1JL3A

Crystal structure of b. subtilis arsc
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
137
structure length
137
Chain Sequence
b'NKIIYFLCTGNSCRSQMAEGWAKQYLGDEWKVYSAGIEAHGLNPNAVKAMKEVGIDISNQTSDIIDSDILNNADLVVTLCGDAADKCPMTPPHVKREHWGFDDPARAQGTEEEKWAFFQRVRDEIGNRLKEFAETGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARSENATE REDUCTASE
molecule tags Oxidoreductase
source organism Bacillus subtilis
publication title Bacillus subtilis arsenate reductase is structurally and functionally similar to low molecular weight protein tyrosine phosphatases.
pubmed doi rcsb
total genus 47
structure length 137
sequence length 137
chains with identical sequence B, C, D
ec nomenclature ec 1.20.4.4: Arsenate reductase (thioredoxin).
pdb deposition date 2001-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jl3A00
3GL9A 5KC8A 3ROTA 5CHYA 1VKRA 3T8YA 1QNLA 1RZRD 1U2PA 4PYRA 3SQNA 3JY6A 3M9WA 4UHJA 4YS6A 5TQ0A 4F11A 4LE1A 5IBQA 4EUKA 4MRMA 4M88A 2R48A 1K66A 2V0NA 4CBVA 4IF4A 5F64A 1M5UA 4EY3A 3N8IA 2VUHB 3G1WA 1BDIA 3IP6A 5C5CA 4ETNA 4KNYA 5T7BA 3HK2A 1E6LA 5EWJA 4MQEB 3JPWA 3HDVA 3M9XA 1PNTA 3LUFA 4IGAA 4ZPJA 4EVRA 3HJFA 3KLOA 1P6QA 2IPNA 4UHKA 4W5RA 3H1GA 5TPWA 1YS7A 4WZZA 3H5IA 5IUNC 1IIBA 1LK0A 4ETIA 1R8JA 1ABFA 1SD5A 3HVRA 4HNRA 3SG0A 4XXHA 5KQPA 4NV3A 4HNSA 4QICA 2L2QA 2PAFA 3CKMA 2JB9A 4F12A 3LKVA 6ABPA 4XAQA 5TE9A 5C5EA 2PUDA 4F8JA 4YV7A 1ZVVA 3KG2A 1A2OA 1NTRA 2FQYA 3LUKA 4G0ZA 4MR9B 1Z2DA 3QLVA 4P1ZA 2E4WA 5CNJA 3SAJA 2PUGA 1CHNA 1JFVA 5ED4A 2WJAA 4W5TA 2M1ZA 4N03A 5TPWB 4GNRA 3UK0A 5JNTA 2MYPA 2RGYA 1PHRA 3QEMA 2F8TA 4YR7A 3MM4A 4DN6A 1JDPA 5BRAA 3EULA 2A9PA 4LZLA 5E3JA 1GUBA 2GBPA 3QELB 3EJWA 4MR7A 5DKFA 1M2EA 2PMCA 1F4VA 3KTOA 4YLEA 3RVOA 1YK1A 3Q41A 3L49A 1PEAA 5KQMA 5FBHA 2MSLA 4Y9TA 2E4ZA 1FFGA 5ABPA 1QO0D 3R0JA 2CHFA 3RVQA 2FMKA 2FMIA 2FVYA 3IP9A 2QVGA 4H3HB 4EVSA 5KQGA 5KWSA 2JRLA 1XWWA 4Z4EA 3LUGA 1Z2EA 4N41A 2IDMA 3CRNA 4JP1A 1Z17A 4MR8A 3MQ4A 3RQIA 1Z18A 1H9CA 4WT7A 2QU7A 1JX6A 2FKAA 1Y1LA 3N6VA 1I3CA 3LKBA 2FLKA 3QLUA 2HJ9A 5HKOA 3KYIB 2KYRA 1DRJA 4NICA 4EYKA 5EWLA 3HM9A 3BREA 2FXIA 3JPYA 2QVCA 2QXYA 1FQWA 2M98A 3CG4A 2FMFA 2PUCA 4Z9BA 4WUTA 1AB6A 2R47A 1CEYA 4FE4A 1W25A 1YTUA 3QLUC 3G85A 1NXXA 2PL1A 3CTPA 3KS9A 4MR8B 1YMUA 4N0PA 4OLBA 5JNVA 2HQBA 4O5AA 1C0EA 2QR3A 1ZESA 2A9RA 4S04A 1QMPA 4RV5A 2FTKE 4KRFA 3HXMA 3QEKA 1FFWA 5I4CA 5FWYB 4RXUA 1QO0A 1M2FA 4ZYLA 2W42A 1C4WA 2RJNA 3F6PA 3IP5A 3OMXA 4ZMRA 2GWRA 1DC7A 2JVKA 2VUIB 2WRZA 3O2JA 1S8NA 3RVMA 3LUAA 3CFYA 1ZN2A 2PKXA 1K68A 3BRQA 1YS6A 1SXGA 1JHZA 4RKRA 3DGFC 1P8AA 3EODA 2IOYA 2FEWB 2NUBA 3JVDA 4MR7B 1JWLA 1DZ3A 3N0WA 4KK4A 4PEVA 5FBKA 2QW1A 1USIA 4YRZA 3GV0A 2PUFA 2OQRA 3SM9A 2R4QA 3N53A 1ZDMA 3JTEA 4OLAA 2MYUA 3OLZA 1SXIA 4OATA 4G0MA 2IYNA 3OO0A 3HSYA 4KQ9A 4KV7A 5TQ2B 4YCSA 3HV2A 2A9OA 3LUHA 1UDRA 1KMIY 4KREA 1MB0A 3QK7A 2E4YA 1MB3A 2JVJA 4RK7A 1XHFA 1NXOA 4W5OA 1P6UA 3HUTA 1JFTA 1W9HA 8ABPA 4QPJC 1VPWA 3GA5A 4L4UA 2P9HA 3DZDA 3E3MA 3KJXA 3TD9A 1KRWA 1OXBB 3QLTA 4YO7A 3URMA 1DG9A 3OLYA 1E6MA 1MAVA 1SRRA 2YHBA 3C3MA 4TN5A 1DCFA 1RZRA 3MF4A 2NT4A 4MS1A 1D4ZA 1USKA 4D74A 2FLWA 3QX9A 4MR9A 3RVPA 5JS2A 2MSWA 3EDCA 4XARA 3F6CA 3D8UA 3HCWA 3BILA 3H5TA 3GYBA 5B3JA 4RY9A 3IPAA 1JBEA 2ID9A 3GRCA 2CD7A 3FFTA 5FWXB 1GCGA 2GI4A 3O2QB 4RZSA 1EWKA 1T34A 2JBAB 4F3TA 3DGEC 1DC8A 3KHTA 2WWVD 4KFCA 5KQLA 2H0AA 2MSKA 4PICA 3TO5A 5JNSA 9ABPA 5IEBA 5CNIA 2NT3A 5KI6A 3NHZA 1RXIA 3H5LA 4TLMB 3HDGA 1A04A 4LDAA 4NCAA 3KKEA 5TPZA 1TLFA 1Z13A 4RWEA 4FE7A 2WB4A 1DBWA 5CNKA 5IX8A 1L5ZA 3HEBA 4ETMA 1EFAA 3O1JC 3UUGA 1ZY2A 3VNAA 4LDZA 3A3KA 2WJWA 1BAPA 1Z26A 3N0RA 3O75A 5IC5A 1RXEA 4OG2A 1XHEA 1TM2A 3P9YA 4OBBA 4O1HA 2Q5CA 4RK1A 2FQXA 3A0RB 4NCBA 3LOPA 5JNWA 2X7XA 2PLNA 1DCMA 5DTEA 5T3YA 3DLBA 2B4AA 5DLEA 1A0OA 3C6QA 4Z4HA 3OM1A 1DRKA 4IMJB 3SY8A 3KCNA 1WETA 3OQMA 4G97A 3OQOA 2MYTA 4MLDA 3ILYA 3KYJB 2HPHA 3I09A 1DBPA 2CWDA 4WWHA 4WXEA 1D5WA 1EHCA 5DGCA 1JYEA 1NXSA 3E61A 4EVQA 2IPMA 1U8TA 2VYCA 3TX6A 1QP4A 4N76A 2VK2A 4MS4B 4O1IA 4QYMA 4RU1A 3T95A 3F73A 3DLHA 1Z25A 1KRXA 2L18A 3HZHA 3O74A 3TB6A 3NHMA 4IILA 4Z4IA 3C97A 3UKJA 3H1EA 5EWLB 4RXMA 1TVMA 1ZGGA 1ABEA 4RK5A 4G0QA 1ZH4A 5IUKC 1QP7A 2HQRA 3OLVA 3EAFA 1MIHA 1ZH2A 3Q7RA 4G0OA 5PNTA 1LJUA 1L5YA 2H3HA 1NXVA 3Q15C 4RKQA 5TQ2A 1LBHA 3O1HB 1QP0A 2FEPA 1MVOA 2RDMA 3OMWA 1URPA 4MS1B 2QZJA 3C3WA 5TPZD 2I6FA 1FSPA 3RVRA 1GUDA 1PUXA 1NXTA 3T38A 2F8SA 2LUOA 1U2QA 3O1IC 2FN8A 2YHAA 3EGCA 2L19A 2QV0A 3GT7A 3OO1A 4MAAA 3OLWA 4Q6WA 3W9SA 4E7OA 1NXPA 4D6XA 2LBPA 1NATA 3I45A 4H3KB 4G0XA 3C3KA 1EWVA 3GWGA 3NBMA 2ZWMA 1YK0A 1F51E 2R25B 3BRSA 1ISSA 1P2FA 2P4UA 3CLKA 2AYXA 3FFWA 1U0SY 4IRXA 4MS4A 2N9UA 4MLCA 3RVSA 3LUDA 2E4XA 3EQ2A 3H6GA 4G0PA 4W5QA 3QLVC 4MRMB 1JH9A 1NXWA 1YIOA 3CNBA 4XFKA 3RVJA 2RJOA 1JLKA 4MS3B 1ZHHA 2NZUG 1KGSA 1NY5A 3LTEA 1QPZA 4DQDA 4Z4GA 1DBQA 1FFSA 1DCKA 1HEYA 2CHEA 2AYZA 3RH0A 1M5TA 3T6KA 3K9CA 4QYWA 1E2BA 1QQAA 4Z9AA 1CYEA 3I42A 3ILHA 4KVFA 3CZCA 3MIZA 4TMYA 1QKKA 4LRQA 3LFTA 3H75A 4FB4A 1BDJA 2IPAB 3H1FA 3H5OA 3LMKA 5EWMA 2BGGA 3EQZA 4MS3A 3GBVA 5EWMB 1B00A 4E7PA 5JNUA 2GKGA 2DRIA 4B09A 2OENG 3QX8A 5IUJC 3N0XA 5EWJB 4Z4FA 3FGZA 2J48A 1VLZA 2B1JA 1JFSA 3MYYA 3FFXA 5B3JC 3B2NA 2WY2D 5TQ0B 3I5AA 4Q6BA 3D02A 2NZVG 3VNBA 5JS1A 4EYGA 1ISRA 5FWYA 1APBA 5TQJA 1TJYA 1ZGZA 4KZKA 7ABPA 4EGSA 4JB2A 3CS3A 3Q7SA 3RVKA 3ROFA 3NNDA 5BQ3A 2JBAA 3GBPA 4RXTA 4JOQA 5JNRA 2JK1A 4GPAA 4JB0A 5FWXA 2HQOA 5IULC 4KK3A 4RY0A 4PZ0A 3IDOA 4KPYA 1Z12A 4Z4CA 4RK0A 4RS3A 1RNLA 3A0UA 4ZJPA 4MQFA 2IPLA 1AB5A 2ZAYA 4OTZA 1YVUA 4MQFB 5HQJA 3RVLA 2PUEA 4DADA 3M6MD 2O20A 2LPMA 3HO1A 2FEKA 5BRJA 1JL3A 3IPCA 3N75A 3OM0A 4P98A 3Q9SA 4Q7EA 3OQNA 4JASB 1DJMA 1E6KA 1PEYA 2ID7A 3HUUA 4JA2A 4MQEA 1J56A 4RK6A 4D6YA 4JAVC 4RK4A 3O21A 5GOTA 5GQSA 4F06A 1YMVA 3Q7TA 5HSGA 1DP4A 2FMHA 2XDYA 5CNMA 4YGXB 3CZ5A 4S05A 4WXMA 1VRVA 1D2AA 1EAYA 4XLTA 3KLNA 3A10A 2HSGA 4Z0NA 2JVIA 1QQBA 3JS5A 4G86A 1ZITA 4KQCA 4ML3A 4TLLB 3H5VA 4HYEA 2TMYA 4IMIB 3F7NA 4YWHA 4Z99A 1SXHA 1GLGA 1U04A 1LBIA 3K4HA 5KC9A 4HNQA 1LJLA 2L17A 2IKSA 1D1QA 3LUCA 2JCGA 3IP7A 2FQWA 4EYOA 2FN9A 4MYRA 3L6UA 4PE5B 4NQRA 1USGA 1JDNA 3CHYA 5BR1A 3MA0A 1EWTA 2FSPA 3TMYA 5IEJA 4RDCA 3JVIA 2GX6A 1BVHA 2PJUA 3OLXA 4XASA 1PNRA 4YP9A 1JF8A 3QELA 3MMNA 2E4UA 2MYNA 3H5WA 4MGEA 3CG0A 4LE2A 3NNNA 4ZMSA 2FW0A 2WMYA 1OXKB 1ZAYA 4LE0A 2E4VA 3CU5A 1D1PA 3HS3A 3NNSA 4KMRA 4LX8A 6CHYA 1BDHA 4MPTA 3KSMA 1RPJA 3FMVA 5HM6A 4W5NA 3BBLA 4H60A 3DBIA 2LIVA 2LP4Y 2PUAA 2QSJA 2PE5A 5DCLA 4EYQA 1TMYA 4N0QA 5D2CA 4L85A 1Z15A 3S99A 3FDFA 1BA2A 3H6HA 3RVNA 4N47A 1GCAA 3LUJA 2PL9A 4RY8A 2A9QA 3O2SB 1JYFA 4RSMA 3SNKA 2PUBA 1Z16A 3QEMB 4G0YA
chains in the Genus database with same CATH superfamily
4EG4A 1NBMA 2X9QA 4TKMA 2Z1NA 4IOMA 5JTTA 1IIRA 3ROTA 1Z4LA 4IIVA 1QNLA 1A8IA 1U2PA 4PYRA 3RYCB 3AI7A 1JTVA 2H1CA 5ALNA 1E3EA 4REMA 2IXDA 3NYRA 1JXMA 3KFVA 4I5FA 5B36A 2DBVO 5JYEA 2WABA 1XTVA 3CISA 4MJLA 1M8JA 3SHFA 3G1WA 1TW2A 2VHEA 1JS1X 1BDIA 1DKNA 2O1SA 2EOAA 2OZKA 1FMLA 2IRWA 4I9FA 3AJAA 2NSHA 4MDYA 3M33A 4J0DA 4U2FA 3SJZA 5BQPA 4WI1A 1PBNA 3M5DA 1PNTA 1M8KA 4D25A 3OOEA 2ZE7A 4BFXA 2FDXA 5EJIA 1YZYA 1TM4E 3H5IA 3WWYA 2X2OA 3CXUA 1Y1SA 4KJXA 3WLJA 2MMCA 3KELA 2CMGA 4E5KA 1JIJA 3GW8A 1AM4D 3EDQA 4MO2A 3LQKA 5IFLA 1DI0A 3PQ6A 2O59A 4AYTA 4IWXA 5C5EA 1CNFA 4KE6A 5E7JA 5CT8A 4FDTA 4EMTA 3D7SA 4WKNA 1F38A 2Y0CA 3B8HA 5IK2A 7REQB 3OCZA 1I33A 5I7EA 2VJQA 4M99A 5T4FA 3VOTA 4B75A 3AVXA 2WVAA 3LC2O 3A6EA 4G36A 2WM3A 1J21A 4KBYA 4A8TA 4KO1S 1N1DA 3TDNA 4MWDA 1XJCA 2K7ZA 2FF7A 2ADMA 4HDQB 4KPGA 5AOCA 1UPXA 4DQVA 3UFXA 4F21A 1JDPA 4CKCB 2QLMA 3TBKA 3RUCA 3QKRA 1JSLA 2QMQA 3PENA 1DBIA 2QNRA 3JYLA 4RLFA 3UGJA 4V1CI 3ZHUA 1QDLB 4KG7A 5AJXA 5U1PA 1RQXA 3UGQA 1LQTA 4IW3B 1D2EA 5IDQA 3CN9A 2MSLA 2J3IA 2E4ZA 3KALA 2JIDA 2PUHA 1TD1A 5E6RA 3MZ0A 3W6UA 1W46A 2Z56A 4PFQA 4WFJA 4I4TF 1DIOB 4N49A 4A8JC 1UQUA 2JRLA 2W2QA 3C7DB 1KR2A 1EUCA 4R6XA 3E9RA 2WJ3A 1XX6A 3HCCA 4RKYA 3H9EO 4UUQA 5DW0A 2ZUWA 1VLJA 5A5GA 3AL2A 5AVZA 3IQIX 3RRYA 2GVZC 5A05A 3N6VA 2I76A 4B4WA 5ALGA 1RSZA 3NGXA 2XUAA 1NLMA 1E5XA 3GF4A 2FF5A 4KGZA 2E7ZA 1VQ1A 4TS3A 3MWDA 2FXIA 1AT1A 3R4CA 4YAWA 1FQWA 2VF7A 5F7JA 4DG8A 3GC6A 4GZMA 1PBTA 2ZSDA 3BHNA 1SH7A 4Z49A 4Z4GA 4RENA 2AF3C 2FWBA 5LBIA 1H2YA 3OSZA 4F7DA 3TK1A 4AN4A 1DOZA 1EUDA 1FYEA 1H2ZA 4JI1B 2QRMA 3L41A 1IJKA 4B85A 4P0QB 3VZSA 1Q3HA 1WXFA 3ETJA 3BN3A 2V5UA 3QBTA 5BYKA 1QC5A 3BRCA 1U9IC 1QMPA 3QA9A 3RSZA 2R6HA 2IC5A 5I4CA 3N8GA 5SY4A 5AVWA 3M1AA 3WYEA 1G6HA 1W5SA 2C4TA 3L05A 4LJ5A 4E0BA 5AXBA 4LNUB 3O6VA 4ZQEA 5HKKA 3SIRA 4CCYB 1P62B 2WHPB 4G9BA 2OVFA 1KAQA 5DB4A 4D4IA 4RMHA 3ZV5A 2IZ0A 4B4DA 2JF0A 3V1YA 2HC9A 3U60B 2JLWA 4A2PA 1T5SA 1XDSA 1H0SA 4OREX 3DGFC 1C9EA 4P9NA 4B74A 5KWVA 3U4QA 1CUVA 1ZSYA 4A6DA 2NSDA 1TQ4A 3GN1A 4M9SA 5DSZA 3G2HA 4F2HA 3ND5A 4KQHA 3QHPA 4HN4B 3FAKA 3QBJA 5JMWA 5DN9A 2OQRA 4Y3UA 2R8BA 4LC0A 1SHTX 2Q7XA 5BXQC 5LZ9A 2ZXUA 2VK8A 2BMJA 2NXJA 3WGNA 3EGDA 2ZPTX 4LYAA 2YY6A 5BRNA 2ZDGA 3OT1A 2HI0A 2YW9A 1EM6A 5ARCA 3MTGA 3GH1A 2P2CA 4AJ1A 4LF8B 2JVJA 3UXYA 1OIWA 2LWIA 2JEYA 1FQJA 4JL6A 4PPYA 4PQEA 5DYWA 3HZZA 5AUQA 3ZQUA 4L75A 1DMSA 2VT3A 3N8DA 1QIMA 5AVQA 1EA5A 5LLDA 2CFOA 4V0NA 1HNZB 3CZQA 4LQCA 4UAUA 1CRQA 1F5SA 3AF3A 3KJXA 1UC8A 1KS9A 4RD2A 5LQSA 3EAGA 1G1AA 4M8IA 4ZU6X 1ZZGA 5CJPA 2CF6A 2EFCB 2YHBA 1XJ5A 4XUGB 1HI9A 1WXWA 3QW2A 3R6LA 4K9PA 4PAOA 1Z8FA 1IPEA 1VKJA 4V02A 1SU6A 2GKSA 3TINA 4ZHSA 3V3TA 3DLTA 2GTIA 3HNOA 3OZTA 4O4HA 2FLWA 5DCYA 5F5NA 4ZC1A 3FNEA 3AESB 3SQMA 3WJ2A 1KJWA 3K0AB 4IDFA 5DWDA 2AR9A 4AUNA 3BILA 1O96B 2ZRFA 3D81A 1EEHA 3DEFA 5IDVA 4B7UA 2JJ1A 4E22A 1J2EA 3AUFA 3BFVA 3ESAA 4QO8A 3GRCA 1QGUA 2ZRDA 4CMIA 4D3YA 1Z4QA 4L3OA 3P20A 4Q39A 1KOGA 3UEOA 4HEJA 1QGDA 4HB3A 2QUZA 4ZCMA 2QXUA 4M7WA 3P9PA 3IP3A 4GBMA 3IGFA 2Q0SA 5HS6A 4AWAA 2AF4C 3MHTA 2EKLA 1IEQA 1XXHA 1Z5ZA 2G83A 3NHZA 1Z38A 1G17A 3VAZA 1U2TA 3LOQA 3IR5A 3W4JA 1HUQA 2D1YA 3LBHA 1WG8A 2HKIA 2C2WA 3V1TC 4L51A 4RM2A 2B1GA 4PQGA 3S1AB 1I6WA 2HXGA 3LKZA 1OREA 4I0WB 3QTLA 1JI3A 1ICEA 1NYRA 2Y1CA 1XPOA 2HWWA 3Q87B 3RSSA 1SC9A 3O9MA 1GR0A 3HKDB 1KY3A 3FYTA 1GNRA 2YFQA 5CXQA 4XWYA 2LGJA 2YZMA 4HQOA 1GRNA 4RD1A 1IAQA 3OAAA 1C1XA 5TMPA 3PF8A 4FYYA 1RMQA 1OBVA 3PT5A 4B8ZA 2YXBA 3H2SA 3WGTA 3E3OA 2DCUA 1YF3A 2B4AA 2ZTUA 3LBNA 1BHSA 1UOOA 2G80A 4IL5A 3DE3X 4PBRA 1ZGJA 3A7DA 5BQ5A 4BVFA 5JSKA 4IDGA 3UCXA 3R5XA 5JS6A 4C6TB 2C8JA 2Y3IA 2AMJA 1C8BA 5ECYA 1J0XO 4K6HA 2O8EA 1N5JA 1XU7A 3HYTA 5KYGA 3M34A 4JMLA 1GUFA 2IE0A 3OHMA 1T2CA 4M6WA 5H83A 1CR0A 3D6NB 3TW6A 3GVPA 3WQQA 1KK1A 3BVPA 5IPFA 3S8YA 4C03A 2QDXA 1FMCA 1FK8A 4LCEA 1I4TD 2IH2A 3GGDA 2XBMA 3ZWNA 2I6UA 1L5VA 3AJDA 3BFXA 3JCZA 3F73A 2J46A 1E0DA 1LLQA 3B1KA 1H9AA 1W35A 4RCVA 3W1VA 3N3BC 3Q3IA 3LWDA 1SZJG 3MD9A 5DX8A 3S0JA 3ODGA 3ZBUA 1L8XA 4PG5A 1ZGGA 2WWRA 3LU1A 1L5OA 3WDKA 2AQ8A 1QP7A 1QJCA 3BXEA 1P7PA 3EIHA 3JQEA 1LEHA 5TB5A 4YFVA 2H3HA 3FXAA 4K6OA 3AG5A 2FEPA 1BXGB 3QJ5A 4IG4A 2ZUTA 5CW1A 1J07A 3AY6A 4POAA 3T38A 2J9GA 2QTZA 1GG5A 4JYBA 2W6JA 4XE5A 4PX5A 3OO1A 1VLLA 1T6NA 2O7NA 2I4MA 2FRXA 4UAGA 1PG0A 1QP8A 4F92B 4ZZ3A 1A3CA 4BKRA 5DM60 3LXRA 1EWVA 3CLUC 2WQZA 2AG0A 4S3MA 4F3NA 1Y6JA 1E6UA 2QZPA 1D4AA 3BRSA 2GKOA 1J70A 4OBEA 4BQPA 2PU5A 4QPDA 3GZNB 1HL7A 4MKFA 4ND7A 1ISHA 4ZO9A 3S2UA 2QTWB 1G60A 4FW9A 3VHXB 4RTOA 3GLIA 3D4OA 5EXDA 1J2RA 5EIOA 1JJ7A 3Q2OA 5CG2A 5BORA 4QSHA 4JR2A 2APJA 2MT9A 2KMLA 4I6EA 5FB3A 1FPQA 1QPZA 2QVBA 2WTXA 4JLKA 3Q11A 3C8ZA 5C8YA 3A36A 2WMNB 1AGXA 1ZUNA 3UVEA 3NWJA 5DVZA 2B20A 4GRIA 3HJNA 1F5NA 5DGXA 4BPBA 4KODA 2C5SA 1DCKA 3RT7A 1KO4A 3O38A 4D8YA 5M29A 5F1OA 1Q0QA 2HN9A 3T6KA 2OC4A 4QPPA 5EN4A 5CA0F 1OTYA 3ZWDA 3IALA 2GJSA 3RV3A 4O63O 1MU0A 1QHXA 2AXPA 1CBUA 5FL3A 3I42A 3O4RA 1LW7A 3AHCA 4RVDA 1U7XA 3H7AA 4HN2A 1TIBA 1U6KA 4P3XA 3EMDA 2C2XA 2B4TO 2R1TB 3RBZA 2BFBA 1NWCA 3O4VA 3TSWA 3VC1A 2YIVX 5HCIA 1ZN7A 3ZI0A 5JNUA 1S3GA 2GKGA 1HDXA 2D5IA 3NEPX 3TCKA 1VBKA 2HTEA 4AQYB 2YJZA 4Y2SA 4Z4FA 3ZTYA 2Q4TA 2X2FA 3G6WA 4TLBA 1SY7A 2NVWA 1M83A 3ENQA 4CMAA 4NJEB 2YASA 4WNAA 1CF4A 3KQSA 1JB1A 4OHRA 3BXXA 4JJEA 2FWRA 3RFUA 3FOEC 1AS2A 2CE2X 1NMEA 5BO5A 3L4BC 3L4SO 4DA6A 2QRUA 3ORYA 4XIFA 3K9LA 5UKDA 2X0DA 2RK3A 6NULA 3VUFA 3U3XA 3GPLA 2XE6A 3F9IA 4AJOA 1MP0A 5JXGA 2WJPA 3GRYA 2UV8A 2IH4A 4JT8A 2QF7A 3GOQA 1J0DA 1RYFA 1GN9A 2WHYA 5J43A 2RAVA 3FTEA 3PXDA 4R1TA 4LYEA 5B64A 1PYDA 4AIRA 5BN5A 5C5IA 1C4OA 1N6NA 3R44A 5HYVA 4ETWA 2DQSA 1C9NA 2WTNA 3BK7A 1MW9X 1O8BA 1UWVA 1GSIA 3C3CA 3E5NA 3GDHA 3H2HA 3ANMA 1WCYA 3MBKA 3OQHA 2IOHA 4OXXA 4FWTA 4CMGA 3MEQA 1N3YA 1UM9A 1PTKA 4LA4A 4ZJYA 1T9ZA 1J00A 2R8PA 5CUQA 4ME6A 2NXCA 3HEAA 4Z1MD 1JAHA 3G49A 2F3TA 1JIKA 2NTYC 3IMGA 3HUUA 2ID7A 3FF4A 3CUVA 4JA2A 5IDWA 3ER9A 3VMMA 1YRBA 1T0JB 3D3QA 2BI7A 3OT1B 2DU8A 3N7AA 1GQ2A 3OJCA 2A4KA 4J16C 4BVHA 4KAAA 3Q7TA 5CNMA 4FOLA 2C8LA 5B12A 2K7FA 5EKXA 2JAQA 2BAGA 2E49A 5B53A 2IS1A 4Z0NA 1SXJD 1EKXA 1KC3A 3C41J 4BNIA 5INTA 4EZIA 4WXPA 2WUGA 5JEDA 3D5TA 1R9JA 1YS9A 3D6VA 4PGMA 1WZUA 2BFEB 4CL8A 1S1MA 1TD9A 1P0IA 4PFSA 3RK1A 1NI3A 5B6JA 3VTKA 1QVRA 4IG9A 5AKJA 4AK9A 2X7HA 5TF4A 2WPNA 1R0CA 4Q3DA 2XCUA 1ZA2A 5KYTA 2VEDA 4ID9A 1A9XA 1B6RA 3L92A 5KVQA 4BP3A 2CFIA 5DOVA 4DMUB 4CTMA 1KI8A 5CA1B 1Z0JA 4OL9A 2Y93A 3BG5A 2FSPA 2F4NA 3ZVLA 2GX6A 3OLXA 1ZN8A 2G70A 5ALHA 1R7RA 4YCNA 1JKXA 5HIMA 3OI7A 4U0JA 4UVIA 4E2YA 1GA4A 1Y6FA 2W0MA 3WGHA 2J9YB 1HT0A 3MMNA 1ZW1A 2NPIA 5CIQA 1X86B 3UOWA 2W2VA 1E1LA 2FZEA 3PIIA 3WL5A 2PUTA 1Q0HA 4KRGA 3WKCA 3C6XA 1TCUA 1JHUA 3IQGX 4GM1A 2OVBA 2B7CA 4RHXA 1XMOB 6CHYA 1T29A 4YK7A 1YQ9A 1N7JA 1RBMA 1H1LB 3L1VA 1FEZA 4P35A 2F9MA 2EW2A 1P75A 3BD8A 4IJMA 3RBVA 4CU2A 4DMCA 1Z62A 3SHOA 1O87A 4DJTA 4W5NA 1QCCA 3BMXA 1XQXA 3M6XA 1JU4A 4LY3A 3DBHA 5G4KB 3TZBA 2QM8A 1KL7A 3THRA 5E6SB 5KNLA 3NIDB 3LG2A 1II8A 1UPTA 3PVCA 4ONEA 1PHPA 1QOZA 1WKVA 3L1KA 3M6UA 3S99A 2B8TA 3BIJA 1BH6A 4ALIA 1BQ3A 3V8NA 2ODBA 4ESVA 2YV2A 4DLVA 3AQ4A 4PAWA 3BWMA 1DQYA 2H63A 1MO4A 1H5QA 3CW2A 4EPXA 4WACA 3G6KA 2YQ4A 1EFKA 4U39A 3THYB 3TIXB 4G4GA 1FTQA 4JUFA 1Y8ZA 1NHGA 4DR7B 1O77A 1QM5A 2Z3WA 3EZNA 4G0YA 2ZE5A 2C9DA 4RJTA 4AS1A 3W5SA 3ITNA 4GWLA 2BFAA 1I9GA 3D3JA 2ORIA 4OB6A 1S4MA 1T13A 4XOUA 3VPSA 1RZVA 1R0RE 3OZRA 4A8JB 1TE2A 1U3TA 5BR7A 3K0CA 3I4CA 3PYXA 2OXEA 4LBWA 4LE1A 4BFSA 1O94D 3I37X 5BMOA 3FUUA 4IF4A 3NBUA 5F73A 2VUHB 1W5FA 1E7MA 2JHCA 4NARA 3WLEA 5DTRA 2AE1A 3TQCA 4I81A 1J2TA 2POQX 5JHGB 3OUTA 1ID8A 3JPWA 4I50F 2BFMA 4PZDA 2PPLA 2ZI4A 3EPLA 4ZV7A 1D7AA 2MU1A 2ZYVX 1QRUA 4KGVA 4XFJA 2NO6A 1EFPA 4D92A 4W7SA 2ZIUB 3PPIA 3NV9A 3ZLBA 3HXLA 1NX9A 4C7VA 5TARA 3ZC3A 4YMUA 4Z1OA 2PZEA 4MHSA 3SQOA 4M55A 4D0SA 2P6MA 3PX3A 4XXHA 3VH1A 5CK4A 4PW0A 3OVMA 1SQFA 4RGBA 3BE5A 2JB9A 3FLMA 3GP5A 1Z0SA 3NGLA 2B98A 1TYZA 2D54A 4DW8A 3NH9A 1BCSB 3H42B 4A16A 4YAIA 1XZDA 4TRMA 4A91A 5EZSA 4N65A 4P1ZA 4BO3A 2VYVA 3PNLA 4P4UA 5K3DA 1UJMA 1OA1A 3ZE0B 3ZCQA 2R1VA 4Z7QB 1LDNA 1SXJB 2M1ZA 3OECA 5BVHA 1E64A 3KQWA 5D7BA 2PYDA 3KR9A 4LJ6A 2RGYA 3AF1A 5ELLA 1CB0A 3E27A 3S44A 3IEMA 1TU3A 2MINA 3OIUA 4Q47A 4MRRA 4D8TA 4RTNA 4GOOD 1HYGA 2C04A 4L5BA 1UZLA 3EULA 4JJ6A 3UNXA 2B92A 2OESA 4JY7A 4AZWA 2V6GA 4P8RA 4EJSA 2FWJA 4RETA 5F52A 1FDOA 1M1NA 1J24A 1IZ9A 3W7AA 2PWYA 1BJTA 1NJ8A 1Y1RA 1Q1BA 3DW1X 1P33A 2FWIA 3CYFA 3GGOA 3I39X 4HOYA 1QO9A 2OB1A 5ABPA 3TCNA 4DV6B 4JZKA 3EWAA 4YBZA 4DQKA 2FMKA 2I2AA 3KEFA 3PFGA 5KHOC 3TB4A 5IANA 5K8IA 1VKZA 3B3AA 3HVHA 2P1ZA 3S2GA 1UBCA 1PNQA 4X3PA 4Z4EA 3HFJA 3WBFA 2QZ9A 4MR8A 4BC1A 3UMVA 2CLCX 2CNLA 3BTUA 4D8UA 4EY4A 2UXDB 1JQKA 3B2EA 5F2NA 4BN5A 2C54A 3SWWA 3ZIUA 3G0CA 1MB9A 1VJCA 5EIBC 1Z4KA 3MQ2A 3RD5A 3U39A 3ZE8A 1CR1A 2ODTX 1S9HA 2DPYA 4YJFB 2JFWA 5EWLA 5TGDA 3T3GA 5CAEA 2O19A 1FXUA 3QF4B 3GCXA 1ZGHA 3K8ZA 3F3SA 3W78A 4UNRA 2BHTA 4OXNA 1GL9B 1IDN1 1PL7A 4GVPA 1CSEE 5GJWC 3O7MA 5I6DA 2VDWB 4NCIA 4WK0B 1NMSA 4Y6SA 3ZTTA 1AV7A 1E20A 1MORA 3GGCA 2EW1A 1B43A 3O4HA 1JSXA 1OGJA 4JVNA 4MB0A 3ZZ0A 1NMXA 4P3KA 3GVCA 4ROSA 3NTLA 1Y4UA 1R18A 1QZTA 2A9RA 2Q6LA 1R0LA 3AWIA 1M0WA 4G23A 4H08A 4JU8A 4NOKA 5D84A 1L5KA 3GRUA 1LDYA 1OXXK 5T5QA 1ETHA 1M2FA 1U1FA 2GFQA 5IAEA 3VGPA 2E2WA 3JAWA 3ZGOA 3ZWKA 5DLQC 1PX2A 3VZQA 3AUAA 2HF9A 2BGIA 3JQPA 4JP8A 1S8NA 3E3NA 2QRJA 2QN9A 2ZYSA 2BFFB 2GHQA 3BH6A 2VQDA 3HI4A 3INYA 2Z4TA 3F90A 4UHBA 3EODA 1J0CA 3EXIA 4KDCA 5H02A 1WHTB 4PN3A 4JJFA 3OURA 3N0WA 2YBDA 1Q1ZA 4GZ5A 4Y1EA 3RIHA 3S2YA 4XVUA 2OYSA 4PEVA 4FXPA 3T3OA 1TM5E 2BHRA 5F77A 2V7VA 3UOAB 4C87A 4PVDA 2JJ1D 1D2RA 3JQAB 3U3OA 4CMEC 2GBLA 3IMFA 3TPZA 3RRXA 2QEQA 2QNIA 2RGNC 4QT0A 1DC3A 3R74A 4DC0A 4WN9B 1L5HB 2IVFA 2V6JA 4KV7A 1YQXA 1IULA 1YONA 3TD6A 5J2TF 4XI9A 1NW4A 1Z0AA 3BIWA 1KOLA 3F5SA 1TO1E 1X1RA 2QQGA 3LNTA 3MRSA 4FYXA 2C5FA 1U8UA 1RWBA 2F1IA 3PDIB 5SV2A 4QQKA 1OFUA 4NMMA 4EHJA 2OP0A 4FCTA 4YJ2B 3FTQA 4EG3A 3DZDA 1SQ5A 3BTVA 1HY3A 2J5QA 4RZXA 4CQMB 4KWTA 2RGRA 4R54A 4WLOA 1E77A 3U4AA 4DB2A 1SBZA 3GLIB 2Y4OA 4DIEA 2HU5A 1C3OB 3NXSA 5FXMA 2GBLC 3WYNA 1D4ZA 1YUNA 4R7ZA 1GTJ1 5H3LA 1KOFA 1USVA 2QG6A 2RBGA 2IEYA 3DNMA 2JHAA 4XSGA 5DBHX 1U8ZA 3IXMA 2WJYA 3G0DA 1QKIA 3D8UA 2IQ5A 3EY9A 5HP4A 1RPTA 1E9EA 3GYBA 3OFKA 1OLUA 1P2BA 2VRCD 4X97A 4RABA 1SCQA 1JBEA 3V8VA 2CEAA 2IHJA 4REOA 1VE3A 1YA8A 4IV0A 3HA2A 1V5FA 1OH8A 3O9ZA 4CCYA 4CV0A 4OFZA 4C4AA 1RCTE 2ZQYA 3U09A 4EBBA 2H16A 2FY8A 3QBVA 3NWBA 2CVOA 2QRQA 1EDOA 2MSKA 3BM5A 4FHZA 4BNUA 5JAHA 1EVQA 1FDSA 2ORVA 3CLUD 3DVAA 3TO5A 3OOJA 2UUCB 1KAGA 3EN0A 1XCLA 2IYOA 2P2GA 4G5QA 4LBZA 4G1CA 3HDGA 5ULLA 1B2LA 1DWQA 1JLRA 4GM4A 5EHGA 1K3UB 1WCIB 2XOKA 4AMVA 1CFZA 5I7HA 1DBWA 2G63A 5A5DA 4QT4A 4Q12A 4G9GA 4EF6A 1WXGA 4WECA 1ZY2A 3VNUA 3BF8A 5JY6A 1YQQA 2Z1MA 5LP6F 3K0BA 3AF6A 4F56A 4P4SB 5JARA 4M9CA 1C2YA 1JKFA 1V39A 3UW1A 3JQ6A 2ZWAA 4D9HA 5L51A 4RK1A 4FB5A 1A50B 1YRYE 3R7WA 5MGBA 4C0KA 4I50A 2X7XA 4Q9NA 4P83A 3SX2A 1HNWB 5DTEA 2R6GA 4QUDA 4IXMA 5HZGA 1DRKA 1EH5A 2AWNA 2P9GA 2RKOA 3VDMA 2ONJA 3W9YA 4IOKA 1N2IA 4UKDA 2FMXA 1VGQA 2N1MA 2JI9A 2PT6A 1L8OA 2ZRNA 4M9UA 3WR5A 3R3VA 3N6XA 3FN4A 3L9XA 4Q0MA 4EJSC 1D09A 1H0KA 2HPHA 1YOVA 2WEKA 3R6GA 1ODTC 2F67A 1XNJA 4FILA 2O54A 4WKPA 1U8FO 3DBVO 3WRXC 4CM7A 4TKUB 5A5EA 3LF1A 4U7DA 1N6HA 2IPMA 4K2AA 2UZ1B 2WFLA 4RYLA 5JT1A 2CV2A 2D1RA 1G20B 5LA6F 3RAGA 3UYKA 5FJIA 5JFOA 4IZOA 1XRNA 4HGNA 5K0FA 1G0OA 2DFLA 3LYUA 3DZBA 2MMGA 4Y2XA 1KE1A 1LY1A 2WP0A 4G4SP 3UAGA 1Q0ZA 3HB7A 2OSVA 3BB4A 5LYJA 4A2WA 3NTUA 4II7A 1TVMA 1W48A 4M1WA 1VFNA 2DE0X 3NT2A 5A7GA 4LF5B 2GD0A 3DFFA 2CXSA 2QTAA 2QT1A 3EAFA 1U2DA 2QRPA 3HDYA 3UUEA 4XRRA 2RC5A 2R85A 5J59A 1LJUA 4BTVA 4LJYA 3UBTA 1NDHA 3K1YA 1DC4A 4RH1A 4HXEB 3TXXA 1C1HA 1DBSA 1O8CA 4UHDA 5B1IA 2ZR7A 3OMWA 4BCCA 1DTWB 1PW7A 2IHYA 5CYOA 3RVRA 1ZCAA 5JZ9A 1XZAA 5AJVB 5BPFA 4NE7A 2P35A 1CQIA 2FN8A 3O1IC 5J63A 3W4IA 3F5FA 5J40A 3VXKA 2ZZNA 1MJ5A 2QSUA 2WICA 5BVHB 1I5OA 3E1SA 1G21E 4G0XA 1WP9A 4EDFA 4UVHA 2BZ0A 5I7FA 4L6IA 3WK9A 3T12A 5DTJA 1H6BA 4JP2A 2E4XA 2JARA 2LZ0A 4TTVA 4D7AA 4EHIA 3QV1A 3BZUA 2VSYA 5SYAA 3UN1A 3R0QA 3HG7A 4XFKA 4QO7A 3OE4A 2R7LA 3LQFA 5HHTA 5H82A 5HK9A 1K2WA 1ZHHA 3LRPA 4ZYXA 1SUEA 2X0FA 4BN4A 3KD2A 3RUAA 1VSTA 1PR5A 3PGLA 1M5TA 2EL9A 4HZGA 2QW8A 4BQFA 5G0UA 1W0KD 1ZIYA 4DLUA 3NAZA 5K0GA 1DV1A 3SYLA 3A9WA 2EEZA 3M81A 4HNAB 4TTPA 3FSRA 3NEJA 3CZCA 3MIZA 3PGXA 1H4QA 1BMDA 4ZT6A 1K7XB 3KJEA 4DQLA 1ULUA 4CE6A 3H9BA 4PVCA 1RRKA 4MS3A 2BKUA 4FMPA 5K1ZA 3ROPA 5E0OA 5EJ9A 4FFBA 1HRKA 3E7DA 2VSNA 5F98A 1XCPA 2BKLA 2Y71A 4LTDA 2P7IA 2UYYA 1ZZEA 2KLBA 4LECA 2X13A 2OK8A 1ZMOA 1ADBA 2A3RA 5TS3A 3I04M 1JFSA 2XWPA 2QAIA 4QBTA 4PF1A 1UIRA 2JGDB 4B3XA 5KUTA 4F4DA 1KPGA 2RGXA 2VYVD 1C29B 1Z74A 1ZISA 3RTAA 3SBDA 3TE7A 5J47A 4GE3A 1YT5A 3IT3A 3B7WA 4JC8A 4B17A 2YIDA 1CQJA 1KY2A 1QPBA 1UWLA 1WSBA 4TTSA 4LWZA 5JUWA 1NLYA 2XMDA 1LA2A 3AVPA 5JNRA 5JPIA 5TS2A 1YHYA 1M34A 1VC2A 2HQOA 2OO5A 2GXQA 1AGRA 1GLNA 1UMCB 4X62B 1W49A 2VQFB 5JBNA 5A4JA 3D6TB 3CY6A 4JHXA 1ORHA 2EGGA 3KSBC 3GZ4A 4HGRA 4C7MA 3BULA 4RTKA 1GGEA 4HQKA 3U81A 3K30A 1M1XB 3FPHA 5DZSA 1GFZA 3EH1A 2PUEA 4CDNA 5C8YB 3NIWA 2NSJA 3CJTA 3EXFB 4YBRA 3GEIA 4YJHB 4E21A 2QQ0A 1QGZA 3EZYA 1C3OA 3HI6A 3L8DA 3IJEB 4UULA 2GO1A 2FPIA 2C0PA 2OD9A 2IJGX 4JASB 3ISJA 1MLDA 4O5OA 4MQEA 1EFDN 4RK6A 4ZZ0A 2G8LA 2RC6A 3O21A 2Z2YA 4JV5B 4F3KA 1VHJA 5K0LA 3GFSA 2VSOA 2JGAA 3IX7A 1T8TA 1BS9A 1MEOA 1Y7PA 2WJJA 3A28A 1N8SA 3ER6A 4LDNA 1WDLA 5CR9A 1HMPA 2QAGB 2WHRA 2YV3A 4GKJB 4PC3A 3MTBA 4QUAA 5JCOA 4QFMA 1QQBA 2H8GA 2RCYA 2QMOA 3M3PA 4PQYA 2L82A 4P93A 3U6KA 3PFHA 4P54A 2VG8A 5A7FA 5KVAA 3MYRA 2I1QA 3BMCA 4B3HA 4MV5A 4EH1A 4YC7A 3N2IA 2A58A 4IMIB 1HDYA 3HZRA 2H1HA 1P7YA 1NFFA 3QM1A 4Z0PA 4MQMA 3CB2A 3IIIA 1N5DA 2WJZB 2QG4A 2QRGA 2V59A 3QNUA 1D1QA 3WGOA 4J7XA 1CXZA 1Z68A 4HS4A 2AN4A 4BJ1A 5BSKA 2FN9A 4MYRA 5FIUA 5CYFA 1WRBA 2HBQA 3DBLB 2Q50A 2Z9CA 3L02A 4OA5A 4OSEA 4Q4AA 3TBFA 4PN7A 4XRGA 3V4LA 1IU9A 5KQRA 5A3RA 1QZUA 5L53A 2YDXA 4K0RA 4XASA 3PDHA 1UBJS 2XA2A 3RU9A 2XPCA 4I66A 2Q07A 2GXSA 3AI2A 1GPDG 1ZC3A 2HK9A 3AR9A 4FHEA 4WLUA 3DEKA 2VSFA 4ZAYA 5LYYA 4OL0A 4GOND 1DXOA 3LO5A 2BL4A 1XRQA 3O2NA 4A0FA 4OEHA 3E2PA 1MTZA 3UXHA 2ZBUA 2R4UA 4X1KA 2FJPA 3U3RA 1KO8A 4TQGA 3ZHQA 3OKAA 3OZEA 4JIGA 4R9UC 4BFLA 5BW8A 1P9RA 2D00A 2IBTA 4J3JA 4IDAA 4NENB 1MJGM 3DBIA 3Q2KA 1XQ6A 2JAPA 4J2TA 3AY7A 4TYMA 3RIMA 4BRUA 2HT1A 5KYXA 4DMKA 1U7ZA 3K20A 5I45A 4RTQA 5JXJA 3K09A 4KO3S 3G2NA 2WYVA 2OOKA 3K4PA 4HTFB 5E9QA 1QGAA 2CK3D 3B5JA 1AQIA 3KP1A 4FQ7A 2YJNA 3K70B 2G72A 5AJTA 4RQAA 4PBSA 3EFOA 1NUSA 1XDWA 4Y2TA 1T9AA 3KHSA 4RQTA 3GJZA 3WAJA 3A1VA 3GUYA 4RESA 1N3BA 3A9TA 4BFCA 5KC8A 3CWZA 5ICCA 5KVCA 5AVYA 5D6NA 5KU1A 4OKIA 4YMLA 2ZSHA 3U4CA 3EUFA 1AHHA 1QHSA 1QV9A 2TMDA 3KQOA 5K7SA 3BF7A 3M9WA 4LG1A 3PV0A 2WT9A 4WLVA 3I72A 5IBQA 4C29A 3HVUA 4EUKA 5K8TA 2H2WA 4B32A 4H17A 1RQ7A 2C5LA 3D6FA 3JWJA 3R3YA 5B7NA 3N8IA 4PLWA 4TMZA 2ORWA 1EDDA 4UMVA 5IAOA 2SKCA 2I7TA 4WFIA 5EJ8A 4M86A 2ENWA 1U3CA 3D8RA 5ISMA 2FA9A 1D0VA 3JASB 4KITB 1E4OA 4IGAA 4QOFA 1L7PA 3V6MA 4BB5A 4ESOA 3LKDA 5HOQA 3HJFA 4EHDA 1C3VA 2H07A 2IPNA 1KEZA 2I2FA 2XUGA 4I99A 3C3XA 4FCWA 1R6XA 5AW8A 4Z0TA 2WOOA 3BIFA 3F8SA 3WNBA 1C7RA 1GZ4A 3H2GA 3JWGA 4QDXA 4C0LA 1P5RA 2PAFA 3LKVA 4X65B 1ZMRA 3NCHA 3W2HA 2AN5A 4JJIA 4LOAA 3S1LA 1P44A 1W8DA 2ID8A 4BX3A 4BZZA 2IYZA 2CMDA 2FVXA 3ZOZA 2BFNA 3FPCA 5JQGF 3IAS1 3C5WP 5DHQA 1WF6A 2CXXA 3TOXA 5DEIA 1IOVA 4MVJI 2CFTA 4YJGA 3LDHA 1A71A 3EZGA 4G1EB 2QRHA 4MV4A 5EIXA 2V8OA 3WRYA 5KHAA 4IS2A 1PHRA 3RQSA 1L7MA 3TRFA 3U49A 1F06A 1J9ZA 2Q3EA 5J1TB 3EVZA 1Z2PX 3GAAA 4PX2A 4QBGB 1US8A 4GXNA 2FUKA 3A6ZA 4AT1A 2VNJA 5JZMA 4JEMA 1B8OA 1W5EA 1X8JA 1VB5A 3OOWA 3LZ6A 3P5BA 1GKKA 4DEYA 2F43A 4IFIA 1RP1A 2VAWA 1U80A 1Z7WA 3HA3A 1IYZA 1IQUA 3ZLVA 1E59A 3DMPA 4DJDC 2E5LB 1L5GB 2DEUA 5HGJA 1YC5A 3RVQA 1MD9A 1T8YA 2FMIA 3PUJA 4PQRA 4K8OA 1GQYA 1YKSA 4LXXA 3IIKA 3VAYA 3GCWA 2B35A 5ESRA 2P9CA 5I8PA 3EPJA 4B3IA 3DONA 1RHRA 1AUQA 1Z2EA 3CRNA 1TTQB 4JP1A 2WYOA 2QU7A 4W82A 1HT1E 4R8SA 4XWKA 4KIWA 1MC8A 3FVVA 3BIOA 4DS3A 2J3LA 1RWXA 3SCZA 1A4IA 1LLFA 5EEGA 3NC1C 3BA1A 4RMIA 3PUHA 1H6CA 3BERA 1XLUA 1A7UA 3Q7QA 5CYPA 2FZWA 3TRIA 5CVDA 2BKEA 1IZ7A 1UC9A 2QXYA 2FMFA 3UJ3X 5BYJA 1X77A 2IIQA 4AP9A 1F4PA 5EGNA 4P0TA 3V1KA 2JGRA 1JSRA 4Y2JA 1EM8B 1Z0ZA 4JLMA 2QJOA 3TWOA 1Z2CA 1A69A 3PA6A 4PHTA 1SUIA 5DN6A 1YB6A 1SUBA 1GYRA 5AW3A 3KOXA 1R4NA 4HXFB 1I2MA 1C0LA 1E4YA 4Y7CA 5L8VA 4K2HA 1YCFA 3DCJA 3KZVA 1IBKB 1KDPA 3GLFB 3DW3X 3ISTA 4IDQA 4MIYA 5H59A 4MNTA 3HXMA 2IYAA 4O2RA 4ALKA 3DDCA 4NESA 3OMXA 1SZCA 1NBOA 1MJHA 2CL7X 3I92A 2IEGA 2JJMA 2CN1A 3HTXA 2AG1A 2W22A 2QR5A 3MTAA 2DWPA 5EP4A 4QGBA 4UBMA 1D1TA 3USES 1UKEA 1IMOA 5JOQA 3HRKA 3LW8A 2CK3A 2HIGA 2VH2A 4NZOA 3DM9B 2ODWA 4NX2A 4L0CA 1Q5PA 3TPFA 1MV8A 4X7BA 3GV0A 1EFRD 1SG0A 3MINA 4A03A 2EG5A 5KOJA 2AEEA 1WNTA 3DNPA 1VYHA 2VHUA 5C4GB 5HTOA 3FGPA 4PPNA 3ZDCA 1JDSA 3NHPA 2CXRA 4YJDA 3M6FA 1QOQB 4LDJA 4M8LA 1L5RA 4JOBA 4B4UA 1NE7A 4ENUA 4PZZA 2XCQA 3DXFA 2E48A 3RAPR 3LUHA 1NRWA 1UDRA 3DDOA 2Z2ZA 3BGVA 2VPYA 1RJDA 1SN7A 3FCEA 1WMDA 3I6QA 3IV6A 3FSGA 4HV4A 3RUFA 2VQEB 1GSAA 1FW6A 4OLJA 4L73A 2ZITA 4DLNA 3ND8A 1T2NA 3GRRA 1AF7A 4ACBA 3B7PA 4QOIA 3I3SR 5E2BA 3X43A 1NC1A 4UUPA 1P1HA 3B6EA 2CNKA 3L0BA 1AXRA 3ZI7A 4YHHB 4G0WA 4FT4A 2FSGA 4UE3S 2OHVA 2AUNA 1GZHB 2L69A 5CFZA 5B58T 4I9GA 1Y5RA 1UBOS 1ONPA 1RRGA 1VYVA 1MJFA 2YOFA 1R5NA 4XYLA 1F7VA 2BM1A 2OXRA 4DLZA 3E3LA 2NU6B 1P18A 2A5LA 2EEPA 4JBGA 4A9AA 4B2IA 4EECA 4D74A 1OWLA 4YRGA 2ZCJA 1CR2A 2EBFX 3DPUA 4XARA 2VF8A 3QQ5A 2NNLD 5KYYA 1TYDE 4QBIA 1WD5A 5M7EA 4QULA 3D6AA 4N3GA 3MERA 3FPBA 1XYGA 3ACDA 1NSTA 3FFTA 5A2GA 1V2GA 2A33A 4QYXA 3ZJUA 1E3DA 1Z0IA 4N3CA 4H7PA 2H7XA 2RHLA 4MJ7A 4BMDA 1KK2A 4KFCA 2BUAA 3V3KA 5D3MB 5JZOA 1BXZA 2HA2A 2ZRBA 4MDEA 3E22B 1I51A 1U9IA 3A1NA 3DCNA 4RY2A 3EB9A 2QUBA 2DR0A 1FTWA 4OQDA 4B79A 1GPKA 1NVUQ 1S8OA 1XLTC 5DJ5A 4EJ0A 2D4HA 4HFJA 3S2FA 2J30A 3V8RA 1N5IA 2ADFA 3N2NA 1OASA 3PQEA 4MZDA 3TFWA 2GESA 2JBWA 3BWYA 3VR3D 1VGVA 2JFPA 2WF6A 1U9CA 4N40A 4M53A 4ZVRA 4U7JA 1ZGAA 2P2SA 3CBGA 1Z26A 2ET6A 1COZA 1ZCBA 1TM2A 1W88A 2C0QA 2OLJA 2ZQ5A 3P52A 2Q5CA 4OG2A 2NSLA 1Z5NA 4URWR 3SICE 4TXJA 3V2HA 2BFCA 4C3ZA 5A4MS 3PRJA 3MMPA 3A4YA 4Q3BA 1N2BA 1EQ2A 5CHEA 4DILA 5FLKA 1QX3A 5I7OA 2GLTA 2EDCA 2DWQA 3AB3A 3OIFA 5FNVB 1GSOA 1RKQA 4IJKA 4LI0A 3UMFA 5JSZA 3BFKA 4H1VA 3KCNA 1PZMA 1WETA 1UXGA 3QHQA 1TCCA 2J31A 3ONVA 1K5DA 2AMVA 5HWSA 4QJIA 1LKZA 1Q1AA 1DFGA 3GFVA 4X1IA 4ZD6A 3EMBA 2NADA 1DELA 4F8YA 1R9GA 3AEZA 4URHA 4EB3A 2I99A 5GAJA 3HU2A 4RH3A 4FFRA 4BGDA 2R44A 5LQAA 2N46A 4IEFB 2CXTA 2IPXA 2DPXA 4NJOA 4ZAGA 1L2TA 1AU9A 2Z4SA 4ZVTA 3SIWA 3BC1A 3G23A 1HFWA 5HFAA 1TUIA 3Q72A 1QP4A 2VK2A 2IHKA 2RHHA 2OAP1 5AVSA 1YBHA 2ACKA 4Q1EA 2D5LA 1VE7A 2EQAA 1AZWA 3ZNOA 4BE7B 3GAZA 4FOPA 4GIBA 3LQRA 4IILA 4RIHA 3PKZA 2Y0PA 2WYHA 3DULA 5ERYA 5C8VA 3ETGA 1ILEA 1AURA 4TV9B 2NVOA 4PG7A 2AFHA 2BKAA 5CA1A 1R9MA 3G0BA 3GMTA 2OY0A 1QRDA 3L77A 4LSGA 4G0OA 4HH0A 1XDBA 2HO4A 3UQYS 1NXVA 4LJKA 3TBHA 1YA6A 1GRVA 1UFQA 3M3HA 3OQJA 4WA8A 1JILA 5ESXA 4CLHA 2DC1A 1TOAA 3IOYA 3LP5A 4PGHA 3H8WA 2RDMA 2BEVB 3LDUA 5ECDA 2XA1A 1FFBA 2H7CA 1NRXA 1URPA 1Z0FA 3DDHA 3EIWA 3HYSA 5TPZD 4EFMA 3WWPA 3TD2A 1UPBA 2PX6A 3RUEA 5HRUA 1RCFA 2IP1A 3HYNA 3H9GA 2ZJYA 3IS3A 2A9JA 1ATIA 2B4RO 2O8VA 2O5VA 1L3CA 3L06A 3G7SA 2XMZA 2GEBA 1EZZA 4MUHA 2HCBA 4ZHQB 5A3QA 2I91A 5FUBA 4U5XA 3SDBA 2HNKA 2O14A 3C3YA 2P4UA 4HP8A 3CLKA 1NUAA 2FSVC 1R15A 2O0MA 1F17A 1XFAA 4IRXA 2CEKA 3KSAC 1HEUA 4GXQA 3WZMA 1S7GA 3QLVC 3UJHA 3X1ZA 2G5GX 2V54A 3VR1A 2Z1DA 2C29D 4RMGA 1X9HA 4KLZA 2ZR9A 2W5UA 3WWEA 4KQJA 1NBEA 3LVRE 1YZQA 1AKQA 1JHXA 1RQLA 2LR0A 3CO0S 1OXSC 1K3FA 3GELA 4V24A 3TTWA 2C0CA 2J5BA 2WJGA 5FOSA 4EB0A 3TLAA 3DD1A 1KDRA 1SFRA 1VL1A 3PHIA 5FJJA 2GERA 3L4BA 1N7IA 4X66B 1G66A 1T2VA 2HFKA 4LXIA 4XYEA 3I5YA 1XZQA 4FHCA 4E1AA 2ODNA 3GVXA 4US1R 5LZ7A 1QKKA 4R41A 2I34A 5T8KA 2PL5A 4JUBA 2W6PA 4CFYA 1T0UA 4EWLA 1XSEA 3PL5A 3VSEA 3PHJA 3GA0A 4GDFA 1B8NA 1KVRA 2DRIA 3U7JA 1CUFA 2OENG 4GBGA 4ZQIA 4OP2A 1O6CA 4X1KB 5IUJC 5JLAA 4CQJA 1CEXA 2YN2A 1E32A 1U5BA 2HDOA 4MUMA 1NM5A 5K8UA 4GQAA 3JR3A 2WKWA 3IBFA 3ZJTA 4UATA 5AHXA 2ATVA 2H7VA 4CCAA 5A0VA 3ZOKA 3B2NA 1PR4A 1E99A 1GPMA 4PGAA 5E7MA 5IARA 1KHTA 4PLFA 2HQSA 2MJLA 1X7GA 1M6WA 1PS8A 4O2BB 1X42A 4EYSA 5KNBD 3UHAA 3GLFA 2ISSD 4JODA 4KLCA 4JJ4A 3U6BA 5ADVA 2VHCA 2H2FA 2V98A 2WSYB 3Q7SA 1ZVJA 1WZ2A 3MJ4A 1UMDB 1K63A 2F4VB 1YMQA 2IELA 2NQ8A 3MT7A 2GARA 3OEHD 1C1DA 2W70A 3ISVA 3KQMA 3MJSA 1Z4NA 4CUKA 4CNBA 2D2IA 2NYAA 1U1DA 2G5CA 4RS3A 1LBQA 4R2MA 2BOVA 4OSOA 5AOAA 4AN1A 4R1LA 2FPWA 2BGKA 2UUPA 1YVUA 4OTZA 3DOHA 3Q10A 1KI7A 1OYWA 1DC5A 3M2TA 4FFLA 1AHIA 2NAPA 4IFTA 4JQOA 1KYQA 2GNAA 1VFPA 4E2FA 1M0TA 2O20A 2Q1YA 4DLAA 5AM2A 5LQNA 4Q24A 4IOJA 4GLFA 2YIMA 5HUQA 4RTLA 3NDIA 1W52X 1PJ3A 5ITSA 2PZ8A 2QM3A 4IVRA 4ES6A 3PX7A 4AJNA 1TA9A 2VQ3A 4QL3A 3OT4A 4LZWA 4B1FA 4BNGA 1KK0A 2SHKA 4WJLA 1GM5A 3AL0C 5HSGA 2UVPA 1JHDA 3VR4A 5CB4B 2YS7A 3E0XA 2ZI3A 3KKMA 1B1AA 2CVPA 2ZPUA 3KXLA 4NYMR 1I10A 4ZPXA 1K0FA 3P27A 1B93A 3WJ7A 1L5MA 3VX4A 1LWNA 4O4JF 4C0BA 3OF5A 1KEVA 1ZYUA 4QVIA 4EI9A 3W6PA 2TMYA 4U2EA 1H22A 2ZANA 4BLPA 2BJHA 5ALLA 2QI9C 1SUSA 2RI6A 4PSUA 4NOLA 4UM5A 5B7QA 1NRIA 5H4GA 1JDVA 3LUCA 4CL2A 5D7NA 2JAXA 1DWOA 2ZWIA 2IUUA 1UBLS 5J3JA 1JEAA 1NW8A 4MIOA 4PE5B 4NQRA 5LP1A 4JBXA 1N1EA 5EIAA 5T4HA 3ONEA 4BO8A 1Z8NA 1U0OC 1JG2A 4EKIA 4F5WA 1QXSA 4P34A 2CMFA 3A6FA 4BGVA 2C00A 3ND7A 1EG7A 1DX4A 4X20A 4YP1A 3AO0B 5D85A 1C1YA 4IYRA 2OBMA 3QPDA 3NNNA 1LJ8A 1T0PA 3KAPA 3LHDA 2IBSA 4EENA 2E4VA 3SIPA 4DAEA 1QFXA 1GZ3A 2CD9A 1MG0A 4HAXA 2J9ZB 2C95A 2A5DA 2CMHA 2QJFA 2XUJA 4UU8A 2EZTA 5EJ5A 1BDHA 1RWVA 2YRXA 3KVNA 4IKPA 2XQVA 1LW6E 3VR5A 3H2JA 3ZY4A 1SKYE 4PG4A 2BR4A 5LOVF 4NV0A 3ANSA 3A2NA 2OWEA 4LV6A 4NBRA 5D2CA 3GEMA 2CXOA 2ACVA 3IIMA 4Q1CA 1JFFA 1R3UA 2ZIWB 3STYA 5EP3A 4E31A 4F9TA 3K0HA 3DAOA 2NUPB 5IXJA 3NDJA 5KQSA 4BP8A 2PL9A 2Q8NA 2VDVE 2F6RA 2G5TA 2Q2QA 3NG1A 3TLJA 4XPZA 4BRSA 1CIPA 1GDTA 2AOUA 1L5HA 2V6BA 4A7PA 5A4DA 2HAEA 2IU4A 2OHJA 1T0HB 1OLSA 3GB9A 3QEMB 2PQ6A 4EUEA 4MUXA 2JCSA 3BJIC 3OPYA 1XZNA 4ERXA 5D3QA 4IVPA 3BMCB 4NMLA 3OTOB 2A9FA 2BFDA 1GQOA 2UYOA 2XI4A 1XZKA 4OXIA 5B5SA 1LDMA 4LW8A 1Y9JA 1QVWA 2TECE 1L1RA 2Q7DA 7MHTA 1A5TA 1CQWA 4H7EA 1QNFA 1NJ2A 4R8MA 2J09A 2PXHA 4PHGA 2BTQA 3SK0A 5A4AA 3OG9A 1JP7A 2CW5A 3ND9A 4U6SA 4Y2GA 1JG7A 4I1OA 2NW6A 3EASA 3E5HA 1W1WA 2Q3HA 2XUFA 3CW8X 5T7BA 1O94C 2QYTA 4M76B 1HSZA 5EC8A 2YWFA 1JBKA 2AOXA 3QFTA 3UV6A 1P17A 2FFBA 4OQQA 4LXUA 1FX0B 4L0DA 2EX0A 4G63A 2X76A 3DKVA 3DL2A 4P92A 4Q7MB 3H1GA 5AMXA 1NVTA 1J8YF 2H4WA 5AW9A 2X8BA 2OPHA 1LK0A 4E03A 5AM3A 3VU8A 4F2WA 3IULA 1PK7A 1OWPA 3ZKWA 2AN1A 3HE3A 2X4GA 4GG1A 5DTQA 3QNMA 2XECA 5K99A 2XUDA 3M4NA 4KQMA 3KBOA 3W5BA 3IBSA 4I7EA 4X8OA 5T57A 1SWVA 3DVAB 1KY4A 1PWHA 3DVRX 4ZYZA 1H2RS 3N7TA 4MGHA 5IW8A 3VU9B 3BK2A 1XMVA 4M89A 4CHTA 1Z2DA 3B82A 1FDUA 4XR4A 3GJTA 4YTEA 5CB0A 4BMOB 4AZ0A 3SBOA 2EWWA 3NYIA 1WS6A 1T3ZA 4XWAA 2HHJA 3PD7A 5FO1A 2X41A 2GETA 3RSGA 4WNCA 1RQPA 2FP3A 2JIZA 2F8TA 1V5WA 3RU3A 1CETA 1EGQA 3VTAA 2PZMA 1TTHA 2O7VA 5FBLB 3N5KA 2GSDA 3QVMA 4N0EA 3QEAZ 4L22A 1XNGA 2X6TA 2BGNA 1Y3BE 2D13A 1YR1A 2GD6A 4TM7A 4G8CA 1W1IA 3MXOA 5D3MA 1F4VA 1FRZA 1NZFA 2QRVB 1XT6A 2QLJA 2X2PA 3IAUA 1NDQA 3H8JA 1VHTA 3K92A 1XO1A 2ZB3A 4PYKA 5JDIA 3KWMA 2XX3A 4Y9TA 2VDNB 5C46F 3BMNA 1J2UA 4D3ZA 2A0KA 1LPPA 2CHFA 3OUZA 4J8PA 1CY2A 2WZCA 4OHXA 5CLGA 1GNLA 3L0YA 3JR7A 2CHQA 2Z3ZA 4YT5A 5KYUA 1XWWA 1TPYA 3L9WA 4AAYA 1PLKA 4W63A 1LPMA 2C4MA 1P77A 2IDMA 1CERA 1Z17A 2R68A 2V3VA 1YZHA 2CNNA 3CUWA 3EOZA 4Q3OA 4UHCA 3T9EA 3GNQA 1IY9A 2PXXA 1TVKB 4OQYA 3WMGA 4B3FX 2Y4NA 4M38A 4CM8B 1E9RA 2CKDA 2QWXA 2MSNA 3KVVA 4MUEA 4CVNA 1IONA 1DJPA 1PWYE 5I48A 4F04A 1DRJA 3HACA 1S2NA 1OFGA 4BOYA 1L5NA 4EG7A 3HM9A 5B6PA 3AU9A 1EJ0A 1A7JA 2X15A 1KO1A 3D6UA 3ZHRA 4L2IB 2M2IA 2P2NA 3MWKA 5HOEA 1VJRA 4FJ2A 2BI8A 4FGSA 3UT6A 1H2EA 5ALDA 3VAAA 4C0QC 1GKYA 4P4GA 2IT1A 2O2EA 1H2XA 5AT1A 2Q99A 1CZNA 1Z0DA 4RVNA 4TKZA 3RWMB 3TTSA 4EARA 5I4IA 3UAVA 3UMCA 4ZT3A 3FGOA 2GYWA 3ZGXA 3UWSA 1M72A 4AQ7A 2B34A 3AF2A 5EPUA 4O4IA 1Z35A 4RWZA 5EZYF 4RXUA 3GGPA 4RJLA 1QB7A 1CYDA 3F6PA 2B30A 3OWHA 4FYWA 4CKXA 2ZETA 3JAWB 2ZJZA 3BJZA 4WN9A 2ZB2A 2VP2A 4YDQA 1VIMA 3M1YA 1GUAA 1ZN2A 1GPJA 5DASA 3WTCA 4KUGA 4BX9A 4DR1B 1UJ6A 2DLNA 5EKSA 4GMKA 3GLGE 3C1UA 4WKGA 2XDQB 4ZJZA 3LYLA 4XGRA 4LRXA 4G65A 1I7DA 3R6TA 3LW7A 4RDIA 3W2IA 1JR2A 1OV6A 2W9XA 3WLNA 3W34A 2D74A 4AZ3B 1VE1A 2C07A 2DQZA 1G8AA 3SQXA 2KE5A 1MENA 2O0JA 1K6EA 3BXOA 4E07A 1LI7A 3D2AA 1ZD1A 3INNA 4XWTA 4DJEC 4Z5XA 5B4UA 4ZK6A 2P75A 3PWSA 4JLSA 4M1YA 3PWZA 4BFTA 5HKKD 4ER6A 3PQCA 4JQYA 1QYRA 1PGPA 1K06A 5B4VA 1N32B 4L02A 4DEVA 1Y8QB 5FTWA 4MCHA 2WKPA 1V26A 3OEWA 5H5JA 2EGUA 2OXFA 4DT1B 1B0PA 5A7HA 4F6RB 7MDHA 3OFSA 1H65A 3SBEA 2JGFA 2VS1A 1Q83A 1DOAA 3G2IA 4I8DA 5TT0A 2DPGA 3HXQA 4DIOA 2C99A 1K86A 1NXOA 4GL4A 2OUIA 3MPOA 3V2GA 5FA8A 1JQEA 4LYJA 1FXWF 4MARA 1YKGA 2P9HA 3TLMA 2HU8A 1RKVA 2YWJA 4S2EA 4IYJA 2ECPA 1X0XA 2JEZA 1XLWA 4JUIA 1TTTA 1YR9A 2VXOA 5LBUA 4BS9A 5HUJA 3S27A 2A6PA 3MT9A 1U7OA 1T6BY 4R3WA 3OEHA 2QRNA 1EVEA 3GG9A 3L8ZA 5FUYA 3MF4A 4ZT4A 4MWZA 2QVYX 3NAQA 5T4EA 2D1FA 4LVNA 4P3YA 4PC6A 4YREA 1DXHA 3LM8A 3F6CA 4UEKA 5CA1F 5AHKA 4DRXA 5KTKA 2EV9A 3Q7IA 4KDRA 2WVHA 3KFXA 3KNZA 4FM9A 2CD7A 1WXXA 4JT4A 5HTKA 1MPTA 2AGVA 2HU7A 3TX2A 4RL4A 4KFUA 4ZAFA 1Z7YA 2ZBFA 4LRSB 1IJFA 1EBUA 4LISA 4TRRA 4X44A 3DGEC 5JU6A 1RQNA 3PXEA 3I2JA 3ZD7A 2BKXA 5KQLA 3LF2A 4CLOB 1EK0A 1TM1E 4JJ7A 5H4HA 2VYFA 3JAKA 3PUYA 4NG4A 3VDQA 5CNIA 4CTKA 4EQ6A 1RXIA 2VRNA 1ZICA 1SAYA 2FZGA 1VI5A 1VE6A 1AKRA 4GSKA 2AOTA 4DLRA 2G5PA 4XTCS 1Q1GA 5F76A 2OQIA 1SUWA 1IBSA 2IPOA 3HEBA 2J07A 3U4QB 3O1JC 3KDAA 1GFSA 1A95A 2WJWA 1SU4A 1YFKA 2W2TA 3E5MA 4ZRMA 4QUHA 4I5DA 2D7DA 3I0ZA 3CXRA 3QTTA 3FPKA 3U7QA 4ON9A 1BGVA 2ZYIA 3OE5A 1JIQA 5PGMA 2RHOA 3X1KA 3AJ8A 4KOAA 2PVCA 4I3GA 1KP2A 3QUAA 3KPWA 3QBEA 2R5WA 2VXBA 3DV9A 5BVGB 5DNDA 3L7KA 5IVPA 3II6X 5D00A 1AS0A 3OM1A 4LSMA 4YRTA 2FPIB 5FPQA 4EA9A 2H1WA 5IU6A 1FX1A 2DBRA 4BAZA 2WF9A 2QMEA 3AYXB 3M70A 4N6OA 5DHUA 3NVMB 3D7KA 4N3AA 4QPCA 4ZV9A 3NWPA 4U6NA 1DBRA 3NM4A 1G5TA 4XUCA 5DP1A 2P68A 2XGGA 4WWHA 1SCUA 3GFPA 3GN2A 3LNCA 3WQHA 5KU7A 3WGIA 2P0EA 1JYEA 3VR0A 2ZM6B 2HF7A 1CUWA 1GARA 3WNQA 1SBTA 3GRPA 3RC3A 1YGPA 2DCMA 2GEUA 1IXSB 1B74A 1RYZA 1H3NA 2IOFK 5KWEA 2H17A 5C4IA 4EPYA 2R87A 2H59A 3DR5A 2HUNA 1BJKA 3MIIA 4CDRA 2P90A 4DQ0A 3MUFA 2Y1FA 2GJ9A 3EC1A 3UKJA 5CA0B 1V6AA 4N1AA 4BNTA 3Q8LA 4PZAA 4Y6RA 5FKJA 2Q3LA 1RAIA 3C24A 4L6AA 4BZQA 3S28A 4PY2A 4HLNA 1BO6A 5GV7A 5FI1B 3T3EA 3WWOA 1ULHA 4EPRA 3PNSA 4ZJUA 1TMGE 1Q84A 4H3VA 4NK4A 2EIXA 3UK6A 3DE6X 4V0QA 5AH0A 5FV7A 1SURA 2B25A 2RK6A 3O1HB 4K9OA 4NE2A 4PXSA 3VYWA 1HQCA 1AQUA 5AVKA 1QG0A 2RGCA 1GCOA 1OBFO 2GFIA 3WRXA 4TLEA 1PUXA 2GGSA 2J9RA 1DV2A 4TRNA 4UPVA 4YFYA 4UJ5A 2LRHA 2W00A 3P0RA 1RJ9A 4R5HA 3DYIA 3AL3A 1R37A 5BV8A 3IPRA 2RHDA 1XQVA 1IATA 3DE2X 3PEVA 3C3KA 1PQYA 3GWGA 3LP8A 5HDBB 4FZRA 1ODSA 1F2TA 2Q1TA 3RSFA 2AV6A 1SVNA 1YK0A 1ISSA 4RELA 2Z5VA 1RHKA 3NU1A 2JCXA 2PKYX 2PU7A 3AM5A 4MLCA 4HEQA 4BNWA 3CX7A 4NS1A 2SICE 3PC7A 4XJVA 8ADHA 3G0OA 5KDDA 1ZSNA 1UCFA 4C7XA 2CJPA 3KD3A 1Z2OX 4PR3A 1C30A 2XXAB 3WISA 1BVHA 3TSOA 1QHHA 3S8MA 1ZUHA 4F3CA 3I8OA 2W58A 2HDHA 4CRWB 2EF0A 2HSJA 1FNDA 3IJRA 2G0TA 2JBHA 4AWBA 5LWQA 2XNDA 1W44A 3TS1A 3HRHA 3TOZA 2KM1A 2AJLI 3H86A 1HL3A 2WHQA 3IPXA 1QUEA 3IC5A 2GM3A 3PXCX 3QJYA 3WSWA 2H0RA 3JQGA 3UAOA 4BWYA 2AZXA 4L8LA 1IJEA 4IJQA 3JYQA 3H1AA 4IKEA 4MYHA 4TMYA 1KI3A 4UZFA 3UK7A 4LRQA 3WC4A 4AJLA 1P1JA 4BVEA 4CQLA 1PJRA 1S1CA 4IIJB 5EWMA 3TFOA 3KT0A 2B6NA 1EFPB 1V5IA 4E7PA 2VF2A 2OBXA 1OKKA 4QARA 4BO2A 4HXYA 4PZPA 1OLSB 4BO7A 3FMPB 4R8KA 1A8QA 1K97A 2J48A 1U8CB 2B1JA 3QUCA 3PFFA 2A8YA 5HVNA 4L8VA 3WYBA 5AR1A 2A5YB 3FOAA 4MVXA 2WY2D 4C0HA 3K9HA 1P4AA 2G67A 4ACAA 2Q5OA 4BN0A 4D56A 1W7AA 3JX9A 4WPGA 1M10A 2O48X 3KOZA 5CPFA 2SCUA 3W3AD 2NUPA 3SOZA 8LDHA 5KCZA 3PHBE 3ZW9A 1K8ZB 5BXYA 3RVKA 3U7IA 1X8KA 2LV8A 2ZJ3A 3BGWA 3NTRA 2JBAA 4FDLA 4RXTA 4V0MA 4ER0A 4DCSA 1IBLB 4W9RA 5FWXA 3JWEA 3O1LA 5IMBA 3T5TA 2XUHA 1D6SA 4PRYA 4XQEA 4D4JA 5A0TA 2AR0A 3I61A 1AUXA 3HL4A 4Z6KA 4ZJPA 2DJIA 1P1KA 4RAQA 5EVCA 3K1JA 1YNSA 1LZKA 5LIRA 3BMQB 4MWTA 5JO9A 1KAMA 3PJDA 4GECA 1XJQA 4E3WA 4ZMBA 3RUIA 3PU6A 4ZZ1A 1PZNA 3VYRB 4LZPA 2JFHA 2F1RA 3D59A 2D1TA 1E6KA 5I9MA 1U4OA 3KLMX 4WLFA 1J56A 4ENVA 3C8MA 1S2LA 1CK4A 2GH1A 1JMYA 3LRXA 4Q3CA 3BSYA 4LN1A 2PMDA 1HE4A 2GN4A 3KCQA 2FPKA 4YB8A 2AFIA 4M21A 2FU5C 1Y33E 1TZ2A 5ITZB 3FFBA 5DIFA 1VL8A 5AUPB 2WD9A 3IQDB 3ROZA 1WUJS 3WB2A 4B6EA 3AJEA 4TLLB 1P1BA 3AEUA 1XTIA 4EA6A 3V46A 4TQ9A 1R3DA 2COEA 3GP8A 1O6GA 3ZHXA 2IUEA 1R0KA 4JI3B 3VR6D 3E53A 3AVUA 3BFPA 2FRDA 2XDWA 1N2CE 3VRHA 5H9WA 3DV2A 4ZKDA 1FTYA 1KYWA 3CUKA 4HNQA 3OF2A 2DT8A 4MVJM 2JCGA 2FG6C 5JAIA 1BXRB 4IIJF 4XM0A 4UM7A 2OKCA 2J5KA 1R16A 3EOAI 2RH4A 2QQEA 3CHYA 3F8TA 3VPBA 5JW6A 1DAIA 4E88A 3G89A 2C5HA 1TO2E 2ZWVA 1MOPA 1T4CA 4CIXA 5K9ZA 5B1DA 1V71A 2B2CA 1AA6A 4QPZA 4JI8B 4E30A 1PJTA 3FMGA 1IHXA 3E9DA 1D9ZA 4DARA 3DFZA 1N9ZA 5EP2A 1AZSC 1DARA 3I6MA 1WHTA 3KEGA 1DUIA 1DS6A 1OXKB 6ADHA 3GIDA 4WZBE 4WJZA 2ZUFA 5J2UB 2C8VA 3EPRA 3FBTA 4IGKA 1M2HA 4D2IA 1J2YA 3KT8A 2FETA 1NE2A 1R5OA 4CKWA 2CYAA 4LNAA 2OXTA 5A3SA 1JHAA 3WMXA 4NBVA 4DZTA 4YMGA 1JHRA 2XCOA 4I19A 5TDHA 2QP3A 3GROA 3V7FA 5FTLA 3ZW8A 1XV5A 1TVKA 1DTWA 5P8WA 1RI5A 2BMEA 2VAPA 4H6XA 3HFRA 1UIMA 2A1UB 5E7IA 2NO1A 2GF2A 3MINB 1L1QA 1KGDA 3MS4A 2JW5A 1T4MA 2AXQA 3AHEA 4OK3A 5COQA 2NUAA 3O2SB 3ZVKA 2JJ2D 2EWVA 4D4MA 5JMTA 6LDHA 2M1XA 2QV7A 2ZRMA 5REQA 4OY3A 1IUNA 2LCQA 3MJFA 4FSDA 1QK5A 3HDTA 4HUTA 3NRJA 1NBMD 3HYRA 3MWGA 4HNHA 4YDHB 5IBRA 1NPTO 1Z5GA 1WIWA 3K0FA 4PLZA 1LDEA 1FZQA 4Y2UA 5EMLA 1MDFA 3B1WA 4YUWA 3B51X 3EVEA 3FPGA 4X1YB 4G1UC 5JPCA 2V0NA 2R7KA 5EL0A 5AVRA 3AVOA 3L01A 1JQ3A 3FROA 4U5QA 2K6GA 4DWWA 1ZIPA 5JCOC 1OYYA 3O4FA 3IP6A 2Q62A 3P0HA 4WZBB 3A6GA 3DZFA 4LGVA 1PJZA 2C57A 1XA0A 1T1RA 3HDVA 1STOA 2FQQA 3A7EA 3LUFA 1C7ZA 4ZEVA 1CWUA 4DV5B 5CX1A 3U4IA 3WGVA 1H3EA 4MIKA 3BT7A 2HV9A 1F9EA 2XUZA 1R50A 2OD7A 1GYPA 1M1UA 2ZXEA 2JJ8A 3K2IA 3OCYA 5DRYA 2RKWA 1ABFA 1ODKA 1I2DA 1KZGB 4FMDF 1UZNA 1Z7GA 2G71A 4FCCA 4PHFA 4UNIA 4D9FA 2PLRA 3AUXA 1I7PA 4LSWA 5GGYA 4BZWA 5GV8A 1U0NA 3G0GA 4LXQA 2UZ4A 1ND5A 4I8IA 4XAQA 2EVWX 1UBSB 1LPOA 3TNFA 3AR2A 5LUBA 3QXHA 4LZNA 1GSHA 4MCAA 3LK7A 2DBZA 5CT5A 3LY8A 3DKRA 3PHLA 2ZJAA 3ZHBA 4K81B 1X1TA 1I32A 2HSDA 1AMUA 3K9NA 4C4SA 2H3EA 1CHNA 4ZTZB 2Z09A 5ED4A 4TVSA 4A23A 3DP7A 1OIXA 4IXWA 4LQLA 3ENNA 2IHZA 5CXSA 4BPRA 5A5VA 4YR7A 4DN6A 1A2KC 2WWGA 3F7TA 4BNZA 4JL5A 4RZUA 3I01M 5AK3A 4DA7A 2PRSA 2IK8A 3NDPA 3HRIA 5J4HA 1GUBA 1NVDA 3ZHYA 2Q49A 3G9TA 3KV3O 1EX6A 4HAWA 3RYFB 5I9TA 5SY6A 2IP2A 1RHJA 2O1XA 1RXUA 3OPYB 1Q74A 2AN3A 4FGUA 3SE7A 3ZEIA 4B80A 1QV6A 1TUBB 4F85A 1QPGA 2AUTA 2H06A 5EZ6B 3RTEA 2OPBA 4OB7A 3AR6A 1GPBA 3HBJA 2O2CA 4J7UA 1D2HA 3VZCA 4P3NA 3FCXA 2YMQA 3PYMA 4XYMA 3GAMA 3NOXA 4CT5A 5B1YA 4H3HB 3FM9A 2BM8A 1ONBA 2FSUA 5KQGA 4AXBA 4TYPA 3JZIA 1NUTA 3AUKA 3T0GA 2I2CA 2ZPAA 3PB3A 1ZGCA 5EYPB 3PD1A 4AKGA 1NVBA 2I5PO 3P9SA 2I4OA 2FKAA 1GDHA 1HE2A 2FWNA 2HA6A 3NEYA 3G8AA 1CLUA 4CLOA 5L3VA 1NF3A 1WZCA 1J8VA 1SO8A 3G2PA 4RMJA 5EMKA 2DHQA 4ZDJA 1Y63A 4U9IS 4C3VA 5LYJB 4UTZA 1JALA 3BOSA 4U7FA 3HLKA 4E32A 2ZIXA 1ZEMA 4ARZA 2CNDA 3CWCA 4CMHA 4DMMA 5BV2P 4O2AA 1L7RA 3INRA 1G8KA 1JAIA 3QLUC 1WV0A 4MKIA 3Q3HA 1HLPA 2FR0A 4JB8A 1T5DX 1HNNA 1SKYB 3R3UA 4KUEA 1MXHA 2HQBA 4G5RA 4S2UA 3U4MA 4O02B 1I24A 1PT5A 1Y6RA 1ZMXA 2HU2A 2EFEB 1SCUB 4OQZA 4YVFA 4DCJA 4KRFA 5BNWA 4IZHA 4EW3A 1ESZA 1YS1X 2PGOA 3W3ZB 3UJCA 4RMNA 3IKLA 4A3SA 5CX4A 1L0BA 1MOSA 3GWZA 4WCFB 3X1MA 3KJHA 2WA2A 3TF5A 1D0IA 5LJIA 4RA9B 3WAGA 1CJVC 3P26A 4FFWA 4H4EA 2BPOA 2PAAA 4LF6B 1OOEA 1QVZA 4YUVA 4IUYA 3OE1A 3RC7A 4A2CA 1KWGA 4COOA 1U81A 3EVCA 3KSUA 5H3CA 5LDGA 4I08A 1Q16A 4MQLA 4B33A 1Q1EA 2IH5A 1M6VB 1ZI6A 5J5VA 1ADGA 3TVYA 5LWHA 1CD5A 4QUKA 3EYWA 3LO8A 1PQPA 1J0EA 3PEYA 3EZ7A 3SM9A 1QCYA 1J0BA 2BMWA 4H27A 1L8QA 4X95A 3AHIA 3CNOA 1NQOA 3PHGA 3RE1A 1RCUA 3A4VA 4FS3A 4LOIA 3VR3A 2XTZA 4I4NA 5JJ5A 1VCHA 2B83A 4AY5A 1R2QA 1TF2A 3F96A 3HV2A 4Y0NA 1TT5A 4RSHA 4TUYA 1JQ5A 1IK4A 1MB0A 5EXTA 3THSA 4AG5A 3QK7A 3PLAE 4H9GA 2HA5A 1E9BA 1VA4A 2XZTA 4MJ3A 4TKVB 1YDWA 3FMOB 2GN9A 3PSHA 3PUWA 2V5VA 3GA5A 2VN8A 4JBHA 5EJ7A 4WBSA 3R0ZA 5JMPA 3MMXA 4ABYA 4I4TA 3UMMA 2DERA 621PA 2P41A 4MEBA 4RD4A 3H2YA 2L0XA 5AW2A 1JU3A 4P7GA 1OZGA 5C18A 2COUA 2NZWA 1KJJA 3SXUB 2ZCVA 1PX0A 1YGYA 4UHHA 4OMFG 2VZEA 4WHMA 2WJVA 5HE8A 2O8FB 1B2RA 2I71A 1NMQA 1JXAA 2ZBEA 2A0YA 3D8TA 3MWJA 1N6RA 1XB2A 1KYXA 1VG1A 3MB5A 3CURA 1X94A 1M9NA 4IR7A 3B1FA 2FPOA 3HXTA 3MWLA 1YZTA 1PQWA 1CQJB 3D3WB 3QIAA 1Y3AA 4RHUA 4Z8YA 4DCUA 1V35A 4GI1A 1UM9B 2G88A 1CKEA 2ONZA 5AKZA 2G9VA 3EEQA 3GT3A 3DO8A 1EWKA 1T34A 4FNGA 3U1BA 1EFCA 5KNDH 4XVQA 3WGQA 3JZMA 1XEXA 3CONA 3T15A 2PZFA 2VPIA 1P7ZA 4Q7JB 4V2IA 1YU9A 1X1DA 2WKRA 1M3SA 3AM3A 4HJXA 3ZXSA 3W9BA 3BHJA 1PYGA 1C4KA 3MJVA 4JIMA 4XDYA 5CBPA 4P53A 3IKVA 4LYFA 5ENDA 1G7CA 5IH7A 4WAUA 4NBSA 3TW8A 4O2LA 3W2EA 2O5RA 2J7PD 1G7RA 1CLEA 1YOBA 2DH5A 1L5ZA 3ZWWA 1LBEA 4LHYA 1IWBB 4JA0A 1I36A 2ZI7A 3LY7A 5CDUA 2DP4E 2HPAA 4HGYA 1RBZA 3CLSC 3TIFA 1EWRA 4DJAA 1XVIA 1P2SA 4RTRA 1Y3CE 3RUHA 4CM1A 1V1RB 2AJ8A 4OBBA 1QQ6A 5BURA 4F7WA 2FQXA 4PLYA 3PP8A 5AKYA 4I5GA 3ASZA 5DNWA 1CUGA 5AM0A 4PPQA 5JNWA 2DHEA 2DB3A 5K6AA 1XELA 3FVRA 3A8TA 3H17A 3VOSA 2E5WA 4DPLA 3UM9A 3QMWA 5AIBA 1XR3A 2GK6A 1Z45A 3KBBA 5BT8A 1THGA 3QPBA 4X6UA 2A67A 3GLRA 1SVKA 4D8XA 1LGYA 3OQOA 3MJDA 3V7WA 1PT9A 4WESB 1E89A 3EW7A 1G6KA 4TX1A 3RS2A 5L3SA 1V25A 2P11A 2WSIA 3AP2A 3KYJB 3PQDA 3NTQA 1ZUIA 1X14A 4C4RA 2CWDA 1CE8B 1ISFA 1THZA 2IA5A 3D8NA 4FLFA 4LPKA 4RCYA 4UJ3A 5COBA 5FPYA 5CD1A 2VJNA 1KO5A 2ZJ1A 1NKTA 4JC4A 2EU8A 1CY1A 1EUQA 4H7KA 4M98A 3TZEA 2XJ9A 1E5LA 1S96A 1UBNA 5FH9A 5F4BA 2P1DA 2XB6A 5JCXA 2RHGB 3PQ8A 4FYKA 4E5UA 3RRFA 1G9TA 5EHIA 2H1SA 4JYAB 4GX5A 4U7PB 1BWRA 1JFRA 1ZD3A 2EARA 3LQ4A 4JEUA 4BL5A 3OJEA 2Q27A 2PD3A 4WZAE 3ACBA 3KQHA 1VDMA 3ANNA 2WE8A 1JLLB 4MUAA 1RYHA 3WKEA 4JI2B 3CRRA 3B1JA 3GJ0A 2VJBA 1Z6GA 2NX2A 3I0MA 4QTUB 1KF0A