2XOXA

Crystal structure of pteridine reductase (ptr1) from leishmania donovani
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
276
structure length
216
Chain Sequence
TVPVALVTGAAKRLGSGIAEGLHAEGYAVCLHYHRSAAEANTLAATLNARRPNSAIPVQADLSNVAPVTLFKRCADLVAACYTHWGRCDVLVNNASREAMEAAAADLFGSNAMAPYFLIKAFAHRVADTPAEQRGTNYSIVNMVDAMTSQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLAEVSDVVIFLCSSKAKYVTGTCVKVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE
publication title Structure of Recombinant Leishmania Donovani Pteridine Reductase Reveals a Disordered Active Site.
pubmed doi rcsb
source organism Leishmania donovani
molecule tags Oxidoreductase
total genus 78
structure length 216
sequence length 276
chains with identical sequence B
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2010-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2xoxA00
2J3HA 4AJ4A 1TT7A 1U1IA 1NFQA 3I4FA 3H5RA 4Z9XA 4DLAA 4LMRA 1GR0A 1ONPA 2CMDA 4N7RA 3ANMA 3NTQA 1R4NB 2GDZA 3FR8A 2GGSA 4E2WA 3OH8A 2PZKA 3H9UA 3ABIA 5G0UA 1GTMA 4E13A 5DF1A 4D42A 1CQJA 4EZBA 1ONOA 3ROQA 1E3WA 1B14A 3H6KA 4FFMA 1U2DA 5GY7A 3SXPA 4XB2A 4EJ0A 4MVJI 4AJKA 4R5MA 3GEGA 1W6UA 3P5SA 4CL3A 4YAJA 3BIOA 1P1FA 3I6IA 1E5LA 2EKQA 2P5UA 4GMGA 3VC7A 3ASUA 3AM5A 4PG6A 3VPGA 1PGQA 5L45A 1WXDA 2FZEA 4E2ZA 3DR3A 2X5JO 4OJNA 4ND3A 2ZB7A 3P7MA 3A28A 4E6PA 2DC1A 3D64A 2FPIA 3PLRA 3GVIA 4NBTA 2IXAA 2AW5A 1JKFA 2DUUA 1DC4A 4P4LA 5JMWA 3K6JA 3VVCA 3PZBA 1O9BA 5JC1A 3ICPA 3DZKA 4BNTA 2AQ8A 3FTNA 2WSBA 5J23A 3F1LA 1ZSNA 1E1MA 4U5QA 4ILKA 1UP4A 4BOYA 2BGLA 5DOVA 5T8KC 2BRUA 3DOJA 4PLFA 5KKCA 4WNCA 3E6AA 2R00A 4R1SA 5ENDA 3T7CA 1V3UA 1M2WA 5IF3A 4BMSA 1EE2A 4RPKA 3QW2A 4ZHSA 3ZNNA 4GMFA 2WWRA 3S2EA 1GZ4A 1ZJYA 4OHUA 3OETA 1WP4A 4UUMA 2O3QA 2HDHA 4DIFA 1ZFNA 4E2XA 2R00C 1SZJG 4NFYA 3DAFA 2VHYA 1J49A 4JLWA 4Y98A 2EW8A 2FMUA 2NU8A 2VQ3A 1LDEA 1JAXA 1T2DA 1FDTA 2EWMA 1IULA 3ENNA 4J4BA 3ZGYA 2ET6A 5HS6A 2Q45A 2BFAA 1AXGA 4BO0A 4DIOA 1XQ6A 5IJZA 1EK6A 4H15A 3I52A 2ZYAA 1DIHA 1N2SA 4D3DA 5KOIA 3D7LA 4YQYA 2IRWA 5TS3A 2ZQZA 4EDFA 4ZICA 5DDIP 1EVZA 4E5NA 1VJ1A 2VZ9A 1IZ0A 5ILOA 4BMNA 5U4QA 3JD1A 3U4CA 3WGQA 3WS7A 1YDEA 2D8AA 5DCWA 3TZKA 4D3SA 2XXJA 3PK0A 4CMKA 2BF7A 1LU9A 3INTA 3KYCB 5C7LO 1VC2A 2CVQA 4LRSB 4L9RA 4WCFC 3ZWYA 1ULSA 4IS3A 1EVJA 2Z5LA 3KUXA 1MXHA 4C7KA 4MVJD 1ISGA 2GLXA 3PTZA 4Z0PA 4RORA 3W4KA 5CFZA 4E32A 1B3RA 3PHIA 1F17A 3QP9A 1LEHA 2B0JA 4MJLA 2Y0EA 3W1VA 4GX0A 3GVHA 2VZ8A 4QO7A 3RJ9A 5DBFA 5A9SA 2VRBA 3GMDA 3PHLA 3JQAB 1PL6A 3PDUA 1HE2A 4XQ9A 2PLAA 3L9XA 4J43A 1YB4A 1ADGA 3DZFA 1UUFA 3FF4A 2Q3EA 2XXBA 5DOZA 3TZCA 1NAHA 1KEVA 1QMGA 5CEFA 3VPSA 5HA5A 1V9LA 3OHSX 2AXQA 4BNMA 1EBUA 1HZZA 3FHLA 4ZQBA 3I9OA 4II3A 1J0XO 1HL3A 4EEZA 5JLAA 4GGPA 3DTTA 3O9ZA 3GHYA 1QV7A 4JBHA 1OI7A 3JQFA 3DMTA 3MJSA 1AHHA 1LXCA 3RROA 3K31A 3HUDA 3P19A 5B37A 5JYEA 4AG3A 1WPQA 3JQ9A 4Z0TA 3TOZA 1QLHA 1ZK3A 2WEKA 5HM8A 2FP4A 1KY5A 2YFQA 4EEXA 5A05A 1ONNA 3QWHA 4FFNA 2NTVA 4L76A 5ES3A 4GWKA 4K26A 3OBBA 1ZXLA 1ISMA 2V7PA 3DMTC 4HKTA 3FRJA 4ZRNA 2HJRA 5AXAA 5KJCA 5GZ6A 1RPNA 1U3TA 5THKA 1ISJA 4LMPA 3IOYA 4A10A 3RKRA 4AICA 4CV3A 1GQQA 4PLHA 2HK8A 4IMRA 4Z9YA 1KOLA 3RUEA 3JQ7B 5C7IO 3A9WA 3NX4A 5LCXA 2EHDA 4IS2A 5LC1A 4L75A 2W2LA 3WYCA 4JCOA 2OORA 4GH5A 3OIDA 4YYZA 4LSWA 3MJEA 4PGFA 4IDEA 4KTVE 4TRMA 3IP3A 2I99A 3ST7A 4PIVA 2VWHA 1KIFA 3WQQA 4BNLA 4XGNA 1GV0A 4FSHA 3WFIA 4XCVA 1V35A 1H6DA 4XRGA 2ZB4A 4EUFA 3KHUA 4XYBA 5ENVA 2GN9A 2W8ZA 1EBFA 2W90A 2JFFA 5KVVA 4NIMA 1PIWA 1YRLA 2O3RA 3WLFA 4XYMA 1N5DA 3K5PA 3ROPA 1SBYA 1BVRA 3TNLA 4CM4A 4CJXA 2VWGA 2AE1A 1AN9A 3Q3CA 1LQUA 4L4RA 4NQZA 4R41A 4YR9A 2PGDA 4UEKA 3IMFA 3DHNA 1G0OA 1P1IA 2VRCD 1UZLA 2VCYA 4WLFA 3A06A 1DHTA 1UXIA 3T7EA 4CV1A 3AI1A 4BL5A 1C1XA 1UXGA 4TMFA 3ZI0A 5I7EA 4G2NA 3ZWVA 2RH4A 3I23A 1L1FA 5K6AA 1T2EA 3C7AA 4INAA 5A5FA 3NGXA 3DBRA 3JQGB 4BO3A 3ZNPA 3ROMA 3CUKA 2OOSA 2HMTA 1HYHA 1Y5MA 3GVXA 3KEQA 1G1AA 3CPSA 4IPTA 1KC3A 1MLDA 3H3JA 2UUPA 5K6AC 3K2EA 3KYBA 3NYWA 2G5CA 3ZWAA 3JYLA 1ISFA 1FDVA 4XYGA 1NXQA 4J0FA 1PEDA 1ZSVA 3EYWA 3D3WA 4R3WA 2X58A 2NLOA 5I9LA 4HADA 1YVEI 3ZU5A 4Y6RA 3G17A 1RKXA 1P0CA 2P9GA 5IDWA 4I5DA 4M49A 1M6HA 2Q4EA 1J6UA 3C1TA 3GAFA 4Y8VA 3LC2O 4FQ8A 1ORRA 4IY1A 2DBRA 4HUJA 4LW8A 2O4UX 5A03A 2H5LA 2VUSA 2DPGA 1PZGA 1E92A 1GZ3A 4R1UA 1BXKA 4WLEA 2E82A 3PYMA 2P68A 3V2HA 1I33A 2ZATA 4BNJA 4NK4A 1RYDA 2VOEA 3TF5A 4AJPA 4HFRA 2FRDA 5JYDA 4YJGA 3GH3A 3CH6A 3DFUA 1DIGA 4K28A 3E9NA 2GN4A 1YOVB 4DPMA 1AE1A 2IDZA 4NNJA 1QXSA 2Q2VA 3K2BA 3SC6A 2EJWA 1IL0A 3FWZA 3O8QB 1IHXA 5L4LA 4FC7A 2HJSA 1PJTA 1NQTA 4DA9A 4CUZA 1GYPA 4B4UA 4N18A 1I01A 1LC0A 3WICA 1QLJA 4ZJUA 3R1IA 5CDSA 1RM4A 2NV6A 3QIVA 4YEDA 4E30A 3FI9A 2GZ3A 4AJIA 1MUUA 2B4TO 3KBOA 3TRIA 3WXBA 5KTKA 3D3WB 3WBFA 1FXSA 3B1KA 4GWGA 5TQVA 2FWMX 4L0QA 5A04A 3GZNA 5BNTA 2FR0A 3I83A 4FD3A 4NMHA 4YBZA 3LT0A 3SLKA 5DP2A 2OHXA 4RZHA 4ZQGA 5IZCA 4UUNA 1E7WA 4CMAA 5A3VA 2EV9A 3K9QO 4KP7A 2QZZA 3M1LA 4NR0A 1NFRA 3W8FA 3ZV6A 4ND4A 4BNZA 4AJOA 4WNIA 4ID9A 1W8DA 4JBIA 3IKTA 1XQ1A 2JAPA 3S8MA 3U3XA 2BFPA 2VN8A 2C29D 4R68A 2BGMA 3CKYA 2J3KA 4IZHA 4EUHA 2NU6A 2GZ2A 4UVDA 1JLLA 4N54A 5C3MA 2X86A 1XLTA 1B16A 1NVTA 1U5CA 3H3FA 3TOXA 3OIGA 3GOHA 3E82A 2CDAA 4MIOA 3UW3A 4JJGA 4RVSA 5H81A 4GLLA 4HXYA 3D0OA 1NBOA 1WDKA 4PLWA 1UDBA 3U0BA 2BH9A 3R3JA 4CLOA 3WGHA 4ALIA 5TIIA 1ULUA 3VAZA 1C1DA 1DSSG 4WASA 3BTOA 4FGSA 3KZVA 2VYNA 3TFOA 2YY7A 4TZTA 1Q7BA 1KEUA 4PG5A 4IJUA 2NSDA 1WDLA 4EYEA 3GZNB 3VZRA 1K5HA 2GCGA 2VOJA 2C5EA 3PFFA 1YB5A 3NDRA 1F12A 3PIDA 4NHEA 3H7AA 1RJWA 2AEFA 2PA3A 2O50A 4ALNA 4QO8A 2IZZA 4JGBA 3PRJA 5KVQA 3ZHZA 5IN4A 3JQDA 4PRLA 4XIJA 3PZRA 4MVJA 4OAQA 4XGKA 3IAHA 4IINA 4BQRA 1EVYA 2P4QA 3WJAA 3EK2A 4YRDA 2PKQO 2WDZA 4OQYA 5JXWA 5HS4A 1HXHA 4RPLA 4D3FA 3RCBA 2QYSA 4OO3A 1K89A 1EUZA 5A5EA 2FY8A 1VI2A 1TXGA 4YWJA 1OBFO 3U09A 3K96A 4PLGA 4RVDA 3JQCA 3ZWCA 1PWXA 3SC4A 5LDGA 4JP3A 4KDFA 3AM3A 5B4UA 4XQEA 1A9YA 2HMUA 1CIVA 3C7DB 4CR7A 1YQDA 2JHFA 3RQSA 4CR6A 1HDRA 2I9PA 5G4KA 4IIVA 5A06A 3ZWOA 2OBNA 4YDRA 5T64A 3GN1A 1QR6A 5ER9A 1UP6A 3E5MA 4I9HA 1HE5A 4AJJA 4RCVA 1C0IA 3ZU4A 4CMIA 4E2YA 4Z3DA 1Z7BA 4AL4A 2C07A 5H83A 3HQ4O 3AU8A 1ZK0A 4MVJH 1LDGA 2EP5A 4IBOA 4RLHA 1X15A 1H9BA 3U4HA 1QYWA 3F9IA 1LUAA 4UEJA 5T5QA 4BNVA 5TT0A 3E48A 4ESOA 2FR1A 4TZKA 1R15A 5TLSA 1BXGB 2C2YA 4O63O 3S55A 4B3JA 5JS6A 5F5LA 2Y0CA 1R4MA 3BMQB 3VVBA 3Q0EA 3N58A 1P44A 3IJRA 3RVDA 2Y66A 3BAZA 4ZRMA 4IJKA 3LC7O 3ZWXA 3O26A 4EBFA 1BGVA 1UZNA 3W8DA 1DXYA 1JTVA 2OXIA 2AMFA 3EGOA 4XDYA 4D46A 5IAAA 3ZU2A 4HX5A 3OQ1A 3ZW8A 3F46A 4YJFA 3JYPA 1BTOA 2AG5A 3E8XA 4RQTA 3RAJA 4BKRA 1QG6A 1HYEA 4DYVA 2BKAA 3GHHA 4B8WA 2GASA 3DO5A 3QWAA 3ASVA 1XIVA 5BNFA 1JAYA 1U3VA 3MTJA 2AQHA 3S1LA 4WKGA 4ONEA 3OQ6A 4EITA 4DQVA 1NR7A 1D8AA 4B4VA 5BSGA 4CMEA 4XB1A 3W6ZA 4E5MA 1LRJA 1U4OA 3L4BA 4PLPA 1R4NA 2RIRA 4TVBA 5JCJA 4CM7A 4NPCA 2OMEA 1E3IA 4DC1A 2O23A 4W6ZA 4IDGA 4BNYA 4MVJP 4ZU3A 3OEWA 2NVWA 1W4ZA 3ETDA 3FNFA 3HN2A 1OC2A 3QV1A 1YJQA 2Y1GA 3AK4A 4LK3A 4FFPA 1PR9A 2X8LA 2GN8A 2WMDA 3KO8A 2D5CA 1ZBQA 1GCUA 3L4BC 3DONA 1EZ4A 3NV9A 3WNVA 1KVRA 2LDXA 4NJMB 5C5IA 2OP1A 4O0LA 3D4NA 5MDHA 5BQFA 3EDMA 1E5QA 5DCYA 1DDOA 3GUYA 3RSHA 1HWYA 2ZTLA 3AY6A 3EC7A 3STHA 3BA1A 3OEYA 4CR8A 1SEVA 3DZJA 2HCTA 4TWRA 2NVUB 3PWZA 1LLDA 3AUAA 4M55A 3GLQA 1JKIA 4RLSA 1KYQA 3A1NA 3DAPA 1ZUD1 1XR3A 1EFLA 5IDYA 1GEGA 2WE7A 3H2SA 4BIIA 2VZ0A 3MZ0A 4UVGA 1WLYA 4BUCA 3CE6A 3RUDA 4PCVA 3WYEA 3F47A 1FDUA 1OFGA 3R3SA 1ZK1A 3TZ6A 4GGOA 3VTZA 2OL4A 1PJCA 3I9LA 4FN4A 3C3XA 1JDJA 3ZV3A 1HETA 3OMLA 2Y1EA 1EK5A 4IQ0A 2GO1A 4J1QA 3OECA 1XSEA 4Q3BA 4Z3KA 5C7OO 3KETA 1T4BA 4M89A 3WQSB 1PJ2A 1V0JA 1LDYA 1BDMA 3WWZA 4G65A 2VWQA 1E6EA 3L6OO 2B35A 2VNSA 2NVBA 4AFNA 5GZ3A 3LK7A 1RM0A 3JSAA 4DWVA 1WWKA 3G3EA 3MOIA 2D5AA 1UAGA 2ZQYA 4ZQFA 3AJRA 3HSKA 3ONEA 1LLQA 4NBWA 4P22A 4B8ZA 2IEDA 1H94A 3GRKA 4RF5A 1NYTA 3H9JA 4WLVA 2Y99A 3OIFA 3PFWO 1SB8A 3CSDA 1P1RA 3OJFA 1CDOA 2H9IA 4D0RA 1ZZEA 2NUAA 2EERA 4Q3CA 2YJZA 2PD4A 5FI3A 3U5TA 3FTPA 2C7VA 4GPD1 1SAYA 1NPDA 5CHEA 1UZMA 3QVSA 1HDOA 5G2OA 2NACA 1NQOA 1GUYA 1C0LA 4W82A 4J9UE 1Y8RB 1B2LA 5JFOA 1LSUA 4N5MA 2CY0A 3LF2A 2I6TA 2CDBA 4JJFA 1BDBA 4Z9FA 1HDGO 4RL6A 3O38A 3B1FA 3NJ8A 5CEJA 3PGXA 1NM5A 1H6AA 4B7XA 2FHSA 5ICMA 1O0SA 3BMCB 1ENPA 1C0PA 3PHGA 4KQXA 1Y9EA 4DMMA 1G6KA 3DOOA 4D7AA 3I4CA 4RF2A 3KYCA 4XWYA 5G4LA 2VHXA 5JW6A 1RYEA 2QRJA 4WLUA 4PLTA 4R1TA 4XD2A 4CODB 4JK3A 2G76A 2Y93A 4BO7A 3L07A 4F3YA 1ZJZA 3BTVA 3WGZA 3DXFA 1A5ZA 1U8FO 3NKLA 4P38A 3KLMX 3CEAA 1EUDA 3A14A 4IGEA 1DRUA 2C2XA 4BNHA 3RC7A 5FYDA 1DPGA 1KS9A 4WCDA 2V6GA 3UF0A 4BO1A 1DIRA 1UXJA 3D4OA 4BO4A 3ANLA 1JN0A 3ZNOA 1I10A 2Y1CA 5FWNA 2O7QA 3JQAA 2CDCA 4XX0A 1ZMTA 5DN9A 3PXXA 4MIYA 3JD4A 2AEMA 2G1UA 5U9CA 3HADA 1E7MA 5EERA 1DJQA 3OJ0A 4PLZA 2WM3A 1PQWA 2D4AA 2AHRA 2LDBA 3GR6A 4JBGA 4L8VA 2HRBA 3UUWA 1UP7A 4XJSA 4XZ3A 4XRRA 3NGLA 2BI7A 1R37A 4CM3A 4RJTA 4HP8A 2IZ0A 3LLSA 2PFGA 4F46A 3VZSA 3COSA 2JCXA 2IODA 4RGBA 5AXBA 1DOHA 4I5FA 5IG2A 5TNXA 5L9AA 1X7HA 1B15A 4E5KA 4O1MA 1LRKA 1Z73A 2A92A 2HLPA 2DTXA 1YQXA 4B4OA 3AUTA 4B3IA 1M67A 3K73O 2FZWA 1IYZA 2HKIA 1E6WA 1WAMA 4BNFA 2ZTMA 3LDHA 2A4KA 5DZSA 1HE3A 1OC4A 1DJNA 4YA6A 4UAGA 1A71A 1QYXA 4RF4A 4XQGA 2EXXA 1QYVA 4EJ6A 1SO8A 1U3UA 4L4XA 1LBEA 1B8PA 2ZIZA 3H4VA 3MCVA 4XKJA 4MPDA 5TC4A 4ND1A 5DULA 2BI8A 3VZPA 3UN1A 3U62A 4JIGA 5EJ2A 1JW9B 3JQ7A 4OMUA 2DTEA 3AOEA 4DPLA 1RM3A 4CQLB 3EMKA 1TT5A 5COAA 2NNLD 4IJWA 2YHIB 3Q1LA 4ND5A 4CMJA 5EESA 4Z6KA 1SMKA 1H0KA 4E5YA 2Z1MA 1VJTA 3T4EA 1IOLA 2PH3A 4MDHA 1PQPA 2JHGA 3D5TA 1F8FA 2NU7A 4CM8A 1HE4A 4OXYA 3MJTA 3C1OA 4D43A 4C4OA 4ZD6A 4PVCA 1ISHA 3VKVA 3PEFA 5IXYA 3JD2A 1WDMA 2YV1A 4TQGA 1MV8A 4GKVA 1MP0A 4WK6A 1ENYA 1ZMOA 4YCAA 2QZ9A 1T2FA 1LNQA 1A7AA 2F00A 2JAHA 3WGIA 4WUVA 1W0CA 1LX6A 3V2UA 4DTIA 1K0UA 1VSVA 5I9NA 2EKLA 3BXXA 5JNLA 3WYBA 3FR7A 4BKUA 2O3TA 3DAGA 2X5OA 1Y8QA 4YQZA 3PQEA 1NAIA 4B7CA 2J5KA 1E7RA 5F1OA 3DHEA 5JE8A 1A4UA 4YAKA 5CDTA 2VHVA 1K6IA 4RVGA 5G0WA 1GD1O 1LJ8A 3JQFC 4OXKA 4J1NA 3RD5A 4AVYA 6ADHA 4II2A 4MKRA 4GSKA 3VH4A 4L74A 1GY8A 2CZCA 1ADBA 1VLLA 2RCYA 4DREA 5JDIA 4J0EA 5JPIA 1Y5RA 3JQ9C 2NQ8A 3EUWA 4XIYA 3JTMA 4E33A 8ADHA 2OGUA 1BXZA 2RHRA 3UHAA 4ALJA 1TT5B 3AFNA 4RQUA 1HT0A 2ZYDA 4PLYA 4IDFA 4YVFA 4Q3DA 3JQGA 3RFVA 1DIAA 2X0IA 4QTZA 3RBZA 1IY8A 1B7GO 3UKOA 4OL9A 2VHZA 1B8UA 4S3MA 4CM8B 3WTCA 1DHRA 4BGVA 4R69A 3QWIA 3IDSA 2DBVO 3TFQA 2DM6A 3GZ4A 1U28A 1E3EA 3H5AA 2CSUA 3ETEA 1I8TA 4CLRB 2SCUA 3AM4A 1XELA 4FR5A 3NDJA 4IQ8A 2PZMA 1MFZA 4CV2A 4DL9A 4ZQHA 3D5QA 1PS0A 4GAEA 3RBXA 2B37A 6LDHA 2A94A 2O3UA 1Z6ZA 1Y8QB 1GV1A 1NP3A 2X9NA 3H9EO 3X2FA 5F1KA 3SVTA 4DXHA 4YACA 2NU9A 3TDKA 1ZVMA 2HSDA 3FPCA 3FPLA 1HLDA 3EVNA 1I32A 2X7HA 5AYVA 3GGGA 3RUCA 5AXCA 2B5WA 2BLLA 5F1PA 1R6DA 3GK3A 2W4QA 2X9VA 1YOVA 2JCYA 4WOJA 4LISA 4U7WA 2E49A 3GQVA 2B36A 1QSGA 2GNAA 1X7GA 3HDHA 3R0IA 4IDDA 2RAFA 1C3VA 2PGLA 3D3EA 3O8QA 3TWOA 2QRLA 4IM7A 2DT5A 4H7PA 1GYQA 2BFMA 2VYVD 1P3DA 3GAZA 2QW8A 3FNGA 4R5HA 3DWFA 3WNQA 2VNAA 3HHPA 4P4GA 4GI2A 4FDAA 5EN4A 3QHAA 2GZ1A 1XKQA 1Z82A 4TKLA 4WOKA 3JYQA 3HNPA 2OP0A 4X54A 2DAPA 2ZTUA 3MEQA 1DO8A 1W73A 3GNQA 3RU7A 3LU1A 1NQAO 3K8ZA 1YKFA 1HZJA 1DAOA 4D0SA 1PJ3A 4YAIA 3PHHA 5THQA 4I9UA 2QHXA 3GMSA 1UDAA 1XGKA 4NU5A 5JAIA 5JAMA 1TI7A 1UR5A 1Y1PA 2VUTA 1PZHA 3ULKA 1VKNA 1SEPA 3ZZNA 1M66A 4GBJA 5ITWA 3GC6A 2BFOA 5T57A 2IYPA 4U0JA 5IDQA 3SLGA 3QA9A 3M2PA 3PQFA 1WMAA 1B8VA 3KVOA 3CTMA 3W8EA 3ZNQA 5L4NA 4PG4A 5EMHA 5GZ1A 1T25A 5AXDA 3PJFA 1TVEA 3F3SA 3RUAA 5H82A 2FOIA 2O2SA 1CQIA 3GUCA 3LVFO 3BMNB 3RKUA 4J1TA 1PR3A 1LRLA 3CIFA 1HEUA 1X1TA 3ICCA 4H3VA 1FJHA 1HDYA 4YT4A 2NWQA 5AOVA 4QFDA 3VHRA 4RO0A 5CDGA 2GF2A 3L9WA 1D1TA 1WNTA 4J6FA 1U7HA 4FIZA 4E3ZA 4OGWA 4U6SA 5EPOA 4BGUA 4BKQA 1FMCA 3VPFA 5KJ1A 5COQA 1MG0A 4XGIA 2H1SA 3KLPX 3PGJA 5FEUA 3V1TC 3WOHA 1YBMA 3IKVA 4LVCA 1L7DA 2GR9A 1AHIA 3GF4A 1K3TA 2VUUA 1GQYA 2I66A 3PYLA 4UUPA 4R51A 2RH8A 3NT2A 5ADHA 2GRAA 2PV7A 3MTGA 1PJBA 3FBGA 2IYOA 3LF1A 1XG5A 4CPDA 4YPOA 5JAQA 4CL8A 1YBVA 3AOGA 3DFZA 4NBVA 4HBGA 3RC9A 3WGTA 4BS9A 1MC5A 4TSKA 4Y6PA 1HYGA 3AUUA 2VT3A 1QYCA 5IZCC 2VTDA 2EIHA 3S2FA 4IDBA 1X0VA 1HDXA 1P33A 4BHTA 5TRTA 1O6ZA 4J2OA 4MKZA 1SB9A 3BTUA 1NX6A 2YV3A 5IDXA 2WD7A 1P1HA 3SJ7A 4Q3NA 3TZQA 3VZQA 2Q1WA 1U5AA 5BNIA 3GG9A 3FWNA 3HDYA 2VTEA 5L3ZA 4IJVA 3GY0A 2C20A 4MOWA 5I8ZA 4HNHA 5DCUA 1V6AA 2CNBA 4XEHA 1MG5A 1FDSA 4R4JA 5CEEA 4YAGA 3ADPA 1VE9A 4HFNA 4B4WA 5KVCA 4KMSA 3MWEB 2PTGA 1NWCA 3HJAA 5DT9A 1MB4A 3QJ5A 2RBEA 4BNWA 1BXGA 2WYWA 1PZFA 2FPGA 2BD0A 4QXMA 5ITVA 3GNTA 3GEMA 3V1YA 2X9GA 3DMYA 4OQZA 3IP1A 3DBVO 3OQBA 4TRRA 2Q4BA 3BMQA 1YDWA 3UCXA 1Z7EA 1P31A 2UYYA 3PHJA 3P2YA 4WLNA 5JSFA 2X23A 1HSOA 3C7CB 1ADCA 3IL2A 4J91A 5EIOA 3C85A 3NRCA 2GSDA 3CINA 5A4DA 4DRYA 3ON5A 5BT9A 2EGHA 3DBHB 2PZJA 1Z75A 3DQPA 3WB9A 3IIEA 3HFGA 4BNKA 2VWPA 4BNXA 3D1LA 3WSWA 4LVUA 4DVJA 1EE9A 2DBQA 1KY4A 2H6EA 3NJ4A 3Q6IA 3WSVA 4W7IA 1RM5A 2PNFA 2WD7B 3IJPA 3PIIA 1PL7A 4GVXA 4MVJG 4A73A 1VL0A 4CLDA 1DRWA 4R3NA 1E1LA 4CQMB 1LLCA 4EUEA 2EG9A 4R1NA 4A2CA 1JKJA 2Q2QA 4GSLA 2HU2A 2IZ1A 3NTOA 5TSDA 5HWSA 4ITUA 1JVBA 1K6JA 1R0SA 2G82A 3LSYA 1GUFA 4D79A 1ISIA 3VPHA 2I67A 1NASA 1PGNA 3F4LA 3HFSA 9LDTA 3F1KA 3G0OA 4K6FA 1XWFA 2QYTA 4IDCA 1ZK4A 8LDHA 2PK3A 4DGSA 4DPKA 1WZEA 2GYYA 5FFFA 2BMAA 4D44A 2H63A 2GPTA 1CEQA 3VH3A 2Q2WA 3B1JA 4QFCA 1BW9B 1YS4A 1GQ2A 3DZGA 2P2SA 3ENKA 4FJ2A 4BO8A 3E9MA 1BSVA 2BELA 5KJ6A 2HMVA 2AE2A 4CM1A 4PLVA 4YAEA 2Q50A 5KJEA 5I8WA 4B7UA 4HWKA 4J7CA 1B0AA 1N9GB 4NJMA 1BVUA 3M1AA 5KVSA 4O6VA 1QYDA 4GX1A 1EQ2A 1XEAA 2WYUA 2FR8A 2Z95A 5HRUA 1KERA 2Q1TA 2BGKA 2NVUA 4CV0A 1GAEO 4A7PA 3OICA 1GPJA 4RVHA 5TX7A 1DC3A 2I5PO 2JJYA 1ML3A 5L4SA 3L6EA 1GZ6A 2PZLA 3G49A 3RU9A 3W6UA 1JWBB 4AJLA 3L6DA 4B3HA 2Q49A 4OH1A 3GVPA 3K92A 1EDZA 1JQBA 2W2LD 4NG5A 2UAGA 1PS8A 4DBVO 2EEZA 3ZH2A 3LC1O 4QQRA 4A5OA 3KRTA 4WEQA 3M6IA 3PVZA 1BMDA 3I9NA 2J3JA 4ROSA 1X14A 5A9TA 5CDUA 1X0XA 5BSHA 3JD3A 3ANNA 4HNGA 3FBTA 3CMCO 3PPIA 1AXEA 1HKUA 2X4GA 1WMBA 1ZO8A 5CPBA 5KCZA 3BHMA 3HN7A 1ZXBA 1NR1A 2X1HA 4CUKA 2GERA 2XAAA 3MOGA 4U0KA 3QSGA 3GEDA 3RASA 4CMEC 4FC6A 4QT0A 1R16A 4J7XA 5L51A 1MGOA 5AQ1A 4MINA 1DC6A 3OFSA 1EMDA 4GL4A 1MXFA 2VRCA 3E03A 4MP3A 4UUOA 3BZUA 1L7EA 1N7HA 1B26A 3ZW9A 1PJ4A 3GDGA 1I36A 2HUNA 3GVCA 2IE0A 4UEOA 4J3FA 3TZHA 4J9VA 2HO5A 3ZWMA 2HK9A 1DLJA 1E1NA 1VM6A 1QP8A 3QWFA 4YJHB 1E3JA 5DBIA 4J4HA 1Y8RA 4XR9A 1A27A 5G0TA 4YRBA 3UAGA 4Q3EA 3FD8A 4DQXA 3KEOA 1R0LA 1MC4A 4O5OA 1PGPA 3L77A 1P9LA 3I9JA 1EFKA 4XQCA 1Q7GA 1Y6JA 2VYVA 2AG8A 5F21A 4XJTA 2X5KO 2UDPA 3BMCA 1EDOA 1GEEA 1VL8A 4WE3A 4WJZA 3W4JA 4RPHA 5L53A 1F06A 3VDRA 1PJSA 4HY3A 3Q2IA 1T1RA 4CM9D 4TRJA 1UDCA 2ZCVA 4BNNA 1DFGA 4PVDA 5DBGA 2E48A 2C59A 1YONA 3QVWA 2YQ5A 4OOEA 1KVTA 5L7WA 4U6QA 2XF8A 3JCZA 4RPGA 1KC1A 2NM0A 2JL1A 2Q1SA 2R6JA 4BO5A 4MIEA 3AU9A 1EQUA 1PQUA 2D0IA 5EINA 1ZEJA 3U4DA 3AI2A 1U2GA 1LDMA 5F3RA 4HFJA 2DTDA 4EW6A 1DFIA 1IB6A 1I2CA 3I1JA 1I2BA 2PR2A 3IUSA 4W7HA 3OP4A 1EVIA 4RV9A 4OXNA 1ENOA 4KWIA 1U3WA 1ZKMA 3EAGA 4KTTE 4CMGA 1Z45A 4OKIA 2EKPA 1HDZA 4R9RA 1CRWG 3AWDA 5HBRA 3E9QA 3V8BA 3QVOA 3OA2A 4K6CA 3EZLA 4ALLA 3QRWA 4FFLA 1I2ZA 5HTOA 2DLDA 4R16A 1GCOA 4OIMA 1FF9A 4CLHA 2OUIA 5B4VA 1OOEA 4XYEA 5L7YA 3FNEA 3LT2A 1E7QA 2WTBA 2C5AA 3JD0A 4NK5A 2QIOA 3H9GA 5T8KA 3EW7A 2YDXA 4N5NA 1I3NA 1I5RA 1TA4A 2C7GA 3IC5A 3QY9A 4AJEA 2C54A 4PZEA 4EJMA 3RJ5A 2O3SA 3AW9A 1IE3A 3E5RA 4C7JA 3JQ8A 1NPTO 5JC8A 4TRNA 4DLBA 3FCOA 1MA0A 1H6BA 2B83A 4M1QA 2ZJ1A 1U7TA 1YL7A 4BVAA 3DBLA 4CQLA 1CJCA 2PD6A 3TN7A 3PLNA 2YHIA 3SEFA 4IXTA 1UAYA 1ZEMA 5T67A 3N7UA 1N7GA 4FJ0A 5ER6A 1XCBA 2EGGA 4FOOA 4MKXA 2D2IA 3OSUA 5FI5A 1CYDA 1H2BA 3PP8A 2FSVA 4BQPA 1E3WB 5U1PA 3VH1A 2DPHA 4IQGA 1I30A 1X7DA 4RDIA 3JQBA 2GD1O 2DQ4A 2WYVA 4QUKA 1T2AA 3KSDO 2OFPA 5TF4A 4B79A 3JV7A 1SC6A 2QRKA 3UCEA 1GFSA 4NFSA 1YB1A 3SJUA 3PI7A 4YRAA 1YE3A 3PJEA 2X0NA 3WMWA 1X1EA 1EUCA 1I24A 1PGJA 4YXFA 1VRWA 2DVMA 4RPJA 3H65A 2P91A 5L7TA 3B6ZA 3JQBC 1RWBA 1D3AA 1VKOA 2Q1UA 1UXKA 4KUGA 5IFLA 4WCFA 4AJ1A 1E3SA 2VYND 1YL5A 4RDHA 1NNUA 3EHEA 2I3AA 3M2TA 3VKUA 4WECA 3NT4A 2G0TA 1JVSA 3INGA 1H93A 1PL8A 4YJDA 1Q0QA 3JQ8B 3OM9A 3H2ZA 1P45A 1XU7A 1P0FA 3HB4X 4JN6B 4PRKA 2JFHA 1YWGO 1S7CA 3I5MA 4M54A 4BO9A 5EQDA 3KSZO 2B5VA 3S2GA 3DBLB 3HDQA 4JXKA 4GKBA 4ZA2A 3WGGA 1LSSA 2E37A 2E4AA 1PTJA 1LA2A 2JD2A 2ZTVA 4BV8A 4XYLA 4FFOA 1I3MA 1D1SA 1H2HA 3IUPA 4L73A 3CZRA 4DMLA 3WFJA 1LDBA 2AQIA 4QECA 1K6XA 2EW2A 3RFTA 5BSFA 2TMGA 3EVTA 3AOEC 1BHSA 4D41A 4W9NA 1GDHA 3HG7A 3F6YA 1A7KA 3L0DA 5CG1A 4CLRA 3UVEA 2O3JA 1U8XX 2JD0A 3UXYA 4CLEA 4E4YA 4GVLA 3EZYA 2UVDA 3V2GA 2X22A 2P5YA 3GPDG 4NDNE 5I7VA 3U4IA 4MVJF 1ZNQO 4DUPA 4W9NC 1YQGA 1HRDA 4KQWA 4JQCA 4E12A 3RUHA 2CFCA 2NTNA 4WCFB 3RFXA 2HMSA 3NUGA 4A26A 3UH1A 1DAPA 4BNGA 3AUSA 4PLCA 2Q99A 4A27A 1GU7A 3FNHA 1DFHA 1PJLA 1PSDA 1PJQA 3I3OA 4BMVA 1R0KA 1VPDA 5A3JA 1TEHA 4PN3A 5I7SA 4YT5A 4H16A 4ND2A 4DLLA 3MWDB 2ZB3A 5JY6A 3DZIA 3LT4A 3MJVA 4A03A 3ZDFA 3GNSA 3WGOA 2Q46A 4PZCA 4PG8A 4E5PA 2I3GA 2W98A 1GADO 3PJGA 4XA8A 3WDSA 1H6CA 3G1TA 3B70A 4LGVA 5JDIC 1N8KA 2X0RA 3LLVA 1P1KA 4Y67A 4BV9A 1T26A 3NAQA 5LDHA 2D3TA 3MJ4A 3DB2A 2POQX 3I9KA 3S2IA 5A9SB 4W4TA 1SCUA 1ID1A 5T6BA 1PGOA 2HMWA 3LQFA 3GDFA 1DLIA 5DP1A 1SOVA 3ORFA 1M76A 3QQPA 1VSUA 2HK7A 3RIHA 1E7SA 2YW9A 1QORA 4J16A 1LDNA 1XDWA 2O48X 3HB5X 1P1JA 2V6MA 2JKVA 3B20A 1E1KA 4OYRA 3R6DA 3JQEA 2EJVA 4YT8A 1T2CA 5JAZA 4LCJA 3VDQA 2PY6A 2PD3A 2VT2A 1YJ8A 4OM8A 4L4SA 4LN1A 1I0ZA 2O2YA 2YDYA 1E6UA 4WGGA 5JCJD 9LDBA 1NHGA 2D59A 5JY1A 4OKNA 4Y9DA 5G0VA 4LRTB 2NTJA 4E31A 5B12A 1IHYA 4LCEA 2J5QA 3H9QA 3INRA 3VTFA 3IQDB 3WG9A 2OBYA 3ZWBA 4CMBA 1ZIDA 3ZCXA 2J8ZA 2XOXA 2B69A 2OZPA 7MDHA 3LT1A 4FGWA 4DYDA 1MFPA 1N1EA 2AA3A 3AY3A 1LI4A 3BMNA 3HZZA 4G5HA 4J49A 1E7YA 1HF3A 1ZH8A 5K0ZA 3ZWPA 1PS9A 3W4IA 4TROA 4ZN6A 2AQKA 1VL6A 1YO6A 3DHYA 1GYRA 1DC5A 1V3TA 3NTRA 1I3KA 3ZHXA 1O5IA 1OAAA 3OJLA 3GT0A 3WQRA 1J4AA 4BO6A 3GFGA 5I9MA 2Y05A 3KB6A 3E18A 2YV2A 4A0SA 4MP8A 2EF1A 3C24A 4DBZA 5IZ4A 4GX5A 4BO2A 1T24A 4BKPA 4DC0A 1XYGA 5CPFA 1JA9A 4J1SA 1E77A 2CF6A 3CMMA 5A02A 2WD8A 2Y1FA 4I8XA 3WTBA 2UUOA 4GX2A 3VOSA 3G1UA 3GFBA 4CLXA 3PYXA 4U8GA 4NBRA 4CM9A 3RI3A 3N74A 4ALMA 4DIBA 2ZB8A 3FSRA 3E1KA 4KWHA 1PWZA 1Q1NA 3VH2A 1KETA 4PFJA 4GLOA 2YFHA 3TSCA 3PWKA 2JCVA 4FOSA 4FPXA 2O7SA 1UXHA 1B3BA 2V6FA 3WGYA 1NVGA 1XU9A 3WBBA 4AJHA 4NH4A 3TL3A 2HAEA 2QQ5A 4CM4B 4PZDA 3V5NA 5B4TA 5CP8A 2X0JA 5A9RA 4XDZA 3F4BA 3FN4A 5JMPA 1P77A 4J7UA 1Y81A 5CG2A 4ALKA 4KUEA 4IIUA 4KZPA 4Q3AA 1C1XB 1CWUA 3Q9UA 2R2GA 1K2WA 2GUGA 4NZ9A 3DZHA 4TVOA 2C82A 4N5LA 4BNIA 2FSSA 4CM5A 1ZK2A 1CETA 4URFA 2PKRA 3WMXA 4YB8A 1JWAB 3Q2KA 3MJCA 2J5RA 1D7OA 5TT1A 3U9LA 3NDIA 3DBRB 4AJ2A 2O4CA 1YH3A 4WPGA 5I7FA 3UFXA 4TKMA 5BR7A 2P9EA 1NVMB 4S1VA 3ROKA 1DRVA 4J90A 2Y1OA 3KXDA 1BWSA 3X2EA 1DB3A 3SX2A 2W2KA 1T4DA 5JO0A 1DBVO 5KNLA 1SOWA 4M86A 1ENZA 3WIEA 3RUFA 1C14A 4HV4A 5B1YA 1E3LA 1O8CA 1U9JA 1H5QA 4CMHA 1YL6A 1FK8A 1Q7CA 1R12A 4MO2A 2A9FA 3ZV5A 2D1YA 3BHJA 1A4IA 3LYLA 1XHLA 5AVOA 3IS3A 2Y68A 3VPXA 2PH5A 1KVQA 1YGYA 1AUPA 2DUWA 3DBHA 4FW8A 2Y0DA 4RZIA 3V1UA 3UCFA 1YBAA 5KKAA 1KVSA 1A9ZA 4CQMD 1F8GA 4I1IA 4CMCA 2QX7A 3G79A 1U4SA 4FJ1A 2F1KA 3JQ6A 1KEWA 1KVUA 3JQAD 4OSOA 1Y7TA 1R66A 5L95A 4NU6A 4UVIA 3D4PA 4NFHA 3KSUA 1ADFA 4CQMA 1JU9A 3GG2A 1GL3A 3ZN2A 1Q2XA 3O03A 4UVHA 4D45A 4I9NA 4BGEA 4YJGB 1Q0HA 5F5NA 2CD9A 2RHCA 1BG6A 3PJDA 1AGNA 1T1SA 2ILTA 2NQTA 1I3LA 2P4HX 3CXRA 1F14A 1LC3A 2ZK7A 1QV6A 2C0CA 1IPFA 3ITDA 4W99A 3ZHYA 1CF2O 3WJ7A 1F0YA 1HLPA 4FBGA 4F6LA 3ONDA 4K9DA 4NI5A 4KUHA 2JD1A 4JNKA 3GPIA 3BHIA 4Q9NA 2W2KB 4Y6SA 1BW9A 3KOUA 5JCXA 3KM0A 3AFMA 3DL2A 3GRPA 5MGBA 2ZJ0A 2YQ4A 1KBZA 1CERA 1Q0LA 2UV8A 4NBUA 4BKOA 4F6CA 1M6WA 4IZIA 3JYNA 4BB6A 3L4SO 4PG7A 4ZVVA 4RF3A 5ICSA 1N9GA 1NPYA 1LTHR 1OZAA 5JBIA 4J2HA 4YTEA 1ZCJA 3CZMA 5C37A 3NT5A 2CUKA 1QKIA 1G0NA 1MX3A 3DEYX 2HQ1A 3HWRA 4JX8A 3DOCA 1H9AA 2YHUA 2QG4A 1TLTA 4YT2A 1V8BA 3WWYA 3ETGA 1PU2A 2JFGA 2DU8A 4LSMA 2XPCA 1E0DA 4WEOA 1LQTA 2B4RO 3GDOA 3ZV4A 4UVEA 3KTDA 5TGDA 1UH5A 1M75A 4FFRA 4CUJA 5JDCA 3H8VA 1NQ5A 3BTSA 5KWEA 4CM6A 3ADOA 1LSOA 1IPEA 4E21A 1OMOA 3WX0A 3BMOA 5TJ9A 4JJIA 4I08A 3ZHBA 5TJHA 3DTYA 5K9ZA 7ADHA 5DNAA 3QWBA 4ZQEA 5IXSA 3QE3A 3Q9NA 5JDCC 5JO9A 4QX6A 4OSPA 4FS3A 3C8MA 5EL0A 2IXBA 3AI3A 4CLOB 1XA0A 4IXWA 3EY4A 2FN7A 4OOFA 3OA0A 1C1DB 2PWZA 3DDNA 1IUKA 3F5QA 3KV3O 1LSJA 3DC2A 4R01A 1ARZA 1HDCA 3PDJA 1WVGA 1DEHA 1SPXA 2WE8A 3GA0A 1HTBA 1O89A 2J6IA 4P4NA 5KIAA 3KYDA 1SNYA 4M87A 1PZEA 3TQHA 1WW8A 2YYYA 3Q11A 3WIDA 1V3VA 3I6QA 1FDWA 2FPPA 2PKQP 2ZCUA 3A4VA 3DZBA 3RUIA 2J3IA 3UICA 4YJHA 4IMPA 1N1GA 3TL2A 2DKNA 1P74A 2CVZA 4G81A 5IN5A 4QEDA 2ZKLA 5GMOA 3RC2A 4HFMA 3I9MA 3HDJA 4KOAA 2DFVA 2V6BA 1LLUA 3LZ6A 5COBA 3OJOA 3QVTA 4Z0HO 3BMOB 1ZW1A 4F45A 4GQAA 3H5NA 2Y67A 2P9CA 3TPCA 4IUYA 4M8SA 4I5EA 3GGPA 4R54A 1X13A 1N92A 4JP2A 4BB5A 3RC1A 2I65A 4BNUA 1GPDG 1O94A 1UJMA 1DIBA 2EP7A 5L40A 2HRZA 2OO5A 5ILGA 4I5GA 3GGOA 4MP6A 5G4KB 1NTOA 4BGIA 2NADA 4NJOA 2ZYGA 3UGKA 2BHLA 3ZWWA 3OF2A 3T4XA 2IEBA 4AJNA 2X6TA 4RVFA 2PGJA 4CMIB 2A35A 5CDYA 4UREA 4MVJM 1YXMA 1Z74A 3WLEA 2G17A 3AY7A 2WJPA 3KYDB 2V65A 2AEJA 3PWSA 2Z1NA 5A1TA 4EGFA 3QLJA 4ZGWA 3C1AA 4QSMA 1HSZA 3NEPX 4Q39A 4IDAA 4FB5A 3SBOA 3K30A 1PX0A 1VJ0A 3QVXA 1Y9AA 5FF9A 1NHWA 1R4MB 1S6YA 1TB4A 3HE3A 3ITKA 2TMDA 4FCCA 1GUZA 5EQFA 3UOGA 5BSEA 3OJEA 2CVOA 1WZIA 4K1LA 3ONFA 3WR5A 1NFFA 3RWBA 2YZ7A 1D4FA 1A72A 2DBZA 3BYZA 4XR4A 2B4QA 4E0BA 2Y1DA 1QRRA 2I76A 1O95A 4JROA 4R9SA 4WLOA 3TJRA 2E6UX 1NWHA 4YJFB 2DFDA 2VHWA 3F5SA 4DQUA 2GN6A 5G0SA 3JYOA 1IZ9A 2CF5A 3O4RA 3GN2A 1KEPA 4KDEA 1C0KA 3ZWNA 3ZU3A 4EI2A 3U49A 1J5PA 5KJFA 3P2OA 4MVJE 4J4TA 1ZSYA 4IGFA 4O59O 3RBVA 3PQDA 5CAEA 2YUTA 1BRMA 4UULA 4P8RA 1EEHA 4RVUA
chains in the Genus database with same CATH superfamily
3RS7A 4HS9A 3R5HA 4G07A 1A2BA 2QYHA 4GPAA 3HSSA 3JTEA 4FQ5A 3SYKA 3ZWDA 3LS2A 1GR0A 4FYXA 4X1OA 3V7WA 2RJ3A 3ANMA 4OU4A 3NTQA 2YOHA 1BVHA 2FUNB 2GDZA 2Q8QA 2ZQ5A 1EHIA 2CSXA 3AVXA 1NXOA 2IWHA 2D0DA 1QC5A 3LX6A 4GKKB 1P4RA 3FVQA 4C0BA 3EA0A 1JIQA 5C34B 4D42A 4RPCA 4EABA 3PC2A 3ZR4B 4KV7A 5HGJA 1FYDA 1V37A 1GVHA 5FBVB 1N77A 4BCCA 1YQWA 4EJ0A 2WRZA 3KTFA 3FCUB 5D8DA 1N2CE 5SV2A 2PQ2A 2VNJA 3GEGA 3L1VA 2WJGA 3AMVA 1SIBE 1QH8A 1SC3A 3OZCA 4BQIA 1E2BA 1QONA 3AVOA 2EKQA 3I6IA 4GMGA 4BLUA 2ZZNA 4KXMA 2ZJ4A 3N7TA 2XMRA 4KQ9A 3ASUA 3BZBA 2WIGA 2WYIA 4FZRA 1PGQA 3VPGA 5L45A 3OE4A 4ITVA 3DR3A 4KIUA 4P3XA 3QF7A 4GYKA 3AEXA 3GJ8A 1C3OB 1W46A 2VKQA 4JOSA 2I3ZA 1U2DC 3GYGA 1WTCA 1RHUA 4ND3A 3IO5A 2XNDA 4RKYA 5J2TF 2IX3A 1JXOA 1NBMA 4QPPA 5AOAA 2HCFA 2JI4A 1JBEA 4E6PA 3D0KA 1DWPA 2OGTA 2DC1A 2H5JA 3OE7D 2I3DA 3NQ41 4XM0A 5A3SA 4FCVA 1JKFA 4P4LA 1QVRA 2Z2KA 3N8DA 3VVCA 3UWOA 2UZIR 3K70C 3R5FA 4M99A 1O9BA 3C8HA 5GOTA 3B13B 5CAEB 5DXAA 4KEAA 2X19A 4B2YA 2RB5A 2W37A 4RWEA 3RTCA 6REQB 5J23A 4WZZA 2WG1A 2VG8A 3OOHA 1UP4A 1MOPA 1ANKA 2BGLA 4N9WA 5DLYA 1DAGA 5EZYA 3T7JA 5EWMA 4PBSA 3WDLA 821PA 5AIBA 3DOJA 3KSMA 1R6AA 3C7KA 4PLFA 2YV5A 5H59A 1CUCA 1S5PA 4EYKA 2R00A 2YVAA 4QTTB 4YRFA 5H1YA 2HW8A 1V3UA 4X6YA 3S68A 3T6KA 3JXEA 3U7EB 4BMSA 3O4GA 4DMRA 4LRWA 3QOFA 5DHRA 1UJNA 4W9MC 1II0A 3GJSA 4ZHSA 5H70A 2PUVA 2HLDA 2BTOA 4FT4A 4LBVA 4IG9A 3FNRA 4RW0A 3NCHA 5B1EA 2BHRA 1YQUA 3S2EA 3ABSB 4LF6B 1WLSA 2QAGC 3B38A 1K8XB 2O3QA 3LBNA 4DIFA 5BSWA 1QHHA 2OYRA 1OUMA 4KSYA 1RXYA 4E2XA 2HA6A 4NICA 3NS7A 2GQ0A 1JAZA 2QZPA 1SZJG 3M5CA 4TYNA 5MGBA 4RULA 4JLWA 4M1KA 1LDEA 1JKMA 1T2DA 1M73E 5FTJA 3R7LA 1L5HA 4FINA 2W2VA 3ENNA 3QNUA 2ACKA 2FOLA 2MTBA 4A15A 1FTWA 4AB1A 1J9EA 2IXDA 2QN1A 4CRWB 3NVMB 4BO0A 4DIOA 3FG9A 5ITSA 1TF5A 1EK6A 3JU3A 3O4JA 4LDPA 2HXYA 2AXNA 2PX3A 4H15A 3E27A 2ZYAA 1N2SA 2WOJA 4J0CA 2QPLA 2C4MA 1M7BA 1NLMA 3M81A 4FT2A 3V9PA 5SZKB 5KOIA 3D7LA 1KDZA 3EQ8A 2A9PA 3HCEA 4EDFA 1U0FA 4RABA 4IWXA 4GOXA 2AXPA 2IXFA 2GCOA 1VJ1A 2VZ9A 1IZ0A 1M8PA 2RCNA 3L06A 5ILOA 3OIVA 4YMSA 2B9VA 1N57A 3JD1A 3WGQA 1Q1GA 3DQZA 1YDEA 3UG6A 2HV9A 4D3SA 3PK0A 3F7OA 1MVNA 2Z56A 1LU9A 1U5BA 3INTA 4HAXA 4M6WB 3WRWA 4EMBA 3QEBZ 1TU3A 1I9GA 1ULSA 2JLBA 2OSVA 2D5BA 4I4IA 4LUCA 5AI5A 1EVJA 4MPPA 3M6UA 2DPLA 4W8HA 3HYTA 4Z0PA 4J6EA 3NHRA 5ECWA 3W4KA 4YYEA 4AULA 1KJZA 5F2OA 1B3RA 2CNKA 4CF4A 3PHIA 2FQWA 5FLKA 2Z2IA 4LGCA 1T0IA 4RE5A 4FR2A 2WHXA 2HZBA 3SZ3A 4JI4B 3GVHA 2UZ1A 2LPMA 2JCBA 1OX4B 4B6PA 5A9SA 3GMDA 4F1WA 3PHLA 1PTJC 4EO4A 1PL6A 3PDUA 1W93A 3UB2A 2CVFA 4JC5A 2B2XA 4XQ9A 3U56A 2CXHA 1FSPA 3JRNA 4GW3A 2G06A 3FDZB 3DHVA 3L9XA 4M76B 3GLRA 4CDGA 3D3QA 1SCDA 1GZDA 1UUFA 4PO1A 4QXQA 4D3ZA 1CUEA 3EX7C 4JC0A 1J1ZA 5TDHA 3LBAA 1QMGA 2I33A 4LJLA 2BJHA 3OIUA 5HA5A 3NUQA 3OHSX 1ETHA 1MA3A 1QHIA 3NHYA 5JISA 2O19A 1HZZA 1CB7A 2BCEA 2C98A 4LHWA 2NXNA 4II3A 1E59A 1YJCA 1F4PA 1VTKA 1Z88A 2ODQA 3I37X 3K8OE 1CR2A 3BRCA 4XWGA 3VOBA 3VU9A 3FDXA 4CI0B 2GEBA 1HK7A 2LWIA 4GGPA 4YGYA 3THXA 4V1CA 4M0LA 2XLCA 4B79A 1A95A 3HZRA 3AHIA 1WEHA 4TTAA 1N6HA 1EM6A 1DELA 1Y89A 2DOKA 3DVLA 5HDBB 3KWLA 3M89A 4MJXA 1KI1A 4AG3A 5KZMB 3E22A 4GVPA 5BV0A 3TOZA 2CE7A 4GOKA 1ZK3A 2YFQA 4MKGA 4CKEA 2CLKB 1JR3A 1ONNA 1T91A 3KJFA 3QWHA 4H0FA 3S29A 3H4IA 2PKYX 5DH9A 1R9GA 2NTVA 4HS4A 4MGEA 3K53A 5ES3A 4MMZB 3RVSA 4WZAB 1VIVA 2QJFA 3DCIA 1FFSA 3L1UA 5AXAA 1RRMA 3KQKA 5KJCA 1HMYA 3VKHA 4G0XA 5THKA 3N3BC 3IOYA 3PPWA 4FMBB 1KOLA 1G55A 4L27A 3VJRA 1GQFA 3PFKA 3X1YA 1Q44A 1N3LA 5LCXA 2H08A 3JQPA 4HDSB 4L75A 1UZUA 2QY9A 1KSFX 4KTVE 1YRBA 4RPIA 5JSZB 1TMKA 2I99A 5JTUA 2IKQA 2XRFA 5FR1A 4AIIA 5BMVF 4PIVA 1KZ6A 4YRGA 2H17A 3Q85A 2VK2A 5AVZA 3N2GA 2Y8EA 3WQQA 3P4YA 4C0HA 2AFIA 2O14A 2PBFA 3AESB 3AQIA 1MV5A 5I4IA 2VDUE 4DG9A 1H6DA 4YP0A 4DADA 3UJ3X 2IKSA 2QD3A 4BTVA 3FZGA 4BVJA 1M2KA 2PG3A 3DOFA 4XJVA 4AMVA 1L4EA 1XVUA 3EXIB 2P5TB 3EEFA 3LKVA 2LUOA 1PUXA 4X1KB 3RHSA 4J16C 3GX1A 3ZZ0A 5BRAA 1BQEA 2W90A 3R7WB 1YFJA 4UEQA 4ARSA 2VDOB 2VBFA 1PIWA 1YRLA 1LKZA 3JAKB 2GCNA 3L8DA 3QM1A 3T9CA 4DMGA 3JRXA 3H0CA 4RY9A 1BVRA 2IPMA 3TNLA 4CM4A 4CJXA 2VWGA 4DWJA 2O1WA 4BVEA 5CX4A 3Q3CA 4NQZA 1LQUA 2D2XA 4L4RA 2QNIA 3E5HA 4R41A 4UHKA 4AK9A 5A0FA 5U4XA 3SQXA 1P73A 3AHFA 1K5GA 4KVFA 4DDUA 4PPGA 3IE0A 1VBNA 4GEKA 1UBSB 2XOKD 1DHTA 2A1UB 5BV2P 1QKJA 5DWVA 3ZI0A 4G2NA 5IARA 1OWLA 2JB9A 2PO5A 4X20B 3NWPA 1OLXA 1WCIB 3A31A 1IN1A 3I23A 4UHDA 2YZ2A 2EFCB 5AJXA 5MN4A 1PT7A 1GSHA 1QR2A 1JBQA 5B1SA 3FYSA 3DBRA 3NGXA 5KMGB 3VR1A 1RU3A 2JDIA 4U7GA 3CEJA 4U7PB 3ZNPA 5F73A 1BH6A 3KJXA 3HKBA 4R2WA 2IEAA 4P54A 2OOSA 5EUQB 1HYHA 1Y5MA 2GNOA 3F8WA 4ISCA 4BP1A 5IVKA 1CJUC 1F0PA 1G1AA 4IPTA 5J4KA 1ODFA 4PM4A 3OWHA 4X3CA 2AKEA 1KC3A 4PXAA 1MLDA 1QG2A 5K2MA 3S27A 5JFGA 1JR2A 4RELA 3O3CA 1SUAA 1V1RA 4IVNA 4IYJA 4UBKA 1W88B 3K2EA 3KYBA 2G5CA 4YP6A 1VP3A 4F92B 5JRJA 1FDVA 3NM5A 4Y2UA 3THWB 3W3AD 1NXQA 1NVXQ 4M9RA 1UDRA 3JASA 1ZH0A 2IYVA 4BQSA 2X76A 2YINC 3D3WA 4ENRA 1W47A 1LPPA 3A9RA 3ZU5A 3MJFA 3EZ9A 4B31A 4EJSC 1RKXA 2NG1A 1ACMA 2P9GA 2J9ZB 4HDQB 1RKQA 1U7PA 1WS6A 1KPGA 2WFLB 4B2PA 5IDWA 2QX9A 4XQ0A 3T3MB 1VLJA 4M49A 3GAFA 2OO3A 3ZZUA 3QX3A 3U7QA 4B32A 4YREA 4IFBA 2QTNA 3ESQA 2AC2A 5JG7A 4PFSA 2O4UX 1V7CA 4CW7A 1BC5A 2PSSA 4RGYA 2DPGA 3RG8A 1BX0A 1GZ3A 2X42A 3I73A 2JZOA 2IV2X 1O96B 2E82A 2EBUA 3I6MA 4MV4A 3V2HA 1H22A 2WUVA 3W1WA 4NK4A 5HFNA 4YRJA 1RYDA 3IXQA 5LJLA 4LV6A 4HWOA 2BMDA 1CJVC 3OUZA 5TY0A 2AJTA 1PVOA 2ZRMA 5JYDA 4HAUA 2YMLA 4UBLA 3SE0A 1MQSA 4FWIB 2FSPA 4HLUC 3SYLA 1TJNA 4OXIA 3E9NA 4MUEA 2GN4A 4POOA 4YLYA 3TBFA 1UBLS 2DRIA 5I9IA 5E2BA 2RK4A 4EA7A 3LQ2A 1G5QA 2DJIA 2IDZA 4ARAA 3SC6A 4X1IA 4WL0A 3G8YA 5EYPB 3FTEA 3AEKB 4DQDA 5I5EA 4KR0A 4OX9B 4FMDB 3NBZC 4UCQA 4B0OA 5DHPA 1E6MA 2H7VA 2H7CA 4UJ5A 3RANA 4IUDS 4Q82A 4CUZA 4FGUA 1UPBA 4UMFA 5AI8A 3C87A 3WRXA 1P7PA 2HBZA 4N18A 4NDAA 1OB2A 1IOWA 1QLJA 1Y5NA 3OT1A 3R1IA 1J06A 1RM4A 2CJYA 3OE7A 1UPTA 2A5LA 2OHVA 3B36A 3KDPA 3FI9A 5ALGA 2JBWA 1NZFA 1ST3A 4P35A 3BBLA 3L40A 4O2BF 4P82A 1SCJA 2MYTA 5TQVA 3WBFA 4GWGA 2FWMX 1QGED 1NXXA 1H66A 3GZNA 5TPWA 2R7AA 3L8ZA 4M38A 2RGRA 4BPBA 2CHGA 3A2LA 3UHPA 5BNTA 4NMHA 4YBZA 1IWBB 2VVTA 1TAHA 3LBYA 5CXUA 3E81A 3P0HA 4RZHA 2H31A 5T6MA 1IZ8A 3K0AA 5B64A 2EV9A 2JGLA 4NR0A 3LFUA 1P4JA 3W8FA 3SQWA 1PR5A 4ND4A 2HBYA 4AN4A 3PVCA 4QTYA 2QI9C 3VNQA 1NF9A 2F7SA 1PQ4A 2HV8A 2Q5QA 4ID9A 3CB2A 3IKTA 4Z4QA 5LOVB 4NE2A 3O1LA 1CUGA 1JQEA 3QFRA 3K8QA 1FX1A 4M4SA 3SMVA 4IZHA 2XZTA 4GM0A 4EUHA 2NU6A 2GZ2A 3Q2OA 1XZPA 4UVDA 1M1XB 2ISQA 3NPMA 2YWJA 4HN2A 4LDNA 4KO3S 1XN1A 5FNVB 3VZDA 1U5CA 2E1RA 1DBIA 3UMMA 1JEYB 5IU6A 1MEJA 1SVWA 1BNCA 5H81A 3SBDA 4E2FA 3PEWA 3I61A 4JI0B 5BN3B 3G5TA 4IAOA 1R10A 3NTXA 5GAJA 2EJTA 3NOVA 5IBPA 4OXQA 3SOPA 3BWYA 3WGHA 4CLOA 4P9NA 1TAQA 1KORA 1U1FA 2VJAA 2R4TA 4OB6A 1F7VA 2V4ZA 2MSEB 1DSSG 4M60A 4GRIA 1MW8X 3BK2A 2V9CA 3K0KA 4BQQA 3JVUA 5FWYA 3EVCA 2YY7A 1WETA 3TKAA 4NYJR 3RFCA 1DGQA 4KREA 1WDLA 3PT5A 4Q1EA 5I7HA 2OM6A 3KB2A 3UAOA 1W76A 2LP4Y 5GJBA 2VOJA 5J2UA 3KLNA 1BYUA 4RK0A 4OBBA 3PIDA 4HX9A 3ZIAD 4H7FA 5IANA 1Y80A 5BSKA 5DGIA 4EEZA 4R31A 5KX5B 2WSSA 3C6MA 3PRJA 4QPJC 5KVQA 5IN4A 2OCIA 5TARA 1QHEA 4XIJA 4L02A 1WZ2A 4WDQA 2JVJA 2VCEA 3UJHA 5FTWA 2IF2A 2WFAA 2WDZA 5LA6F 4RPLA 4OO3A 3DT8A 2G7MC 3RAGA 2NIPA 3B48A 5TMEA 1VI2A 1TXGA 3H5IA 5AUPB 1OBFO 1TYCA 2PWBA 3A6LA 4U2EA 5EC8A 3UJ9A 3JQCA 3UV3A 3AF3A 4B34A 5DK6A 2Z2ZA 3VR6H 1Z07A 4JHXA 4DR6B 4P34A 5HKKD 5ICEA 5B4UA 1UK7A 4ZAGA 1II9A 1NLZA 2NPIA 2Q8NA 3A70A 4WBXC 1A9YA 3QU4A 5CMLA 3KQMA 3N2YA 3C7DB 4AMGA 2FX2A 4OFWA 4CR7A 4TYWA 1SULA 3I32A 2I9PA 1W4CA 5HSGA 1SHJA 4IIVA 4EW3A 1WUIS 2F6RA 1EGAA 2X1MA 4YDRA 3WSTA 4TZ0A 3GN1A 1X94A 1ZOLA 4LDZA 1H4QA 1GAWA 3E5MA 4LGYA 4AJJA 4V2UA 1N6KA 1C0IA 5DM4A 5AVUA 3GQBB 4PHCA 1E1CB 1Z7BA 5K8VA 2C07A 3MLAA 3HQ4O 3ED1A 1ZK0A 5EJFA 5H7XA 1SXGA 1ZNXA 4RLHA 4JGIA 4J03A 2VPTA 4MV0A 2GHQA 3SN6A 4C7MA 2J9FA 2RBGA 1P4HA 4Q00A 1EFPA 5TT0A 3QELA 2YQZA 4P0TA 4V02A 4DV6B 3EIFA 3M34A 2GESA 4FWBA 4KK3A 4NEQA 4P3YA 5E7IA 3H5VA 3S55A 1G3MA 2PQMA 2FPKA 5EWLA 4B3JA 3INYA 4PC3A 2VH2A 1QCDA 4DT1A 2F48A 1NULA 3R23A 3BMQB 3N0TA 9ABPA 1J8FA 3DXXA 5K01A 3CWCA 1VG8A 3N58A 4AD8A 1P44A 5IUJC 4C7VA 3R09A 3BAZA 3O74A 5K0BA 3N8IA 3DEHA 4EBFA 3F73A 1XTZA 5K2OA 3DVQX 5I7RA 1BGVA 1FU8A 1CZRA 1OFIA 1D2CA 1F4VA 1NDHA 1PD1A 1JTVA 1KDTA 3H2HA 4KODA 2A6PA 4P86A 1K4KA 2OA0A 3VUFA 3WLTA 4D46A 2H8KA 4ZYUA 4GL2A 3OQ1A 2II6A 3MBKA 3F46A 2RE8A 3NBFA 4QIHA 3UB3A 3RAJA 4QEKA 1JJBA 1L7OA 3BF8A 4GM4A 3OPYI 3GHHA 4KPGA 4E51A 1NV9A 3K71B 2GASA 3A58B 4DLXA 1TD1A 3QWAA 3TSAA 3Q7SA 4CFYA 1JAYA 1NC1A 5CFPA 1M5RA 4Q05A 2UVQA 5GJVC 2XGMA 1JLHA 3R5XA 1JKJB 4JHLA 5IMBA 4PQYA 3KWFA 5AM0A 2QQFA 4WTOA 2FSGA 1DXQA 4ACBA 1MC8A 3NANA 3RK1A 4A8TA 1PV2A 3KPJA 4CG1A 1NI3A 3O84A 4XB1A 2JAXA 1YFZA 1U4OA 1RABA 2F1IA 4YCMA 3MILA 1JE1A 3RIXA 3VZBA 1TQ6A 1A77A 2QZJA 2WIAA 1E3IA 1LNZA 3LPAA 3IR5A 2CXPA 1JQDA 2Q21A 4B44A 3RGGA 1Q77A 1D03A 3A6FA 1OFUA 1YIOA 4YLEA 3R4VA 1DCFA 3QU9A 4UTVA 1QFJA 5SYNA 4MVJP 3MB5A 3FNFA 1IHPA 1Z0AA 1VKJA 1PR9A 2F17A 5AKLA 2X8LA 3E5NA 3WLHA 3TBKA 3ZLUA 2A9RA 3EVFA 1GCUA 3L4BC 2W6NA 1GPLA 2JS7A 4JLKA 1KVRA 2LDXA 4PF1A 5C5IA 3GMTA 4X3OA 2WF6A 1RE0A 4P81A 1JS1X 4HQOA 4OQ4A 3EEOA 1NG1A 1ZONA 5MDHA 4B46A 1E0KA 1E5QA 2ZBDA 1UL1X 3EDCA 1LK5A 1C3OA 5E0KB 1RWOA 1ODTC 2GEJA 1P8AA 2GA8A 5GM2A 3PWZA 4LJAA 3HBNA 4V0OA 3BJZA 4M55A 5KNBD 1ZC3A 2QX4A 4RLSA 2ZRQA 3DAPA 4UNSA 1V43A 1QIKA 3FY4A 2ZYRA 2GVDC 4IV8A 4DGQA 5BR8B 1EFLA 2NT4A 4MUAA 4B71A 4EM6A 1JL3A 2RMKA 3MZ0A 3PR1A 4Y18A 2L2QA 3RSOA 3E7FA 3FWPA 1N3IA 4REOA 3RUDA 4HN4B 5ALYA 2WIKA 1JT9A 2P9ZA 3A3KA 4MEAA 1FDUA 4QPCA 1D2MA 4BLWA 4MDEA 2JLSA 1XQXA 4GGOA 4FM9A 2XCIA 2JJMA 1T6ZA 3IODA 1WCYA 4H7KA 4FYIA 4MUGA 3C3XA 5LMCA 4BTEA 6REQA 2BF4A 3HVRA 1JFTA 2GPYA 3FWHA 1SUCA 1WG8A 3OMLA 2GO1A 4J1QA 5C7OO 5JADA 5EIXA 3W3AA 3NHWA 4ENWA 1BDMA 1FVHA 1DUVG 1RRVA 1YAJA 2DQSA 2IYQA 2XUIA 4M0FA 5LZ4A 4QRHA 3W5IA 1A2QA 1CFJA 4B35A 1QOQB 2DWCA 2B35A 3R6TA 4RV4A 5GZ3A 1KYWA 4NDZA 1RM0A 3L0OA 3RC3A 4DQ0A 4H1TA 3TR0A 2HFJA 3PCRB 1SBQA 4FNGA 1UAGA 2N1MA 4E11A 1P9RA 3OPVA 2Q4RA 3ONEA 1LLQA 3MBIA 2FQYA 4RF5A 1JTFA 1ZCAA 1I0LA 3IYLW 1NYTA 1J25A 1I6KA 3TW8B 5K3OA 3R9XB 3OIFA 2NP6A 3BCRA 5IW8A 2HIGA 4S05A 4AWBA 1P1RA 4KXYA 4XB6B 3WK4A 4MWSA 3RC8A 4D0RA 5JAPA 3LPCA 1Y4AE 4Q7EA 5FI3A 3U5TA 2C7VA 2IYUA 1SAYA 3RABA 1R0WA 4KLAA 3TQFA 5KB3A 3CZ9A 3BIFA 4ENTA 3KT3A 2PRZA 4JWTA 3HL0A 3GPBA 4RTRA 3HR7A 1Y63A 3K5WA 4TT3D 1C0LA 1RNLA 3TCXB 3HXOA 3F2VA 4BMZA 4WKBA 1Y8RB 3QFTA 2ODNA 4D98A 3NP7A 4PEVA 5F1YA 5GADl 2YOFA 3DLTA 4IF6A 3WAGA 2CDBA 1DUIA 1E2PA 4Z9FA 2NSJA 1HDGO 3QVVA 1GKYA 3QU7A 3O38A 5EP4A 4F56A 3D3KA 3IEPA 2PUWA 2HSJA 3LVBA 1NM5A 4X1YB 3M3DA 3WGJA 5ICMA 4L5JA 2ZUFA 3BMCB 4LPSA 5BY2A 3TMAA 2D06A 5KNDD 2IBTA 2GYUA 4E22A 1GGMA 4JR2A 2B8JA 1Z83A 4KR6A 1KAGA 1TQ4A 3I4CA 4M6WA 3SC2B 5G4LA 3T5BA 4ZYVA 4PCAA 3TEFA 1RYEA 3CR3C 1N8TA 2H06A 3LZCA 4WLUA 1UJCA 4LWQA 4PLTA 4XD2A 5B1DA 3W2TA 3BUSA 1D8TA 2G76A 4QJ3A 4F3YA 1L5YA 1KF0A 1NVDA 1RWKA 1ZJZA 2ECFA 2H5EA 2I1QA 4ZGGA 3HTXA 5ALIA 4C7OB 2UUAB 1U8FO 2JGFA 1L1EA 2OD7A 2QTGA 3KLMX 1M0SA 2NOAA 5E9AA 4BNHA 4BO1A 3SIRA 2HT1A 5JROA 4AG6A 1F51E 3ANLA 1OX4A 3ZNOA 4G0PA 3G8CA 2Y1CA 1A8PA 2RB4A 2VIIA 2FFBA 5K8JB 1URPA 4I6EA 3S7ZA 621PA 3H1BA 1LY1A 4K2AA 4KH0A 2EFYA 2PX0A 1R88A 2GRJA 1JEOA 1NQWA 4L5BA 1IOZA 1YZKA 1XTJA 2SECE 3QEKA 3FDZA 2G1UA 1T9AA 1Z5UA 3HADA 1E7MA 1V4NA 1K7EB 1U2RA 2LDBA 4G4SP 4JBGA 1VGRA 1WHTB 1EIZA 3MT8A 1UP7A 2AS0A 2I0FA 4FQ7A 2Y1LA 4QG3A 4GMXA 1JPNA 4I9GA 2N0SA 2IZ0A 3LLSA 4DHWA 2PFGA 5BOVA 2C3OA 2JCXA 3PNKA 2M6LA 4MGZR 1DOHA 1XDZA 3LFHA 4L1KA 2H1CA 2BI4A 2X2FA 3I5XA 4E5KA 5JIBA 5ALSA 3U0VA 2Z09A 2Z4TA 1E1DA 1LRKA 4TOIA 3P0EA 2IUUA 1Z73A 3VOAA 2JFOA 3BVPA 3CG4A 2DTXA 1YQXA 1AZSC 2IZ5A 3PFHA 1FW8A 4B3IA 1M67A 1NL3A 4QODA 2WNHA 1W94A 2FZWA 5EJGA 3W05A 5KSWB 1NXVA 3ZJTA 4B87A 1IZ7A 3WADA 2XWPA 3OJCA 4FYHA 1HE3A 1SVIA 4YA6A 4O4HB 1ZOOA 4UAGA 3AHDA 1QYVA 1KFEB 2EXXA 2Z8YA 4XQGA 5IH7A 5CB4F 1U3UA 3LI2A 2FPWA 3GJXC 2A7QA 2HPZA 1LBEA 1B8PA 3OZRA 4MR8B 1V1JA 3FGZA 3MPOA 3KU1A 4JYPA 2F3UA 5AKGA 2BI8A 4BYMA 3OZSA 1L2TA 1RWNA 3KT8A 2ZIEA 3OX1A 4LRUA 4UHCA 5EJ2A 3IP8A 4C0QC 2X77A 3GEPA 3O31A 2WG2A 1NXWA 1Z5NA 3N5CA 4MV7A 5COAA 4HDSA 2GLTA 2HTFA 2CDNA 2NNLD 4XIGS 2YHIB 1AUQA 4ZOLB 3PE4A 3QE0A 1WZCA 1UF9A 2C9CA 3MWGA 5EESA 1H0KA 4Z6KA 2WQ6A 5IC4A 4AW9A 3WKAA 2AD5A 4NBNA 4F8YA 2GCEA 2JGEA 2EZ9A 2PH3A 1WXEA 1F8FA 3WLMA 5DT2A 3ZE2B 4KI7A 3G5MA 2PKXA 4MV3A 4CM8A 2HGZA 3AESA 4OGFA 1TKAA 4OXYA 3I0MA 4XXHA 4UFOA 4NYJQ 5D3KA 1EA5A 1PFQA 1CS4C 2OAEA 3Q5DA 1FP4A 4B6OA 3EOZA 4TQGA 3EXIA 4UU0A 5AVRA 4WK6A 4X1KA 1ENYA 2GI4A 3OOSA 2EJUA 1EXVA 2CNNA 2F00A 1A7AA 2JAHA 3HB1A 1VHTA 4MKHA 3KNZA 1WSWA 3R7WA 3WGIA 4AQDA 1MTOA 3SQOA 4LXUA 4TXJA 1WXXA 2YHAA 2EKLA 3ZD9A 4DZTA 4DC9A 3LP6A 1RQPA 3BXXA 4OQMA 4QGBA 5JNLA 1QTIA 1QK5A 4BKUA 1EGMB 5A4AA 2AC7A 2O3TA 1KOGA 4PAOA 1TLLA 3TZLA 3V8MA 4JD5A 4R98A 3UMJA 4Q9KA 4HNVA 2H2AA 3IERA 1GD1O 4AVYA 3QE2A 3ZXUB 1E2DA 4HD8A 3OT4A 5F98A 1PYOA 3UXEA 2CFSA 3ANSA 3VH4A 1POXA 2CZCA 1ADBA 2BFBB 2I7TA 1Y5RA 2OB2A 3BL5A 3KHKA 1D4ZA 2VQDA 2NQ8A 3JQ9C 1RHRA 5EOVA 3RFUA 2LKDA 1EAYA 3JTMA 4ABYA 5FBRB 2FUEA 2H52A 2OGUA 3Q0TA 4BRUA 4CQJA 4D99A 5LUAA 3FOZA 1A9PA 1A0OA 2CMHA 3AFNA 3KKPA 4RQUA 2ZYDA 1ECGA 2WK1A 4QU8A 4RXTA 5KMGA 2PIDA 3RFVA 4BFTA 1IY2A 3UTDA 1FTGA 1DIAA 2X0IA 4QTZA 3RBZA 1U8EA 1IY8A 2QTMA 3UKOA 3R44A 2JPDA 1IK6A 2VNKA 1GKUB 1E3QA 4FU0A 1EFAA 1OT5A 1GNSA 3UK2A 4R8SA 3NNNA 2FG7C 3IIMA 5DGXA 5F2KA 3A1UA 3USZA 3ZW7A 1CUAA 3IDSA 1M2NA 2J9RA 1H2RS 1NDQA 2GBPA 2XUOA 3QBVA 3THWA 4QGHA 5AVKA 1PRYA 5AW4A 2JAOA 1PBNA 1U0JA 2C0PA 4ZEWA 4K7JA 4Q15A 3HRHA 4IXMA 2RC6A 3MFQA 4H3KB 4NOKA 1Z4NA 3N75A 3H3XA 4RUKA 3AF5A 1YZ3A 2BGWA 2FZGA 3ROGA 3TSOA 2I7XA 2QTCA 1SY7A 1WUHS 3G89A 5AW0A 3X1XA 4CV2A 4ITRC 2ATEA 1AQNA 3KAPA 6LDHA 4LRQA 3GJTA 5AR1A 3LHKA 1L4NA 2O3UA 1A9RA 4I99A 2JARA 1P3JA 4PONA 1R9JA 2IEYA 4BLSA 5HUJA 2QTFA 3W6NA 1NP3A 2ATCA 2CMKA 3H9EO 4MX8A 1C41A 3X2FA 4N7JA 2NYAA 1IRIA 1BE6A 1IU9A 1K7SN 1U7UA 2NU9A 3Q3EA 4NNPA 4P4SB 1O96A 4QXOA 3N07A 3DWEX 5FUVA 2L69A 3TDKA 4BGDA 4NBLA 2VJPA 5LBUA 1ZI9A 1A98A 2ZVDA 2X8JB 4KXUA 1AKMA 5BWCA 2NXWA 4JS0A 2BBTA 1C7QA 2BVNA 1CVRA 5CVJA 1CU1A 1E61A 2QXUA 4LX0A 3CVJA 4S0ZA 3PNMA 2O0KA 4UDYX 1IUNA 2W4QA 2X9VA 1SUFA 4ZEMA 1WV0A 3HY4A 1OW3B 2JCYA 2FU5C 2X13A 3N7AA 4OBXA 4WOJA 3K5IA 5CLGA 4ZARA 4CT5A 2H29A 4EHDA 3STVA 2ZJ2A 2B36A 1SD2A 5ED0A 1X7GA 3HDHA 2IZ6A 1WSAA 2RAFA 5EYPA 4FTWA 4HAOA 1FU4A 1RQ7A 1W25A 1ZISA 3W2IA 3L18A 2DUJA 4H7PA 1PEAA 4N49A 4ZQIA 1X80A 3FI0A 3FNGA 3RM3A 4ZCPA 5DEIA 4P4GA 1U6IA 3ZBTA 1SBCA 3P9SA 3HABA 4FDAA 4PYKA 4DE5A 1XKTA 4X65B 1PX2A 1G7TA 4EHFA 221PA 1Z82A 4WOKA 3NR2A 1RJEA 1GNRA 1TYAE 2DQYA 1U04A 2NTYC 3JYQA 4O2RA 4PC6A 4QBKA 2DAPA 4RAQA 1W85B 2ZTUA 3MEQA 4G1EB 1DO8A 5BXQC 2JGJA 5BSRA 1GTJ1 3GNQA 4FE3A 3K09C 1HZJA 2WWFA 1LPNA 4YMTA 1P2DA 4CL0A 5LZ8A 1KH2A 3G2MA 3TIXB 1W0KD 5THQA 5LQKA 3F97A 3HU2A 1MRNA 5JAIA 2DLNA 3HJRA 1MT3A 5BW4A 1NSYA 1TKBA 1MKYA 2YC4C 1CF4A 1QH1B 2FWBA 2V7XA 1VKNA 2IYXA 4RK7A 2AMJA 2WJWA 1M66A 4Z1OA 1Y1KE 2QXYA 5T57A 5EJ9A 3SYNA 2FMKA 3SLGA 4UEWA 1MQ8B 3PQFA 1D2RA 4JI5B 1WMAA 3C8DA 3BCSA 4N5IX 1YE5A 1B8VA 5ALJA 4DCJA 5EUBA 3CTMA 4CL2A 4YQFA 5CU7A 4NCXA 2W6CX 1L5SA 3LUFA 2V3WA 3PJFA 2VDPB 4JA0A 1OH5A 3RUAA 3ADDA 2AV6A 2F1JA 2O2SA 2PL9A 3ZGLA 3LVFO 1GNVA 2G1JA 4LOLA 1KJ8A 2QK4A 2BMJA 1YHYA 1PR3A 1LV8A 1J2UA 1JAIA 2O8NA 3HV2A 3CIFA 3OSZA 4KBGA 2LZ0A 4X8OA 3UNXA 1XMVA 4DLPA 5BN3A 4WD3A 2PUHA 1XK7A 3U40A 2WM8A 5CDGA 2GXAA 1A4XA 5EXSA 3SBEA 3L9WA 4Y0NA 3A9VA 1U7HA 1SC1A 4FIZA 1E6KA 1QFSA 4BGUA 5CEJA 5KJ1A 2R6R1 1MG0A 5EP3A 3RGWS 3RREA 5KAPA 4P7BA 4XGIA 5JATA 1UIRA 3SKVA 3IBCA 3KLPX 3VKFA 1JDPA 3OZTA 4WOBA 2GZAA 2HUPA 2O20A 4PQGA 4UW9A 3R20A 2IWRA 4BAUA 4CT0A 1XCJA 5D01A 5LUBA 4TMZA 4BB9A 3L3BA 3UANA 2AWOA 4DIEA 1FPMA 5IMSA 4MYRA 5HUQA 3CZ5A 2J5XA 3PYLA 4YJ2B 3D0RA 5GONF 2FCRA 4ENUA 2RH8A 2VP6A 1FYFA 1HL7A 3A9UA 4AS2A 4IHJB 5ADHA 4KDCA 4ZO4A 2W2OA 1G2QA 3FBGA 2IYOA 4B6EA 4O4LF 1O54A 4B3RB 1DEAA 2YYZA 5FO0A 2CHEA 4MV5A 1KEZA 2ZUSA 4EX7A 2GPBA 1VHDA 2NW6A 3LJKA 1H8HA 4BS9A 3JAMA 4IHKA 4WACA 1ZITA 1FZQA 2VP9A 1T4MA 4Y6PA 3VVLA 1B00A 1QYCA 3W34A 3S2FA 1IM8A 4GOMD 2MU1A 5FOUA 2X1VA 4WXYB 4MGIR 4QLBA 1Z16A 3IURA 2TMKA 4KQCA 1WUTA 1SB9A 4GPTA 1RYHA 5EKUA 3S2SA 3UJDA 5IDXA 2WD7A 1QU2A 4JB0A 3GLGE 1BEEA 1Y3IA 3OPYB 5EMNA 4Z0NA 1FUIA 1I80A 1U5AA 3F71A 2Z3WA 3GG9A 4PTLA 5CM9C 3T9EA 1ZJJA 2H16A 1Z4QA 3FWNA 5E6UA 4JXXA 2VTEA 2ZSFA 1OZFA 4Z1MD 5I8ZA 4XCQA 3GQBA 1ULTA 2G8LA 1V6AA 4L72A 3MWFA 4HO1X 2OC9A 1AXRA 3EEIA 3RVNA 2XCUA 3AR2A 5CT9A 1X1RA 3KP1A 3E1SA 3X1JA 1WZUA 4K6MA 5KPDA 3O2QB 4JELA 4PYQA 1JLMA 2GXUA 1XZAA 3ADPA 3ZV7A 4EW2A 1EPUA 2CL6X 1Z6TA 3HJAA 1NWCA 3U4MA 3NHPA 3U4GA 4TWIA 4ZCTA 1PZFA 2BD0A 1TF2A 2HF2A 2XA1A 2P8SA 4J0HA 5E4FA 1SXJC 4OQZA 4FBLA 4FYYA 4MULA 2IXTA 3KKEA 5E8JA 4OM7A 3DBVO 3L4KA 2DH6A 4Z4IA 1OT3A 2BGIA 2R1VB 3BMQA 4X85A 1P31A 3PGMA 3PHJA 3P2YA 3IP7A 1PZMA 2OWDA 2PS9A 2X23A 1UPFA 2ZTSA 4H31A 3ZZ1A 4YP5A 1BOFA 2GYVA 2XDWA 3HXPA 3B9QA 3NRCA 5G3ZA 4WBNF 2HRCA 5H5JA 5T41A 3OFND 3A9TA 5FOTA 1AU9A 2W11A 3DBHB 4HHEA 1ZJWA 1FS5A 2NXJA 3DQPA 5D86A 1QGDA 1B6TA 4WXMA 1FC0A 1NXPA 3WB9A 5C81A 4Z4GA 1SFRA 3VO9A 2TMYA 4F96A 5E2IA 2YUIA 1WABA 1JEJA 3O9MA 2J1LA 2VWPA 3BSSA 4LOJA 4ZVSA 4BNKA 5KYKA 1XZBA 2XT6A 3BIWA 1K4YA 1X87A 4YLGA 3V7UA 1EE9A 2H92A 1KY4A 2B1JA 2VDWA 3NJ4A 3SSMA 5AW1A 3WSVA 1R9NA 2PNFA 1XTBA 3CCFA 4G5SA 4GVXA 3IR6A 4GZ5A 1EJ2A 1DE0A 4L9AA 3VDNB 4B17A 1AQUA 4DV7B 5JJIA 4R7GA 4CQMB 4AMBA 4MYUA 4IGIA 1JKJA 4OJMX 5C4MA 2HU2A 4DZRA 1RAEA 3QVMA 2G82A 3THRA 5F9FA 5HKBA 1R64A 4RGVA 2I67A 1M5UA 2FW8A 2H9YA 1PGNA 3F4LA 2A0FA 4Z7JA 1N36B 3G0OA 4W1SA 2ZPAA 4HH4A 1M6VA 1RBQA 3UJBA 1NVEA 2YIVX 2AR9A 4JMPA 5FFFA 3V8VA 4Z4CA 2V58A 4FOLA 1KP3A 2FPGB 3B1JA 1FFBA 2B25A 1BKYA 1BW9B 3O2SB 4GI5A 4QFCA 4QTXA 5CD9A 2CLMB 3L7MA 2XB4A 3DKVA 3ENKA 4FEYA 4FJ2A 5EE1A 4V39A 5F78A 4BO8A 5JSHA 3PXAA 4I55F 4JT8A 2HMVA 1DKPA 2WABA 3T54A 4FKMA 4JYCA 2FUG1 5CJ2A 1U2SA 4CM1A 2DFLA 4PLVA 5I8WA 3LLCA 3EIUA 4UNPA 1E2EA 2RG1A 4C3OB 4R2XA 3D7RA 3RWMB 2QRPA 5KHAA 1M1YE 3N6VA 1NKTA 3PCXA 3TI9A 3ACDA 3LLMA 2WWXA 3DOHA 3M82A 1T4CA 5CLQA 3L6BA 2ORYA 3TEJA 4A7PA 1KMHB 4UD6A 3OICA 1GPJA 4RVHA 4TQUS 4B6QA 1DC3A 1XRRA 2JJYA 4QYIA 3T3GA 4CDRA 4EY4A 5BORA 5L4SA 2P2YA 3G5AA 4JB2A 5CYOA 1KA9H 1Z3CA 3L6DA 1K8QA 4B3HA 2XMGA 1JIKA 2F3RA 3IT2A 4ZJPA 3K92A 1PFGA 3LHSA 3QF4B 3QLVC 4DN6A 4DSZA 2WNSA 2DCUA 2QL6A 4DBVO 1UC4B 3UB4A 2J0EA 3DVSX 1O87A 3LC1O 2GMWA 3LA8A 1CTQA 5GGYA 4B3BA 5JNTA 4I1PA 4OQFA 3KRTA 3PVZA 3DH0A 1BMDA 1Q16A 4KPYA 2XXAB 2Y71A 1N2JA 4XIIA 4QKQA 3T1YB 1XNGA 2AZXA 3KQSA 4BEWA 5CDUA 5BSHA 4C88A 1HKHA 3TIVA 1Y4ZA 2HADA 5J40A 3FBTA 1QQAA 4GOND 4Y2PA 4DUGD 3ZBUA 2RKBA 3BXFA 2IW1A 2Q5OA 3PG5A 1GWNA 3RU2A 3MPUA 4KIFA 4N40A 2XAUA 4HDOB 4PCUA 5IKPA 1U9IC 3RPEA 2QM7A 4Z54A 3ACBA 1WXFA 1IDN1 1CZKA 4NU8X 3GBPA 3TW8A 4YJ3B 1NLFA 1Q0PA 2VSNA 3IP6A 3R9XA 2FSIA 3TQTA 3ZJYA 2R4QA 5AQ1A 3OTOB 3ZDBA 2HF7A 2R0QC 1MPXA 5LQMA 1SXHA 1T8SA 2VRCA 1EWQA 1WBBA 3MOSA 3E03A 4A1FA 4HL6A 2QIPA 4UUOA 3CCCA 2OY0A 1C3XA 3BZUA 3O0TA 1L7EA 2PH7A 4XM2A 3UUEA 1QBGA 1I36A 1Y5LA 2HUNA 2RIPA 2WHYA 3GJ4A 3LV8A 4C1NA 4N39A 4BV2A 4J3FA 3TZHA 1VA5A