2F7SA

The crystal structure of human rab27b bound to gdp
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
186
structure length
179
Chain Sequence
DYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Ras-related protein Rab-27B
publication title The crystal structure of human Rab27b
rcsb
source organism Homo sapiens
total genus 51
structure length 179
sequence length 186
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2f7sA00
4ASUA 2YWFA 1FZQA 1DEKA 4LBWA 1YRBA 2P3SA 3BWDD 4ASUD 3L43A 1Q21A 4ZDWA 5CM9C 521PA 2Q6TA 4KHZA 1ESNA 4DUGA 3ADBA 4EPXA 2IUSA 4TT3D 5P21A 5FI1B 4HZUA 3NBXX 1E4YA 4TTPA 1G7SA 2XTMA 2ZM5A 3GJ3A 5HPYB 4DUGD 1RRCA 4Q02A 2N42A 4D4MA 4DRZA 1P9NA 4DZZA 3GLFE 3NC0C 4NYMQ 3X2SA 4HYYA 3AB3A 4A6PA 1PUIA 2WWWA 2AN9A 3TK1A 4TLDA 2ZUDA 2ZS7A 3R8FA 3IEUA 2X1VA 4M1KA 1J70A 1F60A 4OK5A 2GRJA 4AKEA 2GJ9A 3HYTA 1G8PA 1OB5A 4BLQA 1ZINA 4RD3A 5KNBA 4URYR 3GLGB 1GWNA 1J7KA 2ZYUX 1E6CA 3R7WA 2FX3A 5JJIA 5GJWC 3OIUA 3K9LA 2H7VA 1G6OA 4D4KA 1I4LD 3OAAA 1LB1B 1DBSA 4PQRA 2DB3A 4LHWA 3AUYA 1AJEA 3EPKA 4AYWA 1GM5A 1JJ7A 1HUQA 2ORIA 4TQ9A 4WA7A 3RS2A 3OAAD 4M8NE 1CULC 1P7CA 4FWIB 5KUTA 4B76A 3PEYA 1G4UR 2ZS8A 3T34A 1ZCAA 4HDQB 1GKYA 3GMTA 3QI2A 5EP2A 2WKRA 4A82A 2KI5A 5FPTA 4MDFA 4EPTA 4KYIB 1HV8A 5ANRB 4KXFB 4NHOA 3M6AA 4NCHA 3U3OA 4Z8XA 4OL0A 4Q4JA 1AM4D 1G1MA 3BH0A 3UKDA 5KTYA 2VHQA 1E94E 3SE0A 2F6RA 5JEEA 4IJMA 1E9SA 1MOZA 2OM2A 4JLBA 4DSNA 4KITB 1XTKA 3C7KA 3SOPA 3O8DA 2WTUA 4HZIA 5HZHA 1GTVA 1N5KA 3U61B 1N6HA 2KB0A 3QY0A 5TVKA 3UPUA 4FD2A 3W6OA 3PIRA 4P4SA 1N0WA 2ANBA 4B35A 2GXAA 1R6BX 2JLRA 3GEHA 2ZRMA 3A1SA 3KX2A 1U0JA 2AWNA 4XVQA 1MRNA 5KDDA 4MQBA 1Z6AA 4LC1A 1MR3F 2CCJA 2J7KA 3NBYC 3W90A 3CM0A 3RRMA 3VTKA 4E09A 2WWFA 3ZVNA 3ADDA 3KFXA 1YZQA 2DWQA 1QHHA 5C4GB 1XTIA 4YMSA 5C1BA 3KQNA 2IS2A 4QGAA 3TKLA 1J2JA 1NMYA 4JT2A 2ZTSA 4JBWA 3IIKA 3WRXC 2GCPA 4Q4LA 2N46A 4EFLA 2QMEA 5SZJA 2ZJAA 3IQXA 2GDJA 5KDLA 3NVAA 3K9HA 3THOA 3EPLA 1UEIA 3QEJA 4PHTA 1LS1A 1V5WA 5IDVA 3KJEA 1P4SA 4Z54A 3THWA 2BEKA 1NVWQ 2IYQA 1KDRA 2GESA 5BYKA 1CU1A 1P73A 3TUIC 1P2SA 3RWMB 1Q3HA 3I61A 3B13B 1D2EA 4MGYR 3QXJA 5C46F 3W9YA 1MABB 5DYIA 4CEJA 4IOLA 2O8FB 4P3YA 2NGRA 3F5FA 2FWRA 1U90A 3EARA 2FMXA 2ZI9A 4N0DA 1T0JB 3CWQA 1SGWA 3KKQA 3TVDA 1KI2A 4FMBB 4FCVA 4JBYA 1II0A 2GHIA 2BBSA 1RRPA 1X8KA 3TUZC 5KNDA 5FTLA 1XD2A 2IYVA 3I5XA 3TMKA 1Q12A 3DOEA 1UPTA 4FCWA 1RC8A 1IJFA 2D06A 2YC2C 4HDOB 1IM2A 3LRPA 2XITA 1X8JA 3FFAA 3ND8A 1TADA 2ZRDA 4UXJA 2OBNA 4AI6A 4LBVA 1HEIA 1QG4A 4FMCB 2C98A 5D3MA 4E22A 5AJWA 3LD9A 4GOKA 5DN6D 1EWQA 4NBSA 3GJ5A 3RC3A 2ZRPA 1KK1A 1WP9A 1PV4A 2C9CA 4Q7MB 1R0XA 5L3QA 3B60A 4DLUA 1OXUA 3OEHA 3VX4A 4JT4A 4B3DA 2X2FA 2ZSFA 3ADKA 4GL2A 2O0KA 4V02A 2XX3A 1ZNXA 2ZU6A 3KUDA 3OEHD 4DCUA 1WF3A 1LF5A 1VG9B 2ZYWX 2EYQA 3RABA 1MKYA 3UG6A 4IDOA 4HAUA 2W0SA 1XXHE 4A92A 4B34A 2XAUA 5JCZA 4MRVA 2QT1A 1DELA 1ZRHA 3TR0A 1BYUA 3MWYW 3CRRA 3TAUA 4PANA 2C5LA 5AUNB 5B57C 3WYGA 4GSYA 3H84A 2R62A 3H86A 1TTTA 1YRAA 1Z2AA 2Y8EA 2WIAA 1W47A 2AXPA 2XZPA 1HA3A 4MYCA 5SZKB 4HAZA 2W00A 3WXMA 2A5GA 3I72A 4FI3C 2D74A 4Q18A 3SFZA 3KQKA 1YJ5A 4WOPA 4LUCA 4CT5A 4KV9A 2QY9A 3IHLA 2VIIA 3GLGA 5JS8A 4GI7A 2CVHA 3OF5A 1OFTA 4LYFA 3ONWA 4LI0A 3F3YA 2WJHA 1E98A 2PZGA 4WVFA 4LCBA 1II8B 1QRAA 1D2NA 1VG1A 3IDQA 4BFSA 1G7TA 3P32A 1Z63A 2ONJA 3EC1A 3Q3JB 2OFWA 1AKEA 2RGCA 3X1ZA 4DLSA 1NVXQ 1JEDA 5E7JA 5JI3E 1ODFA 1PLKA 4C0JA 1EX7A 1SXJE 1UKYA 4LGMA 4CEHB 4XWOA 3U7EB 2QI9C 2ZROA 1N25A 2ZIAA 2OUKA 3SBEA 2AK3A 1OE0A 4HDCA 2YWHA 2NIPA 4M1YA 3U6BA 3IPXA 2WOJA 3EIHA 4TLCA 3AVTA 1P9RA 5AJXA 3W6NA 1K5DA 2J0SA 4A36A 1D9ZA 3E1SA 2BMJA 1W5TA 3AF1A 4LJAA 1GZSA 3U4QB 1Q1EA 2IYRA 1WCV1 2RGDA 4IXMA 3ZYCA 3QSYA 3DMDA 4LJ9A 3CRVA 3AH8A 3KKNA 3QIAA 4TWZA 4XWAA 1Z6XA 3MAAC 4ZO4A 5HE8A 4QBIA 3WMFA 3AVOA 1F3OA 3CX7A 4C7OA 4JBXA 4A0GA 3VNUA 1KJZA 4W5JA 3IPYA 4M9XA 2BKUA 3D31A 2VSOA 1Y3AA 2GZDA 3P27A 1FMLA 4RJLA 3ZH9B 4DEYA 2RGXA 1GNRA 4DB4A 3SQXA 4C4PA 2BMDA 1IBRA 2BCGY 4LOAA 5DI9A 3HWSA 3GD7A 3ZIAA 3M1IA 2IXEA 3WNBA 5KO2A 4DVGA 2OXRA 4LV8B 3TSZA 3H1TA 5B58C 1Z07A 4A0RA 2OAP1 1YHNA 2QMOA 3B82A 5FTNA 3QUSA 1CP2A 3ZIAD 1W7AA 4KAXA 4DLVA 4KO8A 3W8NA 2OCAA 1U0HC 2D2EA 4URXR 3FOZA 2EW1A 1BOFA 1T9HA 2YZ2A 5CK5A 3VHXA 4Q19A 1KI7A 3K9GA 4K8OA 3SYLA 4Y0AA 2RB4A 3DMNA 4O2LA 2QA5A 3CRMA 3GFOA 1N6LA 1MABA 1TUEA 5LB2A 2HT1A 1ZNZA 1R5OA 3EZ9A 3AVVA 1OIXA 2B8TA 4HATA 4BZQA 5KSZA 3GLIA 2AD5A 2QMHA 5DHFA 4ZCLA 1JAIA 5GVSA 4U00A 1ETUA 1GDDA 3RSOA 3HPQA 1U9IA 1KI1A 5JCPA 1KZGB 1G18A 2JEOA 3ZGXA 2J87A 1F48A 3RYTC 2BJWA 4WZBE 2MSEB 3H0KA 2IT1A 1N6NA 4OQFA 2QBYB 2YOGA 4HLUA 4ZCIA 4YMUA 5LDDC 3J81k 1F2TA 4DSTA 1BMFA 3EX7C 1CJKC 5FBQB 4PPQA 2Z83A 4TLAA 5CITA 2J5XA 2ZJOA 4NDZA 5FOVA 1R2QA 1CJVC 4M4SA 1GUAA 5E4FA 1BMFD 2ZETA 1NSTA 2LKCA 2ZRIA 3KB1A 1E9DA 3AVPA 3HU3A 2PBRA 1JNYA 1BH2A 4JLMA 3W3ZB 1OXTA 2WKQA 2JLXA 2WV9A 5GJVC 5SZIA 3BFVA 4PZLA 121PA 4G0NA 4PPFA 2F1HA 2G1JA 2RHMA 5JWHA 1M7GA 2O52A 1VYUA 1CS4C 2QM7A 2CHGA 3UMSA 1Z29A 2ZJ2A 3IKJA 4KVAA 5JHHB 3UXMA 4GZLA 1N2CE 2FNAA 3ECCA 4QG7A 3RSLA 4PSVA 1KY3A 1KI9A 5JWOA 1GILA 2JLUA 1VTKA 2HXSA 1UBCA 2BMEA 5DYGA 1HQCA 3ZQJA 1J99A 1E0KA 2ORVA 4IFBA 4QNMA 3W8RA 4MKFA 4WBSA 1AQYA 5H68A 1KSFX 2WJGA 1IN8A 4KYUA 1KK0A 3F8TA 2ECKA 3NH6A 3V9PA 1NJGA 1RVDA 3RS5A 3KL4A 4DCSA 1N0VC 1TQ6A 5EXTA 1OHHA 4TMXA 1NN1A 2CK3A 2WJYA 1RJ9B 1VCMA 4DDTA 3AGQA 4R2HA 5GADl 4PPNA 4WIAA 5JHGB 1A7JA 1L4YA 3AKYA 2XXAA 1OHHD 2FH5B 3KKOA 2CK3D 4V0ME 1AS3A 3SJCA 2NZJA 3NH9A 4EKDA 1MRSA 3KKMA 3TUJC 4HLDA 2RGEA 3PG5A 5C4MA 1P60A 2FOLA 2IK8A 3FMFA 4JS0A 3AVQA 2XTNA 4WW0A 2PMDA 4HUTA 2QQ0A 2H8KA 2GKSA 4L9SA 4CT4B 3AVWA 2VRWA 1OSNA 2IWRA 3SI7A 1M74A 4JL5A 5LBIA 4CEHA 5G41A 4P31A 1F5NA 1C9KA 5TMPA 2FSIA 5F9HA 1EESA 1VYVA 2O5VA 4GZMA 3N70A 4HB2A 2OV2A 5E7IA 1ESMA 3RLFA 3BXZA 1N6RA 3QKSB 3QXSA 4QRHA 4AC9A 4OBEA 4LDJA 4IFEA 1WBBA 1KI8A 2FFQA 2W2TA 1T91A 1JQLB 221PA 1MO5A 1S96A 3EWSA 5JRZA 3FHTA 1F2UB 3X1XA 3QVUA 4A0FA 5DLQC 2JLWA 4AG6A 4M21A 2DR3A 2WJIA 4RCYA 3K8YA 4GP6A 5EXXA 4NMMA 2CDNA 2VA8A 1QZXA 4LHYA 5F98A 3T1TA 1NBME 1SVMA 2I4IA 1XTQA 3GCGA 1KO4A 1LF0A 2PEZA 3BH6A 4D80A 2WWIA 3S1AA 5KPJA 3VHLB 4BLRA 4L15A 1NP6A 3SR0A 1XJQA 2PH1A 1ZM4A 4JSYA 5JFGA 3BB1A 2C96A 1FP6A 1XF9A 2A2ZA 821PA 4M22A 2QAGA 3MD0A 4Q4JB 4HB0A 3CF2A 2D7CA 2VYFA 2J59A 3Q8XB 1IXRC 2P2LA 4GOJA 1NVVR 1O87A 3PEVA 2IS4A 3LWNA 4KFTA 1OYYA 2GCOA 5DIFA 1W44A 3HR7A 4JL8A 5EZ5A 3C16C 4B48A 4IDHA 2H17A 4UQOA 2XNDA 1ZP6A 3RVBA 1KSGA 4B44A 4BLTA 2PLFA 3B1YA 1KI6A 4P4SB 1E0JA 4KCGA 3WYFA 1AA9A 1DADA 1R0ZA 4B3GA 2XNDD 3CUEF 2JJ8A 5L3VA 2X19A 4I81A 2ATVA 2ZYVX 1R8QA 4PC6A 2QSYA 3U5ZB 3EZFA 4IVRA 5JLJA 2YINC 421PA 1UBGA 2XNSA 4WXPA 2OFXA 2FPMA 2QG6A 4OI0A 1UFQA 2D62A 2OT3B 1T3HA 1K8RA 4JVSB 5AJYA 1VMAA 2A5FA 2E87A 1QHHB 2WSSD 4JYCA 1T0HB 3MRSA 4GMXA 4M9QA 2W2XA 3K53A 1XPOA 4LX0A 5FTMA 1NSFA 2F43A 1AS0A 1DAIA 4G01B 3AKCA 4ZV4A 2GAAA 4DSOA 3ADCA 4Q03A 5CYPA 4JSTA 5BYJA 2GXSA 4G5GA 4Q1FA 3A4LA 5FR1A 1CJUC 4B3CA 2C04A 2J3EA 1ZW6A 1MO6A 3CF0A 5JBQA 4RD0A 3THWB 2GZAA 4TTRA 3A37A 2DFNA 4AG5A 5A5GA 1KK2A 2REOA 4KFRA 3EPJA 2V9PA 4G3XA 4HAYA 4BZPA 2ZANA 3SHWA 3NXSA 1AQUA 3GLFB 3AVYA 4MRSA 3Q7PA 5E7MA 1W36D 1E1QD 3K9NA 1XD8A 3H2YA 5F2EA 3WP0A 1P6XA 721PA 1Q3TA 4Q9LA 1RZ3A 4WZAE 2UZ3A 3KQUA 1BKDR 2IL1A 2VP5A 3AF2A 2WOOA 3EWAA 4DEXA 3T15A 4JLJA 1ZD8A 3G0HA 1NN3A 3QOFA 5DI3A 4HLUC 1P2TA 2WAXA 2ZS9A 3U3MA 4V0LA 4O25A 3V00A 2OSBA 1JPJA 1D6JA 3REFA 3VR5A 2XB2A 1OXXK 1NBMA 4WZ6A 4NP6A 1HURA 2CXXA 4Q4AA 2ZI5A 5TARA 2BHRA 5D3MB 3NEJA 4Q1BA 4UJ3A 4YC7A 2XTZA 2P5SA 1NBMD 4DSUA 1HT2E 2H92A 4MRRA 4LJ5A 2KBFA 2UKDA 2W0MA 1G7RA 4LJ8A 3C5HA 3A1UA 3QG5A 1CEEA 2UVQA 1IOZA 2V6IA 3UWKA 1CXZA 1E79A 3NKVA 4JL6A 4PO8A 2ODWA 1FTNA 2RGGA 4TT3A 5JRJA 4N0EA 2NPFA 1E96A 5BWMA 1E79D 4LJYA 4BPBA 1S8FA 1AGRA 4DWJA 2HYIC 3EASA 4KJZA 1UKZA 1LTQA 1G5RA 1RW4A 3B6EA 4OKSA 4YDHB 1FMJA 3SDZA 2XB4A 1KZ7B 4TZ0A 3DEFA 4L8GA 5ELXA 4FW9A 1TQ2A 4WXRA 4U5XA 1FW6A 5EP1A 1OF1A 1S3GA 3KJGA 2WVJA 3L0IB 2OEPA 3LBNA 3R9WA 1KTVA 4TTQA 3VKWA 3QKSA 1NVUQ 1HY3A 2ZI6A 1ZMXA 3QQ5A 3EXAA 2VF8A 1E2GA 2VHJA 1DPFA 4I4LA 1L7VC 1FUKA 2RGBA 2IF0A 2ZRHA 1F2UA 2TMKA 4LBZA 2OCBA 1E69A 4GDFA 1PLLA 4RD1A 2ZU0C 1G41A 3QEOA 3PCRB 4G5QA 3P4XA 4HLQB 4DDWA 2QTFA 3Q85A 4DIDA 2CJWA 2GK7A 1JI0A 2R8RA 1KY2A 1QHYA 2V1UA 1AN0A 3GJ0A 3LXXA 2BBTA 1WBDA 3SYNA 2IYZA 4MGIR 1YE8A 1T8TA 5FPKA 2EWVA 1UKVY 2ZRKA 3IIJA 3RRZA 4A2WA 1GG2A 4DC9A 3OE7A 5CDFA 3DM9B 1FQKA 4X8OA 4Q7LA 3RANA 3PUVA 2ZRJA 3CPJB 2HXYA 3AF0A 3K0EA 1Z0IA 4JLDA 4OYHA 3U60B 1EFCA 3OE7D 2QROA 3LQQA 2GETA 4H9GA 2CHVA 4Q5IA 4DLTA 3ZLJA 4D6PA 1G9XA 1G8FA 1KSHA 3ND9A 3TAHA 2AX4A 3DZ8A 1KYIA 2IYTA 1Z6GA 4IDQA 5FTKA 2OHFA 3CKLA 3W5IA 2PT5A 5IRCD 2EFEB 2QTVB 1XZPA 2KSQA 1OV4A 3CWZA 4C0LA 5J4KA 2JLZA 2WICA 5B30A 1KGDA 3K09A 2VSFA 1E32A 1IN4A 1LFDB 3K0AA 4O0MA 4TYQA 4C7OB 3VFDA 1DAFA 1HE8B 3GEEA 2B21A 5CYOA 5FPHA 4AY2A 1JR3E 3TGPA 1S1CA 4MGKR 1CR4A 4JLNA 2QAGC 3ZD7A 1CF4A 1OXSC 2KWIA 4DLYA 2P5TB 4GNKA 4DCTA 1WMSA 5D3QA 1QHSA 1NG9A 1GRRA 5H70A 3UMRA 1FOEB 1IXSB 3FMIA 4NE2A 2AKYA 1XNJA 3T5DA 2XZLA 4HUQB 4TMKA 4PC7A 2MMCA 1VCNA 4MKGA 4ZI3A 3I92A 4P4UA 4V0KA 4PSAA 1XXHB 1NVVQ 1SVOA 1KKMA 1I2MA 4QC2A 4LJ7A 4BFUA 1SKYE 1XMJA 1XRJA 4POAA 3TNFA 5KSYA 1VHLA 3KTAB 2CL0X 3GLFA 3HU2A 2WAYA 2WSMA 1G20E 4EIWA 3GLHE 1I4DD 3DZDA 4PHFA 1XFAA 1NI3A 4C2UA 1A1VA 1A2KC 1COWD 2W2VA 2J0VA 1GL6A 4GPTA 4PO1A 1LV7A 1N5JA 2JLVA 1NLYA 3GJ6A 2RCNA 4QGHA 3K0CA 1LW7A 3GLIB 5EXPA 3PJRA 5AK0A 2PZEA 2Q3HA 2JCSA 3KDSE 5A4JA 2ZRCA 2QZ4A 2GEVA 1R0YA 4DDVA 1R8SA 2Q21A 4I1OA 4US0R 2VQSA 3H4MA 1XTRA 3WP1B 2ODNA 5EZ6B 2QGZA 1KI3A 2VP2A 2XJ9A 1X3SA 4P33A 4W5HA 1XJCA 1E2HA 5DN6A 1F2TB 3B2EA 2NTYC 1W36C 1OYWA 4QM6A 3NBFA 3SJZA 4C0HA 4CF7A 1VCOA 1C4OA 1EG7A 2QAJA 3UK6A 2AK2A 2O8BB 4BEJA 3EIQA 4A2QA 3TVTA 1KDTA 5JWRA 2IWHA 2D2FA 3TW8B 3KKPA 4YMWA 1RIFA 2CLCX 2R6FA 2FDCA 5BN3A 1P72A 4U7DA 1SVSA 4CGZA 2HF8A 1LNZA 3MJHA 1EFRA 1GL7A 2GZHA 3CX8A 3FMOB 1YU9A 4GFDA 1GSIA 2HCJB 1E99A 3SEAA 1EFRD 4EJSA 4PQFA 4HB4A 3SZRA 4B3FX 5KPDA 3I8SA 2G0NA 3BIFA 2IYXA 5DGXA 1US8A 1FTSA 3UG7A 4D2IA 1TEVA 1JXMA 3VR2A 3EW9A 1H65A 1ZU5A 8OHMA 3U7GA 2KBEA 4M53A 4G1UC 4M1MA 4B71A 1UADA 3MWJA 2CL6X 2DFLA 2EWWA 1E0SA 1S4QA 4ACAA 3AKDA 5DO9A 3LH5A 1ZNWA 1OH7A 1IONA 3RHFA 4E5UA 3BK7A 4CDGA 4NONA 5FL3A 2FZLA 3CX6A 2CHQA 3BE4A 2JDIA 3TH5A 2BEJA 4OHXA 2QN6A 4AIIA 4EPWA 3IQWA 2HUPA 2AXNA 2J9RA 2XXAB 4BLOA 1N0UA 1YKSA 2JDID 2LCFA 2XGJA 5G40A 2WPDA 4JJZA 1F6BA 2JASA 2YOFA 1AK2A 3T12A 3ZQ6A 4Q1CA 3K70B 3Q72A 3IBGA 2WPDD 2Q9AA 4DLZA 1JALA 5JSZB 1HT1E 1EGAA 1Q1BA 1YZKA 4C2TA 2QEQA 3KZ1E 1CR2A 3UIEA 3QE0A 4KODA 4DLWA 5CB8A 3SJBA 4BEBA 1VG0B 2JA1A 4PHHA 4BFTA 4MRNA 3GLHA 2QMUA 1VDZA 2REXB 2ZAMA 4D4JA 2ZRBA 5FOXA 2O8CB 1OB2A 2VH5R 3TSWA 1IXZA 1C1YA 1ZAKA 2FGJA 2Q9BA 4D26A 1GRQA 1XPRA 4HSEA 3LQRA 5FBLB 1E9BA 1P62B 1X8LA 5CK4A 1IN7A 5LD2B 1KMQA 1ZM2A 4MUBA 5K8UA 2ZRFA 1ZNYA 1XTJA 1UDXA 3BBPA 3R9IA 1SKQA 2IUTA 3BJIC 5G3YA 3VU9B 2FEOA 4ZDIA 1W2GA 2Z4RA 5FPSA 5JZVA 3LFUA 2CLSA 1XD9A 3D3QA 2DFTA 4BFVA 2WKPA 3NIBA 3KQHA 1N5LA 4A15A 3WMGA 2IS1A 2D3WA 1O3YA 1PZNA 1T8UA 3CO5A 3PFIA 4URZR 3S1AB 2NPIA 5L3SA 2J0QA 1H8HA 1UKEA 3I8XA 1Z0AA 2GEUA 2QP4A 3LV8A 3AEZA 2BWJA 4JLOA 2GVZC 1R7RA 3AP1A 4BUJA 1Q0UA 4R98A 4PFSA 4B75A 1H8HD 2ZI4A 2HJGA 2QAGB 4UXHA 3WHKA 1GNQA 1VKJA 1E9RA 2WZQA 1EX6A 1AGPA 2P67A 2ZSDA 1IJEA 3G82C 5BN5A 1E9FA 4GOXA 1OH8A 4IVPA 3E2IA 2GCOB 1D2MA 3QG1A 1KMHA 1NY5A 4Q4HA 1G291 1R0WA 4HUQA 2VP9A 4EFMA 4HAXA 4XH9B 1XXHA 1QVAA 4JVNA 4XD7A 3Q5EA 1KI6B 2FE4A 2QENA 3K09C 1KAOA 1RFLA 3SHFA 2G83A 3IO3A 4YDSA 4MH0R 5IK2A 4XD7D 4EAQA 2B6HA 4HI0E 3TBKA 1FFHA 2GILA 1KI4A 3KTAA 2PZFA 3GQBA 3CBQA 3PENA 3PEWA 3OHMA 4GBMA 3AF4A 1A2BA 4RZ3A 3QKTA 4OQMA 3NWJA 3AVXA 5EUQB 2IYYA 5IK2D 4ILEA 4IRUB 1KDOA 3U3JA 3LNCA 4B43A 4OI2A 4R9UC 4A8JC 5HZKA 3F0TA 1E2LA 2WHXA 3BH7A 3NC1C 4BWYA 1FX0B 2AWOA 1Q44A 4OK3A 4EQ6B 1ZBDA 2PCJA 1CJTC 2QU8A 1DARA 2GWHA 2K5UA 1YZUA 3MUFA 1G5TA 4YQFA 1DE0A 2F43B 5F9FA 3SFVA 1B23P 2WWGA 4LRWA 4M1SA 1P61B 5J4YA 1GFIA 4QHTA 1QHIA 1DG1G 2DWPA 2WBLC 3IUYA 1ANKA 3BB4A 3MMPA 4DJTA 1S2MA 2FZ4A 2EQBA 2J45A 4RCZA 1Z5ZA 3D7MA 1XX6A 2FJUA 5L3RA 1W36B 1UBFA 4L4UA 1WXQA 2O8BA 1DVRA 1SXJA 3KXLA 4FMDF 2B7BA 4LHVA 2Q9CA 3D8BA 5HR5A 1E0AA 1UJ2A 3VNVA 4MYHA 1OXVA 5C18A 5KU1A 3K0CC 4E07A 4NCIA 2ZRAA 1SXJD 4D81A 4LYAA 1WQ1R 3ICEA 1RYFA 4IOMA 2LKDA 4ESVA 3GEIA 4DXAA 3NDPA 4PAQA 1JJVA 2C9YA 4ACBA 2A9KA 2VHCA 1K6MA 5K8IA 2ZE7A 2AKAB 4JLVA 4ZIRA 2BIFA 5DI3B 5K8TA 5HKKA 5FI0B 4ZI2A 4URWR 4MDEA 1FP7A 3LO5A 1S3SA 2A5DA 3HYRA 2VHTA 5HKKD 1KJWA 5BW8A 4Q01A 4Q4AB 5JI2E 1NJFA 3GFTA 2OBLA 2OO7A 1MO4A 3FE2A 2N1BA 2ZSEA 1E2PA 5C2JB 3QKRA 1UBEA 1P2UA 1ZVQA 2V55B 3MWKA 5FL7A 5FPYA 1U99A 2JJ2A 1E3MA 1DO2A 3CLVA 5DISB 4FINA 4NZYA 5J40A 1PJRA 1EFHA 3WBJA 5DNYB 1KNQA 2PX3A 5FL7D 1JXOA 4NYMR 3QXHA 2JJ2D 5GJCA 3CNNA 5CLQA 5E3HA 4BECA 1RKBA 2WM9B 3NHBA 1A82A 4ZDJA 3SN6A 4EJSC 2PLRA 1E2QA 2IA5A 1BYIA 1GP2A 4C0KA 5AUPB 3FKSA 3PR1A 1TU4A 2X77A 5EE0A 1FL9A 3Q5DA 2I1VB 4PXAA 2XOKA 3BORA 5J47A 2J1LA 2Q3MA 2CEAA 1OT3A 2HEIA 3FKSD 5JSZA 5DH9A 4B47A 2FSHA 3NEYA 2ATXA 2G88A 3SS8A 3AM1A 3VKGA 3K70D 2XOKD 1G16A 4B2PA 3B1XA 4BE7B 3K1JA 4BFYA 4D0NA 2YWEA 1BO6A 1XCGB 2CCKA 4JYBA 4QBGB 4Q7JB 1EFTA 4F7WA 2JLYA 4FWTA 1SVKA 3ZS9A 2O8CA 5J4LA 2ZE8A 3EAQA 3FWYA 4UKDA 5IHPA 2IBMA 1ZYUA 2DWOA 2Z43A 4DIEA 1E9CA 2OAQ1 3A4NA 3CRQA 4IEIA 5FUVA 2ZXUA 1XTSA 4IW3B 3ICQB 3MFYA 2FF7A 2BBOA 3LLUA 4D82A 3VR4A 1NL3A 4JLPA 2PT7A 3CH5A 4C30A 3SJAA 2ZR0A 4EUNA 4ZCMA 3LVRE 1AZTA 3QENA 5KHOC 4G5OA 3VU9A 3X1WA 2VP4A 5KNCA 1NN5A 3ASZA 1ZM7A 1EK0A 4UXIA 1P3JA 4IXNA 3ZVLA 1PLJA 2CJWB 2IHBA 3RS3A 5BXQC 4AKIA 4RZUA 4WAUA 1M1YE 1G3MA 3QJYA 2A78A 2A3RA 2F7SA 3B8HA 4JVLA 4LV5B 1G21E 3WY9A 3GJ7A 1KSJA 2B92A 4N3NA 3SNHA 5GJBA 4L5BA 2QRZA 2J41A 3LXRA 4Q66C 2DY1A 1OH5A 2QGNA 3AF3A 4B2LA 3KUCA 5TB5A 5L8VA 3BC1A 2Z4SA 2BC9A 4QXAA 4AK9A 3Q7QA 4UNPA 2AFIE 4BLPA 4AYXA 4Q1AA 2HV8A 1S1MA 3LW7A 4W7SA 4PC3A 1Q22A 1YZLA 2A30A 2X2EA 2YKGA 4UJ5A 2P65A 2QTHA 3QNUA 3HP1A 1MT0A 1W5SA 1OFHA 4TQAA 3OZXA 4LZZA 4NKRA 4QKQA 3EA0A 2IYWA 2L0XA 4V0OA 4LV6A 4UNRA 4DLRA 1CJMA 3ZS8A 2IF2A 4IKEA 4DDUA 3QVVA 2QUZA 3TQFA 1SVIA 2OZEA 3K0AB 3FHOA 1ZUHA 2WSSA 1JEEA 1VIYA 5FUXA 4LHZA 2IX3A 2CLDX 5KYKA 1CRPA 1X1SA 3IBYA 2ZR9A 3BFKA 4HAVA 2IW3A 4A1FA 1ZM3A 1FX0A 4LC0A 4C0BA 4V0NA 4A8JB 4EQ6A 4MUAA 5AJVB 4DKXA 1SULA 3O8CA 3IGFA 1EFUA 1E4VA 1G7CA 5JS7A 1M7BA 1JPNA 1KO7A 2NG1A 4V0MA 2F1RA 5FBRB 3KJIA 1YQTA 1D9XA 4JZKA 5EP4A 3VR6A 2ASEA 3WNCA 4CEIB 3WHLA 1ZIOA 4PSKA 4OHWA 3L2OB 3EPHA 1DAKA 2IC5A 2ZRNA 3DHWC 3BB3A 3JZMA 1ZUNB 2Z6VA 3LW8A 2O0HA 4ARZB 4XTRA 3M0EA 4V03A 4LPSA 1E1QA 1R4AA 2NO6A 3QBTA 4M1TA 3K0FB 1E2KA 1NLFA 1DAHA 2PMKA 3THXA 3AVUA 1G3QA 2I1QA 2NO7A 3B85A 4Q48A 2C9OA 2HF9A 3CR7A 3W6PA 2V6JA 2VHUA 3A36A 4P32A 3T06B 1TPZA 5CJ2A 4O2RA 1XB2A 4Q21A 4QGFA 3THYA 2H18A 1MV5A 3EIEA 2IS6A 2D4HA 2JGNA 3FHCB 1QHXA 1GRNA 1JB1A 1KHTA 3B7GA 3DPUA 3E5HA 4DLXA 4ON9A 1TAGA 2RGNC 1AIPA 4BFWA 4OI4A 4BZXA 1Z0KA 3RAPR 2J0UA 4TMVA 1D8TA 2OILA 2AHOA 2CVFA 4MKIA 2BCJQ 2FFHA 3TR5A 4XVUA 1OKKA 2FEMA 4W5WA 4RVCA 5A0FA 1IY1A 2C95A 2EFDB 4LYHA 3UANA 1X6VA 3HU1A 1SXJC 2ZVPX 3SU8A 1OKKD 4B74A 1Z6TA 2QP9X 1U8YA 3P1JA 1IAQA 2UZIR 2XEXA 2DCUA 4S2EA 1OIVA 3QPWA 4TZ6A 1L2TA 4YLGA 3AP2A 2JIZA 2QSZA 3DL0A 4Q47A 4IOJA 1OPXA 4L16A 4LHXA 4KFUA 1G5PA 4I1UA 2YYZA 4ZKDA 1II9A 4DT1A 3NG1A 5KSPA 1MO3A 2JIZD 2ZPTX 4FIDA 2W6ID 1GL9B 5F3WB 4Q9KA 1VPLA 2GCNA 3T1VA 4PC2A 2JJ1A 2H1LA 3PUYA 2QP3A 2NMVA 4H1UA 1NRJB 1NKTA 1VYTA 4EJSB 1DAMA 3CPHA 2EU8A 2V1XA 3NHAA 5FFMA 4BLSA 1A5TA 2IEYA 1Q20A 3ASYA 2V3CC 4LY6A 2JJ1D 2CL7X 4Q00A 4B3BA 4BGDA 1US8B 4YONB 1MH1A 2IYUA 4PO9A 2YVUA 5CB6A 1XEWY 2XSZD 1M6NA 2G77B 2CE2X 2VEDA 1JBKA 2PEYA 2HCBA 1DOAA 1RRFA 3SC3A 2R6GA 3BAFA 4EPVA 3PVSA 3KXIA 2LWIA 4R2IA 1RE0A 4PPGA 2FV8A 1HE1C 1KDPA 2ZUBA 2GJAA 3CNOA 2F9MA 1KIMA 3VR1A 1ONBA 1L8QA 1T6NA 2ZRLA 3B1WA 2RAPA 2WWYA 1QVRA 3CIOA 1QF9A 1E2IA 3FVQA 2E9SA 3MLEA 4RZXA 2YJTD 4EDHA 1JR6A 3TRFA 4TSFA 1E2NA 1N6IA 4OQLA 1T5IA 2A5YB 3K70C 4J0QA 3WNDA 1OLOA 2ZVQX 3IHWA 4TSFD 3R8CA 2KE5A 4BFZA 4URVR 3TE6A 1L4UA 1J8YF 1ZIPA 3GJ8A 1SKYB 4KLNA 2ZREA 1KJYA 1LVGA 2OLKA 4RFVA 1Q57A 4OHZA 2CNWA 2G6BA 4CYMA 1OW3B 1JECA 2WWHA 2FA9A 2NOAA 3MCAA 4TQUS 2PJRA 3GLHB 2IEZA 4TYYA 4AKHA 1NIPA 4OHYA 2QL6A 4NU0A 2CNWD 2DHRA 1YR6A 5LD2C 3O8BA 4GRAA 2O0JA 3BD9A 4RD2A 2ZITA 2YV5A 1FQJA 1Q1ZA 4Z8YA 3ZJYA 2AD1A 5DSZA 3MWLA 1XEXA 1UF9A 1GNPA 5KSOA 3MJRA 2DPXA 2ZEJA 3FFBA 4QOSA 4TN1A 3QXCA 1H8EA 4QBHA 4RD4A 1TU3A 1TL7C 4ZPXA 1V43A 1E9EA 3DM5A 4X8MA 1G3IA 2GA8A 5BN4A 3CRW1 1H8ED 5J5CA 2GK6A 4AWXA 5L3SB 4RKFA 1FNNA 4NTZA 1G64A 4W9MC 1G19A 4QBFA 5G53C 5EUMA 3REGA 3OIVA 4A8JA 5JECA 4C0SA 1YR8A 4RFSA 2F3RA 3DKPA 3E70C 2QT0A 5UKDA 2J7PA 6Q21A 2PCLA 3LBHA 5TV2A 1KMHB 4Q4HB 4TMZA 1XCMA 2J7PD 4CEIA 3BERA 2P6NA 4FMDB 2D7DA 3MSXA 1EWRA 2VO1A 3ZVMA 4ARZA 2W83A 1P75A 4Q9HA 1COWA 2ZAOA 1J8MF 3L0PA 2W58A 5H8WA 3K0FA 2QE7A 3DKVA 5H1YA 4OHVA 2QPOA 1ZD9A 4XWKA 3GLGE 2OFOA 2O8DB 1E2DA 2QE7D 2QPTA 3OEEA 4KVGA 2ZJ5A 4YMVA 1T3LA 1Z28A 5FOUA 4YXWA 1TF2A 4HEJA 2YHSA 3OEED 1SZPA 2RHDA 4XSHA 4NL4H 1Z0JA 3GP8A 2VF7A 4I1VA 4EPYA 4YXWD 4NYIR 1IY0A 2EFCB 3T5GA 2OCPA 4OK6A 4KFSA 3PV0A 4OQNA 5AUQA 2GJKA 2HLDA 2ANCA 3U3KA 1WRBA 4PQYA 2Q0HA 1B0UA 4LJ6A 3N5CA 3PXGA 3M4YA 1GVNB 3ZD6A 2ZE6A 3P26A 3TLXA 3QXXA 4F91B 2HLDD 4YMTA 4MKHA 4B3XA 1SXJB 5EE1A 1M7HA 4JKYA 4M0LA 4N1AA 3LDAA 2VP6A 1GAJA 2VBCA 4B73A 3KB2A 3U2QA 3AUXA 5CJPA 1TF5A 2ZJYA 4OJKA 3N2EA 3RS7A 4PR0A 2GNOA 1GITA 2QPAA 4QJ5A 1P2VA 3T61A 1FNMA 4NCNA 4NYJR 2FU5C 3FKQA 2GXUA 3DDCA 1NMZA 4U02A 2IYSA 2O8EA 4XSGA 4ZIRB 2OCYC 2OXCA 5AWFC 4AD8A 3CONA 1G4AE 2AFHE 1OJLA 4D0GA 1IHUA 3IIMA 4IDPA 5J4VA 4GMDA 1FPMA 4F4CA 1ZD1A 1Z06A 4M9ZA 4MA4A 3R20A 4NCJA 2OLJA 3PQCA 5DE3A 1G3UA 4P0TA 4OI1A 3QKRB 1ELOA 2OESA 1JR3A 5JJKA 1KO1A 2ODBA 2FSGA 2G0TA 3A8TA 3FDIA 2C99A 4F93B 2FSFA 3C15C 3RS4A 5FOWA 5AUOB 4G5SA 1KK3A 1N6OA 1JR3D 4QGGA 4LJ4A 2ERXA 1M8PA 1Z08A 4X8HA 1X1RA 1GKIA 2GJ8A 1NMXA 3TW4A 4JLKA 3KQLA 2VTKA 5FBWB 2IYLD 2VPPA 2C77A 4TL8A 1QG2A 3CPEA 2ZR7A 2ZE5A 4H1VA 2V7QA 4RY2A 4XTCS 1CBUA 2YC4C 4ZKEA 3T35A 3K0SA 5EP3A 4E03A 3GLIE 4AKGA 3A1VA 3JVUA 2V7QD 4OJQA 4TL7A 1IQPA 3D6TB 1AKYA 4QHYA 4R7ZA 3FB4A 4FXPA 1TMKA 4QNRA 2H5EA 4JJKA 5LPNA 1VCIA 4RKEA 3I5YA 1HYQA 4IVQA 1KO8A 5HE9A 2C78A 5SZHB 4ZDKA 3ETLA 1Z2CA 5JEDA 4F4JA 2WMNB 3DO6A 1YR7A 3CNLA 2YNMA 2FFAA 3IILA 1TEXA 2GBLA 2W6JA 3GPLA 1RYHA 3GJXC 3HR8A 2SHKA 2C8VA 3RC8A 3KJHA 5B2ZA 1NG1A 1QHNA 2NO1A 2W6JD 3A1WA 3B1VA 2HT6A 4HLCA 4UNQA 4QJ3A 5FTJA 1N5IA 4I1SA 1X86B 2BOVA 2NO0A 2FG5A 3JZAA 3BFXA 1A4RA 3B9PA 3RDPA 5B64A 1DAEA 3UWOA 4O3MA 4ERNA 1G17A 2FGKA 1JAHA 4B6EA 3VQTA 4IOKA 4HB3A 5CIQA 3A58B 4A4DA 2H16A 2MSCB 3L0SA 5GVRA 4JMPA 1SHZA 3UATA 1HTWA 1T3SA 4AYTA 2R9VA 3V4RA 4DCNA 3C8UA 2REBA 3AP3A 4A9AA 2QM8A 2X8AA 1DO0A 1SVLA 5CIWA 1XMIA 5EQTA 3U6KA 1P5ZB 1UEJA 1OFIA 5FUYA 4RSGA 1XCPA 2CE7A 3BOSA 3IO5A 5K8LA 4QHSA 1W4BA 4EFNA 3B9QA 3OESA 1W4AA 1GKUB 3PUXA 4IEEA 2CMKA 2EYUA 1XPUA 1TQ4A 4ESHA 3RRYA 1WB9A 1AZSC 1XMVA 2O8DA 2WMOB 4C0AC 3TQCA 2V8OA 1ZM9A 1W49A 1N3BA 1W2HA 1HH4A 3KFVA 5HTKA 4A6XA 4JLAA 3T1QA 4PZYA 4EPRA 1YVDA 2ODEA 4XIGS 4MRPA 1CTQA 1S9DA 1CR1A 1ZUIA 3I4LA 2F1IA 1BS1A 3ZVRA 2E1RA 1E2EA 2RH5A 3CZQA 2RGNA 3N2IA 4KU4A 5EE3A 5KOYA 2O8FA 1TNDA 1VECA 2EFHB 2ZRGA 3C41J 3UMFA 4ABYA 5TDHA 2IXGA 2IUUA 4BRUA 4X8LA 3B78A 3A1TA 3L82B 1WDTA 1OIWA 4JIMA 4DB2A 4AURA 2R2AA 3CB4A 3THXB 4C9BA 3AGPA 3EA5A 3I62A 3CH4B 4Z1MA 2F55A 2A7QA 1E2MA 1TF7A 2BM0A 1XEWX 1XEFA 3TIFA 4Y0VA 4UNSA 1G8HA 4Z1MD 2P0EA 3THYB 3OIYA 3B5JA 3ZZ0A 4PC1A 2IXFA 2NZ8A 4GT1A 4BASA 3PUWA 2HYDA 1Q1QA 2ZQ5A 1W1WA 3L0OA 4JVMA 1HQYE 2CBZA 1XBTA 2ZI7A 4LYJA 3VR3A 3U7FB 1P9WA 4GP7A 1NNEA 2R65A 5EXSA 2RMKA 2VSXA 1CR0A 5G3ZA 5FUWA 2J0UB 3BRWD 4B33A 4S35A 3PEUA 3R9XA 3B1ZA 3T1OA 1DG3A 3SYKA 1YZNA 3EZ2A 1CIPA 4TLEA 1SQ5A 1U8ZA 3WBKA 1E1RA 1LY1A 2RKOA 4NYIQ 4CRWB 3QPVA 1ZCBA 3SQWA 1QDEA 3EC2A 2JAQA 3QKUA 5JJLA 1KO5A 4XOIA 3FMPB 2BKEA 1E1RD 2QORA 4Q7KA 5AR1A 3U44B 2FFBA 3QF4B 3ZZUA 4TYNA 4II7A 4DT1B 5KDOA 3C4JA 1I4TD 3W34A 4XJXA 1E2JA 2YWGA 1G8YA 1W46A 4MYTA 4L9WA 1GOTA 3LVQE 2JLQA 4B32A 5JMTA 2ZJ8A 4I99A 4OQXA 4PAMA 5FR2A 2GXQA 2MMGA 3IEVA 1Z0FA 4NYJQ 1YZGA 1RRGA 2PL3A 2I3BA 4C3ZA 3FTQA 1KAGA 2BVNA 1G8GA 3BS4A 1AS2A 2ZYTX 5EE5B 1Z8FA 2DFKB 4US1R 2CCGA 3W3AA 4FMCF 1TUIA 5DHAA 2G3YA 1R5BA 4Q9JA 1FUUA 2BJVA 2RGAA 3LLMA 4MYUA 4US2R 2P6RA 1E9AA 3KXKA 3WRYC 3I73A 2EVWX 5FOTA 4IDNA 3LBIA 4HAWA 4ITRC 1ZJ6A 2PJZA 4G5RA 1II8A 3LX5A 4TMTA 4HZUB 3HJNA 5CLLA 1VG8A 1XZQA 2J46A 3RWOA 1XMSA 1YR9A 2IHYA 4QM7A 3LAWA 2F3TA 3HDTA 1W0KA 4PAOA 4NH0A 3EZ6A 3EG5A 2ZSAA 4TYPA 1DS6A 2ERYA 2WJVA 4B6FA 4R71A 2AL7A 2DYKA 1W4CA 1NN0A 1DAGA 1W0KD 2OG2A 2AR7A 2V4ZA 3CF6R 3L8YA 3AQ4A 1SVWA 4LPKA 4DHEA 4M1OA 1Z0DA 4IHQA 2FPKA 4QFMA 1TX4B 1VIAA 1NLZA 1QBKC 3DOFA 1J90A 1ZC4A 3R7WB 3VMFA 3W5JA 4TYWA 4F4IA 3MGCA 4F92B 3U4QA 3NBZC 3PUZA 1CRQA 1U8AA 1U2RA 4BQSA 2ZUCA 1DTSA 1U98A 4NCKA 1S0UA 5E95A 2BDTA 3P4YA 3AKEA 5AJZA 3U3RA 4PTLA 1XEXB 2GF9A 3HPRA 1W4RA 1YZTA 2GBLC 3C14C 4Z51A 3GFPA 3AV0B 4DCVA 1U94A 5CM8B 2R6AA 3QF7A 1KOFA 3NTUA 4A0HA 3SBDA 1Y63A 2QRNA 4MITA 3BGWA 2GEDA 4KI0A 3A4MA 3I32A 1UM8A 2Z0MA 3DVLA 2VP0A 3JVVA 3I1FA 1IN5A 1U81A 2F9LA 4FCTA 4TLBA 1M2OB 1UDWA 2BM1A 2WJJA 4LWZA 4PZZA 1NIJA 4BFXA 5EJEA 3A6PC 3FYHA 4D0LB 1E2FA 2WWXA 3WYAA 1KKLA 3CR8A 2ZJZA 2ZSBA 4CW7A 1W48A 2GVDC 2XJ4A 2HJVA 4JKIA 4KBFA 4RFSB 3QBVA 4Q1EA 5TXGA 4CZ2A 2H57A 2C03A 5LB4A 2BV3A 1Z47A 1R10A 3CW2A 3LX8A 4URUR 3ZDQA 4LBYA 1XU4A 5TY0A 4NPHA 2R6CA 3CZPA 3VKHA 2ORWA 2VL7A 1G6HA 1Z22A 1T5LA 1D5CA 2ZI3A 1OFUX 1GIAA 2GF0A 4UNNA 2QQEA 1XJ0A 1ZC3A 3P20A 1XP8A 5HCIA 4BRWA 1JQJC 5BQ5A 1K5GA 2R6DA 2V54A 2B7CA 2ONKA 2WIBA 3EZ7A 4A2PA 1XWIA 4Q1DA 1Z3IX 2F1JA 4P4TA 5FH9A 1WE2A 3OIWA 1XDBA 2P6UA 3WMEA 4KSCA 1TQDA 2Q3FA 1VHTA 1NF3A 4RD6A 3TJZA 3TSOA 4DBLC 1PVOA 4M2LA 1N6PA 4XVRA 4C0QC 1W0JA 2QBYA 2FN4A 2XZOA 1NKSA 2G9NA 2MSDB 1LS6A 4D4LA 2DBYA 2BBWA 2KJQA 4QJ4A 4B2IA 2GAOA 1EXMA 3O47A 1CKEA 3RS0A 4MGZR 1W0JD 3GJ4A 4LK2A 2NO9A 1ZU4A 2JATA 3ZZTA 4KLZA 1M34E 2VLIA 3G5UA 2OE2A 3OFNA 1IY2A 3LA6A 4M1WA 4RZ2A 1U0LA 621PA 5CDFE 2A5JA 4CEJB 3O8RA 3U7HB 2C2HA 3I3SR 1N6KA 1Z6YA 3X1YA 3L8ZA 5HCNA 3OFND 1BIFA 1IN6A 1SHKA 2JLSA 4K46A 1WA5A 1U9IC 1R5NA 4TL9A 3U44A 1OH6A 2EFGA 4QL3A 5J4HA 5IT5A 2W6IA 3C5CA 1G3RA 3QF4A 3Q9LA 2NQ2C 1XD2B 4TL6A 5FOSA 1PUJA 4KBGA 2PX0A 5FBVB 2Z5FA 2GTPA 4D25A 1I2DA 4M9SA 1Z83A 2ZJBA 1T4GA 3QPUA 4PHGA 1RPZA 2GJSA 3PITA 4FN5A 5EE9A 2G1KA 4F38A 3NDBB 2B8WA 2O8EB 2XSZA 1UAAA 1S9HA 2BMFA 4LSGA 4K81B 4CIDA 2YOHA 1NY6A 5IF9A 3RRNA 3X1DA 4PX9A 5L3QB 4KSBA 1CLUA 3MG9A 4Q9IA 2R44A 3VAAA 3VX3A 3FPAA 1RJ9A 1KNXA 5M04A 2HDNB 3RNLA 4CVNA 2OBMA 3FGNA 3LY5A 2FPLA 3V4FA 1QHGA 4TMWA 2QNRA
chains in the Genus database with same CATH superfamily
3A1NA 3WOHA 1E9VA 2OO5C 3MLBA 4WJLA 1SVUA 3DEZA 4WBXC 2PH5A 1WB6A 1FZQA 3V2IA 1Z2NX 5J1TB 2O5CA 2PTHA 4PGGA 1Z4LA 1YL6A 1V5FA 3BWDD 1CP3A 3IAXA 3KEGA 5ICFA 4ASUD 4E13A 3CEJA 3V4OA 1Q21A 4Q16A 4ZDWA 4DUGA 1ORIA 3H42B 3LPCA 3TLGB 4R3WA 3P2KA 2HMVA 2ZM5A 3N2LA 3T3DA 3N8NA 5HPYB 4M36A 4KQ1A 2OMKA 1A50B 1EVKA 4JUIA 4UULA 5DK4A 4UBNA 3AZQA 4Q02A 2N42A 4D4MA 1P9NA 3OM1A 2FF5A 1YO6A 4ZA2A 3URKA 3WNZA 1APBA 3FNRA 3PD0A 2FSSA 2SCUB 4YAEA 4DNFA 2LIVA 3IOCA 3ZJUA 5K6AC 3OFKA 2AN9A 1TIPA 1U5BB 4YT2A 1NBAA 3CEPB 5DCYA 4HFMA 4INJA 1XTUA 3DMYA 3KEFA 3R8FA 4XQ0A 2D13A 2H0QA 3FUWA 3N0XA 1UOQA 3FOAA 2GRJA 2WUWE 4MHSA 5L7YA 2GJ9A 3HYTA 3HB0A 4KJXA 4BKUA 4EG0A 3MCWA 5A03A 2XW6A 4PLTA 1ZINA 3LTEA 2B7LA 3DUFB 3EEQA 2XUJA 5KX5F 2O0LA 2H5LA 2QB5A 4YJFB 1RI4A 2VWGA 2YX1A 3DE0X 3R5XA 1GHTA 1CY6A 2C4MA 3JQ7B 1LB1B 3M82A 4D4KA 5KNBD 3DCNA 3M5WA 4LHWA 1AJEA 4HRAA 3UJPA 4MIYA 3ZHCA 2GHTA 1L7QA 2ORIA 1GCOA 2KLHA 3KJNA 4JJFA 3KQWA 4JJEA 2XLCA 4TQ9A 4DHWA 1JLMA 2X3UA 3P5SA 3UJ3X 4M8NE 5KNLA 1P7CA 1JIKA 2ZJ1A 1ZA2A 3GYBA 3T34A 4OSPA 1KZ9A 1IHOA 4IYJA 3AOEC 1YZHA 1BAPA 3HEBA 4XYLA 1H5QA 3LUJA 4EYEA 4KXFB 1FY2A 1HQKA 1DHRA 2ZBQA 1RJWA 4FQ8A 3U3OA 4HN4B 2CF6A 2CHEA 4OLJA 3UKDA 1CT9A 1SEVA 1E94E 1BE6A 1O0SA 2X4GA 2VJMA 1J1IA 3EVZA 4IJMA 4MEBA 1X80A 4Y30A 4JLBA 3R7NA 2CNBA 4R2JA 5ILGA 2EXXA 4AJ4A 4KITB 2VCEA 2CYCA 1I30A 4HZIA 2WPNA 1GTVA 1N5KA 3BM5A 5KYUA 4ADSG 2R1ZA 4DLKA 4YP5A 2JAXA 2ODTX 2PSHA 4UTZA 2VJQA 3SXPA 4DIFA 3UPUA 4P4SA 4B4UA 1N7JA 4LJRA 1KS9A 4KR9A 3IH5A 3P9NA 4O4JA 4B35A 3WO1A 3JWHA 3GG2A 1UQUA 2FX5A 3QWAA 4EF5A 5JMWA 1GAQA 3DC7A 1U0JA 2HMWA 2F8SA 3E5NA 1MRNA 4QNNA 4F7DA 5EJ7A 2O59A 2PMCA 3E84A 2ZUFA 2FPIA 1B8VA 4PRKA 2FHSA 4XDYA 2CCJA 4CF4A 3W90A 5CD9A 3EPKA 3CM0A 3RRMA 4IINA 5IVIA 1JUDA 2H7CA 1LVUA 2QN3A 2IP4A 1MJ5A 5HNKA 3BRQA 3N75A 2Q5HA 3IS3A 4GHWA 3ZUGA 5C1BA 3KQNA 2V58A 1F7VA 1W88A 3OZIA 1SZDA 3R9KA 4DQXA 4ESEA 1E89A 2GCPA 2HA0A 3HFSA 2N46A 1Z8DA 4KL8S 5D01A 1HNZB 2QMEA 1PR1A 2ZJAA 2OXEA 2JFXA 4MW4A 1DBVO 1L4BA 3HJFA 4ZTUB 1YKFA 3A31A 3IR6A 4JK3A 3VJLA 4P3NA 3ELUA 3LE8A 1QRRA 3KJEA 1PYGA 3O03A 4Z54A 2XMBA 4TRRA 3HA3A 1QNFA 3RB8A 2GNAA 1KDRA 1R88A 5BYKA 1CU1A 1P73A 3DDOA 5MF6A 4F60A 4GR5A 1P2SA 1XZKA 5CM2Z 3RWMB 2ZVJA 3EH2A 2XRMA 5DK6A 3VTZA 5BR1A 2C0QA 2XMGA 1D2EA 4EFKA 3QXJA 2Q2QA 1RLUA 3NFRA 1TLLA 4TXJA 4R01A 1JSZA 4P3YA 1GPLA 3SQDA 3WK4A 1VGRA 3OQHA 3AIIA 5KCMA 2KQUA 2R1TB 2FWRA 5TRTA 4C20A 2VDWA 3L0CA 1V7ZA 1SGWA 4E2YA 5A4DA 4FBMA 2WB2A 1N2HA 2NT3A 4FCVA 1H2YA 3URMA 2R96A 5I7EA 1SUEA 3L05A 1RRPA 4B46A 4MB0A 4N9WA 3HGMA 5KQRA 4WXEA 5A2GA 1U0RA 2JGEA 3DDHA 1RC8A 2G1AA 4QVKA 2ZGVA 3T7JA 2YC2C 4HDOB 1IM2A 1BHSA 1QQ6A 1SOMA 2QUBA 2XGGA 2XITA 1HEYA 4Z7NB 1NQUA 1NLMA 2HOQA 4AI6A 3EQ2A 3K6KA 1NOIA 3PGLA 4D42A 4OX9B 3B1KA 4ID9A 3D64A 5AJWA 3B3GA 2BUBA 4GOKA 5DN6D 1BVYF 2NV0A 4UEOA 3RC3A 4I19A 4RIHA 1E7MA 5D2CA 5F3DA 1XROA 3EH1A 3T4UA 4IIHA 3G9QA 4XPIB 1R0XA 4G65A 5JYEA 3B60A 5JAMA 4DLUA 2VTBB 4JT4A 1VKNA 1QFYA 1UC8A 2AIRA 3IP1A 3QLVC 1MMFB 2COKA 1KVSA 3S1LA 2X2FA 2ZSFA 5KVCA 1NXSA 1AF7A 4JUFA 2J3IA 1YJAA 2ZU6A 2CHFA 4RPHA 4KPFC 5ALWA 3OEHD 1DBWA 1WMDA 2FTKE 1LF5A 4IHKA 2V7BA 5EVCA 1RIIA 1PR5A 2FUG6 1MKYA 3A6EA 3RUDA 3Q7IA 1URPA 2IRWA 4HAUA 1LDGA 1Z0ZA 3RARA 3TI9A 4BNIA 4A92A 1K4YA 4MJXA 1M8JA 1MNAA 1FP1D 2IW1A 2PXHA 2FPOA 1XN1A 3TLGA 4BU0A 3Q7EA 1JXAA 4KTVE 4PANA 4JROA 3I39X 2J3LA 1E64A 3WYGA 2W4MA 3WL6A 2JCGA 4DNOA 1RT9A 4L7VA 2R62A 2B94A 4R1TA 2FZ5A 3OLCX 5EWMA 3T99A 4UU8A 5AW2A 2WWTA 1A72A 5F76A 2WTNA 2SCUA 2YASA 3DAYA 2WIAA 1XCBA 1W47A 2ZZNA 2XZPA 3RFTA 4OFWA 4IGEA 1PI3A 3L6EA 1U5AA 1Y5MA 1O8BA 4XQCA 4ARAA 5AVVA 4L4ZA 1JFRA 1SZCA 3WXMA 4F5YA 1BJTA 2R5WA 1JZQA 4CLRB 4DILA 4WOPA 2Q9UA 1IZZA 4GH5A 5CJJA 5I8ZA 4MEAA 3R5JA 3GU3A 4EO4A 3DUFA 1UPAA 4QULA 1NZDA 1OFUA 4RQTA 4GI7A 4GXRA 5CA0F 2FZKA 2XA1A 1WTCA 4CUJA 1OFTA 3G5MA 3FG9A 5ADWA 4GYYA 5H3HA 2QTCA 3JQ7A 2JK1A 3LGXA 2PZGA 1WTAA 1VG1A 1D2NA 4BFSA 1PDWA 2IELA 1MORA 1R27A 2ID4A 3P32A 4GMFA 1ECPA 5EJAA 2ONJA 4BV9A 2AG6A 4LJKA 5BV1A 1ZCJA 2RGCA 2BUCA 5K0NA 1WPRA 5E7JA 3E7PA 3MJDA 1WABA 4AT1A 5JI3E 1PLKA 3MUOA 1UKYA 4LGMA 2WU0A 2GNPA 3U7EB 1I1OA 2VUIB 3UUWA 2JAPA 1I8TA 2GTIA 3Q10A 4JP5A 4EI9A 2I4RA 3Q9SA 3AILA 3SBEA 4J6EA 1CUYA 4UDOA 3ZGLA 4XM2A 1BJRE 2FVYA 4M1YA 3IPXA 4X7RA 4F21A 5KHLB 3CLUD 5FNVF 5H5JA 1P9RA 2QJRA 1ZL0A 2VUHB 3EXG1 3OUUA 4IIEA 2GWRA 1D9ZA 1WVGA 5C7IO 1UINA 1IQUA 1V47A 1IZ7A 5TEVA 3AF1A 4TKZA 3AHEA 4N4AA 4UM9D 2UZ0A 4LJAA 3RSCA 3ZGNA 4C3UA 1E66A 1GZSA 2RJNA 4EHIA 4KV7A 3U4QB 4RGYA 5F1OA 3WYEA 4CQLB 3VNQA 2Q1SA 1Q5PA 2PLAA 4LJ9A 1EVIA 3BD8A 1P19A 1RPAA 3QIAA 2IEAA 2BKVA 4HH0A 4O1HA 4XWAA 4DQUA 1V3QE 3FPBA 1F3OA 4MVJF 5IUKC 3MBOA 1U0BB 1XVIA 2W37A 4GECA 3SE7A 2ZYIA 3E7FA 5DPMA 5GIPE 3VKUA 1Y3AA 2H2FA 3P27A 1FMLA 2XDAA 4RJLA 4XQ9A 4DEYA 4DB4A 5ALDA 3D7RA 1L5RA 2BMDA 1C4KA 2BCGY 4C4XA 1PHPA 1L3CA 4KACA 4O8CA 4WK0B 1AUVA 3OICA 1WX1A 5KO2A 1QJ4A 2D7JA 3B70A 1A8HA 5KTKA 1YHNA 2QMOA 1SJ9A 4ZOBA 5FTNA 3T52A 2AG0A 3ROEA 2PUDA 1FCJA 4MHOA 2FG6C 1U0HC 2H7YA 3GAAA 3GWGA 4ZO8A 5CT5A 3FOZA 3HBJA 4FKMA 4JV5B 3DOJA 4BNMA 2W2QA 3A26A 5CT9A 4R31A 2HBYA 3R5KA 2VJCA 3SEFA 1KI7A 4KUHA 4K9KA 4OF4A 1N36B 1YAJA 3VH2A 2Q7XA 1QIEA 4YIHA 1CFJA 2ZLBA 3PC4A 4A03A 1H42A 2IUYA 1X7HA 4WCVA 2QA5A 1NX9A 1TUEA 2HT1A 2HADA 2GBFA 3D2AA 4GSKA 1B8UA 2PRIA 2HDWA 4LRXA 4K40A 2EV9A 3P94A 4RKWA 4BQQA 3AVVA 3NHPA 4Y2RA 4AJJA 5KSZA 4QREA 1JHQA 4IDFA 1VRWA 4MJ3A 2BGKA 1XTVA 2X0FA 5SY9A 3U5TA 1JAIA 3ZCPA 5GVSA 1TZ2A 1X0VA 3BCHA 4GBED 4G1VA 3I42A 3QUQA 3HPQA 4QQNA 4YCAA 2H1FA 1KI1A 1AUPA 4MDHA 1GLVA 3QYAA 3U9TA 1L5HB 1K7SN 2J87A 3ZGXA 2BJWA 2NTEA 3OD1A 5EXPA 5I9IA 1P4RA 1N6NA 4FYXA 1G98A 2O1WA 3WIDA 4YCJA 4FC6A 1YOBA 3JD2A 3OZWA 3P9KA 1U1CA 3KLBA 4PPQA 3IVMA 1CUIA 5IVDA 4AFNA 1KXZA 3KOZA 4CJXA 1XZFA 1AGXA 1NJ1A 3PI6A 5HJ2A 3WB9A 1J33A 1PVDA 5E4FA 1BMFD 3QJGA 4A5OA 2ZRIA 3PLNA 4MPRA 1E9DA 2YS7A 3HU3A 1YUMA 2PUAA 1B16A 2BHSA 2PBRA 3GNTA 1RSZA 3AR4A 3N2GA 4YO7A 1BH2A 1WY7A 3W3ZB 2OV1A 3L7KA 4CPDA 4NS4A 2JLXA 1JIQA 2HSJA 1LBEA 1T25A 2HY7A 3GA0A 5T8KC 1IWOA 1NUPA 2RI6A 3RVNA 1XL1A 4PPFA 3VPGA 3AEUA 4AY6A 2A0YA 1D1SA 2BH2A 5JWHA 1NQOA 4JI3B 4HNGA 1XRPA 2ZJ2A 3HVIA 3M5PA 4G4SP 4K2AA 4DXHA 1BJKA 3TG8A 1MHTA 3I2YX 1N2CE 5JS1A 4HWKA 1JFLA 2HA2A 1HDOA 3F5DA 4PVCA 4MYRA 1J09A 3F7MA 4RL6A 2QM0A 1UBCA 2JLUA 5DYGA 1HQCA 2QTNA 4JDPA 1QRTA 3C7CB 3EVGA 4D99A 2ORVA 1PSZA 1ZD4A 1TMOA 2C4VA 4QNMA 3H8WA 3W8RA 4WBSA 5H68A 1QGUB 1BU5A 1DCFA 1XAHA 3FPLA 4UBOA 4ZAZA 4GPZA 4BBJA 1MW9X 2JKYA 3D0QA 4RV9A 2NYUA 3F8TA 2ECKA 2J9FB 4JUDX 3WWPA 1L5QA 1RVDA 4QICA 3RS5A 5B2EA 5DMHA 4HGYA 1GGNA 1Y4AE 4BV2A 5HJEA 1TQ6A 4KXNA 1YRLA 5KYNA 3QLUC 2PVPA 3GMIA 3KDPA 1YL5A 2H2IA 4G0PA 4WIAA 4RAOA 3TDKA 3EN0A 4NJEB 4DCJA 4EY5A 4GI3A 2QRQA 5AKJA 1OHHD 2FH5B 4TRNA 2CK3D 1FYWA 2IDZA 3LUKA 4J03A 4V0ME 1Y7TA 2NZJA 3HY3A 5KYYB 3NH9A 4D9IA 3INGA 1HOTA 4G89A 1G66A 4HDSB 3TUJC 1C30B 5CAEB 4KO1S 4HH3C 3FAZA 2ZWIA 4M0CA 2DKFA 2XQIA 2IHNA 4MQ5A 3DYVA 3P4UA 3VPCA 2ZIUB 1CB0A 1U0EA 1P4GA 1TECE 2OAEA 4IJWA 3STVA 4B0PA 4D0SA 4YHHB 3AVQA 2XTNA 4HFNA 1ZKDA 1XXLA 5ELLA 2HGZA 1VHQA 3PXEA 1NLUA 4KGVA 2ACWA 4K28A 1OBCA 5DIZA 2PXAA 4BJ5A 2QAIA 3LU1A 2VRWA 4N01A 3DR3A 3E61A 5LBIA 1G8JA 4LZAA 2PGLA 1MB0A 4YLYA 5JFTA 1V3VA 1B2LA 2FSIA 2QZJA 2YXBA 4U7FA 1WUJS 2E37A 5F9HA 2ZBRA 1JH9A 3N8HA 2QW0X 5E7IA 3RLFA 5CB4A 3OJ0A 3QKSB 2XQKA 3QXSA 4LDJA 4B5LA 3H0CA 2PG3A 4XFJA 3WNQA 3GZJA 1T91A 3KEMA 1B73A 4K9RA 4UE2A 4WKGA 5AK5A 5JRZA 4U1RA 4I8DA 3MINB 1WOYA 1ZOOA 1FJXA 1Y1PA 1OI2A 2R2GA 3RVLA 4AG6A 2RK3A 4YALA 3K8YA 2AUTA 2ICAA 1GSAA 3KJXA 5EXXA 1D07A 4AECA 4CQLA 2CSXA 2GYUA 3HUUA 1I1HA 1T9ZA 4OBXA 1P0FA 1RBQA 4KXXA 4ZEMA 1CQWA 1NBME 4J2HA 1R9NA 2I4IA 1Y48E 3C85A 2GARA 4DF3A 2PEZA 3F5QA 3BH6A 1Z9BA 5BY2A 3S1AA 5C5DA 4S1VA 5IAJA 2V74B 4EECA 4I5DA 1ESCA 1NP6A 1G6KA 2O48X 1XJQA 2PSFA 3IJEB 4MR7A 5CMLA 1ZM4A 3A04A 4JSYA 1KAMA 3DD1A 2G82A 1T2VA 2EZ8A 2A2ZA 821PA 3MN1A 4EENA 2P9TA 4CHTA 4R7GA 4Q4JB 1ZGJA 2R97A 2VYFA 3CF2A 2HV9A 2J59A 4WOBA 5EHQA 1ENZA 2JGIA 5BQPA 1RI1A 3TQQA 5JPDA 2PAFA 4IDGA 4RC9A 1U2GC 4KE7A 4INOA 2GCOA 4YS6A 4JD5A 5EZYB 3OQJA 4JL8A 3K9WA 3WRXA 1J2EA 1N2EA 3QA3E 5BSWA 2Q4BA 1JEOA 1GA6A 3C16C 2P9BA 4IDHA 3RVBA 1K92A 3A10A 4BLTA 4B44A 4YROA 3B1YA 2XDYA 1H22A 1M3SA 4ZQBA 3HNRA 5CA1B 4LF6B 2XCUA 2GBGA 3H5VA 1PL7A 2CDAA 4KIUA 3WYFA 2I6GA 3PRYA 2QOEA 2F1KA 2XNDD 3SLKA 3ISTA 5IKMA 1UCFA 4HDNB 3BD7A 2ATVA 4OL9A 4I9HA 2ZYVX 3L8FA 3DC2A 4AKSA 3PEFA 4YJ2F 4RMHA 4CNQA 5F77A 3EZFA 4IVRA 5JLJA 4QTTB 4KPUB 1YFKA 3IIIA 1UBGA 4XPZA 4OI0A 3D1JA 4RK5A 3M5DA 3RUFA 2CFRA 1GPDG 4F2DA 1ACMA 3ED5A 1T0HB 2R1VA 2PT9A 3LCMA 4DLNA 3MRSA 4GYJA 2QSJA 2OSVA 2Z5GA 4PFQA 3E0QA 2Q6KA 4OHMA 3PNVA 1DAIA 3V7UA 3AKCA 3PLRA 1FTYA 1F2DA 1U3WA 2AYXA 5HF8A 4TKVB 5HJ5A 2FPGB 4V2IA 3QIVA 4FQ7A 5K4HA 1WXWA 1BA3A 2B4TO 1GCUA 2PMEA 1L5HA 2WJZB 3G59A 1Z82A 2D1RA 4G5GA 4JB8A 4CLOB 5LYJB 3WK8A 2VH2A 5FR1A 1QZZA 2G5GX 5KHAA 1X7DA 4ARIA 2J3EA 1LDMA 4H15A 1MO6A 2JF0A 4XGIA 4BVEA 2GZAA 3QTBA 4NX2A 1XK6A 3VR6D 3JATB 4LOIA 4AG5A 5EKXA 1KK2A 2B5VA 2WTMA 3NORA 2A84A 4I6GA 5KINB 3IQIX 4KQJA 1X1DA 3AVYA 2EBFX 1G63A 5HBGA 3VPDA 4YP0A 3R3HA 4F9FA 4B8WA 4FNGA 2PBLA 1OLXA 1P5JA 2C2GA 2O3JA 1N1MA 2GDZA 1NW6A 3BIXA 1NUSA 1IY9A 3H2YA 3I2IA 5DWDA 3V4VB 1NF9A 4H4CA 3P2IA 5BP7A 2VHYA 1RZ3A 4KGZA 2UZ3A 3HCFA 5EIBD 4NBKA 2IL1A 2PKRA 3AU8A 4INZA 4U7PB 1Q1GA 2WOOA 3C1AA 1QMPA 4FWBA 4DEXA 1N33B 3T15A 4JLJA 1JE1A 3S2SA 3R4VA 1DFIA 3GFRA 1T9GR 3G0HA 3GUYA 4YDQA 3WE7A 3GK3A 2POQX 3QOFA 4OOFA 1FUEA 3F2IA 2Q07A 5DHSA 2WAXA 2F8TA 5DTRA 5TC4A 1QVWA 1QV6A 4O25A 1CUDA 6ABPA 1Q0TA 5CFMA 2NQ8A 3REFA 4WZ6A 4IGKA 4NP6A 3W2EA 5HGXA 4HCJA 4Q4AA 4UUBA 2PWYA 2JJYA 1BRMA 4L0CA 3EVEA 1FDSA 3ZK9A 3NEJA 5B58T 5BR4A 1QGUA 4EJFA 2P5SA 5CA1F 1A9SA 2J9FA 3G88A 4F1WA 1ZKMA 2IUFA 4OX9Y 4YBRA 3ELYA 1BSVA 1QYXA 4K9LA 3IJRA 4MRRA 4LJ5A 1IK4A 1YE5A 5BN3B 3IQZA 3P8ZA 2PUJA 4BRSA 1VZ3A 4MA0A 4CMAA 3NAQA 1CXZA 2O19A 4N6NA 5H16A 1FTNA 1YR3A 3I34X 3OEWA 3PNPA 4DS3A 2Y6UA 5JRJA 1FFBA 4HDSA 1UXKA 4KR3A 5CAEA 1CEQA 4YLEA 2C29D 1UFRA 4ETMA 1E79D 4BPBA 3LT1A 1RHUA 3UUFA 2A0WA 2Y1GA 1Y6FA 1S8FA 1AGRA 4ML3A 2HYIC 4KJZA 3QX8A 4BNUA 1FVXA 4Y9RA 4YO8A 3G0DA 1VRCA 4O4LB 1N5OX 4YDHB 1FMJA 5DYWA 5M7EA 1TJNA 1ODCA 1U0SY 2QR3A 3FNFA 1VBFA 1VJTA 1ZHHA 2WYUA 3BRCA 4JP8A 1ZSNA 3DEFA 3EXHC 4L8GA 3D0KA 1PV1A 2XWQA 5ELXA 2P68A 1J06A 4ZYZA 4OQEA 5JS2A 3GJTA 1FW6A 1W96A 1ZEMA 4FR0A 1OF1A 4JBIA 4RS4A 4RPCA 1EUZA 2WVJA 3L0IB 5CW2A 3GOQA 1J1ZA 3PDHA 1KTVA 4TTQA 3QU2A 3S99A 4IDEA 3QKSA 1AZWA 1Q15A 4IQ8A 3M6UA 5F3RA 5SYMA 3TOXA 5I6DA 4DBZA 2HQ1A 3QQ5A 2I9KA 4QOJA 5C8YF 4E5SA 4F85A 4Q3AA 5B6PA 4I4LA 1L7VC 1UBRS 1VDMA 2IF0A 2P2SA 4O1MA 4YT5A 4KHPB 3LCRA 1B93A 2TMKA 4LBZA 2B2XA 1T2UA 2ZIXB 1PLLA 4RD1A 4QUIA 2QVCA 2PD6A 4F0JA 2P9JA 2RAUA 1N3LA 1E62A 1WKVA 4LWQA 2P5UA 4G5QA 4KAJA 5KWVA 1SIBE 3ZJ5A 2F3UA 1QHYA 2V1UA 1PSWA 3K5WA 2AEJA 1XUOA 3X2EA 4EAAA 1ZJWA 2W8BB 2XBMA 4ICIA 4FC7A 2CBGA 3SYNA 2FR0A 2IYZA 4MGIR 3QNWA 4N7JA 4MW0A 3WYCA 3LP6A 2XMSA 3BJZA 1T8TA 3PK0A 2CJYA 5FPKA 3LFTA 2UXBB 1FTWA 4YRNA 5EHIA 1GG2A 4GUAA 4P6VF 4YRKA 3OTHA 5CDGA 5IBRA 1FQKA 1LJ8A 4EGCB 2VFAA 3EUAA 4FGUA 1NXVA 4Q7LA 1RU3A 1LJLA 4E32A 2IY8A 1O08A 1Z5NA 3FJYA 3PD7A 3AF0A 4J2OA 5TQVA 4H6XA 4JLDA 3SS7X 1T0PA 2GCIA 2YJGA 1BGVA 3DDSA 4RXTA 3OE7D 4Q5IA 3U60B 1BE8A 2GETA 2CHVA 5J5AA 2XUGA 4QPCA 5EZYA 5KEIA 3HUFA 2IYTA 2V6GA 1PKXA 1YAHA 4IDQA 4BBPA 2HC9A 1ZUWA 3KB8A 4JDUA 1MEJA 2QUJA 2JGDA 1GU7A 2QTVB 4Q4CA 2WYOA 4H0NA 3BMCA 5CA1A 2PRYA 4IRMA 5AKHA 4BATA 3IE1A 5K3FA 2DFPA 1K2VN 1A9ZA 2ZIFA 3I8OA 4O4IF 2WICA 2NLOA 2W5UA 3D8UA 3DDNA 3PQEA 4RKQA 1KGDA 3DAHA 1R1DA 1GPYA 3K09A 4O08A 5LZ5A 1LFDB 3ZE1B 3K0AA 3C5WP 1PZMA 1CS0A 2D2IA 3ADOA 3PQFA 5IU6A 1YIAA 4Y6OA 5FPHA 4TTVA 1JR3E 2Z2IA 4IGIA 5TF4A 4ALLA 1PJ3A 2B8EA 2Q50A 2I4NA 2K87A 4PG4A 1OWLA 2WTBA 5AMXA 3UV7A 5HWSA 2KWIA 4DLYA 2P5TB 3K8ZA 2R7AA 2CNOA 1QHSA 3QSGA 2TSYB 2IHTA 5H70A 1RI3A 1NQWA 1IXSB 2PSEA 3G23A 2B1IA 4NE2A 2FPGA 5ITWA 3ROZA 3AR2A 5HMLA 1T8RA 2ATEA 4NNOA 3RAJA 4EO9A 3T5DA 3MJ4A 2I29A 4TMKA 1KQFA 3E15A 2O5EA 1BHO1 5LYJA 3UT5A 4CLOA 4W82A 3FYUC 3MMZA 2NZ2A 2Q8QA 4ZODA 2AFRA 3TTYA 2HIHA 2CKDA 2QZZA 3PUKA 1NVVQ 4PS1A 4AUMA 5GV7A 4GIBA 3SY8A 4B82A 2FRDA 4LJ7A 4ALJA 3JATA 3E48A 1ZUNA 3TNFA 3VHXB 5FF9A 4N41A 4WNIA 4XI9A 6YASA 1ZGAA 2C5EA 3PQ6A 3WLRA 4HPJB 1OREA 2ZRQA 4P7GA 3L1VA 2WMDA 1FUYB 1NI3A 2H52A 2NV6A 4Q6WA 4QDUA 2FPPA 2ATCA 2BKLA 1BN7A 1YACA 2O4CA 2W2VA 3A0UA 1LV7A 2V4UA 2R79A 2X6QA 3OOYA 1T4CB 3GJ6A 3OQ6A 4QGHA 2X8WA 4JYPA 2ZULA 4YRCA 1EQAA 2PV7A 3GLIB 4IVNA 1I0ZA 1I7NA 3FNEA 3MB8A 1QYRA 3ES9A 1LZLA 4KYVA 5CW1A 1SBIA 1NYRA 2WINI 4LW8A 1HDIA 3KDSE 3TRHA 4MW5A 2QN2A 3FTFA 3L04A 3IKLA 3DG9A 1R0YA 1YB7A 4KQIA 4FZ5A 2FMKA 3LTNC 2VBGA 4I1OA 4B4DA 3KZMA 3KUKA 4X3OA 3MGAA 2IZOA 3OLXA 3P96A 1NC3A 3N58A 4W7HA 4F8EA 4MSUA 3U26A 1P9LA 1N2SA 1OTYA 1Q0SA 4K9SA 1E2HA 1E3WB 1EUCA 4FEYA 4I8IA 5HQTA 1GTL1 1W36C 2BGTA 1Z5PA 4P4LA 1DRUA 3KC2A 1QANA 4C0HA 4LSZA 1DGQA 1EG7A 4YCNA 1NI5A 2R4QA 4XDGA 2J09A 1QFSA 1IXKA 2VK1A 3OHSX 3TVTA 1LEHA 1UEXC 4AKGA 3FCXA 4CFSA 2I80A 2D2FA 3TIIA 4YMWA 1TKCA 1F14A 2IODA 3DCIA 5EKSA 1VPWA 2FDCA 5BN3A 1FLDA 1ND6A 2D0IA 3F3KA 5ALNA 4U7DA 2BZSA 4YP7A 2HF8A 5ARBA 4BCDA 2GZHA 3CX8A 1GA1A 1NVAA 1P1JA 4FYPA 3D6MA 4YRTA 1UXIA 5FUBA 4EB6A 3SK0A 4KDRA 1U31A 1RLJA 3SEAA 2DE0X 1V11B 4PQFA 1E1CB 2HHJA 4RA6B 2GN1A 4PIVA 3SZRA 3INRA 3WGZA 5K4GA 2OVFA 2V5AA 3C43A 4IXTA 4PSUA 3HJBA 4RIEA 2O14A 1FTSA 4O4LA 2NP7A 2GO1A 3MERA 4N47A 3VR2A 4ER6A 3RVJA 8OHMA 2XVXA 5DEIA 3U7GA 5I5GA 5DXAA 3MWJA 1KZHA 5EQDA 3UJBA 2DFLA 3U7QB 1E0SA 4HMOA 5ALIA 3PXXA 1KPHA 4L4YA 1CSEE 2CV0A 5FWXB 5KREA 4B40A 3DCYA 1DRVA 4NONA 5FL3A 1E63A 2CHQA 3AUFA 3OJCA 1J25A 1R0LA 2DSTA 3NKFA 2YIMA 2BZGA 2GPAA 1RYEA 2VN8A 4V39A 2QN6A 2PANA 5F5LA 2HUPA 2AXNA 2IZ7A 2J9RA 2EQAA 3CUYA 3EMDA 1V45E 3NJ8A 1EDEA 2GZMA 1N0UA 3DNPA 1FFXA 2WU4A 1T4MA 4XOUA 4WKBA 2R8PA 1NQ5A 2C0PA 3KP1A 4JJZA 4DOMA 2YOFA 3K2QA 2PZKA 1VKRA 5FQNA 3Q72A 3HRKA 1KS2A 1FXWA 1BEZA 4ZEOA 3QEKA 3H4TA 2QYTA 1TZJA 4D3YA 1HT1E 1JB9A 1Q1BA 3V3KA 3KT3A 3MYYA 1OC4A 3NC4A 4M38A 4P3PA 4Q9DA 4QFCA 4E4TA 1PEYA 2W8BA 4HNRA 4TZTA 2HUNA 4HX2A 3OECA 4I6JA 1N2JA 2P91A 1BKYA 5IVKA 3F46A 2REXB 2P4HX 3M1LA 1LLDA 2ZAMA 2EKPA 2JBAB 2PH7A 3IJ5A 3IAEA 3LXUX 4KR2A 5H3LA 3NR2A 8ADHA 5F98A 3TSWA 1YA4A 1C1YA 1JIIA 1ZAKA 4OEHA 4D26A 3BSSA 2VOEA 2YXLA 3ZI7A 4HADA 2Z98A 5KOHA 1ZM2A 2DF8A 3RVSA 1ZNYA 1XTJA 3R9IA 1IUNA 2IUTA 1W1UA 1NP7A 3H3JA 3BKWA 3E9EA 4I4TB 4ZDIA 2Z4RA 3GAFA 1RLTA 4UM5A 4OM7A 5FPSA 2QZPA 3VJMA 4NABA 1XD9A 4E08A 5DVZA 5D00A 3ZWAA 1VM6A 1N7HA 1DSSG 3P9IA 3F6SA 3R5TA 3KQHA 4GZ3A 1V6CA 2AC2A 4A15A 3MT8A 3DT9A 3FETA 3AZPA 1QYVA 2CW5A 2NPIA 2X7HA 2J0QA 4OLAA 3OPYI 2GEUA 2QP4A 3HKCB 1VLJA 3RW9A 3Q6MA 4OHBA 1JEQB 1M5UA 2NXCA 4QZVA 2M1XA 2ZI4A 3WHKA 4UXHA 4L4XA 3V1TC 1AQJA 1GNQA 1VKJA 4RNDB 3O4RA 2ZSDA 4MW1A 1KE1A 4KOEC 3QEBZ 2GBPA 3EUFA 3QKWA 4LVNA 1T1IA 1YULA 4IVPA 2OZLA 3O84A 2JH3A 1RWOA 2H08A 1NY5A 5AM4A 2R8OA 3AY6A 2VP9A 3IQGX 4C08A 2VDMB 1G0NA 1KMMA 1GTRA 5IT0A 4XH9B 1KJ9A 4H3HB 4XD7A 1IJKA 3Q5EA 4CQMB 4P5DA 1FBTA 4TTIA 4HBZA 3B89A 4M0DA 3TFQA 3G2OA 2I4TA 2CVPA 4RVOA 5IK2A 1LCIA 3SZLA 2BFOA 2FP3A 2OYCA 1KI4A 4ROSA 2PY6A 4BV8A 1DKOA 3O2QB 4YT4A 2P7HA 3G17A 4GBMA 4RZ3A 2WF9A 4Q9NA 2ZJ4A 4Y2QA 5E1OA 1W29A 4LTDA 1Z4QA 4P8RA 4YECA 4C6TB 1PYDA 5K3SA 1PKEA 1N32B 1BCRA 2WTXA 5B12A 1E2LA 4ZI7A 4Y6GB 2BP7A 5DRYA 5TJHA 2VWQA 2NT4A 2AWOA 1C8KA 4ND5A 5I9MA 1JRLA 1T4CA 1ZSVA 4HWGA 2PCJA 3OU6A 3WL4A 2YR0A 3CEAA 2LCIA 4NZ9A 3CS3A 1IBCA 1YZUA 3JVIA 2XLBA 2C9MA 3RQIA 4EA7A 1AQNA 2F43B 3N8IA 5LBTA 4HS9A 1CERA 2PX6A 4LRWA 4HWOA 3Q8LA 2CL5A 3K5IA 4A16A 3P9ZA 3G8AA 3H05A 4KQCA 3ZWPA 3KCQA 4EKIA 4DDUA 1E1YA 2F4NA 1T15A 1U2EA 3E6AA 2LE0A 2PFSA 1O9GA 3UAOA 4ZHQA 2BDEA 3C70A 4K1XA 1PT6A 1T5DX 4E30A 1X7XB 4JU9A 3IPLA 2E4VA 2DRIA 3WOVA 3D7MA 1CVLA 2IDMA 1WW2A 3C45A 3E3AA 4Y67A 1B8PA 2FJUA 3CF4G 1JG4A 4KIFA 5L3RA 4L4UA 1WXQA 1Z5OA 4LHVA 4CCWA 4HX5A 1UJ2A 3SDBA 4JASB 3VNVA 1BNCA 1SBHA 3SM3A 4Z4IA 3OOEA 3B52X 2X4DA 3R3XA 3PCTA 1JFFB 1WQ1R 4GLBA 1ZO8A 1OZHA 1Y6QA 4M8KA 3OZVA 3ZE0B 2NZYA 4CMJA 1OPRA 4EUFA 5TMDA 3WWCA 2C9YA 2JFQA 1C7QA 1L8XA 1SCQA 2QS9A 2VHCA 2XE8A 3DHYA 2D59A 3P19A 4GOND 4R54A 2YQ5A 1ZH2A 4M0FA 5COAA 3SYTA 4BVKA 5K8IA 4F1JA 2IU3A 1E1CA 1EJ2A 1Q0PA 2BIFA 5DI3B 5FI0B 3G8DA 1TJ3A 2JAUA 5CTJA 4BVGA 2LZ0A 2MINA 2YWCA 3IQFA 4KG7A 4URWR 3RTGA 2FXVA 5KC9A 1JDPA 1FYDA 3ZV5A 1J9GA 4BKRA 3FXAA 1ENOA 3GFTA 2OBLA 1MO4A 1TM7E 3FE2A 5B37A 4UQLA 2NTVA 3GIWA 5C2JB 4B17A 1IHDA 1PT5A 3QKRA 3GZTB 2R68A 3Q3VA 1U99A 2GCEA 3CLVA 1JIXA 3IMCA 1X1EA 4FINA 1RRMA 5HMMA 1HSOA 4BGVA 1MOSA 1DDOA 2VDRB 3WBJA 1JEYA 1BWQA 1F1BA 1N8TA 5LCXA 1U1IA 5GJCA 1AQIA 4EYSA 3CNNA 3ROGA 4M0KA 2Q41A 4QDOA 4BECA 1PEDA 4R40A 3R23A 2PLRA 1A9RA 4AMBA 2IA5A 5AUPB 3B2QA 2FRVA 3PR1A 3HCPA 3UWSA 1A8QA 3R77A 1GKLA 4HDKB 3Q5DA 3AYXB 3B6ZA 2I1VB 4PXAA 2OVBA 2XOKA 1XKXA 4MUKA 4LF8B 1MNQA 3W7AA 2Z1MA 4C0WA 1OT3A 2LDBA 4KAAA 4B47A 3FA2A 3ER6A 3W8EA 3NEYA 3Q8KA 2G88A 3VKGA 3SS8A 2EEZA 1G16A 1MC8A 4MYSA 2D5LA 5GZ6A 1B6GA 3QEMB 2G8NA 1Y1LA 3K1AB 1KDZA 4AF8A 4BE7B 1BO6A 2VYQA 3DDWA 3GXOA 4JYBA 4QBGB 1EFTA 4Y6LA 2JLYA 4EP1A 1SVKA 4JIGA 5FI5A 4ENSA 5AM2A 2EX1A 3NWEA 3UJAA 3KFLA 4E14A 5K45A 3MJSA 4ABTA 5FBZA 2CXHA 5IHPA 5K03A 5JXIA 4BMNA 2EKBA 3KPJA 4M76B 1EP3B 1XTSA 4IW3B 5DT9A 3T7EA 3LLUA 4WXYB 3R3SA 4D82A 4KZKA 1L1EA 1I9GA 2PT7A 3SJAA 4BNGA 2VPQA 2ZR0A 3EFOA 3PWKA 3QENA 2ZYSA 1MB3A 3QX7A 4UMFA 3W2IA 1NU6A 1XMXA 2FRXA 5A4KA 4WZBA 1R8JA 4BBAA 4BO3A 3VR4D 1H9CA 2J9YB 5F1KA 1UZLA 4KRYA 3ZTWA 1ZM7A 2SBTA 7MDHA 2GD6A 4IXNA 2GQ0A 2I7CA 2CJWB 2PA0A 4ZYWA 4AKIA 3HRIA 1CWUA 4GW3A 4RZUA 4IL5A 4WAUA 1LSJA 5B1SA 1M1YE 4KXLA 5I7AA 4C5BA 1JJIA 5IT4A 2I3ZA 1A7KA 3OPXA 2QR2A 5AKXA 1OLUB 4IG9A 3I1JA 4BTVA 2F7SA 4LV5B