2XOXA

Crystal structure of pteridine reductase (ptr1) from leishmania donovani
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
276
structure length
216
Chain Sequence
TVPVALVTGAAKRLGSGIAEGLHAEGYAVCLHYHRSAAEANTLAATLNARRPNSAIPVQADLSNVAPVTLFKRCADLVAACYTHWGRCDVLVNNASREAMEAAAADLFGSNAMAPYFLIKAFAHRVADTPAEQRGTNYSIVNMVDAMTSQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLAEVSDVVIFLCSSKAKYVTGTCVKVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Recombinant Leishmania Donovani Pteridine Reductase Reveals a Disordered Active Site.
pubmed doi rcsb
source organism Leishmania donovani
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE
total genus 78
structure length 216
sequence length 276
chains with identical sequence B
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2010-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2xoxA00
2ZB7A 3PEFA 3C1AA 1WWKA 5I7FA 1T24A 1Y81A 1NP3A 4AJ4A 3JQGB 2HLPA 3GLQA 4RCVA 5B37A 5A1TA 3MJTA 1UAGA 4G5HA 4MVJM 1EUDA 1GTMA 4CM8B 2HMWA 2JFFA 1CF2O 3F3SA 4AJHA 3GRPA 1BDBA 1A27A 4L0QA 3A06A 3SXPA 3I6QA 3GG9A 3ROQA 1UXJA 3M1AA 2WJPA 4Y67A 3CSDA 4EZBA 4GAEA 3HDQA 5L51A 4YAJA 2GF2A 2UV8A 3IKVA 3WLEA 3ICCA 1J4AA 4QFCA 1YH3A 2I5PO 3NTOA 2AMFA 1WDMA 2E6UX 4I5FA 3ZWBA 3C8MA 3H9UA 1R0SA 5A04A 1DB3A 2CDAA 4II3A 3K31A 5TQVA 3H5AA 3IC5A 3AUTA 4DC0A 1HL3A 1ML3A 4B3IA 1LQTA 3GPDG 4YT4A 1C1DB 3RASA 4GWGA 2BRUA 1E6WA 1R15A 3ZW9A 4GSKA 1PX0A 1R12A 1NPYA 3QHAA 4ZGWA 1G0OA 4CM4B 1Q0QA 3L4BC 4J2HA 3NYWA 1WMAA 4NK5A 5LDHA 3DB2A 4BIIA 1EK6A 3ZU3A 3F5SA 3I6IA 1AXGA 4CUJA 4R1UA 4IDAA 1UP6A 5A9SB 4DPKA 4II2A 2Z1NA 1HLPA 1AUPA 2GN9A 3DBLB 5KOIA 5DBIA 1PL8A 2Q1TA 5ENVA 3NGXA 3N58A 3DZKA 1NHWA 3F1LA 4IQGA 2OMEA 3OA0A 7MDHA 2Q1SA 4Z3KA 1ENOA 1JAXA 3ROKA 4QTZA 3FNEA 3ASUA 5H83A 4GLLA 3IKTA 3AUAA 2W90A 2J3JA 5C7OO 4HY3A 3NDRA 2D5CA 5DCUA 3AOGA 3DR3A 4J91A 4E33A 4E5PA 3KB6A 1Y8RA 3PHJA 1P3DA 1V0JA 2J6IA 1ORRA 4IJVA 3HN7A 3WSWA 3QVSA 5A4DA 1V9LA 2BF7A 5GY7A 3Q6IA 1QYWA 1Y7TA 4FD3A 4D3SA 3KBOA 3MOGA 4CMCA 2V6GA 4RDIA 3RUEA 1BSVA 4RDHA 3E48A 3GK3A 3L6EA 3OF2A 2AQKA 1PQUA 1GCOA 1Q7BA 2HAEA 3PIDA 1YKFA 2NV6A 1PZGA 3E6AA 2YQ4A 1U5CA 3W6ZA 3Q0EA 1I2BA 3H2SA 4GX5A 1E6UA 1YO6A 3DAFA 3PIIA 1R4NA 3ZV5A 1SZJG 1XHLA 1Y8QA 3WMXA 3GHHA 3RUIA 1D3AA 2J5RA 2NTJA 2OOSA 1PJ2A 3WICA 4C4OA 3UW3A 3GFGA 3LT2A 3ZW8A 3NAQA 4WGGA 2YZ7A 2J5QA 4CL8A 1P1JA 5DOZA 3WFJA 2YFHA 1EVZA 1E7YA 4ONEA 1ZBQA 1F0YA 4TRMA 2OP1A 2VNSA 1RWBA 3IUSA 2CUKA 1UDCA 2DTEA 4JROA 4R41A 5C7IO 1E7QA 1F17A 3OQ1A 4ZQBA 4J4BA 5L3ZA 2IXBA 4CV2A 5EERA 1O9BA 5FF9A 4CMJA 4NPCA 2X58A 3SC4A 1HYHA 1JKFA 1OFGA 3GUCA 4PG5A 1O95A 1GPDG 1WMBA 1Z7BA 4NU6A 1VJ1A 4J7CA 1NAIA 3DMTC 3RVDA 2HJRA 2FR1A 2O3SA 4NJMA 4CV3A 3RBVA 1TXGA 1Y9EA 5HTOA 5CG1A 4DQVA 1E7MA 3EY4A 1JLLA 4TRRA 1U2DA 4Y9DA 5GZ3A 3BZUA 3WIEA 2WSBA 1ENZA 1B2LA 1IULA 3S8MA 1O5IA 5H81A 2HU2A 4YYZA 1FDTA 3WB9A 4K9DA 2RH8A 1O8CA 1ADBA 1QXSA 5I9LA 1KVUA 1B14A 4F45A 2GLXA 5JXWA 2A94A 3VH1A 2W2LD 3H6KA 2G5CA 3ROPA 5F3RA 2D4AA 1SB9A 4JBGA 2LDXA 3BTUA 3LF1A 5I9MA 2VWQA 4KTTE 2YYYA 2XAAA 3PGXA 1YQDA 2LDBA 2VTEA 5KVSA 3O8QB 4WCFC 3MZ0A 5F1PA 3GPIA 3ZU2A 1BVRA 3Q2KA 1W4ZA 1NYTA 4MVJD 1E1KA 1KS9A 2BGMA 3NKLA 3D0OA 4YAEA 1VM6A 1NTOA 3GGGA 1E3WA 4M8SA 1Y6JA 4OOFA 2W2KA 3RJ9A 2GNAA 4LSMA 4M49A 1PJ3A 3OH8A 2D0IA 4C7KA 3KETA 3M2PA 4K1LA 5G0SA 3U3XA 4LMPA 3TZQA 2B4QA 2VWPA 2Y0DA 4W82A 4TRJA 3VPFA 1U3UA 4GX0A 2POQX 2CMDA 3QQPA 1E7SA 1BXKA 2ZTUA 1AE1A 3AOEC 2XPCA 1F8GA 3QW2A 3AY3A 3K6JA 1ISIA 1KVTA 4BB6A 1WDKA 3VC7A 1M76A 5EN4A 4I08A 3D3WB 3CKYA 4RPLA 2EP7A 4GKVA 3JQAB 1DJQA 3MJSA 4F3YA 3KLPX 2JJYA 3DL2A 1P44A 4G65A 2VHYA 5G4KB 4OKNA 1W73A 1O0SA 2NVUA 4WUVA 3FF4A 1R4MA 4CMEC 1MUUA 2NVUB 1HSZA 2B83A 5BNTA 4BNYA 4PG6A 2BH9A 3C24A 1NBOA 1QP8A 2AHRA 5DOVA 4M86A 1QV7A 3OJEA 2FWMX 3UKOA 3H5NA 2Q50A 4W7IA 2AG5A 3ZHBA 5CDGA 1LRLA 4FOSA 4PCVA 4CM4A 1P0FA 2P9GA 3GT0A 3HFSA 1KY5A 2RCYA 1PGJA 2AQIA 2X4GA 1S6YA 1YJQA 2PKRA 1XIVA 3WJ7A 1GQ2A 3G0OA 4ZQHA 2B37A 1C1XA 5AXDA 4H16A 2VHXA 1C3VA 1JKIA 4EJ0A 3PFFA 1BW9B 4IDCA 5T8KC 1ID1A 1LUAA 5HWSA 4W9NA 4WASA 4R9RA 1GEGA 3PJFA 4J0FA 1BXGA 2GN6A 4XGIA 1U3TA 3D3EA 3W8DA 4BMNA 3CH6A 4QO7A 2NQ8A 1UAYA 3VTZA 2FN7A 3IS3A 3PWSA 1DBVO 2BD0A 2ZJ1A 3DHYA 3HWRA 4I9HA 3IIEA 3U4HA 3NGLA 4EEXA 4BMVA 2CF6A 3L6DA 1F12A 1VSVA 4RVSA 4NDNE 2IEBA 3H7AA 3FHLA 1RYDA 3MJ4A 2XF8A 4KZPA 1RKXA 3K92A 4FIZA 1WAMA 1C14A 4PFJA 4QECA 4HXYA 4YXFA 2F00A 4JIGA 5IZ4A 4RL6A 4XR9A 4UVDA 1FXSA 1IB6A 1KOLA 2G76A 5JO0A 3HDYA 4KWHA 4I1IA 2G0TA 3NX4A 2DBZA 2J3IA 3EYWA 3FBGA 3KYCA 4HWKA 3I1JA 3K73O 4Q3EA 5EPOA 1M66A 2OORA 2VRCD 3KYCB 4K6CA 4RQUA 2WYWA 1T26A 3HQ4O 4XYGA 4OYRA 1EBFA 4R54A 3W4JA 4J49A 3IUPA 3C7DB 1HDRA 4N5LA 1FK8A 4GX1A 4DTIA 4YPOA 3ETDA 4RLSA 3ITDA 3V2UA 5HA5A 1PIWA 1BG6A 2IYOA 5TGDA 2D1YA 2WDZA 1XSEA 3E82A 4DIBA 1QORA 5TRTA 3FR7A 3RUFA 5IXYA 4WK6A 1U8FO 3TN7A 2C7GA 1JAYA 1VJTA 3P5SA 4XYLA 2GASA 2Z95A 2DLDA 1XEAA 4R01A 4Q39A 1GQYA 3Q1LA 4TSKA 1UXIA 5T8KA 1Z7EA 3C3XA 4XA8A 4F46A 4P4LA 3ZV6A 1LLQA 2DPGA 2ZB3A 4DL9A 3PVZA 1I3MA 4BNNA 1GDHA 1N8KA 3WNVA 1GPJA 1MV8A 1IE3A 4MVJG 3IJPA 3KZVA 3RKUA 1GD1O 1E3LA 1TB4A 1YL6A 3KXDA 4U0JA 2P9CA 2ZJ0A 2CVZA 3TL2A 4KDFA 1CIVA 3I9KA 4K6FA 2DTXA 2BGLA 4GGPA 1A4IA 2G1UA 3B1FA 4WOJA 5I8ZA 5K9ZA 5GZ6A 5JAIA 1DC4A 1HE2A 1MFPA 3FWZA 2Y1GA 4FR5A 5A3VA 4CMBA 2QHXA 5JDCA 1V35A 4IQ0A 5DT9A 4DLLA 3RSHA 3UVEA 4AJOA 4L75A 3TZHA 2IXAA 2QRKA 5JDCC 1L7DA 1T4DA 2ZYDA 4TQGA 3S2IA 1NVMB 5JCJA 3BTSA 4WNCA 1HT0A 3BMOA 3KTDA 4IIUA 1GUFA 3GVXA 4YJGA 3V5NA 1R4NB 1IPFA 4RPJA 2GN4A 2WEKA 3ZN2A 1H9AA 5KKAA 3H9GA 4NG5A 4YJFB 4UREA 5T57A 3E1KA 3I9NA 1DHRA 3QV1A 2ZCUA 1PL6A 2QYTA 2ZB8A 1S7CA 4BNUA 4XGNA 2B36A 2Q1UA 1DLIA 5AYVA 2J5KA 3BMNA 1JN0A 4W4TA 4IDDA 4WJZA 4E32A 1EMDA 3AK4A 3JD1A 3DWFA 5DP2A 3DZHA 4NI5A 1ZMOA 3M2TA 5F1OA 4EUFA 4FC6A 5JLAA 3V8BA 2DFDA 4DIOA 4WLEA 1PJBA 1XG5A 4GQAA 3E5RA 3UHAA 2EWMA 5FI3A 2H9IA 2OHXA 3JQBC 5GMOA 4UULA 1SB8A 2B69A 3AM4A 4UVEA 4ND2A 1DAPA 3GG2A 4BNWA 1B15A 2D8AA 3H65A 4BL5A 3JQ9A 4WE3A 2CSUA 4PLVA 2NTNA 2JAHA 1T2DA 2IZ1A 2AXQA 4CMGA 2CDBA 5BQFA 1YS4A 3AI3A 4AL4A 2FSVA 4NK4A 1HLDA 2O3TA 3P7MA 5JPIA 4LK3A 4EITA 3DONA 1Q2XA 2O2SA 3QLJA 1D4FA 5HS4A 4GSLA 1NWCA 4FW8A 3DBHA 3DZGA 1XGKA 4A27A 4JLWA 4DBVO 5B4TA 3UAGA 4YVFA 1P1RA 4BO1A 4LISA 2VUTA 1ZSNA 3L6OO 4F6CA 1B3RA 5HM8A 3GMDA 3WWYA 3ZH2A 1N1EA 5I9NA 4IDEA 4QUKA 3ANNA 3JQ9C 5DP1A 4IBOA 3TFQA 4BO6A 3EC7A 1UXGA 1V8BA 1Z82A 3QVTA 5BR7A 3R1IA 4CUKA 1QSGA 4A26A 2X86A 4RPHA 3KSZO 3WDSA 3WNQA 3AWDA 1FMCA 5JC8A 3GDGA 4PZEA 2X5JO 3M6IA 3ITKA 3BMQB 3JCZA 2VWHA 2YFQA 2YY7A 1EDZA 3EK2A 3S55A 1HRDA 3SLGA 5KJCA 4J3FA 1O89A 1X7DA 3ZHZA 3ON5A 1QLHA 4BNFA 3H8VA 4W9NC 7ADHA 1XCBA 3O03A 2NU6A 3OQBA 2C20A 4YRBA 4BNHA 1T2FA 5JAMA 1TI7A 1PJSA 4IMRA 1DOHA 1LJ8A 2GR9A 1U7TA 2BHLA 1ZCJA 4BKQA 1WNTA 2CD9A 2FHSA 1Y5MA 1PEDA 5BSGA 5KJ6A 3PZBA 4A2CA 1LLCA 2RBEA 3DAGA 2VOJA 2G82A 2JHFA 3EDMA 4UUOA 1C0PA 2VTDA 2A35A 1HE5A 3RC1A 3VVCA 4PLFA 2AW5A 2J8ZA 2VYNA 3NT5A 4MVJI 3D7LA 3VZQA 3JYLA 4GI2A 4XRRA 4XEHA 3JQEA 4NFHA 2PD4A 3DZBA 4NFYA 4GX2A 4BNGA 1N5DA 2NVBA 4UEJA 5A5EA 5GZ1A 2EG9A 2OL4A 3QWHA 4E2ZA 2JL1A 2DPHA 2ZYAA 3JQFA 3QWIA 1NPDA 4KP7A 1R16A 4Z9XA 3P19A 3RUDA 1Q0LA 2BMAA 2BELA 1E3JA 5G0TA 1EZ4A 4FSHA 1LQUA 2HCTA 4DQXA 2B0JA 2HQ1A 3BMNB 3FSRA 5JO9A 3W4KA 2GYYA 3ZHYA 3TJRA 1DC5A 3ST7A 1FDVA 3U09A 1LU9A 3WYEA 4L8VA 3FI9A 4MKXA 4XQ9A 2PZJA 3FNFA 4R3WA 5F1KA 4DWVA 3EVNA 5TJHA 5L4LA 1GQQA 4R1TA 5G0VA 9LDBA 3TL3A 2PWZA 2W2KB 5LC1A 1D8AA 1J5PA 3G3EA 5IDWA 4XR4A 1VL0A 3PHIA 4PVDA 4AJKA 2HK8A 1VLLA 1PZFA 3WBBA 3ANLA 4Y6RA 1NR7A 5C37A 3L4BA 4HV4A 1H6DA 5CDTA 3HB4X 1B8PA 3GNQA 4WECA 1GYRA 3OBBA 1YBAA 2BGKA 4E2XA 2PGLA 5IG2A 4ZD6A 4DUPA 1YL5A 4MVJA 3OQ6A 3TSCA 1B8UA 4DREA 1OZAA 1W6UA 4MO2A 1LLUA 4GWKA 1PZEA 4NMHA 1KVQA 5B12A 1D1SA 3ZV3A 1ONPA 4TKLA 3FPCA 2EXXA 1K6XA 2X9GA 4PLHA 4CLXA 3AJRA 1JU9A 4YT2A 1GR0A 1B16A 1WZEA 2O3QA 4BV9A 1ZEMA 5DN9A 4YRAA 4PN3A 3PQEA 3CE6A 4QQRA 5THQA 2VZ9A 4E4YA 1SBYA 4IJUA 4JQCA 1C0KA 3DFUA 5JNLA 3DMTA 5KNLA 2GZ2A 3CUKA 1DC3A 1PWXA 4LRSB 3ETEA 3QWAA 3GVCA 4HADA 3GC6A 2DC1A 1M6WA 4QXMA 2IRWA 4DA9A 3MTJA 4BQRA 1XDWA 2VYVA 4PVCA 4YQZA 4BUCA 4CLHA 1YQGA 3NT2A 1YB5A 4PG8A 4GMFA 5A9RA 1U8XX 1ZXLA 4E13A 2EGHA 2NU7A 3JQAD 3WIDA 4WKGA 1DJNA 3E9NA 1HXHA 3QA9A 1BXGB 1BVUA 2HO5A 1P74A 5COAA 2EERA 1CYDA 1IZ9A 5JYEA 1EFKA 3ZWCA 3H9EO 1GYQA 4DVJA 4U0KA 4ZA2A 2H63A 4O0LA 3F46A 1E3EA 3STHA 1YWGO 6LDHA 4XB1A 4YT5A 2C82A 3VOSA 4LSWA 2Q99A 1IPEA 5AQ1A 2O7QA 3ZWOA 1MFZA 3B70A 1PR3A 3OJFA 1QYCA 4CV1A 4P38A 5JCXA 1IHXA 1YVEI 1MP0A 3NDIA 5FI5A 1NQ5A 2Q4EA 4RF4A 4DC1A 1IOLA 2V65A 4XX0A 2E49A 4NHEA 1VI2A 5TLSA 4L73A 3GVIA 2R2GA 3I23A 4PG7A 1UDAA 4AJ2A 2VUSA 1NX6A 3VDRA 4RPGA 3GGPA 4ID9A 4EUHA 4A0SA 4O63O 3AUSA 2WD8A 4ZQGA 4LCEA 4QSMA 2X0NA 4E5YA 2W98A 1K6JA 4OKIA 2YQ5A 5EMHA 2UYYA 4EJ6A 1R0LA 2FRDA 3HN2A 3I52A 2JD2A 1KBZA 1VL8A 1XQ6A 2X7HA 5COBA 5TNXA 4IJKA 3OEWA 4ALNA 3ZWAA 5HS6A 2EJWA 2CF5A 2FSSA 3F1KA 4GBJA 1SO8A 3LZ6A 4OM8A 1EUCA 3FNGA 2H6EA 3A4VA 2NACA 1LNQA 2NU8A 2O23A 2O3RA 4LVUA 4XRGA 5IXSA 2R00C 1J6UA 1ISHA 3DHNA 3MTGA 5TIIA 3LYLA 3GRKA 4O5OA 2VRBA 3C1TA 3WMWA 2EKLA 2WE7A 1IUKA 1VL6A 3LQFA 2ZQYA 4CQMD 3GEMA 1OOEA 2YV2A 1ZVMA 3VHRA 4D3FA 3VTFA 4B7UA 4OXKA 4GKBA 3VKVA 4E2YA 1R4MB 3D4NA 2IZ0A 1RPNA 1ADGA 1TVEA 3PQFA 2FZWA 3WSVA 3WQSB 4MP3A 2EIHA 2NWQA 4U5QA 3UUWA 2VCYA 1HTBA 1QLJA 1NNUA 5BNIA 3U62A 1ZSYA 2W8ZA 1HETA 4J1NA 3RU9A 2YJZA 3UCFA 3WXBA 1N1GA 2YUTA 3OM9A 2NUAA 2IE0A 2X23A 4Z3DA 3OJ0A 3U49A 1Y5RA 5JMPA 2QZZA 1ULSA 3SJUA 1B7GO 5COQA 1GFSA 4OSPA 4UUPA 1BDMA 3RFXA 4DMMA 5CEFA 4XQCA 4PZCA 1E6EA 4LW8A 1N9GB 1U5AA 1PQWA 4YRDA 1PL7A 1CEQA 5KCZA 3OP4A 4KMSA 5KVCA 5ILOA 3QRWA 4MIYA 3X2FA 1SEVA 3FBTA 1QRRA 2AQHA 4G2NA 1SNYA 4A03A 4CLRB 3JQAA 1YB4A 3LC2O 4J6FA 1T25A 5DF1A 3WGOA 3DOCA 1WDLA 1YONA 1UR5A 1DIAA 3DBRB 1HF3A 3U0BA 1YXMA 2PH5A 5KVQA 5L7YA 1KY4A 2PZLA 4ND4A 5HRUA 5DCWA 2AEMA 3H9QA 3FR8A 1YRLA 2O7SA 4PRLA 4MVJP 2O48X 3F4BA 1KVRA 4S3MA 1A5ZA 2Q46A 3JQFC 3INGA 3TFOA 3OIGA 2CVOA 4YJHA 4NBUA 4GPD1 2O50A 3EZYA 1V3UA 5IN4A 1EEHA 5G0WA 4D0RA 4ZN6A 3LC7O 5CG2A 5JAQA 4MVJE 1AGNA 3AY6A 2ZIZA 1OBFO 4W7HA 4E12A 5JAZA 5L40A 4BGVA 3JYPA 3DOJA 3ZNQA 8LDHA 4G81A 4FJ1A 3ZWNA 3H3JA 3WGZA 4W6ZA 4AJIA 1K89A 4B4UA 3KUXA 2FY8A 4TZKA 3BTOA 2HSDA 3HDHA 3HZZA 1PJQA 4FS3A 5IZCC 5JYDA 2OP0A 1YDWA 5AXAA 1MLDA 4PLZA 5THKA 4DYDA 4HUJA 4HKTA 1LRJA 3NV9A 1U3VA 3IP3A 3C7AA 2EW2A 4Z9FA 3B1JA 2WWRA 3PJEA 2QRJA 1LDEA 1GZ3A 1QYDA 4R69A 1DIBA 2QZ9A 3GAZA 1E3IA 3CTMA 4FN4A 4M1QA 3DZIA 1G6KA 4FJ0A 1NFFA 4M55A 1F14A 3GA0A 4GVLA 4PGFA 3NRCA 4B3JA 1KVSA 3RUHA 1KETA 4B4VA 1VPDA 4ILKA 4RVGA 3DXFA 3M1LA 5KIAA 4RVFA 1K5HA 5IF3A 3Q9NA 2J3KA 4H7PA 4AICA 4NJMB 4PRKA 4EEZA 4DGSA 4ZRNA 1X1TA 3DZFA 1Y9AA 4DRYA 4UEKA 2GN8A 1IYZA 4ITUA 2ZQZA 4MVJF 1LX6A 2X1HA 5EQFA 4L9RA 4AJLA 1VC2A 4NNJA 3RFVA 1WVGA 1YL7A 4YAGA 1A9YA 3RC9A 4WCFA 1HDOA 4BO9A 3ZHXA 1M6HA 3JQ8B 1EFLA 1W0CA 2Q2WA 2D3TA 4KQWA 4MINA 4AJ1A 4CQLA 4YB8A 4H15A 2VT3A 3U4DA 4M54A 5EESA 3LK7A 4FBGA 1BGVA 3BHJA 4DLAA 5IDQA 4B4WA 5JBIA 4JK3A 3ZNOA 4CR7A 5JDIC 5CPBA 1UZNA 5DULA 2PZMA 1VJ0A 2ZATA 4J4TA 5CDYA 4XCVA 3OIDA 4RVUA 2AQ8A 1UDBA 4XKJA 4I5DA 1ZEJA 4EI2A 3UOGA 1BW9A 1G1AA 4JJGA 3H5RA 2VZ0A 2Q49A 4XYEA 4O59O 4QX6A 5L7TA 1YOVA 4HP8A 5I7VA 2X5KO 5T67A 3BMCB 1YOVB 5CEEA 4HNHA 1JQBA 1FJHA 4AJNA 2UVDA 3DEYX 3CMMA 4JGBA 1LI4A 4Y98A 2OUIA 1N7GA 2BFAA 4CR6A 1GCUA 3B20A 2JD1A 1MB4A 1I3KA 4RVHA 4RQTA 3V1UA 3L9XA 4BHTA 2UDPA 3PDJA 1EQUA 4P8RA 3LVFO 3RD5A 3ROMA 3ZNNA 3E9MA 4GL4A 3ANMA 4AJPA 1LSJA 1JVBA 3KSDO 4O6VA 1MA0A 3L77A 3V2HA 1NXQA 3UGKA 3VZRA 2NM0A 1KC1A 2FMUA 2Y05A 4TKMA 3SJ7A 3PWZA 4D0SA 4R68A 3UH1A 4WOKA 2GUGA 2PZKA 4YCAA 5TS3A 5F5NA 3GHYA 2VYND 1SOWA 2P5YA 1FDSA 3A9WA 3VZSA 4UVIA 2VHZA 3EW7A 3ZNPA 4IGFA 5C3MA 3RU7A 1DRWA 3LC1O 5FWNA 1V6AA 3QY9A 3IL2A 1CETA 1E1LA 3PHGA 5B1YA 5TSDA 5DNAA 3BYZA 2FPGA 3WYCA 3O38A 3ZV4A 1LSSA 4WCDA 3ICPA 2X22A 4CMAA 2DT5A 5A05A 2WMDA 1LXCA 3ZU4A 2DUUA 5A5FA 4MKRA 4WLVA 3JQ8A 3IMFA 4IS2A 2HJSA 4KDEA 1VRWA 4CQLB 3BMCA 3G49A 2UUPA 2Q1WA 4EUEA 3TF5A 2I76A 1I8TA 2PH3A 3QVWA 3RROA 1GZ6A 1ADCA 3GGOA 3DTTA 3INRA 1M2WA 3GZ4A 2RH4A 4RVDA 3KYDA 3R3SA 1SOVA 5A03A 2PA3A 1EVIA 1GAEO 5U1PA 1BWSA 4J1TA 3ENNA 5EIOA 2CFCA 4I9UA 5LDGA 4OMUA 4DPLA 3GAFA 2DBQA 3KHUA 1DHTA 4LCJA 4RJTA 2DU8A 4J90A 3VVBA 2ET6A 1XLTA 4YJDA 3D3WA 3G17A 2IODA 1E3SA 3PTZA 4N5MA 4RF3A 1MX3A 1UH5A 1GV1A 4ND5A 2BKAA 3VZPA 1MG0A 3NDJA 2AEJA 3UN1A 4LN1A 1ZUD1 3JYNA 3K9QO 1K2WA 3NT4A 3QWFA 3V1YA 3PRJA 2PGDA 3IOYA 2WD7B 1P33A 2GZ3A 3PI7A 5AOVA 1ZK1A 4JBHA 4XQGA 3K5PA 1E77A 2YHUA 3PLNA 1EQ2A 1NVGA 2DFVA 3R6DA 1VSUA 1YJ8A 2AA3A 2QQ5A 1E3WB 1LA2A 2NTVA 3SLKA 4BMSA 1AN9A 4Q9NA 3QIVA 3T4EA 3T4XA 4YAKA 5BSHA 5AXCA 3U4IA 4BOYA 1A72A 3AI1A 3DBVO 3GDOA 3JV7A 4J2OA 4U8GA 5EINA 1PGNA 4B7XA 5L45A 1J0XO 4OHUA 3SX2A 3WLFA 4D79A 4FFRA 5L4SA 1H6AA 1WW8A 4BNZA 3VDQA 4XDZA 1WZIA 4EW6A 1M75A 2C2XA 3I9OA 4CLDA 4ZVVA 1U4SA 1VE9A 2QG4A 4XYMA 2QIOA 1CQJA 1JVSA 1H9BA 2X0RA 4XGKA 4TVOA 2TMGA 4CV0A 2R00A 5G2OA 2JCVA 2RHCA 1RM4A 1PS9A 3WS7A 4BGEA 4FFLA 3D5QA 2A9FA 5IFLA 4E6PA 3UICA 1DFGA 1ZW1A 1QYXA 1XELA 4RPKA 4BO2A 4R4JA 1E7RA 3F4LA 2I99A 3KVOA 3U9LA 3UF0A 3DFZA 1ZNQO 4CM9A 3GF4A 2EF1A 1P1HA 1YBMA 3E8XA 5I8WA 2JAPA 1NFQA 4INAA 4CM9D 2B5VA 4IJWA 3WTCA 5EQDA 1RYEA 2WTBA 4YA6A 1N92A 1K6IA 2P68A 2XOXA 3QE3A 4E5MA 6ADHA 1X13A 4WEOA 4Y8VA 1SC6A 3GDFA 4WCFB 1HE3A 3ADPA 3CZMA 3CPSA 2I67A 5JMWA 3GNTA 3T7EA 3RKRA 3QVOA 1A9ZA 1NQAO 2Q3EA 3FTPA 4DQUA 3LF2A 5HBRA 5LCXA 1E0DA 4BNVA 4W99A 3HE3A 3ZWVA 1RM5A 1TT7A 4BO4A 4IXTA 2O4UX 1EE9A 3GY0A 1ENPA 2F1KA 4IZIA 2RAFA 3BMOB 4IMPA 2YV1A 2B4TO 4URFA 4X54A 3OETA 2V6FA 1G0NA 5A06A 4DXHA 3TOXA 1UP7A 4CLRA 1XU7A 1P1KA 1YBVA 1GEEA 3JD2A 4EGFA 2YV3A 2OZPA 5G4LA 3CXRA 1Z73A 4NH4A 2GDZA 4KOAA 1LTHR 3D1LA 2YHIA 4IS3A 3KLMX 2JFHA 4UVHA 4CM3A 3DO5A 4GVXA 2X5OA 2EEZA 4D3DA 1ZK2A 2VWGA 2DUWA 1A71A 3H2ZA 3EAGA 3HG7A 3WGQA 5K6AC 1PZHA 4I9NA 2Y99A 4DBZA 1I0ZA 4NU5A 5F5LA 1R66A 3D4OA 4MJLA 3BHIA 4ALIA 4PLWA 4EJMA 2Q2QA 4CPDA 1OMOA 4CM8A 2PLAA 2HMUA 1X0XA 3BHMA 1EUZA 1GY8A 2GZ1A 4J4HA 4J1SA 4TRNA 4NQZA 5TX7A 1RM0A 1CWUA 2JD0A 1EVJA 2ZKLA 4XB2A 1R0KA 3DC2A 4FB5A 2WYVA 2ZTLA 4OSOA 3ADOA 1HYGA 1I10A 2PV7A 4WPGA 2A4KA 1D1TA 5L4NA 2VQ3A 3LLSA 2ZK7A 2B5WA 2I3GA 1ARZA 2QYSA 4ALJA 4K28A 3RI3A 3HUDA 1PJLA 4I5EA 1PU2A 5B4VA 4TROA 1LEHA 1R37A 2JHGA 4B79A 1ONOA 3RFTA 3G1UA 4N54A 3FPLA 2Y68A 3TZ6A 3PP8A 1EBUA 1H2BA 2BFOA 5A3JA 1H6CA 1D7OA 2UUOA 3QWBA 3GMSA 5TT1A 2Z1MA 3K2BA 4PLYA 4HFJA 3RJ5A 3IJRA 5DBFA 4NBTA 4D7AA 3PQDA 3WG9A 1U3WA 1RM3A 4HFMA 1QV6A 4FFOA 1UP4A 3F47A 2WM3A 4XD2A 3O9ZA 1HZJA 3BAZA 1PJ4A 3KO8A 4M89A 3SC6A 1QKIA 3TNLA 2FPPA 3IQDB 5KTKA 3K8ZA 5C5IA 1GYPA 3NTQA 4R5HA 4S1VA 3RCBA 4UAGA 2HMVA 3UFXA 1Y8RB 3OECA 3AFNA 4AVYA 4FFNA 2C59A 5AXBA 3HDJA 5ITVA 4FQ8A 4ZHSA 4CLEA 3AW9A 1FDUA 1HDZA 3D4PA 3ENKA 3VH4A 3DZJA 3OA2A 3F6YA 2FOIA 1JWAB 2P4HX 4IPTA 1DFIA 4CLOA 4CM7A 3I4CA 2UAGA 2V6BA 4P4GA 1I01A 4MP8A 2Q4BA 3HJAA 2P2SA 4ESOA 2V6MA 1I24A 2O3UA 4E3ZA 3R3JA 1P1FA 4MOWA 4NR0A 3AM3A 4E31A 2NNLD 1YE3A 1A7KA 5I7SA 5CHEA 3GEGA 4A7PA 2WYUA 1SEPA 4ZICA 1C0IA 3I9JA 3VAZA 1E1NA 4BB5A 1JWBB 4N5NA 2PY6A 1N9GA 1UZMA 2C7VA 4BNKA 1JDJA 2B4RO 2H1SA 1T2EA 4IQ8A 2HKIA 2C5EA 3V2GA 2GGSA 3HHPA 3T7CA 4FFMA 1Z6ZA 4PG4A 4ZJUA 3EGOA 4AJJA 2PKQO 3VPHA 4J9UE 4CMIA 5JFOA 3Q11A 5ER6A 3HFGA 5C7LO 3IP1A 2EW8A 4OGWA 4CM1A 4D44A 4D45A 2FR0A 3C85A 3WGYA 2ZB4A 2CDCA 1XYGA 2Y1EA 3N7UA 4OO3A 3MJEA 1JKJA 3CMCO 4ND3A 1Y1PA 2HMTA 1JW9B 2C5AA 2DBVO 1ZXBA 1I36A 2X8LA 3GN2A 1ADFA 3GFBA 1X0VA 3WGHA 1EVYA 1YGYA 2AE2A 2W4QA 5EJ2A 2G17A 4BNJA 2HMSA 1DSSG 1HYEA 3W1VA 3FNHA 4E5NA 4IDBA 1BMDA 1DLJA 4J1QA 4J9VA 4NBWA 4CR8A 9LDTA 2W2LA 1NFRA 3FCOA 3GNSA 1P31A 4OH1A 3HB5X 3PGJA 2EHDA 3CZRA 3ZWWA 2X0JA 1ISGA 3AI2A 4TMFA 1KEVA 1MC4A 1X1EA 1JTVA 4RZHA 2HDHA 3A14A 4OL9A 4IGEA 4OXNA 4TVBA 4R1SA 4A5OA 3WR5A 1ISFA 3INTA 5JSFA 3Q9UA 1B26A 5KWEA 3WOHA 5J23A 1ENYA 1HEUA 4YACA 3ETGA 3PPIA 4CMHA 3VPGA 4GMGA 1Z75A 4ALLA 5ICSA 2NLOA 1TA4A 2RHRA 1ZJZA 2I9PA 2I3AA 1H0KA 2GPTA 3HNPA 4TZTA 4WLFA 4XYBA 5K6AA 3JQBA 3X2EA 2FP4A 1V3VA 3RC2A 1BRMA 1TEHA 3TWOA 3AU9A 4RF5A 4L76A 3ULKA 5A9SA 1NAHA 4DIFA 2QW8A 3WQQA 1CRWG 1A4UA 2VHWA 3RBZA 4D46A 1I2CA 2SCUA 1AHIA 3B6ZA 2Y93A 5CAEA 4YJFA 3L0DA 4KTVE 4WLNA 5EL0A 4E2WA 5L95A 4ROSA 1I5RA 5ICMA 5DZSA 1P9LA 1NVTA 3K2EA 4JJFA 3G79A 4UUNA 1ZK4A 5JS6A 1CJCA 1UUFA 1HDGO 1BHSA 3EZLA 4D43A 3E5MA 3ZI0A 4BGIA 3UCXA 3AY7A 4CLOB 1O94A 4OJNA 2GSDA 3PDUA 2AG8A 4JN6B 4E0BA 2P91A 1H93A 1P77A 4PZDA 2CVQA 1HE4A 1F06A 1ZFNA 2OO5A 5BSEA 2X9NA 1SAYA 3UXYA 4ALKA 4FCCA 3AM5A 3OSUA 4BKPA 1DIGA 3DAPA 1ZMTA 4PIVA 5T6BA 4U6QA 4WNIA 4FGWA 1NASA 4B4OA 4XIYA 1YDEA 1LSOA 2E4AA 2DKNA 1PSDA 4IDFA 2NVWA 3DQPA 3ONFA 2ILTA 1HSOA 3BMQA 3EVTA 4Z0HO 3PYXA 2XXJA 4EYEA 3KEQA 3ABIA 1QYVA 2E82A 4RLHA 1E1MA 5U9CA 4BO7A 3L4SO 3DHEA 4LMRA 1BTOA 3PJDA 1WP4A 1EE2A 2JKVA 4PLPA 4MP6A 3DBLA 3JTMA 4BV8A 1NQTA 4L4RA 3VPXA 1KYQA 1ZKMA 4JJIA 3ZWYA 4CMKA 2YW9A 4TWRA 3JYQA 3KOUA 5TT0A 1PGQA 5IDXA 2OGUA 3O4RA 3AFMA 4F6LA 4M87A 2PKQP 5T5QA 2WE8A 2CNBA 2Y67A 4HBGA 1MC5A 1N2SA 4NFSA 4EDFA 1UXHA 2R6JA 3RIHA 2XXBA 3TZCA 1NR1A 4FFPA 3KM0A 4Q3NA 4FOOA 4RORA 1NM5A 1LDYA 1ISJA 3FTNA 4I8XA 5I7EA 1N7HA 2BI7A 2EV9A 1C1DA 1I33A 1ZO8A 4BO8A 4AG3A 3PHHA 4FDAA 3OICA 4JP2A 5DDIP 3ONDA 3IAHA 2IDZA 4RV9A 4BO5A 1CDOA 1IY8A 1X7GA 4CUZA 2OXIA 3OHSX 5JDIA 3QJ5A 4IDGA 4L4XA 1AXEA 5G4KA 4DPMA 1VKNA 1M67A 4L4SA 1Q7CA 3TRIA 4R51A 1AHHA 3PFWO 1UJMA 3O8QA 4LGVA 3PLRA 3C1OA 1I2ZA 3OEYA 1TT5B 3GZNA 1P0CA 1ZSVA 4XQEA 3RQSA 4GGOA 2E48A 1KC3A 3Q3CA 3S2EA 4Q3AA 2P9EA 3RWBA 3AU8A 3PHLA 4IM7A 1WPQA 2VUUA 2GERA 5CP8A 1DO8A 1XU9A 3QVXA 1HKUA 4NJOA 3K96A 2PFGA 3JSAA 5L9AA 2Q45A 3JQGA 3O26A 4QO8A 1KEWA 4N7RA 1OAAA 3ZDFA 1ONNA 5U4QA 2C2YA 4JP3A 2HRBA 2O2YA 5KJ1A 1SCUA 2DBRA 1LDNA 4IIVA 3S1LA 1PS8A 5KKCA 2Y0CA 4UVGA 2HUNA 1LSUA 2D2IA 3I4FA 2DVMA 5CDUA 3GVHA 3MWDB 2OFPA 3ONEA 4Q3CA 4Z6KA 4AFNA 2GO1A 1Q1NA 1YQXA 4UEOA 5DBGA 2FZEA 1V3TA 4WEQA 8ADHA 4Z0PA 5IZCA 3NUGA 1O6ZA 3B1KA 3R0IA 5A02A 3PZRA 4BS9A 5IAAA 1F8FA 4NIMA 2D5AA 1ISMA 2DAPA 2ZYGA 4CM6A 3JQDA 5DCYA 4BNXA 2NADA 3WBFA 4YJHB 4XIJA 1LLDA 2HK7A 4BNTA 1ZIDA 5G0UA 4P22A 1R6DA 5A9TA 3NTRA 3ZWPA 5JCJD 5FEUA 3UCEA 2ZTMA 1I3LA 4LVCA 1PR9A 1XA0A 4QT0A 3BIOA 4JX8A 4YEDA 3MOIA 3HSKA 2NSDA 2HK9A 1MXFA 4PLTA 1LDMA 1MXHA 3VPSA 5FYDA 1MG5A 5KVVA 1J49A 2VZ8A 4D41A 2CZCA 1PWZA 3FD8A 1U9JA 3EHEA 1IZ0A 3OJOA 4E5KA 3LT1A 1NWHA 3W8FA 1E7WA 4B7CA 1SPXA 1GADO 2PK3A 3DMYA 5ITWA 4DLBA 1HDXA 2X0IA 3OJLA 4ZQEA 1HZZA 3S2FA 3PYMA 1XQ1A 3AOEA 4J7XA 1WXDA 3N74A 2PD6A 1PS0A 3P2YA 3WGTA 4ZRMA 2P4QA 4HNGA 4CL3A 1DPGA 3KV3O 3BA1A 4P4NA 4MPDA 3RUCA 1K3TA 1FF9A 3E18A 2I6TA 4A73A 4QEDA 5BSFA 4R3NA 1ZH8A 2DM6A 2EGGA 1OI7A 3A28A 1UXKA 5BT9A 2X9VA 3I5MA 3K30A 4J7UA 1WLYA 5H82A 2Q2VA 4RO0A 2J3HA 4BGUA 3DOOA 4KWIA 4OOEA 3RUAA 4OIMA 4MDHA 4N18A 3KSUA 3W8EA 1GL3A 1E5LA 3L9WA 3BXXA 4MIEA 1H5QA 3NEPX 4HX5A 1PGPA 1K0UA 3COSA 1LDBA 2EKQA 4A10A 4YQYA 3RC7A 3OIFA 4GLOA 2HRZA 2QRLA 5MGBA 2RIRA 3MCVA 3LSYA 5L7WA 4Z9YA 1LBEA 4LRTB 2GCGA 4K26A 4IINA 3ZCXA 2X6TA 3LU1A 3OFSA 2PNFA 4BQPA 3F9IA 3I3OA 2ZTVA 2Y1DA 5T64A 4BNMA 5CFZA 1B0AA 2A92A 3PK0A 1CERA 4FPXA 2Z5LA 3FRJA 4FC7A 3LT0A 3GVPA 1B8VA 3F5QA 1DFHA 2AEFA 2JCXA 5CPFA 4OQYA 5B4UA 5MDHA 4MVJH 1T1SA 3JD0A 3KYDB 3KRTA 3JD3A 5IDYA 5JY6A 1ULUA 4C7JA 3TOZA 4Y6SA 1P1IA 2BI8A 1CQIA 4U6SA 2C07A 2D59A 4BKUA 3EMKA 1YB1A 2P5UA 4Z0TA 1A7AA 4BNLA 2V7PA 1SMKA 2OBNA 2Y0EA 1XWFA 2BLLA 1PTJA 1RJWA 3VH3A 3L07A 3ZWXA 2Y66A 1DRVA 1DDOA 3I9MA 4J0EA 4JXKA 3DDNA 4RF2A 1DIHA 1LDGA 4FGSA 1H6BA 1T1RA 1GUYA 4OXYA 2IYPA 3W6UA 3JQ7A 3H4VA 3Q2IA 1HDYA 3TPCA 2JCYA 4OQZA 3ZZNA 4QFDA 3NJ4A 2I65A 1U4OA 5TF4A 3JQ7B 1T4BA 2DTDA 2FR8A 5ER9A 2NU9A 1NPTO 3MJVA 3GQVA 2YDXA 4XJTA 2OBYA 3D64A 1GV0A 3QP9A 4JCOA 2EP5A 3P2OA 1UZLA 2QX7A 2VHVA 2YDYA 3HADA 4Q3DA 3WX0A 3MJCA 4CMEA 1P45A 3RBXA 1ZJYA 4OAQA 5L53A 4CMIB 4R9SA 4I5GA 2TMDA 3E03A 4JNKA 4HFNA 1L1FA 4UUMA 1C0LA 2E37A 3I83A 3LDHA 1H2HA 1NHGA 1W8DA 1I3NA 1X15A 3DTYA 3LT4A 5AVOA 1HDCA 3GN1A 3D5TA 4YR9A 1T2AA 3KEOA 4RGBA 1OC2A 4XDYA 4BNIA 4KUHA 2EJVA 1KEPA 4EBFA 3JQ6A 2JFGA 1VKOA 5ADHA 1U1IA 3SVTA 2VOEA 3DBRA 3WJAA 1Q7GA 1DAOA 1Z45A 4YBZA 3SBOA 1GU7A 4L74A 1QMGA 4R16A 3TDKA 5JC1A 1NQOA 1IHYA 5F21A 3U4CA 3W4IA 1BXZA 1GUZA 3MWEB 4B8ZA 2C54A 5BNFA 4YTEA 3WYBA 3MEQA 1X14A 4NBVA 5ENDA 3JQCA 3S2GA 4Q3BA 5IN5A 5CEJA 4CQMB 5K0ZA 1I30A 2NQTA 1PJTA 4CQMA 1ZK3A 1I32A 4ZQFA 3NJ8A 3GEDA 2Y1OA 4KUEA 4R5MA 5KJFA 4HFRA 4J16A 3WTBA 3CIFA 2VT2A 1MGOA 4YWJA 1T2CA 2PGJA 4ALMA 2H5LA 4WLOA 3H3FA 5TC4A 3SEFA 3C7CB 1TT5A 3GZNB 1GZ4A 3WFIA 3A1NA 3G1TA 1H94A 4U7WA 4IXWA 3FN4A 3KYBA 4E30A 3ORFA 2ZCVA 1OC4A 4CJXA 4KUGA 3IDSA 4B8WA 1Q0HA 1Y8QB 2Y1CA 1IL0A 1HWYA 4YJGB 5ILGA 2PD3A 3CINA 3BTVA 4BKOA 1KEUA 4D42A 5JY1A 1L7EA 4KQXA 3RAJA 3GH3A 5IJZA 2VRCA 3JD4A 3QSGA 4YT8A 2PR2A 4GH5A 4IZHA 1E92A 3PYLA 5JE8A 5JW6A 1C1XB 2YHIB 2PTGA 1XKQA 3AUUA 1B3BA 1QR6A 3PXXA 1PGOA 3V1TC 2GD1O 2GRAA 3GR6A 4IUYA 4BO3A 3TQHA 2BFPA 2Y1FA 2AE1A 1JA9A 1LC0A 1U2GA 2CY0A 3WWZA 3VH2A 1PQPA 1XR3A 4FJ2A 3WQRA 1KIFA 3ZU5A 4WLUA 5KJEA 1DRUA 2C29D 3JYOA 1ZZEA 3H9JA 2O3JA 2VYVD 4XZ3A 2VN8A 2BFMA 3GUYA 5TJ9A 2O4CA 3CEAA 3ZWMA 4YDRA 4ND1A 2B35A 4J43A 1LC3A 3I9LA 1ZK0A 3WGGA 4MIOA 4R1NA 5FFFA 2EKPA 3GOHA 4BKRA 3LLVA 1DC6A 4BVAA 3FWNA 3PJGA 4RZIA 4JBIA 2DQ4A 2IZZA 4H3VA 4YAIA 4NZ9A 2FPIA 1U7HA 2WD7A 4CM5A 4E21A 3PWKA 4PLCA 1EK5A 1E5QA 4IY1A 4XJSA 3VKUA 2C0CA 2IEDA 4CODB 1DXYA 4NBRA 3ZGYA 1X7HA 3TZKA 4DMLA 3DBHB 3U5TA 4ZU3A 2I66A 3WGIA 1DIRA 1U28A 3EUWA 4XWYA 4AJEA 4B3HA 4BO0A 5ES3A 1FDWA 2VNAA 3ASVA 4PLGA 1PJCA 3E9QA 1TLTA 1EDOA 1KERA 1Z74A 1DEHA 4MKZA 4Y6PA 3OMLA 1QG6A 4O1MA 5CDSA 4DYVA 1LRKA
chains in the Genus database with same CATH superfamily
2MSLA 1WWKA 3FHCB 1Y1KE 3QVJA 1Y81A 1NP3A 1MJGA 3ICVA 2HLPA 4RCVA 1E94E 1B1CA 4EA9A 5B37A 3THXB 1FSPA 4J0IA 2J9GA 3CX3A 4INOA 3CSUA 2B7CA 3G0IA 1EUDA 4IVQA 2RGDA 5EPUA 2VPYA 4MQ4A 1CQPA 1AT1A 2V54A 2PX8A 1BDBA 4GXTA 3TCNA 4HG2A 1V1MB 3CONA 3IJEB 4IJ6A 3NLLA 3A06A 3PWTA 4ZKDA 3OOEA 2FMTA 3FNRA 1GGFA 3GG9A 5K8JB 1R6TA 1LX7A 1MNAA 3ROQA 1LPSA 1OHHD 4TKZA 1U7WA 1JR4A 1YS1X 3HDQA 2ZBUA 5CIWA 2PIDA 2YXLA 4G85A 4DBLC 4YAJA 2NIPA 3GD5A 4RESA 1M34B 4V0MA 2O2EA 1BE1A 1FUUA 1O1YA 3TUIC 1YH3A 4F72A 4L50A 5H0IA 4PCAA 3ZWBA 4C4YA 4RULA 2VJCA 5TV2A 2WWFA 4HBZA 3L8CA 2X7JA 1DB3A 4R3UC 4XW2A 3ZDYB 1YRBA 2ONYA 3D6NB 2R86A 3H5AA 3JAWB 3LPDA 1TRHA 2GBIA 3DKRA 4CNBA 4L16A 4A36A 2JLCA 4AAYA 3GPDG 1VYVA 2QAJA 1C1DB 3CT6A 5CU7A 2ZJFA 3ZGVA 4CNQA 4D8VA 4DR3B 4HXEB 2BRUA 2PS9A 5BN5B 1HE8B 3C97A 3QHAA 4E7PA 1NPYA 2P2DA 3EGWA 1H4SA 4NG4A 1JHDA 4KACA 2N1MA 1NDHA 2V4ZA 3NTUA 4BIIA 3ORRA 3ZDXB 1NZDA 3G59A 3ZU3A 1ULAA 4WOCA 3A9CA 1JJFA 4E08A 1S9HA 1Z0FA 3T1QA 1T3ZA 3CH5A 1JA1A 4U2BA 3DG9A 1U3GA 2J1LA 2FQ1A 1YT5A 3UMGA 4EP1A 3WKCA 3RAFC 4UU7A 2AI2A 3OIUA 4P5EA 3CG0A 4L02A 4TTTS 3GFPA 1NF9A 2WQZA 4KG7A 1ULBA 1P2TA 3B51X 1N4AA 8AT1A 3T12A 3WK8A 4FLMA 1DCKA 2OMEA 3AEXA 2H31A 5FPHA 3CLTD 3BM5A 1XZNA 5H16A 3LGAA 3AF6A 2FX3A 1FTQA 1UM8A 4RTLA 4PYNA 4NCNA 2VH1A 3EZ2A 4GLLA 1DS6A 4NAHA 1C7FA 1SCUB 3AUAA 1BHQ1 2DPLA 3EVFA 4QUIA 5EZYB 4ZWNA 3HA3A 4DMRA 4PXYA 4ZTUB 3LM8A 1ODJA 2W4MA 2WVJA 3AOGA 3CUYA 3JR7A 3LPMA 5EE1A 4E33A 2CUZA 3B60A 1NATA 2V59A 1SD2A 3DAOA 3DEKA 5GIPE 3OIVA 3F6BX 1V0JA 1Y89A 1KJNA 1ORRA 3DVAA 2ZIVB 4LVNA 3TX6A 3K9FC 1QTQA 2V6IA 1G55A 4PO3X 2CLIB 2P9HA 3WSWA 3Q88A 2F43A 3BDIA 3MS7A 2FRVA 2WTNA 4UE3S 2PYZA 3T7KA 3WAJA 5F98A 1Z0DA 1XMSA 2BDUA 4GI3A 1JDTA 4PONA 1H65A 1UJ2A 1EB9A 2I2DA 5GONB 1M1NA 3V42A 1DIOB 4U1RA 2QT0A 3EC1A 2WB2A 4MV3A 2VEDA 4NX2A 5LP1A 3E48A 4ZAWA 1N5KA 1XWIA 4IIDA 4A6PA 2RK6A 4DAEA 3RRMA 1NNEA 5BY2A 4G8DA 4UHEA 1ZHHA 3RIXA 3QX9A 2FQQA 5ED0A 3QSYA 2JNWA 3D6FA 1XMXA 1YKFA 4WRRA 3SZUA 2VUIB 2NV6A 4B34A 1O94C 1U5CA 2WHXA 3H1PA 1XQXA 1TAUA 3NWJA 1LVGA 1SVMA 3H2SA 1CZLA 1IWPB 3HWWA 1R4NA 3GEIA 2ANCA 2ST1A 4RCZA 1V5WA 3ZY6A 2FVXA 2WTAA 3RUIA 4X1KB 4UPEA 4PNPA 4E14A 1Y1RA 1V96A 2K5UA 5K0GA 3V8MA 4YDQA 5HCNA 4Y0VA 1QHEA 3MTQA 4CL8A 4F4IA 3UPTA 3OE4A 5CMLA 1FW8A 2AKAB 1EVZA 1BNCA 1UMDA 1W36B 1U8ZA 5J4KA 3DLIA 3SWWA 5J2TA 4OMCA 3DF9A 3LTNC 3GLGB 2C2GA 1PT6A 5F2EA 3MXTA 1YU9A 4R41A 1E8MA 1E7QA 1KI2A 2YBEA 1D2MA 5L3ZA 2ZRKA 5SZIA 1JMKC 3CM0A 2ZDHA 3KR9A 4CMJA 2YYAA 3DYIA 3PG5A 4JWTA 4LNAA 1VLZA 3DW3X 1CDDA 1QO7A 4ZYYA 3JYHA 1Z7BA 3IJ5A 3DLBA 1EXDA 2C9ZA 1AK1A 3WO1A 1GNVA 3MWEA 4NJMA 1TXGA 3AR2A 3M6VA 3EY4A 1LW7A 1UBOS 4B82A 3AQ4A 4TRRA 1U2DA 5GZ3A 3S68A 3BZUA 1UBUS 2JGJA 2WSBA 2YWDA 3ISTA 4Y2HA 1IULA 4A0GA 1KQPA 4LAFA 1TIPA 5DM2A 3EGCA 3FY4A 1IVYA 2R6HA 3HUEA 4OGFA 1GPAA 4YJ2F 2HU2A 3V4SA 3WB9A 1L7MA 4K9DA 2VNKA 4D9MA 3CPJB 1KVUA 5JXWA 4F45A 5KC8A 2YXNA 2XEXA 2A94A 2CUTA 2W2LD 1G9TA 4FOLA 3ROPA 3UWKA 1HFEL 3VU9A 5D84A 1SB9A 2WI8A 4WERA 5ALZA 3RVRA 4AC9A 3BTUA 3C45A 5I9MA 1JBKA 3Q8XB 2QA5A 2OGTA 2YYYA 2H4ZA 4WAUA 4B35A 4ZZIA 1YQDA 2LDBA 4GOMD 3F8TA 1SU7A 1F2DA 3UHFA 2EJTA 3IEXA 3ZU2A 1BVRA 2FAXA 3L7NA 3Q2KA 5LQNA 2P4EA 3Q7RA 1E1KA 4TN5A 1KS9A 2B78A 2BGMA 2P9FA 2XQKA 4P32A 3S40A 4XXHA 2AGVA 4GMDA 1Z2CA 3ILHA 2AYZA 2XZTA 4QUBA 4EJFA 1NTOA 3QX7A 3HBJA 1A96A 2RONA 2OK8A 2XMGA 1DG1G 4JITA 3T1TA 1PJ3A 2JJ8A 3KETA 2C8VA 5KTRA 3L0OA 4XOUA 5G0SA 2WVHA 4Z99A 1J7KA 2B4QA 4W82A 2Y0DA 5DBOA 1GL7A 1TL7C 1EK0A 1KHHA 1A5TA 4M9CA 5A4FS 1U3UA 3GBSA 4GX0A 1L5WA 4FU0A 3UK0A 1WRBA 1JVNA 1TYCA 1UBKS 3QOXA 1E7SA 3ND5A 4JLSA 1WY5A 3U17A 4D8TA 4OSEA 5I5EA 4XVHA 2NO9A 3CYFA 2W4IA 3ZCTA 1RZVA 2XPCA 2ZI4A 1VKHA 3QW2A 1WXHA 3OCXA 4AZ3B 5FA6A 1ABBA 4HSGA 2PQMA 1ISIA 1C8VB 2F8MA 1TTTA 4BB6A 3PTLA 3TGLA 2FE4A 5DV9A 3VC7A 1M76A 1LZKA 1J9EA 3D3WB 3CKYA 3L1JA 2G04A 2WHRA 3U26A 1E2EA 1XTPA 4AIIA 4KO2S 3PDCA 3MJSA 1FOEB 3TLCA 1ADJA 5EWJB 3CT4A 3KLPX 1FP4A 4KXWA 5LLSA 2VXOA 3C48A 5ERYA 5G4KB 4C0KA 3TNYA 4OKNA 1W73A 5DTRA 5DI9A 4UM5A 1JSRA 3OZDA 4WUVA 3NO4A 1WE2A 1BGXT 1MUUA 4F71A 2FX5A 2NVUB 1TVKA 1OBOA 3LY7A 3PB3A 3MAGA 4JIMA 2BH9A 3EGXA 4TWJA 3ETHA 3E70C 1VP9A 6PFKA 3SHWA 2II6A 3M5DA 2R1VB 1ICEA 1JHAA 1T6XA 2YWBA 3H5NA 3HEAA 4FXPA 3ZHBA 4O4HF 1XRRA 4FOSA 3TPFA 2PUEA 4RABA 1NT2A 3FFXA 1R3UA 2ZJ4A 3HN6A 5K3FA 2G08A 3ONVA 4D5EA 5L6LB 2W7TA 1NBHA 4I55B 3HFSA 1NW9B 3RTEA 3PL5A 4ERXA 1EHIA 4Z4CA 1YJQA 2O0MA 3WJ7A 3G0OA 4G9GA 2X77A 2ZG6A 5DW3A 1L9XA 2IHUA 3I09A 3PD1A 5AXDA 3RFCA 4DLWA 1SCQA 1C4XA 4P54A 2KLBA 2HCRA 5LQDA 2QM7A 2NO1A 3M4YA 4OQEA 5JISA 3U44A 5CCBA 3PDIB 3PKJA 1J2EA 3U7GA 3L79A 1LUAA 5HWSA 2IPLA 4HX2A 4WASA 4ZREA 2W58A 5KYYA 2P3OA 3BVPA 2ZRFA 4HN4B 1H3FA 4QHSA 2VRWA 1BXGA 3BQNB 4LHXA 5FCDA 2UZ3A 1VB3A 1DX6A 5D3MB 5BQPA 4PPQA 2QTHA 2WQ6A 4Y6QA 2ISSD 2AKEA 3PWSA 8MHTA 4GU5A 2BD0A 2EZ4A 3DHYA 2BHTA 4I9HA 5LA6A 4ZDJA 3WAGA 3U4HA 3WZ2A 4BMVA 4RTMA 5IT0A 1EXWA 3HJTA 5B5SA 3RK1A 2FXVA 3BG5A 5JJ5A 1F12A 4TLEA 1NVFA 1E0KA 5AVYA 4OK3A 2P2LA 3GRUA 4KVZA 3E5HA 3IP6A 4Y2QA 3RKSA 2H57A 2QD2A 3TH5A 3D2CA 1IK6A 3V7FA 4B0OA 4UM9B 3K92A 4E5DA 4BPBA 5L8VA 2XE6A 3G8BA 2HEIA 3GLHA 5CB6A 4JI2B 1OYVA 4B3BA 3H99A 1ZCAA 4L6CA 4C22A 1EKXA 2O8FB 1PLKA 2Q1XA 4D0NA 1IB6A 5JNVA 3C5CA 2G76A 3MLBA 1ESMA 4Z4FA 3HDYA 3T0GA 3U4GA 4B2IA 4RSMA 2QJWA 3KTFA 1QE5A 1GZVA 3G0CA 4I1IA 4LQLA 1FFXA 3EYWA 3WNZA 3KYCA 3O4HA 1G6OA 1GUBA 2VO1A 3I1JA 4HWKA 1TGYA 4Q3EA 1MJ5A 5EPOA 5FPQA 4P6VF 1CY6A 1EB8A 4BFWA 5FX2A 3HQ4O 5DIFA 4XYGA 1G1MA 1AQYA 1Z4JA 4N5LA 3C7DB 4GX1A 4DTIA 3A4TA 1GGJA 4HN9A 4V2IA 1YB7A 1TYBE 2O7RA 2YV4A 4DRZA 2CLSA 3O0TA 5HA5A 5JWHA 4CTMA 5EJ9A 5JSYA 4AO6A 3SS7X 1J06A 4C7OB 3MGGA 3VVLA 1YACA 5DYIA 5I45A 1TU0A 1XSEA 3JW8A 4Y9SA 5LMUB 3WLTA 4DIBA 1Z6AA 5TRTA 2FWPA 5KHAA 2H52A 4ANFA 5LDDC 2PR7A 2ZJOA 2YMQA 4M99A 5IXYA 1FSGA 4MQBA 2C7GA 2QP3A 1JAYA 2Y8EA 1XZKA 4G97A 2Z95A 4NCHA 4NH0A 9ABPA 2DLDA 1XEAA 4O4JA 2V5AA 4Q39A 1XZEA 3N0VA 4TSKA 2RGEA 1Z7EA 3LUBA 1K9SA 4RHYA 3HI6A 4DGQA 2DPGA 2H4XA 4V0RA 3VJLA 2HRDA 4N5HX 3L7IA 4BNNA 4OU5A 1L6IA 1GPJA 3H4MA 1MV8A 1Y6ZA 3IJPA 1QIJA 3L04A 3RKUA 3ISVA 1W88B 2H2IA 3B89A 1YL6A 5GADl 1ZH4A 2QVZX 4U0JA 3E22B 2ZVQX 4B43A 4M1OA 3MGCA 2J9ZB 3T4PA 5GONA 4KDFA 1N2GA 3KKQA 1RYNA 3IAFA 3W2TA 2GAIA 4G1UC 4GGPA 4L78A 5FDFA 2XRFA 3MXOA 2V7BA 3RIEA 3B1FA 3TOSA 2HGZA 5GZ6A 3K4HA 4FFBB 5JAIA 1DC4A 1HE2A 1Y34E 4FR5A 1L8AA 5A3VA 3I01M 3UMRA 5DT9A 4DLLA 1BXRB 2AXNA 2F2TA 1PW7A 1G5RA 1SIUA 3KAQA 4L75A 3UBMA 3AX6A 2IXAA 3SKYA 3FKSA 4ABTA 2CXSA 1AK2A 3SSMA 3S2IA 4GUAA 5JCJA 1YRWA 4IW3B 3BL8A 1OYOA 1B0ZA 4L28A 3E3NA 4I4NA 1OROA 3KTDA 3Q12A 1YZLA 3ROGA 2NSJA 2HEGA 3G68A 5AW2A 2ZUEA 5BVGA 2XMCA 1SRQA 4NHOA 4A8TA 2BE7A 2B9EA 4MRPA 4Y2SA 3HRKA 4RDXA 5FUQA 5GINE 1N33B 1H9AA 2NX2A 2JRLA 5KKAA 1H4VB 2RC6A 3H9GA 1NF2A 4EHHA 5B36A 2F1JA 3OP1A 1KFKB 2Z30A 1K8XB 2I6FA 4J0HA 3K9HA 2QI9F 4ZAXA 2W6OA 1M0EA 1HT1E 3WRXC 5DBEX 4L07A 7GPBA 2Q1UA 5AYVA 3T1OA 1TECE 4A8JB 2GAJA 1JN0A 4WJZA 4IDDA 1JT2A 1Z68A 5DH9A 4Z8XA 2ORVA 3OHPA 5B1DA 3M2TA 3VA7A 1W88A 3O9VA 4YP5A 3V8BA 1JRLA 1L5SA 5DHTA 1K7YA 1PJBA 3E5RA 3GJSA 4H4CA 4RXMA 2I0FA 3GXBA 3VYUB 3VU3A 2H9IA 3WGNA 3COWA 5K0TA 1MHPA 1M10A 1ZCBA 4TMTA 4UULA 3LQQA 4H1TA 1QZXA 4UVEA 2P6MA 3NCHA 4RZQA 3I4LA 5BQ3A 1B15A 4EO7A 3O4GA 1ORHA 3JQ9A 3T5AA 1IOWA 2BMWA 4PFQA 2ZUWA 1H0RA 4M1MA 3K70D 5BQFA 1G7RA 3HCEA 1ZNYA 4R7TA 2O3TA 5JPIA 3VAAA 3KQSA 2IVFA 1U5BA 3R41A 3FGZA 4EITA 3DONA 2O14A 2O2SA 5BN1A 2VBGA 5LZ9A 4IMIB 1T5DX 2IOQA 3FIUA 3NOOA 1DJPA 1U1EA 3DBHA 1A82A 2VDMB 3A1TA 3MS2A 3PXCX 4Z8YA 2LVBA 1O87A 2GZMA 4D8XA 3TEJA 4DBVO 5B4TA 4DWJA 1CLUA 3E7FA 3RVBA 3HGMA 2QBYA 1PJZA 2O1WA 1OA0A 4ED9A 1I4OA 1NBMA 1ZSNA 2I62A 5ERXA 3VJMA 4EW3A 2FN3A 1S2LA 2GAAA 4HB2A 2V74B 1J39A 1NN5A 1EGAA 3DC7A 4JUFA 3U7JA 2BBWA 4QUKA 3G0HA 3BD9A 3EVEA 4IBOA 4L0MA 3QXGA 1V8BA 1REQB 2I29A 3ELYA 3TFQA 4HRAA 3VSEA 1MZPA 4HOYA 1TC2A 2DXIA 1QSGA 2YFKA 2ZXUA 4KVGA 3DMFA 5J9FA 1SOUA 4IVNA 4W5HA 3MPOA 3KSZO 4RPHA 3UT6A 2A86A 2FFBA 4JJ7A 3OG9A 3AWDA 3HCAA 3HUUA 2X5JO 1NMQA 3IKMB 5B1EA 2VZLA 3H2BA 4KH1A 2VWHA 1N5LA 3S28A 1VMKA 1Z15A 4JKOA 1QR2A 3W34A 5I3ZA 1BDHA 4W9NC 4QM6A 5B6IA 4EYSA 3VR5A 3O03A 7ADHA 3OQBA 2B1JA 2NG1A 2C20A 2Q3FA 3RRXA 3WLJA 5AESA 4BNHA 1U80A 2UYOA 4IMRA 1Q0SA 3EY9A 2I2XB 2ZJ7A 1ZP6A 3AF3A 3BK2A 3B2NA 3TUZC 5EYPB 1GUAA 1XHFA 4BB9A 1A2KC 1ITZA 3ORYA 1UOOA 4A2CA 1FU7A 1IC6A 1KK1A 1RD4A 1SCBA 5HKOA 5KSZA 3CHYA 3B85A 1K4MA 2H48A 3WV5A 2VOJA 1Q15A 3EDMA 4Y6GB 2PFKA 1C0PA 1E79D 3G2JA 2R2AA 4QYIB 5A7GA 2A35A 3LL7A 4LCBA 5HOEA 4MJXA 2IYUA 1ZUIA 2FYTA 1GFIA 1Y1SA 3K15A 3GBPA 3U1VA 2MYTA 3JYLA 4GI2A 2DULA 3IODA 5LOVB 1QP4A 1KDOA 2F4VB 2Y77A 3DZBA 4NFYA 2KM1A 4DBLE 4I55A 1SD5A 1Y3FE 5C1PA 4OH1A 4WY5A 1SK8A 1ZN8A 3HO1A 2HRCA 4JB0A 3TS1A 5IABA 2LIVA 1N3LA 1PFYA 4P08A 1XZJA 4FCTA 3ANTA 4E2ZA 1U7UA 2JL1A 1PDWA 3CZ4A 3HDVA 3IXMA 3QWIA 4MNTA 4UZFA 3P19A 3RUDA 3V8NA 4M38A 5FBQB 1E3JA 3HPRA 4F86A 4I1VA 3M49A 4XGRA 3NIFB 2BSXA 2QLTA 1FFHA 5DHPA 2AI3A 1OPXA 5JO9A 2DUJA 2IYLD 2JJQA 3W8NA 1FDIA 5FYQA 4CT4B 1NDUA 3N9IA 2HC9A 5DTEA 3ZHYA 1UMDB 3TJRA 3VR4H 2IYRA 3TAUA 4MWSA 4DR7B 1HFKA 2GEDA 2JHPA 5E9JA 4LHEA 3R7DA 1MB2A 1QG0A 4MKXA 4NYMQ 3K0FB 3FNFA 4X1YA 2BFBA 3W77A 4F2PA 5HEKA 3AEQA 4DLUA 1F8YA 2ID8A 2X8BA 2PWZA 3I72A 1RJ9B 1WLSA 4EI8A 4NCKA 5TF0A 4LF7B 1OF1A 1XTKA 1J5PA 4BIMA 2LCFA 2ZT8A 2XVYA 4YH1A 5DX8A 4N7MA 2YIVX 1W6RA 4RSHA 3V4VB 2BCEA 4TV9F 3OD5A 2YX1A 1NF3A 1QHHB 3ANLA 2V7UA 2ZRIA 4KQ6A 3NM6B 4RD2A 3WBBA 3NOXA 1T8TA 1DAKA 1Z4IA 1ZRSA 1H6DA 1PBNA 2WT9A 4D96A 4ENVA 1PJRA 3GNQA 1GP2A 1PG5A 2PE5A 1GYRA 2C78A 5BVHA 4YGYA 2PGLA 5FBWB 5IG2A 3NPMA 2QU7A 5EOVA 1ZM9A 1IMJA 1EG7A 4DUPA 4DM7A 4RADA 3DHVA 2A0FA 2R7KA 4BVGA 5FBKA 3HZOA 2REQB 3AT1A 3UTDA 1NMXA 2AZXA 4DREA 4NOKA 4K0KB 1A9TA 4MO2A 1LLUA 4GWKA 3CPHA 1CUGA 1DMSA 5EVJA 3KR0A 3K6KA 4C05A 5LYJF 1SIOA 3ZV3A 3ZDCA 2X40A 3WL8A 4LJ6A 2EXXA 6NULA 4R98A 2GPAA 2YKGA 4UCXA 1KO1A 4CDMA 4YT2A 1YF3A 1B16A 5ALRA 1DVRA 1YC2A 4F8EA 5BWCA 2ACWA 2O3QA 3FZYA 3R75A 4EB6B 4F96A 4NQRA 4PN3A 5F7OA 1R0WA 2YS7A 2BZ1A 1H2YA 4QQRA 1D6SA 4EMTA 3BSYA 1T6BY 3ADBA 4XPIA 5C4IA 3HBMA 3MJHA 2BSAA 3LXMA 4R9NA 5JQWA 2WJ3A 2OHGA 4X93A 2OXCA 3DMTA 3GFTA 3CUKA 3S2YA 4K40A 1PWXA 1N6OA 1ZH0A 2B4AA 2TRSB 3O8OA 1QK5A 3RVLA 5ALHA 4UDXX 3OPVA 1Z0SA 1U6IA 1ISPA 1N25A 4OPMA 4ARSA 4BQRA 4QKQA 4PVCA 3HB1A 1UMCA 4LXIA 3LWNA 2A14A 1T0IA 3RRBA 5GVSA 4CLHA 2FNAA 4YFYA 2C3MA 3AZQA 5BQXA 1RCFA 3LBFA 4OLHA 4DMGA 4E13A 1C8KA 2EGHA 2XDQB 3JQAD 2P62A 3WIDA 5JBQA 4B4KA 4QPPA 2YQZA 1DJNA 5LJIA 1MJNA 2PBZA 2VH5R 2WSMA 4HR7A 4JOSA 2HR1A 1GA6A 4P31A 1Y4SA 2NYVA 3C6YA 4PAWA 5I7AA 1AGYA 2HO5A 1T1GA 2I4OA 3IIMA 3JAWA 1M2GA 2OKCA 1IZ9A 1TM5E 1KDZA 5JYEA 2BKVA 4H7JA 1YTUA 4ZA2A 1ZGHA 5BR1A 1BN7A 3G9TA 3L8FA 4L57A 1E3EA 5ECWA 3FLAA 3STHA 2DCMA 2D7JA 2D2XA 4KWCA 2Q3JA 4AULA 2P2GA 6LDHA 4LSWA 1L4GA 2Q99A 3DDUA 4H3HB 1FQOA 5DNDA 5EGNA 5I51A 5FXMA 2O7QA 3ZWOA 1CW2B 1H8HA 3HKEB 4G24A 3PHCA 4H7DA 4M0CA 4BMZA 1E1RD 1IY1A 4G84A 1FTNA 4P38A 1IHXA 4KYIB 1CUZA 2HQOA 5FBVB 4DC1A 2V65A 4PE5B 4LXXA 3SQWA 4KGDA 2BFCB 3LYHA 4LG1A 2FP3A 4NMXB 1O57A 1E6LA 3V55A 5TLSA 1MHTA 1IN7A 2I7VA 3IUYA 3WIUA 1V5GA 2OWDA 3CU5A 3GGPA 4EUHA 2BGJA 1WY7A 2BMVA 3AUSA 4RETA 2PUWA 4IG9A 3OQOA 1WDTA 4QSMA 1E9DA 4G07A 3ZHUA 4GBMA 2F1OA 4DMKA 4EVSA 1K6JA 2GBCA 3N8DA 4J2TA 5EMHA 3R76A 3SEZA 2IEGA 5KOJB 3NDBB 2HQRA 3GNLA 2OVFA 5DRTA 3HUFA 2GETA 5GJWC 4HGRA 3I5YA 1GTRA 4GG1A 4BTVA 4FE7A 5TNXA 3HNRA 1EXMA 3C3PA 4IJKA 3ZWAA 4E4TA 4J94A 2FSSA 3ZQ6A 1SO8A 3LZ6A 4LBZA 4BMCA 4D92A 1EUCA 1EM6A 3A4VA 2NACA 4JA0A 4RCYA 1WABA 2NU8A 3CVWA 2IYEA 4XRGA 4KV7A 3OKAA 2UVPA 2Z57A 3T61A 5GGXA 2M32A 4LA4A 2G6TA 4QULA 3NOVA 3UJBA 4F1WA 1KP9A 5B7GA 1KWKA 2VRBA 5CCDA 4R31A 3LY9A 1NXXA 2EKLA 3RUPA 1BKDR 1PFVA 2PLWA 2FWBA 4JT9A 2ZQYA 1YCGA 1OOEA 1ZVMA 2XUPA 1CS4C 5DU2A 4B7UA 3ESAA 1XCOA 4D3FA 1ZL0A 4YRGA 1R4MB 5LQSA 4O2LA 1GTG1 1Y6GA 1TVEA 3WQSB 2IP4A 3G5MA 3TBFA 2G72A 4ER6A 2F1RA 2ODPA 1FX0A 4MP3A 2G40A 3P2EA 3DB1A 4U5QA 2A0KA 3HO6A 2VJDA 3LOQA 5BNIA 2Y0BA 5EG5A 4NEQA 2VP9A 2BJHA 4PCUA 1X2BA 1J22A 2D13A 1Q11A 4M9ZA 1HETA 1OX4B 2Q0HA 4WCVA 4J1NA 2C04A 3O1LA 4YCSA 4PR0A 1GTVA 3MTEA 3EFBA 2VXYA 3D3JA 2FH5B 3FMVA 4PICA 1N1GA 2YUTA 1DKQA 3OM9A 3WL4A 3LKZA 2OV2A 2J9XB 3U7QA 2WF6A 4ZYZA 4C4RA 1NKTA 2X23A 4ASUD 2COUA 3OJ0A 3VISA 3SAJA 2J9RA 3CCCA 4BAGA 2Q5CA 2FG6C 1PR0A 4W8HA 3SJUA 2XA2A 5TY0A 3TQQA 3VO1A 4AI6A 3IT0A 4OSPA 1BDMA 1X42A 3GLGA 1WJGA 1HEIA 4XQCA 1KYYA 2YTZA 5FOWA 1N0HA 4QHYA 3F6CA 1U5AA 1FPMA 3Q40A 4YRDA 4XJVA 1J24A 1B6GA 2PZEA 1K88A 4FWIB 1ZX1A 2Z2XA 3T7SA 3VU0A 1XP8A 2J07A 2YS6A 2FJUA 1KDTA 2OD9A 4C4SA 3CLSD 3QRWA 2COKA 3LNCA 4F5YA 2HDNB 2A57A 1WBBA 4Z49A 1IVNA 1QRRA 4CLRB 4NBLA 4D56A 4EJSA 4RIIA 4HDMA 3RVNA 3P9YA 2EW1A 2P5SA 1YB4A 5DF1A 3WGOA 4I4IA 1E9VA 3DOCA 4D6XA 4E03A 3W6NA 1UR5A 2ORED 1Z4LA 3EQZA 2Q27A 3EWSA 3KKMA 4ZQIA 1MBZA 4E22A 5L7YA 4R1PA 3JWPA 3D02A 1BO6A 1SVIA 2PZLA 3I39X 2VSYA 3NONA 3QOFA 4FCVA 4II7A 4ND4A 1D07A 3H9QA 3T7TA 1NOIA 5HRUA 1VPEA 2OLEA 4JLVA 2O48X 3IP7A 2PS0A 4MB0A 4M9SA 1GTZA 1KVRA 1VKRA 1XKXA 2ADOA 1KEEB 2Q46A 3HFJA 3II6X 1L4FA 4G3XA 1ICIA 1RYMA 4H1UA 4HB4A 3E0XA 1VCIA 2CVOA 2HJVA 1JKXA 4J8PA 4KRXA 2PZBA 4NBUA 4C14A 4DSNA 5LQMA 4CKYA 1EEHA 1AZTA 2V4UA 4ZN6A 3UENA 2Q5QA 4DA4A 1P4AA 1ZJJA 3CJTA 5CG2A 5BURA 4MVJE 3L4KA 4ZTBA 2WPDA 4Z7JA 4FDMA 2ZIZA 4ZZ2A 4QODA 1DZ3A 1E2PA 2A0YA 4OLAA 3DOJA 3ZWNA 5BYAA 2D74A 5DTMA 3GLUA 2GTPA 3USCS 3T9EA 3H2HA 4DUZB 4FHZA 4AJIA 4XSHA 3HSYA 2FY8A 2C7PA 4RMIA 3HZZA 2I2FA 1PJQA 1O3YA 3W3AD 1DT5A 3T0FA 1NLZA 3WADA 3I12A 1IDOA 2H7VA 2XMPA 4KW7A 2ERYA 1R18A 1R5BA 1X8XA 1MMFB 2Y9MB 3IP3A 3M4NA 4HKTA 2V0CA 4HUJA 1K68A 4FYIA 2EW2A 5E6RA 3LZDA 3FSEA 2O19A 2BR4A 5AQEA 1S2OA 3F97A 2JFXA 4PZ9A 2WWRA 2CCGA 4GLJA 3ADCA 3CZ5A 1AGPA 3UGJA 2LV8A 3M82A 1QYDA 4ZO8A 2WOJA 4DR6B 3TBKA 2HTEA 3GAZA 5ECGC 2DT8A 2PLRA 3DZIA 4M1QA 3A36A 2H2WA 3O8NA 3G5TA 5HQJA 1RS0A 1KFEB 5AW3A 3JTEA 4DV1B 4F60A 4S05A 3W05A 1QQAA 1MVLA 2ZSDA 4PAQA 3WDKA 3JATA 1JQAA 1KVSA 1O97C 3VGJA 2IS1A 1KETA 1OAOC 2CEAA 1VPDA 3AL2A 3CJRA 3GI1A 4LRUA 4RVFA 2AV6A 3Q9NA 1H4TA 3SU8A 3ACDA 3QJGA 2D1FA 4EEZA 4DGSA 2ZWIA 1ORVA 3G82C 2KJQA 1V8ZA 3OPYB 3KVNA 5CFLA 5CFNA 2IH2A 1IYZA 5DN6A 3IELA 3KXPA 2GJ9A 1W52X 3C3WA 2QNRA 3PGMA 4N39A 3RF6A 3SQNA 1WVIA 2I2BA 2BN4A 1Z13A 4DMFA 5EHQA 2XZDA 2AN5A 3RFVA 1S5PA 1WVGA 2JI6A 3CEHA 4WCFA 2IS2A 2JLXA 1XZDA 3UBTA 1RXCA 2DWPA 2O06A 1W0CA 2Q2WA 5AKYA 3STYA 1C0EA 4CQLA 4H35A 3AILA 3O4IA 3U4DA 4MGIR 4M54A 3AFOA 4HNRA 1CY8A 2YJ5A 4KRGA 2PX4A 3IQHX 1XCPA 1YMVA 2QNIA 4KXMA 4CR7A 3ZY3A 1V6SA 1AV7A 3DEJA 2CNOA 2C2HA 4DQLA 5F7JA 2BH2A 3C98A 3CZ9A 1JEQB 3L8YA 5CDYA 4IXDA 3NEJA 4MW9A 1UODA 5JOQA 5E6SB 4G5YA 2CVPA 4A2QA 4G0YA 3K9WA 3IKTA 4G67A 4EQ6A 1DV1A 3IR6A 3HC7A 4NYIQ 3IDAA 3MERA 1W7AA 3H5RA 1WXIA 4GS5A 3VJKA 2V3CC 3AUXA 5K3BA 3V8PA 3ZHVA 2QM3A 3RHTA 1RJDA 2C2MA 2PV0A 4M8IA 4ESHA 3KFXA 4ZZ3A 5T67A 2Z9DA 1YOVB 3BMCB 2P41A 5JCZA 2RAUA 5CVUA 5ALNA 1VJCA 4MUEA 2FFRA 4R9UC 2K7FA 1CQJB 1X8JA 4HXGA 3UB2A 2D7CA 3A27A 5BOSA 1PEYA 4B6FA 4JGBA 1LI4A 1M8FA 3MA0A 5DMXA 2F55A 4G9BA 5HJ2A 5B2EA 1HGXA 2NNWB 4R1OA 4RUKA 5AM5A 3GH1A 2BFAA 3R7FA 5K0EA 5KWIA 2AC2A 3B20A 1MB4A 3T34A 5E6RB 4H6VA 4IYRA 1J1ZA 1U65A 1KP2A 3KKNA 3L9XA 3I8XA 2Q41A 1EQUA 4UASA 1JEOA 1DTWA 3ESBA 4P8RA 3RD5A 3ZNNA 2UYCA 4JAVC 1JVBA 3IOEA 4ZDKA 1UBGA 2P67A 4O6VA 2ADMA 4K6KA 4M3NA 2W71A 1XVLA 3L77A 1FL9A 4DT1B 3H2GA 4Y9TA 3W2HA 3UGKA 4TLMB 1MIOA 3PFBA 4BNDA 3ZCRA 1KC1A 1YA4A 4CKCA 4FZ3A 3VOBA 4LNHA 1FX0B 4FNOA 3H1FA 4C0AC 2PZKA 4XUDA 3VR3A 4CHGA 4BPRA 4HAWA 1QHSA 3GHYA 1T5IA 4XWOA 1FDSA 3VZSA 2CLEB 1J2JA 2DYKA 1OT5A 4UVIA 1MABA 4DC9A 2VHZA 1PSWA 5J4VA 1DJLA 4D5GA 4A0FA 4UAUA 5KQRA 1RWMA 5B1YA 3ZJTA 2YVKA 1Q14A 1JIXA 2AJBA 3PQ3A 1ZMBA 1C41A 3ER9A 1U0LA 4WCDA 3ICPA 3MINB 4DMUB 2R1ZA 3L8MA 1TW2A 2WVGA 1JDBC 2DT5A 3L0SA 3ZGOA 1LXCA 5M7EA 2H1IA 3SZOA 5A5FA 2NPIA 4V3BA 3RF7A 2FSIA 5KVAA 2B2XA 3HJNA 2RAVA 4QNRA 3WIOA 1TNDA 3H05A 4CQLB 2R9VA 4M88A 1AIPA 3ME5A 3SFZA 5DTJA 1QBGA 2EZ8A 1GZ6A 1Q5PA 4JUIA 2X76A 3EEFA 4K9PA 1XNQB 5A4MS 3GZ4A 1YVRA 2P1ZA 2R7AA 2ACVA 2RBKA 1C8BA 2VDOB 3KYDA 3BJEA 2IZ6A 4OUDA 5EIOA 3H5VA 2CFCA 2OZVA 4UTRA 4OMUA 3GAFA 3QEKA 4LCJA 2FF7A 2XADA 1JIJA 2F1HA 2ZS7A 3VKFA 1XZPA 2HA5A 1XLTA 4G4JA 3G17A 2JZOA 2PUFA 1P62B 4LOLA 1DUVG 4LF5B 1GV1A 2H4FA 3VZPA 1JB9A 5LP6B 1G8JA 3NDJA 2JH8A 1SQ6A 4LE2A 5IK2A 2AEJA 3KLOA 4QYWA 4H0NA 3H11B 3A2NA 2H5JA 4GI5A 3K9QO 2C4TA 3JALB 2VHJA 4A8PA 1YUBA 4P4TA 1ZM7A 2FHPA 3MM4A 3Q72A 3IOYA 3TRJA 4HNUA 4WXPA 2WD7B 3FA2A 3PI7A 1XAJA 5AOVA 3ZE6A 4RXTA 4AJ9A 3NJRA 4YDSA 5AVZA 3YASA 2QN1A 3IBFA 2C3PA 4CWAA 1UK6A 4P5DA 1JG6A 1EQ2A 2IYXA 4MKGA 1QCZA 5LQKA 4KQIA 1Y80A 3MT0A 3O2NA 5MHTA 3WC4A 4BX2A 3MW8A 3PFNA 4JKYA 1QOPB 2BR3A 5C4MA 1LA2A 2NTVA 3OIWA 3TTUA 3QIVA 2O1EA 3T4XA 3WLRA 2CNDA 2P2ZA 4BOYA 3OZBA 3AI1A 3GDOA 2VSOA 4J2OA 4RD3A 3W2EA 3OWOA 1NI4A 1SCKA 3SX2A 3WLFA 2PQ6A 4OB7A 1WW8A 1V11A 4BNZA 1ZNWA 4GF5A 3IXLA 4IFBA 4IH1A 1MEEA 2OM6A 3V9AA 4DCCA 4CLDA 1AN0A 3H9BA 1U4SA 4GNRA 3U81A 4BJ1A 4EECA 1Q21A 1WQ1R 2X0RA 1JVSA 4XIIA 4A8JA 4FGLA 3KVVA 5CNKA 5JS7A 2ODBA 3I42A 3I5AA 4CV0A 2R00A 1A5BB 5FUYA 5CW1A 4DUGA 2XAUA 3H16A 2VA9A 4JLMA 3C74A 4MUIA 3WS7A 4IO0A 4MWOA 2IYAA 5IFLA 3UICA 3UFXB 1VG0B 2RGNA 4BO2A 1P29A 3AKCA 2HD4A 3F4LA 3L7YA 4MO9A 1OD6A 4CGYA 4YGXB 4G5RA 5JFGA 1DXQA 1UJ4A 4PXAA 5MN4A 5LNK6 4CTJA 1PNQA 3ZVLA 3PHBE 1P1HA 4UMDA 1TVCA 2A67A 2JAPA 3E8XA 3SG0A 2J0QA 1NFQA 2J67A 1XK6A 1IATA 1M6VA 4B0PA 4W9MC 2OCBA 4OHOA 3G6KA 1RYEA 1Q16A 1E6CA 1K6IA 2P68A 2WKQA 3H1AA 3T7DA 5LU9A 4DYHA 1SC6A 4WCFB 2QNBA 3ADPA 5CB4A 3QKWA 3P26A 4BMXA 2QIPA 1E2HA 4B80A 5EQTA 1NJ6A 3RKRA 1U04A 3W7BA 5CA1B 4HLUA 3FTPA 3Q98A 2OCKA 1I6LA 2IWRA 4F5DA 6YASA 4P7GA 3ZVKA 1NI4B 4W99A 1SHLA 2PUDA 4NBSA 1RM5A 2FPRA 4MW6A 4IXTA 1EE9A 4XFDA 3GY0A 2XB9A 3DH0A 4MV0A 4HRYA 4MVXA 5HHTA 1J97A 2AFVA 2AJTA 1HX7A 4M1KA 2LWIA 2QPLA 2FW8A 3FKSD 4XVQA 4WZ6A 4IMPA 3H8JA 2XMSA 3OETA 4OLFA 2V6FA 1QVZA 4OJTA 5EP2A 3CVVA 1UPAA 4K87A 4N0EA 3AHEA 1OB5A 4NLLA 2JAXA 1GCAA 1A88A 1N0VC 1FRNA 4U9UA 4DDHA 1XU7A 1Y82A 5K0LA 1EIZA 2YV3A 1LW6E 1DL5A 1U6JA 2BGTA 2OZPA 3CXRA 4N3BA 1O4WA 4WFQA 4X3OA 1SZDA 3L1UA 4NH4A 4F2WA 1G5FA 3CV3A 1NE2A 3NG1A 1LTHR 4HDKB 1Z8FA 3BREA 2C2ZA 3D8UA 1CUIA 1POXA 3R09A 1EWKA 1ZGBA 2JFHA 2G8LA 2GBPA 2W2VA 3KLMX 4AG6A 2QRUA 4GVXA 4KFSA 3TW8A 2FSHA 3FCAA 1JWLA 3ABSB 2EEZA 1JV2B 1S9DA 3WYDA 1SUBA 4D3DA 3CZCA 3ETCA 3QFHA 4D8WA 3I2JA 2DUWA 2OK7A 4K9KA 4CN8A 1PZHA 3ETNA 3LP8A 2ACEA 2Q7XA 5FV4A 4JOCA 2KE5A 4AY3A 1I0ZA 2CDNA 5F5LA 1G60A 1T1JA 1A1VA 1PUIA 1CKEA 2DY1A 4YMVA 3BHIA 4ALIA 3VHXB 3OKPA 2CGEA 4BKMA 4EJMA 4R0MA 4KE8A 2O8BB 2WAXA 4LTMA 1OMOA 1B2RA 5FH9A 1X0XA 3L7MA 5TX7A 4TRNA 3FUUA 1TUGA 1KI1A 2JD0A 2XHZA 4MQ6A 3P52A 1PJ8A 3GOQA 2X4IA 2FRXA 3FPAA 2O54A 3TKYA 4Q3OA 2NXJA 3ADOA 2Y1WA 4UOQA 3IO5A 2RI1A 3WL5A 2PV7A 5IHXA 3KQNA 3DV2A 4WPGA 2A4KA 4Y0AA 4WV3A 2XB4A 3D6AA 3TLYA 2FQWA 1HI9A 2ZK7A 3B3GA 3P27A 3PXBA 2I3GA 1QF9A 2K2QB 1ARZA 3GAAA 3MSCA 4MPTA 4PPGA 4RU1A 5KYTA 2NZ2A 3GCZA 3L7KA 4EW1A 4EY3A 3GLFB 3KQPA 1PJLA 1PU2A 2QLNA 1OIVA 1YVDA 3LC0A 1VDMA 2JHGA 3G1UA 2CFRA 1MD9A 1JIVA 2FPGB 2HM7A 3KZ1E 5BUCA 3TZ6A 3PP8A 1H2BA 3EVGA 3LKBA 4KRYA 4Y2XA 4C7BA 5A3JA 2OQ2A 4PZLA