2XOXA

Crystal structure of pteridine reductase (ptr1) from leishmania donovani
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
276
structure length
216
Chain Sequence
TVPVALVTGAAKRLGSGIAEGLHAEGYAVCLHYHRSAAEANTLAATLNARRPNSAIPVQADLSNVAPVTLFKRCADLVAACYTHWGRCDVLVNNASREAMEAAAADLFGSNAMAPYFLIKAFAHRVADTPAEQRGTNYSIVNMVDAMTSQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLAEVSDVVIFLCSSKAKYVTGTCVKVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE
publication title Structure of Recombinant Leishmania Donovani Pteridine Reductase Reveals a Disordered Active Site.
pubmed doi rcsb
source organism Leishmania donovani
molecule tags Oxidoreductase
total genus 78
structure length 216
sequence length 276
chains with identical sequence B
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2010-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2xoxA00
4CM5A 3GNQA 1Y5RA 1WMBA 1PL7A 5CDGA 2JFHA 1PGPA 3PVZA 2IDZA 3KUXA 4BO9A 1PTJA 2X6TA 2X8LA 1IOLA 3DMYA 5ILOA 1DLJA 3GAFA 2CZCA 3PZRA 2AE1A 4WLVA 4YVFA 1LDNA 1R66A 4N5NA 1EVZA 2DTEA 4MP8A 2C07A 1T1SA 2Q4EA 3DZFA 1QXSA 3NTQA 5T6BA 4BMSA 4BNWA 1CEQA 4LN1A 1Z74A 4J2HA 4XGNA 4J7CA 3VZSA 1JKJA 4Q39A 4U7WA 3BTUA 2VZ9A 2CDBA 3ZCXA 3ZWNA 1ZW1A 2I3GA 4MP3A 5MGBA 4BUCA 4DUPA 5L95A 5IZCA 2J8ZA 5BSHA 3JQ9A 3U09A 3I9LA 5BNFA 4NJOA 4KUHA 4CMKA 4B4WA 4CMEC 2X9NA 3G0OA 1D8AA 5L7WA 1E6UA 4IZHA 3GHHA 4WLUA 1SOWA 1KEPA 3JQ7A 3JYOA 1Q2XA 2Y1GA 3WDSA 3E18A 5FYDA 3EZYA 3GVCA 3C7CB 3SJ7A 3C7DB 1CF2O 1VJ0A 2ZATA 3W4JA 5JO0A 1I3LA 3DONA 5DF1A 3OA0A 4CPDA 5EMHA 3W8FA 3A06A 3GHYA 3KSZO 2AW5A 4CMCA 5HS6A 3SC6A 3JD1A 4ZN6A 4D46A 4PG5A 2CDAA 2YYYA 3AY7A 2AE2A 4AG3A 5A02A 3DZIA 3L77A 5JDCA 1UP6A 4B7CA 4OSOA 2O7SA 1QYDA 3FRJA 3LLSA 4CMIB 1M2WA 4EW6A 4DMMA 4AJ2A 4N5MA 3ZW8A 2XF8A 2P9CA 4QO8A 1JDJA 4R4JA 1QV7A 3JQ8B 2OO5A 2O48X 4GKBA 4XYMA 1OC4A 1SMKA 3FPLA 4CM9A 2B0JA 2CD9A 1YOVB 3E5RA 3KEOA 1M6WA 3TDKA 1DRUA 1P1HA 1NQOA 1RM0A 2GGSA 3VH4A 5JFOA 1OZAA 3FNGA 4PRLA 4D3SA 3JQCA 4FOOA 2PD4A 4KUGA 2DLDA 1GZ3A 1SO8A 3TF5A 2PY6A 3ZI0A 1EFLA 1Y6JA 3SX2A 1ZIDA 4JGBA 2NSDA 3HHPA 3CXRA 4Q3CA 4IXTA 5JYDA 1P1RA 1XG5A 4XYBA 2DTXA 4LISA 4BMVA 3TOZA 1VLLA 1R6DA 4UUOA 4Y98A 4BQPA 3DO5A 2I6TA 3ZWXA 3BMNB 4EBFA 1MC4A 2PGJA 4NBRA 2YHIA 4IZIA 4ALLA 5AOVA 1PL8A 3U49A 3GA0A 3IJRA 3I6QA 1BWSA 2RCYA 3BHJA 4J6FA 5TT1A 2VCYA 1Y9AA 2HJRA 4ZA2A 4IDGA 1BXGA 3U9LA 2RHCA 2HMUA 3HN7A 4RF2A 6ADHA 1UZMA 3PFFA 1UP7A 4OM8A 4RL6A 3OSUA 4O63O 3RSHA 2DAPA 4DBZA 2PA3A 1PGNA 3F9IA 4WCFA 5EINA 1CETA 3DWFA 2YUTA 2GUGA 1ZVMA 1C1DB 5F21A 3VTFA 2BF7A 3OF2A 4UUMA 3CUKA 2VWPA 2GNAA 2CF5A 1L1FA 1E1LA 4MP6A 5KJEA 3KTDA 2C54A 4MKZA 3EK2A 3KVOA 3WG9A 2ZB7A 3E9NA 5H81A 4AVYA 2VT2A 3I5MA 2GN6A 3UAGA 1ZXLA 2X9GA 4PVCA 4DRYA 4J49A 2FZEA 1Q7CA 5I8ZA 5DCYA 4CJXA 1XELA 2NV6A 1YB5A 4ND3A 4HNHA 1RPNA 2C5AA 4KWHA 3VTZA 2F1KA 4U5QA 1D3AA 1M76A 4JBHA 2JCYA 1ORRA 3HN2A 4WECA 3WYCA 5JAMA 4L4RA 2BFPA 1E1NA 3E6AA 4G5HA 1I0ZA 3VDQA 4B79A 4CV1A 4PGFA 3E9QA 3VPHA 3HDJA 4P22A 3W6ZA 4K28A 1XIVA 4UVIA 4WOJA 4CR6A 4MVJM 5KVSA 5ENVA 1PJTA 2ZB4A 3R1IA 4LSMA 1Z7BA 4FSHA 1MV8A 3VHRA 3F1LA 1JQBA 5KWEA 1YWGO 1DHRA 3H9JA 4FW8A 5JDIC 2X86A 1DDOA 4OMUA 5DP2A 4NR0A 2IZZA 1F17A 1PJSA 2Q2VA 3WGOA 4WUVA 4WE3A 3ONFA 4A73A 4J0EA 1PJQA 3Q2KA 4YJGA 1W0CA 4XB2A 3DBHA 3PYXA 3W6UA 1XLTA 3DEYX 4BNIA 4NQZA 1F14A 1PR9A 1HDCA 4I5FA 1VL6A 3HB4X 1DIGA 1BDMA 2BFAA 2HUNA 1B2LA 2X0RA 5G0VA 5ILGA 3QY9A 2PGDA 1JLLA 3OJOA 3SEFA 1M67A 3PJDA 4O6VA 2OFPA 2FOIA 2P5UA 3ZZNA 2WD8A 5KJ1A 1EZ4A 4R41A 4YEDA 5B37A 3TWOA 2JD1A 3JQ7B 3X2FA 2ZB3A 3Q6IA 1C0IA 3WGTA 2B5WA 4E5NA 1KVSA 2PZMA 3WICA 3WQRA 3PGJA 1R0SA 4CMGA 2RAFA 3MJTA 4E2XA 4HX5A 3FNEA 1EDOA 2NQ8A 1V3VA 3WWYA 3GN1A 4WLOA 2Y0DA 3K96A 3ZV4A 1DRWA 3U4DA 3JSAA 4YACA 2Q49A 5CPBA 3INGA 4RPKA 2R6JA 1N9GA 5L4NA 2WE8A 1Y81A 5B1YA 2Q99A 1HXHA 2VNAA 4JJFA 4HV4A 4FFLA 3M2TA 5L9AA 1I01A 4TMFA 5H83A 1QR6A 2HMSA 4HKTA 4UUNA 3AI3A 3UKOA 4IMPA 4PLWA 1E3WB 5A06A 3QA9A 1RM4A 2DC1A 4NH4A 2VHWA 4W99A 3GPDG 3L6DA 1P45A 1K6XA 3E82A 1PWZA 1PS0A 2ZB8A 3UN1A 2P68A 1K89A 1LRLA 2G0TA 4LW8A 1GEEA 3DOCA 1SZJG 1V9LA 1EE9A 1VI2A 2BGMA 3QLJA 4I9UA 3IS3A 3WGHA 1PJLA 1M66A 4DQUA 1E5LA 3BMCA 4FFRA 3GEMA 1JU9A 2P4QA 4CQMD 4DQXA 5CEFA 3WNQA 2WDZA 3RKRA 4Q3DA 1U3TA 4II3A 2C82A 1F12A 1U5AA 3W4KA 1DIRA 3WMWA 1I3NA 4PVDA 3WTBA 4CLOA 1H6DA 2JAHA 3RBVA 3C1OA 4RORA 3TZHA 3ZWWA 6LDHA 3BA1A 3RJ5A 3GZ4A 1BXGB 4HFRA 5JCJD 2D5AA 5JAZA 1U3UA 3NTRA 4K6FA 2IZ0A 4DC0A 2D1YA 4D3DA 5AXAA 3OBBA 4WCFB 1A7KA 4BGEA 3GVHA 1ZK4A 4RPLA 4B7XA 4FN4A 2FR8A 2Y99A 5A04A 1I10A 2HKIA 4YAIA 1BW9A 1XR3A 1Y9EA 3JCZA 1VKNA 4EITA 3FNFA 1YBMA 1P1FA 2G82A 3EUWA 3NYWA 4TRRA 3PIIA 1XQ6A 3D5TA 3L4SO 4RVHA 1SNYA 1K2WA 2WE7A 4EDFA 3MWDB 1AHHA 2PKQP 2B4QA 4XYEA 3H5NA 1GDHA 3GLQA 3VPXA 4YAJA 3WB9A 3F6YA 5HBRA 4BB5A 4CMAA 4R5MA 1JWBB 2ZYDA 2XXJA 2VUUA 3IIEA 4BO2A 2HMTA 1UZNA 1Q0LA 2XAAA 3SBOA 1C0KA 1PU2A 4XB1A 5L7YA 4B8WA 2PD6A 1HRDA 5ITWA 5JCJA 2B37A 2VYND 3EHEA 4B8ZA 2W98A 4F46A 3L9WA 2JHGA 3R3JA 4HWKA 4Y8VA 4A0SA 2C20A 5IN4A 3IL2A 3AU9A 4J91A 1CYDA 1ZFNA 4RVGA 1LBEA 4Z0PA 2VWGA 5C7OO 3GRPA 3WJ7A 1N7GA 4W9NA 4LMRA 1Y5MA 2X9VA 2HMWA 3PLNA 5IN5A 1A72A 5BR7A 3KYCA 3RUAA 3IAHA 2VHVA 3IOYA 4I08A 4HP8A 1ZO8A 2H5LA 1EVJA 5BT9A 4YJGB 3NEPX 2YV1A 4OQZA 5TT0A 1XYGA 3QJ5A 3S2FA 1GTMA 2PLAA 4FFPA 4YRAA 3JQ6A 3KYDA 5CDUA 1ZEJA 1DFHA 4RPHA 1A4IA 4D0RA 3JQFC 1C3VA 4NBWA 4B3JA 3AY6A 1NPTO 1ZK2A 1KERA 2PZJA 4N7RA 2X5OA 3DTYA 4BL5A 1V3UA 3L6OO 3Q9NA 1GQ2A 3HDHA 3ZWPA 4GKVA 1CQJA 4G65A 4XCVA 1GUYA 2DKNA 2CVZA 4YJHB 3RKUA 1E7MA 1U3VA 3FNHA 4J2OA 2PK3A 4CV2A 2ZCUA 2DU8A 3TFQA 3H8VA 4TSKA 4URFA 1U2GA 3UXYA 1OAAA 4Y67A 2QRKA 3DBLB 4NU5A 4XRRA 3G1TA 1WXDA 1WDKA 4PG6A 1O5IA 3D4NA 1BDBA 3OQ1A 1SBYA 3TZ6A 3JYQA 5CEEA 4CLHA 4EUHA 3EVTA 4ILKA 1N9GB 1PEDA 2FMUA 3G1UA 1ID1A 1BVRA 2HU2A 3IP1A 5BSEA 4KQXA 5CDTA 3M1AA 4XQ9A 4GVXA 3H4VA 1T2AA 5DN9A 1ISGA 2EG9A 4CUZA 4DYDA 3DL2A 3PWKA 4IJKA 5FF9A 2HQ1A 1OBFO 2GZ3A 3FBTA 3M1LA 1I2BA 3IKVA 3PYMA 4GMFA 4EI2A 5A9SA 2HK8A 4UVEA 5DBIA 2EP5A 3QWAA 5TIIA 1L7DA 3BTOA 3BMCB 3ITDA 4ITUA 4R3WA 3PGXA 1R15A 1VKOA 1KEWA 8ADHA 2AA3A 3G79A 1DPGA 3LQFA 1QYXA 3ZDFA 4IBOA 4P8RA 4ZQGA 1H93A 4FJ2A 1QP8A 1H94A 2WSBA 2B4TO 3IP3A 2POQX 3G17A 4CLOB 3P5SA 2DT5A 3HUDA 1WZIA 1X13A 5A03A 4J90A 1T2EA 3OQBA 1MX3A 4RPGA 3F5SA 4FJ1A 3PJFA 4J4TA 4KDFA 4MVJE 1GPDG 1ULSA 4N54A 4XEHA 1DC6A 4XIYA 3U4HA 3RFXA 4AJEA 4BNMA 2EKPA 3W1VA 3ADPA 3PWSA 2BH9A 1YB4A 5IDWA 2Q2WA 1D4FA 3FR7A 3JQ8A 2VZ8A 5IG2A 3DZKA 3M2PA 1YOVA 2Y0EA 2YV2A 1Y7TA 3D4PA 4PZEA 4ONEA 4CUJA 4OYRA 1UZLA 3ZGYA 4BO6A 2J5KA 1MP0A 1L7EA 3ICPA 2FP4A 3WTCA 5AYVA 5COAA 4YRDA 3EC7A 5A4DA 5LC1A 4OJNA 1JTVA 1T1RA 2EEZA 5T8KC 2GD1O 3MEQA 3ROQA 2F00A 7MDHA 1HSOA 3VH1A 1FK8A 2Y1OA 3RBZA 4DC1A 3EZLA 3LT1A 2VOEA 4Z6KA 3AI2A 5JMWA 1IL0A 4QFCA 3NX4A 4Z9YA 3LT4A 4TROA 3SVTA 1PSDA 1CIVA 1PQWA 2RIRA 2X4GA 2YY7A 4PG4A 1IZ0A 4PLYA 2OP1A 2IEDA 4WPGA 3TRIA 4BIIA 2WYWA 4R5HA 2QW8A 4DWVA 1OFGA 2J6IA 1R4MA 3L4BA 4QQRA 3HADA 3JD4A 4PIVA 3MTJA 3LVFO 3PEFA 3R6DA 2WD7A 5A5EA 2NU9A 5I8WA 1EVIA 1WZEA 1B3RA 2BLLA 5IF3A 1BHSA 4FFOA 1PJ2A 4MVJI 1WVGA 4J1SA 3VKVA 5ER6A 1XWFA 4OOEA 2ZYGA 5JE8A 4LVCA 1VJ1A 2BGLA 3OICA 4L75A 4OSPA 1IULA 5CDSA 3Q9UA 1ZK1A 2PD3A 1MXFA 3RUFA 3UW3A 1G1AA 1C1DA 4TWRA 2AQIA 1KC3A 3S2GA 3GG9A 3KYCB 3WFJA 5G4LA 3L9XA 1NQTA 2ZKLA 4NPCA 1HWYA 1E1KA 4EJ0A 1P44A 1PZEA 3CE6A 5JBIA 1EE2A 2ET6A 1UDBA 3F46A 3ETDA 2QYTA 3GNSA 3D4OA 2RH8A 2VN8A 4AJ4A 3KYDB 2WYUA 2EHDA 4AJLA 5AVOA 3UOGA 3CSDA 3I83A 1F8GA 5IAAA 2OP0A 3QRWA 2RH4A 4NIMA 3H65A 3GUCA 4PZCA 1RWBA 1DJNA 1W4ZA 3QVXA 2ZTLA 3LSYA 5L7TA 5IFLA 1IPFA 1U4SA 4QEDA 5GZ3A 1T26A 1U7HA 5F5LA 3ORFA 3DOOA 2GCGA 2PGLA 3DMTC 2IEBA 3RU7A 1MFPA 1NFQA 4U6SA 4GX2A 5EESA 3AM5A 3PTZA 2JD2A 5L40A 3RUEA 1D1TA 2DM6A 3MTGA 1A9YA 3AM4A 4OKIA 3AM3A 2FSVA 3EW7A 1LRKA 1AXEA 4P4GA 1IY8A 4E2YA 1U1IA 4L76A 2PKQO 2UDPA 3ZU4A 1JW9B 3R0IA 4BO7A 4MDHA 3FTPA 3KETA 1ZH8A 3F4LA 3IMFA 1DBVO 3DZJA 4BNJA 4FGWA 1N2SA 3UCEA 4BOYA 3HFSA 3V1TC 1NAHA 4J9VA 4MVJD 2OBYA 4CQLA 3KLMX 3BHMA 2Q46A 3JQDA 4R54A 4UVHA 3ADOA 3PK0A 4CV3A 1HKUA 1VE9A 4OKNA 1PJBA 3VPSA 3RC7A 1TA4A 4IDCA 1XU7A 3WIDA 3JD3A 2IYOA 4NBTA 3ZWMA 4M86A 2Q1SA 3NRCA 4QTZA 4RVFA 5KTKA 5A9SB 4GBJA 5JLAA 1PJ3A 1ONPA 1LLCA 1DIHA 4J4BA 2Z1MA 1LSJA 3U3XA 4W7IA 2JL1A 4CMEA 1NYTA 3FWNA 3GK3A 1N5DA 4LMPA 2NADA 1HE5A 4IDAA 3P2OA 3UGKA 4YCAA 4A26A 2UVDA 4IJVA 4CL8A 4CMBA 4CM8A 4RF3A 2BI7A 1FMCA 3ZN2A 1X7HA 2IE0A 3E9MA 1NVMB 3AW9A 3DHYA 4R9SA 5A1TA 3ON5A 4R51A 1SC6A 3WYEA 4IUYA 2VUTA 1FDTA 4EEXA 1MG5A 4A7PA 1KYQA 3RIHA 2C0CA 4I1IA 1H6AA 2BI8A 1X7DA 5BQFA 1X7GA 4HY3A 3H9GA 4B3HA 1EFKA 2Q3EA 4A27A 1YE3A 3KOUA 4FQ8A 5ICSA 1W8DA 4W4TA 3CZRA 1NHWA 4A5OA 5ENDA 4BGVA 2YHUA 2ILTA 4IQ0A 2HK7A 3H2ZA 4MVJA 3C1TA 5JXWA 3AUAA 4DPMA 1E3WA 2Y1DA 2X22A 2FRDA 3A4VA 3A9WA 4KUEA 2GR9A 1TEHA 2IYPA 3GEDA 2VQ3A 3AUUA 5A3VA 2I65A 1I30A 3FR8A 3JD0A 3BMOA 1VRWA 1DLIA 2CDCA 1K6JA 4JN6B 1C0PA 1DHTA 4CR8A 1FDUA 2HO5A 4Q3EA 4L9RA 5KKAA 3KEQA 1C0LA 3NDRA 1Z6ZA 3WLFA 4DPKA 1HZJA 4GQAA 3ZU2A 1UXJA 1NX6A 2W2LD 3ETEA 3KBOA 4MPDA 5LCXA 3H7AA 4XA8A 5COBA 4UREA 3QSGA 4PCVA 5IXSA 1R4MB 1I8TA 3C85A 5GMOA 4MKRA 4CMJA 2JHFA 3GN2A 3TZQA 3L6EA 2E82A 2BELA 3L07A 4RCVA 2WD7B 3P19A 4RGBA 3TL3A 1GY8A 5BSFA 5B4UA 1I24A 4YA6A 2QRJA 1JKFA 2BD0A 5DCWA 1KS9A 3C3XA 3NKLA 4M87A 2GYYA 4BKQA 1BXZA 5FWNA 1E7WA 2Y1CA 5DBFA 5JW6A 2FHSA 2CMDA 1P1KA 2B35A 4ALIA 2NVBA 5FEUA 2AQHA 4M8SA 2UUOA 4BO0A 4RV9A 1ONOA 2EWMA 1BMDA 3H5RA 4DVJA 3BIOA 3GC6A 1GYRA 1JWAB 2VHXA 4BKRA 4WCDA 3OFSA 4CM7A 4NBVA 3OIGA 1GL3A 4GGOA 2Q1WA 1OMOA 2QQ5A 1T25A 1YKFA 3PXXA 1OI7A 1YH3A 3RVDA 2D0IA 5ER9A 2W2LA 2ZQYA 5MDHA 3W8DA 4UAGA 3DB2A 4XQEA 3E1KA 3MOGA 4J9UE 5U4QA 2C2XA 2G1UA 3DQPA 4IDDA 3CTMA 4RPJA 2BHLA 3VAZA 3EAGA 2YFQA 3LF1A 4XZ3A 1I33A 4H15A 2OZPA 3IQDB 3O03A 4NU6A 4RQUA 2DQ4A 2EKLA 3WGGA 1KVRA 2EIHA 2E4AA 2W90A 4XIJA 5EJ2A 3WXBA 5K0ZA 3NGXA 1B7GO 1TVEA 4LCEA 4AJ1A 1AXGA 4Y9DA 3KO8A 2NLOA 3HB5X 3FWZA 2R00C 5ICMA 1DIBA 5G0WA 4CLDA 5C5IA 3WMXA 2I66A 2O3RA 1GZ4A 4PN3A 2E6UX 1MFZA 5JDIA 1QLJA 2Q1TA 1EVYA 1KVQA 4R68A 3V2GA 2OBNA 2PTGA 5JS6A 1FJHA 1V6AA 1ADBA 1R12A 4MIEA 5EQFA 4BMNA 4BS9A 5A05A 4IS3A 5G2OA 4CQLB 3JQBC 5CG2A 4TRNA 3GMDA 5KJFA 3S2EA 3OQ6A 2H1SA 3WNVA 4QX6A 2CY0A 1E7RA 4ZQFA 2FPIA 4I9HA 1ISIA 4A10A 1HZZA 1NNUA 1Q7GA 4RVUA 4R1TA 1E3LA 2C59A 5AXBA 1CRWG 1J0XO 3KB6A 5I9LA 1W73A 5I7VA 1E3IA 2DTDA 1SB8A 4LVUA 3KHUA 4OHUA 3JYPA 3UVEA 1EEHA 4CM8B 3EY4A 4YJHA 4XYGA 1E7QA 1ZXBA 5A3JA 1PWXA 5TGDA 4PLVA 3FN4A 4L74A 2W8ZA 1T2DA 2VTEA 3STHA 4KZPA 1U7TA 4R1UA 2GN8A 4CM4A 3K5PA 2V6MA 3DBLA 2DBRA 4NFYA 1PJ4A 1N92A 2OGUA 4DLBA 5KVQA 1YBVA 4NK4A 1X0VA 3IUPA 5HA5A 4FJ0A 4NFSA 3AI1A 1LSOA 1EDZA 4Z3KA 4UEKA 4MIYA 5LDHA 1JVBA 4UEOA 4GLLA 4AICA 1AN9A 3ZU5A 3MJSA 2NUAA 1N1GA 1ZMTA 3AWDA 3E8XA 4MOWA 3UF0A 1VC2A 2D2IA 1O94A 4YRBA 3MZ0A 4E32A 1GYQA 4Z0HO 3BMOB 1MUUA 3RC1A 4FB5A 5G4KA 4L0QA 3ZWCA 3T7CA 2GDZA 4Z9XA 4Z3DA 3LT0A 2YFHA 2GZ1A 1JN0A 1VSUA 2NNLD 1LEHA 2UAGA 4Q9NA 1DEHA 4WEQA 3ENNA 3PQDA 1KETA 2VWQA 5K6AC 1PGQA 5L3ZA 1U4OA 3JQEA 4E3ZA 1BG6A 2OMEA 2CVOA 1RYEA 5I7FA 3SLKA 1ZSVA 2W4QA 1NFRA 3DFZA 4R69A 4BNKA 2CFCA 1I32A 1F06A 4H16A 3JQAD 4DTIA 4U0KA 1YQXA 4Q3AA 1LLQA 4EUEA 1DO8A 2CUKA 3PWZA 2JFFA 4KWIA 3D0OA 4XJTA 1LA2A 1ZJZA 2A35A 1B3BA 3OM9A 2UUPA 3AOEC 3GY0A 4M54A 3GNTA 1ADGA 2X0NA 4XR4A 4I5EA 1DC4A 4HFMA 1ZK3A 1YQGA 2VRCD 1V3TA 1U2DA 2P4HX 3HWRA 3DDNA 2EV9A 4O1MA 4IPTA 4EYEA 4NHEA 4WNIA 4ALKA 2V7PA 1HDYA 3TZKA 2DUWA 4D3FA 1O89A 2EW8A 5KVVA 3K30A 1MC5A 4NK5A 4ALNA 4EGFA 4CQMA 2BFMA 2Y68A 5I9MA 1A71A 1S6YA 3A1NA 3I9OA 1LI4A 2A9FA 4JBIA 1VPDA 1PS9A 1GUZA 4CM6A 4KOAA 4GLOA 3RQSA 1ENOA 2X5JO 1ZKMA 3O9ZA 4ZD6A 3ZNOA 2JFGA 3C8MA 1LC0A 1YGYA 1K3TA 1LU9A 4J0FA 4MINA 1XSEA 2YQ5A 3TSCA 4LK3A 4B4UA 4YAEA 3OEWA 1ZUD1 5TRTA 3ZWBA 4FCCA 4QECA 4LRSB 1IHYA 1O6ZA 4IM7A 3LDHA 2G76A 3DAGA 4YT8A 5A9TA 2VNSA 4MIOA 1UH5A 2IXAA 2VOJA 1LNQA 3GGGA 3ZV5A 3WYBA 4E5PA 1EQ2A 1HL3A 1R37A 2AG5A 4CUKA 3JYLA 4XR9A 4PFJA 1EK6A 2E48A 4UVDA 3O26A 4OO3A 4DYVA 3K8ZA 3W8EA 2VRCA 3MJCA 1T4DA 1BTOA 2GN9A 1LJ8A 3D1LA 3LLVA 3S2IA 1DFIA 1HYHA 3KYBA 4BHTA 1KVTA 3AUSA 3DFUA 4YYZA 1ZSYA 1OOEA 2HCTA 3M6IA 4BV9A 5L53A 3UFXA 2QZZA 2OHXA 4YJDA 3H9UA 2YV3A 3SC4A 3N7UA 4Q3BA 1ZBQA 1XKQA 3WGIA 1DC5A 3JQFA 4Y6SA 4KTTE 4YXFA 1VL0A 5DDIP 1DB3A 2IRWA 1DAPA 3ZWVA 2P91A 4RO0A 1TT7A 3MJEA 4YDRA 2PNFA 2JAPA 2VT3A 5F1OA 1PIWA 1EBFA 1V35A 1ZK0A 2UYYA 2VYNA 2GF2A 3PHIA 1ZSNA 3LC2O 4NJMA 3VH3A 5ADHA 4BQRA 4BB6A 4OQYA 3WGYA 1E3JA 3ZW9A 3GVIA 5IJZA 3VDRA 4J16A 5DOVA 4XX0A 4CM4B 3ONDA 5AXCA 3WFIA 4O0LA 1PX0A 4TZKA 1WLYA 4M89A 2BRUA 2O3UA 3EMKA 5JSFA 4IINA 3ZWOA 1T24A 5KKCA 5B4VA 4HXYA 4RQTA 1WAMA 3H2SA 4BO4A 3IKTA 1ZJYA 2VWHA 2JKVA 3Q3CA 1MG0A 1Z82A 2Y1EA 1B15A 4ZQHA 5C7IO 2YQ4A 4OXKA 4DMLA 1UR5A 1ADFA 5C3MA 5CEJA 4PLPA 2HAEA 4D0SA 1LDEA 4TQGA 1PJCA 3B70A 1CERA 1XQ1A 1GV0A 5F5NA 3KSUA 2WM3A 4CMHA 3NDJA 1Q0HA 2YDYA 5DNAA 4JJGA 1ZZEA 5G4KB 2Z1NA 2X7HA 5CPFA 3HSKA 4U0JA 4MJLA 1XGKA 3QE3A 2WMDA 2I67A 3H9QA 5AQ1A 5IDXA 1DAOA 1HE3A 3U5TA 4XJSA 4YBZA 1A27A 1F8FA 1YQDA 1IB6A 3I3OA 3COSA 4J1TA 3PQEA 3KLPX 2DFDA 1EUCA 3HNPA 2BKAA 1NVGA 2EJWA 4I5DA 1Y8QA 2GSDA 2V65A 4PG8A 3AOGA 2C2YA 4DIOA 1MXHA 2WTBA 1GCOA 4QSMA 1G6KA 2RHRA 2E37A 3QP9A 3EVNA 3DHNA 1U28A 1HTBA 1LDBA 1TT5A 2ZJ0A 1AUPA 2Q1UA 3RFTA 3GDFA 3NJ4A 1I36A 3KRTA 3GOHA 1LSSA 5U1PA 3IC5A 2Q4BA 4DLAA 2HRBA 4OXYA 4OXNA 2PH3A 1MA0A 3SLGA 5G0SA 4RLSA 1UP4A 1GFSA 1PQPA 1QSGA 3NDIA 3H3FA 3CINA 1B0AA 3FSRA 2PZKA 3O8QA 1DOHA 4WK6A 4FIZA 1FDWA 1NP3A 1GV1A 1SB9A 4PG7A 3RROA 5T8KA 3D7LA 3CPSA 1HYEA 3ZV6A 1ISJA 4CL3A 4CQMB 1OC2A 2EF1A 3NTOA 3ST7A 4WLNA 3GFGA 3DZGA 5GZ1A 2BMAA 4M1QA 3H9EO 3HDQA 1YRLA 3I23A 2X1HA 5EERA 3KXDA 3WIEA 1ISHA 1A5ZA 3ZHYA 4KP7A 4LSWA 4U6QA 5EIOA 1YJQA 2WEKA 3RC2A 1HDOA 3GAZA 4EZBA 2OUIA 1B26A 1NTOA 3BZUA 1MGOA 1P0CA 1P33A 1Z75A 3JQAB 4AJOA 1NR7A 4NI5A 1ENPA 4YPOA 1QG6A 3CIFA 3LT2A 2DVMA 4UVGA 1PQUA 4ND1A 1A7AA 1BGVA 3GPIA 3LZ6A 3SXPA 4JNKA 1V8BA 4XQGA 1SEVA 4MVJF 4RDIA 3LU1A 4JIGA 3JD2A 3PJEA 2A94A 1NPYA 3UCXA 1P0FA 1U8FO 4JBGA 4D42A 3PHHA 2DBQA 3PHJA 3W4IA 2ZYAA 4OGWA 3RFVA 4MVJP 2J3IA 1NAIA 3V2HA 1LLDA 1N1EA 1UDAA 4JJIA 3GUYA 4Y6RA 3ZV3A 2R2GA 3H3JA 3DBRA 3TOXA 1JAXA 1NFFA 3ENKA 4D79A 1VSVA 1XEAA 3QWFA 3CKYA 5GZ6A 1R4NA 2X0JA 2CF6A 4OAQA 3I4CA 3PLRA 2HJSA 3BYZA 4RZIA 3ANMA 5EQDA 1NPDA 4FOSA 4BNHA 5THQA 2E49A 4AFNA 5A5FA 3QIVA 1J49A 4PLTA 3HDYA 3GZNA 5HTOA 3PI7A 4BNTA 3GQVA 4DA9A 2D59A 4RDHA 3DMTA 4XDZA 1R0LA 2I9PA 3NV9A 4NJMB 4HBGA 5COQA 4CODB 4R3NA 4QT0A 1T2CA 3FCOA 3MCVA 5DP1A 5HM8A 3JV7A 4QXMA 3RWBA 2EXXA 1B8VA 4I8XA 4XGIA 4BKUA 4RVDA 1ZMOA 2FR1A 4J3FA 1KC1A 1XHLA 4E5MA 1NQ5A 2AQ8A 3Q11A 3K9QO 1D7OA 4ZQBA 1O9BA 2TMGA 1U3WA 1W6UA 3KM0A 3PZBA 3VC7A 4J43A 3QWHA 4CR7A 4D41A 4Z0TA 3WJAA 4II2A 4JP2A 4NBUA 1BXKA 5IDQA 4FDAA 3PRJA 3VH2A 3DBVO 4E13A 3I9JA 4AJKA 4OL9A 3WGQA 3WR5A 4HUJA 3PPIA 5TS3A 3LYLA 2QHXA 2EGHA 3PDUA 1Q0QA 1K0UA 1GQQA 1DSSG 3INTA 3OMLA 3QQPA 5KCZA 1NHGA 4LGVA 2FY8A 3INRA 1H2HA 5IDYA 4BGIA 4BKOA 4CM9D 4K6CA 3HQ4O 2Y0CA 4BGUA 5KJCA 4OH1A 4IGFA 3WBFA 3QHAA 1HLDA 2X5KO 5KNLA 3GR6A 4BO3A 4BNXA 1U8XX 5IZCC 3GGPA 5DULA 5TJHA 2LDXA 5EPOA 1PGJA 4J7XA 3PJGA 3HG7A 1GR0A 1UAGA 3JQ9C 4G2NA 3ROMA 3R3SA 4YB8A 2PWZA 4AJNA 3TQHA 5B4TA 1Y8QB 2Z95A 1FF9A 3DZHA 3NGLA 2VUSA 2O3TA 3OECA 1GPJA 1UXGA 3V2UA 1DC3A 4W82A 1LDMA 1HLPA 1LQTA 1ISFA 4XKJA 4DQVA 4DXHA 4GPD1 4BKPA 1QRRA 3B1KA 4TZTA 4RZHA 1Y1PA 2NTJA 4BO1A 3MJVA 5IXYA 1TT5B 1E77A 1PGOA 4XGKA 3T4EA 2O3SA 1YO6A 3S1LA 1WDLA 2OORA 4M55A 1I2ZA 1JA9A 4TVOA 3GMSA 4PLFA 4IGEA 5JDCC 2O4UX 5I7SA 3VVCA 1O95A 4FD3A 4WKGA 2VYVD 2X58A 4K1LA 3O8QB 1IPEA 3B20A 1YONA 2A4KA 3ROPA 1KY4A 1E7YA 4E12A 1C1XB 2ZJ1A 3GRKA 3HJAA 4FS3A 4XQCA 1HF3A 4ND4A 4GX5A 4WASA 3TPCA 1E5QA 4BNGA 1G0NA 1YDWA 2WYVA 1EMDA 4OOFA 3ZU3A 4F6LA 1GAEO 4FPXA 4EUFA 1RKXA 2VZ0A 3B1JA 4P4LA 1IYZA 3C24A 4QFDA 3C1AA 2I3AA 3AUTA 3CEAA 2CNBA 3AY3A 4FC7A 3MWEB 1AHIA 3DZBA 1PR3A 3BHIA 2HK9A 3V8BA 3RASA 1ISMA 1I5RA 4QO7A 3I9KA 1P1JA 1ARZA 1ZNQO 4GMGA 1IUKA 7ADHA 1M75A 3DAPA 3RD5A 3ZWAA 2GLXA 4QUKA 5JC8A 1A9ZA 1KOLA 4S1VA 1B14A 1Q1NA 4GWGA 2Y1FA 4WOKA 3EYWA 4BNVA 2WJPA 5L4SA 4ZQEA 3G3EA 3ZNQA 4RLHA 2YDXA 3OJEA 4TVBA 2JD0A 2IODA 3KSDO 3NAQA 5CHEA 3VPGA 4CLRB 2VYVA 3RBXA 1MB4A 4WCFC 3ZHBA 1O0SA 2DUUA 5TLSA 1RM3A 1GZ6A 3DBRB 1WPQA 5JC1A 1LX6A 1X0XA 2X0IA 4YQZA 4C4OA 4CLEA 5CP8A 3U4CA 2QZ9A 2NU7A 1R4NB 1VJTA 4IXWA 1H2BA 1NBOA 1HE4A 1WNTA 1KEUA 4P4NA 3WWZA 1K6IA 3NT4A 3SJUA 2SCUA 3MOIA 3V1YA 1Z73A 2G17A 1XCBA 1Z7EA 4R9RA 1KEVA 3GZNB 4IS2A 2JJYA 2ZK7A 3ZWYA 1ONNA 5L4LA 4B4VA 3ANNA 3A28A 4YR9A 3GVPA 5G0UA 4ZVVA 2D3TA 3ABIA 3ITKA 1X15A 1P31A 4AJIA 1KIFA 4ID9A 1M6HA 3GVXA 3K92A 4DL9A 2PKRA 3TL2A 3U62A 5I7EA 1E6WA 1V0JA 1QORA 2H6EA 2R00A 5CFZA 2FPGA 5CG1A 3DOJA 4IDBA 1UDCA 1EK5A 3H5AA 5F1KA 2C7GA 2GZ2A 1S7CA 2AEFA 4ZRNA 3OP4A 3VKUA 2EJVA 3I4FA 4R1NA 2B83A 5A9RA 4ZU3A 3S8MA 3HE3A 1B8PA 4JLWA 5AXDA 3RUDA 3TNLA 4EEZA 2ZQZA 2ZTVA 4KDEA 4Z9FA 3JQBA 4IIVA 3HZZA 1UAYA 4GI2A 4JCOA 1CJCA 5THKA 1BRMA 2O3JA 2Z5LA 3LF2A 1TI7A 1JKIA 1LTHR 1P77A 3G49A 1SEPA 2HDHA 2NTVA 5L45A 3WX0A 3H6KA 4YT4A 4D43A 2J3KA 5FI3A 1WMAA 1GYPA 1H0KA 1NVTA 1LDGA 4E5KA 1GADO 4F3YA 2QX7A 3ZHZA 2Y05A 5ES3A 1JVSA 1NWHA 2O50A 3OJLA 1SOVA 3EDMA 3I6IA 2PR2A 1GU7A 2G5CA 3K2BA 4E4YA 9LDBA 4HNGA 2CVQA 2H63A 4BNLA 1J4AA 3RUIA 4XYLA 3RAJA 1MLDA 3NJ8A 1KVUA 2ZCVA 5JCXA 1QYVA 2W2KA 4MVJG 3AK4A 4KMSA 4O5OA 3UICA 3LC7O 1RYDA 4BVAA 1LUAA 3ASUA 4LRTB 3AFNA 4L4SA 1QYWA 4E30A 1O8CA 1HEUA 3PIDA 4R01A 3VZPA 5KVCA 2IZ1A 2A92A 3D3EA 4E21A 4GVLA 4R16A 1E0DA 3RU9A 2GN4A 2AQKA 1RJWA 4YTEA 3ZHXA 5B12A 4FFNA 1P1IA 3PHGA 5H82A 1CQIA 3GF4A 1LC3A 4YWJA 2OXIA 3TJRA 4E33A 3KV3O 3Q2IA 3N74A 5L51A 1NASA 3JYNA 4GAEA 4X54A 1E3SA 3WGZA 1PZGA 5JY6A 1J5PA 1U9JA 1FDVA 3DXFA 4NG5A 2AHRA 5TQVA 4RJTA 1P9LA 5T64A 4XD2A 3QVOA 1NM5A 1E92A 1P74A 2C7VA 4WEOA 1HSZA 3DTTA 5K6AA 4YAKA 3OHSX 4N5LA 4LCJA 3OETA 4O59O 4YT5A 5U9CA 4E31A 1DFGA 2AEMA 4WGGA 4GGPA 4GSLA 3O4RA 5JNLA 4K26A 4BO5A 2NWQA 1NQAO 2Y93A 4UUPA 4E6PA 1KBZA 4IIUA 1ADCA 4Y6PA 3PYLA 3AU8A 4HADA 1WW8A 2C5EA 3RC9A 2C29D 3IJPA 1GQYA 3UH1A 2ZTMA 3ICCA 5JAQA 3VOSA 2NU6A 1ZCJA 4AJHA 4KQWA 2YHIB 4JK3A 5BNTA 1E3EA 1BVUA 3BMQA 3LC1O 2AXQA 1WP4A 4E5YA 4I5GA 3AOEA 2VHYA 3FBGA 3WSVA 1VL8A 2GRAA 3PFWO 4N18A 4IJUA 3B6ZA 3WS7A 1PS8A 3A14A 4NZ9A 4PLGA 5TF4A 4D45A 1HDZA 3ASVA 2XOXA 4FBGA 1HDGO 4E2ZA 3D5QA 2Q45A 1TB4A 4PRKA 3HFGA 4U8GA 3QV1A 3UCFA 9LDTA 4ZHSA 4CV0A 5DT9A 2EERA 5CAEA 2CSUA 1Z45A 4WJZA 4WNCA 5TJ9A 4XWYA 2J5RA 3FI9A 2B36A 2OL4A 2JCVA 4A2CA 3E48A 4E0BA 1YJ8A 4RF4A 1X14A 2B5VA 3O38A 2QIOA 3B1FA 8LDHA 4J1NA 1ENYA 2J3JA 2D4AA 2NVUA 4PLZA 4JP3A 1A4UA 1X1TA 1VM6A 3F3SA 3WLEA 1ML3A 3JQAA 1I2CA 1HYGA 1WDMA 3RI3A 2EGGA 1N8KA 1U5CA 5JY1A 4IDEA 1UUFA 4UULA 3T7EA 3CH6A 4IJWA 5C7LO 4FC6A 4NFHA 4WLEA 2QRLA 1YDEA 5C37A 2AG8A 2EW2A 3FHLA 4DIBA 4J1QA 2O4CA 5TC4A 3AFMA 1YL7A 4KTVE 4DIFA 3DC2A 4ND5A 1LXCA 1JAYA 3CMCO 2FR0A 4F6CA 1UXKA 3GH3A 1YXMA 5TNXA 3PP8A 3QWIA 4RVSA 4AL4A 5EL0A 4A03A 3GDGA 3F5QA 3UHAA 1LRJA 4PZDA 1HT0A 4MKXA 3K6JA 2NQTA 1ULUA 2GPTA 3IUSA 2AMFA 3K73O 4YT2A 3BTSA 3WQSB 5JAIA 2UV8A 5JPIA 3GGOA 1XDWA 5T5QA 1DXYA 4GH5A 4C7JA 3FPCA 4W9NC 5ITVA 4D44A 3NUGA 1RM5A 4ZRMA 1Y8RA 2YZ7A 4TKMA 4ALJA 2HSDA 2B69A 3NT2A 2FZWA 4TRMA 3CMMA 1ZEMA 2P5YA 4J7UA 4NMHA 1PZFA 1EQUA 3QVTA 3V1UA 3DBHB 5GY7A 4MO2A 2LDBA 5DBGA 4BNYA 2FN7A 5TX7A 1LLUA 4WLFA 4JROA 5IZ4A 2NVWA 2V6BA 1YB1A 2NM0A 2I76A 4R1SA 2O7QA 3MJ4A 2W2KB 2O23A 3QWBA 2FSSA 1WWKA 1B8UA 4YJFA 4AJJA 3D3WA 3P7MA 1SCUA 2H9IA 3JQGA 1UJMA 2P9GA 2DFVA 2Y67A 4ROSA 3ONEA 4I9NA 2VRBA 4RF5A 1CWUA 3OEYA 4J4HA 2HMVA 4TKLA 3PDJA 2NTNA 2D5CA 4B7UA 1EBUA 3I9MA 4CLXA 3N58A 2NACA 2Q50A 4P38A 3S55A 2PZLA 5HS4A 2QYSA 4AJPA 1AGNA 1IHXA 5TSDA 4XRGA 4DREA 5FFFA 4M49A 2EKQA 1FDSA 1LSUA 4BO8A 5HWSA 5KOIA 2P2SA 5DZSA 1HETA 5T57A 3ANLA 2HLPA 1GUFA 2J3HA 3K2EA 2V6GA 5J23A 2DBVO 1H6BA 1NXQA 2DBZA 3ULKA 5G0TA 1QKIA 2YW9A 4JX8A 2HRZA 1KY5A 3GDOA 3GEGA 2B4RO 1TXGA 4H7PA 3DR3A 3ZH2A 1N7HA 3D64A 4GSKA 4BNFA 1I3KA 3WSWA 1XA0A 3PQFA 1H9AA 2DPHA 1CDOA 2GERA 3Q1LA 1J6UA 1YS4A 2DPGA 2GO1A 1GD1O 4JXKA 4C7KA 2RBEA 3RCBA 2FWMX 4EJMA 1SAYA 4EJ6A 2JCXA 3F47A 3WOHA 3L0DA 4F45A 2P9EA 3GT0A 1YVEI 2D8AA 4FGSA 4IQGA 5DCUA 3KZVA 2WWRA 2IXBA 5JMPA 3T4XA 4GWKA 4PLHA 5K9ZA 2QG4A 3BMQB 4FR5A 1IZ9A 2BGKA 2O2SA 3QVWA 3U0BA 3RJ9A 4XDYA 4GL4A 3DAFA 1TLTA 3IDSA 1QYCA 3DHEA 4CM1A 2PV7A 3WQQA 1HE2A 4YQYA 1DJQA 4ZJUA 3EGOA 3BXXA 3TN7A 3BAZA 4L73A 2GASA 3VPFA 3OJFA 1ENZA 4CMIA 1K5HA 3OH8A 4GX1A 2V6FA 3I1JA 4S3MA 1H5QA 4CM3A 1C1XA 4BNZA 2I99A 1C14A 4IDFA 3WBBA 4DBVO 3VZRA 1E1MA 4OIMA 1YBAA 4DPLA 1BW9B 1HDRA 1YL5A 1YL6A 1LQUA 4MVJH 3JTMA 5BSGA 1D1SA 3VVBA 5DOZA 2NVUB 5T67A 3K31A 2BFOA 2O3QA 1DIAA 1IE3A 3F4BA 4GX0A 3ZNPA 1GEGA 2X23A 4NDNE 4G81A 4UEJA 1I3MA 4Q3NA 1NWCA 5EN4A 1NR1A 2Q2QA 1X1EA 4PLCA 1GCUA 3V5NA 2VHZA 3BMNA 4B3IA 1F0YA 2Y66A 1R0KA 2NU8A 2PFGA 2I5PO 1E6EA 1AE1A 3L4BC 3OIDA 4ND2A 4DGSA 3TFOA 1E7SA 3CZMA 1B16A 5I9NA 3U4IA 3E03A 2J5QA 1P3DA 5LDGA 4BNNA 1PZHA 1Q7BA 1QMGA 2FPPA 3FF4A 5CDYA 1G0OA 3X2EA 4H3VA 1T2FA 4B4OA 3ROKA 2ZTUA 3UUWA 4ALMA 1QLHA 1R16A 3OJ0A 4NNJA 1T4BA 3LK7A 4CLRA 3RUCA 5F1PA 2ZIZA 1FXSA 2XXBA 4ZICA 2TMDA 4IMRA 3GFBA 4ESOA 4FFMA 2XPCA 4L8VA 1H9BA 3FD8A 1DRVA 3Q0EA 3AJRA 3E5MA 3I52A 5F3RA 4IY1A 4BNUA 1Y8RB 1LDYA 3TZCA 4IQ8A 4INAA 3C7AA 4L4XA 2O2YA 2OOSA 3P2YA 1UXHA 4YAGA 3F1KA 3QVSA 3PHLA 4HFJA 1HDXA 2VTDA 3FTNA 5KIAA 5JO9A 4BV8A 4TRJA 2EP7A 4D7AA 1PL6A 3OA2A 1XU9A 4W7HA 3OIFA 4W6ZA 4YJFB 3D3WB 3GG2A 3I9NA 3JQGB 4HFNA 5BNIA 3RUHA 2YJZA 1UXIA 1H6CA 4ZGWA 3QW2A 4K9DA 5FI5A 2PH5A 3VZQA 1SPXA 3BTVA 4JQCA 3ZNNA 3ETGA 1BSVA 1EUDA 5KJ6A 1EUZA 2AEJA 3NT5A 4DLLA 4E2WA 5JYEA 1QV6A 5HRUA
chains in the Genus database with same CATH superfamily
3E58A 4A8JB 1WMBA 1CEXA 1GGMA 2MSWA 2ZSKA 3M4XA 1P9WA 4IXNA 1PGPA 5CDGA 1J9EA 1K27A 4ZI2A 1P2UA 2IDZA 2PQMA 1Z9BA 3AHEA 3CX4A 3UJ6A 1P73A 4WXHA 2ASVA 3DYBA 4F9GA 5ILOA 1DLJA 2C4VA 3D02A 3GAFA 3PZRA 4EGJA 5BWNA 2Z9BA 3QJGA 4BEVA 2JLQA 3G5TA 3VR6A 3JAWB 2IU0A 4IDQA 3NTQA 1OGYA 1RCUA 4BMSA 4AY2A 4K6GA 3R3VA 4LN1A 2BEWA 1Z74A 2G8NA 4D8XA 3A04A 3X43A 4DAOA 4CIDA 3H5VA 4ZT5A 4H59A 1N36B 3DWGA 1JKJA 3G89A 1RLTA 2Z83A 3ILHA 4TV8F 3SC2B 4C0WA 3BTUA 2VZ9A 3FWYA 1ZLYA 1L8XA 4MP3A 5TQ2B 3ZD6A 3BXOA 1N6OA 1ULBA 3UB4A 2PX4A 4MV5A 4NOLA 1BQ4A 1T9AA 2ACKA 4Q1DA 3RHZA 1NQXA 5BNFA 4ZIRB 1ZAYA 4HYQA 1NF9A 5HF9A 4EF4A 2PUDA 1P2GA 3MERA 1TDJA 1UKAA 1EUYA 1D8AA 1RHQA 5B3LA 2GX6A 4IZHA 3Q4GA 1KEPA 3JQ7A 1Q2XA 3VOAA 3GVCA 3SJ7A 5CDFA 2NO1A 3LCJA 1VJ0A 2YNMA 4PO9A 4ZOLA 2NSLA 2YY5A 3DEHA 5IW8A 4X65B 2OG2A 4AECA 3C8HA 1Y1KE 2G88A 3A06A 4ZOEA 5AUQA 3W8FA 3SEZA 3WBJA 5JMTA 4FMBB 3H83A 2Y6VA 3I3SR 3PFHA 4G67A 3L5KA 4YRMA 3SC6A 3JD1A 4D46A 2I8AA 2XRZA 2BMDA 1UPTA 2CNKA 3AETB 4H35A 2HQOA 4KBYA 5DGHA 5A02A 2HLDD 5AKEA 3X1JA 1SCBA 2QD4A 3KZMA 5B1IA 4IV5A 1AMOA 3QVUA 1JILA 1SRRA 1L5MA 3KT0A 4OSOA 4L0MA 4CMIB 3FRJA 1Y7IA 5FB3A 3S5UA 3URKA 4DMMA 2BHTA 4LTDA 1YHNA 1OU4A 2ZIWB 1JDJA 1GRNA 2BY4A 3DQZA 4PCUA 4R4JA 3JQ8B 5AD1A 4O4JF 3X1MA 3FPLA 2PSEA 1YOVB 3P2IA 3HY3A 3ZQJA 1NQOA 1RM0A 1G7RA 1THGA 2DFKB 2BTQB 1R6AA 1XXHE 5JFOA 1TYBE 1XP5A 2B8WA 3FNGA 4DMUB 3HSSA 3JQCA 4FOOA 2J9XB 2PD4A 2O54A 1N3LA 1SIOA 4NYJQ 1QK4A 2DLDA 1GZ3A 1CJMA 1SO8A 3OCJA 1YRQA 3ZI0A 4YAFA 4KIJA 1Y6JA 3H6GA 1C9JA 2AVNA 4ITVA 2NSDA 3HHPA 3REQA 3CSUA 1SZDA 4NONA 4ZJZA 2DTXA 3T4UA 1V48A 3OFNA 3ZQUA 5J4LA 5IKXA 3TOZA 4RD4A 1EPUA 4GRIA 3TEJA 5BQPA 4B3CA 2COKA 1XZPA 2Z04A 5T6MA 4JOQA 1XF9A 4KQEA 2YZNA 4BQPA 2I6TA 2PR7A 5BRNA 3OFVA 4GPZA 3R7LA 4LHYA 1RU3A 1EFVB 1KFKB 2B2XA 1COWD 3EZ6A 2ZJ8A 5ESXA 1WQ3A 4ALLA 2BFEB 4HGQA 1L4EA 4WXYB 3U49A 3JVUA 2WNSA 4OP2A 1Q91A 1FP6A 4BCCA 4BVGA 4G9BA 4EO9A 4K9PA 1D8TA 2WZDA 4Z1OA 5H3CA 1M72A 4IDGA 1XRNA 1YZQA 5BWOA 4KG7A 4EFLA 3TBKA 3TZEA 1J33A 4WMLA 3W2TA 3FTEA 3AQIA 3ILYA 6ADHA 2HXGA 1FOEB 1RHRA 1RPJA 1UP7A 1ZD2P 5IWAB 1N2BA 2DAPA 2XZTA 5CNIA 1EBBA 4MYRA 4UCXA 3Q0IA 1F2VA 4M0EA 5TMDA 4ZO8A 2CBGA 2DOKA 3TQIA 4FFSA 5EKDA 3PGLA 3HMKA 3OUZA 2FV8A 4FR0A 2HSZA 3OLWA 5DRTA 2J9RA 1RYNA 1C0EA 2CZGA 1P3JA 1BWPA 2C83A 3MA0A 4HPWA 1YDFA 1H0SA 3G2PA 4B9AA 2DP4E 1WY5A 4QGHA 4A2QA 5LZ2A 4MKZA 4DV3B 2VK4A 4TV8A 5EWLB 2FFQA 3JTEA 4GEKA 5FUBA 3WYGA 3LUCA 1NMZA 1PG5A 1FNBA 1YZNA 3EFBA 5H81A 5F76A 4ES6A 3COPA 4MKHA 4AVYA 1MW8X 3T7KA 2G77B 1L1QA 3DR5A 2GN6A 1SVNA 3B6MA 3ZJYA 2FZEA 1YR6A 1WNFA 2NPOA 1UBOS 1DC7A 4EK9A 4FFWA 1WW2A 1YB5A 1MHPA 4LGYA 4DJJA 4ND3A 1RPNA 2PT5A 2QZSA 3KDSE 2JDIA 4ID3A 4UXIA 4XSVA 5TF0A 4PINA 2CJWB 3FYCA 3IMEA 3T5GA 4DR6B 1M76A 1C4WA 2E4ZA 2D2FA 4JBHA 2JCYA 1ORRA 4LY9A 4KW7A 4GLJA 3WYCA 1JEYA 2ZUVA 2P2YA 4B79A 5EAIA 1KBQA 5JQGB 3P96A 3EXIA 1V47A 4S1PA 4ARBA 2XDAA 1I1NA 2VPQA 4FOPA 4G84A 4ME6A 3W6ZA 5J4YA 5JOQA 3TCKA 1G17A 1UJ5A 5KVSA 3N8NA 5ENVA 3BC1A 1T34A 3DV9A 4FIDA 2ZB4A 4EI8A 2J46A 2C3OA 3K05A 1Z7BA 1SVLA 1N2CE 4FLFA 4NICA 5LR6A 5LOVF 2ZSEA 3QEKA 3L1JA 4NMXB 4RD0A 4TRMA 3DG9A 3W2HA 2FDRA 1E6CA 2VPXA 1BQEA 4Q1CA 5DP2A 4J29A 3ZZUA 1H1LB 3T3MB 2BF4A 2QN3A 4J0EA 3RE1A 2OBFA 1GT6A 2P8SA 5FFMA 1RJGA 3PYXA 3DEYX 4NAUA 2O8NA 1Q0ZA 5CH5A 3R9WA 2O57A 2YWBA 5BWBA 1GN8A 2R85A 3AVYA 1MORA 3KL4A 3CRZA 3LNCA 3DZ8A 3MWYW 5BVHA 3RVNA 1VL6A 2OLEA 3G85A 4R8LA 1XXLA 2BFAA 1B2LA 1RADA 1PYGA 2F9LA 2X0RA 1MNQA 4BMYA 4BV2A 1JLLA 4IGKA 5FD8A 5KJ1A 1TVCA 2P5UA 3BDVA 4UTNA 2WD8A 3NFYA 3T38A 5JSQA 1JS1X 4R41A 4EUNA 4N47A 3AB3A 3AIOA 1KU0A 3FDJA 3EQ6A 4EKYA 1MIOB 2B5WA 1OXSC 4WN9B 2ZE8A 4IGIA 2YWCA 1SQ6A 3EBOA 3RK1A 2MHCA 3PHBE 4KQHA 3UHJA 1QP4A 2RAFA 3OBIA 4KV9A 2Y9MB 3SFTA 1AA6A 3HK2A 4WGFA 2UZ3A 1MDBA 2PSHA 2I7VA 3PR1A 3QBEA 5FX2A 3Q8MA 1V3VA 3V48A 2G1KA 2IY7A 3IQWA 3GN1A 3WWYA 3BFKA 3ADDA 2OQIA 3K96A 3PGA1 1VMIA 4QBHA 3UHFA 2XVMA 5IMBA 3S28A 1CFJA 1VDZA 4FSDA 4U02A 5ALMA 3A0RB 3INGA 3NTVA 1V1MB 3ORQA 2G36A 1N9GA 2WFZA 3GEHA 3G0BA 1FW8A 3ETLA 4MUMA 5KTOA 4IXDA 1LV7A 4HV4A 4BQNA 4B2YA 3M2TA 1NZFA 1QR6A 4HKTA 1Z18A 3B78A 3AI3A 3UKOA 4JHLA 2RSLA 4HNUA 1E3WB 4CTJA 4NH4A 5A06A 2VHWA 1ZM4A 3GPDG 4RY0A 3TVDA 4ZVQA 4ZAVA 2WIBA 2XB8A 4TKZA 1ZINA 4DQDA 1KZ1A 5CLLA 2WPDD 3W6PA 3M7IA 2G28A 3EGDA 4WKNA 2XYGA 3VPAA 1VHLA 1SZJG 1G5QA 4CIXA 1T4CA 4QDJA 2NO0A 5CXXA 3R7DA 3EXEA 3AYZB 4DQUA 1E5LA 4LHSA 2QRNA 1YQ9A 3GEMA 1JU9A 4E7PA 1TKCA 3L7MA 4IXMA 2P4QA 4ZCSA 3B13B 2AH5A 2PL1A 3ZJ5A 1EFCA 5BYKA 3HCPA 2YTZA 4TT3D 3M4NA 4II3A 3FPAA 4YRIA 1AGRA 4KAAA 4Z1MD 1F0KA 1M1NA 4Y2RA 3SZGA 3WTBA 3F8SA 3H87A 2JIRA 3IAUA 3RBVA 1U7WA 2ATEA 3TZHA 1ZD5A 4M99A 1M33A 4UNRA 5K6RA 4LTNA 4EHKA 3KJGA 4YHHB 3MGAA 3GZ4A 4L16A 1ZH2A 3PSHA 1D4ZA 4XTRA 5J9FA 3I64A 5LP6A 3ILSA 4AKHA 3G5LA 1X94A 3OT4A 3W7VA 1WM1A 4UE2A 3RRBA 1YS2X 1NOKA 3D3JA 1JBKA 1Q0UA 5KQRA 2BV3A 3BBPA 4BGEA 1X9IA 4LWQA 3CPJB 5LOVA 2XTAA 4ZODA 2XHZA 2AB0A 3U7QB 3D0QA 4S2EA 2IUTA 2PO5A 1V11A 3KNZA 3NHJA 4ROTA 3RAGA 3CZCA 3EMDA 4ZZ0A 2JGFA 1QH0A 3VU1A 5HYVA 1VKNA 3IT1A 4GZMA 3R7SA 4D2IA 1YBMA 3ABSB 3EUWA 3TKLA 1XQ6A 2HPAA 2HWWA 4HX2A 2Q5OA 5DLPA 3C16C 4GNRA 2G70A 3F4KA 1SNYA 3VZDA 4F2HA 1E18A 2FUCA 1SHJA 4PGMA 3IA2A 4FMCB 3BEOA 2HU5A 4XYEA 4RHXA 4JR2A 5JJCA 3KQQA 1NLMA 2VO1A 2VZLA 1DBPA 3FHCB 3SIWA 2MYTA 4ZHQF 4B3SB 1AC5A 1GIAA 5F12A 2DUMA 3DE2X 4WFKA 1JWBB 2W6ZA 1S01A 3PD7A 5G4KB 4GOMD 1MB3A 1Z88A 2CCJA 2VUUA 4UXHA 1SVSA 4ZARA 4BO2A 3R0VA 1KH2A 4H08A 2WJ3A 3ZCUA 2BGTA 3BIJA 2ANCA 3ZR4B 3FX2A 2VDRB 2HL6A 3UWSA 2J31A 1Q3KA 1OROA 3A9RA 5B2ZA 1N3BA 4P98A 3C3DA 3BF7A 3HBLA 4IW3B 5JCJA 1I5OA 3G6WA 3NALA 3EHEA 1PT6A 4B8ZA 3P9QA 5BURA 3RGWS 4I1OA 3R3JA 1U8TA 2F8MA 4DJTA 1RLUA 2EHJA 3IVCA 4A0SA 3FDFA 1N8NA 1GKIA 1YCDA 4P84A 4RVGA 3IKLA 4HLNA 2B98A 2DWUA 1UBUS 4XASA 3TW8B 4QHTA 2CLHB 3VAYA 3ADKA 4PY2A 2Q3CA 1RLIA 1N7GA 2IS2A 4B6QA 2GD2A 2ACVA 3H2HA 5BR7A 3ONVA 1Y6RA 2UVPA 1K5GA 1HYQA 1PYOA 3EQZA 3IOYA 1POXA 2FRXA 5KPJA 3K0AA 5BT9A 4YJGB 3ZDBA 3H2JA 1AKVA 3T95A 1R6UA 1Q16A 2YV1A 4IAOA 3DHVA 2PX2A 1IUPA 1PTKA 4M0LA 4NZPA 5TT0A 4RW0A 1O58A 1RHJA 3PCXA 3S2FA 4DOMA 1K3UB 1QYIA 3X44A 4XB6B 2VDNB 3NCTA 2FSHA 3BH6A 2NSHA 2XOKD 1RZVA 3HO1A 1NUQA 4NBWA 3MRSA 4WKPA 1M8KA 3BSFA 2C95A 4C4PA 4CBVA 3JR3A 5IVKA 1OVGA 2PZJA 2WVAA 2I2FA 1WULS 2XEDA 3BILA 1XMXA 3A25A 3NXKA 5ELMA 3GJ4A 1V3UA 2CNLA 2QW0X 3L6OO 3FJOA 1GQ2A 3HDHA 3Q9NA 1JR3D 4TLCA 3CN7A 1QWOA 1QIGA 4NV0A 4YFVA 2GEUA 4UNPA 3H0KA 1NVBA 4FYVA 3RKUA 2HSGA 1E7MA 3E7PA 3UQZA 2Z8ZA 5DPMA 2IU3A 2IELA 3FNHA 4EI9A 1KZGB 4ZYYA 1QIHA 4IQ4A 2DU8A 2Q0HA 2PZGA 1YB6A 3H8VA 3KXPA 3MG9A 3PWTA 4OSEA 4ZREA 1GPAA 3P4YA 3OTHA 1ZITA 3Q40A 4HMOA 4ECAA 1OW3B 5DCLA 3SQXA 4NU5A 4XRRA 3G1TA 5GJVC 1WEHA 4C2UA 3W5AA 1O5IA 3OQ1A 2Q6TA 3GJRA 4Z7JA 5EJ4A 5BRJA 4UOZA 3K1TA 1IEQA 5TY0A 3Q12A 3EVTA 2LXNA 4ILKA 1AZWA 4ND8A 5ALZA 3G1UA 4JT2A 4HNRA 2PUHA 2PX0A 4KQXA 1CK4A 3UOAB 3O4FA 1R18A 4BV3A 2CCKA 4DSTA 3O9VA 2GHIA 1DWUA 2VUHB 4KKVA 3L0PA 2V9CA 2H06A 1CD5A 4ECEA 2EQAA 3KJEA 3OEED 4XQ9A 1ZJWA 4IIHA 1WPGA 2OK8A 3AHDA 3PNOA 4MGYR 3RPEA 1NR5A 2A30A 4ZI5A 1GVNB 1ISGA 1FYVA 1QKJA 3ZJUA 3PWKA 4R9UC 1XKTA 1AY0A 4LI0A 2VYFA 3F9RA 4S0XA 4HDNA 2WSMA 1YBHA 2CE7A 1I7LA 1SCIA 2GZ3A 1D9ZA 2HIGA 3GXBA 3M1LA 3PDWA 4Q02A 5FNVA 2HK8A 1QS0B 1IJBA 3JALB 1XXHB 3KKQA 3DVAA 4M0FA 2XT9A 4I4TB 5AM4A 5AKHA 5HFJA 3UW1A 1L4LA 3ZX5A 1L7DA 2PLNA 5TIIA 3BTOA 3C15C 1XTZA 3DCNA 3AMVA 4MO9A 2HMYB 1VKOA 2WIGA 3O0DA 1V7CA 5D86A 1WRBA 4B76A 5KTSA 1J5EB 3LY7A 1GGJA 4CGZA 2E5FA 4Q1AA 1QYXA 4J1TC 2O5CA 4P8RA 4G85A 2LCQA 3QFRA 2ZIUB 1PLJA 2LBPA 4U2GA 3RRJA 2NVOA 4C05A 2DT5A 3KB2A 4O33A 5H4GA 4D3YA 1V26A 4I6EA 4JI7B 3F5SA 5ALPA 2R96A 1Y42X 2YV5A 1ULSA 3AR2A 1DC6A 3U4HA 2R44A 3HCAA 3AKEA 2GZAA 2XX3A 3RT1A 3O8BA 2EKPA 4HAOA 3PWSA 2GK3A 2ATCA 2O2CA 4DDKA 5IDWA 3N76A 4BEWA 1D4FA 3FR7A 1IHPA 2W11A 2WK1A 3UPUA 4TWIA 5K8VA 2HRDA 3IR5A 5LYYA 2IEAA 2IOHA 4BLTA 4LBVA 1UC4B 2Y0EA 1Y7TA 3DCIA 1DO2A 1O03A 2PQ0A 4KXNA 5J1SB 2WB2A 4RFVA 1SQSA 3BMXA 1JT9A 2YCBA 2WWWA 4QC2A 2J5KA 1MP0A 3TGLA 3SX4A 1F1JA 4FSXA 1GM5A 4D0GA 2RKBA 1HC7A 1QQ7A 2FN9A 5DNDA 1WB6A 3ZY3A 3VBCA 4EYQA 4PC7A 4L72A 2QI9F 3STUA 2BDEA 3TQFA 3OZIA 4G5OA 5C31A 1VIDA 4L0CA 5LC1A 1RQ2A 1JTVA 2JCSA 3Q3IA 4H6XA 4PICA 4AB1A 2GD1O 1RFGE 1XD9A 2HSWA 3BRSA 3GLUA 1VBNA 1FK8A 4Q3KA 4DC1A 1T15A 2C4KA 4L0DA 5JMWA 1XZCA 4QXRA 3NX4A 4J8PA 2XTMA 4LV8B 3FCEA 3OU6A 5AW7A 3SVTA 1PQWA 4MQEB 2X4GA 2CNDA 2VUIB 4HAWA 4NCHA 4PLYA 4PR3A 4KRYA 3TRIA 3VR3A 4F4JA 5HUJA 1P39A 1ZM7A 4B40A 2I4TA 1OXMA 1UPCA 4QQRA 3K2IA 2ZBVA 4AZ0B 4BRSA 3ADBA 3THXA 1AM4D 2P35A 3PEFA 4FGJA 4BEBA 1F4LA 4N12A 4NECA 1WZEA 1XJ5A 1B3RA 2PU7A 4QYWA 2D1RA 1BHSA 4OB7A 4DZTA 1XMOB 5L8VA 1E69A 2QRVA 1OHHA 1PJ2A 3PTLA 3QKRB 4MVJI 5EA2A 3PT9A 3KSRA 2E7ZA 1QG2A 1XALA 5ER6A 4D26A 2ZYGA 1J21A 2BGLA 3RF7A 4G0OA 3SE0A 1GRRA 2H4WA 3QBVA 3HCRA 4XCXA 1QIDA 3UW3A 1JBQA 1VLHA 3UUEA 4P34A 4TWRA 5EJ9A 3PXAA 3OOYA 3S2GA 3DE5X 1XI2A 1EWTA 4PV7A 4I1VA 4PC6A 3TAUA 2QM7A 1N2CB 1K75A 3IDOA 1GVHA 2QD1A 1MEOA 1EE2A 4GOOD 3DV0B 3VFDA 1Y1SA 2ET6A 2ZAMA 4BCBA 4AKTA 4YJ3F 3K09C 1MDFA 3O3OB 2CMHA 1GTRA 2OBMA 1UWKA 2QYTA 3PRKE 2RH8A 5GOTA 4MVWA 3KYDB 3WYAA 1FJXA 3L46A 2ADMA 3ID6C 4LPSA 5IYZF 4WXPA 5KINB 3CB4A 3I83A 1F8GA 5IAAA 4F5DA 4CQJA 1E1DA 3T8YA 4D4MA 1XVAA 2AW3A 3NKVA 3B36A 2JHAA 2GBLA 1ABEA 3ZQ4A 3A32A 1W4ZA 3QVXA 2JJ1D 3QLUC 5L7TA 4FE7A 4Z8XA 4RLQA 5FP0A 4CEHB 2CLKB 1U4SA 3KQYA 3PVCA 1E2HA 5G1PA 3FPFA 4QDXA 3ORFA 1SUBA 2GFQA 4FNGA 2Q9CA 4TS4A 1SXJA 1NBMA 2V96A 4UJ5A 4ZT7A 1XVUA 3GP8A 4GX2A 4AI6A 1W59A 2P7IA 2CL7X 2JD2A 4A36A 2YYZA 4X71A 3MTGA 4JSYA 4OKIA 3CEMA 3ZIDA 3D7RA 3QYAA 5SZIA 1MB0A 1RFLA 3EW7A 3PD0A 2FF5A 2WJ4A 4L76A 3QEMB 1BHJA 4KX3A 1JW9B 2PLWA 3S5JA 1IMJA 1AKWA 2PIAA 1E9VA 4CTOA 4E4TA 2ZPTX 3FCUB 1Z37A 2WINI 3R0JA 3S2SA 3UJCA 4NCAA 4GKJB 4PHHA 1XDGA 3TIIA 4ZU1X 3W9SA 4AY6A 1S2NA 3KG2A 4PFKA 5HCIA 3V1TC 2UYHA 4J9VA 3HLYA 2OBYA 4Q4AA 2VDMB 1TU4A 2ZJ6A 2Q46A 1Z8FA 1TE2A 4PNHA 1TJNA 1J2RA 3HBJA 5CYPA 3RC7A 2FQQA 4RAOA 3ZWMA 2ZUEA 1XU7A 2JGEA 2L0XA 2IYOA 4NBTA 3TSWA 4AY5A 2Q1SA 4MQLA 1ABBA 5JISA 2FSUA 4QICA 3CRQA 3HDVA 1P3Y1 2YVUA 3SQOA 3JVDA 3HCFA 3U4GA 3FPBA 1PJ3A 4PANA 4H6VA 3EEOA 3SZMA 5FBWB 1TPYA 1LSJA 2CHUA 3ZJTA 3FB1A 1QO9A 5WRFA 2R1UA 1FUYB 4P83A 4HRYA 4TWZA 4BE7B 4US1R 2NADA 2WYHA 1AO3A 3GRFA 3P2OA 4BJ5A 4YUXA 3RSGA 3UGKA 4KJZA 1E3TA 1NY6A 4CM8A 4JFRA 1X9HA 3ZN2A 3E9MA 4R9SA 3DHYA 2XIJA 5H02A 1WKVA 3ON5A 1QG0A 2OCIA 1V16B 2R86A 3MRTA 4R51A 1KU6A 2PAFA 3WYEA 3U44A 4IUYA 3VR5A 4NU0A 1OA1A 1RAIA 2JLBA 1OPXA 3I73A 2G9VA 3B5JA 4CF6A 4UHJA 1U0EA 5CA1F 5AVYA 4DR2B 1U0GA 4YMTA 3UOWA 1H6AA 5L3VA 3BWBA 4XFKA 4UASA 4RKRA 5JG7A 4B3HA 3H9GA 5FOVA 1EFKA 5DI9A 2X2EA 3WLQA 1E0JA 2GXSA 1WXIA 1T3GA 1LQ2A 3IOEA 3CZRA 1QUFA 2YJ3A 3K0BA 3Q6MA 4GZ5A 3TLCA 3NOOA 1J09A 1BD3A 3AVUA 4BGVA 2YHUA 1M2OB 2ILTA 5CJ2A 5D3MB 4JLSA 3OZEA 4NY1A 4IQ0A 1BDIA 2HK7A 3DEJA 1CC1S 2Q8PA 3H2ZA 4OMCA 3EPLA 4MVJA 2HA2A 4E88A 3C1TA 2OORC 5EJIA 4DW8A 4HRXA 4NXNB 5AM3A 1SM4A 2IHTA 2QN6A 1Q1QA 4BDTA 5ERGB 7REQB 5KMGA 3OTOB 2BLNA 2X22A 4WBNB 2W6CX 5CFLA 4OI4A 1B23P 3A9WA 4MUNA 4KUEA 4ZZ3A 3GEDA 3C4JA 3FYSA 4BIMA 5JARA 3BL8A 4YJ3A 5K4AA 1VRWA 1DLIA 1Z6TA 2CDCA 3DLCA 3B38A 2B4AA 1FFGA 1TU0A 1C0PA 3FCCA 3GLVA 3LIPA 4LIPD 5E6UA 2NG1A 4YXWA 1XZKA 1FDUA 5IFKA 5KKAA 3KEQA 2IPOA 3PC6A 4EB0A 5A0TA 3WRVA 3EMVA 4GQAA 2RFLA 3KJNA 1UBHS 1G3MA 1I1HA 2ATXA 3KBOA 5LCXA 4MKGA 3KDPA 4UOQA 2O8DA 1YS6A 2WV7A 3DW1X 2H2AA 4YIKA 4XA8A 4LY6A 1O08A 2R6AA 1MZVA 1NJ5A 3EIWA 4GYYA 1NLYA 1MKYA 1AXRA 3M6MD 4HYEA 4PBTA 3UMCA 3QSGA 1R4MB 4MKRA 2OBLA 2PBLA 3GN2A 3TZQA 3RVMA 3HNRA 2BELA 3S68A 1XZDA 4AKIA 3HYCA 2WD7B 2ZUDA 3TL3A 3C5WP 3O2QB 2HLDA 1GY8A 4NEHB 4PQYA 3ESYA 3ZWKA 5B4UA 4RLFA 2R97A 4YA6A 1GXSA 3NVAA 3N0TA 5EQJB 3RRFA 4DWOA 1JKFA 1ZLXA 1QZUA 3U60B 3D7NA 5CURA 3C3XA 3I5YA 2FE4A 1MQSA 3I1YA 3PQ8A 2Y1CA 3SZ3A 5EKUA 1C81A 5IJ0A 1QAQA 3LHFA 2OLJA 5ANRB 1HLGA 1P1KA 2IPLA 2WICA 4R2KA 5CK4A 2CUZA 2QTAA 2PBZA 2CMGA 3IAS1 1MA3A 3L7BA 2OG1A 2EL9A 1PD1A 3PG5A 4BO0A 3FUVA 4Y2XA 1NVVQ 4HRVA 2KB0A 2EWMA 1BMDA 2WJYA 4BJHB 1MAHA 2O2JA 3BIOA 3GC6A 4N65A 4BKRA 5K09A 1MO3A 4M98A 2NPFA 4AQ7A 4F9FA 1RXWA 4RACA 4ZO7A 2ZBDA 1C3EA 4EYKA 4D25A 3PA6A 1T6YA 1J9ZA 3BWDD 3K1AA 3EBLA 4J94A 5BYBA 3ZY4A 2QQ5A 1T25A 2D5BA 3IIIA 3TL6A 4PSAA 1XJQA 5TEWA 2GM4A 1EDEA 4Q4HA 2IV3A 5AJXA 3FMFA 5J2UF 1SCJA 4BBJA 4YUAA 4XQEA 3W5VA 3ZJ4A 3MOGA 4J9UE 1NRIA 4TN1A 5H3LA 5U4QA 3TFWA 1COWA 1NBAA 1ZOSA 5EZYF 4E22A 3W5SA 4RPJA 3QOXA 4YMLA 2RB5A 3M3PA 1FDOA 3VAZA 3EAGA 2YFQA 3G2KA 2B7LA 2WF7A 3JAKB 3L7IA 3LF1A 4K9OA 4OQDA 4UNQA 4P81A 1E1YA 2ZSUA 2XUPA 3Q7TA 3P0RA 3C97A 2WD9A 2A7XA 3WGGA 1MPTA 3AUKA 1U90A 3DCJA 1VZ2A 2HZBA 1XJCA 2V6JA 5CA1A 3D6NB 2IYEA 1VLQA 1IXKA 4FOLA 4LQDA 1UBRS 4BWGA 3GOQA 4UATA 1EA5A 1LVGA 4CF3A 5ICMA 1TZCA 3AESA 2IQIA 1V4NA 2PT9A 2C03A 5G0WA 2M6KA 2W6PA 4X20B 2QNRA 2BZGA 1MFZA 2P2GA 1QLJA 2H52A 4F9TA 3QNMA 1U6KA 3DMPA 2CXXA 4MMZB 1XQYA 3CRMA 3WLNA 4RM3A 3H5WA 2QMQA 1Z13A 1ADBA 1X1RA 4MIEA 4NNOA 3WWEA 4BS9A 4LYYA 4KQIA 4RMNA 5G2OA 3WMGA 2PSJA 4EJFA 4OFWA 3OQMA 2IF0A 3R3YA 3L7KA 3UAWA 4GE0A 3SJCA 3CVJA 3WNVA 1V7PC 3VYRB 1H0RA 1E7RA 4H18A 3E3OA 3H8SA 4H27A 4RE5A 3KFXA 1ESMA 2MSDB 1J2TA 1ISIA 1MN6A 4MAFA 4OHWA 5K99A 1Q7GA 3BREA 1ZICA 5KOJA 1KTVA 1RAGA 1FLDA 3DULA 5L3SA 1N2GA 5MN4A 1S2IA 1UK8A 5CDHA 5BN4A 3DDSA 1J0XO 4KIUA 1UC8A 2OFXA 3P9SA 1RRGA 4MUKA 1E3IA 4R98A 4CCWA 5FLXA 1NXPA 4LVUA 1Z3CA 3M6LA 4R8RA 3A3YA 4OHUA 3A4TA 4BX9A 3HMQA 3I2KA 1DJOA 1KQPA 3EY4A 2A0UA 1J56A 1NI4A 4YJHA 4XYGA 4NATA 5A3JA 1PWXA 3MCZA 2H51A 2KYRA 1WY7A 4PR0A 5FBRB 2I33A 2VLIA 4ZAZA 2OXEA 2JK0A 2P0EA 4KZPA 1UODA 1H69A 4R1UA 4L8GA 2UUBB 4BAUA 2GZMA 3DBLA 3G6KA 5CB0A 1PT8A 2DBRA 5C9ZA 4NFYA 1N92A 3ZLJA 1KYTA 4DLBA 3TI9A 1V45E 2FP3A 3UM9A 1X0VA 4UKDA 4JB8A 5HA5A 4D74A 2Z1DA 4PN7A 2JH9A 2O6HA 3ODGA 1ZJJA 1SBZA 2GD6A 1LSOA 1WCYA 1G8SA 2VP3A 1R9NA 4UEKA 1PFWA 4QAQA 2J0VA 4UEOA 3UXHA 3QE2A 1BKDR 1J0BA 3JY6A 4AICA 5DGTA 3ZU5A 1NSYA 2ZIAA 4TL7A 1BIFA 4GYWA 3MWFA 4KLZA 3E8XA 4JB3A 5KNCA 2IOQA 3VR1A 3H13A 2F3PA 2QVXX 5A3SA 5I6DA 2RGUA 3MZ0A 4E32A 5F7OA 2JCBA 3EIFA 3BMOB 4F2DA 5G4KA 2FSGA 3ZWCA 4QOSA 5IK2D 3A4YA 2L82A 1BHQ1 3A1TA 3LXXA 2VEOA 5IKMA 2YFHA 2GZ1A 4Y0VA 1VSUA 2Z0MA 1JH9A 2UXDB 2BM8A 3KB8A 1JAZA 1DEHA 3QIAA 5J2TF 4CEJA 1GA4A 3ZKWA 1VMKA 2KM1A 1Z2AA 1VGRA 3NHBA 3PICA 4N3CA 1OA0A 3ZUPA 2Q7XA 1FTQA 3SZUA 2AXNA 3SDBA 1M0TA 2AUMA 3A1FA 3FIUA 2W00A 1ZSVA 1CZRA 1EWYA 2QD5A 2QRMA 5SY4A 1WUJS 2W4QA 4AD8A 2D1FA 5ADWA 4WVFA 4RENA 3DFZA 5I9SA 5JS1A 3KPYA 5GGYA 1T5TA 1JG3A 3BDIA 3KT6A 4H16A 2I6SA 1JLSA 4G07A 1RZRD 2PVSA 4U0KA 3DAHA 2ZGVA 1W6RA 1OQAA 1PSZA 5KEIA 2NTYC 4XVRA 1QB8A 4X6YA 2CUKA 3PWZA 5G53C 3WBKA 2QX6A 4FYMA 4WK0B 4URYR 4IMJB 5JXJA 1JPVA 3OM9A 1B3BA 1JU4A 5MGNA 3U4QA 4C7OB 3H3XA 3LYUA 4P3PA 4JUCA 4FKBA 5LA6B 3GNTA 4PYMA 3ZCRA 2IS1A 5FLEX 3WQHA 2Z58A 4GD3Q 3RRMA 4I50B 5DLDA 2XGOA 2H92A 3RHSA 1ZK3A 4B6OA 3CKLA 2PG3A 3ZWQA 5JFGA 2ISSD 2WPDA 3IBTA 3HWRA 1KFJB 1Q95A 4L5YA 3I6YA 4G9EA 4EYEA 1B6GA 2F3SA 4RA9B 4BC1A 4OYLA 2I34A 3F6BX 4KVFA 4C2AA 3VYUB 5C53B 3HL4A 1MX1A 3FIJA 4J03A 3DCYA 4D56A 4NK5A 4BLOA 1UF9A 1B93A 5C1BA 4RIEA 3IIJA 3IUJA 2BFMA 1QHYA 1T8TA 1XTKA 1JMVA 4XTCS 3WXMA 3DE1X 1G9XA 1GO2A 3K5IA 5F4ZA 4Z1MA 1H65A 3V4PB 2FN4A 5HPYB 4DN6A 1NVUQ 2M1XA 1LI4A 2C98A 4JYBA 1ECPA 4L4UA 2I1VB 3TNYA 4CM6A 4KOAA 2A67A 2WTXA 2X5JO 1KK0A 2ZT5A 2OCDA 3TRDA 2H7YA 1SUIA 1YZVA 1LC0A 4DA4A 4P32A 1YE8A 2E18A 3I04M 1LU9A 1XTQA 2V6IA 3QPDA 4U00A 3W06A 3JARB 3TSCA 4LK3A 1J2YA 2FSPA 3CFYA 3DVRX 1C30A 4F1KA 3X1DA 1BKYA 1KY3A 3TIXB 3ZWBA 4QECA 4QXAA 1O6ZA 3ILVA 4OLFA 4NYIR 4QG7A 2JA1A 4JLJA 2VNSA 1BJKA 1UH5A 1U2EA 3QXJA 4FWIB 4LZOA 1X7ZB 3TR0A 2FPGB 1OAOC 3C43A 2VJNA 2C4UA 2IYLD 3A70A 2AG5A 1UPAA 1YMUA 4OY3A 3OU7A 4E7OA 3VTKA 2W93A 3LA8A 4N0PA 2ZIXB 4U2CA 3OZGA 3O26A 5EYPB 1MO2A 2VP4A 1NNI1 2VRCA 3FOBA 1TIKA 5LYJA 5IKPA 1Y8CA 5IBPA 4JQYA 3W5DA 5A6VA 3E0QA 3KYBA 1ZRMA 1XWWA 2QR3A 3MUEA 2I29A 4IRUB 5LUBA 3VR0A 4TL8A 1G21A 3ESCA 3VMFA 1IATA 1GGFA 1YVUA 1Z26A 2NZVG 2QZJA 3UFXA 4F3CA 1RJ9A 2XQGA 4B3FX 4MDEA 2QZZA 4YJDA 4E5DA 1AGYA 3G68A 3PUYA 3SC4A 3N7UA 1ZBQA 3WGIA 5CM2Z 1E2UA 4J7AA 3KQWA 4Y6SA 1L8LA 1FZTA 5LQSA 3SNKA 5IT5A 4YXFA 2IV2X 3KLBA 2P6RA 2V7TA 2BBSA 3H05A 1DBQA 1X9GA 2IRWA 2A0FA 3R6TA 5J2TA 5K3DA 2HA3A 1H05A 3KOXA 2ZJ5A 2B1QA 2PANA 3OE7A 2PNFA 3L7NA 1R0CA 3JQPA 2QMEA 3VRHA 1GCAA 1OV4A 3HJFA 1NSFA 4FT2A 6GPBA 1GLVA 3KVRA 1S1MA 2UYYA 4E2FA 2OCYC 3PHIA 3FHTA 3LC2O 5ADHA 4V03A 2C58A 4ICIA 4KGXA 1K63A 3AVTA 4EF5A 3VDRA 3DOEA 1JSZA 1SVIA 4MQFB 2GEFA 5AXCA 5AVXA 5LQCA 1PX0A 4TZKA 5AVSA 1WLYA 4EG1A 1SVWA 4B9EA 4PNEA 4CT0A 3IPLA 1TQ6A 3WYFA 5HOEA 3LCRA 4C5CA 2OGTA 4DLRA 4HXYA 3NBFA 3H2SA 3NV7A 1IAQA 1V9CA 3CF4G 3VV3A 1MG0A 3WLJA 3CEHA 2BUCA 3EZNA 4EB8A 4E4RA 1OI4A 4ZQHA 1F6BA 5FAKA 4ARSA 4BN0A 4F4UA 4QEZA 5EMJA 2VPYA 3W3AD 5C3MA 1Z08A 1L4UA 4JX9A 2NUAB 5A3QA 1CQIB 1PJCA 5A4AA 3B70A 1CERA 1P4JA 1GV0A 2WU0A 2DB3A 1AKRA 2WM3A 2ZWMA 4HDSB 1EHYA 1DINA 3KELA 1NMEA 3NDJA 1JMKC 1Q0HA 3RS4A 3MS4A 4PGGA 3VU9B 4JJGA 1ZU4A 4D5GA 1ZCAA 4O4LF 2JF0A 2QRGA 4HH3C 1K08A 5D8DA 5KNBD 1RPTA 2ID7A 3C5EA 1VHWA 3NIFB 1XK6A 4F3TA 4FBLA 4HGNA 2ZPUA 4OK5A 3IILA 9ATCA 3ZLTA 4R8SA 3CJRA 5CB4F 1TD9A 3SIRA 2FK8A 2OAP1 3CW9A 1AGXA 3P9PA 4N41A 1G4HA 4J1TA 5BOVA 3WNDA 2XNHA 5BN3A 3T9AA 2DFDA 1D7AA 1SU6A 5MN5A 4Z7OB 2XCIA 3DDWA 4Q9IA 3O4IA 2RAUA 4I5DA 3LP6A 1R3UA 5DYYA 3PKJA 4FLMA 4GF5A 4UBNA 1XNRB 1OXUA 3ITEA 1PUJA 3ND8A 4M83A 4DIOA 4QXPA 5BO5A 2QAJA 2RHRA 4PQEA 4YMVA 5KYYA 2AUTA 1AS2A 2AXEA 3LOUA 4PGAA 1T5IA 2EOAA 3AF1A 3RS0A 1HTBA 1LDBA 1CQXA 1TT5A 2ZJ0A 2Q1UA 3GDFA 1QTIA 1EXWA 2JFOA 3FFWA 3NJ4A 4DLTA 5GVSA 3GOHA 3VR2D 4C9BA 1LSSA 4V1CB 1IQ0A 1Z33A 1J2UA 2J9YB 3BXPA 4OXNA 1MA0A 2G5TA 1QF7A 2PV0A 4PM4A 4QDUA 3UFBA 2C1ZA 4OHOA 4B87A 4Q3OA 3UT5A 5BW5A 1Z0IA 2QW1A 1ORVA 2V7QD 1PQPA 2XT6A 3Q5DA 3QHPA 2C7OA 1OX4A 1VB3A 1XMJA 1FYXA 2AN1A 1XAIA 2PZKA 3O8QA 4IIEA 3B6IA 1IY1A 3WMEA 2AZXA 4WK6A 2JI6A 3HYRA 4DXAA 3UMMA 1FDWA 1ESCA 1GV1A 1NP3A 1SB9A 4PG7A 3TRJA 4TYWA 1KY2A 2NO5A 3QOWA 4CQMB 2V9PA 1H4QA 4DNOA 2JLCA 4QDZA 4L5JA 2WKWA 3NP9A 2BMAA 4WT7A 3J7TA 5LXTB 1XVIA 2QAGB 1KH1A 3OKFA 2FZGA 4M0UA 3WIEA 4D99A 3AQ4A 5IM4F 4TWJA 1E60A 1PUXA 1BCRA 4KIFA 1R0YA 2NO6A 3MWEA 1EDBA 3D6FA 4DCOA 4HQ6A 1YJQA 4DA7A 3RC2A 1HDOA 4BZPA 1CR1A 2OUIA 1MJNA 3AB8A 2J3EA 4I1SA 5CR9A 1P0CA 1P33A 3JQAB 1U63A 4AJOA 1ENPA 3DKPA 1T1IA 3EEIA 3EWSA 2DVMA 3NUZA 1ZN8A 1PQUA 2I2AA 2HOQA 1WD5A 1LWOA 1YT5A 4EB6A 1IVSA 4IJMA 1Q11A 1SKYE 1XX6A 1XZGA 3LP8A 4TV9B 2QPLA 1PNOA 1V8BA 4JNKA 2YIDA 4PE5B 3AVPA 3O2NA 5G1NA 3FDZB 4F8EA 2V7EA 1DG9A 1ZDMA 4RDIA 2FMTA 9ABPA 1M6NA 1IHOA 2JGLA 4ZAGA 5EUCA 1NBIA 3PJEA 2A94A 1NF8A 1NN1A 3LKZA 3UCXA 3WRXA 1P6QA 4AROA 4OQPA 4D42A 4M38A 3PHJA 1AHNA 1TKRA 1U7DA 2NUPA 4M9UA 3K0HA 3N2YA 2J3IA 2BGUA 5HUQA 3DMRA 3RW9A 3ZCTA 1OBCA 4DLPA 2OXFA 1N1EA 2GHTA 3K09A 4LBZA 2BM1A 1M6VB 2R7LA 1Y4DE 5REQA 1XK7A 2C2GA 2X76A 4B0PA 1GPYA 4D79A 4IOKA 3QITA 1QH1A 4ZEOA 3NIDB 2IEGA 4O4LA 4A2PA 1R4NA 3AHJA 3UMGA 1K0FA 3G8BA 4KO8A 2HJSA 3EUAA 3ANMA 5JNSA 3U7GA 1QZ3A 2K6GA 1I4EB 1SVMA 5H9VA 4PZZA 1NC1A 3QLUA 3WI7A 2HA5A 3T1HB 1FXUA 3QIVA 4TLEA 2B9VA 2WU4A 3HDYA 4PGHA 4H7HA 3SPXA 1R0LA 1SUAA 4LOIA