2W42A 3QQPA 1BE1A 2GRAA 3N28A 3OZCA 1DAOA 4EY8A 4YJ3A 1HGXA 1YZFA 4YLGA 4IGAA 1XCLA 3ZY3A 4CF5A 1K9SA 3LDUA 5CR9A 2B94A 1FW8A 2A5YB 3OQ1A 2F6RA 5CCDA 1M1XB 4IDBA 3PB3A 4K3UA 4JWKA 1YMUA 5JATA 1EM8A 1KH2A 2QK4A 5AW2A 2DRIA 4LHSA 5DWVA 5KNLA 4CETA 4E12A 4MRNA 3EUFA 821PA 4JFAA 1NMQA 4ZGWA 1X92A 2W6JA 1XRJA 3BUSA 4YJGB 1A8PA 4MDEA 2OESA 4J0IA 3NDIA 1M2EA 3GGPA 5K0FA 4HNHA 2GD1O 1ESNA 2LCIA 3UC5A 5CJJA 2JK0A 3GARA 2ZIGA 3K2EA 5JI2E 2O8FB 1UZMA 3L8GA 3OQHA 4M1KA 1XCMA 1YZVA 3H19A 2BWJA 3UMCA 3U19A 3HV0A 4K9LA 4ED9A 1TZJA 2DWUA 4HV4A 4FOLA 4KFSA 3K2IA 4UE6A 5EQJB 1XVAA 1QLWA 1RMYA 1USVA 1G20E 2JEOA 1R6VA 2KMLA 1IZ7A 2IIQA 3IQDB 2HRDA 1N3LA 3KPYA 4O25A 3M33A 1BXGA 2G80A 5E4YA 2DJ5A 4FOTA 4PZDA 1TU3A 5LMCA 5L3ZA 3FG9A 4R7ZA 2D7DA 3M89A 3MINB 4DIMA 2VUSA 3EPRA 4WXEA 4AL4A 1IBMB 2X19A 3Q5GA 5BSHA 1V96A 3RS0A 1GLGA 4OSOA 2IEYA 3JQ8B 1Z13A 3QVUA 1N2OA 4YIKA 2C2GA 4DYVA 1NI4B 3LGSA 3MPOA 3FPFA 1TVEA 2F3PA 2Y6VA 4G1VA 4AKSA 3ETLA 5CTJA 2CFOA 2G9QA 3IP3A 3VBCA 3PNBA 1KQFA 3RRXA 1B0UA 1H23A 2XMGA 4R9RA 3RIXA 1JHQA 5HS4A 5CIQA 1A69A 2VAPA 4YO8A 3C15C 3PGJA 4R5HA 2B7LA 3QVVA 2HZBA 2IIVA 2XPCA 3JQFA 4Q4AB 1ODSA 4FMCB 2Y4OA 2O3UA 2IE8A 2VZEA 3OOJA 3QYJA 1RBYA 2G8NA 2WM8A 2ZR7A 3PITA 3R0ZA 1Y8RA 3CIFA 4FGSA 4UDXX 4WKBA 3VYSB 1AG9A 3A2KA 2VKQA 3V7YA 1MH1A 1NKTA 1Y1PA 2VO1A 3PICA 5HKKA 3NHUA 3AEUA 4R16A 2PLRA 2R7NA 5TMBA 3TF5A 4BX8A 2ZIEA 2A9RA 1ABBA 1V1RA 3JQBA 1J1IA 1GVHA 4RETA 1FF9A 1A5BB 3C1OA 3L77A 2HXGA 2OFWA 4IIBA 3C8HA 5EMNA 3SYKA 1MB0A 3ZCUA 2B4YA 4FN4A 4JD5A 4PHGA 1J2JA 5H1YA 2K6GA 3OOWA 4PZCA 2XD9A 3FJ1A 3IO3A 4ILEA 4BFYA 1FDSA 2C8KA 4G37A 2CYCA 4A3SA 1U2DA 2QAGA 5G3YA 3NTRA 1CEEA 2WFAA 1HKUA 1YL7A 3NETA 4JOQA 5COAA 1JA1A 2VLIA 3R3YA 1N4AA 3QFRA 5KCZA 2IYLD 3I2KA 1SB8A 4FDAA 2GN1A 3LUKA 1QUFA 1DBVO 3G0IA 4MK4A 2BGRA 3HADA 2WSIA 4J1TA 5DI9A 1A9QA 5KTTA 5LVAA 4G07A 3H9BA 5LP1A 1E9AA 1UBGA 4IEIA 4JT4A 1RDFA 2DECA 4QUKA 4TTPA 4PYNA 4ZVSA 4R1NA 2ZDGA 4AZ0A 1MC1A 1XXLA 3CX7A 2NQ2C 3ZV7A 4ZK2A 4RTMA 1RKQA 2UYQA 2Z1DA 3BULA 3IS3A 3KXLA 5DCLA 1IXRC 3WISA 5G0TA 2PUFA 3SS7X 5I01A 1V3QE 1FFCA 1LVGA 4L78A 4U02A 2EJCA 2OECA 1ZX1A 4RHYA 1UADA 2IITA 4R4JA 1KMNA 1M5UA 1KYYA 3Q7QA 4FNGA 4KMRA 4RENA 3K2QA 1FDOA 1GSOA 3GP3A 3JRWA 3INTA 5FBVB 1I6KA 1R6TA 3WYNA 1P60A 2CY0A 1Z08A 2B7CA 4MVXA 4Q4HA 3V1TC 3E2PA 5CUQA 4NENA 5L4NA 1OR8A 3JZIA 3PCRB 1TFUA 3FN4A 3KU4A 1J09A 1QIKA 2PVPA 3GFQA 4UVEA 4DL9A 3T5PA 4TTVA 4US0R 1J20A 4HAIA 3SEQA 1SUAA 3GX1A 2SHKA 2PJUA 4XQ0A 5KOJA 3L0BA 4BE9A 4NOMA 4GSYA 3SKVA 3D2AA 4JBIA 3W5VA 3L49A 4HDRB 3PUKA 2WM2A 3HBFA 2P0EA 2HM7A 2AYZA 2J7PA 4G9EA 4LOLA 4B74A 2WWFA 3K73O 2XGOA 2CZQA 5DNAA 2IXEA 4CMKA 2X3YA 3OQMA 3B52X 3MXOA 3H2IA 4PSVA 5A05A 5BN4B 1MAAA 1OKKD 3TQFA 5K0TA 1P2SA 4CGYA 1XZKA 2XHZA 3EMKA 3OQJA 5AVYA 3RC8A 2W90A 4J16C 3T54A 4UD6A 5CJ2A 4OP3A 3BRSA 2Z57A 1W35A 3DE3X 5BYJA 1AGNA 1C0PA 1C9MA 2M1XA 4DDVA 4I4TB 2IOFA 3A3KA 3L06A 4MVYA 1YJQA 1P6UA 4KDRA 4ZYXA 1GLVA 3FMIA 3A9TA 1HDIA 5FNVA 1M74A 3U44B 4RY8A 4UNNA 2IBMA 3WO1A 3SQOA 2R8RA 5LP6F 2EKDA 4DMRA 1VSUA 2PV0A 4CMHA 4HGNA 5JHGB 1QFYA 4Q4LA 2XUQA 3DV0A 4F8JA 1B6RA 1IZ8A 4W5RA 4WBNF 2ZTLA 2ZQ5A 4I1IA 4JA2A 1BWRA 4KV9A 2JAWA 3LDAA 3P0FA 5ERGB 3GMSA 2C0CA 2FW0A 3MWEA 4J76A 5BXQC 2C4TA 4KRYA 3UFBA 3T5MA 3L7BA 3MIIA 2PBLA 4EGAA 2ZIUB 4TL8A 1GNPA 6ABPA 2NXEA 2RFLA 4Q9JA 5HF8A 4WLFA 1VMAA 4H4CA 4Q7LA 1AO3A 2HY7A 3I1IA 3PDHA 2F3SA 5DYIA 5EIXA 5KSPA 3HEBA 5CDFA 3HSYA 1LU9A 3EQZA 3ZWCA 5I9LA 4ZRNA 1B73A 1ZJYA 2QTTA 4I99A 2X9NA 1OT3A 2OO3A 3BDIA 4DMLA 5BR1A 6LDHA 2PXXA 3BB1A 1ZKDA 3BA1A 1CEQA 1V4NA 3L7MA 1ODJA 1UFRA 4TQ9A 3TI9A 1A3CA 5EFZA 4EY4A 1KXZA 3FAZA 4JI8B 1TECE 4MJ3A 1WSBA 2FEPA 3JD2A 1J0XO 3ECSA 3NCTA 1M8PA 1O6GA 2WHQA 3DOEA 4JLBA 2XNSA 5KNDD 3LZCA 5KWEA 3U9SA 4H4EA 2O2XA 2VATA 4K9KA 3UTDA 5LWQA 2VHXA 1DOAA 4J94A 3IAFA 1A9SA 1JVSA 2NN3C 5EIHA 4ECEA 1JYFA 3BIJA 4YT2A 3TMAA 3OJCA 2WWYA 1JEQB 2O8EA 2WP8J 1U7XA 1XXHB 1X42A 4DQLA 3C70A 3NZEA 1Z33A 2DPYA 2H4JA 1NBAA 4TKUB 4WNAA 1G291 4Y6RA 4ZYTA 3AHJA 5A0VA 1RJ9A 3BRCA 1N6RA 3AT1A 2JEYA 2QRVA 3ND5A 1N8SA 4JELA 5CVDA 5FQOA 3VPHA 3OICA 1O57A 4LIPD 2HYDA 3AM4A 2HL6A 4AAYA 2YCLA 3L7YA 2L69A 3HRKA 1ZN8A 4UHDA 1P7ZA 3WL5A 4F8EA 1CRZA 4GI2A 3MJEA 4P7GA 4EENA 3FOBA 5KPJA 2QRGA 1RE1A 1J2UA 1WB5A 2RGAA 1SBCA 4WZAA 4HNTA 3ZD7A 1QZZA 3ADBA 3A32A 3QKRA 4BRWA 5IAJA 5B4VA 5BSKA 4KR9A 1KI8A 5DI3B 2ZIZA 3MJ4A 5KC8A 2XA1A 1ZUD1 1R4ZA 1NJ2A 1DAMA 1Z5PA 2GF0A 3WC4A 4B6GA 1OXUA 3C8MA 1O5IA 5JAOA 2ZYWX 4R2JA 2IWRA 4M1TA 1SEPA 3E58A 4P8RA 1ZBDA 4MYHA 5EMJA 5AM1A 4MYUA 2EGGA 1NDUA 1IBKB 3D6VA 2WILA 1B74A 2QLNA 2A9OA 3U49A 1D5CA 4ISBA 1FXWF 1H05A 2GEFA 1MVLA 3WGLA 1G21E 2R97A 2G1JA 1ND5A 4LZZA 4L22A 3RVDA 2IY7A 3X1YA 3SMVA 3ZBUA 4QFCA 3DOCA 3N2ZB 4QAQA 4C88A 3D54D 2CJPA 4LSWA 3B3AA 3HI6A 4I6JA 3LD9A 3NR2A 2IUFA 2IBTA 3PX3A 1JG4A 3DFIA 4MHOA 4B6OA 1PT9A 1JBEA 1EX7A 4E5NA 5JDIA 4Q37A 4B3RB 2H07A 1X8KA 1Y9EA 3R9XA 1BQ3A 5GM2A 4E15A 1XDSA 4KAXA 1X8LA 3IBSA 3RU3A 3ZLUA 5HX7A 3E9DA 1QHFA 1OA1A 1IY0A 3MSCA 2P67A 4QYWA 1CS4C 4FBMA 4H15A 4UMVA 2AG6A 2GF9A 3TRKA 1BVRA 3JQFC 1AS2A 4FXPA 3BHNA 3SHTA 1JIVA 2H4XA 3L7NA 1JL3A 1P44A 4JCOA