1ESZA

Structure of the periplasmic ferric siderophore binding protein fhud complexed with coprogen
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
260
structure length
260
Chain Sequence
IDPNRIVALEWLPVELLLALGIVPYGVADTINYRLWVSEPPLPDSVIDVGLRTEPNLELLTEMKPSFMVWSAGYGPSPEMLARIAPGRGFNFSDGKQPLAMARKSLTEMADLLNLQSAAETHLAQYEDFIRSMKPRFVKRGARPLLLTTLIDPRHMLVFGPNSLFQEILDEYGIPNAWQGETNFWGSTAVSIDRLAAYKDVDVLCFDHDNSKDMDALMATPLWQAMPFVRAGRFQRVPAVWFYGATLSAMHFVRVLDNAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords FERRICHROME-BINDING PERIPLASMIC PROTEIN
publication title X-ray crystallographic structures of the Escherichia coli periplasmic protein FhuD bound to hydroxamate-type siderophores and the antibiotic albomycin.
pubmed doi rcsb
source organism Escherichia coli
total genus 83
structure length 260
sequence length 260
ec nomenclature
pdb deposition date 2000-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 1eszA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 1eszA01
2M6LA 5JG7A 5KOHA 2AFHB 2QI9F 2OV3A 2AFIA 2PRSA 2YNMC 5AFSA 2M6KA 1L5HB 5B58T 5GGYA 5JJ5A 5I4KA 5BVHB 1ESZA 3MINB 3BE6A 2YNMD 4WN9A 4B8YA 3AEKB 3HH8A 4WESB 3AERB 2XDQB 4TKUB 4DBLE 3MFQA 3MD9A 3AEUA 5M2QA 1QH1B 1XVLA 3G9QA 4PAGA 2PHZA 1KAHA 2OGWA 2XV1A 1N2ZA 3PSAA 4INOA 1QGUA 1H1LA 3PDIB 3HXPA 4OVKA 2OV1A 4OXRA 1FP4B 2RG7A 4UTPA 3AETB 2MINB 4K3VA 1K2VN 4LJSA 1MIOB 3TEFA 2O1EA 4WNAA 1G20A 4IRMA 1KAEA 3K1AB 1K7SN 4PM4A 5BVGB 4XPIB 5M34A 4UDNA 4ND8B 3NU1A 2AFHA 3EIXA 2XQVA 4TKVB 4MLZA 4HMQA 4NNOA 4WZBB 1L5HA 5KHLB 1M1YB 3MWGA 5BVHA 5KOJB 3MINA 4MX8A 1KARA 3AESB 1M34B 3BE5A 1G21B 4UDOA 5CR9A 1QH8B 3AEKA 4WESA 3U7QB 1M1NA 3AERA 1N2CB 3PSHA 2XDQA 4FI3F 4TKUA 4WZAB 2PS9A 4H59A 1QH1A 1K75A 2Q8QA 5CX1B 3PDIA 2PS0A 1FP4A 3AETA 1PSZA 2MINA 1MIOA 3LI2A 5FLYA 1TOAA 3K1AA 3R5TA 5BVGA 4XPIA 3CX3A 4FILA 3AEQB 1QGUB 4ND8A 4HMPA 2XH8A 5JPDA 2WHYA 5GGXA 2WI8A 2PS3A 3EIWA 4TKVA 3ZK7A 5HX7A 4H0FA 4WZBA 1PQ4A 2XY4A 4FNAA 5KOHB 5KOJA 3LHSA 4HMOA 2AFIB 3AESA 1N4AA 1M34A 3ZTTA 1G21A 3R5SA 4UTOA 1QH8A 2ETVA 2XUZA 3U7QA 4FKMA 1N2CA 3UJPA 4BBPA 4WZAA 3GI1A 1K0FA 3HJTA 4WN9B 3TNYA 4M7OA 5CX1A 3ZK9A 3TLKA 4HN9A 3AEUB 4MO9A 4N01A 4NNPA 4G07A 1M1NB 5HDQA 3ZKAA 2R7AA 1H1LB 2OSVA 4GICA 2R79A 5M29A 2X4LA 1N4DA 5M3BA 1EFDN 4CL2A 4G09A 4OXQA 3AEQA 4LS3A 3MWFA 5JOQA 2Q8PA 4INPA 1M1YA 4MDYA 1G20B 4WNAB 3ZK8A
chains in the Genus database with same CATH superfamily
3ASUA 4D4LA 4JP5A 1KI3A 4G0XA 2W37A 4J1QA 4ESVA 3ZWVA 3IVGA 3GH1A 5AFSA 1FSFA 4WERA 5DGXA 1WQ4A 3OAAA 2OLKA 4G5QA 4P5DA 1OHHA 4JV5B 1KYQA 1YE3A 2EBFX 1T2VA 1BE6A 2B6NA 2ZBPA 4UBOA 5I7AA 2D8AA 2FSFA 1CFJA 1UJBA 1X38A 2J6BA 4UEOA 3AW8A 1PFWA 3K2BA 2GK6A 2XCOA 2BGKA 2NUBA 5AP9A 1MQ8B 3DLPX 2VWQA 3H2IA 1DXYA 2LP4Y 3RIYA 1QTNA 1RP1A 3W1EA 2G8NA 4QOGA 4PAGA 1CETA 3K9HA 1DMSA 2DLDA 3QBEA 4J9UE 3VNUA 1LPMA 2WD7A 4F93B 1WB6A 3C8HA 2RGNA 4MLCA 3GJ0A 1CUVA 1EZ1A 1ZXXA 2QJRA 3G9UA 1QZTA 4LW8A 4BLRA 2HA4A 4IV8A 3H2HA 3KDAA 4KFTA 1IH8A 2J0UA 3IHLA 4UBMA 4OHZA 1RAIA 3IULA 1DDGA 4EUHA 1QX3A 1K9VF 1G7RA 2DF8A 4WNAA 5LA6A 4IRMA 5FO0A 3T41A 3WICA 3ZHZA 2AVDA 4JBWA 1VA4A 3PYLA 4CN8A 1E2MA 2BJVA 2BR5A 4EAAA 5FL7A 2FZ4A 2HAEA 2AL7A 2H7XA 2L69A 4JASB 4MWCA 4R3NA 2XMSA 1I8TA 1V8BA 4OV6B 3UB4A 1FW8A 4AG5A 4DLUA 3CBQA 1E79D 3FVVA 2OYSA 2C97A 5E6RB 2YR0A 2ENWA 3KPUA 1R10A 3ZX5A 5EYPA 5EIOA 3DEIA 1DEOA 4W5OA 4TSKA 5ER6A 3RUIA 1YMVA 4I50F 1E6WA 2DMRA 3NIFB 1YDEA 2UZ0A 3QXHA 4M7RA 5TQ2B 3P52A 3HLTA 1EVJA 4GWLA 3TLJA 4PFKA 3WLHA 4CMEA 3E5MA 2B30A 1KQGA 1YBFA 5H7XA 3TN7A 1JHQA 4A36A 1OQAA 3HEAA 1FDSA 1CB0A 3SZMA 3ZC3A 1PSZA 3R09A 1M76A 2BN4A 2PZJA 2VDUE 3N86A 3RYCA 1AZWA 4AO6A 4GNRA 3ZWYA 2HX1A 5E3HA 4V1CI 4NCAA 1QYDA 2OO3A 2DX7A 3NG1A 4MUEA 4BWFB 3LD9A 3AVVA 4UATA 1RD4A 3CKLA 1UH5A 4JY7A 1Z39A 5AHRA 2PS3A 4ZC8A 3WXMA 3CS3A 2EC5A 1RTKA 3AWDA 1JUDA 1VP9A 4A7PA 1JU9A 2Q9AA 4D4JA 2DT5A 4JFAA 4LVOA 5TQ0B 1EQUA 3NEYA 3RVPA 1U8FO 2VPTA 5TR9A 2H2AA 3U4CA 4O2AA 3LUCA 2QTBA 4BVJA 3L82B 5FRDA 4RSRA 3VPGA 3MN1A 3D1LA 4KK3A 5B53A 1FMTA 2XB2A 5JS1A 1X94A 1X8JA 4IF6A 1WCV1 2YVKA 2KM1A 3KXIA 4Q1CA 1KFKB 4I8XA 4XJTA 2FUNB 1ZKDA 3H1EA 3HTXA 2CJWA 5IWAB 3QPWA 4MUGA 1N2JA 3OQPA 4A1OA 1BG6A 4PZZA 4NCXA 2A1TR 4NEQA 4CEHB 1Q0RA 1SCUB 2D8MA 5CXSA 1XCJA 4EG7A 4YA6A 4WBSA 2QPLA 3IB3A 2WU4A 5JG7A 1TTQB 2VJNA 1A4IA 1BX3A 1PK9A 221PA 3II6X 4GR9A 1LBHA 3K8YA 4C5CA 1RM0A 3NJ8A 4JN6B 2A92A 3K0FA 1O5IA 3P9CA 4O4LA 1O9GA 4P3KA 4PW0A 5MHTA 5CAEB 1FLAA 2DWOA 3N6XA 3SC2A 3IBSA 1J9EA 4WVFA 3FNQA 1T1JA 3GRFA 5IJ9B 1KEWA 2ZK7A 1Q7BA 4QFBA 1KPHA 2GWRA 1FLVA 1J21A 4IDNA 1L7VC 3IIJA 2X0EA 4HXGA 4MPDA 1XTPA 3AHJA 2XDQB 3CWQA 3TXYA 5ITZB 1U5CA 1GL6A 3IT0A 3E70C 1GD1O 2FJPA 3OZCA 3G9QA 3HXOA 3IAS1 1T6YA 1KZHA 2X9QA 2PFSA 2XQKA 4X93A 2FEWB 1H94A 5LQJA 1U9YA 3SJZA 4BB5A 1KORA 2XA9A 2XQJA 2PH7A 3Q7SA 4L2IA 2WFAA 1EA5A 5LIRA 1Y48E 3AT1A 2CDBA 3NDRA 2ZB2A 5JASA 2A2ZA 3KJIA 4XUGB 3CVXA 4E7PA 2H16A 3WGIA 3LYUA 3GLIA 1LBIA 3FKQA 4H1WA 1KI6B 1XA0A 5CDTA 2FR8C 3RQIA 2ZIAA 3EIOA 3GX1A 5ALTA 4KR2A 2VDNB 5DNEA 1SVOA 1NKTA 2XSZD 4XCXA 3JQDA 4A0RA 2IIVA 3IT3A 1OU0A 2UUPA 1BU8A 2Z57A 5EMHA 3AV0B 1FFBA 1SHUX 1SAYA 4F72A 2YICA 1SWWA 4GWKA 1N36B 3UMJA 4KRFA 2GBGA 4FFLA 4W7IA 1D1PA 2WYUA 1X80B 1RYBA 3FR7A 3UHJA 5A4DA 1UAAA 1VC2A 5J43A 2A94A 2BFCB 1V43A 3EFOB 3ZPXA 3RJ9A 1T0BA 4GQAA 3T4XA 1LDEA 4DG5A 3R7SA 2DLCX 4DA9A 3BT7A 1DJMA 2ZIGA 2JCVA 2XE4A 3IP6A 2RK3A 3PP8A 4C29A 3HO8A 1UC9A 3AY6A 5KVQA 3FPFA 1JKJA 2CFRA 3KYJB 4NAVA 5EWMA 3UQZA 3HCAA 2O23A 4L76A 1R27A 4LOKA 1KKMA 3NH9A 3L7OA 4UAGA 2XXJA 4GRIA 721PA 4DV3B 1TA0A 3GDFA 2R5NA 3Q0TA 1CJSA 4NDZA 1SCDA 2C7VA 4G2TA 4DIMA 5CDSA 2PMCA 1K0UA 4OQQA 1YFZA 4PGMA 5AJHA 5FPHA 4B3BA 5KIAA 2AB0A 3M6UA 1A04A 4BO7A 4ZVUA 1FYEA 1E2IA 1HO3A 1LF5A 2XUOA 1TF7A 3EAQA 4O33A 3SS7X 1UKZA 5H8WA 4ESEA 1PTJA 5H16A 2XNDD 3U4QA 2QJTA 1JGTA 3DHYA 1Q14A 2V9PA 4F9FA 2R85A 3AEXA 2ZUUA 1IBCA 1YB6A 2OFPA 5EGNA 2BEVA 1KH2A 2HYDA 4I55A 4W9RA 3WLOA 2XZOA 1MA3A 4NBLA 2WIKA 1GSAA 6GPBA 1X39A 2Y4NA 1CR6A 1P72A 4AJ9A 5JH7A 1UPCA 3KEGA 5CX1A 1ZW1A 1XRSB 4MUIA 3UMSA 4K1XA 4YACA 3WV5A 4W4TA 1A77A 3C3AA 3HRKA 4WI1A 1V16A 4BPRA 1NDQA 1M7GA 3HUEA 1H1LB 1K6IA 2C3YA 2OSVA 2YJ3A 4S0XA 4KGZA 4XM2A 3AI1A 1P45A 2NN3C 5BMVB 1XZJA 4FBGA 5L6LB 1S96A 4G9EA 4TV8A 3DJFA 2OBNA 3V48A 5J47A 4YRPA 2YXDA 4I1UA 4R81A 1MRSA 1SKMA 3DOIA 1HE1C 3ED5A 4GR4A 4ITRC 2C7GA 3LQFA 1C1DA 1XVAA 4EYEA 5IH3A 5B1EA 4P0PB 4DN6A 2R1UA 1DQRA 4EVSA 4GI3A 4IJMA 1AB5A 2QVYX 2JFNA 1SD2A 2VK2A 3NV9A 4KLCA 4LY3A 3KOWA 2A0YA 5IYZF 2B1JA 3QWFA 2OQVA 3TQRA 1PZGA 4TVKA 5JJ5A 4Z3OA 4N39A 5BVHB 3QEBZ 3RSOA 1E0AA 1NASA 2ANBA 1W8DA 3HWSA 3QLUA 2FN8A 4R4JA 5IPFA 1N2CE 3UT0A 3RADC 4JIMA 9ATCA 1N57A 1OC2A 4R7ZA 1J20A 2WWGA 1NKVA 4XAQA 4DBLE 4ZCRA 2X42A 1XMOB 5ALXA 3QXJA 4EW1A 4LF7B 1T8SA 5IAGA 4FEGA 2WJ6A 1JEJA 2D2XA 4D8TA 2JKZA 1LV7A 3T1VA 3AETB 4ZCLA 1SUBA 2UZIR 1T8YA 4MR8B 4YJGA 1FNSA 3VU8A 1N3YA 4TMZA 1CUYA 3AYZB 3NHMA 2CLMB 1XPUA 3K1AB 2VAXA 3PT5A 4QASA 4QQFA 4G1FA 3GNTA 2H31A 3GZ4A 2DH5A 1SJ9A 3ZCVA 2Q5IA 3NR2A 4DREA 3EVGA 2NT3A 4FOLA 4G1CA 4L75A 4PZ0A 4HZUB 1LF0A 3N6VA 5BN5A 4CKZA 5HZMA 4PLFA 4KQKA 1C3XA 1LDMA 1VFPA 4RDHA 2D4AA 5DWVA 1K5HA 2L42A 2FMKA 2VBGA 3D8UA 5FBVB 4URFA 3P96A 1Y7LA 4LE1A 2XEXA 4FE4A 1WUJS 5ALZA 4ZO8A 1H9BA 2P7IA 4JC5A 1UFQA 2DXIA 3R9WA 3CIOA 1LTHR 2VAMA 1QGED 2W2PA 3K9FC 3FI0A 2Z8XA 4J1NA 2ZIWB 3D2CA 4TYMA 2FWJA 3LH5A 3TUIC 4Q39A 1FU7A 4IO0A 4D74A 1CVIA 1WWKA 4KE8A 3USZA 3AP3A 1R0ZA 5L45A 1UP4A 2I3ZA 2AN3A 2VS1A 2P2LA 5FUVA 1RJDA 3OCYA 4EA8A 1FEZA 1D5WA 1TIKA 1UMKA 3CVUA 1E7WA 3V55A 3ND9A 4YMHA 1DBQA 3WJAA 3SY8A 1NXOA 4C6HA 1PQ4A 4YNBA 5C31A 3OP4A 3AF5A 4QPJC 5EP4A 3GN2A 1JAZA 1M34A 4MMXB 1F48A 1WUKS 2INGX 2JH8A 1N8TA 3KQHA 4HDQB 1T9HA 5HXAA 4AJEA 2RJOA 2CW5A 5A9TA 3RS3A 2P5SA 2G4LA 2ID9A 1LY1A 3RVRA 1MVLA 3E7WA 3ZHTA 3UJ7A 3LPNA 1V41E 3ADBA 4QWWA 2V7XA 1C29B 3QMMA 3WQRA 5JSZA 2OZKA 3IQIX 4NZNA 5C18A 2QBYB 2BGMA 1Y4ZA 3CE6A 3IA7A 4WY2A 4KQWA 3VUEA 1QFSA 4MI9A 4V02A 4LC9A 2QTCA 2UYQA 2RGAA 2J8ZA 1UPAA 2BFNA 3BDIA 4CMCA 3WDSA 3GDWA 3HYCA 3TBHA 4P4UA 4ARCA 1G59A 5L7WA 5D3ZA 5KNDA 2WHEA 3IAHA 3I45A 1ST2A 3WGMA 1N5RA 4PAQA 3LZCA 5K51A 1XU9A 3LT5A 5D3KA 5AXCA 1PRYA 5M04A 1GGKA 1UXOA 1G8PA 1Z68A 2IYXA 4LJ7A 2WT4A 3IAAA 5K99A 4AWAA 1JHUA 1ODJA 5ENDA 1PAUA 4ROTA 1G9XA 3NBXX 1M6EX 5IM5A 4Y2PA 1P2VA 2FV8A 1A4RA 1HE5A 4WN3A 5CT8A 2NU8A 2F62A 2CNWA 2VYFA 2XVAA 5CRIA 1MX9A 3GARA 3EHDA 5AK4A 2QV7A 4UNRA 4XWTA 3RFXA 1Z6ZA 2D1SA 2GQ0A 3T7JA 4W1QA 3TD2A 1E9SA 4PHGA 2OK7A 3EVZA 1AHPA 4ANFA 4ALNA 3EVCA 1WB9A 2NQ2C 2TMYA 4JMLA 1W85B 2YYYA 3JQEA 4ZVMA 3PSAA 4MVJH 4LJ9A 1NVEA 4G4IA 4RANA 1Z5UA 2NT4A 3TAUA 3WKDA 3U9SA 4X24A 2E0IA 2VO1A 4KQXA 1KR2A 1T8UA 5BMVF 2J6IA 3QELB 3W6NA 2ZUFA 4ZVRA 1OVGA 1VOTA 2E1RA 1PS8A 5CT6A 3AHCA 3SF8A 3O4HA 2YXLA 2Y1XA 4UVGA 5AJUA 2WRZA 1Q91A 4DB4A 5L4LA 3CV3A 2HRZA 4GW3A 3A6ZA 3H65A 1BFUA 2JLRA 2VNJA 3WZMA 1O6GA 1P62B 3CLUD 3KWJA 4AS2A 3WYFA 1O77A 2WSMA 3AESB 4NAUA 1OI3A 2V54A 1BEUB 2QT1A 1C0IA 4YCBA 1SFRA 2C99A 5BOVA 3IIMA 1K92A 1ATZA 3KVVA 2IGTA 3PSHA 5AIAA 5U9CA 4GI7A 2K7ZA 1ACLA 1CY1A 1Q3HA 3MQFA 2Y2UA 3V33A 4BNFA 2PUDA 3I1IA 3NHZA 1ODSA 1TECE 5KYWA 1XRPA 1JIUA 3WGJA 1MO2A 2FOIA 1JPJA 3O84A 3OM1A 5AVSA 1YC5A 3SNKA 1JA1A 2QY9A 5PGMA 3OE7D 4LRSB 3P32A 1J09A 3TZHA 3LQRA 1YB7A 4JQSA 3UOWA 3AI7A 1QGZA 3BA6A 3NM5A 2DBRA 4Q12A 3F3MA 4TWAA 4CIVA 5ICSA 3U09A 2C5GA 1OXUA 3IBCA 3S2UA 2BE9A 1PV1A 3G8YA 1SC6A 3MRSA 4UM9B 1Y7IA 1THMA 1D8AA 2YIMA 3NDJA 1NZDA 1UR5A 3FLMA 2WWVD 5BUQA 5LP6A 1DAHA 4LISA 1MX3A 4JJ7A 1T3SA 1Y6ZA 4R7GA 1CZOA 3I23A 1KDYA 1U80A 3GUCA 4LWOA 1NJGA 2V1XA 4ZO6A 4K5QA 4I3FA 1L5VA 2AEMA 1V4BA 4QX6A 1JG6A 4DLXA 1DKNA 1SUEA 5C3UA 1NWCA 2P9JA 2BMEA 4ND1A 1UPXA 1AZLA 3GOHA 4L9AA 4NBSA 3V4ZA 3ZNOA 3LGSA 2A1UB 2JBAB 5LQSA 1NQOA 1F9EA 3TNYA 5KNBA 1OFVA 3FNEA 4HYEA 3KVOA 2FZWA 2W5UA 4ND6A 5JHGB 3EDCA 5HKLA 4PYLA 3R8XA 1Z33A 3CO0S 5EHXA 2LPMA 3MBIA 4RY0A 1MQSA 3UM9A 5ALVA 4LZPA 1ZMXA 1UFKA 2YMMA 4GI5A 2C8LA 1RJ9A 4N7MA 1A88A 4ZALA 1A2OA 2R7MA 3FY4A 5DSTA 5TPWB 1R9JA 1TD1A 4KIGA 1WZEA 2WUWE 1PNQA 2C9DA 4LXYA 1Z07A 4K6CA 1IVYA 3KR1A 5ECDA 1EG7A 1NBMA 4X97A 4QUGA 3ZV7A 4MWEA 1C80A 1N9GB 2H1CA 2JD2A 2QB5A 3D31A 1NTRA 1JHZA 3I01A 4P5EA 1Z18A 2V6BA 3FIUA 3W06A 2UVQA 2ZJ2A 2QJWA 3LPCA 2BCGY 4QJBA 4FINA 3DYVA 3LLCA 3PDHA 2V7UA 3JASA 1T2FA 1UC4B 3BE6A 1Z2DA 4NPAA 2XCTB 4TV9B 4M8IA 1PX2A 3KEOA 4TTVA 5EVCA 4ZU6X 1QFMA 4K0RA 5FUBA 1JDTA 2GLXA 3QVTA 4RV5A 1A9ZA 4IIVA 1ZN8A 1TJYA 4MI1A 2B92A 1AHIA 4HN2A 5AUPB 2NQTA 1CQJA 2C83A 3EGVA 4I4CA 3DT8A 4PQYA 4UNIA 1ULAA 3KFLA 1MO6A 4YV0A 3UAZA 3CNNA 4HNVA 4X3OA 1IU9A 5HTOA 2PGJA 3O38A 3OCZA 3GB9A 3B2EA 2Q6KA 3S1AB 1B1AA 2JAUA 4J16C 4YAOA 4YJHA 4AMYA 4NCKA 1AMNA 2XZDA 1YBHA 2NZUG 4KXMA 2Q7OE 4PBSA 3PXXA 2GXAA 3CLHA 1I7SB 2F1IA 4CM9D 5CIYA 5FWYB 5TMEA 1TZBA 1ZEJA 3ZNNA 5JD3A 1G8GA 2PT5A 4MULA 2PUCA 1ECLA 1XLUA 2PCLA 2PY6A 4UOQA 1JJAA 4FGWA 4S04A 4C21A 2Q6OA 4A16A 1I01A 2NAPA 1W7AA 2QEQA 2PX6A 3FIJA 5F1PA 4LCEA 4EY7A 1TCAA 4X1IA 4ER0A 3KR0A 1CUIA 4BKQA 1FUEA 2YOGA 4KRYA 2OESA 1CDOA 3N5CA 4DPLA 3FSGD 4TXMA 5DI3A 4HNUA 2FPMA 4N4AA 2V96A 2G0TA 2WIGA 4PNPA 4AKSA 4H4CA 4DLWA 2C9BA 3ER8A 5LDHA 4FEEA 4LJRA 1C8VB 1M8JA 1DS6A 2DECA 4K6HA 5KKNB 3SU8A 2FZVA 2P4EA 1XQYA 4HXFB 3PUXA 4CDNA 5DJ5A 2KE5A 3K9LA 2QTMA 3WL7A 1KDRA 1VQ1A 3T7RA 3IL2A 3EUAA 1NAHA 4I1IA 4YP7A 1DQZA 1N1EA 13PKA 4M3NA 1EDZA 2JATA 2WJJA 3KYDA 1C9NA 1P17A 3K0BA 3L7YA 5ADVA 3UKDA 4QOIA 3AOGA 3PNMA 2YY6A 3HN7A 1OILA 1Q44A 1VB5A 3EXG1 2NYUA 3H18A 3EGDA 3PG5A 3EZ6A 5FNVB 1J2RA 4XE5A 2ABWA 3I12A 4OB7A 3EAGA 4B3SB 4JR1A 4XZ3A 2EF0A 4XARA 3RI3A 3WGUA 4OQNA 4CKCA 3ZQ6A 4CEJA 4ZYTA 1DBVO 3KT0A 3HDGA 2DUMA 2XVMA 3Q8WA 4ERNA 2HYIC 3VAAA 1J0CA 3WDLA 2ZJ0A 3K4QA 4Q3EA 1A9XA 3TBKA 1ODKA 1OW3B 1QIFA 2H9IA 3A7EA 4IO1A 4MUXA 3SXJA 1S9HA 5C1IA 2AI2A 2CXUA 1JDJA 4NP6A 1JR3A 5HDQA 5A4KA 1FU4A 3G7SA 1HNXB 1U3GA 3IUQA 2C4KA 1XQXA 4OY3A 3A37A 1L7MA 1G8YA 3IURA 2CZCA 3AW9A 5E9JA 1Q7GA 5EHGA 3A4TA 1GN8A 1IATA 1U3UA 3IESA 2OYRA 4YDHB 5EXTA 1W36B 1DJQA 4INJA 3N8KA 3H5IA 4Q37A 1U2PA 5LN1A 4F56A 1JVBA 2AE2A 3NUQA 4YJFA 5E4FA 1W9HA 2AC7A 2W7TA 5JEDA 2UYYA 2IH5A 1K6MA 2Z09A 3OAAD 4LEIA 4P53A 4XB6B 3RBZA 2YXBA 1AURA 3F7OA 3QLVC 2IU0A 3L01A 3NNSA 3N8GA 1EFHA 3SEQA 3H5RA 3JWJA 3QKIA 3UOAB 1VJ0A 5JJBA 5TMPA 3PDWA 4RMNA 1GKYA 3X1DA 4ILKA 1BW9A 1Q7CA 3ROEA 3CCBA 3F5QA 4KSYA 1BA3A 2Z4TA 4U39A 2OCLA 4MRNA 6PFKA 4JUDX 2QU7A 1ZOLA 2SKCA 3V8MA 2G1JA 4EG6A 1ZG3A 3KR2A 2GN4A 3L93A 1H65A 4NH4A 2WMNB 1VE9A 4EPTA 4QPPA 4F1JA 4DQXA 3TQCA 1GT6A 3AYXB 4HGNA 1OI2A 1XU7A 3MXTA 2FHSA 1KO7A 3DV0A 1KFCB 3IP5A 5TDHA 5IDYA 2IF0A 2AXEA 2NVUA 2WNSA 4U9UA 1M33A 1JYSA 3Q7IA 4KH0A 2ZITA 2FZLA 3HGTA 4LI3X 3V2GA 3FPAA 2LGJA 1QG2A 1K7XB 3DUWA 5J4YA 1CJMA 2ZJAA 3BGVA 2ATXA 2EYQA 2Z83A 3MB8A 4TV9F 1JG7A 5IC6A 3W5HA 3CUKA 3P2IA 2WHPA 1I2MA 3WOHA 2MU1A 4HDKA 4QA9A 2KBFA 2OO5C 1I7DA 3NT5A 5LCXA 5CYPA 1F06A 4IH1A 1CWUA 3UTDA 1GNPA 2KMLA 5C37A 1ZRHA 4ZAYA 4JD5A 5F7ZA 3W78A 1E99A 4DBVO 1C9KA 4YMUA 2A0UA 3UK1A 1LPNA 1Y1QA 3KTAB 3PC8A 4RAQA 4IRXA 1MEEA 4EJ2A 2VUIB 4Q21A 4EFMA 5HKOA 3WV4A 2AK2A 1R9MA 2PKRA 3CR3C 4KRXA 1Z62A 4RTOA 3DBVO 2MWMA 2FPIB 4LYGA 4Z2YA 1H4QA 3KOYA 3M89A 2AOTB 3UMGA 2OYCA 3V8NA 3KOMA 1XMIA 2PD3A 3T54A 3CVWA 2B9VA 2NVBA 4FJ0A 4ZREA 1T1IA 1IPEA 1RQLA 5JTUA 1PEDA 1IE3A 1C4OA 3STHA 5CM9C 1I0IA 1RVDA 5JC8A 2ETVA 4UHEA 1E6EA 2FG7C 1M9NA 2ZAOA 1ECBA 3FMFA 2AF4C 5GADl 3N76A 1W59A 2GERA 4E09A 3UJHA 1JEEA 3QI7A 4LUCA 1HRKA 3TZCA 1COZA 4CLOB 2CGEA 4MHOA 2H5LA 1GEEA 1HZJA 4MKXA 2IX9A 4QVIA 4CNQA 1J07A 1WUTA 2X13A 2X1HA 5HZHA 2JFHA 2R9VA 3JR7A 3MJEA 1Y6FA 3T7KA 4L4SA 4JI7B 1GNSA 1EFDN 3RIGA 4GZ3A 5AI5A 4YWJA 1W48A 1XL1A 3F8SA 3N6RA 4FP9A 2N0SA 1P3DA 3GJTA 2FA9A 1OB5A 1JSZA 4Z9BA 3CNEA 5F3WB 1RRPA 3HCBA 3MWEA 3PNQA 4OIFA 1JDZA 3D3NA 3I2GA 1ZK3A 5FNVF 3M5DA 4G0NA 1BROA 5GGYA 5THQA 4N8DA 4FHGA 2QJOA 1LQ2A 5EE9A 3TBFA 4HCJA 4Z1MD 4MUFA 1NQWA 1CQWA 3RT7A 7REQA 1NW6A 1KZ9A 2J59A 4RAOA 1JDPA 1KYWA 1U0NA 2RE8A 1ZESA 4IXDA 3QJYA 3O03A 4PPYA 4HI0E 3IOYA 1AXGA 1E1LA 2Z6VA 3RRXA 3PIRA 1T6NA 2Z2ZA 2XV1A 2IPOA 1CY8A 3K53A 3L0BA 3BKWA 4IXMA 2W2TA 4KTVE 3L8ZA 1FFCA 1GPDG 1VRWA 3VZSA 4BYGA 2UYOA 3NCTA 3ESDA 5AUOB 1VL8A 1C14A 2PLAA 3HC7A 2B35A 2D4HA 3KE8A 4UEWA 3TZ6A 5BQPA 3WL4A 2IEYA 2QE7A 2H2IA 2ONCA 1TU4A 4KK4A 3REFA 2BKXA 5EUQB 3DE4X 2UKDA 3KELA 5D84A 1SUPA 1C7IA 2R25B 3LT4A 2BPOA 3QTLA 3KXDA 2VTKA 1MW8X 4XVQA 2Y1KA 1DJPA 421PA 1KTVA 1B16A 2HCTA 2H1IA 2W83A 4F5DA 5LMUB 2JB9A 2NO7A 3H6GA 1RYHA 1W47A 1U7DA 4M7PA 3KQSA 4Y0AA 5SZIA 3KEFA 2PH5A 2JZCA 1I0ZA 3GPDG 3U0VA 5ARCA 3IUYA 4F86A 1HX7A 3GNQA 4CFZA 2YZNA 4AY3A 2WJHA 4ZFNA 2C2OA 5CD9A 1EB9A 2SECE 1RPJA 1PSWA 1I3KA 1UPFA 4GF5A 1NF8A 1TK2A 2I22A 3I9MA 4U7WA 4WK0B 2C77A 1QC5A 4NBVA 5A6SB 1H3NA 4ZEWA 3QE3A 1IL0A 3IVXA 4PC3A 3NONA 2MHCA 4B83A 2RARA 3P94A 4GBMA 4Y1FA 3WLSA 1TQDA 2PTHA 3HXLA 4I1OA 3TDKA 4FDMA 3R7LA 3VU0A 2IOYA 5KOYA 3S8YA 1UZUA 2DHEA 4PCAA 3RLFA 5I7HA 1LDGA 4Q9KA 3PGKA 1HNWB 4EY5A 1J8DA 5CJ2A 4HGQA 4CLRA 5AT1A 3L1JA 3V1NA 4JXKA 3A2NA 3ODPA 2EW2A 1GPJA 5C2JB 1TK3A 3B3FA 4MVXA 1JYFA 3BEDA 1SEPA 5IU6A 2OP0A 1N33B 3TLCA 1NX9A 1N4AA 4ABYA 3QKSA 3P9SA 1QLWA 3EC1A 3CLRC 5F33A 4AD8A 5C4MA 3ETGA 2N1MA 1WCIA 5IP5A 5TY0A 1J25A 3JQAA 3VDQA 3VDXA 5EUMA 4RBNA 1TL7C 2ZSKA 1FRQA 3C3DA 4MDHA 1ULBA 5ES3A 4F8EA 4XX1A 3G8DA 4GH5A 3HN6A 2BFDB 3GBSA 4GZLA 4MWGA 4CG2A 1C9JA 1ZN7A 2IE0A 3HA2A 2HY7A 3GLFE 4FCWA 4YRNA 4TS4A 1A7UA 4F2PA 4DV1B 1GRRA 3PPWA 1JTFA 4B31A 4DMFA 5LXTA 1ZJ6A 1JQAA 3DDHA 3FOBA 4LCJA 1GCGA 1I13A 2Q3LA 5FOSA 1M7HA 5KMGB 5LLDA 1VPWA 4CCSA 1CRWG 1UMBA 4HAOA 1MNAA 1ZJYA 1XNGA 1D6SA 3WWZA 1HTWA 2HMTA 3JQGB 1J33A 3ANTA 1Q1GA 4AWXA 3U61B 2ACKA 3HVIA 3MAJA 3E1GA 3D4PA 3D8HA 1QQTA 2VT6A 3DUFA 3PPIA 1JHXA 2Q99A 5TLSA 3KSDO 4G1VA 3BRWD 1NRWA 3EBLA 5SZHB 4CETA 3COVA 1DT5A 1POWA 2A33A 3AV3A 4UTXA 3O3NB 1E1CA 2EFGA 3U44B 4WN9A 1QAMA 3RASA 3I1JA 1GGFA 5SY9A 2A3RA 5KYXB 2VF5X 3GROA 3UKJA 2OB1A 3MELA 4CLDA 2TYSB 1SUFA 2GF9A 1FW6A 3U4DA 3L4SO 1BZYA 2TECE 4C05A 1FFXA 3KO8A 4F11A 1JFLA 1S1MA 1A9SA 3HG7A 5A4IS 2GN6A 1VFNA 3GBVA 4B3IA 1P1CA 1MT3A 5AI4A 1S02A 2P9YA 1LDNA 3SHFA 1GNRA 1CZRA 5E7IA 3U19A 1KVUA 4FDAA 1Y81A 4UU8A 5FJIA 1PJ8A 4EEZA 1EFAA 1U7ZA 5C0OE 2ID7A 1A8UA 3R6DA 3SGLA 4BNKA 1WDMA 1GKLA 2Z8ZA 2QS9A 4O4HA 4Y6LA 3HR7A 3BZBA 3W8DA 2B4QA 1YO6A 5DYIA 3BMOA 2QV0A 2O20A 2AXNA 4AP5A 3EJ6A 3COWA 1VRVA 4LZWA 3FM9A 3FZQA 1DOZA 2FI1A 3LLVA 4BV8A 2P78A 2W2MA 3IMGA 4G5OA 2WOJA 4M88A 3VM6A 1QDUA 3RVNA 2OGZA 4RA6B 4EY6A 4PO8A 3GRVA 3GFRA 1IZYA 3L04A 3MRTA 1NC1A 4KC0A 2W42A 2SCUB 1WBJB 1KRHA 3VI3B 1X9HA 3UV7A 1DKLA 5KWSA 1EP3B 1DIRA 4BIIA 1T3TA 3O74A 1NI4A 1ISFA 4IIHA 4ALJA 3COPA 2F1HA 2ZXUA 1ZGZA 4YGYA 3WMEA 1Z47A 3NMUF 2P91A 5BY2A 4NH0A 2UZ3A 1DC7A 1FDIA 3TQFA 3WYAA 4AUEA 5BN3B 3ZWMA 4B4OA 3JQ7B 4XYBA 3FMVA 4NE7A 3OU7A 5DNVA 3CNLA 3QFHA 1TMGE 5BVGA 1RXSA 5KQMA 4CEIB 2ZRLA 2NSJA 4JSRA 3RIHA 1CT9A 1ZIDA 5F4BA 4BTEA 1VL0A 2C4MA 2FGJA 4RCZA 4B87A 4YCLA 3SQXA 1G9TA 3BM5A 2RHDA 5HUHA 3O8QB 5KOJA 4ID9A 4DRYA 1E18A 4HGPA 4H6PA 4ACAA 5M5BA 4COKA 1JVSA 4ITVA 4JSTA 1KRXA 1KPIA 2ORWA 3ZQ4A 4D6XA 3DHWC 3JTMA 4QLOA 5AI0A 3TINA 1UPUA 1ZJJA 4Q6BA 1MU0A 2WHXA 2B1RA 3ESRA 3VOTA 1B6RA 4BO9A 5JD5A 1KJNA 2JARA 4MZDA 4R5HA 1H05A 3VH3A 1W93A 2NXCA 4G37A 3QI2A 2NMVA 3PJRA 3M49A 1PL0A 2D2FA 3IUPA 2VJMB 1EFUA 1Q22A 1DCKA 3JQCA 3KSUA 4RPHA 4IH9A 3E82A 4O59O 3WLPA 1ZD8A 3EUEA 3QYFA 1NIPA 5FPYA 3C7KA 4NE2A 5I7OA 1FMJA 1VCIA 3C6XA 5H70A 4C7MA 4B6SA 1DIBA 4NDNE 4DNXA 3QENA 3T3MB 3ABZA 1CLEA 1LU9A 4KO4S 4UMDA 3O8RA 3B6MA 1NFFA 2O7RA 4CDMA 3IVAA 1GNQA 4LDQA 4NY1A 3THOA 1HDOA 2DR2A 5C5DA 1ZD3A 1J2TA 1UC5B 1ODCA 2I6UA 3BMQB 4WJKB 2P27A 4R8RA 4GG1A 5CXUA 2IITA 2C8VA 1JWBB 2QX6A 5CFOA 1QRAA 3DVRX 1ISHA 4DR4B 1GNLA 1MMFB 5ALYA 4M1SA 4E6EA 2PLWA 1K63A 3BJZA 1IZ9A 4CHGA 4V0SA 1E0SA 4LDJA 1YTLA 4MUMA 7YASA 5TC4A 1HT1E 2QUIA 1QVRA 1W0KD 4WESB 4CZ2A 1MVNA 1L5ZA 3QPBA 3P9ZA 2HZ7A 3QUQA 4TLDA 2C3MA 3K9NA 1T9CA 3RWMB 4AJPA 1NVDA 3U26A 2BKVA 1VKHA 2OKCA 4L5YA 2H11A 3I9KA 1FP4B 1LVHA 1U1FA 1V1RA 3WKBA 5L3VA 5H68A 1XMPA 3VDRA 3J7AC 2JLQA 4JQZA 1JE1A 2PV0A 4JVLA 1L7EA 2J9GA 2V5AA 3THWB 2ONYA 2HKIA 3MHTA 5FTMA 1XJQA 4W6ZA 1FRVA 4L74A 4MV9A 4RV4A 4J43A 4F8YA 4JJZA 5H3HA 5A62A 5IJAA 1SBCA 4DNPA 1RXIA 4ZOBA 4D9NA 3LKVA 4UBKA 2P4QA 4I3HA 5CVUA 1AXRA 3VZRA 3LUDA 3MINA 3OLQA 6CHYA 1WMBA 1S7CA 3UJNA 1DARA 4TT8A 1JHRA 1XFDA 4QVKA 3SYMA 3L2OB 3U2QA 5DW0A 2Q49A 4B9EA 5I01A 2GD1O 2I03A 4LN1A 4LQ4A 3NKFA 3EFBA 2QPTA 3DVAB 5JMTA 4HB2A 5KVAA 4IOJA 4XM1A 3FAKA 3EXHB 3EX7C 3HJGA 4X8HA 3V8RA 2HIGA 2XYVA 3GAZA 2WU0A 1GCAA 1XYGA 4HUTA 2DKNA 3JATB 1U65A 5EY5B 1LLFA 1I3OA 1PGNA 5HF6A 1L4GA 4ZAWA 2XT9A 3UJDA 3MMXA 4C08A 4FMPA 4DLYA 5B4VA 3U80A 1EGMB 2J67A 3S2EA 4NDAA 4PEVA 5K5EA 3LLMA 2SICE 2VHVA 3W2EA 3LTNC 1R00A 2R5FA 4TKVA 3KAQA 3F90A 3TTTA 2NU7A 4Z0HO 1CNEA 5FTWA 5BN4B 4Y2HA 5J4KA 3L6EA 3ZDAA 3JAKB 1W4CA 1DAGA 1P5FA 2IS4A 1I7LA 1TM5E 2Q7DA 1VLVA 2H8KA 2CSXA 1QHHA 1O08A 4KRGA 3AONB 4OGFA 1J24A 1EDDA 1Y3CE 2BHLA 2I54A 2PXCA 3B6ZA 3G1TA 4HRXA 4O29A 2UV8A 2G83A 2DKOA 1L7NA 3U9TA 4J0KA 4XW2A 1ZJZA 3EYAA 3T38A 1DAKA 3S2GA 3FGOA 3P9YA 3RAEC 1YJ8A 4RF4A 521PA 3N0RA 2HJ9A 4IGIA 3ABRB 3N53A 3U62A 3VSCA 4GRAA 4ZJZA 4P7FA 1AH2A 1UDRA 1VMEA 2QQEA 5DBOA 4JXXA 4JZKA 2HSDA 3NORA 4KV9A 2WLTA 3L8GA 3IRVA 4WCFB 2X7XA 2O8DA 4GBED 2FKNA 3E5NA 2WC1A 1RAEA 5KKAA 2VYQA 3H8JA 1RDFA 1Q16A 5G0UA 1YKSA 4G8CA 4YT4A 1XZQA 5BNTA 1KR5A 1C0PA 1VGVA 3JRNA 3QK7A 3UFBA 5H3LA 3LO5A 2IH4A 1PZNA 5DHSA 3VBCA 1SO8A 5LA6F 3JX9A 2D1QA 1JU4A 2V6IA 3VR4A 2VTBA 4MXDA 3WK4A 4KZKA 3CGWA 3MJRA 2K7FA 4MKGA 3T9BA 3KOOA 1CZNA 2HCBA 5CDHA 2JFYA 4DCMA 5EERA 1KIAA 3VO9A 4QXAA 2D7CA 3RF6A 5JSFA 1U3CA 2OHGA 3OY2A 2JVIA 1ZH8A 3HKCB 1SZDA 4NBTA 4HZGA 5AYVA 2IY9A 1AKMA 4AIIA 2XDWA 4RK7A 1QHFA 4RV9A 1O54A 1YR3A 1G5HA 3NC4A 2QAGA 3K92A 1RPTA 3N07A 2BGJA 4M8NE 5IM4A 4P2BA 5DNWA 5LOVA 5A7FA 1NVBA 5D3MB 4GXRA 2JI9A 4YONB 1DAMA 1NQUA 3H5OA 3ND5A 4L5BA 4PLTA 2CB9A 1YQEA 4NYJR 5KOIA 3IUEA 1E66A 3NHFA 1R37A 3B52X 5DHFA 3G1UA 2NLOA 1Z22A 5DVZA 2GUWA 4G23A 5LZ7A 4MWBA 2R4TA 4CG3A 3RVOA 3SXUA 2IDMA 1FC0A 2VLBA 4MR9A 1UBUS 3CB4A 3EF3A 5FOQA 4OO3A 4J07A 1RIIA 3B5EA 4OATA 1WUIS 4ZQFA 3TMAA 3NKVA 4C4YA 3CZPA 4JA0A 3IP8A 4RC9A 2BGLA 2H65A 2GS9A 2OWEA 3H1TA 4L7VA 4GFDA 1JH8A 3AM5A 4OI4A 1PR5A 2WYVA 4QDUA 4G5XA 4MTCA 2IBSA 2BFMA 1M8FA 2K87A 4II2A 3DE6X 4GXTA 2KBEA 3IE2A 3KQNA 1JDVA 3G0CA 4FZ5A 1E6LA 5BQOA 3A1FA 3R3HA 2J3IA 1T9KA 1C7JA 1X1DA 2ZIXB 4G5RA 2VWGA 3LQ2A 2YYZA 3GC6A 1P4HA 3DBRB 3ILXA 5ILQA 3W4KA 4BO3A 4LRYA 4NECA 1I1QB 3IILA 3QG5A 3ROZA 1NC3A 4GMGA 1YRWA 1ENOA 4ZU3A 4DV7B 3AR5A 1IBKB 4B0OA 1UZMA 3G0BA 2IEDA 1CQXA 3I9NA 4E08A 4QOSA 3QX3A 4UHCA 1G5TA 1BJTA 1NLZA 2AG5A 5BUCA 4YS6A 1L8QA 2CLFB 2QTRA 4POOA 1T0UA 2H59A 4WDRA 4XGIA 4P3NA 2W0SA 3L40A 5IFKA 4GZMA 2IJGX 1T4CA 2WMYA 3LC7O 3HB4X 1ACMA 2LRHA 3L43A 3NIGB 4W8HA 3PC6A 4O08A 1EHYA 3HFGA 1ZH4A 2BELA 3L0YA 2W2NA 4N0EA 3ANYB 2F8TA 3TFWA 2A9KA 1H5NA 4U6SA 1NW3A 5A3JA 3L0DA 4HAXA 2QN8A 5B7QA 4LNUB 2ZT7A 1IZZA 3P9KA 2DQZA 3V7YA 5KUTA 2HFJA 2OV6A 3QRWA 5AXBA 1LSUA 1S2IA 4AVYA 1HG1A 1FX0A 1XR3A 3MAGA 4OH1A 3DKPA 3STTA 1ZIPA 3KQTA 2Y9MB 4KDRA 3IGFA 1U2GA 5JS8A 3IAUA 2FEOA 3DQQA 4EJSA 3FJOA 1XT6A 3THXB 4J0IA 4JLWA 1L6IA 2E82A 2IIBA 2G7MC 3H5VA 4AJ1A 3BTVA 4LF5B 2QLMA 4E0BA 3SLGA 4PYRA 3OG9A 4GMFA 3NIWA 3OE1A 2GM5A 2JI8A 1P91A 2ZIVB 4HS9A 2DFDA 4D92A 4V0ME 3UCXA 2NTNA 1RQ7A 1H3EA 2V8OA 4S05A 3DOCA 3DC2A 3F9IA 1COWD 4FE3A 1U28A 3CNHA 4L27A 4NU5A 2CCKA 3GG2A 3BWXA 3Q3IA 3MGBA 4CKWB 4P81A 1MAAA 3B1FA 3LC0A 4L9SA 4D3ZA 1U6JA 4BZZA 1OT5A 2Q2NA 4R9NA 1R66A 2C94A 2AJDA 2IHYA 1KI7A 3I04M 2KJQA 5CNKA 1Q17A 1GV1A 3F4LA 1RXUA 3UG7A 2O4UX 4S12A 2I4NA 2JIBA 2ZWMA 3DLIA 2YFKA 3KSRA 1OPXA 1T29A 1JEQB 1V5GA 5FWXB 3H3XA 3Q8KA 4D25A 4HY3A 4QU9A 2R00A 3LZDA 4MS4B 2QENA 3AL2A 1EUCA 1L4FA 3RRMA 4DMLA 1JI3A 4PHTA 4EUFA 4MV5A 2QMQA 1MHTA 3CHYA 4CL0A 4RD2A 3TOZA 1IUNA 1IY9A 3B82A 5BWCA 4DR1B 3PD0A 2R7LA 4KR9A 1D2AA 3PHBE 1G2PA 3DW3X 3BWBA 4RELA 2AC4A 1Y6RA 4G01B 1L9KA 5CCDA 4KIFA 3PTAA 1HWYA 5AOAA 1M8PA 3TLAA 3LF1A 1LPSA 2G63A 1H4VB 1PNVA 3WIEA 2FX3A 3PL5A 2QSYA 4L0CA 5G0SA 5JFGA 4AJJA 3L6OO 3ZW7A 1JZSA 1OIVA 3BQNB 4KLAA 4H59A 4KBGA 3ROMA 3EXHC 4YRMA 4W9MC 3FOFC 1TLFA 1NP3A 3M5PA 4N8EA 4MOWA 5HIJA 3X0DA 3HKDB 2VPXA 4F6RA 1KI4A 3NPAA 4DV6B 1IZ8A 2PEZA 1SU7A 4F9TA 2PS0A 1U9ZA 2GKOA 2ZRCA 2X9LA 3VJKA 4XVCA 3UMFA 1ZRSA 2EFJA 1E9CA 5TS2A 4P32A 3ZVLA 4DMUB 2VJQA 3ZY3A 2A86A 4F4FA 1BMFA 3ELDA 3PPYA 1RKXA 3EN0A 1HE3A 4QQKA 3VO8A 3ZE6A 1IHYA 3B13B 3JYQA 4FILA 3A7DA 4OXNA 1X87A 1E2EA 1D3AA 1QZUA 1T24A 1NN5A 1EGQA 4X1KA 3CZ5A 1UP6A 2XWPA 2PZ8A 4HQFA 4MA4A 4ZCQA 2BMAA 4A6DA 1WABA 1BMTA 3SJUA 5AW1A 2WJWA 5I7SA 2ZRPA 2QM7A 4FBMA 4ZVTA 1J70A 1EXNA 4QTXA 1EVZA 3ZXSA 3OO1A 4CM8B 1G55A 3QU7A 5JCPA 5CA0B 2Q50A 1SUWA 4UE3S 2FUG6 1E3QA 4J03A 4AMVA 4O4JB 1QE3A 1SXIA 3D4LA 2D06A 3GJ7A 1H5QA 1Z13A 3Q1KA 4JI0B 4WWHA 4GP6A 5COAA 3EPHA 3PQFA 1HDIA 4G63A 2X9NA 2Y0CA 3KUCA 2HIAA 2R751 4QHYA 5ALNA 3Q98A 2I7DA 4IINA 1MX1A 4WCFC 3BC1A 2YWDA 1H0KA 3DP9A 4IM7A 2Z5LA 4WOKA 1YL5A 3MLEA 2M6RA 3UGJA 1XCMA 4LKRA 4F7DA 2X5OA 3IRUA 1LBQA 1CJTC 1Z28A 4LTDA 3HXQA 1G8SA 2HSGA 2ZRMA 3QBDA 1OV4A 3AIOA 1SH7A 2DH6A 5JOQA 1TYAE 3L1KA 3OZ7A 3ESBA 4V39A 3TMYA 4YRGA 2FCAA 4D79A 3O4FA 2VSYA 3KV3O 4AZSA 4L28A 4B71A 3TK1A 2P6RA 3EE6A 2HW8A 5CLLA 3C2QA 1CTQA 4M1QA 2QYSA 4MIYA 4B79A 3QUBA 1PG2A 1PKXA 2EFHB 5L53A 3NHPA 3S8EA 3RYFA 3B7WA 5LYJA 5C81A 3ZNPA 1YF3A 1X14A 3E2PA 4YMTA 3ORFA 2ZS8A 2QX4A 4OHOA 4FIZA 3C5VA 1S2LA 4AY4A 1XFAA 1XA3A 2Z95A 3D4IA 1N8SA 1XX6A 2VDQB 3LY9A 2W6MA 2WM9B 2HQSA 4IZ6A 5J2UB 5K0NA 4MYHA 5JYEA 5EE1A 1KQNA 3CLTD 3R44A 3EC7A 4Y1RB 2YHIB 2PKEA 4J3NA 1IXSB 2EYUA 4MGIR 1TCUA 5LC1A 3ZKWA 4QUIA 5B7PA 2G28A 3M82A 1DC5A 4CKBB 2QTVB 1AU9A 4WFQA 4KI0A 5FAXA 3RS7A 1ISIA 1TZMA 2YMLA 4HUJA 3VC2A 5K8JB 1ND5A 1P5RA 2JEYA 2D7DA 3G49A 1OBVA 3D8TA 2NNWB 2LBPA 4N5NA 2CLSA 3KWMA 1E9FA 3ONFA 3JQ8B 1KH3A 4M38A 3FXAA 4EATA 1DVRA 4P7GA 4JYAB 4K9KA 1SD1A 2HT6A 4DAOA 4EG8A 2QUJA 2SKEA 2W8ZA 2X41A 1FOEB 4OA5A 3G8AA 3ZZUA 1GFIA 2DTXA 4BRZA 2RHTA 3Q40A 3BIXA 2F67A 1WBBA 2Q2VA 1ZNQO 2XYQA 5CR9A 3UH1A 4WK6A 1WSDA 1SEVA 5HBGA 1NVGA 3PGJA 3SM9A 1T2CA 1XZDA 5MGBA 1LFDB 1V6AA 2O2DA 1J1ZA 1JFFB 2ZUVA 3D4BA 4B3HA 4NXNB 4QG3A 1EHCA 4DRZA 1Z4KA 4DT1B 1KI9A 1DRKA 4IL5A 3O0DA 5FOUA 3X1KA 3SE0A 5GOTA 3K0EA 3ZIDA 4BNLA 1JZTA 3BCHA 3OD5A 5DWDA 5CK4A 4MAAA 5HE9A 2OLEA 4FW9A 2IOQA 3OCVA 5T41A 4DLVA 2R68A 1P7VA 4H27A 5D85A 2DUJA 4L1KA 1TM7E 3F47A 5C7OO 1CP2A 3Q3CA 3VTKA 5A4MS 1G66A 4M1ZA 4WLEA 2J3MA 2QN6A 3MUFA 2PJDA 5IN5A 3ZGNA 4JT8A 3KWFA 4UXIA 2AFHE 2Q4DA 1E5XA 1QIHA 1ZA2A 3DKIA 4G5FA 3L4BA 4YRZA 3LHSA 2DPMA 1NQAO 6NULA 3NBKA 5GONA 4JI2B 5GZ6A 1UK8A 3ZDZB 1GTG1 1EMDA 1NT4A 4RDIA 4AUKA 3URKA 2EFEB 1FTYA 4MR7A 5DYYA 3RRYA 4UHHA 4S0ZA 1OF1A 3OFSA 4F3KA 4GZ6A 2C54A 1Y5LA 4Z4EA 2OCYC 3NVMB 4I14A 1VA5A 4XIGS 4Y9DA 5H81A 3SVTA 5HKAA 1AQJA 3AJ8A 2ZPAA 2AYZA 1NVUQ 5FBRB 1QGOA 3HVRA 1B3BA 4CKEA 2VQ3A 2OBLA 4DSTA 1Q84A 2I7XA 3A05A 1BIFA 1VKRA 3BA1A 3DD5A 3FKSD 3LUJA 4QD3A 2F00A 2O5RA 2RHWA 4UARA 4KBFA 2JH3A 3WGZA 4L50A 3W3AH 1HGXA 2BC9A 2AZTA 1V37A 2J4FA 3M1IA 3MVEA 4N3GA 4QIHA 2GPSA 1OFUX 3DV2A 5A3VA 2WEKA 1BE1A 1H6AA 4UEQA 5EJ2A 4CCYA 1O9BA 1W5TA 2J7PD 1SKYE 3MIZA 4R83A 1D1SA 2W0MA 2PUJA 3S40A 4Q01A 4RQTA 1CP3A 3B1WA 4C07A 3W2HA 4JJFA 2BSAA 2XMDA 3EJWA 3ILYA 4W99A 1OLXB 1D2GA 2H7YA 2PWAA 1TDJA 1DFHA 2CNOA 2GR9A 2XWJI 3LQYA 4O4JF 1I4OA 4Q0MA 4XKJA 4RTKA 1KBOA 1ZOPA 1IIBA 1OI7A 4OLHA 4MSUA 4E2ZA 5IUNC 4DR2B 2X3UA 3O83A 1U4OA 3OU2A 2VP3A 4RK0A 1JSRA 4OP2A 1XVLA 4Q9AA 4QELA 4EECA 2WV9A 2ZRJA 4E51A 4DV5B 3IJ5A 2ZVDA 2C9YA 1D2CA 1ZMOA 1CX9B 3LWNA 1OH5A 3EA4A 3P27A 4QXRA 4UHFA 1L9XA 4L02A 2YW9A 3HY4A 2FUCA 3CSUA 5EMMA 1VIMA 3W0LB 4B84A 4YRTA 2QG6A 3FGPA 2ZJ4A 1A96A 5EP1A 3ROTA 4UDNA 2YWGA 2M9MA 3EWNA 4LDNA 4YAFA 3AOEC 3IO5A 1YC2A 1L7AA 3HVJA 3WHKA 1BEZA 8ADHA 3PWSA 5A7HA 3W5IA 3IPXA 2LCFA 4A2QA 5DB4A 1A8SA 4IJKA 5J2TB 3DFFA 1WZCA 2VYCA 1N6PA 1P2FA 3FDZB 2XODA 1GJRA 3KPYA 1L5QA 3F9RA 3M6FA 1HYQA 2J1LA 2CLEB 3DTVB 3PKJA 3NH6A 3DDSA 3L8MA 2OA0A 1UMDA 5T6MA 1USGA 2XMPA 3B1XA 3JWHA 2MIIA 3NFYA 3PE4A 4HDSA 4YJ3B 5AVOA 5J2UF 1WDLA 4EHAA 4NBKA 1ADYA 7AT1A 3U48A 1MR3F 2GYUA 2GPNA 3M4JA 3B48A 3VDMA 1SXQA 3W8RA 4Y9TA 2I34A 5C1BA 1A69A 1R6BX 3EH2A 2CF5A 4FYMA 5DYTA 4F0JA 5K0GA 4RHCA 4FQ8A 3L6BA 3T94A 4FC7A 4YAKA 2RFLA 2EV9A 2Y3IA 1ZBQA 2O9JA 2NTJA 3VR5H 3DMPA 4ZAVA 4BUZA 4E2YA 1PZHA 3OPMA 2FPPA 1CQIB 2BEUA 3OTQA 4IX9A 4Q3LA 1KOFA 3MWJA 5EKTA 5TS3A 2GBLC 3H9GA 4J2HA 1KBZA 3I9V1 1Z0KA 3QUAA 3D6VA 3MNFA 1WEKA 2JJMA 2NO0A 3ZGYA 1LLCA 2R6R1 4FMCF 3GHHA 1LW7A 3T3EA 5A9SA 2IYRA 4L6AA 4C2BA 1QCCA 1Y8RA 1N2SA 2I1VB 3R3ZA 4D0NA 5KU7A 2ZUSA 4XFDA 4ZYYA 5DRYA 1QM5A 1GP2A 5EJ6A 2EARA 2D54A 3OUTA 3ZLUA 1UM9A 3LC1O 1H9AA 4LSGA 2PUHA 1PYGA 4KE9A 1VE3A 1ISRA 3ZWNA 3SCZA 4LCBA 3GHYA 2WICA 4D97A 1S01A 2VHXA 3JWEA 1GZSA 3N0WA 4RYDA 1EQAA 3PYXA 3OEYA 1L1QA 4MV0A 2XNJA 3AUJB 2B1IA 1VJ1A 2C7BA 5BR4A 5I7EA 1IXZA 3JW8A 3IEKA 4F4UA 5A71A 1RWXA 5INTA 1E4EB 1PZXA 3N28A 1C2YA 1BXGA 2A35A 5IAEA 2P9CA 3B6EA 4NZMA 1U90A 3FR8A 4ME6A 4QXQA 4AAYA 5FBWB 1A98A 1SZJG 3BCUA 3TG2A 4J91A 4CFSA 2PVCA 1WMAA 3EY9A 3U3RA 3COYA 2JIDA 3C16C 4R40A 1OTHA 3OFNA 3IXQA 2ZQZA 1KERA 3O73A 1PT8A 3WNDA 5IDWA 4U8HA 1NYQA 1UL1X 1VLZA 1HE4A 4Y6SA 1X0XA 2FPSA 3U44A 5I3CA 2V7GA 2Z9CA 4ARUA 4DLKA 4IHJA 2FQXA 4RW0A 1W29A 2G36A 4I99A 2X0FA 1XDSA 5SYMA 3U37A 2I3GA 3X1YA 3BGIA 4B75A 1U2QA 4ED9A 2RGDA 1R0RE 3H5NA 3ZE9A 3I2KA 3N0VA 4KQHA 4WFIA 2XQGA 4KJXA 4XPIB 2IZ5A 3B9QA 2HTEA 3F96A 1FQOA 4TZ6A 1Z17A 2C4VA 4PG5A 3UWOA 3G0GA 4NMMA 1UJNA 4BEBA 4F84A 5BSGA 4H3KB 4RE6A 1GU1A 1PGQA 2R8ZA 2UUCB 4YIHA 1ZK4A 4BUCA 3GJ6A 3W6OA 1QK3A 2O2ZA 4M9CA 1MH1A 4LJ4A 1DOAA 4RADA 5HK9A 2P1RA 3LKZA 5DOZA 2WVAA 4QDXA 3IVCA 3U6KA 2BL4A 3VA7A 3T0GA 1MORA 1V5FA 2GFHA 3D5TA 4KR7A 3Q1LA 3RSGA 1A9TA 1G0OA 5K2OA 3DZIA 1R9NA 4E2FA 4P22A 2P6PA 4KWTA 4QFMA 5KDDA 4CMBA 3HVKA 3QU9A 5HOEA 1ZVQA 1P1KA 2E5FA 1PWHA 1AUOA 3PV0A 2GA9A 2VOEA 2FZ5A 2QLLA 3AVPA 3PGMA 4H7DA 3AKCA 4XD7A 3U5TA 1K97A 4RESA 2WI8A 5HNKA 1OASA 1NQTA 5CDFE 4LBWA 3ND6A 4OQ4A 5TSDA 2XGOA 3IEXA 3W8NA 5G02A 3WL8A 2GFQA 1PJ3A 1WX1A 3THSA 1MA0A 4EL0A 5E2IA 2HHHB 1N25A 5J2TF 2AD1A 3V8BA 4X5OA 4DW8A 1EWTA 4D46A 3T1OA 3VAZA 4FT4A 1EX1A 4H60A 3VPCA 1RCFA 3O8OA 4YJ3F 5EE3A 2IOFA 4BNIA 4I9FA 3UK2A 2Z4SA 4PS0A 3S7TA 4IEEA 2NU6A 4UVHA 1MAUA 4J3FA 2VT3A 4ZOEA 5KPDA 4BQQA 3H16A 2CCJA 2Q45A 1JR2A 5DP1A 1R6DA 3UY4A 1UFVA 4QDJA 2GZ1A 5ALSA 1U7TA 4GRDA 4C0KA 1E3MA 2JAWA 2QLNA 3GZNA 1GAJA 2IEBA 1CKEA 2WJ4A 3P0HA 1RZ3A 4KQIA 1N6IA 2ISSD 4MVJA 1KY3A 3QFFA 4CU2A 4E14A 2X0IA 1AKYA 4Q34A 1T36B 1N8KA 4H77A 4KDFA 2MSKA 2WZBA 2V5UA 2ENUA 5DK4A 5EP3A 4U2EA 3VR4D 1SCAA 2PE5A 1OFUA 4FMBB 3F6EX 2CSUA 3UC5A 3IDZA 4MQEA 5ERYA 1P44A 1V3UA 3ZYCA 3ISJA 3GF4A 4TL6A 1YIOA 5TB5A 1GLNA 1Q0ZA 3G82C 3HDQA 3H8VA 4PZDA 5KO2A 3BKXA 4RA9A 1YBAA 4D5EA 3LHFA 5B1DA 1D2NA 5A4AA 3KX2A 4DY6A 5K4HA 1XZNA 1MP0A 2H1LA 3MZ0A 1QHYA 1WF6A 1XWWA 3MS2A 3W6UA 4BN4A 2RH8A 2YVAA 3QNWA 3CW2A 4MAFA 2AMLA 3HKBB 4H3HB 2IZZA 3SZGA 1RADA 3F6BX 2AS0A 2GX6A 4NKRA 4Y0VA 4BNJA 5KI6A 4IVQA 2JHFA 4M9UA 4HYTA 4TQUS 1U99A 3R5HA 2CXTA 3L0PA 1L3BA 1D6MA 4XJSA 4C4ZA 1LS1A 3TLGB 1K4MA 1E7MA 3KRTA 2XIQA 4TLCA 4UMFA 4BOYA 5ENVA 3OZWA 3QX7A 3QKRB 2PFGA 4Z5XA 3MG9A 4XTCS 3CKMA 3MYRA 5T3UA 5MFPA 1FX1A 1O87A 4D57A 2C78A 3ZH2A 3NHKA 1P9OA 4R16A 2AZMA 1IVSA 3HSSA 3DTTA 3QYAA 1ZC4A 2Q9CA 1PWEA 1P39A 1SBNE 1I3CA 5HG0A 3G2HA 1D4AA 3PX2A 4QDKA 5HJ5A 3HO6A 2VRBA 4EWLA 2P69A 3DYIA 1F2TB 4PSUA 3E9NA 3PFIA 4YJ2B 4ZVPA 1U8EA 3WLNA 1KYZA 1SRRA 3TUZC 2VJAA 2AZ4A 3JD3A 2OBBA 4YC7A 3RBVA 5KZMB 4TRMA 3I2JA 1AOXA 4H1HA 1I94B 2AWNA 1SB8A 3CX6A 3EA5A 5EZYA 4PAMA 1SXGA 1CUZA 4CMAA 1I6MA 1RAFA 2ZRAA 4OJMX 4RTMA 4RQAA 4YO7A 3MT8A 3IQEA 3BFPA 3OEEA 1MOPA 1PV2A 1KJ9A 2K5UA 2HREA 5TPZA 1F6DA 4WVLA 1R0LA 1KMHA 5AM0A 1AHNA 3S55A 3T8YA 2I1WA 3HI4A 3C41J 3QJGA 2AMFA 4L8VA 3WGOA 2GHTA 3ME5A 3GRAA 2VN8A 4W63A 4I66A 4PCLA 4MRRA 2QL5A 2BD0A 3NZEA 1N3BA 5I5EA 2XZLA 4FZJA 4URVR 1KS9A 2QGNA 1TW3A 2Z3WA 4S1VA 2P11A 2WT8A 3ETCA 3PI7A 1M2VA 2C9ZA 4KUHA 4XYEA 121PA 1JYEA 1RYNA 2ACVA 4JP1A 4EKNB 1RKBA 4QTTB 4FKBA 3RS8A 1U81A 1BCRA 3GEEA 3JYHA 1HTTA 3KCNA 1HMYA 1UCFA 2BV3A 2G77B 4UBJA 2OFXA 1XPOA 3KJGA 1NPTO 2ZTMA 1E9DA 1HXHA 1RWWA 4IICA 2PAAA 3ECAA 1NF3A 2C1ZA 3GRZA 4RK1A 1UZNA 2GVNA 4CG1A 1E6UA 3SR3A 5BQ3A 4DA6A 1JKIA 1YK0A 1N5DA 3CH7A 3L8DA 4FZRA 4FIDA 4M89A 3T3PB 1U8UA 2E3JA 5BW6B 3ZV4A 3ZLJA 4RNCA 1X2EA 2FWRA 2QW0X 3HPRA 5K3DA 5UKDA 3DULA 3EZFA 4N6GA 3V4LA 1L1FA 4LBVA 3QA9A 2H92A 3KLPX 1T6ZA 4FYPA 3TLEA 4EPWA 3WYEA 2FP4B 5I9SA 2ZZMA 1LEHA 4DS3A 3R41A 4P0TA 3T99A 1SOVA 2A7QA 2B34A 3P0IA 2VG8A 4WX2B 2ZRQA 5AOVA 3KJXA 4HDNA 5AHOA 1WPGA 2EWVA 2VXBA 2YZ7A 5ELLA 2F3UA 3CCFA 1NBEA 1KF0A 3AUKA 3ZN2A 4RMJA 3PGLA 4FK8A 4JLSA 4P31A 3OTOB 1NV8A 3CVOA 4BLQA 2Z5FA 4D9GA 3ABOB 2VUUA 3JQFA 2PRIA 4KU4A 3GLHE 3U3OA 3K5HA 2Q9UA 4ZHQB 2ZVQX 3CF2A 5GVRA 1XMXA 1UJ4A 4BZWA 4U9IS 4C6TB 1JDNA 1Z7EA 3PXBA 4IIJA 2Z30A 1I9GA 4OI1A 3KT3A 3ADDA 2Q2QA 4E5UA 1I6KA 3LP6A 2C82A 1QYWA 3FJ1A 4G0PA 1B0AA 1YKGA 3BICA 1XD9A 3PQ7A 4Q3KA 2VJYA 4WKOA 3VC7A 1BD3A 4KAXA 2GZMA 2NV2B 2FQ1A 3R3UA 1KDTA 5DM1A 3Q9SA 2CV0A 2CEAA 1B6SA 5E38A 3WGTA 5DBEX 1TK9A 2CCGA 1E0KA 4PYQA 3QJ5A 4XR9A 3JALB 1MO4A 3ZV5A 1TAUA 1CF9A 1F51E 3I0NA 4B33A 4YVFA 4EQ6B 3CZMA 5DM4A 1T0JB 3OLZA 2FSVC 2WFLB 4QSMA 4JZYA 3RWOA 2FUG1 4CMKA 3HQ4O 1GYRA 1P4JA 2JF0A 4LV8B 1FYDA 1KFBB 3SC4A 1ZFNA 1BVUA 4KAJA 2G9UA 1HL7A 2B0JA 4IZIA 1RQNA 2WJYA 5DMXA 2AG6A 4JLAA 4B44A 1IN1A 2O1XA 1DKMA 2COUA 2JVKA 1WLYA 1KEEA 5DH9A 2FPWA 4BJ1A 1O2DA 2P9FA 3VYVA 4BRSA 2BY4A 3PC4A 4UCXA 3W9SA 3BEOA 4OFXA 3KDSE 1AO0A 5EKXA 5JECA 1FXWF 4OX9B 5KJ6A 2HLDA 3JQQA 1G8JA 1W34A 4NMWA 2AZDA 2IW1A 1OJLA 4D1YA 2QPAA 3BSYA 4QPCA 3PC7A 5A06A 5B3LA 4YWHA 1FUUA 4BVKA 1ZIOA 5FPSA 1YCDA 4AM8A 1RZRD 1EFTA 3D8RA 1TZ2A 2FWIA 1WMFA 3BD6A 1ILWA 2Q7XA 2YMPA 3DF9A 1O94C 1CS0B 3EQ2A 3MJ4A 5T4HA 3HGQA 3FDIA 2ZSDA 4M0CA 2HQOA 2IFTA 1NW9B 5HIAA 2W58A 2DYKA 4NYMR 4ZHSA 1RRKA 5EMNA 1QB8A 2Z04A 4FB5A 2CKMA 5EWLB 4WBNA 4Y7CA 1DKRA 5CVVA 3RDPA 4M37A 1U1GA 3SOPA 1R8XA 2X7JA 1FUYB 1N2HA 2HXGA 1U7OA 2ZTUA 2GBCA 4MA0A 3SYRA 4EHNA 4EY4A 4N82A 1TJNA 4YJ2F 2FYTA 4ACBA 2NTEA 2XGJA 3WLJA 2VP9A 1O97D 3VVBA 3LJKA 3LBYA 4C4PA 2GVZC 1T3HA 3HU5A 3K9WA 3FF4A 4DJJA 1DLIA 1TEHA 1GYQA 2ADMA 2LUOA 5AVZA 1M0WA 2BZSA 1YACA 2IDKA 4OMUA 1WU8A 1PT5A 2ONKA 3H9QA 3RC7A 5BOSA 1PLKA 2ZXEA 3DBHB 3LDUA 5JBQA 1FTNA 2YWXA 2AIRA 4TRRA 1ZSYA 4XOUA 1SUSA 1JDSA 3TYXA 3WLTA 1PX0A 2XLCA 3EVEA 1JECA 2O8EA 3P1JA 4X91A 4ARZA 2ORYA 4X9XA 4D0LB 3GQBA 1JE0A 2AFVA 2FTKE 4P4SA 5CLQA 2G04A 2AFIA 2CE7A 2QUHA 1QBKC 3MK31 4U0JA 4UM8B 1OLSA 2ZCVA 2QTAA 3SJAA 4AQ7A 1Z6QA 3A11A 5CVCA 3G23A 4CQMA 3WBKA 3AP2A 5JCOC 3NT2A 2PM8A 4M49A 3UYKA 1FMLA 1NX6A 3FPCA 2GEKA 5AW9A 6REQB 2NO5A 4IYJA 2VCYA 2ZVPX 4MVWA 2CXNA 1NV9A 1QAOA 2PKYX 4ICIA 1Z5WA 3HYLA 3IQWA 3KJZA 4JENA 4YLGA 3RSSA 3V4SA 1DJOA 5CVTA 1RE1A 4RY8A 3F1KA 3IUNA 1R4ZA 1DZIA 2H1WA 1QPZA 3HZRA 1SUIA 1XIVA 3E7DA 1AS2A 1TIBA 2D0IA 2LVBA 4A8JB 4ZI7B 5JDIA 3G2PA 1ZCJA 3FLBA 4PY2A 3HCPA 4JKYA 2A5GA 4JLOA 3ZWCA 3IPLA 4Z9AA 4X60A 2ZBEA 1YZQA 4KIWA 1L5GB 1NIJA 4L72A 1X7XA 4KXUA 1B93A 3NAZA 3DWFA 3KUDA 4GC5A 1E3SA 4DIKA 2C2MA 3A9SA 4J4HA 2UZ1B 4PQEA 1SKBA 1OIXA 5C1DA 3H2GA 1G8FA 4H9GA 4BJHB 5KSWB 5ETJA 5K1ZA 4ZPXA 1WXWA 3NXSA 3FMIA 2WUVA 4W5NA 5DLEA 2AOUA 2AR9A 4KFRA 1XTVA 1DIHA 2PQMA 2FW8A 2DY0A 3TX2A 1J23A 1H23A 5AI8A 1JTVA 5K6RA 3DO5A 1BRTA 1D0IA 3ZHQA 1WE2A 2QZSA 5TGDA 4HLUC 2IPLA 3OQMA 3FFTA 3FBGA 2Q5HA 2X8JB 3RSZA 4BFTA 4D8XA 3RU9A 1KRWA 4ZEXA 2DPHA 1IOLA 1MG0A 4NC9A 2O0MA 1V8OA 5IUJC 1E61A 3HRHA 5L3QB 1QX4A 4YEDA 2ZJ3A 2Z9BA 4GQIA 2ZTLA 1SU6A 1CR4A 2BRUC 2CLOB 3K1TA 4LXTA 2YN4A 3IV7A 4WECA 5LZ5A 3RLIA 1IY8A 4UFNA 3ZJUA 1TVCA 5FTJA 1UBGA 5C53B 2ZAIA 1ATIA 1DV2A 3RG2A 3USES 2XUPA 5FB3A 2XH8A 3IUBA 4BB0A 4CQNA 2V9CA 2VRNA 5EMJA 5TVGA 1ISMA 4U8GA 5LBIA 2MYUA 1ZK0A 3QKTA 2OCKA 3T1YB 5KTTA 3SYLA 1J9GA 1G9SA 4RXTA 3U7GA 1O95A 1CY2A 1L7RA 2FPGA 4ZKEA 4GOND 2YVUA 4NQRA 1I36A 2A4MA 2W6NA 3AIIA 2VLIA 4BKUA 3HKEA 3K3PA 4HT3B 1ZL2A 3E0XA 1QHEA 2PBLA 3RT9A 4AP9A 4UPEA 4LFBB 1E2BA 2CNLA 4RJKA 4ZTZB 1REQB 5IEJA 1TA4A 2EHDA 2DQSA 3WQBA 1RR6A 4ZK2A 2ZUEA 3WGVA 5LM3A 1JQ3A 4PPGA 3TLKA 1NN0A 1PFUA 2BEWA 2GASA 5FJJA 3NBYC 3SIWA 4EB6A 3O8DA 1GQQA 1L0BA 2CKDA 2C3UA 2JEOA 1E2UA 1NBIA 1RPNA 4C14A 2VBIA 3A1EA 3H9JA 1VJTA 2I3AA 1RKQA 1RKVA 3VR2A 4JWKA 4LC0A 4KR0A 5SV2A 4DZZA 1EE2A 3B60A 4Q7MB 5DHTA 3ESYA 2G72A 2VUHB 4LZZA 1DCFA 4GYWA 2HUPA 2OWDA 5A0VA 1MABA 3QX9A 3V32A 1EX6A 3FLEA 2Y71A 4YUVA 4DM4A 4DOMA 1EVEA 4OSPA 1NR7A 2OV3A 4WZBE 3WZ2A 3STYA 1Y34E 1XSEA 4H6WA 1H42A 4O0MA 4OHCA 1SIOA 3DMRA 1VGRA 4RH3A 5LL6P 1DIGA 4DR3B 2FSSA 2OG2A 1RLIA 3A6JA 1X9GA 4PAWA 5DM60 2C59A 3NTUA 2W6IA 3NOVA 4UW9A 3W3AD 1IOWA 2HMUA 4DILA 4FUQA 3Q8LA 1NONA 4N7JA 1IAQA 4YAEA 4UQPA 3CVJA 5KQLA 1OZAA 2Q5EA 2RK4A 1BDBA 2X5XA 2XITA 2Z2IA 3GR6A 4I4IA 3WLFA 1EZZA 2J45A 1KVTA 2X23A 3FX2A 1E3EA 3NIDB 5SY6A 1ZD2P 5K3CA 4PZEA 2YTZA 4DT1A 4DLPA 3G2MA 4HEHA 4CIAA 3OM8A 1FIUA 4YYEA 2MCFA 2WSIA 4UTPA 3I30X 5TV2A 3EULA 4I6EA 3O2NA 2G6BA 2J9FB 3LRTA 1P2GA 3JAWB 4NK5A 2Q5LA 3WK9A 3BH7A 3UVEA 1IJEA 2AN5A 1OMOA 1PJ4A 4OSOA 4HEA1 4PBTA 1T2DA 1BC5A 5DM0A 1UPTA 3QMWA 1Y80A 1OLUB 4CTOA 3HFRA 3AY3A 1VSQA 3Q3VA 1E6CA 1SCIA 2ORIA 2IYOA 3AFIA 3TPCA 4IFIA 3WKCA 4YYZA 4G65A 2ZSJA 5CXQA 1FNNA 4YCCA 3DR5A 4OLFA 3VMFA 4OB6A 1QAQA 1ZRMA 2PKCA 1HV8A 4MW1A 4QT0A 3EVNA 5CDGA 2PVPA 2AJTA 4OHWA 3INYA 1ZHFA 5DWQA 3RANA 4JBIA 3QXXA 1ZNXA 5DTIA 3LT1A 4KO8A 5ICEA 1C7QA 4EB0A 2RH4A 3LVFO 3X1MA 3OQ6A 1ZIXA 2GRJA 1CHNA 2IL1A 4TTIA 4KNWA 5C1OA 4ZI7F 2D2VA 2XKBA 3ZDEA 3WA7A 2QRVA 1SOUA 1DWPA 3UWMA 1NOIA 4RSHA 3FOZA 4LTMA 4R1NA 2DCUA 3HDTA 4FDUA 4TMFA 3CG0A 2BBOA 3SSOA 1BH2A 2D74A 3I34X 3U4IA 1GPBA 4IMIB 3OIVA 3PEEA 2GPAA 1WDWB 3CRRA 3LPMA 3PXEA 2ZWVA 4KZPA 4OHXA 3DBLA 1CIPA 2O57A 4K2AA 2WTAA 4I8DA 4RF5A 4U2FA 5FBLB 1DKQA 5E3IA 2W43A 4X92A 4G9BA 2P4SA 2XY4A 3G13A 4DM7A 1HEUA 1BSVA 2C92A 2OV4A 1C1XB 3NTQA 4IEIA 3LIIA 4RHUA 4RZHA 3VR3A 2NUAA 2AF3C 2AE1A 4J7XA 3T0IA 1QLJA 2GHQA 2ZR0A 3JYLA 3UTCA 4PZPA 1UKEA 2AKAB 2D3TA 5FV4A 3CB2A 3FSEA 3OQHA 1GKKA 3EXAA 3VR5D 1X7ZA 2B5WA 3WP1B 3MS7A 1E2DA 3DHVA 1YFKA 4NU0A 5HF5A 4JGGA 2DBQA 2WKSA 5EXSA 3RG8A 3N2KB 1AV7A 1B73A 4TYQA 1V7CA 1PGJA 2BHRA 3WRXC 1JNXX 4A4DA 3AEUB 1OD6A 3FGZA 3ILSA 4RXMA 5HIIA 1AGNA 1MJGM 4M0LA 2B82A 2D5LA 3PJFA 5ICMA 2FN3A 5JI3E 5DU2A 2DE0X 1F8GA 2FX2A 3V8QA 1JF8A 2BJHA 3LSTA 3R9IA 4A0GA 1MB4A 3BPSA 3MGKA 3IO3A 1CW2B 1XN1A 5B37A 4BNDA 1ZMBA 4L3OA 2H48A 1XXHA 1WSBA 4R3UC 3IP7A 1JEAA 2DVMA 5F9FA 4MYCA 3ZHCA 2ZYDA 3EIEA 3DJYA 1XQWA 3MWLA 2WYHA 2P0EA 4TUYB 3P9PA 5AKKA 4WHMA 1QORA 3L1VA 2CHGA 1ZL0A 4BP9A 2JJ2D 3OFND 4XUDA 3OQIB 1X3LA 1WQ1R 3TX6A 3TSZA 3I62A 4JGIA 4DHWA 2HK7A 2V59A 3WP0A 1QPBA 4AZ0B 5LBTA 4CFYA 3X43A 3EC2A 2DFLA 2R7NA 1XD2A 3LRXA 3KUKA 1JJVA 5ADHA 1TVMA 1YIAA 2B8WA 3BMCB 3T7SA 3U7EB 3VH1A 1J6UA 4UOZA 5DHRA 8LDHA 1WKBA 1CY0A 2Q3HA 5EPOA 2GOYA 4D4MA 2VZLA 3IOCA 1M2HA 2R6HA 3CEPB 1XDZA 1ZH2A 3PQEA 2IPAB 4J76A 4NU8X 4ZANA 4CMIA 1NY6A 3OIYA 3ZEAA 5IF3A 1U0EA 1W4RA 2KWIA 1CBUA 1C4KA 3V1MA 4OAOA 3CRVA 1M6NA 4RD0A 4ER5A 1LFAA 1RWOA 4UHKA 5B1YA 2IHZA 2XDYA 3CLUC 2VNKA 4H7JA 7GPBA 1IVNA 3HM2A 4YCNA 1MB3A 3N5KA 3UBTA 3LOUA 1EFCA 3DPUA 4XWGA 4N65A 2NUPB 3ZI4A 4BMSA 4US2R 4NJEA 5FOWA 3C8UA 3L7KA 3Q0EA 4FD2A 1WOYA 3P2EA 1NNUA 1K3TA 2JFZA 1TMOA 2IUSA 3GJSA 4HS4A 2LTAA 2RGCA 3E3OA 2ZYIA 1GLVA 4BNHA 1IFXA 1N2CB 2TMGA 4TKUA 3TOXA 3FNIA 2WP0A 1NATA 1A5AB 1O3YA 3TSWA 3ZJYA 5FX2A 2CFIA 1L5RA 1E0JA 3NGXA 3A6GA 4KEAA 4HLDA 1KEKA 4C3UA 2CVQA 1UKYA 4TLEA 1FBNA 2PGAA 1Z12A 2GMWA 2PJRA 3S5UA 3ZU6A 4IMRA 4YK7A 2FLWA 2C2BA 4CMJA 1I1NA 2BI4A 3FF1A 1LI4A 2FPRA 2PS1A 1VJCA 2VWPA 1U0HC 4P3OA 4I2NA 5AHXA 3HV0A 3EY4A 3R4VA 3DMDA 3AVYA 2O8CA 3DFKA 2O50A 5BV2P 4Q05A 5B1IA 5K3FB 3UJ3X 3VNRA 1H0RA 4OREX 2HJRA 4IJ5A 2I2WA 1JKFA 2GM3A 2CMFA 2ZJ7A 1AN9A 3VHXB 3X1WA 2DHRA 2ZSBA 1UT6A 5AVKA 1HLDA 1YS6A 2VKQA 3ZBPA 4KYTA 5JNVA 5M7EA 3ERCA 4WXPA 2FR8A 5EZ5A 3GGDA 1R6UA 4Z54A 2P3OA 2QYHA 5KTRA 3BMNB 1LXCA 2VDWA 2I2FA 1ABBA 5HP4A 1UBLS 4Q4JA 4Y6RA 2WVJA 1TW2A 4FJ1A 3RYIA 2PQ0A 2BJWA 4XVUA 1ZONA 2HQBA 1XG5A 4OU4A 2R6FA 4U3JA 2EKLA 2BGUA 2GH1A 1UBTS 1YE8A 2HDNB 2X8LA 2W6JA 3BGSA 2YZ2A 4RLFA 3GUUA 2NWQA 1R0KA 3FN4A 2YN2A 4L4ZA 1IXRC 2XE6A 5D5PA 2IODA 2ERYA 1CU1A 1DQSA 1G5IA 1S2DA 2YJ4A 1P5JA 2Z58A 1ZCAA 3L8CA 4MB0A 3D3WB 3W5SA 5H80A 3C3KA 3WMGA 1R8QA 4ER7A 3LMKA 4F38A 1UK7A 2GCOB 3VXKA 5JNLA 3BZWA 2Y1EA 3MSCA 2C5HA 1R5NA 2FRVA 2ZSHA 4J4BA 1JQLB 2Q3CA 2M6LA 5DNAA 3INRA 3TO5A 4BLUA 1HSOA 3QU5A 3F3KA 2LCQA 2JFWA 2PRSA 4J1TC 5GM2A 1EINA 4FNMA 5ITSA 2P3QA 4N12A 2H0RA 4EMSA 3BXGA 1Z74A 1OWNA 3TE7A 3TZLA 1KOLA 1XTKA 4A0HA 5C7LO 4M54A 1Q12A 1EP2B 2DWQA 3H7AA 1LLQA 1CYDA 1JHDA 1O1YA 1RWBA 3FCYA 3GEPA 5DTJA 4PC7A 3RFUA 3G2OA 5CEEA 2PGOA 1BX0A 3IAM1 1Y1RA 2XADA 3PHJA 3I6ZA 4JDUA 4HQ0A 4KMRA 4HADA 1PBNA 1SQFA 1U9JA 1DTEA 3AWIA 3RRJA 1E1QA 4YRAA 5FBHA 3H3JA 5H1YA 1IN8A 1Q74A 1Y1TA 2I62A 4BVHA 3IP3A 5E1OA 3A8TA 3C8MA 1PSDA 3FOCA 4KXLA 2GJ4A 4QYIB 2WD9A 2O0LA 1G2IA 3WB9A 5EE0A 5I7RA 3CJTA 1JQBA 2O8FB 1S0UA 4LG1A 1NDUA 3IQXA 4PYIA 3PD7A 2VNSA 3M6MD 3B3QA 2F17A 2IW3A 3EW9A 5FULA 5JJCA 2HU7A 4HNHA 1PZEA 1F6WA 3HJBA 3WLIA 3EH1A 4BWGA 1CDEA 2D0PB 4OIMA 4TUYF 1JIIA 4EA9A 1N77A 2MR5A 5GJVC 1A71A 5LB2A 4NAHA 4F7WA 3A4VA 2VPYA 4A3SA 4KO1S 2Q4BA 3KD3A 5DBHX 2G25A 4AMUA 3O4JA 4EZIA 1M1NA 3T9EA 2IA5A 1A8QA 4MGHA 3BTUA 4C4XA 2JLCA 3M5WA 2HM7A 1EUDB 3UJAA 1HQCA 3D6AA 5K20A 1X7YB 3CPSA 1DTWB 1O4VA 3HDHA 3Q11A 4Q47A 2L82A 2P40A 3W05A 5BQFA 5E1MA 2G1PA 3OEED 1ZSNA 1PFGA 5K01A 1EWRA 2R96A 1VDMA 1LJUA 2WSSA 3WYDA 4MKHA 4LJ6A 5JS7A 1CJVC 3V42A 1MN6A 3WBBA 4RJTA 3HCRA 4C0BA 4MHSA 4I4TB 3AZQA 3EB9A 3DONA 4EOGA 4UUBA 3AY0A 6ABPA 1D7AA 1FJXA 2FPKA 3G79A 4RTPA 1P5ZB 3PENA 4BU1A 3GJ4A 5IWCA 1KVRA 3D0KA 5TF0A 4IP0A 3OKAA 4JVMA 1VTKA 4B4DA 4YBRA 4YIKA 3WNQA 4UPVA 4QBHA 2YN0A 5E6RA 1T9ZA 2QZJA 3W77A 1H6CA 1XKLA 3E9MA 4YJDA 1SXHA 2X8WA 4XLZA 2Q5JA 3Q85A 3KOXA 4Z4FA 1BVHA 2D00A 4FKMA 3FMOB 1GAWA 1OY1A 1XA4A 3SQDA 2AKYA 4IWYA 3Q0IA 1SPBS 5ER9A 5TQ2A 5LZ9A 2Y76A 1KXZA 2EGUA 3GA0A 4L9WA 1Y1SA 3GLGE 4NXMB 1XC7A 1ZY2A 2VP4A 4UVIA 5D01A 4BJ5A 3PEWA 3DDZX 3NEPX 4L51A 2DJIA 4F8JA 1DKPA 2G40A 2PZMA 3EWIA 5CHEA 5M29A 3O26A 5AM3A 2LV8A 1TLLA 4PG7A 5JDCC 5EESA 4NV1A 4TXJA 3CJRA 3U7RA 5CFMA 3PFHA 5E95A 3WMFA 2I6FA 5HYVA 1CERA 5H5JA 4DSOA 1W2HA 2IXDA 3SQNA 2FSUA 2HF7A 1G1AA 5HUQA 1WMEA 2QN7A 5LP1A 2I6SA 3C5WP 2I2XB 1TB4A 4JLJA 4NYIQ 1TADA 4PRLA 4UPDA 1B0UA 1GOTA 3O2JA 5TQ0A 3RTCA 4F9GA 1WUHS 3SKVA 1RXYA 1XVIA 2FMFA 2OAEA 3FE2A 3H2YA 4YRQA 4AF6A 3QVGB 4C1NA 5I7VA 1A8IA 1XROA 5JJKA 4CDGA 4HPJB 3B51X 4A2CA 4Y2RA 2WNIA 5L40A 1IZ0A 3SS8A 1G16A 3PUYA 3TIXB 4K81B 5LMZA 3M4YA 2DOKA 2PEYA 1TO6A 1OR8A 4D56A 1HT2E 2NVWA 2X0KA 5DMHA 4JUAA 2PNJA 2CLKB 4V0LA 4Y2XA 1Y3IA 2CXOA 2AQKA 3K2QA 5C8VA 2NPFA 2VHJA 5CCBA 2GARA 1SCUA 3I9FA 4CEHA 4G24A 4K9MA 2Z43A 3FB1A 2OD9A 1LNSA 4X63A 1BCSB 1JMVA 5G41A 3ZGLA 3WWYA 3M9WA 1NVFA 1B6GA 3PI6A 4RO0A 2EOAA 2F3TA 4ND7A 4BX8A 5CAEA 1JU3A