2F7SA

The crystal structure of human rab27b bound to gdp
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
186
structure length
179
Chain Sequence
DYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of human Rab27b
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Ras-related protein Rab-27B
total genus 51
structure length 179
sequence length 186
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2f7sA00
4TMVA 5FTJA 5FOXA 2D62A 4JSYA 4B2PA 221PA 2W2XA 3I5XA 4NU0A 4DDWA 2HT6A 2IYYA 3WYAA 4JJZA 4JKIA 3BERA 1LV7A 2XSZA 1O3YA 3REFA 3U3JA 1XPOA 1D2MA 2CVFA 3K70D 3QJYA 1CF4A 3NH9A 2ZAMA 1OH8A 2O0HA 3K8YA 4AIIA 3IO3A 3LD9A 4IDNA 1P61B 5FI1B 2VH5R 2JIZA 3QKUA 3I5YA 3LLMA 1Q57A 1YZTA 3OFND 2QM7A 5D3QA 4UNNA 5DNYB 3GD7A 3NVAA 2VLIA 2WZQA 5HE8A 5KUTA 2FGJA 4FW9A 5JEDA 1CS4C 3F8TA 3O8RA 1XTJA 3D7MA 2QORA 3EZ7A 1D2NA 2XNDA 3WMFA 1NMYA 3TR5A 3OEED 1EFRD 2YYZA 2EYUA 2OEPA 4P0TA 4PC3A 2BMFA 4G01B 3OIUA 3NXSA 4RCYA 2W0SA 5C4MA 2VA8A 3BH6A 3IIKA 1UKZA 4BE7B 3UMSA 4DXAA 1WF3A 4M9ZA 1ZNZA 1LW7A 2Q3FA 2OLJA 1OXSC 5KPJA 3BE4A 1NVVQ 3PR1A 3QY0A 5C4GB 4EPRA 1XTRA 4UNRA 4BPBA 5FTLA 2A3RA 1KO8A 4S2EA 1E2QA 1E4VA 1XZQA 2AD5A 4WZ6A 2OSBA 5DHAA 4YMTA 5TXGA 4GOXA 1PVOA 1XD8A 2CMKA 4MRVA 4D82A 2YJTD 2YOFA 3U7EB 1I2MA 3H1TA 2ANBA 2IW3A 4TSFD 1OF1A 1OB5A 1LS1A 1KZGB 2RGCA 5B57C 2QZ4A 1KI1A 3TNFA 3U6KA 1JEDA 2DB3A 1AJEA 3IGFA 1DADA 1PJRA 1DO0A 1KY2A 4XVQA 4RD2A 1KI4A 5DO9A 1E2DA 4M4SA 2K5UA 4POAA 1JXOA 4B2LA 3UWKA 4URZR 1DAHA 1RRGA 3BS4A 3BBPA 1MO3A 2Z0MA 3NTUA 4C3ZA 4O0MA 2IS6A 4TMKA 1E2HA 5JSZB 3ICEA 4JLNA 4G3XA 3T1OA 3B2EA 3R8FA 4DLWA 2YVUA 3MRSA 4M8NE 2ZS7A 2QTHA 2JATA 3BRWD 5HKKD 3OIVA 4O2LA 4XTRA 5FPHA 2W83A 3C4JA 3MUFA 1FPMA 1IOZA 1YRAA 5FUXA 3CWQA 4DLRA 4NBSA 1HTWA 1QF9A 1I4TD 4B6FA 2HT1A 3U7GA 1OFUX 4P3YA 4PAQA 2ZE5A 3GLHE 4CRWB 4FMBB 2LKDA 1HQCA 2Z4RA 1OHHD 4PANA 4NKRA 2RMKA 4V0KA 3X2SA 2W6IA 2NQ2C 3QE0A 4B43A 4PSVA 5J5CA 4LBYA 2R6GA 3PEUA 1VTKA 3PXGA 1OKKD 1D8TA 3EPHA 1NNEA 1ESMA 3U4QB 4GT1A 4AK9A 1OH6A 3ZS9A 1MR3F 2NIPA 1N2CE 1Z2CA 2GJ9A 1P73A 1TQ4A 1WE2A 2GBLC 1G6HA 3VFDA 3MSXA 4Q9JA 4TLCA 3KJEA 1T0HB 4A9AA 3WRYC 4ABYA 4YXWA 1M7BA 1OHHA 4DDTA 2JJ1D 1KO1A 2QP9X 5JHGB 4G1UC 5F2EA 2FFAA 5JMTA 2O8DB 5KOYA 2BC9A 2JASA 2WKPA 3L43A 4B3GA 1P5ZB 4RZXA 3H0KA 1F2UA 3MWLA 3TQFA 5BWMA 1G3QA 2NZJA 2OG2A 3EZ9A 5AUNB 4K81B 4Q7JB 4BASA 3ZDQA 3QVUA 2JIZD 3EIQA 1JI0A 4N1AA 2JLUA 3L8ZA 4KYIB 3TQCA 2F1HA 4HYYA 3FKQA 5FTKA 4QHSA 1NN0A 5DE3A 3AP1A 1Z0KA 1Z6YA 3OZXA 2HYDA 1UKEA 4PSKA 2ZYTX 4NYIQ 5FTMA 2GWHA 3PUVA 1E94E 3ZD6A 1W0JD 3TR0A 4US1R 3RS2A 2WWYA 3CBQA 4QM6A 2YWEA 3Q8XB 4IDQA 1E2KA 1OE0A 4D0LB 1OH5A 2XTZA 4KBGA 3LO5A 3ZQJA 2IHBA 1DEKA 4HLUC 2ZEJA 1SXJA 4Q47A 2QSYA 5DLQC 3FOZA 1XZPA 1U9IC 3SOPA 4MKIA 1XWIA 4JLMA 1Z63A 5FPYA 1WB9A 1KTVA 2ODEA 1W36B 3GEIA 5JRZA 1XX6A 5IK2A 2W0MA 3EA0A 2ZETA 2MSDB 1D2EA 2FGKA 3ZGXA 2XB2A 5DN6A 1PUIA 5BXQC 1A1VA 1E2PA 2PLRA 1W36D 1KKLA 3TE6A 3QXJA 5CK4A 4KITB 4OHYA 4IXNA 4I1SA 1ZP6A 1E79D 1ZBDA 1D9XA 1E2EA 3T35A 1F2TB 4ZKDA 4JLOA 1J70A 2ODBA 4GI7A 3KQHA 5FOSA 5JLJA 1NBMA 1G6OA 1KI2A 1N6PA 3CH4B 4HDQB 2OESA 4XVUA 4G5QA 1UM8A 1JEEA 2PBRA 1XP8A 1EFTA 5L3QB 2MSEB 5TMPA 3SYLA 1II8A 4W5HA 3EPJA 1SXJE 2KE5A 4YONB 1CRPA 2G83A 3EASA 2HXSA 3VR2A 1AN0A 2O8CB 2V4ZA 3EA5A 4OHWA 5JSZA 1YQTA 3P4YA 3AVWA 2O8EB 4TYPA 5LD2C 5K8IA 1E98A 1UFQA 1F5NA 2HLDD 3THYB 2GRJA 4NYJR 4GZLA 4P33A 2F9LA 4P4TA 1O87A 3KJHA 1E9CA 5EE5B 3L8YA 1E9FA 2JLVA 2VHCA 1XCMA 1Z5ZA 2HDNB 4EFNA 4IVPA 4M1KA 2BOVA 3CX6A 3R9IA 4BLSA 1NSTA 1TF2A 3JVUA 5FPSA 4MA4A 4C0AC 1N0UA 4KU4A 1KJYA 4EDHA 2ZSBA 4PO9A 3QENA 3SQXA 4NCNA 3DOEA 1T9HA 2WSSD 2IXFA 4URWR 1NKTA 1U0LA 2BJVA 2IL1A 2RGNC 2WKQA 3VMFA 1HH4A 2VP9A 5BW8A 2JJ2D 2J0VA 3PV0A 4U02A 2R2AA 4FD2A 1GIAA 1RE0A 3THWA 1IY1A 2FG5A 5FUWA 3F0TA 2XNDD 1RVDA 4YXWD 4MGYR 1Z6AA 2PT7A 3QKSB 3KB2A 2FE4A 3EIHA 2GCOA 4HUQA 4J0QA 2NO0A 3Q5DA 4IOJA 2O8DA 3RAPR 2IS1A 1G17A 3FB4A 2LCFA 4V0MA 2Q9CA 2ZJAA 4LDJA 1GRRA 3AM1A 2JLWA 4KSBA 4TT3A 4TMWA 2BCJQ 2VP5A 4Q02A 4NYIR 5FUVA 1B0UA 2R44A 3WY9A 1NVUQ 3AF3A 4KFSA 1HQYE 2CDNA 4FMCB 4IVRA 4TN1A 4AKIA 3V4FA 2YOGA 3ZS8A 3K9NA 1FOEB 4ASUA 1G18A 2A30A 2C9YA 2C98A 2W58A 4BLPA 5KNBA 1YZNA 3QIAA 4RCZA 2JLXA 3KL4A 1OPXA 1KMHB 1TU4A 1N0VC 3A8TA 2J59A 2DWOA 4KLNA 2A5YB 5DI9A 1L4YA 2RGGA 1ZIOA 1K8RA 2XTMA 1RPZA 2VBCA 3GJ6A 1S0UA 3BB3A 3CH5A 2C03A 2Q0HA 2WTUA 3UPUA 4BFTA 1M34E 2GILA 1T4GA 1ZCAA 2CL6X 2NMVA 2D3WA 2CHVA 3CPHA 2QEQA 3GJ3A 4AY2A 2P5TB 4Q7KA 4W7SA 2OT3B 3PEVA 3BH7A 4W9MC 3QXSA 5CIWA 1ZW6A 3DL0A 4LBZA 1US8B 4QXAA 1I2DA 4AG5A 1VYUA 3L82B 3NBYC 3SHFA 5J4YA 4DC9A 4NL4H 1ANKA 2NO1A 2DWQA 1NG9A 2ASEA 3CRVA 3JZAA 3Q85A 3TK1A 4A2WA 1X86B 5JS8A 3C16C 4HAYA 5CB6A 2E9SA 4IKEA 1HUQA 4XWAA 4QJ4A 4LC1A 3KXKA 1KI8A 2ZRBA 1R8QA 3OIWA 1OFHA 1IHUA 1P62B 2YNMA 3T1VA 5H70A 5L3QA 4MUBA 3W6NA 4XVRA 4LSGA 1OFTA 4HZUB 4PHFA 3KDSE 3KXLA 1RJ9B 3SYNA 2WWGA 2OFXA 2W6ID 1G64A 2WAXA 1G4AE 4LGMA 2YHSA 1VCNA 8OHMA 1ZM3A 3Q7QA 5JBQA 4QBGB 1CR1A 3RRNA 3U7HB 2ZRPA 4DB4A 3QPUA 4BUJA 2QG6A 2OO7A 4BGDA 4EJSA 3B13B 1R0YA 1KAGA 1XD2A 1PLLA 2C78A 3ZIAD 4M1MA 2V1XA 3VKWA 3NEYA 2CCGA 1FP7A 2EWWA 2PJZA 1S3GA 2QPAA 3I8XA 3X1WA 2EVWX 3BWDD 4YMSA 1LTQA 1ZD1A 3RRYA 1CIPA 1CR0A 3CRW1 4B48A 1NLZA 2X77A 3KX2A 2OZEA 4NMMA 1ZU5A 1TPZA 3PCRB 4XSGA 4JMPA 1VHLA 1GWNA 2IC5A 2D7CA 2I3BA 3KZ1E 2ORWA 1BH2A 1Z0FA 4DCNA 4R9UC 5F9FA 3AVPA 3HR8A 3RRZA 5H1YA 2D4HA 3RS4A 3FWYA 2P6UA 1P9RA 2ZM5A 3NC0C 4WBSA 1FTSA 2OCPA 5JFGA 2ERXA 1KDOA 4IDOA 4D2IA 1QHHB 2HF9A 1Q3TA 2QPTA 1TNDA 1ZM7A 421PA 4B2IA 1LVGA 4RKFA 1QHNA 3GLFA 1XJQA 5CIQA 4YC7A 3EC1A 3GPLA 1GAJA 4Q1BA 1KDPA 1W49A 3U44B 5DHFA 2A5DA 2PH1A 1VG9B 3B9PA 1F48A 3AGQA 2A9KA 2GAOA 4X8MA 2AXPA 4U00A 4HATA 3KQUA 2Q21A 3ZZTA 3LNCA 2PCJA 2CEAA 4R71A 5JWRA 1F6BA 3K0EA 2GA8A 3NDPA 1Z0DA 1H8HD 4XIGS 3PUZA 3PITA 1II0A 1RJ9A 1HYQA 1E9AA 1C1YA 5M04A 2QMEA 2BWJA 3RC3A 5FTNA 2VP4A 2BMEA 2WWHA 1JJ7A 2ZRMA 2CNWD 1E69A 1G5PA 4A92A 4DLSA 1XDBA 1VCMA 2VP0A 4JLJA 2FDCA 1K5DA 3L0SA 4JYBA 4Q9KA 2FMXA 5E7MA 3U7FB 2WICA 2ORVA 1T3SA 2ZVPX 4FINA 1XTQA 4QKQA 2ECKA 4KXFB 3DPUA 1P2SA 3H84A 2Z43A 1E2MA 4Y0VA 2EFDB 3M4YA 2VRWA 2ZRFA 4MGKR 4ZO4A 4NH0A 3GP8A 1SKYE 1AGRA 1G21E 2XOKA 4A2QA 2IS2A 4UJ5A 1T6NA 1YZQA 1P9WA 4FI3C 4MITA 5DI3A 1AA9A 1GL9B 3K0AA 4DEXA 2BMJA 1VCOA 5CJPA 4R2IA 4B3FX 4M1TA 3U3RA 2GXSA 3BH0A 1YR8A 1A5TA 2ZRIA 5D3MA 2QENA 1DARA 4PO8A 4WXRA 3DVLA 4Z1MD 1L4UA 1ZJ6A 4F7WA 1ZM9A 3M1IA 2BEKA 3NC1C 1E2JA 3T5GA 4KV9A 2VYFA 3OAAA 4M1YA 2ZR7A 3CUEF 1G8HA 4Q4JA 1E2GA 1XTKA 4II7A 4KBFA 1WMSA 2A2ZA 2C9CA 1W47A 3DM5A 3DZ8A 2XOKD 1NN3A 2GJAA 5A4JA 1CJTC 2PL3A 2O8FA 4PQFA 1AS2A 1GM5A 4MYHA 3I3SR 3QKRA 3SEAA 1JNYA 4TZ6A 2F55A 2RB4A 2OLKA 1E1RD 5JWHA 1JQJC 4QOSA 1XTSA 2FSHA 2G3YA 4CEIA 3P26A 2J0UB 2ZI9A 1GUAA 3D31A 4IEIA 2QAGA 5FBWB 4F92B 1W4RA 4EPWA 3AUXA 4XWKA 4DCVA 4PO1A 2P5SA 4ITRC 2VHJA 2TMKA 3THOA 1IN7A 3PUWA 2HXYA 2ZRHA 3VKHA 3LX5A 4DSUA 1Q44A 5DIFA 1XMJA 3WXMA 1MV5A 4DLVA 1G3UA 2IUUA 1OJLA 4ZCMA 1GITA 1EXMA 3AB3A 3K70C 3FMIA 4P4UA 1E1QD 3FKSA 2D2EA 2KBFA 1Y63A 4MYCA 4MDEA 4KCGA 3UMFA 3A4MA 2R65A 4UNSA 4LYHA 4A8JC 3BAFA 4EJSC 3U44A 3V9PA 1W46A 2WOOA 3K09C 3OEHD 4JJKA 5G53C 4A0HA 5EUMA 4RFSA 3TMKA 3ZIAA 4RD0A 5F98A 3AVQA 1SVLA 2WJIA 4ZI3A 2GVDC 3UMRA 4BFYA 1G7SA 1XMIA 2WVJA 1D6JA 1AGPA 3TLXA 3C8UA 1PV4A 3FHTA 4DCTA 1Z6GA 2IA5A 4Q66C 3BD9A 4ESVA 4IJMA 1Z8FA 3W9YA 2WIBA 1IN5A 2X1VA 3VX3A 4HAZA 2V3CC 3QPVA 2ZRDA 4GBMA 1B23P 1SVKA 5TV2A 1NLYA 3SBEA 2QTVB 3X1DA 3AUYA 4Q4LA 4QG7A 3EZFA 3WNCA 1VHTA 2HUPA 1ZM2A 1XFAA 1U99A 4JLAA 2J3EA 4RY2A 3A1SA 1QVRA 3E1SA 4JSTA 5FBRB 4D26A 1NF3A 2WJHA 3HYTA 2UVQA 3LWNA 4P4SA 1U81A 4B33A 721PA 5DYIA 1DAFA 5B58C 3MG9A 2G77B 3BORA 4S35A 3TBKA 1JPJA 2FPKA 4EFMA 2HJVA 5IF9A 3QBTA 3QKTA 3CNOA 2BMDA 3DMDA 3S1AA 2GXQA 4B35A 3THWB 3CR8A 3Q7PA 1X8KA 5AJZA 1RRFA 1G8FA 1EFRA 2GF9A 4BLRA 3GFOA 1US8A 5TVKA 5LBIA 2WMOB 2XJ4A 4NCHA 2OILA 3SHWA 4BFVA 4WA7A 5IK2D 4D4LA 4LJ8A 4FMDF 5AUPB 2J87A 5HE9A 2ZI4A 3TH5A 1XXHE 1GKYA 2VEDA 1EWRA 4W5JA 3QUSA 3ZVRA 5AJXA 4LJAA 2O8BA 1E0AA 5KDLA 3VR6A 4OI2A 4OQXA 4BLQA 4UXIA 4QHTA 4JLVA 1G8PA 4B3XA 3DMNA 3RS5A 1U90A 3BXZA 4YMVA 1KMHA 3FMOB 2G6BA 2XTNA 2VIIA 3H2YA 2A78A 4ERNA 2IYUA 5KNCA 2GNOA 3E70C 1T8UA 3EARA 3L0OA 5JI3E 4DT1A 2OUKA 4B47A 2X2FA 5TDHA 4DSNA 1KKMA 1KK0A 2G88A 4F4IA 1VCIA 4CT4B 4HEJA 4V0ME 1M1YE 2FNAA 5J4LA 2YWFA 2FV8A 3W3ZB 5DI3B 2DFLA 2ZJZA 3DEFA 2P0EA 3GJXC 4KSCA 1GDDA 2IF0A 2IT1A 2WKRA 2B7BA 1NVWQ 3CKLA 5KSZA 1X1SA 1OYWA 3VNUA 4Z8XA 1Q0UA 1RYFA 5GVSA 2ZI7A 4Z51A 3VTKA 3NHAA 3K1JA 1BOFA 1AQYA 1DAIA 2OBNA 2QBYB 2IWHA 3EW9A 1H8HA 1ZAKA 4TLAA 2GJ8A 3AGPA 4MRNA 1W36C 2ZTSA 4RFSB 1G8GA 2NZ8A 1A4RA 2QMUA 1X8LA 1QHSA 3RVBA 2UZIR 4KVAA 3UWOA 1DPFA 3ND9A 4RD3A 2J45A 4R7ZA 4DBLC 2B7CA 1DVRA 2QROA 3IPXA 3ASZA 1AS3A 1IQPA 1OFIA 1XEFA 3A58B 1XMSA 2OXRA 121PA 4PXAA 2IXGA 2ZREA 2OBLA 3QOFA 1VYVA 2E1RA 5HCNA 4Q4HA 3WYFA 2R6CA 4CZ2A 1E9EA 3EC2A 1P2TA 1VIYA 3B6EA 4TTPA 3AVOA 1S96A 1S4QA 4ZIRB 3EZ6A 3OE7D 1ZM4A 1DAEA 1IM2A 3D6TB 1ZD9A 4DB2A 3NKVA 4M9SA 5EE9A 4EAQA 1XEWX 1CJUC 2OBMA 1FQJA 1IXZA 1N6IA 1ZYUA 3CX8A 1F60A 3HU1A 4KFTA 1P72A 4QFMA 4PC2A 5SZJA 2WJJA 4ILEA 1N6KA 4D4MA 3I62A 4DIEA 2P6RA 1SVWA 2KI5A 1GOTA 1G8YA 4GL2A 4JLDA 2KB0A 1U9IA 2H5EA 2BM0A 2ZITA 3K0FA 1IY0A 4I99A 4HLUA 1PLKA 5P21A 4IOMA 2I1VB 4C4PA 5HPYB 1CLUA 1E0JA 1AZTA 3CWZA 1MO5A 1NJFA 5CM9C 2JDID 3QSYA 1XPRA 3FVQA 2ZANA 1NBMD 2P65A 3QI2A 4ON9A 3BGWA 1UDXA 2FSGA 3F5FA 1KMQA 4GOKA 4LBWA 2GAAA 1L2TA 4CF7A 4JL8A 3CF2A 4NDZA 2VF8A 4NYMQ 3C5HA 2JCSA 5CITA 1G7CA 2QPOA 4C0LA 3M6AA 1T3HA 3LRPA 1E2FA 4BEJA 1XMVA 1NKSA 3BIFA 2XXAB 2X2EA 3CZPA 1UF9A 2CVHA 2HCBA 4Q00A 3ICQB 1NG1A 1G3RA 2WWXA 3IBYA 2CCJA 5J4VA 4P31A 4HUTA 4IDHA 3ASYA 3SJAA 1E0KA 5SZIA 3SZRA 1XF9A 2ODWA 4NCKA 3QG5A 4MKHA 1I4DD 4RKEA 1ZNWA 1KDRA 1Y3AA 3KFXA 4Q9LA 5GADl 2QP4A 1UKYA 4C0SA 3FHOA 4OJQA 2QT0A 3B82A 3CX7A 4KJZA 3DDCA 1M2OB 1P4SA 1MRNA 2LWIA 3I73A 3T06B 2ZUBA 2GBLA 3VR5A 1X6VA 4PFSA 5JJIA 1MT0A 4Z54A 1N5KA 1YVDA 2J46A 3PFIA 3WBKA 1U8ZA 1UDWA 1V43A 4G5RA 4ZKEA 1TQ6A 2VHTA 3PVSA 4IOLA 4MGZR 4PAMA 2QTFA 4OKSA 3HJNA 5G40A 3N5CA 4LHXA 2ZJBA 3H86A 1R4AA 2W00A 2YINC 1FMJA 1EFCA 2C2HA 2QRZA 5CYPA 5DYGA 1G5RA 2DY1A 4OK3A 3GLGB 4HLCA 3LBNA 3TW4A 4YMWA 4NHOA 2QGZA 4AKHA 3GEHA 2AD1A 3A4NA 1LF5A 4QGHA 5G3ZA 1ZMXA 2G0NA 4PX9A 3WRXC 2Z83A 1J8MF 3S1AB 2IYWA 1Z06A 1N3BA 2N46A 4NCIA 4R2HA 4TTRA 4Y0AA 2HEIA 3SU8A 3QF4B 1VPLA 3GFPA 4KI0A 4C9BA 2IS4A 4JVSB 2ZRAA 1YZLA 3B1YA 4A6XA 2JGNA 2JLRA 3RSLA 4AYXA 1OXTA 2BIFA 1K5GA 2XB4A 4Q4AA 2J9RA 3HYRA 1FUKA 2GKSA 4Q4JB 5JECA 3CRMA 5BQ5A 1KNXA 2ZQ5A 4KFUA 3IUYA 3REGA 2QSZA 1S2MA 2V7QD 4CEJA 3C41J 3AP3A 3SI7A 2QGNA 4EPVA 4M1SA 4TQAA 5FBQB 2ZSDA 5EE0A 4HAWA 2IBMA 4F4JA 2V54A 3FHCB 5EZ5A 4EPTA 4TYWA 2JDIA 2REOA 5EP2A 1KSFX 3RDPA 1DG1G 821PA 2GXAA 2PZGA 2Q9AA 5BN3A 1XU4A 5FPTA 1U8YA 2VTKA 4ZPXA 1VG8A 1SZPA 2ZSEA 4D0GA 2O8BB 3EXAA 1KI6A 2BBTA 3MWKA 1SGWA 1X8JA 2WSSA 621PA 1KO4A 1SHZA 4KODA 4M53A 5DH9A 1W4CA 2R9VA 2NG1A 3VNVA 3IBGA 4UJ3A 2IUTA 4A6PA 5DN6D 3GLFE 2YOHA 3B1VA 4M9QA 4BLOA 4O2RA 1KI7A 3K70B 4ARZA 3LLUA 2OV2A 1XPUA 5KHOC 1Q12A 2FOLA 4EFLA 1NN5A 1NMZA 1R6BX 3KKQA 4OYHA 4TT3D 4WVFA 4YDHB 4UQOA 3RS7A 3BFXA 4EJSB 1MOZA 1J99A 1LFDB 1SULA 2C9OA 3A1VA 3TKLA 4IOKA 4QNRA 5JHHB 2DCUA 2AFHE 2GCNA 3ZD7A 3GJ8A 2W6JA 1G20E 5H68A 4EUNA 2UZ3A 1NVXQ 4OQFA 3MCAA 3QG1A 5EE1A 1W1WA 4C30A 1E1QA 3K09A 4FMDB 4DEYA 1VIAA 4DCUA 4EQ6B 4UXHA 5AUQA 1U94A 2AFIE 2ORIA 3FE2A 1W0KA 4KVGA 4CW7A 2XXAA 3WMEA 3GLHA 2BEJA 3FPAA 4M2LA 2ZROA 3UG7A 2QBYA 4A8JA 1KYIA 2F1JA 2YC2C 3EX7C 5LD2B 1F2TA 2Q6TA 3OEHA 4JIMA 5HTKA 1F2UB 2N42A 5J40A 3FYHA 2MMGA 2R62A 2H16A 4RJLA 2ZJOA 2FZ4A 1T8TA 3AQ4A 5KDDA 1II8B 2ZU0C 4OBEA 3SJBA 2FFBA 2ZYUX 1NN1A 2KJQA 4OQMA 1VG0B 3GLGE 3R7WA 3T12A 1H8EA 4I1VA 1EX7A 2FF7A 3THXB 1E99A 1E1RA 3K9LA 4QC2A 3OFNA 3UKDA 1YU9A 2QAGC 1CJKC 3GJ5A 1QBKC 3UIEA 3ZJYA 2OXCA 1PZNA 4GNKA 3TIFA 4D25A 1E32A 4TL8A 4QJ5A 4TTQA 4QBHA 5AK0A 3NBZC 3AEZA 2L0XA 4CVNA 4TL6A 4DSTA 1XEXB 2ZSAA 4MQBA 3LA6A 4P4SB 4L9SA 1Q21A 2DWPA 3PEYA 3VHLB 4JVLA 3RSOA 3CO5A 2LKCA 3W5IA 4LYAA 1W0JA 4BQSA 1WBBA 1A2KC 2P67A 2REBA 4G5OA 2NO9A 2DR3A 1V5WA 3FTQA 4LC0A 4LHYA 4MUAA 4B44A 4I81A 2ONJA 3U60B 1DO2A 3J81k 2CK3D 4BZQA 3MLEA 4A15A 5CLQA 1OIWA 3QEJA 2I4IA 1GKUB 1H65A 3CPJB 1ONBA 2HF8A 3WBJA 3GLGA 2DFNA 3ADCA 1U0HC 3ECCA 1QHXA 4ZCIA 2A7QA 2ZJ5A 4DKXA 1TF7A 1D5CA 4URYR 2XEXA 3AF0A 4ZV4A 4AURA 5HKKA 1KK2A 2V1UA 4HAVA 5KDOA 4DWJA 2BJWA 5EJEA 3TUIC 1E3MA 4MDFA 2RH5A 3T61A 1R8SA 4HLDA 3BFVA 4JBYA 1IY2A 1KSGA 1YHNA 1MRSA 4CYMA 3I8SA 2AK3A 521PA 1GL6A 2J7PD 2P3SA 1W48A 4LV8B 3QKRB 2ZRGA 4DLZA 4C7OB 1KO7A 4LV6A 1XNJA 3AVTA 1N6HA 3BB4A 2XAUA 1LY1A 2BHRA 4FWIB 2GJKA 3AKEA 3KJIA 3LW8A 4JT4A 2HJGA 3ZVLA 1BO6A 1N6RA 3QEOA 4IFBA 1HV8A 2C99A 1W5SA 3LW7A 2H18A 3SN6A 4A2PA 1J8YF 1M7HA 1CU1A 1N5IA 2QM8A 1FNMA 3GCGA 4ACAA 4F4CA 5J4KA 3W6OA 2NO7A 2NTYC 1XXHA 2J1LA 3O8DA 4E22A 1UPTA 1GRNA 1TX4B 1UBGA 2B92A 2E87A 3U3MA 3NWJA 3ND8A 5IHPA 4MKGA 1SVSA 3AKCA 4BECA 1RKBA 2D06A 2GHIA 1OXVA 2FSIA 4Q1CA 4G5GA 3A1WA 3BB1A 4PC6A 2IYSA 2YV5A 4BRWA 4G0NA 4LJ4A 2IYZA 3KUDA 4JLPA 1KOFA 3TSOA 1KAOA 2WMNB 4BLTA 3IEUA 4PTLA 1ZUNB 2ZRKA 3CB4A 1KK1A 2QE7D 2CJWB 3JVVA 3U3KA 3B1ZA 2PT5A 3GLHB 3ZLJA 5EUQB 3AVUA 3LDAA 4NYMR 1IJEA 2GZAA 2V6JA 4A8JB 1S9HA 4AWXA 1Z08A 2B21A 1E9DA 1KJWA 3QKSA 4PPGA 4U5XA 2ZJ2A 4PC7A 3NEJA 4LBVA 3X1YA 4EQ6A 1HURA 3AVVA 1S3SA 1JR3E 2MSCB 4CGZA 1YRBA 2C04A 1DBSA 1OYYA 4V0OA 3VHXA 3AKYA 1YE8A 4I1UA 1OH7A 3PQCA 3K53A 4AC9A 3AF2A 5EZ6B 1EWQA 1E96A 3QVVA 4LJ5A 4PHGA 4M1WA 2FFQA 2WM9B 2G1JA 3C5CA 4EKDA 1P6XA 1TEXA 2ZRJA 2B8WA 1BKDR 1VG1A 4URVR 4DIDA 1TL7C 5JEEA 4D80A 3CF6R 1GNRA 1X1RA 1GL7A 1TU3A 2Z5FA 2MMCA 2QMHA 4OQNA 4PPFA 3B85A 4NPHA 2ZXUA 3O47A 4NYJQ 2WAYA 2A5GA 4BFZA 2OFWA 1VMAA 1E2IA 1MH1A 2JLSA 2OE2A 2ZE7A 3D8BA 2RKOA 3K9GA 3HDTA 3KQLA 2IYXA 2P6NA 4MRPA 5EQTA 1CEEA 1HT1E 2AWNA 1JR3A 1NSFA 1LNZA 1NLFA 1JPNA 3R9WA 5AR1A 3BC1A 4CEHA 4V0LA 2XJ9A 3AH8A 1IXSB 3B8HA 1RRPA 3ZZUA 3AKDA 3K0AB 4WXPA 4EPXA 5B64A 1AM4D 3B7GA 1TADA 5CB8A 5HCIA 3IILA 1P75A 2ZIAA 3ADKA 1EK0A 1G9XA 2EFGA 4ASUD 1SXJB 2WJGA 4LPSA 4HAUA 4ZI2A 5C1BA 4MYUA 3Q9LA 2R6FA 4OI1A 3A37A 2R6DA 3VX4A 3CR7A 3LVRE 2IEYA 1M8PA 5HZHA 5DISB 5C2JB 4MH0R 4DCSA 3ONWA 5FOVA 4I4LA 2AR7A 1KHTA 4RFVA 4C7OA 4TYYA 5JI2E 4JKYA 4GMXA 2EYQA 1DTSA 2H57A 4QNMA 3IEVA 2QL6A 5E95A 1ZC4A 3W90A 5FBVB 1XEXA 2AXNA 4KAXA 2ZUCA 5AWFC 3I1FA 3QQ5A 4LJYA 4LV5B 4V02A 1BMFD 3L2OB 2CHQA 1IN4A 4F91B 1DAGA 3HU3A 3SDZA 3FDIA 1QG2A 4BFSA 4X8HA 2FH5B 3IQXA 4IDPA 2FU5C 2J0UA 2XGJA 4HAXA 3Q72A 2O0KA 2GZHA 5JRJA 1NMXA 3EWAA 4N0DA 1RIFA 3C14C 3PIRA 2QU8A 4Q7LA 2C5LA 5AJVB 2YWGA 5EXXA 4D4JA 5KSPA 2RAPA 2ZPTX 2ZRNA 3HP1A 5EXSA 4FN5A 1ZUHA 1KJZA 1FTNA 2W2VA 4LRWA 3K0FB 3KQNA 2H8KA 4WW0A 2RGEA 4LY6A 3W3AA 2PMDA 2V8OA 2QE7A 3UANA 2H1LA 1XJ0A 2ZRLA 1GILA 1C9KA 4TYQA 2ZU6A 3X1XA 2CLDX 1OLOA 3UK6A 3GMTA 4ACBA 4GRAA 2WWFA 4MRRA 1RRCA 4LWZA 1KIMA 3SJCA 2AKAB 4TLBA 4L5BA 4ZDKA 2FN4A 4NTZA 1CR4A 2Z4SA 4RZUA 4Q1AA 2B6HA 2IWRA 3GLFB 3C7KA 3DM9B 2RGNA 5CDFA 3VU9B 2PZFA 2QMOA 5DGXA 4HB4A 2PLFA 1R10A 1CBUA 2WIAA 4PZYA 4XTCS 2JLYA 1ZU4A 4A36A 4Q4HB 3KKPA 2ZJYA 4JL5A 2CL0X 1TMKA 1TQ2A 4LUCA 5JZVA 3A1TA 1WRBA 4B32A 3BOSA 4L8GA 4TQUS 3WNBA 4PZZA 5EXPA 5IDVA 4N0EA 4A0FA 1UBEA 1FNNA 1NP6A 3AVXA 2ZR9A 5EP4A 1SHKA 5GJCA 4WOPA 3HPQA 4V03A 1Q1QA 4AYWA 3RNLA 3KQKA 1WA5A 5K8LA 2OCYC 2XSZD 3IQWA 5FUYA 2KBEA 4B74A 4C0JA 2DFTA 4KYUA 2FWRA 2JLQA 1EESA 5HZKA 1E2LA 2FEMA 2WSMA 2JJ8A 1XRJA 3R20A 3TAHA 4TQ9A 4XJXA 1G7TA 4WAUA 4EIWA 5CDFE 4B3CA 1XXHB 3B1WA 4LX0A 4B75A 4Q21A 1ZD8A 2IYRA 3TVTA 3B9QA 3CRRA 4ZDJA 4XH9B 3PUYA 3R8CA 1ESNA 2V9PA 4M1OA 4MKFA 4US2R 4FCWA 3OESA 4RVCA 3T1TA 2YC4C 5F3WB 1F3OA 1N5LA 2FZLA 1UEJA 3GFTA 4LHWA 1QHYA 4IRUB 3MWYW 1A7JA 1YZUA 2QRNA 4QM7A 4D6PA 2EQBA 1NL3A 1R5OA 4BWYA 4I1OA 4TSFA 1MO4A 4OI0A 1OW3B 1WDTA 3GEEA 4H1UA 6Q21A 1DELA 2H7VA 5C46F 1DAKA 5AJWA 1MO6A 5LB2A 2CJWA 4IFEA 4L4UA 1UKVY 1R0XA 2QUZA 3MD0A 1MKYA 4CIDA 1E2NA 4E07A 3TAUA 2N1BA 1OIXA 4DJTA 2QA5A 1XBTA 1T3LA 5TARA 4QGFA 1SXJC 5FFMA 1GSIA 1JJVA 1KSHA 4B71A 4TLEA 4O25A 4Q9HA 1EX6A 1YZGA 2O8FB 1FW6A 5FH9A 1E9RA 1HA3A 2IYVA 4JLKA 3SR0A 4PPQA 4Q7MB 4M21A 4H9GA 1XTIA 2ZI6A 4LJ7A 1SVIA 2DFKB 4M22A 3ZH9B 5KSYA 4UNQA 2XZLA 4CDGA 1ZUIA 2G0TA 2J0QA 1E6CA 2AN9A 1S8FA 4JBWA 1KY3A 1BIFA 4B76A 4A0RA 1ZNXA 1WCV1 1XCGB 2C95A 2FFHA 1G4UR 2FX3A 3NH6A 3ADBA 5G3YA 5LB4A 1COWA 4RZ3A 2XX3A 1UJ2A 2QNRA 3U3OA 5AUOB 1ZCBA 2PMKA 2O8EA 1LF0A 1NVVR 5BYKA 2V6IA 4OHVA 3OIYA 1T5LA 2O52A 3KFVA 2QI9C 1Q1ZA 1TQDA 1YR6A 2ZI3A 3RLFA 2IYLD 3ETLA 4ESHA 5L3VA 2PX0A 2F3TA 4WZAE 4GP6A 4TMTA 3GQBA 1JALA 1Z0IA 1NI3A 3NBXX 4CEHB 1GKIA 2PEYA 3E5HA 4Q4AB 1TUEA 1NIJA 2NPIA 1JQLB 2EFEB 4HUQB 1Z07A 3LBHA 2NPFA 1FMLA 5FI0B 4C2UA 3CRQA 3IPYA 1OXUA 2GCOB 3WMGA 1U8AA 4HI0E 5CK5A 3R7WB 1QHIA 1XJCA 2C96A 4QGAA 1ZC3A 3GLIA 2HCJB 3P32A 5E7IA 3O8CA 1CKEA 2XITA 2G9NA 1W2HA 3HU2A 3O8BA 5C18A 1QRAA 2YWHA 2VHUA 3ZQ6A 4DLUA 2GZDA 3TSWA 4HZUA 3KB1A 2FSFA 5KO2A 1FQKA 1CTQA 5SZKB 1CR2A 3GJ7A 1GRQA 3K0CA 5KNDA 1JAHA 3THYA 1YJ5A 3ZVMA 3FKSD 3VKGA 4LYJA 4A82A 2WBLC 2KSQA 2V55B 2CHGA 4PPNA 4BFUA 2P2LA 5TY0A 3MJRA 4GOJA 4AI6A 4JL6A 4WIAA 3G82C 3SS8A 2F43B 4LI0A 2F1IA 4IVQA 2EFHB 1FX0A 5FOTA 1A82A 1S1CA 3SQWA 3H4MA 3EPKA 4GP7A 3UG6A 3I72A 3W8NA 4URXR 1Q1BA 4IW3B 1AZSC 1IBRA 2BBSA 2CXXA 5SZHB 4ARZB 3CM0A 3LXRA 5KU1A 1QHGA 3CNNA 1OB2A 5KYKA 2ODNA 2GVZC 4AYTA 1W44A 2OHFA 3V4RA 5L8VA 1JB1A 1GNPA 1T0JB 1JR6A 5G41A 3WYGA 4AD8A 3RANA 2FEOA 2GESA 2Z6VA 2EW1A 3DHWC 1W4AA 1Z28A 4IXMA 4M0LA 5D3MB 1T91A 3RS3A 1J90A 1R5NA 2R6AA 3K0CC 2WJVA 4A4DA 2DYKA 2ZR0A 4LHZA 3DO6A 2VP2A 2ONKA 4B34A 1D9ZA 1P9NA 1G16A 4FMCF 2CL7X 3SC3A 3NHBA 3EIEA 4ZIRA 4Q5IA 2F9MA 3A6PC 4TYNA 2Y8EA 1WP9A 3U6BA 2I1QA 3KUCA 2NOAA 2OAP1 2J5XA 3WP0A 5JS7A 4FCTA 2EWVA 1JBKA 3MFYA 3CIOA 4P32A 1KI9A 1XD2B 4KLZA 3BJIC 1JAIA 2QQEA 4HB0A 5KPDA 2IHYA 3LFUA 4NONA 1AQUA 5FR1A 3WHLA 5ELXA 1M6NA 1HE8B 3IIMA 3QNUA 5EP3A 3ZVNA 2WJYA 1L7VC 2EFCB 3E2IA 1C4OA 2ZI5A 1AS0A 4CEIB 3B60A 4QGGA 3GLIE 1KI3A 4LYFA 4DHEA 4HDCA 4M9XA 4DLXA 1I4LD 5FL7D 1R2QA 3PG5A 1EFHA 3CLVA 2NO6A 1OT3A 1VYTA 1G7RA 1W2GA 2GK6A 2VQSA 2ZJ8A 1FZQA 1RFLA 2IK8A 2QP3A 3B1XA 1XEWY 3IDQA 1YR7A 5EP1A 4E09A 4URUR 3CPEA 4BEBA 2QT1A 2GK7A 4HZIA 4YQFA 5BN4A 1DS6A 1Q22A 2NGRA 5E4FA 5KTYA 2HYIC 1ZNYA 3RYTC 2IYQA 3IIJA 1S1MA 3T34A 3SBDA 3P4XA 1OIVA 2FPMA 2XZOA 5LDDC 4RD4A 4L9WA 1XD9A 1HE1C 1J7KA 3QBVA 4GPTA 1N6LA 2GDJA 5LPNA 3DZDA 4JYCA 3EPLA 4GSYA 4MRSA 3N2EA 2BV3A 3PENA 1S9DA 2IEZA 4Q48A 1QZXA 2R8RA 2QY9A 3UATA 2ZSFA 3THXA 1TTTA 4F38A 3N2IA 3SE0A 5AJYA 4TZ0A 1SVOA 4D0NA 2PX3A 2J41A 3TRFA 1X3SA 2ZRCA 3U61B 2RHDA 4TL9A 4F93B 4E03A 3LH5A 3VQTA 2BKUA 4OQLA 3L0PA 3P20A 3A36A 2F3RA 4JVMA 3GLIB 1IN6A 1PUJA 1NY6A 3OE7A 1U0JA 1E9BA 3B78A 3P27A 1PLJA 3QXHA 1Z22A 1KNQA 2ZUDA 2ZYVX 3RWMB 1UAAA 2QAJA 5L3SA 1G3IA 1OXXK 4C0QC 4DSOA 3R9XA 3AV0B 2H17A 1FX0B 1AKEA 1YKSA 2JJ1A 3HPRA 3N70A 4HB2A 4US0R 3TW8B 3IHWA 1Z47A 3TGPA 3OF5A 1Z6XA 3T15A 3K0SA 1Z3IX 1ZRHA 2FA9A 2BM1A 2PZEA 2ZAOA 4FXPA 4R98A 1SVMA 3TSZA 5FPKA 2CCKA 1CP2A 4IHQA 2WHXA 1BYUA 2A5JA 3MAAC 4RSGA 3GJ4A 1XCPA 2FJUA 3IO5A 4LK2A 3BK7A 2D74A 3RRMA 4BFXA 1OKKA 3PEWA 1OV4A 4C0KA 1EGAA 1RYHA 4YDSA 5JJLA 2J0SA 4BRUA 3QPWA 1MABB 2FPLA 2DHRA 2O0JA 2YZ2A 1DE0A 3LVQE 4XWOA 5BN5A 4B3BA 1NY5A 4UXJA 4B73A 2BDTA 2C77A 1MABA 2JAQA 4FWTA 4DDUA 3U4QA 1CULC 5B2ZA 1NRJB 1Z0JA 2UKDA 4WZBE 4C0HA 3RC8A 1P2UA 1UBFA 1W5TA 4LPKA 2VSXA 2WOJA 3HWSA 4A0GA 1ZINA 1YR9A 2O8CA 1JR3D 2SHKA 4UKDA 1FUUA 2Q3MA 2RGAA 1W4BA 1AKYA 2AX4A 1N0WA 2GEDA 1WQ1R 2OCBA 3G5UA 4ZCLA 3WHKA 4U7DA 1GNQA 3CW2A 4NE2A 1E9SA 3SJZA 2GF0A 5J4HA 5GJWC 1Q3HA 4QBIA 1VECA 2IXEA 2RCNA 3RS0A 1JXMA 4NZYA 2VL7A 1K6MA 2BBWA 4JZKA 3PJRA 3MMPA 4EPYA 2XZPA 3KKMA 3X1ZA 1CJMA 2RGDA 4HDOB 4FCVA 4D81A 4L15A 5HR5A 3FGNA 4LJ6A 1KI6B 4IEEA 1Z6TA 4C2TA 1UADA 1Z29A 1IN8A 3WP1B 3CF0A 3QXXA 3MGCA 1RW4A 3Q5EA 4UNPA 3EAQA 4Q19A 4XD7A 1ETUA 1G291 2GXUA 4QRHA 1R0WA 1NBME 3Q3JB 3LBIA 1G3MA 1QDEA 4N3NA 4Q03A 1RZ3A 2ERYA 3QF7A 5CLLA 2VPPA 1E0SA 1LB1B 2CK3A 2B8TA 3LX8A 3A1UA 4JT2A 1T5IA 2AHOA 1N25A 1P60A 2AL7A 1ZVQA 3TVDA 2ZS9A 3MJHA 2KWIA 2IYTA 2DPXA 2OCAA 4Q1DA 2PEZA 3QF4A 4Q18A 1EFUA 4Q1FA 3SYKA 5E3HA 4LZZA 1U2RA 1SKYB 3KKNA 3LAWA 2D7DA 4L16A 2IX3A 3F3YA 3RWOA 4DUGA 1GVNB 3GJ0A 3W5JA 3VR4A 2IUSA 3CZQA 5FOUA 1G19A 3NIBA 2G1KA 1NIPA 2A5FA 1JECA 4MGIR 2V7QA 4H1VA 1M7GA 1N6NA 2RGBA 1P7CA 3IHLA 4OJKA 3PUXA 1BYIA 1YZKA 5GJVC 1H8ED 1W7AA 5JJKA 4RZ2A 1J2JA 5JWOA 4MYTA 1G41A 4LJ9A 1DOAA 4PQYA 1GG2A 2GETA 2WPDD 3LQRA 4E5UA 1WBDA 2REXB 4C0BA 2QN6A 1TUIA 3W6PA 2JLZA 3C15C 1GTVA 1TAGA 2D2FA 2GEVA 4AKGA 4QJ3A 3ZZ0A 2X8AA 4DUGD 4GMDA 1VKJA 3G0HA 1GFIA 3KTAB 3BFKA 4BZPA 4PHTA 4OHXA 1IXRC 4A1FA 4TMXA 2ZE6A 3FMFA 4GDFA 4JBXA 4NCJA 1GP2A 2VSFA 4TL7A 1FL9A 4KFRA 4W5WA 5DSZA 1WXQA 1G1MA 1Q1EA 2J7KA 2F7SA 5UKDA 5EXTA 5KSOA 5EE3A 4FIDA 3TUJC 1FP6A 2W6JD 4Q01A 3EZ2A 2Q3HA 1UBCA 2PCLA 4K8OA 4XSHA 4RD1A 4G5SA 2BVNA 2JJ2A 3AP2A 3TUZC 1P3JA 1CJVC 4Q1EA 1IJFA 2OFOA 3DOFA 4AG6A 1L8QA 2XNSA 2ZS8A 3HR7A 4PR0A 4QBFA 1HY3A 1HT2E 3W34A 1G5TA 4JS0A 1BS1A 4XD7D 3FFAA 1M74A 2ZVQX 3SNHA 5GJBA 3IKJA 1GZSA 2VHQA 4KHZA 3L0IB 3K9HA 2RGXA 4OK6A 1TEVA 4RD6A 1FFHA 3D3QA 3U2QA 2JA1A 1KGDA 4JLBA 2BKEA 2GEUA 5FR2A 3T5DA 4PC1A 4ZDIA 3ADDA 3SFVA 4PAOA 5GVRA 3VU9A 5A0FA 4PSAA 4D4KA 5K8TA 1P2VA 3MWJA 1KK3A 3NG1A 1KDTA 2AKYA 2AK2A 2OM2A 3CONA 3EG5A 3FFBA 2BCGY 1R5BA 3WNDA 3OHMA 5J47A 5JCZA 2WV9A 1XB2A 2CLCX 3KXIA 4HLQB 4QL3A 2PJRA 3P1JA 1Q20A 3OEEA 1QG4A 4TLDA 5L3RA 3RHFA 3AF4A 1HEIA 1DAMA 4TWZA 4DDVA 1AIPA 2VP6A 3I92A 3TJZA 1ODFA 4Z8YA 4TMZA 1N5JA 3B5JA 1IONA 1Z83A 2WWIA 2JEOA 4AKEA 4BZXA 2OAQ1 5L3SB 3AF1A 4KO8A 1SKQA 5K8UA 3I4LA 2C8VA 1TF5A 4DLYA 5IT5A 5F9HA 4Q9IA 1II9A 5A5GA 5TB5A 2O5VA 2EU8A 4GFDA 3M0EA 4PHHA 1R0ZA 1IAQA 2Q9BA 3NBFA 4O3MA 3RABA 5CM8B 4OL0A 4DZZA 2GTPA 1W0KD 5FBLB 1QVAA 3V00A 4B6EA 3VR1A 1QHHA 4DLTA 2HV8A 2X19A 4K46A 1CXZA 4LHVA 4YLGA 4DVGA 3I61A 3AVYA 1OSNA 2VO1A 1KSJA 2W2TA 4HB3A 3OAAD 1DG3A 2AWOA 2IF2A 3LV8A 1KO5A 4X8OA 2HLDA 5FL3A 1KZ7B 4V0NA 3VR3A 2QQ0A 3U5ZB 1UEIA 4XOIA 3KKOA 2WWWA 4QHYA 3KJGA 2GJSA 3LY5A 3T1QA 3DKPA 3FMPB 3UXMA 2ATVA 2CBZA 2F1RA 5BYJA 1RC8A 2RHMA 1LS6A 5CJ2A 1EG7A 2H92A 3VAAA 4CEJB 3W8RA 4DT1B 3DKVA 4X8LA 5FOWA 2CE2X 3SFZA 3LXXA 4OI4A 1Z2AA 2F43A 2VF7A 4OK5A 3I32A 4LCBA 3JZMA 4PQRA 5E7JA 4NP6A 2ZE8A 2BBOA 2CLSA 3A4LA 1NJGA 1COWD 1AK2A 3KTAA 4Z1MA 3ZYCA 1E79A 4PZLA 1ELOA 5JCPA 1A2BA 3EWSA 2WPDA 3CNLA 5CYOA 5H8WA 3LQQA 1ZIPA 4YMUA 3NDBB 2CE7A 2CNWA 1R7RA 5ANRB 2YKGA 4B3DA 2VSOA 5FL7A 2F6RA 2ANCA 4ZDWA 2GCPA 2ATXA 4BFWA 4GZMA 4JVNA 1CRQA 2DBYA 1N6OA 2ZYWX 1E4YA 2J7PA 1SQ5A 2QAGB 4LOAA 4CT5A 1VDZA 1BMFA 4OHZA 1SXJD 5B30A 1Z0AA 4HSEA 3QXCA 1U98A 4DRZA 5IRCD
chains in the Genus database with same CATH superfamily
4HGOA 4AF8A 3KUUA 5EMNA 3PFGA 4YCDA 2B36A 2HR1A 5LSAA 2F59A 1O9BA 4GH5A 1X39A 1YVPA 3C3KA 3QEMB 1VL2A 2XBUA 5DT2A 5FXMA 2HT6A 3UWMA 2JW5A 3LDGA 4ZICA 1MU0A 2FR8C 1YK1A 1Q0QA 2XSZA 2H6EA 2FUG6 4J07A 1XPOA 1IM8A 2CVFA 3PC7A 3K70D 2X9LA 1P1JA 2AZDA 2XRZA 2PXXA 5NLLA 3EF0A 4ZVPA 3LT5A 4DLKA 4LNUA 3LF2A 3IO3A 4IDNA 4D9GA 2VH5R 2PWZA 2QN3A 1IUOA 1RC0A 2GT1A 1GSAA 3EGIA 4GWGA 1F17A 4OGWA 4ZYYA 3I5YA 1EZ4A 5GWXA 1XVVA 3OFND 2QM7A 3I2GA 1H4TA 1USKA 4R2KA 2JAXA 3P2EA 5DNYB 2EP5A 3GD7A 4Y1RA 3B5IA 2VK1A 4ZEOA 2AQ8A 3PX2A 3HEBA 2GFIA 3PNBA 3EZ7A 3WMFA 3K9QO 4N65A 2CUKA 1YS1X 5AK4A 5JZ9A 1EFRD 1NUPA 2Y9PB 1Z7YA 2OEPA 4F9FA 5LMNB 3KWFA 3IVAA 5T8KA 5EZQA 5EZSA 4Z99A 4QUHA 4CR8A 2MR5A 3QX8A 2VWPA 3NXSA 4LGCA 1BH6A 3HSSA 3SMVA 4EA8A 5C4MA 2ZUFA 4GR4A 3WG9A 4LMPA 3TLGA 1E6MA 1VFNA 2H1HA 5ES3A 3G5TA 4CUJA 4LRXA 3IP9A 3MZ0A 4WEQA 1E63A 1GNLA 1J22A 1ZRSA 2FRDC 1WETA 1E7WA 1SIUA 3AIOA 2L19A 2YJ4A 4ZTBA 4N9WA 1XA0A 1OXSC 3NUGA 2GAIA 3BE4A 4JI3B 5KPJA 1L6IA 1NVVQ 3W6UA 4EJ6A 5C4GB 5JZMA 2O19A 4ZEXA 4EPRA 2NXWA 2ZYHA 3ZCRA 1IWOA 2PJDA 3UXHA 1FSSA 3ZE6A 3CJRA 4FOTA 2X2PA 5JAUA 1E2QA 1E4VA 1ZA1A 3C1TA 1XZQA 2O2ZA 3LZDA 3EPRA 5KAPA 4EHNA 3RVDA 4IXWA 1TYDE 5K0SA 1E3WB 5TXGA 4MRVA 4E2ZA 1EFPB 1I2MA 2R79A 2PXAA 2ANBA 4ZVVA 1P0PA 1OF1A 3EVTA 3I39X 1KZGB 2XQFA 4RIFA 5B57C 1ST3A 3K4HA 3PXEA 1C8KA 3TNFA 1ZUD1 1JEDA 4EYOA 1E3EA 2EKDA 2EP8A 4ID9A 3U6KA 2DB3A 1FYEA 1DADA 1QPGA 4M60A 1KY2A 1JT9A 1RHKA 3FLEA 3LLCA 2GARA 4RD2A 4ECAA 4EGQA 3A1NA 3FAZA 5KOHA 3SIRA 4POAA 5KYYB 3ZCUA 4ETWA 5KAMA 2Q2NA 3UHPA 4Z6KA 3BE5A 3KQTA 3LYLA 4XGQA 4BN5A 3BBPA 5FWDA 3C7CB 4UAVA 2VK4A 3WGHA 4P3KA 5KINB 5JSZB 2EBWA 2NUTB 4DJJA 2XXBA 4M8LA 3SF0A 3WWDA 4GZ5A 4JLNA 2ZIXA 4G3XA 3KR0A 3R8FA 1NAHA 2YVUA 4I55A 1BGVA 4IHJF 3SX0A 3MRSA 4M8NE 3PD7A 3EVBA 2ZS7A 3OQVA 1MNQA 2WB4A 3F73A 2D8AA 3D54D 3IUNA 1VLQA 1EE9A 3OIVA 3QK7A 1V95A 5FPHA 3E8MA 4KGZA 1XRRA 2PZKA 3M6VA 5D85A 4B6PA 3ZQKA 3OZFA 2NNLD 3CWQA 3D4BA 4RKRA 5DYWA 5FYQA 4DLRA 1HTWA 3J80A 2E85A 5C5IA 1U2TA 4DV0B 1ECFA 2P2YA 1HBJA 4G25A 4DWOA 5F3RA 2DE0X 5CT6A 2O2JA 2LKDA 3ESBA 3GBSA 3HEMA 1FLVA 3IYLW 4WOBA 4PIPA 4BMXA 4EEKA 5CNIA 3WR5A 2Z4RA 4PANA 2OP0A 3DP7A 1QCDA 1RLIA 1KPGA 5LIRA 1QV9A 1XALA 2ZLBA 3K94A 3RBAA 5J5CA 1K9VF 4LBYA 2R6GA 1HFWA 4LSWA 5B7PA 1TK9A 4FLFA 4TVBA 4OEHA 1CVIA 5G2OA 1DB3A 2ZJ0A 4KXMA 3U4QB 4LZPA 4AKTA 4GT1A 4BE7B 4RTLA 1OH6A 3GRPA 1F06A 1DJOA 5JCXA 3TF5A 1ISMA 1E3SA 1GY8A 1Z2CA 1P73A 1TQ4A 2EFYA 3H8SA 5H3HA 2P9GA 4NE7A 3ZCVA 2GBLC 3IVXA 3FHJA 4K3UA 5TS3A 3L7NA 1SWVA 3SEZA 4BRSA 3AEUA 3CS3A 3IAHA 4AVYA 5BWBA 1M7BA 1O08A 5K45A 3VVMA 4DIOA 1OHHA 3MVEA 1MGOA 1KO1A 1U8EA 2JJ1D 1ORTA 3AU8A 2BEUB 3HRKA 3I9V1 1YJQA 1SUCA 3QQPA 4G1UC 2XZTA 4GD3Q 4CCAA 2BGGA 2YV1A 1J5XA 2FKAA 3Q3HA 3P4UA 5KOYA 2JASA 1K66A 1GUZA 4EBFA 3L43A 4JLSA 4B3GA 1P5ZB 2BEUA 1RSZA 4WFKA 3H0KA 4YO7A 3LQFA 4JHLA 2NZJA 2Q8NA 3EZ9A 3FSRA 1L4MA 4K81B 3OEYA 1FTWA 1WW8A 4X6LA 4AP6A 5IW8A 2X0FA 3QVUA 2JIZD 4O4IA 4WHMA 2YX1A 1VYHA 2D4AA 2V7XA 3TQCA 4KO4S 1MAVA 4NABA 2PGJA 2VT2A 3VZPA 3FF1A 3WLMA 3A6ZA 5FTKA 3AETA 4XM1A 4S3MA 4QHSA 1RYMA 5SYNA 2VJAA 5DE3A 3VZSA 1CQPA 1Z5WA 2HYDA 4MKRA 2NZYA 3F6BX 2R8EA 4FPXA 4FYXA 2DBZA 4C1BA 2P2SA 4EGSA 5JFTA 2ARKA 1T6XA 1GPKA 1JMVA 3PUVA 3UUWA 4F4UA 1K4KA 2W7TA 3EH2A 4A8TA 3IIEA 1T2FA 5GONA 3F6CA 1FS5A 1K7YA 3GZ4A 4GKJB 4Q3AA 2OV8A 1K3UB 4IIYA 3ELYA 4FNMA 1J2UA 3R5KA 2XUOA 2XTZA 2R5NA 3MWEB 4YBRA 3TTSA 1DEKA 4HLUC 4Q47A 4TSRA 3QI7A 4BUCA 1CY2A 1KFBB 3SG0A 3PHIA 3KS9A 2ZCJA 3PXDA 4J6EA 4OUDA 4BAGA 1YS9A 1Z63A 5FPYA 3OA0A 1YDMA 2Z9BA 3L6UA 4QUAA 2HSWA 3DWEX 4D96A 2MSDB 4BVHA 1D2EA 4FZJA 2H4JA 3NMUF 1EM6A 1K3TA 4J0HA 5DN6A 4OAPA 3EMDA 1GTMA 3QWAA 4XUEA 1KKLA 4OJTA 2XMDA 4QT0A 3QXJA 4RA9B 2DH5A 4OHYA 2C3OA 2I8LA 1CE8B 1CZUA 3CNQS 4YECA 3GG2A 1ZP6A 2FB9A 2W4QA 4OB7A 3I58A 4U7FA 3DV2A 4S1TA 3T35A 4WFIA 2J3KA 2VUSA 1MZVA 4LDNA 2OPHA 4JSRA 4PXSA 4M0MA 1QH8A 2ZAYA 3DQQA 1NBMA 1G6OA 3C3EA 3K0KA 4F21A 1ZVMA 5FFFA 4XVUA 4B7AA 3UOGA 4F6RA 5AW3A 1RYZA 1UM8A 1B8OA 2X0EA 1XP8A 3DUWA 4DMFA 5A4FS 4LJSA 3SSNA 5L3QB 2HZBA 4MV1A 1A50B 2PPVA 3SYLA 5TMPA 5DTQA 4W5HA 1R6UA 4KLCA 1T5BA 2F00A 1CQIB 1D3AA 1SXJE 1IY8A 4YCAA 5AJHA 4D9MA 5C7IO 1X0XA 5IT4A 2G83A 4TKUA 5JALA 1U6JA 5LA6A 1CRPA 1PG2A 2D5AA 3VR2A 4BO5A 3AEQA 4CCYA 3A4YA 3EA5A 3JZIA 2H3EA 4ZC8A 1YQTA 4F5DA 1D6NA 3E3LA 4C6RA 5LD2C 4KMSA 1U7PA 3D81A 1C1DB 3DBRB 3E22A 2O5CA 3R40A 3BIOA 1D07A 4NYJR 4GZLA 1NA5A 2G5CA 1YB5A 2F9LA 4UBKA 1UDRA 1FFWA 1T8RA 1X14A 3H9BA 3ZGVA 2XCTB 3P0FA 4X93A 2AE1A 1SKMA 4G24A 1U4NA 1Z5ZA 1ZCFA 5G1NA 5HGXA 2X15A 3OQOA 5DP1A 5ALOA 3IEXA 1UP4A 1B8UA 5JAZA 4BLSA 2BFPA 2JHPA 1UPAA 1TF2A 2NVWA 3JVUA 4I6JA 4MA4A 1VRCA 2FPSA 1H1DA 4J2TA 4CFSA 4EO4A 4UHKA 3LP6A 4YVFA 5DCLA 5E6RB 2RK3A 3TPCA 3MA0A 3QENA 4S04A 4NCNA 3THRA 5L7YA 3LC1O 1N5OX 3E81A 3HCPA 2WKQA 1T1EA 3IA7A 3PZRA 1HH4A 2A33A 3OE5A 2FPUA 1H85A 4R2JA 3UJ8A 3WIVA 4BVGA 4JI5B 1P5RA 3TZEA 3ENQA 2EGHA 4IGKA 4ZHQF 3W5HA 2NUPB 3THWA 1ULHA 1Y7PA 4JOCA 4FD3A 2FG5A 2GLUA 4GR5A 1E3WA 3E82A 1RVDA 1L1FA 3UYKA 2PT7A 1GQQA 3KB2A 4HUQA 3ZXSA 5JVDF 2DR2A 4XLLA 3D7KA 1SH7A 3VYSB 2O8DA 4RABA 3GDHA 4NFYA 4R51A 8GPBA 3S99A 1J1UA 2LCFA 4V0MA 1TD9A 2Q9CA 3NORA 3DAOA 2VDJA 1RBMA 1GRRA 4LDJA 5EERA 4OXIA 2EOAA 4XJTA 1ZCZA 1R66A 1UBTS 1ULZA 4GW3A 4NV0A 1EGQA 4TMWA 2VP5A 4WZAB 4ALKA 4BX9A 2YXBA 4O4HA 2I91A 2RHBA 4FGJA 2X42A 4HX9A 1B0UA 4KRGA 2OP1A 1FUIA 3KT3A 1ISPA 2ZZNA 1U1DA 4KFSA 4FMCB 4DE5A 4IINA 4Z9YA 4ZJYA 3WS7A 2R7KA 2V6BA 2DLNA 5A3SA 1TM2A 1TQHA 2YOGA 3GPBA 3I05A 2V0CA 4K6HA 4ASUA 1G18A 1MX1A 4Y2SA 3ENNA 2W58A 1GKLA 1M6EX 1CIJA 2P7HA 3U3ZA 5ENDA 3CINA 3RRFA 3QUTA 2JLXA 3ZCQA 1GQYA 2XLBA 1EIZA 3GU3A 4GDMA 3ZWVA 3ZU5A 5F7XA 1DO8A 3K6KA 1N2GA 1Z4PX 3A8TA 5K3BA 5KMGB 3HBMA 4RTSA 2E89A 3A9UA 4KLNA 3MJCA 5DI9A 4F4HA 3FDZB 5A4DA 3BL8A 4Y1GA 1Z2OX 1DRWA 1WY7A 1K8RA 4X9XA 2VBCA 3H2BA 4D44A 2B0JA 1DP4A 2DLDA 1IDN1 3A9SA 5M5BA 1RAHA 2GILA 2XHEA 1CDDA 1KEEB 2JNWA 3QU4A 1ZCAA 1FEZA 1H4VB 1S8NA 2CKDA 2D3WA 2ES4A 1YQQA 2BHSA 2ZG6A 3GJ3A 5LZ4A 2GM4A 1MA3A 1PO7A 1U8CB 2OT3B 4REQB 4W9MC 2XMSA 4R7GA 1ZW6A 1V9CA 2XODA 3DL0A 3RHZA 3DCYA 4NCBA 3USES 1VYUA 4DM4A 3NBYC 2RAVA 5J4YA 4HYTA 1ONNA 4NL4H 1ANKA 2NO1A 3S28A 4RHFA 4FT2A 1YCFA 3CRVA 1LPPA 2I0FA 4JR2A 3EEIA 4A2WA 3VYTB 1X86B 1MAAA 1OT5A 4ZYVA 5DM70 1KAHA 1P6QA 2DVMA 1QF7A 1RTKA 1TA4A 3TINA 2C58A 3IAXA 4HAYA 2P5YA 4OLHA 2ZDHA 4IKEA 1HUQA 3KZCA 3H6KA 3UUEA 5SYMA 2JRCA 1R8QA 5EJ6A 1QVWA 1QV7A 3TNDA 1P62B 1IJBA 2QTCA 5L3QA 2C5SA 3ZE0B 1IMOA 1BDMA 4LFCB 4KK3A 2ZB3A 3I9KA 3T95A 4LK3A 3HCFA 2OFXA 2W6ID 3H1GA 1G64A 4LGMA 1G4AE 5CR9A 1A3CA 2YHSA 4D8UA 4GUAA 3HJGA 4EVQA 1GQ2A 1SC6A 2YZGA 2HQOA 4QBGB 4GM4A 4MCHA 1P7PA 4IUBS 3WRWA 4BP9A 2H9AA 3VR5D 4OOEA 2SECE 3IUEA 3QPCA 4LZNA 2E4AA 2QG6A 4F6LA 5JYBA 3IBTA 2M6KA 2ZATA 5HJEA 1XD2A 1YVUA 5AK5A 1SZDA 4XFKA 1PLLA 3H9JA 3K1AA 3QOXA 5TQVA 5A03A 5HKOA 3UA4A 1R1DA 4GBJA 4QVIA 3AYZB 2CCGA 3UBMA 2PJZA 5BV8A 2QPAA 3X1WA 2J5KA 4EY6A 1LTQA 1CR0A 4TLLB 1BMDA 4CN9A 3NHLA 1YRWA 2X77A 3KX2A 1HWYA 2OZEA 1ZU5A 4IDFA 1LPMA 4B6JA 3PCRB 4AP5A 3ESZA 1JLMA 1ZK3A 3GPIA 2IC5A 4TMFA 4UVEA 2I3BA 4Z4CA 2FCRA 1XXLA 3GELA 4R9UC 1ESCA 3AVPA 3ABZA 1E4EB 1FDSA 4X20B 6ADHA 1XTVA 1JTEA 3UJHA 1P9RA 2DUUA 2HWYA 4KI7A 3F7MA 4WBSA 3RTAA 1YR3A 5JY1A 3GT4A 1KDOA 4MS3A 3RSFA 4X63A 3LUCA 3ZOKA 1JHQA 1V16B 5JSUA 4B2IA 1LVGA 1ZSNA 3TLCA 4RKFA 4QVGA 3RADC 4H3SA 5IC4A 3Q11A 3TYXA 1VE5A 1JU3A 2D5BA 3D43A 5JNVA 2ACEA 1M5UA 4NE9A 1KDPA 1IHOA 1W49A 2JL1A 3OD5A 4BRZA 2H0QA 5DHFA 1E1CA 3RUCA 4C88A 2A5DA 2R25B 3PHGA 1KARA 1MQ8B 2D1SA 5HBRA 1VG9B 3R5HA 4YA6A 4GIBA 4E5KA 3F1KA 1E6KA 4DW8A 1I7SB 2GAOA 3TOCA 1GKKA 5BVGA 2QRGA 1CJSA 1XC7A 5CNMA 5KTRA 2FEXA 4BNYA 2Q21A 3ZZTA 1T2DA 2F3SA 3O21A 1DZIA 2FHSA 3NO4A 3OZRA 1CY6A 5EZYB 2CB9A 1ENOA 3FTPA 3D1VA 2F2TA 2GA8A 2H1WA 3K0EA 3WO1A 5IYZF 3O7WA 4B5KA 4N82A 1UWLA 2PZLA 3K2QA 1P44A 2ZIEA 3RC3A 2COKA 5B36A 5FTNA 2P3QA 2VP4A 2C7BA 3OE1A 5E7QA 1NVAA 4D43A 2RC6A 1JJ7A 5JIBA 2CNWD 3PD0A 2E1PA 2FQQA 1JYFA 4A92A 4DLSA 2EAUA 1VCMA 2WKWA 1G55A 3PL5A 4GECA 3E1GA 1K5DA 1TJPB 2CLIB 3GFRA 4PLCA 4Q9KA 5E7MA 3VSEA 1UOPA 3RG2A 1Y4SA 2ZVPX 2WY2D 4KXFB 1P2SA 1KOLA 3S1SA 2Z43A 4JXKA 2ZVDA 4KV7A 5CA0B 4P0PB 3T7RA 5KVVA 1V11B 4GYKA 4UUAA 3UAGA 2ZRFA 4ZO4A 3ZTYA 3GB9A 4ALNA 2BF7A 4KE8A 4CUKA 4O59O 2P9ZA 4WOKA 3O4HA 1YZQA 4X60A 5J1TB 5ADHA 4RK5A 3K0AA 3EQZA 3FSGD 2JAUA 4LWQA 2BMJA 1RC1A 4B79A 2XEDA 4BNGA 3H2ZA 4HXGA 3SE7A 4R2IA 3E4DA 3JAKB 4M1TA 4B3FX 1JEQB 3C48A 1Q1AA 3R3JA 4R6XA 3V4VB 3ZWCA 1I5RA 3HHPA 5IT0A 1ZJ6A 2HGSA 3S5JA 4F7WA 1LVUA 2I2FA 4KV9A 2UVPA 3A6JA 2DBQA 2AUNA 3LIIA 7REQB 2Z8XA 1V35A 4M1YA 4RGVA 4ZT2A 3C4QA 1G8HA 3CJQA 3CUEF 2WVGA 1RDFA 3I53A 3AL0C 4KBFA 3LUHA 1F7UA 2A2ZA 3ZLUA 2E55A 3DM5A 3LBAA 2CZQA 3L8CA 3AONB 2ZJ3A 5JATA 4ZOBA 4RA6A 4HN2A 2GZ3A 3EGXA 1E2BA 1VJTA 4YUAA 3UT6A 3BSYA 3OPYA 4L8WB 1KFKB 3RU9A 3JAMA 3UCXA 3M9XA 1LEHA 4R8MA 1EBUA 3PU6A 3SEAA 3SZMA 1JNYA 3DYIA 2ILVA 1FFXB 4G4GA 5BORA 4TZ6A 1GADO 4BJ6A 1JQ3A 2O3TA 1E1RD 2C2MA 5JWHA 3GRAA 1PZXA 4Q6BA 4O2AA 4NBRA 1CUHA 2ZTMA 3FPSA 1EDZA 1Z26A 4CEIA 3P26A 2J0UB 1JQDA 2FOIA 2GOYA 3VTFA 1GUAA 3D31A 4AJ2A 4XDZA 1R0SA 1TZBA 5HRUA 1DC5A 2FCAA 2PS0A 4M54A 3AUXA 3ZK8A 1CUAA 4ITRC 1JIQA 2YVLA 2VHJA 4IUCS 1X1EA 1C2YA 4Y0NA 1LLDA 1T43A 4ER6A 2XVXA 2Y05A 3ECSA 1N2BA 4LS3A 5F33A 1DWUA 3O9ZA 5AIAA 4F06A 3W5DA 4R31A 3ZCXA 3OHSX 1MV5A 3DMGA 4KQWA 4RLSA 4QYWA 4DLVA 4LZWA 3HXOA 1OJLA 4G8BA 3C6BA 4HYEA 4XIFA 4P4UA 2IOYA 3FKSA 4YRJA 2QTLA 4Q3EA 3UMFA 4TUYA 4RLFA 4TOIA 1ZN2A 1PS8A 2DQSA 3GWZA 1ULUA 3QYFA 4M38A 1GTZA 2WSLA 1EVKA 2EKZA 3FFXA 3JS5A 1ADGA 4K6OA 3AJ9A 3V9PA 1AHPA 4G0MA 4A0HA 3DVAA 1QH8B 3OEHD 4JJKA 3U1TA 3NANA 5BV2P 2ZP1A 2HJWA 4ZO8A 3ROGA 3TZKA 5A5EA 5EUMA 4RFSA 2R66A 3R5SA 4DILA 3SF8B 5LKAA 3BWMA 4ZI3A 3Q7IA 1GVHA 4BFYA 1IN1A 4MULA 5E0OA 1XMIA 2WVJA 1L5OA 3TLXA 4XKJA 4RA9A 1U6IA 1IZ8A 1DSSG 2CMHA 1KA9H 2M6SA 1L5NA 2EGGA 3BD9A 3V1LA 5I7EA 4IJMA 3W3AD 1FBNA 4KGDA 2QRVA 1OWNA 1QK5A 1IN5A 2WIBA 2XT9A 5IVKA 3K8QA 2Z2KA 3QLUA 4IJUA 1NLYA 3SBEA 5DJ5A 5EWLA 2QTVB 3RB8A 4Q4LA 4X61A 4DIUA 3WDMA 5B3LA 1UM9B 2CDCA 1FFEA 2I3ZA 3D8HA 2QW0X 4WOJA 2PMEA 5HHTA 3M5WA 1EDOA 4AQDA 2WA1A 2J3EA 4B46A 5LMZA 3A1SA 1QVRA 3E1SA 3SM3A 3UC9A 3ZHCA 4AMBA 1PR3A 3LKZA 1DIRA 1UBJS 3R4CA 2XXJA 4JSTA 4ZAGA 5G0VA 1JVBA 1MX9A 4X1KB 5JQGA 4UUQA 3LWNA 4P4SA 3T4EA 1U81A 4CKYA 2FE1A 3B7WA 4CLXA 3R44A 3FOCA 4OF4A 721PA 2G77B 4S35A 1ISHA 4JVOA 3S40A 3TX2A 1TE2A 1TK2A 3ZV4A 4BBJA 2FW7A 5CA0A 1J7JA 4M0DA 3T5AA 2VPYA 5IF9A 4KE6A 2CWWA 4TTVA 5LYJB 3S1AA 5G0SA 5BOSB 4B7CA 2IOHA 4LDQA 1KJIA 3GD5A 2IBSA 3KSDO 3BCUA 3OJWA 1FB5A 1N3LA 1NOJA 2GF9A 1HL3A 4AJ1A 4DR3B 2P4UA 4RE6A 4GQBA 4MVCA 2IEGA 3ZCPA 4IV5A 2WMOB 2XJ4A 3IAM6 1TVCA 3L41A 1Y6ZA 4RJTA 3OLCX 1LXCA 2AZMA 2OD2A 1QXSA 2WT8A 4UU7A 2H1FA 4EJ0A 3B38A 3PHCA 4BFVA 1AQJA 1APBA 1GQSA 4GX5A 1SHUX 4MPTA 3AU9A 3TLZA 3J81A 1OV6A 2J6CA 4Y98A 4ZZIA 5HE9A 1ZL2A 2AFVA 3WRXA 4EJFA 4IG9A 5KOJA 3EVDA 2Q5EA 3DOOA 4GS5A 1VPWA 2TMYA 3EBLA 3I30X 3JR7A 3JPYA 3O0TA 2RI6A 4OI2A 5DM0A 4QXMA 3PUHA 4BLQA 4QHTA 3ESRA 4JLVA 3RS5A 2OGZA 1H9CA 3FWPA 5GINE 1JGTA 2G6BA 2PKEA 3O2QB 1LK5A 1XTBA 4BVJA 4HWKA 1YQGA 2CVOA 2I4OA 3T3GA 3L0OA 5JI3E 3JWPA 3O9VA 3V6MA 4B47A 1MDFA 3O95A 4RHEA 1WQ4A 3BAZA 3T9DA 2HC9A 1E5VA 1TFRA 1KEUA 4P4NA 1A72A 5K6TA 2A58A 1PFYA 1WSBA 2X8WA 3A2NA 2PAAA 4N8EA 3HYSA 1AO0A 3FTFA 3G7SA 4I66A 1GXSA 3VZQA 1VI2A 3RJ9A 3DEFA 4KSCA 4HQ6A 5F2KA 3RARA 1PW7A 1JQEA 4LISA 3NOXA 2ZIGA 5EI5A 4F0JA 3ONEA 1X1SA 3FROA 2CFIA 1SM4A 3H7AA 4N18A 3HCCA 5FIUA 5GVSA 2WUFA 3BICA 3AL3A 3BK1A 1KBOA 5IBPA 1N5RA 3H4IA 4AN0A 2O48X 1H8HA 1HOXA 1VMEA 1PWEA 4PQEA 1G5HA 1QFXA 2R4QA 2YW9A 2QU7A 4O2BB 3K9FC 1G8GA 1R74A 4LECA 3CRZA 1A4RA 3KZVA 3I8OA 2G80A 2UZIR 4KVAA 1T4BA 4DBLC 1RYEA 3N8GA 4O2AF 1UUFA 3P94A 1VPVA 2XD4A 4PFQA 1IYZA 1IK4A 1GQRA 2VLBA 5KYWB 4CQNA 1RXVA 3T7SA 5BNWA 1PL8A 1WUTA 3DUFA 1PL7A 5DWQA 1XEFA 3A58B 4AQ7A 4PXAA 2GLTA 3JW8A 4DIKA 4BNXA 2OBLA 2XGGA 1O9HA 2E1RA 4U2BA 5HCNA 1OTYA 4Q4HA 2R6CA 3R74A 3VPFA 5KVAA 4WJZA 3EY4A 4MWEA 4DBLE 1ZONA 3EXFA 3EZ6A 2C5FA 1UM9A 2PSFA 3NW9A 5CLGA 5IDQA 3F47A 4Q7EA 4RK4A 3HYLA 4DB2A 4NSNA 3T7CA 3UCEA 2XDQA 2YWDA 3GAAA 4M9SA 5EE9A 3ZHUA 2IYNA 3QYAA 1ZJWA 1CJUC 2JFGA 2OBMA 4HY3A 3ROMA 1FQJA 1NLUA 3K92A 3RBXA 1ITZA 3UB2A 1SCIA 4Y2RA 4F96A 4EKYA 1DTWB 1YULA 1O4VA 1UZMA 2WJJA 5SZJA 2Q3JA 2C0PA 4LG1A 2WSYB 2BFFB 1WD5A 1PJQA 3CPSA 2XKJE 5DTJA 2AC7A 5IM4F 2C7RA 1QGAA 1SVWA 1GOTA 4CTKA 4O6VA 5JYEA 2H5EA 4EHAA 1TT5A 1F20A 2BM0A 2Q99A 3AEQB 3ZZ1A 4CR7A 4YTEA 3K0FA 3RVLA 4I99A 4E11A 2RHHA 2IUFA 1M8FA 3NIWA 4K3VA 1WEKA 1W34A 4PN3A 2GD6A 3N6RA 4MP8A 2IOFK 1RI2A 2GUWA 3HDGA 1MO5A 2R85A 3P0JA 2EJTA 4LXYA 1BD4A 2UYCA 3GXOA 3A28A 2IHZA 2P65A 4PLZA 3RAJA 4FR0A 2FP3A 3BGWA 4D45A 3HUFA 1KMQA 4Q3LA 4CF7A 5HRCA 2QD2A 2OFPA 2Q0XA 4QUGA 3BGDA 4G84A 1SWWA 5TVGA 2QPOA 4H31A 2XNCA 1T3HA 1AKNA 1QTRA 1YUNA 4P82A 2DHCA 4BEJA 2ZAGA 4IQ8A 2FK7A 3A9TA 3MBOA 1Z2EA 1EQUA 5JADA 2X2EA 1U7UA 1V1RA 1POWA 1B73A 1UF9A 4XGNA 1OZGA 2X5JO 3CF4A 1I13A 4B4UA 1DEHA 3QVMA 1G3RA 4P31A 5C1IA 1Z8NA 2XV1A 3ASYA 4IRMA 3SJAA 4E6PA 1CUBA 4G4SP 3QG5A 4MUJA 3DDWA 1ZZEA 3EISA 4MKHA 1I4DD 1NC1A 4KZPA 1CQJB 3FWKA 4KC0A 3KFXA 3P0EA 4RKEA 1K63A 3FAKA 1G21B 1UKYA 4C0SA 1T10A 2Q4TA 4S1OA 3KEFA 4D9CA 1WZNA 4PU0A 1KWKA 1ZRNA 3B82A 3ZKAA 1IBKB 4BNTA 5MGBA 2C4TA 1XT6A 1NASA 3V5NA 3LWDA 3PNLA 1MRNA 2PKQP 3T06B 1I5EA 4W8GA 3ACBA 5JJIA 2J46A 3OKPA 1GCIA 1U8ZA 1UDWA 4G5RA 5LBTA 4ZKEA 3VPSA 4KQIA 5KTPA 4XDYA 4JBHA 4IOLA 1GA4A 2AOUB 1CFJA 3HJNA 5G40A 1RWVA 4LHXA 4CQMB 5E6RA 2NAFA 3HDHA 5JH7F 3QJ5A 3RV3A 5I3ZA 5JH7A 1NT4A 1EFCA 2C2HA 2HK9A 3AHDA 3PGJA 1T1SA 5TR9A 3AO0B 5DYGA 4D3FA 1G5RA 2DY1A 1J0DA 1U9JA 2Y1WA 1AO3A 1NDUA 4G8CA 4HLCA 1JLLB 3JQGA 3LBNA 4HTFA 4EW6A 1JRLA 2FFRA 2JVKA 3R7AA 1X7YA 2AD1A 4QGHA 3CZMA 3ICCA 1WUYA 3SZLA 1HOTA 2Q6KA 4P53A 3ESQA 1K6XA 1SMKA 2G0NA 4LF4B 2YV2A 2B0CA 3JAKA 4S05A 3UAZA 1Z33A 3IAAA 4NCIA 4R2HA 1AKRA 4Y9TA 3KKZA 2BZGA 4P38A 3NVDA 4KI0A 4J75A 3RHSA 4FHCA 3D3WA 3GT0A 4JVSB 1YZLA 3B1YA 2VA9A 3DBOB 3WK8A 4BC0A 1MP0A 1PF7E 2JLRA 1C9EA 1I6KA 4CL8A 1SPBS 3ITDA 3E7WA 1FUKA 1FLDA 1QK4A 2PGDA 5KCMA 5BXYA 4MKZA 4Z7QB 2PD3A 5JECA 2DT5A 3MB8A 1EFVA 1PJSA 1L5QA 1S2MA 2JH8A 3SR3A 3EUWA 3AP3A 3EODA 4M1SA 1MTZA 3QVXA 2P9QA 4HAWA 2VF2A 5JVDA 2QRPA 4RYLA 3MHPA 3VR4D 1KSFX 2XRYA 3MOGA 1DG1G 1EJ2A 1I7PA 1O5OA 1MOQA 4I50B 4IYRA 5BN3A 2P9FA 1XA4A 5FORA 1UT8A 4RX1A 1U8YA 1MFPA 4KQGA 2Y1OA 1VG8A 1U9YA 1JQAA 1KC3A 2Q49A 2C0CA 3BFJA 3TE7A 1KI6A 2XH8A 1C1XB 3BHIA 1SGWA 4MQ6A 1X8JA 2G09A 2HMWA 1SHZA 2O7QA 1QFZA 3KAKA 4WKBA 2PUTA 1Q2XA 2NUBA 3N39C 2HW8A 1MEOA 3B1VA 4DADA 1JA9A 1I30A 1JQKA 2GN1A 5CDSA 1M8KA 2IDKA 4Z9BA 1SKUA 4GAEA 1YI1A 1HDRA 4U2GA 1Q12A 5CMLA 3A9RA 3ANNA 4HXFB 4LF6B 1NMZA 3URMA 4OYHA 3HV2A 4WVFA 4HK4A 4O63O 2O2EA 3OY2A 2SKDA 2OQ2A 1YQ9A 1VL6A 2DHQA 2O20A 4GSLA 3S1LA 1Q95A 3SNKA 4RCVA 2BF4A 1EK5A 4MI1A 2ZULA 5JHHB 2WQ7A 2DCUA 2AFHE 1A9ZA 1I1HA 1EVJA 2W6JA 4MLPA 4RU1A 1G9TA 2FYTA 3A3YA 1WZEA 1ZOSA 2C2XA 4HQKA 3BQNB 2QXTA 3ESDA 4EG7A 4IG4A 2H1CA 4QPCA 2PH5A 4C30A 5D1NA 1E1QA 3B3JA 3KYDA 4TM8A 4KPEC 4EA7A 5SICE 3DEIA 3OIDA 5A4MS 5LN1A 2F9FA 5A7FA 1WSWA 5DBFA 4YQEA 5DNVA 1V47A 4CW7A 5IJZA 3GLHA 3ITKA 2BEJA 4P7JA 3B9RA 1S2GA 1C3JA 4PNZA 5AT1A 1DLIA 1HETA 3UG7A 4RS4A 3KLOA 4A8JA 5L4NA 2VCEA 3EX7C 2HIGA 2QRLA 4E4RA 3ZWMA 4MHOA 1U7TA 4IIHA 1JFFA 2VDWA 2MMGA 4I08A 4P3NA 3WLIA 1QH1A 2ZJOA 3EDMA 1U4SA 3ROKA 3W2GA 4OBEA 3OQPA 2ZPAA 3G0OA 3LK6A 2DFVA 2ZYUX 3N0WA 1HEUA 4N40A 4AJHA 2O2HA 3F67A 4RVDA 1WV0A 4FC6A 3D2AA 4U2FA 3S2GA 3TLBA 2MYNA 1CY8A 4FFPA 3R7WA 4Q3OA 4Y2VA 2X58A 2FF7A 3QNWA 4RQAA 3HM9A 3OIGA 3AFGA 3FZQA 3N53A 4LYDA 3DEJA 4PLTA 4LXGA 1VJ1A 3GJ5A 2OMEA 3DEHA 2QJTA 3C6YA 3S8MA 3UIEA 3ZJYA 1IB6A 2ZWOA 3UB3A 4DZTA 4WBNA 2F3UA 3O82A 1E32A 1VHDA 3MOSA 3PNVA 4TL8A 3SR4A 3TIFA 4QBHA 5AK0A 2RK4A 3NBZC 5HVNA 3AEZA 2L0XA 2P1RA 4TL6A 4UTPA 2D1RA 2ZSAA 3DZFA 3PRKE 3LA6A 1KDVA 3RT1A 2EJVA 3NOVA 4HDMB 4OQ4A 3U0BA 1U1CA 1ABFA 2IQIA 4JVLA 3VC3A 3BMQB 2GHRA 4UOEA 5C80A 5AW0A 4BO3A 3ZDDA 1W0JA 3GVPA 1WBBA 2BJHA 1A2KC 4G36A 3VPAA 5JJBA 5JFOA 2P67A 2DFDA 2JI4A 3OM9A 2FVYA 5ETJA 1UJBA 2WB2A 1EVYA 3F8WA 1X7WA 1QX3A 3FTQA 3R6DA 3T99A 4AY6A 1E60A 1EDDA 1XNGA 2VUHB 1K75A 4DSAA 1DO2A 2IELA 5HG0A 3J81k 3DHNA 2ECFA 2QL9A 1K88A 2W6CX 3V3TA 5CFNA 2EZ9A 3WKAA 5CLQA 1OIWA 2HMSA 5FX2A 4EB3A 1OAAA 1T9DA 1U2ZA 1P2GA 1H65A 1WEHA 2I4IA 3UMCA 5AM2A 5KKNB 1A9RA 2R86A 3L02A 1EIWA 3ADCA 2FPWA 3RAFC 3ECCA 4QDZA 3CVYA 4ZCIA 2D13A 2UAGA 1NHGA 3FTCA 5DASA 1ZH6A 1DT5A 2OK8A 1D5CA 2FI1A 3GWGA 4OO3A 5KQMA 2XEXA 1T9CA 3GROA 5IN5A 5AVZA 3U48A 1MFZA 5HKKA 1QTQA 4DWJA 2BJWA 4PIMA 3TUIC 5JR3A 1YFKA 2HA6A 5CA0F 4OYYA 1FLNA 5LMCA 1H9BA 4HLDA 5YASA 3OTOB 4U9HS 1IY2A 3A70A 4U9IS 1GYQA 5WRFA 2R1VA 5FBKA 1DKLA 3ESYA 5LR6A 2WM2A 1D7OA 1LQUA 3U17A 3GUUA 2FPPA 1RWQA 2J7PD 3IL2A 1W48A 4TV9B 5TPZD 2OXIA 1M2GA 1P2FA 4CHGA 1LSSA 5KOHB 3JSXA 2AEEA 3MF4A 1VPDA 4DLZA 3B48A 3O8NA 4K9QA 5KYUB 2BMVA 2V5VA 3GMDA 1RS0A 2WTMA 2EQAA 1E58A 1WNFA 3CCBA 4DIFA 1OJ7A 2Y6VA 4ZI7F 5HP4A 1Z39A 4RF5A 1QANA 2BHRA 2C3YA 4FWIB 4JC5A 1BVYF 3VDXA 4YAUA 3GLSA 4JT4A 2YR0A 3LQ2A 3WL6A 4R83A 1BO6A 3ICOA 2PUDA 3G0IA 1HV8A 2C2ZA 5ARBA 2XA2A 1BVUA 1YA4A 3K30A 2G76A 4DANA 5LQAA 2XDYA 2QUKA 2YFYA 3SN6A 2EF0A 1J8YF 3UJBA 3PP8A 1BW9A 1M7HA 2QSJA 1N8SA 1ZIXA 1KJJA 2PL1A 2FEWB 2QM8A 3F1LA 3H04A 3N0XA 3S2ZA 2P8JA 4Y30A 2EX0A 3VAYA 3W6OA 1DRKA 1XXHA 4YRQA 2G4CA 4BV2A 4CGYA 4PNEA 1GRNA 4YRLA 1N4AA 4JBNA 1DL5A 4B4OA 1O54A 1Q16A 5IHPA 3FUUA 4QBKA 4MKGA 4DPLA 2I9KA 1ZK1A 4BXOA 4YMIA 4E5DA 4YUYA 1SCKA 2GHIA 2FSIA 1SAYA 4G5GA 4PC6A 1A95A 4FK8A 2IYZA 4KG7A 4LVUA 5GQSA 3KUDA 4ILKA 4JLPA 4PAWA 1KAOA 2QD3A 2WMNB 2QZ9A 4A8PA 3ZV5A 3UT0A 5J58A 2NQ8A 4BO9A 4BV8A 1UXGA 4ZA2A 3ZI4A 2J08A 5K6AA 3R0VA 3WLRA 2PT5A 3GLHB 1MO2