2F7SA

The crystal structure of human rab27b bound to gdp
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
186
structure length
179
Chain Sequence
DYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of human Rab27b
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Ras-related protein Rab-27B
total genus 51
structure length 179
sequence length 186
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2f7sA00
4LJ6A 1E1RD 2XX3A 4M0LA 1WMSA 3VR6A 2GETA 4Q1BA 2D74A 2VBCA 3FDIA 2J9RA 4B2LA 4PO1A 4LSGA 4M1TA 4GFDA 1E1QA 2IEYA 2LCFA 2R6AA 3SJCA 4EFLA 3CRW1 3AGPA 1NVVQ 1T8UA 5P21A 4MDFA 4X8LA 4OJQA 2IF0A 2FU5C 2IWHA 2WZQA 2D7CA 1NN0A 4DZZA 3P1JA 4MITA 5FUXA 5F9FA 1XWIA 4US0R 1E9CA 4OQNA 2VP0A 2X8AA 3MJHA 3SFVA 2B21A 5DE3A 2YC4C 1KSFX 3SZRA 1ZW6A 4DLSA 1E9EA 1FL9A 1HT1E 3TGPA 4F91B 1G5TA 1MOZA 1NF3A 4KBFA 1LF0A 2QZ4A 3B6EA 3FKSA 5BWMA 4NZYA 1RRCA 4B43A 1Z0IA 1GL6A 2HJVA 3NBFA 4ARZB 4EJSA 2DR3A 4D80A 4WOPA 1WXQA 5HE9A 1KI7A 3CIOA 1NL3A 4GBMA 2JLQA 4QM7A 4EQ6B 4C3ZA 3IIJA 2IC5A 2IWRA 1R0ZA 2WJYA 4AC9A 3U3KA 4DUGA 3LXRA 1J8MF 4M9ZA 4C2TA 2IXGA 3M0EA 2R2AA 3EA0A 4Q4HA 2I1VB 1R6BX 2X2EA 4NHOA 2O8BB 4JVNA 1AKYA 5CLQA 4BFVA 4EPXA 2REOA 5UKDA 4CYMA 5AUPB 1YR6A 5C18A 1XPUA 4JJKA 3SE0A 3GLHE 1NY5A 3TLXA 3AH8A 4DT1A 621PA 4RD1A 1HT2E 3WRYC 2ZAOA 2B6HA 4TTRA 1L7VC 4GP7A 1TF5A 2QRZA 2B7CA 4MKIA 4CGZA 3Q5DA 4YLGA 4A0FA 1AKEA 2GEVA 1QHGA 2NPFA 2VA8A 5C46F 1XBTA 3X1YA 3W8RA 1HTWA 4CT5A 3OIVA 1GRQA 4POAA 4PQFA 1LF5A 4JLBA 2EFCB 1SHZA 1U9IC 4TQAA 2FMXA 1G8GA 2IBMA 3LNCA 1OLOA 3LV8A 3WMEA 4ZDKA 5TMPA 4QOSA 2IYSA 3K70B 1ZINA 2V6JA 2YNMA 5GADl 3QXXA 2VEDA 2IYYA 2BJWA 1XTKA 5FI1B 2RGCA 3SBEA 1Q44A 4EUNA 3KKNA 4B76A 3MLEA 3ZDQA 5CM9C 3T34A 4BFZA 2FWRA 2PZFA 3PIRA 1KI4A 4YONB 5KSOA 4M22A 5CITA 5FBLB 4M1SA 1G3UA 4MYUA 3CZPA 3GP8A 1AS0A 4ESVA 4GZLA 1MH1A 2F9LA 5AK0A 4AY2A 4HLUC 2J59A 3CPEA 5EUMA 1ZU4A 3EAQA 1Q0UA 2Z6VA 4Q4LA 2V4ZA 2PJZA 5DGXA 2AD5A 5DISB 5EJEA 1E0JA 4ACAA 3GLGE 1MR3F 2EQBA 3T1QA 5FL7A 3I1FA 4KFUA 4EPYA 4Q7JB 5B2ZA 1KHTA 3LX8A 4DEYA 2CDNA 1DELA 4TQUS 3BJIC 4B71A 3O8DA 5BQ5A 3THWA 3K70D 3ZZ0A 4UNRA 1OKKD 4L4UA 4BE7B 4OQFA 3MFYA 1FUKA 2QAGC 5JWOA 3QKTA 3L8ZA 2OHFA 1EESA 4LYFA 4C0KA 1C4OA 1RYFA 2QPTA 4D6PA 3VU9B 1FOEB 2ZRNA 2QGNA 3D3QA 4R71A 3K9HA 5J47A 2J3EA 4MRRA 4DXAA 4LV6A 2YWHA 5CYOA 1XTRA 1XU4A 3O47A 2QTVB 2ZRCA 4TMZA 3T1TA 2VHJA 1G3RA 3P20A 2Z5FA 2QT0A 5EXXA 3AF2A 2YKGA 4C30A 4AKHA 5JRZA 1YZTA 1UJ2A 2AD1A 2VYFA 4B47A 4QL3A 3V00A 2B7BA 4ZCIA 1OB5A 3U7FB 3IILA 5G53C 1OFHA 3JVUA 2HEIA 2ORIA 2JDIA 2ORVA 1L4YA 1TEXA 3O8RA 2EFGA 4B3DA 1Z8FA 2VF7A 1P60A 1QHHB 3GJXC 3G5UA 4FI3C 2XXAA 3ICQB 1OH7A 1KI9A 2KI5A 2GXQA 4GL2A 2CJWB 2QA5A 4CF7A 3D8BA 4U5XA 4LWZA 3CF2A 4YC7A 1ZNZA 3EIEA 2ZRIA 1NJFA 4C0BA 3OAAD 3CX7A 3WBJA 1FX0A 2GXUA 3BAFA 3FVQA 2FDCA 1PUJA 5KYKA 4U00A 2R9VA 2FN4A 2VL7A 1BMFD 1XFAA 1QHIA 2KBFA 1KAOA 3K0AA 2IYQA 3GFOA 3QKRA 3TVTA 3C14C 1DAKA 5DSZA 2V6IA 2ZS7A 1E2EA 3OEHA 4V0OA 1U2RA 3H4MA 1II0A 2C9YA 4RZ2A 5FTKA 1GVNB 2X77A 4GT1A 4II7A 4LC1A 1Z6YA 3MUFA 2F3RA 2RGEA 4RD6A 2Q9AA 4Q9IA 3RHFA 3BH0A 3DEFA 3DL0A 4JIMA 1D9ZA 3UWOA 3ADDA 2P67A 4KVAA 1SKYE 4RFSA 5GJWC 5FH9A 1Z6XA 4TMXA 2QBYA 2QBYB 1HEIA 5EP1A 4Z51A 3QF4B 4CEJA 1LNZA 4PC2A 1Z2AA 1S0UA 1IXSB 1CRPA 4MRPA 2VLIA 4OQMA 3DHWC 2JLZA 2G77B 2RGBA 2OFXA 3GLHB 2GHIA 3WRXC 3QXJA 4PC3A 5GVRA 2ECKA 3C16C 5L3VA 2GBLC 2IYUA 2GJ8A 5DIFA 1XXHB 4MYHA 5DN6A 1OPXA 4B6EA 3UIEA 4BLTA 2RGNC 1LVGA 1KNXA 1CJKC 1TF7A 2RGNA 2YWGA 5IK2D 1Z63A 5IDVA 3IDQA 3VFDA 1VDZA 3K0CA 2EWVA 4QBIA 4NCIA 1TF2A 3EA5A 4XD7A 4C2UA 4KV9A 2J0VA 2GJKA 2J1LA 4FMDF 1ESMA 3W5JA 4C0AC 2BBSA 2GEDA 3KFVA 4D0NA 2GJ9A 5E4FA 1KSGA 1DBSA 3UWKA 2GF0A 1WRBA 2O8DB 3AKCA 4N1AA 4BECA 4M1MA 5K8LA 1AJEA 1CF4A 2OESA 1T5LA 2QP9X 3GFPA 4TLEA 2CJWA 2GWHA 1KK3A 5AUQA 1XX6A 2R44A 4R2IA 2PT7A 5BYJA 3FWYA 1J99A 1VPLA 3LA6A 3NH6A 3W3AA 1UDWA 1P9WA 1SXJD 1E2LA 1MO3A 1KDTA 3QI2A 3U6KA 3FHCB 3WYAA 2NMVA 4Q48A 4LBYA 1Y63A 4LYJA 2KWIA 4Q4JA 1E9DA 1GL7A 2GEUA 1U8ZA 1N3BA 4S35A 5DYIA 4EAQA 1BH2A 4LGMA 1ZM2A 1T3LA 3CR8A 1IY0A 4B34A 4YDHB 1WA5A 3RS7A 2ZSEA 4KFRA 2VHCA 1P73A 4A6PA 2P6RA 5CJ2A 2ZYVX 1X86B 3ZD7A 1ZNYA 2CLSA 4EPVA 2XGJA 4RD4A 3ZVMA 4XTCS 2FPMA 2UVQA 2XTZA 1JEDA 3NC1C 5EE1A 4DCUA 1G3IA 1E0KA 1BS1A 1XTJA 1Z6AA 2BM0A 1Q57A 4GP6A 2YJTD 1S1MA 5J4KA 4GMXA 3T61A 1NG9A 2GF9A 1BOFA 1NVUQ 3Q5EA 4NE2A 4EKDA 1ZVQA 4WVFA 1R0XA 1UF9A 3FGNA 3K9NA 1XJ0A 2HYIC 1KYIA 1NVXQ 4CEHA 3EZ6A 1HA3A 5EP3A 1SXJB 2OE2A 3LDAA 3EARA 3S1AA 4P3YA 3TUJC 2W0SA 1OV4A 2O8FB 3LFUA 3LD9A 4E5UA 4RCZA 1E99A 2N42A 2AWOA 2ZE5A 1CXZA 1Z47A 3H0KA 4D4MA 4MA4A 5KDDA 3THXA 3JZMA 1XF9A 5JCZA 3DKPA 2YYZA 3KX2A 4B35A 1T9HA 3DOFA 1MO5A 3AUYA 4DSUA 1MRNA 5ELXA 1T8TA 4QHTA 3KZ1E 2J7PA 4TL9A 3A1WA 1M1YE 2CE2X 3OZXA 1R5NA 2A78A 2ZETA 2D2EA 4PZYA 4TSFA 4CDGA 3NHBA 3I61A 4P32A 1P2VA 1S8FA 3CW2A 4O2LA 1RRPA 2IYLD 4BRUA 2W00A 3LLUA 1P72A 4DLUA 1SVLA 4QGFA 1IXRC 1U8YA 1DEKA 1NSFA 2IUSA 4O3MA 3ZQJA 4KAXA 4D4KA 3B5JA 1RYHA 1JPJA 3B1ZA 3SC3A 3GLFB 4Z8YA 3SU8A 3AF4A 3KB2A 1CR2A 1GKIA 1U94A 2ZRGA 1N5LA 5HTKA 1CR1A 2QEQA 2WSSD 4L9WA 4HLUA 1P5ZB 1UDXA 4JLKA 1G6HA 1ZYUA 2VIIA 1TU4A 3CLVA 2R6CA 3E1SA 4C0HA 2ZI4A 1QZXA 2QTFA 4PAMA 1VIYA 1P62B 1Z28A 2ZYUX 1ZD1A 4L9SA 2ODEA 1UM8A 2I3BA 2OCAA 3NIBA 3LQRA 2GA8A 2RHDA 2WTUA 4PHFA 4G01B 5EXPA 3K9GA 3QPUA 3BXZA 4H1VA 3TUIC 4NMMA 3RS4A 1ZBDA 2X1VA 2V8OA 3BH6A 1YZNA 3UK6A 4FMCF 4HI0E 3AP1A 1E69A 1IN5A 1KMHA 2HCJB 2HDNB 3REFA 1XTSA 3OESA 3AVQA 5HCNA 1CP2A 1II8B 2VH5R 4D82A 4ZKEA 4DIDA 4PANA 1US8B 1MV5A 3A1SA 2BOVA 3C5HA 2Q3MA 2Q0HA 4GOJA 2JLUA 5KPJA 4IEIA 4QHSA 4H1UA 1G19A 1TQ2A 3LBIA 2WPDA 1XCPA 1BYIA 2ASEA 2BMEA 1H8HD 4AURA 1DG1G 1ZCAA 1JJVA 1J2JA 1R7RA 5JZVA 1N5IA 3GEIA 4LOAA 2E9SA 1TQ4A 3IEUA 4URXR 4DLZA 5JCPA 1AS3A 2QTHA 2GRJA 3R7WB 5CB8A 5JI3E 1DO2A 4Q4JB 1IN6A 1E2KA 1W2HA 2I4IA 1JQLB 1YZKA 3QQ5A 4US1R 4XVUA 3K0EA 1B0UA 1NIJA 4AIIA 2ZE7A 5DLQC 1JXMA 2F1JA 4DCVA 2IYZA 2IYVA 2VP4A 3CH5A 1OFIA 4OI4A 2GNOA 1Z5ZA 1S3GA 1R8SA 2A3RA 2BIFA 3DM5A 2CLDX 1G3MA 2ZU6A 2XAUA 4CVNA 3QUSA 3BC1A 2ZJBA 3AEZA 1JXOA 2CHGA 4TQ9A 5AUOB 4TZ0A 2XB4A 2NO1A 4MRVA 5CIWA 1PUIA 2UZIR 4KYUA 4AK9A 1COWD 1J90A 2AX4A 3BFXA 1NG1A 1ZC3A 2GXSA 4HB4A 4KITB 4CEIA 4OYHA 1SVSA 2OLKA 1E2JA 5L3QA 5K8IA 4DKXA 2IA5A 3CWZA 4HDCA 4G5OA 3S1AB 2R8RA 1YR7A 4L16A 2CXXA 2GK7A 4TYPA 2GCOA 2ZYWX 3RABA 3BE4A 3TSOA 3PQCA 3CRQA 1OXTA 1OJLA 2BMFA 1CRQA 1J8YF 1AZTA 1GZSA 2WM9B 5BN5A 1NVVR 1YRAA 4LJYA 3G82C 3EG5A 5KO2A 3D31A 1KMQA 4OK6A 3OHMA 4PQYA 4JKIA 3CPHA 4O25A 4DBLC 2P5TB 1WF3A 2G9NA 1T4GA 1JB1A 3GLGA 2DPXA 1P2SA 1GNPA 2F1IA 5G3ZA 1G8YA 1G41A 1KSHA 1ZM4A 2JJ1D 3LQQA 5D3MB 4TYNA 2V3CC 4GDFA 3CB4A 1W0JA 3EPJA 2PLRA 1K8RA 3EASA 2GJSA 3X1DA 4LJAA 4TLDA 3VR3A 1VG1A 4MUBA 3PUYA 4RD0A 3BBPA 2KBEA 1D9XA 5DN6D 3B85A 4ASUD 1V5WA 2QAGA 4KODA 2QRNA 3AP3A 5KDLA 1SVOA 1EFHA 4DDVA 3QPVA 4OHXA 1NN3A 1D2EA 3SEAA 1F2TA 2BEKA 5K8TA 3PJRA 5LB4A 2O8DA 4JLMA 1KO7A 3IPYA 4NTZA 2QMHA 1W4CA 2YOFA 2WWYA 5EE5B 1QHHA 4AG5A 1XJQA 4PTLA 1EG7A 1FPMA 3AVTA 1XD8A 1VG8A 1P61B 5A5GA 2VP5A 1E0SA 1KSJA 3RYTC 2B8TA 1KI8A 1AGPA 1Z6TA 3D6TB 3QIAA 3PV0A 5J40A 5DI9A 5KSPA 1M7GA 1Z3IX 2R6FA 4P4SA 3OEHD 1T3HA 5CM8B 1Z6GA 3H2YA 1G8FA 1Z22A 4I1SA 3PEUA 4PPQA 1YQTA 5FBWB 2ZU0C 1KKMA 1IOZA 2QORA 2RH5A 3QEJA 5JI2E 2OZEA 3FHTA 4N3NA 1G20E 2RGGA 3AV0B 1BMFA 1R0WA 3RSOA 2ZANA 1IJEA 4C4PA 3TE6A 5FOXA 4W5WA 4CT4B 4QBGB 3EX7C 4QRHA 4K46A 4LYAA 2ONKA 3ZZTA 2ZE6A 2G83A 4P33A 2VRWA 5AUNB 2RGAA 5TXGA 1VMAA 4PZZA 3AGQA 4RFSB 4FCWA 1F60A 2C98A 4QBHA 1GSIA 4M8NE 5HR5A 2ZSFA 4A1FA 2HT1A 3FTQA 4V0MA 3T12A 1KZ7B 1S9HA 4LHXA 3A1VA 3GCGA 4NL4H 4Q02A 4TL8A 4Q7KA 1G16A 2ZXUA 1L8QA 1G18A 1U0JA 3ZJYA 4GMDA 5JFGA 2QNRA 2ZR7A 3FMPB 4H9GA 1DVRA 5JSZB 5KSZA 4WA7A 2XSZD 1W4BA 3A58B 3DO6A 4OI2A 1N0WA 521PA 1W36D 1FFHA 2V9PA 4MQBA 2C78A 4XIGS 5D3QA 3B1XA 4LCBA 4AD8A 2FPKA 1II9A 1GKYA 5G40A 1X8LA 3I32A 3TSZA 1AIPA 4ABYA 2NO6A 1P9NA 3WYFA 1X1SA 3VMFA 2F1RA 2ZI3A 2Q6TA 4A8JC 3BERA 3V4FA 1XCMA 1RE0A 2VHQA 3ZVNA 1W44A 3EC2A 4FMBB 5L3SA 3IHLA 1JAHA 1ZUNB 1VG0B 2JIZD 3MJRA 3QXCA 1KI1A 1COWA 2R6DA 3U3RA 2O0HA 2FGKA 4BLOA 2PMDA 1UFQA 2OT3B 3UG6A 1DG3A 5DYGA 1FP7A 3AM1A 2J0UB 4O2RA 1NMYA 3RC3A 3KDSE 4HATA 2NO0A 3K8YA 3PCRB 3OF5A 4LJ7A 5E7JA 1UBFA 4F4JA 2WBLC 1KK0A 1W2GA 1ANKA 5KOYA 3QNUA 2QENA 4B6FA 2GZHA 2ZM5A 3UMFA 1XEWX 1EK0A 1RJ9B 3W9YA 4TYYA 1QRAA 3CR7A 3NC0C 4IXNA 5KPDA 4AYWA 821PA 1RIFA 2PT5A 1DAFA 3R9IA 5KUTA 5SZJA 4JVSB 4UNSA 1KMHB 3VU9A 1R0YA 2G3YA 2XITA 2G88A 4AWXA 2C9OA 2HCBA 3SYLA 4A82A 1KO1A 3EWAA 3EZ7A 3NBZC 3OFND 2WICA 3U3MA 1P7CA 3SR0A 3KQNA 1VTKA 2DBYA 3MWYW 4M1KA 1IJFA 1L4UA 3QOFA 4M9QA 4WZ6A 1EFTA 2XTNA 2BBOA 2C2HA 2IS4A 4IOMA 3GJ0A 1CJMA 5SZKB 4BFXA 5G3YA 3L82B 4NBSA 2IXFA 3GQBA 5JMTA 2D06A 2KJQA 2GJAA 2QAJA 1QHSA 2DCUA 2ZI7A 4R7ZA 4AYTA 5FL3A 4KLNA 5L3RA 1MABA 4G5SA 1IN7A 2P3SA 1KJWA 2JIZA 4P0TA 1O3YA 4IFBA 5FI0B 1E0AA 4ZCLA 2XTMA 2QY9A 3CF0A 5TVKA 4DEXA 3CM0A 3TNFA 2JLYA 3B8HA 1E98A 3KQLA 3OIWA 3TAUA 1OE0A 2VTKA 1OB2A 2CCJA 3IQXA 4K81B 1W48A 2FA9A 4OL0A 3QG1A 1WE2A 5BN4A 1J7KA 4M9SA 1NJGA 4A2WA 1G3QA 3NEJA 3RAPR 5K8UA 1W4RA 1V43A 3UANA 4DUGD 3K70C 4FCVA 2HXSA 3B1WA 3X1ZA 3ZLJA 4B44A 5KNCA 2OUKA 1A5TA 2XSZA 4EDHA 4HLCA 1U98A 3GEHA 4YMVA 3B13B 3FKSD 5AJWA 1SVWA 5EZ5A 1CBUA 3K0FA 4KCGA 3PXGA 5FPHA 4ZO4A 5TY0A 1NBME 4YMUA 1G4AE 4LC0A 1EGAA 4LHYA 1LB1B 1ZP6A 4NYJR 3ADBA 1HQCA 4G1UC 4JKYA 5JJLA 2AXPA 1E9AA 1E2NA 4FWIB 1ZM3A 2C96A 2C04A 2HLDD 1S1CA 1W49A 1BYUA 2OM2A 2NOAA 4Q4HB 2O52A 1SVKA 2QN6A 2ZRHA 1E2DA 4JL6A 1W36C 1QF9A 4MRNA 3TK1A 3I92A 5LB2A 1P6XA 3W6PA 1T6NA 3D7MA 1F6BA 1S2MA 2GAOA 3WBKA 3TR0A 1YZLA 1S3SA 1X3SA 4TTQA 1W1WA 3IO3A 5FOSA 1XRJA 3TSWA 1Q12A 4AKGA 1KKLA 1UEIA 2J7PD 2ZVQX 3AB3A 3NBXX 2GDJA 4HAUA 5FR1A 4QFMA 3QKSB 3AF1A 2NQ2C 1HE1C 1XEXB 2HUPA 4F93B 4IEEA 1N25A 4XVRA 2QQEA 2ZI6A 3IKJA 2A9KA 4BFWA 2CHQA 3T1OA 2IXEA 4Q9HA 5HE8A 4M53A 1B23P 4I4LA 5EZ6B 4BZPA 1OH8A 3SBDA 1TAGA 5GVSA 2D2FA 3C4JA 2VF8A 1DS6A 3C15C 2IYRA 4UNQA 3PEVA 5SZHB 3GJ5A 3REGA 4BLSA 1W4AA 3MCAA 3ICEA 1TL7C 4V03A 4NCKA 1KY2A 1T3SA 2OSBA 1GUAA 2ERYA 1E79D 4ASUA 5JRJA 2HV8A 3U5ZB 3RLFA 1BKDR 3RDPA 3MWJA 4FN5A 1G21E 3BIFA 3RS3A 1NY6A 1KO5A 2ZSBA 4NU0A 2A5DA 4OI1A 1EX7A 2LKDA 4FMCB 1RRFA 1W0JD 4HYYA 4RZ3A 3ZGXA 3GLIE 2J0SA 3HWSA 2FZ4A 1N6IA 4KYIB 2OCYC 1X1RA 1E4VA 5EUQB 1E2HA 3EZ2A 4LBVA 1HQYE 2IEZA 2ZRFA 4UNNA 5FBRB 2ZIAA 4DLXA 1NMXA 2WIBA 3FMOB 4RD2A 4LPKA 3SI7A 3V4RA 2BMJA 2W6JD 4FCTA 1SXJA 3SQWA 3PR1A 2VP2A 4PAOA 3CRMA 5FPKA 3ZD6A 2E1RA 1H65A 2FFQA 2ORWA 3B7GA 4GI7A 1A1VA 3ZZUA 1XTQA 2P2LA 5GJVC 4JLDA 2OFOA 3MMPA 721PA 3DZ8A 2DFKB 3QEOA 3R7WA 2GCPA 5KHOC 2QAGB 4RD3A 4C0JA 3SYNA 3BB4A 3AF3A 4XWKA 1JQJC 1ZM9A 4RCYA 1KDOA 4XD7D 3QKSA 1IBRA 2CCGA 3T06B 1VCNA 3F3YA 4URWR 4MDEA 4MGIR 2C03A 2MSCB 4JVLA 5FBQB 2OO7A 3GJ7A 4A0HA 2REBA 2BMDA 1EFCA 2RAPA 3CONA 3KKPA 3NBYC 3AKDA 4HUQA 3GLGB 4D2IA 5F2EA 5FTJA 4AKEA 4NYIQ 2D7DA 3WP0A 3NTUA 2ZUBA 4YMWA 5HZHA 4NYJQ 5AJXA 3FPAA 3KKQA 4A36A 3ADKA 2OILA 2CL7X 2Q3HA 3VQTA 1MO4A 1EFUA 5CDFE 3CH4B 5J4LA 4B3XA 2H7VA 3CBQA 2ZYTX 2XXAB 4PPGA 5B64A 3HDTA 3RSLA 4BASA 1PZNA 1ZU5A 2WMNB 3H86A 2AFHE 2FGJA 2J45A 2ODWA 4Q1DA 3ZS8A 3K0FB 4A15A 3GLIA 1GM5A 5M04A 2A5YB 2FSHA 4GOKA 2ZE8A 5JEDA 2RB4A 1TQDA 1R8QA 2RCNA 2GZAA 4KXFB 3A4NA 4DB2A 3EZFA 1H8HA 3CUEF 4FINA 3A1TA 4JLJA 2IS2A 1P2TA 3UKDA 1NKSA 1DAIA 1XMIA 2ATVA 3KKMA 3KL4A 4IDHA 3T35A 3B2EA 1T91A 1AM4D 3I4LA 1YU9A 5KNBA 2TMKA 3EPHA 3DOEA 4YXWD 3QPWA 1IY1A 2ZSDA 2GAAA 4URYR 3PEYA 1X8JA 3CNOA 4HB0A 1CS4C 1TPZA 4B2IA 2BEJA 2HLDA 1OT3A 3AVYA 1G6OA 2GCNA 1AQYA 3O8CA 5LPNA 4M9XA 2PH1A 4JYCA 2WAXA 2CMKA 1I4DD 3A1UA 1PJRA 1XEWY 5TDHA 4UJ3A 5C2JB 3U4QB 2QE7D 3C7KA 2CBZA 2F43B 5KU1A 4C7OB 2V55B 1TUIA 1C1YA 5GJBA 4I81A 3GD7A 3TQFA 5JBQA 4BPBA 4DCTA 2WIAA 1F5NA 2Z83A 1WQ1R 1UKEA 3IEVA 1FMLA 1SQ5A 1SXJC 4JLAA 1OFTA 5FPSA 4P4TA 2AFIE 5CK5A 4M1WA 1ZMXA 3IBYA 4PC1A 2WJHA 1F3OA 3WYGA 2PBRA 4W5HA 3Q8XB 3THXB 2WAYA 2WSSA 4LRWA 1SHKA 2AL7A 4OK3A 1DAMA 4MYCA 1TQ6A 2J46A 2W2TA 4HLDA 2YINC 1ZIOA 4HZUA 3MGCA 4MGZR 1HY3A 5FOWA 2RHMA 4IVPA 1R5OA 3Q3JB 1GNQA 4YQFA 2FZLA 1H8ED 3DM9B 3W6NA 1CEEA 4LY6A 4IVRA 4CEHB 5EQTA 1RKBA 4BFSA 2AWNA 1IXZA 1OKKA 5C1BA 1N6OA 2BKUA 3L0IB 5EP4A 2C99A 1P9RA 2KSQA 2N1BA 2VHTA 1QHYA 4TSFD 4B75A 5JHGB 3BOSA 5H68A 3N5CA 1XD9A 1TEVA 4JJZA 4D0LB 2OEPA 1XDBA 2IYTA 5TARA 2F1HA 2FFAA 4WXPA 2F9MA 4QM6A 3HR7A 3OEEA 2OG2A 1UPTA 2WOJA 4WAUA 1G7RA 1UKVY 5EXSA 2FPLA 3HU3A 3VHLB 3QVUA 4TMTA 2GILA 2XJ4A 4B74A 5L3SB 3AP2A 4PFSA 4XH9B 3RRNA 2XNDA 4DLTA 5JHHB 3ZQ6A 3P26A 1VCOA 4I1UA 4LBZA 1FMJA 4Q18A 5JWHA 3OFNA 4EPWA 2QU8A 5J4YA 2ZRPA 2D62A 3W90A 2VSFA 3U2QA 2N46A 4GZMA 2CL0X 3FKQA 3QBTA 2QSYA 3VNUA 2GVDC 2ZROA 2ZJAA 3B9QA 4QGHA 4GPTA 4KSCA 4E22A 1W7AA 1TADA 3AVUA 1JECA 2W58A 2CCKA 2DFLA 5C4MA 1IQPA 2GBLA 4NH0A 4PX9A 3WNCA 3THWB 5FTMA 4QKQA 3EIHA 1T0JB 2JEOA 3ZH9B 3O8BA 4IJMA 3QF7A 2OAQ1 3KXLA 3MWKA 3SQXA 4XWOA 5C4GB 2IS1A 3ZS9A 1NLZA 2DYKA 4N0EA 2F7SA 1K5DA 2JAQA 2XJ9A 3LW7A 3DMDA 3NXSA 3NDPA 4PPNA 1VG9B 2L0XA 3B82A 1KNQA 2OXRA 3ECCA 4QJ4A 3VKGA 4TL7A 1GNRA 3OE7D 2H18A 1E9BA 1VYUA 2C8VA 3GLHA 4KSBA 3U3JA 3GPLA 4GNKA 4GRAA 2NG1A 4IOKA 3X1WA 2ZQ5A 4ERNA 1A7JA 2P0EA 4C0LA 1Z0FA 4RVCA 2ZITA 2RGXA 1Q1EA 4ON9A 1DPFA 2Z4SA 4IDQA 2WJIA 5F98A 2LWIA 2BM1A 4EFMA 1NLYA 1FNMA 3PUXA 1ODFA 3MD0A 4PR0A 4EPTA 3KQUA 5DH9A 4ZDWA 1Z29A 4DDTA 1LTQA 1XP8A 4IDNA 1PV4A 2C77A 2HT6A 1HUQA 2EYQA 4EFNA 4LDJA 4A92A 1A82A 1VIAA 5J4HA 4CZ2A 2IK8A 4MRSA 1QDEA 4S2EA 3RRZA 3GJ4A 3QXSA 1JBKA 2WVJA 4IHQA 4C9BA 5J5CA 1CULC 4M21A 4WBSA 2H16A 4ZCMA 1OXUA 4KHZA 1S9DA 4HB2A 2DFTA 4OHYA 2OBLA 4JS0A 2C5LA 4JLOA 3QENA 1F2TB 2EWWA 2PCJA 3ZIAA 4UKDA 3QG5A 2ZUDA 3K09C 4OQXA 2LKCA 1UBEA 1GG2A 1GAJA 4DB4A 2B92A 4DDUA 1ESNA 5JJKA 1CR0A 2MMCA 4PO8A 4F7WA 4EQ6A 2JLXA 2NTYC 1IN8A 2G0NA 5FUYA 3MWLA 4TL6A 4G0NA 1XJCA 2GTPA 4XJXA 2VO1A 4MGYR 3I73A 3RS2A 3ZVRA 3FB4A 4KJZA 2MMGA 2A2ZA 4RJLA 1Q3TA 3TIFA 2REXB 4BWYA 1XMVA 4ZDJA 1QVRA 4Z8XA 2CNWA 4IOJA 1KJZA 4X8OA 3OIYA 3Q72A 421PA 2OXCA 1SZPA 3WNDA 4LJ4A 2WOOA 3QY0A 4BFYA 1M7HA 1N6HA 3UG7A 2CK3A 4RZXA 3GJ3A 2QQ0A 3LAWA 3MSXA 3U44A 4BLQA 3SHFA 2ZPTX 4BLPA 1CTQA 1I4LD 4I1OA 1KTVA 1OSNA 1R4AA 3PG5A 4E03A 4ZI3A 1T5IA 1W5SA 4V0NA 1CJUC 4Q5IA 2GKSA 2WJVA 1EX6A 4Q66C 5JS8A 2H17A 2JDID 4DWJA 3J81k 2CL6X 2YC2C 4TN1A 2AHOA 1KIMA 1JNYA 2WJGA 2WKRA 3W6OA 1OIXA 4LJ5A 4DLWA 1XZPA 1GTVA 2ZJOA 4TYQA 2JJ1A 4A9AA 5JLJA 1XB2A 2QP3A 5E95A 4LYHA 5AJYA 1U0HC 3PUWA 2OFWA 4W5JA 5FUWA 1IN4A 2EVWX 5HCIA 1EWRA 2ZTSA 1P3JA 3ASYA 2BVNA 4M4SA 4Q9KA 4B32A 1GFIA 4BEJA 4WIAA 1BO6A 5HKKD 3GMTA 4YMSA 5EXTA 1FP6A 5SZIA 4LV5B 4QBFA 3GLIB 2OBNA 1ZJ6A 1IHUA 1NVWQ 2MSDB 4MKFA 3R20A 3LH5A 1ZNWA 2R62A 5BXQC 1Q1ZA 4TMWA 5B30A 4AKIA 4BFUA 4WW0A 1ETUA 4FWTA 2FSFA 3RC8A 2WWGA 1DADA 3PEWA 2YV5A 5CIQA 4G5QA 4LJ8A 1E6CA 3PENA 3KUDA 2YZ2A 4B3FX 4DJTA 3VNVA 4HAWA 5IRCD 2JLWA 3M4YA 3L0SA 4TZ6A 1SKQA 1KO8A 5CLLA 2VHUA 3IHWA 2BBTA 2QI9C 3FFBA 4NCJA 1TUEA 1FUUA 8OHMA 4ZI2A 3W5IA 1OHHA 1YVDA 3VR4A 2PEYA 3VKHA 4BUJA 5BW8A 1GDDA 3RS5A 3AF0A 2FF7A 3VTKA 1G8HA 5FL7D 1E32A 3VKWA 3I72A 1GILA 1IAQA 1XEXA 2PMKA 3T15A 2V1XA 2ZS8A 6Q21A 4RY2A 4LJ9A 4A0GA 4CIDA 3KUCA 4MGKR 4DHEA 1CU1A 1SXJE 4KLZA 3LX5A 3R8CA 1S96A 1US8A 3BK7A 3M1IA 1NSTA 4DT1B 1I2DA 4IKEA 5E7MA 1UKZA 1II8A 4FW9A 2Z4RA 2ATXA 3BFKA 4D81A 4QJ3A 4F38A 1LFDB 3OIUA 3AUXA 3AKEA 1DARA 4BQSA 4CRWB 2FSIA 1MO6A 2QROA 3QKUA 4GSYA 1KDRA 2CE7A 4A4DA 3EZ9A 2A7QA 2OV2A 4BGDA 3LW8A 4MYTA 1ONBA 1Z0JA 4RSGA 2VPPA 1G8PA 1F48A 3P4YA 2AR7A 2ZI5A 4HB3A 3WP1B 1UEJA 1Z08A 1OH5A 1YZUA 3DPUA 2XOKD 4U02A 2Q9BA 1I4TD 4MH0R 4QNMA 3Q7PA 3RVBA 1RPZA 2VP9A 4LPSA 2ANCA 4Q7LA 4RZUA 3VR1A 5H1YA 3I5YA 5LD2C 4NCNA 4ARZA 4EJSB 3I8XA 1N6RA 3SS8A 3THOA 1Z06A 2JJ8A 2BV3A 3U7HB 2WPDD 1KJYA 2IW3A 3SYKA 1KGDA 1RRGA 2H57A 1KO4A 1OFUX 2F55A 1CR4A 2JGNA 2W2VA 4Z1MD 3E2IA 4TLBA 3VHXA 1VECA 5JJIA 4TWZA 4AI6A 2OCBA 4XSGA 4Q1CA 4Q9JA 1YRBA 4P31A 3UPUA 2BCGY 1GOTA 2PL3A 1G64A 1OIVA 4IOLA 5CDFA 4DCNA 2F43A 4D4LA 5JS7A 3DZDA 3IQWA 4TTPA 2C95A 4JT4A 1W0KA 2ODNA 1KI6A 2JLVA 2YOHA 3SN6A 2G0TA 3WMFA 2YHSA 4LHZA 2YWFA 3H1TA 1F2UB 1F2UA 2NO7A 1IONA 5B58C 1XD2B 1U0LA 1YZQA 3FMFA 4C0SA 1P2UA 2PZEA 2Z43A 5A0FA 3EPLA 1OYWA 4NYIR 3Q7QA 5L8VA 4G3XA 4F92B 3PITA 3IPXA 1FNNA 4IVQA 4LHVA 1EFRD 2GZDA 2QM8A 3A6PC 1P4SA 3CO5A 3NH9A 2D4HA 4M1OA 4PZLA 3AKYA 1NLFA 2KB0A 1RC8A 1ZUHA 1KDPA 4NCHA 3SHWA 3CKLA 3AVPA 4JL5A 2XB2A 1JR3E 2CVFA 2G1KA 4FMDB 1YR9A 1DO0A 3A8TA 1M34E 1JR6A 2WV9A 3A36A 3DVLA 2J41A 1EFRA 3ADCA 1ZRHA 1XCGB 2JCSA 2ZREA 2SHKA 5IF9A 3P27A 1FTSA 1OXSC 2QL6A 4QGAA 2O8BA 2OCPA 2UZ3A 3SDZA 2A5GA 4E07A 1RZ3A 1UKYA 3CX8A 2BHRA 2ZUCA 4A8JB 4A8JA 1TU3A 4NKRA 3TUZC 1HYQA 4DSTA 1E1QD 4F4CA 1DTSA 1CJVC 2W83A 4BLRA 1GKUB 4X8MA 1W0KD 1JALA 4IW3B 4DRZA 4DLYA 4LI0A 4C0QC 3CPJB 2FFHA 4JMPA 3RANA 3W3ZB 2PLFA 2OLJA 1N5KA 1KZGB 2J0UA 1QHXA 1DAHA 2CVHA 5AJZA 1Q20A 3BH7A 2VQSA 4OHWA 1N0VC 2FFBA 2FSGA 2DY1A 2ZVPX 3KJHA 4UXHA 4A2QA 1XD2A 4LX0A 1JAIA 1T0HB 3U6BA 5FOTA 1XNJA 2BDTA 3L2OB 1VCMA 2QT1A 4I1VA 4IXMA 1A4RA 1M2OB 1O87A 5EE0A 3WHKA 2ANBA 1HURA 2ZI9A 2YVUA 1YKSA 3LWNA 4LBWA 3KQHA 1E9RA 3WXMA 4PC7A 1S4QA 1AN0A 3SNHA 4US2R 4D26A 1MABB 1CJTC 1R10A 2V1UA 3AVVA 1D2MA 3H84A 2ZJ5A 3U3OA 4OK5A 3VX3A 3KJIA 2FEMA 4HAZA 2JATA 3F8TA 2A5FA 3WNBA 3IBGA 2ZR0A 4DDWA 2QPAA 1G291 1MT0A 3AVOA 4JSTA 3M6AA 3SJAA 3CNLA 3I62A 1VHTA 4A2PA 2CLCX 2JJ2A 3GFTA 1NI3A 1KY3A 1J70A 3LVQE 1Z0AA 1YZGA 1XXHA 3QXHA 4K8OA 5EE3A 2QP4A 3BRWD 4IRUB 4OI0A 5CYPA 2O8CB 5CK4A 4HDQB 5LD2B 4OBEA 3TQCA 3K0SA 4AG6A 3C5CA 2ZJ8A 5AR1A 5GJCA 2ZAMA 4G5RA 3R9XA 1XZQA 1M7BA 2RKOA 1JPNA 1NRJB 3PUZA 4W7SA 3QVVA 3HU2A 2AKAB 2IHBA 2ZRDA 3QF4A 5EP2A 5FUVA 5HZKA 2ZRJA 2DB3A 3QSYA 4PHHA 2W2XA 3B1YA 5FOVA 2QMUA 1Z07A 2IUUA 5JEEA 4Q7MB 1YHNA 1I2MA 2IYWA 4TMVA 2ZRKA 5IK2A 1TNDA 5HKKA 1MKYA 1YE8A 2QMOA 3NDBB 3K9LA 3BWDD 4QGGA 1M74A 2W6IA 3PVSA 4JBYA 3NEYA 2PZGA 3KKOA 1ELOA 1E2GA 3TMKA 2E87A 1WBDA 1AGRA 3TW4A 3KJGA 2PCLA 1CLUA 2XNSA 1NBMD 2WWIA 1OXVA 2OBMA 4TT3D 4V0KA 1G4UR 2O0KA 2FJUA 3I8SA 3PUVA 1OW3B 2ZRMA 1G7SA 4KFTA 4FXPA 4R98A 1D2NA 1D5CA 3Q9LA 4UNPA 2IS6A 3EW9A 4OKSA 4KU4A 2ZRLA 2AN9A 4R2HA 4TLCA 4KBGA 3JVVA 1FZQA 1QVAA 1W5TA 4HAYA 4B3BA 1Z0DA 3A4MA 4HDOB 2CK3D 1AA9A 4QG7A 1GRRA 2J7KA 1DOAA 1AS2A 4TYWA 3L8YA 2BC9A 4DC9A 2Y8EA 2JA1A 3UMRA 3VR5A 4V0ME 2Q9CA 4Q1AA 4URUR 1ZM7A 1G7TA 3T5DA 1M6NA 2WSMA 4LUCA 1VYTA 2CNWD 4DSNA 3MAAC 1E3MA 3CZQA 1OXXK 5D3MA 4JZKA 5H8WA 4B48A 1Z83A 1JR3D 3K53A 3MRSA 3F0TA 3HPRA 3KB1A 3OAAA 3GEEA 3FYHA 3LLMA 4JLPA 3ZYCA 2DWPA 4QJ5A 5FTNA 4HSEA 5LBIA 1A2KC 2I1QA 2RMKA 4Q21A 4B3CA 1NIPA 3ZVLA 1Q22A 3I3SR 2EYUA 4WZBE 4EPRA 3IO5A 4CEJB 1U90A 2JLRA 2YOGA 2XZLA 5TV2A 2FE4A 1GL9B 4QC2A 4BFTA 2O8CA 3ZIAD 4KVGA 2P65A 4WZAE 3LO5A 3THYB 4HEJA 2WKPA 4CEIB 5KTYA 3W8NA 4OQLA 3QKRB 3IUYA 4BRWA 2W6ID 5CB6A 4P4SB 2HF8A 1AZSC 1G17A 1HV8A 1UBGA 2W0MA 3ASZA 3KXIA 2XZOA 4DVGA 1UAAA 2Q3FA 4WXRA 5DHAA 1XPRA 4B2PA 4XOIA 1FX0B 3K0AB 2NGRA 3HU1A 3BGWA 3K0CC 3BB1A 4Q03A 3NWJA 2EFHB 2ZSAA 4IFEA 4IDPA 3WMGA 3T1VA 2AXNA 3LRPA 5FR2A 5H70A 4JBWA 4F4IA 4HZIA 1D8TA 1W46A 3TW8B 3A4LA 3ETLA 2B8WA 2IT1A 4PXAA 3KJEA 3RRYA 3VX4A 1N6NA 4B33A 1KK2A 3CF6R 5J4VA 4PQRA 1XTIA 3LY5A 4URVR 3HJNA 3GLFE 1YR8A 2WWWA 1PVOA 3UXMA 3SJZA 1QHNA 2DWQA 5IHPA 2O0JA 2Q21A 5FBVB 4HLQB 4NP6A 4HAVA 1CIPA 3UMSA 2WMOB 1G5PA 3OE7A 3RWOA 4AYXA 1NN5A 1SULA 2ZRBA 3B1VA 3X2SA 1TTTA 2PJRA 2FNAA 4A0RA 1UADA 2ZJYA 3I5XA 4NYMR 1DAGA 4BZXA 1E2IA 4P4UA 4Q4AB 3G0HA 1Q1QA 2QUZA 1N5JA 2H1LA 1W36B 4JLNA 4BEBA 1LY1A 2QMEA 3LBHA 4QNRA 3RRMA 2V7QD 1U99A 1Z0KA 2PX3A 1CKEA 2J0QA 4EJSC 1QG4A 2CHVA 2IHYA 4V0LA 4ZKDA 1XXHE 3MG9A 4EIWA 3RS0A 5G41A 5FOUA 3EIQA 1VHLA 3V9PA 2XEXA 1FTNA 1X8KA 2NZJA 2J5XA 2R65A 2IF2A 5KSYA 1OF1A 3HPQA 4DLVA 4Z54A 3IIKA 2H5EA 4ZV4A 2QG6A 2V7QA 3E70C 5LDDC 1SKYB 3KFXA 1VYVA 1E2QA 1ZD8A 4LK2A 5A4JA 3HP1A 4PSKA 1N6KA 3TAHA 1IM2A 4YDSA 4HUTA 5IT5A 1OYYA 4PHGA 2XNDD 2V54A 2O5VA 2ZJZA 5FTLA 1GITA 1LS1A 1FQKA 1YJ5A 3OEED 3AVWA 4C7OA 3U61B 4I99A 4Y0AA 1NNEA 3BS4A 1WP9A 2EW1A 3CRVA 3GLFA 4L8GA 5KDOA 2KE5A 1LS6A 3FHOA 3L43A 2FOLA 2OAP1 4UXJA 3FE2A 5F3WB 5TB5A 2GXAA 3AVXA 2FG5A 3EC1A 2D3WA 4ZDIA 3U7EB 2ZR9A 4ITRC 2QPOA 3A37A 1AK2A 4KFSA 1KI6B 4MKGA 2BWJA 2WWFA 2RGDA 2WKQA 1RJ9A 4JL8A 3C8UA 3EPKA 1H8EA 4DIEA 4Q01A 3BFVA 2BJVA 1EWQA 4E09A 3VR2A 1RW4A 1E96A 3TVDA 2IL1A 4A6XA 2IX3A 4Q4AA 1XMJA 1NP6A 2PEZA 5B57C 1Y3AA 2C9CA 5F9HA 1HE8B 4LZZA 4PO9A 3TR5A 1QG2A 3L0OA 1JEEA 5DNYB 4JSYA 3C41J 1GIAA 4JBXA 5BYKA 3LBNA 4JYBA 5DHFA 1PLLA 1FQJA 1OH6A 3P4XA 3RNLA 2P5SA 4BZQA 4DCSA 2ZRAA 3IGFA 1VKJA 2EFDB 4LHWA 4Q19A 1N6LA 3NVAA 2H8KA 1R5BA 1JI0A 4ZPXA 1E9FA 1WCV1 4ILEA 3QBVA 3U60B 1FW6A 5AJVB 2QE7A 5CJPA 2IYXA 3LXXA 3N2EA 3HR8A 1E2MA 3NG1A 4HZUB 3GJ6A 4UJ5A 4XTRA 1G1MA 2FX3A 1E1RA 1N0UA 4R9UC 4M2LA 2GESA 1OIWA 2WJJA 4PPFA 3TBKA 2HJGA 3R9WA 2J87A 3ONWA 1XMSA 1Z2CA 2MSEB 4W9MC 3U7GA 1Q21A 3R8FA 3ND8A 2GVZC 1WB9A 3LVRE 4X8HA 3WHLA 1JR3A 2EFEB 4ZIRB 2O8FA 1K6MA 2AK2A 4YXWA 3CNNA 5E3HA 5JSZA 2P6UA 4JLVA 4Z1MA 1IY2A 2F6RA 1U9IA 2VSOA 4RFVA 2CEAA 1L2TA 1N2CE 4D0GA 1X6VA 1ZCBA 2DHRA 2WWXA 3F5FA 1KOFA 2F3TA 2QSZA 3SFZA 3FFAA 2QGZA 3U4QA 3THYA 1E2PA 1GWNA 1Q3HA 2R6GA 2NIPA 3K1JA 1JJ7A 5KNDA 1HH4A 1WDTA 2XOKA 3JZAA 4V02A 1ZAKA 4OJKA 3DDCA 4Q00A 5JECA 2JLSA 1U8AA 3B60A 2HXYA 2X19A 2YWEA 4FD2A 4ESHA 3AQ4A 2GCOB 3CX6A 3Q85A 2XZPA 1MRSA 4XWAA 5EE9A 4U7DA 3ND9A 4TT3A 3W34A 3TRFA 4HAXA 3SJBA 4DLRA 1NBMA 4M1YA 4QXAA 1KAGA 3P32A 1XEFA 4CW7A 4PHTA 1D6JA 4PSAA 4L15A 2O8EB 1WBBA 2AKYA 1RVDA 1E94E 3SOPA 1PLKA 5FFMA 2WHXA 3HYTA 4TMKA 4NDZA 1PLJA 2Z0MA 3GJ8A 2JASA 2NO9A 5DO9A 2ZEJA 2AK3A 4OHVA 1XPOA 1NN1A 121PA 3PFIA 2O8EA 4TLAA 4DSOA 3DMNA 4XVQA 1M8PA 2ODBA 221PA 2G1JA 2VP6A 3KQKA 1OHHD 1P75A 1SVIA 3RWMB 1TX4B 3TKLA 3WY9A 1VCIA 1E9SA 3HYRA 2A30A 3QE0A 4URZR 1LV7A 1KI3A 3KXKA 2FV8A 2ERXA 3NHAA 2DFNA 3N2IA 5DI3B 1E4YA 4KO8A 3T5GA 3BORA 4PAQA 3U44B 1DE0A 1UBCA 4N0DA 1E2FA 1QBKC 1R2QA 1DAEA 2G6BA 3B9PA 4FIDA 4HUQB 2A5JA 2JJ2D 2P6NA 5JWRA 3EWSA 4NONA 2NPIA 4J0QA 3N70A 2W6JA 4O0MA 1GP2A 5HPYB 2UKDA 4L5BA 4Q1EA 3L0PA 3X1XA 4JT2A 3KTAA 3DKVA 1ZIPA 2VSXA 4ZIRA 2HF9A 1Q1BA 3UATA 4NYMQ 4Y0VA 2BCJQ 4LV8B 4Q9LA 4RKEA 1K5GA 2HYDA 2QM7A 2ZJ2A 3KTAB 2EU8A 4RKFA 4MKHA 2ZS9A 3NKVA 1ZD9A 1TMKA 5BN3A 3B78A 1ZUIA 4Q47A 1G9XA 4B3GA 5AWFC 3TH5A 1NKTA 5E7IA 1SGWA 5DI3A 1A2BA 1E79A 1W47A 2K5UA 4KI0A 4OHZA 4ACBA 1G5RA 4G5GA 2WWHA 4IDOA 2FH5B 4YMTA 4Q1FA 1AQUA 4PSVA 4B73A 4XSHA 1ZC4A 1U81A 4QHYA 3BD9A 4UQOA 1EXMA 1GRNA 2PX0A 2ONJA 3BB3A 2X2FA 5L3QB 3CRRA 5FPTA 1SVMA 2BBWA 2GK6A 4PC6A 1BIFA 4JVMA 4MUAA 1KI2A 2NZ8A 5ANRB 2H92A 3IIMA 1LW7A 1NMZA 4GOXA 1KK1A 3E5HA 1ZNXA 4D4JA 4NPHA 2FEOA 3FMIA 3K09A 2IUTA 1G7CA 4D25A 5FPYA 3EXAA 3FOZA 4UXIA 3CWQA 1RFLA 3VAAA 1N6PA 3QJYA 2DWOA 2BKEA 3TJZA 1C9KA
chains in the Genus database with same CATH superfamily
1V8DA 1M8FA 2BUCA 2RHOA 2XX3A 3M6IA 4MCHA 1TJPB 4K1LA 4MWZA 4QDJA 4OMFG 2D74A 1QK5A 2J9RA 3SYTA 1V9LA 3NYRA 2YFQA 4LSGA 2XECA 4MO2A 4O4JB 3LRTA 3BCHA 1JR2A 3PZRA 5I7EA 2VSYA 4MARA 4AZVA 4NRDA 5B1IA 4C4SA 3AR2A 4KGXA 2YVKA 5P21A 3WNZA 2WMDA 4X8LA 3W0LB 4CL0A 4KREA 1RAEA 2IWHA 1FXWF 4QJIA 3TOSA 2BFCB 1WW8A 2B35A 4M38A 4MJ7A 1LRJA 1CZNA 4PG4A 3ZD8A 3DE3X 2VYVD 3VPHA 4MVJI 2WJ4A 4QDUA 2VDPB 5FUXA 3TXYA 2Q5HA 3FIUA 3PNBA 1XWIA 3KYDA 3W78A 1QKJA 4OQNA 3A2KA 2ROQA 4BNWA 1HC7A 1MJFA 4DE5A 3LMKA 2B21A 2OLEA 3L79A 1LK5A 2YC4C 1KSFX 1ZW6A 2Q3LA 4J9VA 3CSDA 2C2BA 2B0JA 2B98A 2HCRA 1E3LA 3O74A 3SR4A 2P4HX 1HT1E 1QZ3A 3W77A 2H5IA 4D9NA 4R1UA 3GQBB 1MOZA 4GI1A 2UZ4A 3ERCA 3I2GA 5BWMA 4CUKA 4UTZA 3GF4A 2OK7A 4RHTA 3IVXA 3TD6A 1GL6A 5MFZA 1A8SA 3FYUC 2JVKA 3HSKA 4AF7A 4AS1A 4WOPA 1ZJ4A 1ND6A 1NL3A 2FHPA 4C3ZA 5EWMB 5ABPA 1FFXA 3O3MB 5DHQA 2BP7B 3U49A 2H4WA 4AC9A 2ZWOA 4DUGA 1NJSA 1WDKA 3HKDB 1H93A 4C2TA 3F7TA 3WKEA 1STOA 4IICA 4DBVO 3LKZA 2W6MA 1ST3A 4AVYA 4Q4HA 1BXGA 1W8DA 3TLBA 4EMUA 1HX7A 3L6EA 4NHOA 2O8BB 4JVNA 1ECLA 2PRYA 3PQEA 2I6GA 2ZIXA 1SHTX 3H9BA 4MI1A 4MW4A 4N7RA 5CLQA 4EPXA 3NHSA 5AKJA 2JLAA 3JATB 4CN8A 5AUPB 5C18A 1PNOA 3K0KA 3SE0A 3V4VB 1DJQA 3A04A 1EXNA 2EX4A 3QE4A 2WP8J 3AH8A 5DMHA 3CYFA 4ZA2A 2QV7A 3WRYC 3FFXA 3HHEA 1QV7A 4FX2A 3LGAA 1EEXB 1RQNA 3WGHA 2B7CA 3I0ZA 2GBFA 3Q5DA 4DXHA 1AKEA 2GEVA 4O1MA 1ACJA 2VA8A 1U9YA 3EAGA 3ZLVA 5AQEA 3UMYA 1ORRA 4HEA1 4CT5A 5A5VA 2BHLA 2YQZA 3OIVA 1GRQA 3FH0A 4POAA 1LF5A 4R6XA 3VJRA 4ICIA 3WRVA 2OR3A 5CTAA 2EL9A 3FSRA 1IOLA 1OLOA 1MCZA 2QZ9A 3IT3A 5KCMA 4XGQA 5BRAA 2PJUA 4KIWA 1J1IA 1Z35A 4H6XA 2IYSA 1D07A 2HQBA 3P2IA 2YNMA 4OXXA 1WZCA 3PR3A 3QXXA 2HSZA 2IYYA 2BJWA 1JIUA 4KQMA 1XTKA 3I04M 3W9BA 3O1HB 3LOUA 5BN4B 1FUIA 3TS1A 2XWBF 5CM9C 2O4UX 3UHPA 4BFZA 4EG8A 3EVTA 2R8XA 3PIRA 4U63A 1KAMA 2X9VA 4YONB 5KSOA 3UGKA 2VN8A 4M1SA 3WK4A 3CZPA 3SG0A 4QRDA 4DLLA 1CZRA 2O1SA 1NUTA 4L74A 3FOFC 4I8XA 3CPEA 3EAQA 1Q0UA 2WT9A 1G1AA 4YPOA 4Q4LA 1L7RA 2PJZA 2P4EA 4HGNA 2AD5A 1BX0A 4NWIA 4ACAA 4LNUA 5I8WA 2EQBA 4MX8A 1BHO1 2VJNA 4EPYA 1C1DA 3U16A 4UHBA 1I33A 2QM0A 3LX8A 2CGEA 1I01A 2VZ8A 4ABTA 1KOGA 1BN7A 5BQXA 1Q84A 2VJMA 2AB0A 3MTIA 5J5AA 3HGQA 2VDKB 5DP1A 1F8UA 2PH5A 4OLFA 1B8UA 4EFKA 5IYZF 5I4KA 3TF5A 1PGQA 1MX9A 4UNRA 2WB2A 4A16A 1YS2X 2OFFA 1SUIA 1IHOA 1UAYA 2H1FA 4L4UA 4OQFA 4WRRA 1QWOA 3RFTA 2C0CA 4AIRA 4BE7B 3U7IA 1UZLA 2R5WA 3MOIA 3QKTA 5EIWA 2OHFA 1T2FA 1QCCA 3D6UA 3L8CA 1D6SA 3TD9A 3WJAA 2QPTA 4BVAA 1EDBA 4D46A 4F60A 2EJUA 4RJ2A 1FMFA 4FI3F 4P7BA 1OBVA 4S24A 5DULA 5BVHB 5GINE 1KAEA 1V16B 1VIVA 2GASA 3VBEA 1IBSA 4J9UE 5J47A 2ZIEA 3B3AA 3JQAA 3IUJA 1AC5A 4MRRA 4JOQA 4NNPA 3QVMA 2DX7A 3HJCA 2QLFA 5CYOA 3K1ZA 1A4UA 1XU4A 4BNMA 2ZRCA 3T54A 3OE4A 3TQSA 1G3RA 3QW2A 3VZRA 4OB8A 3LWZA 4I1YA 2Z5FA 3KELA 1OUMA 4B47A 4K0KB 2W4QA 3OLVA 1KPGA 1XZEA 4G1FA 2LGJA 4RNDB 4UARA 4EKIA 3GGOA 3I3OA 5GV7A 2OCIA 1S8AA 2RHLA 4X97A 1S89A 1HT3A 1OFHA 1ZIXA 2QRVB 3JVUA 4RF4A 2ORIA 5ALZA 1H5NA 4BCBA 3L6OO 2DBQA 3PUKA 1UZMA 4P2GA 1I1QB 3I23A 2EFGA 4XX0B 2JJYA 4B3DA 1Z8FA 1AMUA 1P60A 1HOTA 1QHHB 2NQ8A 3INNA 2OGZA 4NC9A 3D4NA 2XXAA 4EY4A 2GXQA 2KI5A 3GRPA 1KR5A 4J07A 3HMKA 1IL0A 4PX3A 5I9LA 4GOLD 5FT9A 4U5XA 3AI7A 1T5SA 3CF2A 4YC7A 1MO2A 3QZUA 4EZBA 2PUCA 4LAFA 1FTQA 1NJFA 2P9CA 2SCUA 1XNRB 1QS0A 2HIGA 4ARBA 4YRGA 5DHRA 4HBGA 3SNKA 3GRUA 3LS2A 5COQA 2NVUA 5KYKA 4QQ8A 3TTXA 1PZEA 2I33A 4QUIA 4LYDA 5FI3A 4FHDA 5KYWB 3K0AA 1V7QA 2IOQA 2IYQA 2O7NA 2VYND 1SA0B 4TKUA 2IYNA 4G9BA 4UDYX 4F84A 3ICWA 4EL0A 3C14C 4K88A 4XASA 1DAKA 2V6IA 5CX1B 1PNTA 2PIDA 3OEHA 1XTVA 5EZYA 1MW8X 1HWYA 3H4MA 3TRIA 2QTVA 1MFZA 1ZLXA 1U0BB 4N41A 4M7WA 1Z6YA 2F3RA 2RGEA 3OD5A 5AVRA 1MX1A 4TZKA 1WMEA 3BH0A 3BM5A 9MHTA 1V8BA 1XALA 1YBAA 2AOUA 4AY6A 5KTSA 3ZWMA 4IO1A 3WGGA 3C1OA 3KKEA 3WSTA 2CDCA 4RZSA 3Q15C 3AEQA 5BSGA 3ADDA 2QBYB 1HEIA 1SC9A 4R83A 2P3LA 2XLBA 1RI3A 1I24A 3G6KA 3HS3A 2HI0A 4CEJA 2JHCA 4QJBA 4M1QA 1CRPA 4L0CA 2JBAA 3KHSA 2VLIA 4KZKA 1MGOA 3KPYA 3R3WA 5BMVB 1Y6ZA 2JLZA 1QPGA 4HLNA 4KXYA 1JKIA 3QXJA 2PMFA 4FGJA 3IAM6 4PC3A 4XDGA 4FYJA 3V1LA 3WRXC 4K3UA 1BRTA 2I62A 3P5SA 5ETJA 1C7EA 4MYHA 3R74A 3VC3A 3FDJA 4O4HA 2RGNA 1TF7A 3RAFC 3EBLA 2YWGA 1L1RA 4FK8A 3O9MA 4D3XA 4ZYYA 2EWVA 1X3LA 2RFLA 3EA5A 1FDRA 3ZTWA 4C2UA 1RDFA 4GEGA 2J0VA 4INAA 1XZIA 3OJ0A 3K6JA 1QYCA 5BSTA 2J1LA 1VOTA 4FMDF 2EHJA 2LE0A 4ZN6A 4HGRA 1Z6ZA 2YMPA 1L5FA 1XL0A 1MQ8B 1OT5A 2VF2A 1XZNA 2ETXA 4M8IA 2O8DB 4N1AA 4B6EA 2CMGA 1XZKA 4M1MA 4UVIA 3B5IA 4N01A 5ALYA 1EJ2A 5EMNA 2QP9X 1XDUA 4CQJA 1Z5PA 2EW2A 4OHMA 1DJMA 4BNHA 4ZYXA 1KK3A 5F1PA 3GJZA 3BSWA 1XX6A 3F8WA 4CCYA 4E4TA 4K86A 1ZMOA 4YPFA 4KRXA 3LA6A 3NH6A 1CCWA 3UJHA 3ML1A 4LZJA 4WN9A 5A03A 2IOFA 3QI2A 1E2LA 1XUOA 3OKAA 4Z1OA 3FHCB 2PM8A 3CCBA 3HXLA 4LBYA 1Y63A 4LYJA 2NT3A 4P7GA 1E9DA 2IU0A 3BWVA 3GN1A 3RADC 2GEUA 5DYIA 2OUIA 4ZO7A 5H5JA 1OGIA 4MVJF 1RYZA 1ZM2A 1E6WA 5LL6P 2C7RA 1OI3A 4AJ2A 2Y68A 4WDRA 1UDCA 3BWMA 1ZKDA 4BJ5A 1VCHA 4K9NA 4BKQA 4KFRA 4R9RA 2OHJA 1VFPA 4YO8A 2YIVX 5CJ2A 4A6PA 4DQVA 2CLSA 3D7LA 3DLTA 1XHEA 5DBFA 4ENQA 2BGRA 4DSAA 3X2EA 5E1MA 4RC9A 3E9MA 1XTJA 1OREA 2Z98A 1JLSA 3VSBA 3AQIA 1QP7A 5J4KA 3TEMA 1LBIA 2FAXA 2GF9A 2H51A 4EKNB 1NG9A 9LDTA 2GHRA 1DC4A 1VXOA 2YW2A 5DZSA 4TV9F 1XSEA 2E6UX 1R0XA 1C1XA 3IUBA 4JENA 1CE8A 3B70A 4MVJH 4V38A 2HYIC 1YRWA 3EZ6A 4CEHA 3CGGA 2IP1A 3M6UA 4HVAA 3QBEA 4PONA 2HWUA 3B2NA 3OPYB 2WU1A 3TFWA 1SXJB 3BXEA 1HTBA 3MB8A 3RUCA 4DREA 2GPAA 3NIDB 4L51A 4QPJC 1E99A 2N42A 1Q91A 1X8XA 2XH8A 2ZE5A 1CXZA 2NTVA 3QKWA 5KC9A 1Z47A 3H0KA 1UUFA 2W2PA 3ROZA 3DZHA 2HJSA 3GBPA 1XF9A 3VU0A 1VE7A 1CY2A 2FETA 3KX2A 4Z49A 5JCZA 4ROTA 3N0VA 4DSUA 3ZW9A 1SIOA 4PNEA 4QHTA 3CT4A 1JIVA 2HA0A 4OGWA 4RTSA 2QSUA 5TMBA 1XN4A 5G4LA 1IE3A 2ZBDA 3NLLA 3RV3A 4CIYA 5A2QA 1KL7A 2HK6A 4WTOA 1H2FA 5BWNA 4QTZA 4AROA 3NHBA 1QDLB 1P2VA 1DQRA 1SHLA 2O07A 3PHLA 3L1HA 4G0OA 3UXYA 1RRPA 1PGJA 1VB5A 4JZYA 4PY2A 4BRUA 1T1JA 3LZ6A 4HCJA 4HJRA 1BE8A 4BXOB 1XRLA 3S2ZA 4GICA 1NMQA 3D81A 1VA5A 4N18A 1SVLA 2W6NA 2IZOA 1K63A 4OY3A 1I6KA 1A27A 2IUSA 2DFPA 1UMBB 3BJZA 1P18A 2XT6A 3I04A 4D4KA 4O3MA 4RDCA 1SURA 1RYHA 1CVLA 1XU7A 2ZYSA 3LCRA 5KX5B 1FYEA 3E35A 4LXHA 4Y1GA 3WMWA 1BMTA 3CEMA 3RYIA 3LPNA 4GPIB 1Q0LA 4ZI7A 5HCUA 3AF4A 8ABPA 1EVJA 1GKIA 1H0HA 1U94A 5AM3A 2WJAA 1J97A 1N5LA 3CXUA 4N0QA 4WFQA 3GLVA 4IIEA 1GNSA 2ID9A 2QEQA 1Y7IA 1QK4A 2PQMA 3H5IA 3LHFA 2XUIA 1P5ZB 3MJSA 3DTTA 4R5MA 4I19A 4YRPA 1QZXA 2QTFA 3K0HA 4KOAA 1P7VA 1RBYA 1Z28A 2X1LA 1ULSA 4L9SA 4DNXA 1UM8A 4ER3A 4RY8A 3ZU5A 1YFKA 1G6KA 1T9CA 1LTKA 3B3FA 3USCS 2HWKA 2P5YA 3OM1A 3K9GA 1UJ4A 4G8CA 4H1VA 3M82A 1Y5IA 4BVLA 3RS4A 3NTXA 3ZV5A 2PTHA 1C1XB 2AXEA 2QW0X 4P83A 2AN4A 2C61A 4X90A 1MENA 3LUHA 1T2DA 4EJMA 3IDAA 2XTJA 5GZ3A 1KMHA 2XIQA 3ANYB 4ZT4A 2DLDA 2AQ8A 3QU5A 5DK4A 3LQKA 2EKLA 4MMXB 3OESA 5HCNA 5HDBB 7YASA 3H8WA 2I8CA 3PC6A 1II8B 2VH5R 3U13A 3EH1A 5HHTA 2BGLA 1U6JA 3H6KA 5CUQA 3J80A 3P2MA 2FPIB 3QFTA 4PANA 2Y1OA 4UAGA 4KE8A 2BFFA 2F8LA 5JH7F 1FRZA 3IR5A 2BOVA 3OMXA 3QM1A 1LKZA 4X85A 1CQJA 1HFKA 2GNPA 4MV1A 3JQDA 2OO5C 5KPJA 5CVTA 4H1UA 1G19A 1L8OA 1ZGHA 3PT5A 1Y1TA 2GHTA 2VQ6A 2JIBA 2H1WA 1GGHA 2DBVO 2FZCA 1NR7A 4IYJA 2A9QA 1JJVA 4F56A 3Q3EA 1J2JA 1EWKA 4IF4A 4L4YA 4R1OA 5JZVA 2JF0A 3HCDA 3CBGA 3PDIA 3WLIA 2J9YB 4CPDA 3DMHA 3R0JA 4WN9B 3WZLA 4DLZA 4W8GA 2QYSA 1AS3A 2VG8A 2PDAA 3M2TA 4JOSA 5DT9A 2XBMA 4CCYB 5JXWA 5AW1A 5JI3E 4YLEA 1W2HA 3WK6A 1U65A 5EJ7A 3QQ5A 4YJFA 1FDOA 1NIJA 2ZE7A 1SELA 4ZT3A 4DCVA 1L4GA 1PZFA 2VP4A 3ECSA 2VHXA 4L8VA 3ZDEA 2VHYA 1OFIA 4D9BA 4UBLA 1VRWA 3K16A 3BF7A 1Z5ZA 3ND5A 4QXOA 1I7SB 1L4FA 2D13A 3ZEAA 1GUDA 2CLDX 4MRAA 4YT5A 2XAUA 5E4YA 3PRHA 3U9TA 4BWFB 3F5SA 3VDXA 4Q82A 4Q3DA 2KS6A 3HADA 1AQIA 1W88B 1LVHA 3O8NA 4FZJA 4TQ9A 1GXSA 5AUOB 4TZ0A 1Y6JA 3SKVA 1U2PA 3IDZA 3RSFA 1F8YA 1PUIA 3FYDA 2LDXA 4HH1A 3H42B 4WVLA 1LDNA 3BN3A 4EI2A 2ECQA 5IDWA 4AK9A 1Z82A 4F3CA 4HB4A 3K4PA 5JXJA 4CEIA 4OYHA 1LPOA 1SVSA 3AR7A 5HIMA 1RXCA 4W5OA 4HDKB 4BKRA 4IJKA 2VZEA 1CE8B 5K8IA 1RYBA 3CWZA 4L3WA 3OCCA 3S2YA 1NW9B 1IH8A 2D8MA 5EJ4A 5KJ1A 1D7AA 4OFZA 1OZFA 2GCOA 4RYDA 4PLCA 2A6PA 3RABA 5IAOA 3IUMA 5KMGB 2N75A 3PUJA 1TC1A 2EGGA 3UFBA 1TU0A 4MWCA 4UCWA 4DKXA 3OQOA 1J8YF 1RWVA 2E85A 5BN5A 4FYXA 4LJYA 5BN1A 3G8AA 4NG5A 3LPDA 1KMQA 4OK6A 4JKIA 4UHFA 2X4IA 5HFNA 3CPHA 1PQ4A 4O25A 4HXFB 4FDAA 1H9BA 4H60A 2P5TB 5ESXA 4AJEA 4D4IA 4EA7A 1TI7A 1O95C 3IV6A 5G3ZA 1Y8QA 3LQQA 3GBSA 3OQVA 4TYNA 1SVNA 3CB4A 1YZHA 4HDMB 2Q5JA 2VT7A 3FZQA 3X1DA 3TFOA 4XIJA 2B37A 4L3OA 4LJAA 2FLWA 2GZSA 4LQCA 2YV4A 3ZY6A 3PI7A 2HMAA 4GD3Q 1DBRA 3BBPA 3IR7A 1XQXA 4EEXA 4NECA 5HOQA 4YALA 1G0OA 1KWKA 2VK1A 3PHIA 1CS0A 1PS8A 2QAGA 4ASUD 1GRCA 3AP3A 3O0DA 1XVAA 3NTRA 1SVOA 4DDVA 4C7JA 3SBOA 1PJSA 3IUPA 2ZPAA 2SICE 1VIDA 4I4IA 1GPNA 1Z2OX 4N3AA 5JTUA 4OHXA 1V25A 1D2EA 3UAYA 1F2TA 2K7FA 3O6VA 4NJEA 4BV9A 4BNJA 5IU6A 5AVYA 3PHGA 5LB4A 1KO7A 4F45A 3HUTA 3IB3A 3IPYA 4PAGA 2QMHA 5EESA 1PK8A 5EE5B 2UUAB 4E1AA 4N0PA 2A4KA 1DWQA 3RYHA 2CFIA 2HM7A 1EG7A 2YH2A 1FPMA 3A6ZA 3IJRA 1XD8A 4PTLA 5TEWA 3KEFA 2WIGA 1W36D 1A7AA 3TJMA 5LVAA 4MWOA 5FBHA 5FQOA 3HY6A 1KI8A 3MOGA 3NMUF 4JQCA 1V1MB 1Z6TA 2NQTA 2IDKA 5I45A 3R3HA 3PV0A 5JBIA 4ZJZA 1M7GA 3QYJA 4EB8A 2JFXA 3FOEC 3WI7A 1G9SA 5L7TA 2QB5A 4HK4A 4O2AA 4UFPA 4YCDA 3ON5A 4I1SA 2CV2A 4IHJF 1YJQA 3M5PA 1IOZA 2Q41A 2RH5A 3QEJA 5EJ8A 5JI2E 1COZA 2PLWA 3GO4A 3HCRA 2FUG6 3I2YX 1YS4A 3FF1A 1AUQA 3EPRA 3AF6A 2PUHA 4W5WA 3SM9A 1Z56C 5HQ3A 4QBGB 3UUWA 2FPUA 4RA9B 5BV2P 3TXAA 3OIGA 1TZJA 2P3QA 2QYHA 4K46A 3URMA 4Z5XA 5JNTA 3PGMA 4W9NC 1E4EA 1HDZA 4P33A 3ZZTA 1M83A 2VRWA 1EP2B 3VZQA 3IAAA 5AUNB 2V7PA 1EFPB 5K0JA 2H4FA 5TXGA 4KO2S 3DQQA 3AGQA 1YNOA 3CZ4A 3SLKA 2XYVA 5BYAA 5HUQA 2C98A 2NUAA 3A9VA 5D1HA 4X3OA 1BC5A 4BTVA 3DKIA 2D7JA 3I01A 2BGJA 4A1FA 3ZDZB 1XKXA 2J9GA 4TTSA 4LHXA 4Q02A 3GRAA 1H0KA 1MNAA 2QMQA 2TRSB 4MA0A 2XRMA 2ZXUA 2MYTA 5TQJA 1LLQA 2E7ZA 1P1IA 1U0JA 3GDHA 3PGA1 4NFLA 4QO8A 3R6GA 3PDHA 2P4QA 2MSLA 2EZ9A 2OBXA 2WNSA 3BQ9A 3FMPB 3QBDA 4H9GA 1E8MA 3EFOB 3N2KA 4CIXA 3G2HA 3AUFA 3PX3A 1KDVA 4CTKA 4EI9A 5JSZB 5G0WA 4PQEA 3OTIA 1QCZA 3IPCA 4AO6A 2E4ZA 4AUNA 1SCNE 2FRVA 4PVDA 5THQA 4OI2A 1HDIA 1IZYA 1SBYA 5G1OA 2FWIA 3IUSA 1WZIA 4MQBA 3AONB 4UTPA 4EJ2A 3N2GA 4H7IA 4K3VA 1FYDA 1MVOA 1PYDA 5FUMA 1CJSA 3FYUA 4YJ3B 4YCJA 2PSFA 1GKYA 5G40A 1KRWA 2IBSA 3HA7A 3TSZA 1RWBA 3K6SB 3DTVB 3WDKA 2WM2A 5JNWA 5BPHA 1RQPA 1GG9A 3UK1A 1HSOA 1PRYA 5IM4A 1LZLA 2OENG 4DMHA 2RKBA 4RTRA 1FFCA 3JQ8A 4HN4B 1MHPA 3TDKA 3C48A 3MPOA 2BHNA 3BERA 1KYXA 2QMYA 4LHSA 4HADA 1E3EA 1KVRA 4HH4A 3KZVA 1W44A 4LZWA 1XTBA 2DTDA 3EXHB 4UVGA 3FPCA 3IPLA 1KGSA 2VZ0A 4XIYA 4UFNA 4CM9D 4EG4A 3AFNA 3RSQA 4KN8A 3U3RA 2I4OA 4BLOA 1NW6A 1PZHA 4TROA 4UEJA 1PYOA 1B7GO 1IQUA 1ZD5A 2WB4A 1DG3A 4X6LA 1YHZA 2PPLA 3OOSA 1EJ0A 3ABIA 2J0UB 4Q9DA 4XARA 4BO0A 2XF2A 5F33A 4QSHA 4JV5B 3JQ9A 3RC3A 3HVUA 3DKKA 3IHKA 2H31A 4HATA 2NO0A 4RV5A 1UQRA 5M34A 1UBFA 4B8ZA 3K3PA 2P41A 1ANKA 2CNNA 4P86A 5TS3A 5KOYA 4GSKA 5LCXA 2GZHA 3UJDA 4B6FA 3PJFA 5DYTA 3VO9A 4JT8A 2O8VA 1QRAA 3NC0C 2OCKA 3Q1LA 5KHAA 1Q2XA 5AXAA 4AYWA 1RIFA 4YVFA 1DAFA 2BMWA 3NTQA 1EUDB 4HX9A 3R9IA 5KUTA 2FW9A 2IU3A 1KMHB 3DEHA 3HV2A 1G5FA 4DQLA 4EKGA 2C9OA 1M72A 6GPBA 2WICA 3F71A 1PFKA 1QU3A 5DIZA 4DCMA 3MWYW 3VNQA 1XDSA 1IJFA 4K87A 4M1KA 4WZ6A 4YBZA 1EFTA 2BGNA 3RE1A 3FRIA 4G86A 4YUZA 5KVCA 4CMIA 2ZOSA 3MUEA 1XV5A 3QTTA 5ESRA 4CV0A 1LGYA 3L82B 3QUBA 3OZWA 4NBSA 4YAOA 3VVMA 5JMTA 3E8XA 1WY5A 2D06A 5EMKA 2F1OA 3BWXA 2Y1GA 1QHSA 1J2YA 2DCUA 3WNVA 1QIHA 1T24A 3CWCA 5IT4A 5IZCA 5KWJA 1VGVA 5FL3A 3BTVA 1YV9A 5A7GA 4HRVA 3RTBA 2AQHA 3MJTA 3SHOA 4RPCA 1MABA 2I65A 4G5SA 3RVKA 1IN7A 1THTA 2EBWA 3FNBA 1KJWA 4HFJA 3ZCQA 2O2CA 2QLNA 4GXRA 4K6FA 2D1QA 2A4MA 1E0AA 1K8XB 2XTMA 5FUBA 2FVXA 4PYJA 3ZU3A 3K7EA 2XYQA 3CM0A 3OJCA 2BFCA 3P0JA 4BJ1A 2AN5A 5BQ3A 3WL4A 5HKAA 4LTMA 4R81A 3AETB 2VOJA 1A9TA 3TAUA 3TTYA 4K81B 2PX5A 3QUCA 1E66A 1W48A 1GTL1 2Y2UA 1XP5A 3P94A 3M9LA 4UUBA 5BN4A 4PGGA 1J7KA 1NJGA 5ICGA 3GVCA 1ETHA 1YH3A 2QLJA 1DBIA 4F0JA 5KCZA 1EM8B 1DIOB 1W4RA 2YV1A 3A27A 1YQEA 4EX7A 4FCVA 2EW8A 1CY7A 2KQUA 1XDGA 4L7VA 4M89A 4BX0A 5DGTA 1U2TA 5KNCA 1YF3A 3HDYA 4ZZ2A 2ZB4A 4FW8A 1A5TA 2XSZA 4IF6A 2JJQA 2M1ZA 1M9NA 2R96A 3JQQA 4EDHA 1JHZA 5DX8A 4R9NA 3LOPA 1VBMA 4LKOA 5I7RA 1UWCA 4LCJA 1YE5A 2VQFB 4XOUA 5GM1A 1E89A 2RHRA 3BTSA 4KC0A 3TTUA 1W5FA 5EZ5A 3VAZA 3VDRA 4A91A 1ENYA 1PR1A 5HKOA 4PS0A 4Z4FA 2YASA 2UV8A 1ZUNA 2WTNA 3PXGA 5K7SA 2FP4A 4WCFC 4HNRA 1NBME 3DE6X 4ZO4A 5H0IA 2OY0A 3TTVA 4YMUA 1GDTA 3VPCA 1PEAA 4LHYA 2GH1A 1UFRA 1HQCA 3PFWO 1J9ZA 4PG8A 3ADBA 3SC2A 2AXPA 3E7XA 2FN8A 1E9AA 1JWLA 1SPXA 1G59A 4I5GA 2C9ZA 1RNLA 3L18A 4PTZA 1N9GA 4OSOA 5LBUA 5B55A 2JGJA 3TCKA 5CTJA 2OM2A 4CLRA 1JJAA 2TECE 3EVEA 3UCEA 1ZMTA 4UMDA 2QN6A 3ROMA 1V95A 4FKMA 1YBVA 4DWOA 4HWTA 4UU7A 1ZH0A 3MUNA 5CX4A 3W6PA 3TZCA 2PPVA 4G65A 1K3TA 2C2GA 3QFSA 5BQOA 4MR7A 3ROXA 1NUPA 1WQ3A 3WBKA 4QYMA 1QNFA 4YP9A 2BFOA 3RBAA 1PZGA 3PIIA 3ZDRA 1BJRE 1W1WA 3IO3A 5JZMA 4IQ0A 1KKLA 3EVFA 2ZVQX 1JW9B 5AOAA 1C0PA 1MEEA 2GDJA 4AS3A 1WUYA 2CJXA 2R25B 1JYSA 3MSCA 4X60A 5T7BA 3D3WA 3MJVA 4R51A 5CFLA 2VDWB 2NQ2C 5K0FA 2HUPA 2HHJA 2Y27A 1PT9A 1Y8QB 1YUNA 1Y82A 3A6LA 4IEEA 2G8NA 4MYRA 3RU3A 3CVUA 4TMYA 1J5XA 4YMIA 4DJJA 1V5IA 4PIVA 4LDQA 1BX1A 2OWEA 2E18A 3HB0A 4FONA 3WGTA 4BBAA 5F12A 5EVJA 5PNTA 3JVIA 4I5FA 1WJGA 1UFKA 4EW3A 1B23P 4S05A 5BN5B 5FEUA 1VA4A 2VT6A 4I4LA 3JTMA 4I66A 5EZ6B 1DIGA 3O1JC 5K51A 3RM3A 4YRNA 1ZHHA 4HEHA 4D3FA 2VF8A 1DS6A 4O08A 2VAWA 3W6UA 2EDCA 2JCGA 2ZTMA 3DUFB 1ZCJA 3G0BA 3R6DA 4KWTA 3GGSA 5SZHB 3REGA 5AVWA 4LSWA 3LX6A 2PKEA 1E1CA 4INJA 3NAZA 4GM1A 3WTBA 4AMZA 2OBBA 2RKWA 5FLXA 1GQFA 1T3SA 3WWDA 4MCJA 2ERYA 4U1RA 4E2FA 5KVAA 3LY7A 1M0WA 2KPOA 4GVPA 3W5CA 1JEOA 2ILVA 1WL8A 2ZCJA 3OBIA 3JYLA 2V5AA 2OSVA 1NY6A 3KQPA 4DV2B 2CD7A 4JH0A 2ARKA 1NNSA 4GE3A 4FMCB 2I91A 1EB8A 1DJPA 2J0SA 4G8DA 4I2NA 1Q16A 2W37A 2OCYC 1E4VA 5EUQB 5FBRB 4X66B 2QTMA 1HQYE 1ADFA 2IEZA 2ZRFA 1GLVA 3AL2A 4DLXA 5K99A 1A69A 2QWXA 4YP7A 1GQYA 4WLEA 5F9MA 1WHSB 4MQ5A 4U7PB 3V4RA 1U0EA 3U4AA 3WWEA 1NPDA 3IPRA 3BF8A 2DWUA 3PR1A 4S1TA 3CR3C 2VP2A 4PAOA 2CF6A 2HMYB 5CB4B 5K4HA 4JI7B 4PQGA 1IRXA 1M2VB 4DCGA 5LKAA 5AICA 2O20A 5H4GA 4FB4A 1PQPA 1TK9A 1PQYA 3PVZA 3I9V6 4GR9A 4DJEC 1INLA 3WQHA 3E6AA 3V9AA 4EQZA 2CBGA 2OFOA 1E6MA 3MMPA 4EG7A 3AESB 1V6SA 2VZLA 3QEOA 3R7WA 5KHOC 3EXG2 3O8OB 4D3DA 4BNYA 4EYEA 3WRXA 3VJLA 3ROPA 5C9ZA 1NJ5A 2OL4A 2VXOA 3AEKB 1C30B 4EG1A 3LTNC 3B1KA 3BQNB 2ZJ3A 1R0CA 4F2GA 1WOMA 1ZM9A 4XD7D 3QKSA 1VBKA 2CBXA 2CCGA 1IBRA 1TJYA 1KTIA 1IAVA 1VCNA 2Q4RA 3NW9A 4MDEA 2XYPA 2BTOA 3D6FA 5I9SA 3WQRA 2MSCB 4S0XA 2W48A 5K0BA 5DFAA 1OFVA 1UIMA 5FBQB 3B6MA 3FCUB 3GJ7A 4A0HA 4HRAA 1OVMA 3QPBA 3OCUA 2JBHA 3AKDA 3CMMA 2I5PO 1C0IA 1NXTA 3EEBA 1XZDA 3CLKA 3YASA 2ZUBA 3B51X 3VUFA 2XWQA 1O08A 1F20A 2G5GX 3KKQA 3VPDA 4X64B 4ENPA 1PNRA 4A36A 1L7NA 2Q3HA 3FCYA 2J85A 3CV3A 4IIJB 3RS8A 4JC5A 5HQTA 5CA1A 1FXSA 3ANXA 5J4LA 4JUDX 2VATA 2GYYA 4UPEA 1P8AA 1JQDA 2ZYTX 1KH1A 3O91A 2XQVA 1T29A 5G0VA 5EKDA 5A62A 1WHSA 4PGAA 1K9SA 4BASA 1ZU5A 4HDSB 2WMNB 3IFSA 3O3NB 4RF3A 3E9CA 4BNIA 4GECA 3GROA 4F85A 1Y3FE 2FGJA 1IBCA 4W6QA 4GUDA 5DXAA 4A15A 3GLIA 1EDZA 2O7RA 4M7RA 1JIJA 1GM5A 4GMFA 4IFTA 4PNPA 5JEDA 2ZE8A 3LXUX 4XX1A 2RCNA 4F9EA 4RORA 5H7XA 3BHNA 3EZFA 1H8HA 3I39X 2R8ZA 3A1TA 4FINA 4G0XA 4ZQBA 3S1LA 3IELA 1NKSA 1DAIA 2Q2VA 3KKMA 3OIDA 5HS4A 1SBQA 4D5EA 1GT91 1OBCA 2E1PA 2AUTA 3FFTA 1EVEA 3Q3HA 1YU9A 3TLYA 5KNBA 3C6KA 3EG9A 5K4GA 2PSDA 3EPHA 3DOEA 4YAIA 2ZJ4A 1Y5MA 4TUYF 3RRJA 2GAAA 1QAQA 2C4WA 4HB0A 1EH5A 3CNOA 3ZNNA 2XTAA 1ZGAA 2ZULA 4B2IA 2NVWA 4MWDA 4XR4A 3T94A 1OT3A 4B4DA 2GUWA 3EEIA 1AKRA 2QAIA 3SICE 5LPNA 4OXIA 5K8CA 5IWAB 2PH1A 1MOQA 1UXIA 4X93A 4D8XA 4YPVA 2JHFA 1O5OA 2AFHB 3HDVA 4O4IB 1Y6QA 1BZYA 1I4DD 3EXIB 4F97A 2C83A 1U2DC 1BA3A 2IHZA 1XZAA 2WP0A 2VRNA 3C7KA 3ICPA 5L4LA 1PL8A 3UUEA 2V55B 1X1DA 4I81A 2CKDA 3ZY2A 3GD7A 3RIYA 4BPBA 4RHYA 3SXJA 4QEKA 2R47A 5ERGB 3IEVA 4IGIA 3OZFA 3I9NA 1UXKA 2NPOA 5ALFA 3KZNA 3V1KA 1V4NA 1HTTA 2QX4A 3KJXA 1X1CA 1ZMXA 2MINA 2O05A 4M1WA 4M88A 1XCOA 1E62A 1TT5A 2CD9A 2I0FA 2JD2A 2XI4A 4ZYLA 1Y37A 1D4OA 3THXB 1SHKA 1J8VA 1IMOA 3OUUA 4MYCA 1YONA 2FYTA 1Z74A 1TQ6A 1UBSB 1ARZA 2QIOA 3AY0A 3DCNA 3O1IC 3LT0A 3PQ4A 4DTIA 4RJTA 3I37X 3B7WA 5IBCA 3G1WA 1OI2A 4MGZR 5TQ2A 1HY3A 4BWVA 3EF0A 2RHMA 4Y7CA 5B4UA 3WDSA 2H54A 3ED1A 4M0PA 4OATA 3WYAA 2ZTUA 1UKCA 1H8ED 2LXNA 3TNJA 3W6NA 3EGDA 4CQMB 2DRIA 1JSRA 2I9PA 4IVRA 3ZQ4A 4LRSB 2ECPA 3P7MA 1FS4A 3C7DB 3CNHA 4FGWA 2PV0A 3A2LA 2FDRA 4YCAA 5D2CA 1MQSA 3MLBA 1OKKA 4Y9SA 3LLCA 1ILWA 3KE8A 4JJ7A 2CLMB 5ALDA 1LLDA 2CHEA 2JRCA 5L53A 3SJUA 2N1BA 2VHTA 3AHHA 4NOLA 3T7DA 3E9YA 4LE0A 3S2EA 4CIWA 4EZEA 1I36A 1Z5VA 1JDZA 3DF9A 3SSNA 1XDBA 4N5IX 2GN8A 1L7QA 3NRCA 5JZSA 2F1HA 3HBAA 3N87A 1IY8A 5GGYA 5AHOA 1A5ZA 2CN1A 3PT9A 5SZIA 3H5LA 4BO3A 5GIPE 4KPYA 1UPTA 2WOJA 1XXLA 3MLAA 2G71A 4LXXA 3ZJTA 4HDAA 3WLKX 5ADVA 3VHLB 3GNTA 3SZLA 1QVVA 2PRSA 3DOUA 1NVTA 5L3SB 3AP2A 1C7QA 2X3FA 2XNDA 3I34X 4RZIA 2ZUFA 2Y3IA 1IC6A 1X94A 4I1UA 4LBZA 4Y2VA 3PLAE 2FG6C 2QN7A 3L7IA 5JS2A 3A7DA 4EPWA 4ER0A 5J4YA 3W90A 1RI1A 3BD7A 4IYRA 2N46A 3WGOA 4DMFA 4V1CI 3FKQA 1M5UA 2QSYA 4CLOA 2ZJAA 1YXMA 3B9QA 3UJ8A 2WI8A 4KSCA 4E22A 2GBPA 1W7AA 1TADA 2G5PA 3C6QA 4C7KA 3LGSA 2CCKA 4PYOA 3U5TA 5C4MA 1E6EA 2IPLA 3GDOA 4NH0A 1J8QA 3LXMA 1MEJA 3IOBA 3B3QA 2CYAA 1P31A 3PC8A 2VJOA 4MAMA 5FTMA 1AOXA 3THWB 5CT5A 3TRHA 4L2IB 3H9UA 2SNIE 1M33A 3O8BA 3HB4X 3KZKA 4ZANA 2C5SA 3ZH9B 3IDFA 5K1ZA 2OAQ1 5ECWA 1W87A 4OIFA 5BSMA 4KJXA 4ID3A 1CVRA 3SQXA 3QEMA 2ZKIA 4QWMA 3T7KA 1UJCA 4B3SB 1LH0A 3G9XA 3ITDA 4LX8A 4NCBA 1ONPA 3Q7TA 3ZWBA 1NLZA 2DYKA 2NV6A 4N0EA 3BIWA 1P4RA 1K5DA 2JAQA 3A28A 2J5RA 3D7RA 3N76A 3Q11A 3DMDA 4OXKA 1NVEA 4P84A 3LYAA 3ET5A 1VG9B 5EJFA 2C1ZA 3B82A 3WAJA 2B1QA 3G5T