2XOXA

Crystal structure of pteridine reductase (ptr1) from leishmania donovani
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
276
structure length
216
Chain Sequence
TVPVALVTGAAKRLGSGIAEGLHAEGYAVCLHYHRSAAEANTLAATLNARRPNSAIPVQADLSNVAPVTLFKRCADLVAACYTHWGRCDVLVNNASREAMEAAAADLFGSNAMAPYFLIKAFAHRVADTPAEQRGTNYSIVNMVDAMTSQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLAEVSDVVIFLCSSKAKYVTGTCVKVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Recombinant Leishmania Donovani Pteridine Reductase Reveals a Disordered Active Site.
pubmed doi rcsb
source organism Leishmania donovani
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE
total genus 78
structure length 216
sequence length 276
chains with identical sequence B
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2010-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2xoxA00
4XZ3A 3KSZO 1EBFA 2A94A 2ZYAA 5LDGA 3H9QA 4RCVA 1PL7A 1X15A 1X7HA 3DL2A 1C1DA 3K92A 4JP3A 1PU2A 2E48A 3DFZA 2C07A 4DL9A 3GGOA 4BHTA 2HK9A 3Q11A 1VSUA 1HYEA 3DMTC 1NFQA 1ULUA 3ANNA 3K2EA 4EUEA 2Y66A 4R1NA 4XGKA 3GRPA 4HADA 1DJNA 3FR8A 1ISIA 4ROSA 2XAAA 2CSUA 1LXCA 4YJHA 3S55A 4ILKA 3GGPA 3PK0A 1R4MA 1XGKA 2OBYA 4BNXA 4YT4A 1Y8RB 4CMKA 5ILOA 1ENYA 1LLCA 1U3WA 1SO8A 4A27A 1WAMA 2DBVO 2HU2A 3HDHA 3CZMA 3PDJA 3SJ7A 1NYTA 1DIAA 3PTZA 3HWRA 5H83A 1BXGA 5IDXA 3E03A 3SBOA 3O4RA 3GAZA 1K89A 5G4LA 1LNQA 3E8XA 1YE3A 3OIGA 1X1EA 4FOSA 5DOZA 5IFLA 3IMFA 5AXDA 1UZMA 2JD1A 3KRTA 5AVOA 1U2DA 3A1NA 4LSWA 3F5QA 3V1YA 4PLYA 3OA2A 2O3JA 4II3A 1BMDA 4DMLA 3QWBA 3BTOA 3V2UA 4QEDA 4BNFA 4GSLA 1WP4A 5AXCA 4NQZA 2AHRA 3D3EA 4XGNA 3DB2A 3H2SA 5TJHA 1R16A 1NVMB 1TVEA 2EP7A 3OJLA 3PJDA 4MO2A 5T8KC 4YAIA 5TT1A 3U0BA 3V1TC 4YR9A 2A35A 4NFYA 4DBZA 1E3SA 1HLPA 2FMUA 1XDWA 1IE3A 3JD0A 4U6QA 4E2ZA 2IODA 4IMPA 4E13A 2RAFA 1NPYA 2HMSA 3H6KA 4RLSA 3PYXA 1Y8RA 3CXRA 4FD3A 1PIWA 2GCGA 3MTJA 5DULA 4J7UA 1VKNA 1ZKMA 2JD0A 3IIEA 5CP8A 3W6ZA 5A3JA 4GH5A 2D3TA 3DOOA 3OMLA 3AI3A 4BS9A 5A9RA 3UAGA 3H9EO 4CM9D 5IDYA 4ZICA 4CM4A 2BLLA 5F1OA 2OUIA 2NVUA 5JMWA 2FSSA 4GWGA 4K1LA 1SMKA 3UUWA 3IKVA 4NMHA 2CF6A 3GC6A 4C7KA 4J90A 4DXHA 3VPXA 4TWRA 4QTZA 2VHVA 2OP1A 2YDXA 3GFBA 3ORFA 1RPNA 5GZ3A 1LQUA 1E3WB 4YVFA 2PK3A 4UEOA 3GG9A 1M6HA 3DAGA 3G0OA 5BSGA 4BO2A 1E7RA 3WGHA 4MINA 3A06A 3I4FA 3UHAA 3VPHA 3RVDA 1JKIA 3PFWO 2PY6A 4RF2A 3VOSA 3IKTA 4YT2A 4PLWA 4CM9A 3DZHA 4NPCA 2NTJA 3TOZA 4PRLA 1GYPA 3DONA 3DBLB 5HBRA 2SCUA 3PGXA 4Q39A 4L73A 5IDQA 2JHGA 2GR9A 2D0IA 1WZEA 4BNUA 4E5YA 1U7TA 3RFVA 1R0LA 3BTVA 4IIVA 1HE2A 3GUYA 4YJHB 1Q0LA 4IUYA 3W4KA 3I1JA 1HSOA 1NAHA 5DP1A 5JO0A 1KVRA 1ZMTA 3GHHA 3LSYA 1QYCA 4WCFA 5DOVA 2VHXA 1I30A 4OO3A 2NQTA 1NBOA 2Y68A 1OAAA 2B83A 4R51A 4N18A 1DHRA 1T2DA 4MVJG 4TRNA 4FDAA 1VL6A 3VDQA 2EP5A 2VNAA 3G49A 3COSA 5MGBA 4MIOA 2HK7A 1F8FA 4INAA 2AQKA 1KC3A 3ST7A 2DT5A 4AJ1A 3ZHBA 4Z3DA 1GQQA 3GZNB 2QG4A 3WTCA 1VJ1A 4LRTB 2QZZA 3BHJA 4BMVA 3L4BA 4F45A 1U5CA 4RVUA 4MVJF 4ZD6A 5L53A 2WE8A 1KERA 1V0JA 3RUIA 4N5LA 2DM6A 2PTGA 4CR8A 2EW2A 4G65A 4RV9A 5CPBA 1UZNA 3W6UA 2X5JO 2Z5LA 4UVHA 3SEFA 2YHIB 3LVFO 4CM1A 4I5EA 1NR1A 2E4AA 3I9NA 1R6DA 2R00A 2FOIA 1C1XB 3IUPA 2NVBA 3F9IA 3SC4A 5EINA 1CIVA 4DMMA 1NVGA 3RQSA 1IUKA 1A9YA 4GMFA 2O3RA 3TQHA 1H6BA 1NAIA 3AOEC 4IS3A 3PWZA 4I8XA 3S2IA 2BH9A 2GASA 4Y8VA 1F06A 5IZCA 4O5OA 3WX0A 1Q2XA 4U5QA 1MX3A 1SOWA 1ISFA 2EGHA 1A4UA 4RDHA 3C24A 4IZHA 4Y6RA 2BGLA 3JD4A 3KYDA 4MVJH 3ZNQA 2V6BA 3ZWBA 4BB5A 4D0RA 1GD1O 3VTZA 3WLEA 3UVEA 5K6AA 1WPQA 2VOEA 2GNAA 3NT4A 4OSPA 1ZEJA 2B5VA 4XYGA 4J0FA 1A71A 1PGNA 5JE8A 1GUZA 1OBFO 2EJVA 1UP7A 4FFPA 4K26A 4AVYA 1JQBA 1NHGA 5CDTA 4JK3A 1EQ2A 1HL3A 2NADA 4CLRB 2OHXA 5EN4A 2J6IA 3NDJA 3T4XA 2AG5A 4LW8A 4UREA 5JMPA 3RFXA 2OGUA 5GMOA 3GG2A 2OORA 2Q1TA 3T7EA 2PFGA 1HDXA 4NBVA 1DC3A 1Y5MA 2D5AA 2GZ2A 1YQDA 4IXWA 5TRTA 4W4TA 3PLNA 4RO0A 5CHEA 1X14A 3TZHA 1U9JA 3OQBA 4L8VA 2YV2A 5G4KB 1E7SA 2Q3EA 3FNHA 2XOXA 3WYBA 4UVGA 2VWGA 2I66A 3E9MA 4LVUA 1K6XA 1YONA 4MKZA 1ZNQO 2VT2A 2BFAA 3CH6A 3GN2A 4XQEA 2OBNA 4AG3A 2EERA 3IOYA 1LLUA 1P1FA 1PJQA 2I5PO 2VHYA 5C7OO 1PQUA 2VZ9A 1W4ZA 2DTEA 3MJTA 3W8EA 4IJVA 3W8FA 3E48A 1D7OA 1I2BA 2UUPA 1JA9A 3WICA 3LYLA 1WDLA 4LCEA 2ZKLA 4L0QA 3EY4A 4YRDA 3OIDA 1ZUD1 3P2OA 1C0KA 1SAYA 4BKQA 2JCXA 3D1LA 4J0EA 1KEPA 2C5AA 3GEMA 2BELA 5JY6A 2D4AA 4NU5A 1N5DA 4W9NC 1UAYA 2ZATA 1VRWA 4R68A 4WLOA 4MVJM 4TROA 4B8WA 4D3DA 4RF3A 2PD3A 2HUNA 3AOGA 2X9NA 4EZBA 4PLGA 5FF9A 3RAJA 1QKIA 5I9MA 4BNVA 1YOVA 2VCYA 3KYDB 3OECA 3UCEA 3WIEA 4XYEA 4BL5A 2C29D 5ITVA 1ISHA 2HK8A 4IDGA 4QO7A 5EIOA 4BO9A 5JY1A 1PJBA 4MVJI 4QECA 4IY1A 3LQFA 1N7GA 4MIEA 4IDCA 4NI5A 1JN0A 3M2TA 4ZQHA 4I9HA 1XKQA 1I2ZA 5JBIA 3I23A 2Y1CA 2VRCA 5CAEA 4YT5A 3KOUA 1AHHA 3DO5A 3F1KA 2ZYGA 3SXPA 4DRYA 1IZ9A 1DHTA 1WDMA 1Y81A 2DBRA 3S8MA 5B37A 2NWQA 4N5MA 1FMCA 1GCOA 3INTA 1JWAB 4PG7A 4E32A 4IMRA 1QMGA 4EJMA 4I5DA 3ZWYA 1YDEA 1ZH8A 3ZHYA 1IYZA 1E3WA 2EHDA 3S2EA 3V2HA 5G0SA 2CFCA 2YY7A 1LSJA 3DZKA 3ZV4A 1B15A 1Q1NA 3ICPA 4IGEA 1JAYA 4JIGA 4DIFA 1K0UA 4XQ9A 3DFUA 3GPIA 1RJWA 1U3UA 1V9LA 3FNEA 4XRRA 1U4OA 4NG5A 4ZU3A 1R66A 1D4FA 2G0TA 2C0CA 1U3VA 3NYWA 2RH4A 3KYBA 3QVOA 3GHYA 4O0LA 2DBZA 3D64A 3KV3O 2G5CA 2CDBA 1FJHA 5KVVA 1ZEMA 4O6VA 4JCOA 4CPDA 1PWZA 4MJLA 4CL3A 1H2BA 3VKVA 1DDOA 4PG5A 3KLMX 2JFGA 1KVSA 3GVPA 3VAZA 2ZCUA 1YRLA 4NDNE 3GVCA 4IQ8A 5L9AA 3TN7A 3MWDB 1PGJA 4NBRA 2QQ5A 3DTTA 1DO8A 3OEWA 3QV1A 5BSEA 1FDTA 4QO8A 1Y6JA 4PG4A 1GY8A 2WD7B 4CUZA 5FWNA 4RPKA 1ZIDA 3C8MA 4E12A 4XKJA 1RYEA 1UXJA 3OP4A 3NDRA 3INRA 2HQ1A 5KVSA 4D79A 1OFGA 2UV8A 4WLVA 1KEVA 5ER9A 4CMCA 4PGFA 3KM0A 4WGGA 2CDCA 2DC1A 4FGSA 4CV3A 3GR6A 3IUSA 3LT0A 2AEFA 4GVLA 1ARZA 4JBHA 3WSVA 3F46A 3ETGA 5CPFA 3JQGA 3V5NA 3D0OA 3FN4A 4A03A 3TNLA 3GVXA 2G1UA 4R1TA 1DAPA 1PR3A 3TWOA 2DU8A 3GDGA 4DC0A 3B1KA 2X1HA 1I2CA 2GN6A 1QSGA 1JDJA 3QE3A 4XR9A 1EK5A 2YYYA 1N7HA 1YBVA 4UVEA 2WSBA 2WMDA 3RJ5A 2Y99A 2HMWA 3CSDA 3SC6A 1V8BA 4CMEA 3EHEA 4HX5A 4BV9A 1ADBA 2GYYA 4BNIA 2X4GA 1HT0A 2HRBA 4JROA 1Z73A 1ADFA 2O7SA 4J7XA 4UVDA 3U49A 3WYEA 5J23A 5BNFA 1NWCA 1E5LA 3QWFA 2H5LA 3QRWA 3JQAB 3PFFA 1DFIA 4WCFB 4XDZA 3LT1A 3DR3A 3D3WA 3VZRA 4YRAA 3ONDA 3AM4A 3RUCA 1RM0A 1LDGA 2YV1A 4EEZA 3INGA 3R3SA 5I7VA 2X7HA 3U5TA 3VKUA 3EGOA 2DLDA 3I6QA 4YWJA 1OMOA 3LT2A 1ISMA 1WNTA 2O3SA 3HFGA 3BTSA 3GQVA 4OOEA 3LDHA 5A05A 1R4NB 5JS6A 5I8WA 4BKUA 1J5PA 5K9ZA 3DBLA 4DLAA 4XB2A 1DC6A 3W4JA 1WDKA 1H6CA 3UKOA 3H9JA 5U9CA 1V3VA 2GSDA 4HFMA 1B8VA 3W1VA 3ZZNA 2NVWA 4CMJA 2ZK7A 2XF8A 2P4HX 5EPOA 4G81A 1XYGA 1I3MA 2B35A 3OEYA 3WQRA 3NX4A 1PGPA 3N58A 1DFGA 1LRKA 3AI1A 1I3NA 3DWFA 1L7EA 1I0ZA 4PN3A 2HLPA 1GQ2A 3E5MA 3Q2IA 1GFSA 3ZV6A 4BO8A 2BI7A 2ZTUA 1TI7A 1U8XX 1LDNA 3FPCA 4PZDA 3C7CB 2NSDA 2HDHA 1BSVA 1CERA 3NJ8A 4PG6A 3MJEA 2QZ9A 1JWBB 3JQBC 2PGDA 3EVTA 3IDSA 3RFTA 4D41A 1CEQA 3RBVA 1O8CA 1U4SA 3LK7A 1O6ZA 3X2FA 5A5FA 1HWYA 3GK3A 1M6WA 4WEQA 5I8ZA 4GX0A 3CIFA 3T4EA 1A27A 3FBGA 3NDIA 4W99A 1E1KA 3TL2A 4RVSA 3VH2A 1T26A 1DC4A 4KZPA 5G2OA 5LCXA 4BB6A 2O3UA 3WMXA 2FP4A 1PZHA 5DDIP 2GERA 1P0CA 2C20A 2ZB3A 8LDHA 3AU9A 2NU8A 4CM3A 1LX6A 2PH3A 4J4HA 1O89A 1NM5A 3JQ7B 2GO1A 5LC1A 3CE6A 3D4PA 4ZRMA 3FWNA 4A10A 1ADGA 4YJFB 3L6OO 2PWZA 4OKNA 3EZLA 3G1TA 2O2YA 5FI3A 5TT0A 2H9IA 4BGEA 4QSMA 4FS3A 1E1NA 5EQFA 3TZQA 4A5OA 2I3AA 3JSAA 1A7KA 3PJGA 4LMRA 3HADA 3DQPA 4QQRA 1PQWA 1D3AA 2B0JA 3WGIA 1ZK3A 1ID1A 1U3TA 3PJEA 4J2OA 4HNGA 3MZ0A 4ND2A 2W2KA 4CQLB 3RUHA 4W82A 2ZTLA 2Q50A 2OZPA 3GFGA 3RASA 1JVSA 1SNYA 3IS3A 5T8KA 4OHUA 1LA2A 5ENVA 1H0KA 4DQXA 1A4IA 1I32A 1SEPA 1I36A 2GRAA 1PJSA 2YDYA 1UXGA 3AUTA 3EC7A 4XQGA 5A4DA 3D4OA 4D42A 2GGSA 3QVTA 4YYZA 2YHUA 1PGOA 1QYWA 2XXJA 3RU7A 4DPLA 2VYVD 3TL3A 3K6JA 3QW2A 2GZ3A 4U7WA 1G0OA 5B12A 2P4QA 3ETEA 3RWBA 3ZWNA 1HEUA 3E6AA 4DUPA 1LSUA 3K5PA 4U0KA 4GPD1 3HB5X 1TT5A 2AEJA 2WJPA 3ZV3A 4IDFA 3IP3A 3SJUA 1SB9A 5H82A 1E1LA 1C0IA 1EVZA 3M1AA 3K2BA 4RPLA 4AJ2A 4ND5A 3PWSA 5CDUA 3GT0A 2AXQA 3JQFA 1G0NA 1ZXBA 4GLOA 3ZNPA 3ENKA 2IYPA 4MVJA 1TXGA 5DNAA 1HTBA 4OJNA 4CQLA 1EE9A 3FHLA 2VZ0A 3IQDB 3LT4A 3HUDA 3WJ7A 1YQGA 2X0JA 3Q1LA 5A03A 3BIOA 1SC6A 5IG2A 4FSHA 3AM3A 2FPPA 5JCXA 3DC2A 2P9GA 2OL4A 4JJFA 5EESA 4YJGA 3TFQA 1Y7TA 1X1TA 3RUEA 5F21A 3IJRA 2VWQA 4H7PA 5JFOA 3WWZA 5I7EA 1QYDA 1YL7A 2VUTA 2BD0A 1M76A 3HSKA 3SX2A 1U8FO 4KUGA 2DQ4A 4JXKA 1UDCA 1IL0A 1ENZA 5JO9A 2PZJA 1YOVB 3M6IA 3D4NA 4TMFA 4Z3KA 2NTVA 1B3BA 1PS9A 2GF2A 5CDSA 2GN9A 3C1OA 4MKXA 1ADCA 4H3VA 3KXDA 4H16A 5GZ1A 5EMHA 2QW8A 2BGKA 3JTMA 3I9OA 1LDEA 1ZCJA 5EQDA 1QYXA 4DIBA 4DQVA 3DBHA 4CMEC 4BKPA 3PRJA 2I6TA 1T25A 1DJQA 4E5KA 4ALKA 1P9LA 1NQ5A 4R5MA 3ZV5A 5CEJA 5CG2A 4RPJA 3QJ5A 4E5NA 3B1FA 4GWKA 2BRUA 4JGBA 3ZNNA 1QP8A 1LDBA 2XPCA 4FC6A 3UW3A 4BGUA 3OM9A 1LU9A 5HA5A 1LJ8A 1IZ0A 4NBTA 5ADHA 1NWHA 3A9WA 5ITWA 2AEMA 4IXTA 1Y8QA 5COBA 1KOLA 1EDZA 4GAEA 2HJSA 4WLEA 1EEHA 1N8KA 1B8UA 2Q99A 4P8RA 2XXBA 1UDAA 1PL8A 2CY0A 4WEOA 3FRJA 3GLQA 1E6UA 1BTOA 1VM6A 4B7CA 3GN1A 1RM4A 3H9UA 3ZU4A 5FEUA 5G4KA 5I9NA 2VNSA 1VSVA 3PYMA 4L4XA 5JSFA 2JAPA 1VC2A 1R4NA 3WR5A 2I3GA 5U4QA 2TMGA 3K9QO 4PLFA 4OAQA 1QXSA 2DKNA 5CEFA 1OC2A 3UH1A 4BNKA 1LDMA 4CV1A 4YRBA 1MGOA 3DDNA 2C2XA 3PQEA 1NR7A 4H15A 3WG9A 5C7IO 1JU9A 3AUUA 4CM8A 2EEZA 3QIVA 3D3WB 2HMTA 3NRCA 1WMBA 4A26A 4RZIA 4GSKA 3A14A 3SLKA 4GMGA 2WYUA 1CDOA 4RVDA 4AJIA 3RJ9A 1ZFNA 3H65A 4RZHA 4S1VA 3BMNA 3Q3CA 4OKIA 1YXMA 4IJKA 5JXWA 4CLXA 1UXHA 5JDIC 2Q4BA 4CM5A 4J49A 4XJTA 2OXIA 4E5PA 3T7CA 3ADOA 3TZKA 2LDBA 3I5MA 4QXMA 3DHNA 3WLFA 4E2YA 3DZGA 2O3QA 1V35A 3H8VA 4NFSA 1WWKA 4R16A 1ZBQA 4DWVA 3FTPA 1QG6A 3WQSB 2NLOA 3RC1A 1ZSYA 2O7QA 3CTMA 4FFOA 4BNGA 3FD8A 4IS2A 4D7AA 1D1SA 2IXAA 4GQAA 2FR8A 3QVSA 4BO4A 3NJ4A 5I7SA 1J0XO 3JV7A 4LRSB 2NVUB 1GPJA 1ONOA 3JCZA 3CEAA 2BKAA 4A73A 3WXBA 3BHMA 3ZU2A 3PHHA 4RVFA 3VZPA 1KBZA 2ZCVA 3U4CA 1YO6A 3G3EA 3LU1A 5L7YA 5L4NA 2CVZA 1N2SA 3JQ9C 3EAGA 5JC8A 4RDIA 5BSFA 1I33A 4GKBA 1HDZA 4J91A 1AGNA 1CETA 4ZQFA 3MEQA 1HDGO 5KJEA 4AFNA 1UH5A 2YZ7A 2P2SA 8ADHA 4ALLA 1KS9A 3WGGA 3ZWWA 1GEEA 2OOSA 1PJ2A 2YFHA 3GRKA 3I52A 4P4GA 3QWIA 4RVGA 4B3IA 3NGLA 3VTFA 1PWXA 1KY5A 4XDYA 1E6EA 2JFFA 3F47A 3FF4A 1XELA 3KEOA 1ZW1A 4FW8A 4NBUA 3WSWA 1UXKA 3UXYA 4EUHA 5L40A 3PPIA 2R2GA 5DBFA 1E7QA 1PJ3A 5BNTA 5L4SA 1XQ1A 1XIVA 3GGGA 4DGSA 1T4BA 4WNCA 4DYDA 4UULA 1ZXLA 3C1TA 3MOGA 1EFKA 4K9DA 5JCJA 1U2GA 4O63O 1M75A 4RPHA 1WLYA 2PKQO 4CLHA 1VI2A 2H1SA 4W7IA 4AJHA 2HSDA 1F14A 3FWZA 5AOVA 4I9UA 4BGVA 3EUWA 3HZZA 3WBBA 3DZJA 1E3EA 4Z9FA 5TS3A 1BXKA 3HDJA 4TSKA 1L1FA 4DC1A 2AE2A 2J5RA 4FN4A 1GQYA 1XEAA 3EYWA 3FSRA 3C3XA 4ND3A 1NX6A 1N1EA 1YB5A 4WLUA 5DCWA 1BXZA 2B5WA 3CZRA 4JP2A 3ZWPA 1S6YA 1OC4A 2Z95A 3Q0EA 4AJPA 4RF4A 5IF3A 4MVJE 4OOFA 3JD2A 5CEEA 1Y8QB 1T2FA 1Y9EA 2RHRA 3HQ4O 4D0SA 3HFSA 3C85A 3JYNA 3KSUA 2E82A 3JYQA 4FR5A 1T2CA 5COQA 5IZCC 3GAFA 4WPGA 2X0IA 4E4YA 2IE0A 4EJ6A 4PIVA 1LEHA 4AJLA 4M89A 4PLVA 1H9AA 3OQ1A 1EVIA 4B4UA 4FC7A 4N5NA 3EDMA 5TLSA 3ZCXA 3VH3A 3ZI0A 2O4UX 3OH8A 5G0TA 3VZSA 1M66A 1N1GA 3A28A 3NEPX 3TSCA 1LI4A 2JJYA 3KO8A 4TRMA 1BG6A 1XU7A 3GVHA 1VJTA 3WDSA 4QT0A 1J6UA 4RGBA 5EERA 3DEYX 5KTKA 5JW6A 2J3HA 1LLDA 1MA0A 1BW9B 1VL0A 3AW9A 3F4BA 1NNUA 2RBEA 1H93A 1P1RA 4RQTA 2TMDA 3ZGYA 4GX5A 3JYLA 1HE4A 3AWDA 4LISA 1DPGA 4AICA 2J5QA 4CQMD 4EYEA 2E6UX 3WNQA 1HDYA 2JFHA 3JQCA 1B2LA 3G1UA 1SOVA 2QHXA 2X9GA 1ONPA 2EG9A 3GMSA 5ER6A 1E77A 3G79A 2Y1OA 3LZ6A 3V8BA 4DQUA 4J4TA 2NU7A 1ZMOA 5IAAA 3F1LA 4GBJA 2OMEA 3ICCA 3I9LA 4OMUA 1YBAA 2BGMA 1JAXA 5A06A 4OH1A 3HNPA 1EVYA 3TRIA 4YXFA 2Q45A 5DCYA 4BNJA 4CMIA 1DOHA 4NFHA 1K6IA 3QSGA 1Y1PA 1TT5B 2EWMA 1BVRA 4A2CA 4L4RA 3DTYA 2WEKA 5HM8A 3BA1A 3O38A 1IY8A 2PZMA 2W90A 5EL0A 5AXAA 1HZJA 3KETA 1W6UA 5CFZA 2HRZA 3CMMA 2ZTMA 4CUJA 4OQZA 1Y5RA 2WE7A 3WJAA 5KJFA 5L51A 1T24A 1P1HA 2AE1A 1R37A 4WKGA 4GGOA 2QRLA 5TX7A 2Y1EA 4YBZA 4FCCA 3WYCA 4HBGA 1P1IA 1FDVA 2V65A 3ROQA 2NACA 3AJRA 1XR3A 4TRRA 3BTUA 3ZDFA 4WCDA 4UUOA 2IEBA 4RJTA 4II2A 4WASA 3MJSA 4KTVE 4EI2A 2X86A 4HUJA 4BMSA 3MWEB 2NNLD 3ROPA 5IZ4A 2BF7A 4HXYA 3N74A 1YL5A 3FPLA 3P2YA 2FPGA 3NV9A 4NK5A 1BWSA 3CUKA 3JQ8A 1PGQA 4M87A 1GU7A 1YB4A 1E3LA 4NR0A 4RQUA 4BIIA 2J3KA 2Q46A 2ZB7A 4WE3A 4YACA 5DBIA 5EJ2A 4R4JA 3SLGA 2DBQA 1GZ6A 4I1IA 3ONFA 3RBZA 5T64A 3ZU5A 1MFPA 4ALIA 5GZ6A 1RKXA 3FR7A 4DPKA 1O94A 2CMDA 4LCJA 4YJGB 4Q3AA 2B4QA 2GZ1A 3OJ0A 3OF2A 3PDUA 4YEDA 5THKA 4F6LA 3I6IA 1T2AA 1O95A 4CV0A 4ZA2A 1I3KA 3WGZA 3PHJA 2V6GA 2WYVA 1C1XA 3L0DA 4RL6A 1XG5A 1V3UA 5MDHA 2GN4A 1IULA 2IRWA 3DAPA 4J43A 3WFJA 2VHWA 4AL4A 1N9GB 3UN1A 2FZEA 4MP8A 3OICA 1GV1A 4CM6A 1KY4A 3E1KA 3WQQA 2EGGA 3FNFA 4ND4A 5IXSA 1Z45A 1ZVMA 3HG7A 3GZNA 1PL6A 1BHSA 3GF4A 2VT3A 3PI7A 3LF2A 2O2SA 4J3FA 3WOHA 2X8LA 3RBXA 2HKIA 4K6CA 5TNXA 4MDHA 5A5EA 4HWKA 5BQFA 1O0SA 4D3SA 1GZ4A 4XB1A 3ZHZA 4TRJA 1NQAO 2YV3A 2HO5A 2FHSA 4IBOA 1VLLA 3ZNOA 3PHGA 3RU9A 1X0XA 2C2YA 1DC5A 4Q3NA 1Y9AA 4P22A 1HZZA 3AK4A 1GPDG 4M8SA 5C5IA 1SPXA 4Q3BA 1DRVA 3E5RA 4JJIA 1EUDA 4FBGA 2IXBA 4WLNA 5A02A 4CLDA 1P1JA 3AY6A 2H63A 3OIFA 1KETA 5T6BA 4LGVA 3H3JA 2X0RA 3GVIA 1NFFA 3RCBA 5A9TA 3OBBA 2ILTA 4DLLA 3HN7A 4DPMA 3ZU3A 4N54A 4IIUA 4QX6A 2Y1FA 1LRLA 5KKCA 3EVNA 4IZIA 5KKAA 1HDOA 2B36A 3F6YA 4R54A 3W8DA 1AXGA 5BNIA 4CLRA 3Q6IA 1NASA 1HE3A 4NJMB 4MP6A 2IYOA 3WNVA 1SB8A 1W73A 4YB8A 1JVBA 3HHPA 3OA0A 3ZW8A 1MB4A 3DBRB 1IB6A 2IZZA 1QRRA 3U4IA 1IPFA 5CG1A 1MFZA 4WK6A 2W4QA 4Z0HO 4CM4B 2X9VA 1XWFA 4Q3CA 4TVOA 3QLJA 3NTRA 3NGXA 4MPDA 3UCFA 2G17A 1UR5A 3H9GA 4KMSA 2ZTVA 2HMVA 2VYVA 3TJRA 4HFNA 3UFXA 4L4SA 1X7GA 4AJJA 4YAKA 3H3FA 2CD9A 4OXNA 1B14A 2WDZA 3H5NA 5G0WA 3KEQA 4LN1A 4BO1A 4W6ZA 1KVUA 3STHA 2X23A 1FXSA 1HETA 1I8TA 3M2PA 3TOXA 5IDWA 2POQX 1OZAA 3TZCA 1D1TA 4J6FA 4E0BA 3WWYA 2O3TA 5BSHA 1E1MA 1ULSA 3C1AA 3CPSA 4J2HA 3QWHA 1LQTA 4PLZA 1D8AA 4YAJA 3ZWMA 2IEDA 1PS8A 2VTEA 3C7DB 3BAZA 2IZ1A 2GUGA 4FQ8A 3BMCB 2YW9A 3AUAA 1EDOA 1UAGA 1YS4A 1ORRA 3ETDA 3OQ6A 4KUHA 2VUUA 4EGFA 4HFRA 5CDYA 2BI8A 3QVXA 2J8ZA 4BKOA 3LLSA 4YA6A 5L3ZA 1F8GA 3ASUA 3KTDA 1F0YA 4AJEA 4FPXA 4TZKA 4CQMA 2RCYA 3RKUA 4HV4A 2PZKA 2EIHA 2AQ8A 3WS7A 2C7GA 3D5QA 3MCVA 3MJ4A 3BMNB 3RC2A 1Q0QA 4YT8A 1HSZA 4XYBA 3QVWA 4F46A 4WLFA 1UDBA 3NKLA 1BDMA 3HB4X 5F3RA 1TA4A 3GEDA 4NH4A 4EDFA 4XCVA 4YCAA 2VHZA 3R0IA 4I5GA 1R4MB 4HP8A 4BNWA 3GNQA 4NJOA 1V3TA 3HJAA 1FDUA 5JAZA 2YUTA 5L95A 4PZCA 1C14A 1X0VA 4Y98A 1I5RA 1XU9A 4I9NA 2DFDA 1VL8A 2VUSA 3IC5A 5F5NA 5L4LA 3OETA 1PJLA 3Q2KA 2B37A 3D5TA 1C1DB 3WGYA 1PJTA 2Q1SA 3L07A 4DTIA 4R3WA 4RF5A 4UVIA 1B3RA 3V1UA 3ZW9A 3KYCB 1AHIA 4UUMA 5HS6A 5TC4A 4B79A 5T67A 2JL1A 1BRMA 5TQVA 2CDAA 4CQMB 2NU6A 3AY7A 2FR1A 1Z74A 3DXFA 5AYVA 4R9RA 3U4DA 4JX8A 4E2WA 1CQJA 1SCUA 1YJ8A 3IP1A 1DIBA 1S7CA 1LSSA 1H94A 3TPCA 1P77A 4Z9XA 3DMYA 2B4RO 4OXKA 1HYHA 1A5ZA 3L9WA 3PJFA 4Z0PA 4IQ0A 3UICA 2A4KA 4JQCA 2PR2A 1DRWA 4I08A 4ND1A 1QLHA 4WECA 1P1KA 1HE5A 3LF1A 4TKLA 1A7AA 3O26A 1PSDA 2E49A 2CF5A 1K3TA 1FF9A 1ISJA 4XA8A 5F1KA 1UP6A 2Y05A 1LLQA 2NU9A 3BHIA 3ENNA 3DBHB 3I9MA 4Q3EA 3I4CA 4R5HA 4M49A 1DFHA 4BO3A 3ULKA 3GDFA 4Q3DA 2JAHA 2AQHA 3VC7A 3JQAA 4D3FA 3HE3A 1BDBA 3DMTA 4FFLA 1NP3A 2G76A 4KDFA 4B4WA 5B4VA 2FN7A 4M55A 1RWBA 2FY8A 9LDTA 3BMQA 3RSHA 4YQZA 2Y67A 4M86A 4ALJA 2Z1NA 4X54A 3DBRA 3VPGA 4ID9A 4EBFA 3DOCA 1XQ6A 2V7PA 2ZJ0A 5JDCC 3JD3A 3MJCA 4M1QA 3PGJA 3RD5A 1IHXA 3ASVA 3FTNA 4JN6B 2B69A 3BXXA 4OM8A 4ZVVA 2PLAA 2RHCA 1U28A 3S2FA 3JQGB 1LTHR 2X5OA 3GY0A 3Q9NA 3ZWAA 1GDHA 1Q7GA 2YQ4A 4GVXA 1DRUA 2O48X 3GMDA 1GAEO 5ICMA 2FZWA 4AJOA 4YDRA 4NNJA 2P9CA 4E5MA 1A9ZA 3AUSA 1C0PA 4OSOA 4CLOA 5JYDA 2WD7A 1UJMA 1P31A 4UAGA 4BO5A 1EQUA 2W2LA 1T1SA 3NAQA 4XEHA 4MIYA 4J1QA 3C7AA 1B8PA 2CVQA 1TB4A 4XIYA 4WJZA 4CV2A 1DIGA 1E7WA 1B0AA 1EFLA 1ZJZA 5ENDA 2ZB4A 2Q49A 1UP4A 1YB1A 3BMOA 1HYGA 2DVMA 2YQ5A 4IPTA 4L9RA 1XCBA 3K31A 4CUKA 2UUOA 2D5CA 3EW7A 1E92A 4ITUA 1J4AA 4Z0TA 3OJFA 2Y0EA 1WW8A 5DN9A 2J3IA 1IOLA 1QV6A 4ZJUA 2VTDA 4IGFA 3L9XA 1X7DA 4WUVA 1YGYA 2QYSA 1EUCA 5GY7A 4CMBA 1C3VA 1H2HA 4BNZA 1GV0A 4IDDA 1E7YA 3UF0A 3WGQA 3ZN2A 5DT9A 2EF1A 4YPOA 4ZQBA 4BVAA 4U6SA 1SZJG 1A72A 1UUFA 1R15A 7MDHA 2EKPA 3NUGA 3NTOA 4EW6A 1EVJA 1KC1A 5A9SA 2I65A 1JW9B 3WB9A 1R0SA 4NK4A 2P9EA 3QA9A 4EITA 1DAOA 2P91A 5BT9A 3PEFA 2Z1MA 2W8ZA 5IN4A 1VKOA 3GZ4A 4YJFA 4ZQGA 3CINA 1HXHA 5A9SB 4R1UA 2P5UA 4CR7A 3RUAA 3H5RA 5DF1A 1YDWA 1M2WA 4KP7A 3JQ7A 3ZWVA 4ZHSA 4GX2A 1VJ0A 3BMCA 3DAFA 3L6EA 3W4IA 4BNTA 5C37A 1Q0HA 5TIIA 5LDHA 1GADO 4LVCA 5ES3A 2X22A 4EJ0A 4J7CA 4KQWA 4E21A 4E3ZA 1P74A 4BMNA 2VRBA 3FCOA 2I99A 4MKRA 1B16A 3KZVA 4IM7A 4Y6SA 1W8DA 7ADHA 5DBGA 2PV7A 4BGIA 2YFQA 4DIOA 4BNLA 4IDEA 2DAPA 1I3LA 3D7LA 9LDBA 2EW8A 4B3HA 3JQEA 2X6TA 4JBIA 1W0CA 1EBUA 2J3JA 3K30A 4OQYA 4KTTE 2OP0A 2PKQP 4M54A 4ZN6A 2DFVA 3UOGA 4BO6A 4KWHA 3AM5A 4XD2A 4GX1A 1ONNA 4AJ4A 1NPDA 1UZLA 4PCVA 1PQPA 4UUNA 4LK3A 1JLLA 4FFRA 4L74A 2Q2VA 4R69A 1LBEA 4E33A 1QLJA 1H5QA 1K6JA 3KHUA 2AMFA 2Q2QA 5DP2A 2P68A 4CMHA 1GUYA 3PP8A 3GNTA 2ZQYA 1GEGA 1I01A 2D8AA 3GPDG 1PJ4A 5KCZA 4DLBA 1C0LA 4KUEA 3TZ6A 4C4OA 3HDYA 2DUUA 2W2KB 1GTMA 4G5HA 3VDRA 1R0KA 2GD1O 1O9BA 3ITKA 4BNHA 3K96A 3P5SA 2VWPA 2O23A 1GZ3A 3PHIA 1T2EA 1TT7A 1F17A 3PYLA 1WMAA 3PLRA 5A1TA 3EK2A 4PVCA 5DCUA 3UGKA 1ISGA 3QHAA 1KVTA 4BV8A 1CYDA 4Z6KA 4L76A 2C7VA 2Q1UA 3MJVA 3DHEA 2C82A 3BMOB 4UEJA 4BO0A 2ZYDA 4Y67A 1T4DA 3OFSA 4J1SA 3ZHXA 1BVUA 3BMQB 2QIOA 5F1PA 4FFMA 3JQBA 3AI2A 2AQIA 3JYPA 5BR7A 2EKQA 2Y1GA 4J1TA 2BFMA 1I10A 3MTGA 1LRJA 1Z75A 4J9UE 3ADPA 4JLWA 5C7LO 2JD2A 5KOIA 2EJWA 2YJZA 1PEDA 3O03A 4CLOB 3BYZA 2OFPA 4CMIB 1EMDA 1ENPA 3BZUA 1U7HA 2FRDA 5C3MA 2VN8A 3X2EA 1X13A 3F3SA 3IL2A 2VYND 1B26A 3ZWOA 3PQFA 3WBFA 1FDWA 2Y0CA 1EE2A 1FDSA 3JQAD 3P7MA 1UXIA 1HRDA 1ZK4A 4TQGA 4FIZA 2YHIA 3S1LA 4CM7A 2AW5A 2PA3A 4JNKA 1DXYA 2V6MA 1P33A 1ZJYA 1DBVO 4YAEA 2JCYA 2UVDA 1YL6A 5B4TA 3KLPX 3U09A 4B4VA 3M1LA 1KEWA 1NTOA 4FB5A 4HKTA 3HN2A 4ALNA 3O8QA 1GCUA 1Q7CA 2J5KA 3ROKA 3R6DA 2H6EA 4OL9A 1KIFA 2EV9A 4NBWA 4R41A 1YH3A 4N7RA 2RH8A 4FJ2A 4OYRA 4OGWA 2QRKA 2D59A 5JNLA 1BXGB 2VWHA 4IJWA 2PZLA 4URFA 1PZEA 3OJOA 4IDBA 4WOKA 4BUCA 3PIIA 4YQYA 4YTEA 3LC7O 2B4TO 4ZRNA 2Y0DA 4W9NA 4C7JA 2PH5A 3DZIA 1R12A 4PRKA 1AXEA 2DTXA 3LLVA 3AY3A 4TKMA 1NFRA 5HWSA 4E31A 3CKYA 1AN9A 1QV7A 1YQXA 2CZCA 4BNMA 3AFMA 3OSUA 5AXBA 3ZWCA 4DVJA 3FBTA 5A3VA 1HDCA 3VVBA 4B7UA 4BOYA 1MG0A 2CUKA 2BFPA 4F6CA 1G1AA 1IPEA 2RIRA 3E18A 3L4BC 4B4OA 4O1MA 4GL4A 5I7FA 4IDAA 5KJ1A 4QFCA 3PHLA 3U9LA 3GOHA 5JPIA 5IXYA 1H9BA 4A0SA 4PVDA 1CJCA 1Z6ZA 2FPIA 4R01A 1ZZEA 1RM3A 5FFFA 3G17A 2R00C 1M67A 4FJ1A 1P44A 2Q4EA 4NIMA 3L77A 5B1YA 1NQTA 3H4VA 4J16A 4AJKA 2PD6A 3AOEA 1WZIA 2O4CA 4EUFA 3PQDA 1FK8A 1SBYA 2Y1DA 1E6WA 5JAQA 3E9QA 4KQXA 4B7XA 4PG8A 1I24A 5CDGA 2DPHA 2DTDA 4BQPA 3B20A 1N92A 2P5YA 2UYYA 2BMAA 1P0FA 2OO5A 3A4VA 1Z7EA 4FOOA 5K6AC 1IHYA 4LMPA 2GN8A 5HTOA 3ON5A 4P4NA 4J9VA 3LC1O 1E0DA 1ZK2A 1EUZA 2VZ8A 2GPTA 2BFOA 3OHSX 4GLLA 4RPGA 1B7GO 3KVOA 1YKFA 2DPGA 2NQ8A 5KVCA 2E37A 3NTQA 5JAMA 1DLIA 3EZYA 1AE1A 5KVQA 1MG5A 2IDZA 1JTVA 3PVZA 3F4LA 1T1RA 1GL3A 1MP0A 3K8ZA 1L7DA 1MUUA 3ONEA 4TZTA 4CM8B 1TEHA 4BNYA 3QQPA 3KBOA 3DZBA 1WVGA 3FNGA 4RORA 1GR0A 2GDZA 4AJNA 1MXHA 1PR9A 4K28A 5AQ1A 3GA0A 4QUKA 1GUFA 2X5KO 3ROMA 1GYQA 5B4UA 4KDEA 3IJPA 1MV8A 1DB3A 2UDPA 1VPDA 2W2LD 4Q9NA 5JC1A 4D45A 5G0VA 5JYEA 5ILGA 4XX0A 5T5QA 2GLXA 3ANMA 3GNSA 4MVJP 5JLAA 1LC0A 2JHFA 3VH4A 4FFNA 2HJRA 1TLTA 1F12A 4YJDA 3KYCA 1JKJA 4HFJA 3WIDA 4KOAA 3PXXA 4GI2A 4PLHA 1MLDA 2WWRA 4O59O 1KEUA 1MC5A 4R1SA 1V6AA 4UUPA 2BHLA 5HS4A 3DZFA 3DOJA 3DBVO 3N7UA 2FSVA 4RLHA 1PZFA 1ZSNA 4UEKA 3WFIA 2LDXA 4P38A 5TSDA 4LSMA 2X58A 1MC4A 2HMUA 1YJQA 4HY3A 3TFOA 1YWGO 4PFJA 2WYWA 4XYMA 2PGJA 3L4SO 1NPTO 3ZH2A 2ET6A 5ICSA 4U0JA 4JJGA 1CWUA 5JCJD 4ONEA 2O50A 5JDIA 3QY9A 3GEGA 5G0UA 3AU8A 1HLDA 4EEXA 2WTBA 2FR0A 2CNBA 1G6KA 5DZSA 1HF3A 1NHWA 3NT5A 3RI3A 1Z82A 4IINA 1QORA 3O8QB 2FWMX 3V2GA 3WTBA 3PWKA 2EXXA 4E2XA 3UCXA 5TJ9A 1YBMA 1DLJA 3I9JA 2VOJA 1DSSG 5L45A 1J49A 5L7WA 6LDHA 1CRWG 2ZIZA 3NT2A 4JBGA 1PJCA 2X0NA 3QP9A 2I76A 1DEHA 1N9GA 3LC2O 5L7TA 2F1KA 4G2NA 4BNNA 1PS0A 2D1YA 1PZGA 2C5EA 5TF4A 3PZBA 4MVJD 4MOWA 3K73O 2PD4A 2NUAA 1K5HA 3E82A 4XRGA 2Q2WA 4Y9DA 1CF2O 3JQ9A 3EMKA 4L75A 1JKFA 2I67A 4XIJA 6ADHA 4CLEA 1RYDA 5KNLA 4IJUA 5KJCA 3SVTA 2VYNA 1RM5A 3GDOA 5H81A 4D46A 1LC3A 2Y93A 1PX0A 3RUDA 4F3YA 5THQA 1E3IA 4CJXA 4U8GA 2I9PA 4FJ0A 1OI7A 4CODB 1P45A 4PLCA 4PLTA 3QWAA 4XQCA 4ZQEA 4D43A 4BQRA 2WD8A 3DHYA 3L6DA 4WNIA 3RKRA 1E7MA 4NJMA 1ZK1A 1HDRA 1H6AA 1P3DA 5IJZA 1Z7BA 4XR4A 3RIHA 2R6JA 1ZSVA 4HNHA 3RC7A 3R3JA 3JQ6A 4D44A 2A9FA 2A92A 4R3NA 1LSOA 3VPSA 1CQIA 2NTNA 3S2GA 1ENOA 1NXQA 3RC9A 4DBVO 2C54A 3VZQA 5JDCA 3PIDA 2EKLA 3WGOA 1KYQA 3TDKA 5KIAA 1AUPA 3RUFA 4P4LA 4DREA 3B6ZA 4XJSA 2D2IA 1K2WA 1QYVA 1XSEA 3GUCA 1NQOA 4E6PA 3P19A 4CMGA 5HRUA 2W98A 2NV6A 4ESOA 1BGVA 3CMCO 4XYLA 4CMAA 2VQ3A 4QFDA 4S3MA 1YVEI 1DIRA 2PKRA 2VRCD 2ZQZA 3GH3A 3ZWXA 4DA9A 5FI5A 4WCFC 3ANLA 5T57A 1H6DA 2QRJA 4RVHA 3H7AA 1O5IA 3PZRA 1WXDA 3OJEA 3VHRA 3VVCA 5K0ZA 2HAEA 4XGIA 4Y6PA 5I9LA 4IQGA 1QR6A 4TVBA 3U4HA 2PNFA 1SEVA 3VPFA 4CL8A 5U1PA 2Q1WA 1OOEA 4YAGA 3MOIA 3KB6A 4GGPA 5COAA 3VH1A 3JYOA 4ZGWA 1PTJA 4NHEA 4K6FA 1BW9A 1Q7BA 3FI9A 3WMWA 2JKVA 1NVTA 1U1IA 3R1IA 3I9KA 4A7PA 1GYRA 3ITDA 5KJ6A 5FYDA 3WGTA 5JAIA 4Z9YA 2AA3A 1LDYA 2AG8A 4J1NA 4NZ9A 2WM3A 4DYVA 2QX7A 3KSDO 3ABIA 2PGLA 3O9ZA 4J4BA 4MP3A 5F5LA 4ALMA 1LUAA 1U5AA 2NM0A 1XHLA 3RROA 3JQFC 4R9SA 1VE9A 3JQDA 3I3OA 3U62A 4B8ZA 5IN5A 3I83A 2QYTA 1HKUA 4BKRA 4B3JA 4I5FA 2JCVA 2ZB8A 3F5SA 2IZ0A 2C59A 3E9NA 4WOJA 1MXFA 3IAHA 3H5AA 4OXYA 4CR6A 5A04A 4PZEA 4NU6A 1XA0A 1XLTA 3Q9UA 3HDQA 5KWEA 5TGDA 2DUWA 4KWIA 3JQ8B 3JD1A 2CVOA 2ZJ1A 3H2ZA 3B70A 4BO7A 1ZO8A 3AFNA 3U3XA 4GKVA 1ML3A 1EZ4A 4E30A 1ZK0A 3B1JA 1EK6A 1E5QA 2HCTA 2V6FA 4XWYA 3TF5A 1E3JA 1DIHA 3KUXA 4PLPA 4W7HA 2UAGA 1KVQA 4FGWA 2G82A 4OIMA 2F00A
chains in the Genus database with same CATH superfamily
5EP4A 2Q3MA 2VUIB 2B0CA 1E61A 4MWEA 4CETA 5L6LB 3UY4A 1EBFA 5CVVA 4FLFA 4OXXA 2UU9B 3H9QA 2C7OA 2AX3A 2DWPA 1V6CA 5HDQA 3R0VA 1A2KC 1X7HA 2MU1A 1C1DA 3DL2A 5CIYA 1PU2A 2ZROA 3T5TA 3ZLTA 4C7VA 1M2EA 2C07A 1SC4A 2P3QA 4Y1RA 1IEQA 5EOVA 4DL9A 4HAVA 4BHTA 2E5WA 4MMYB 4YCJA 5B55A 2O1WA 4GU5A 1QQ5A 1VSUA 2ASVA 3KKQA 1GGFA 2ADOA 3IQXA 2Y66A 3G1WA 3MUNA 3MS2A 2D4HA 4ROSA 1CEXA 1ISIA 4IH9A 2Y6VA 1Q3KA 2WY2D 2XAAA 4ERNA 4QM6A 1LXCA 4R7TA 3S55A 3PK0A 2OBYA 2VF8A 1MC1A 1MNAA 1G1MA 3GT4A 1YB7A 4HH0A 3A6HA 2OXCA 3F67A 2OD7A 2FEXA 3HDHA 1BCRA 1VCNA 3PDJA 1NYTA 2FF7A 4B6EA 2SECE 5IDXA 5H83A 1BXGA 2R2AA 2YZNA 3E03A 2WB4A 2RGBA 3BERA 3GAZA 2G04A 3PIRA 3T99A 3TVDA 4NBLA 3OIGA 2I4OA 4TPKA 1KFBB 2KW5A 2YWHA 3C41J 1IN1A 4G3XA 1EGMB 1XVAA 4J0DA 1I9GA 3H0EA 1NI4B 2PQ6A 1GLGA 1V9SA 1C9YA 3KQPA 3LQ4A 3QUTA 4KQHA 2UYHA 2O5CA 2VPXA 4B84A 2LP4Y 4II3A 3UTCA 3WIBA 4AXXA 4PSKA 2UZ3A 2PBRA 2ABWA 3EFHA 1G2QA 2C3YA 1WTCA 2HO4A 4CYMA 1AMNA 1R16A 1NVMB 2GN0A 3AR9A 4I1UA 2PN1A 2E18A 4BB5A 5C4GB 2E2WA 3RVPA 1XRMA 3H2BA 3LY7A 3MQFA 1QGAA 1K5PA 2UVQA 1CZOA 1QO0D 2A35A 2WT4A 1BD4A 4DBZA 3K5HA 3OLZA 3FRHA 1IRXA 4F04A 4JYAB 1HLPA 4MPTA 3BK2A 5CLHA 2CLIB 4U6QA 2HEGA 4N8EA 2IYUA 5EKUA 4N7BA 1W0JD 4X60A 1QQAA 2GUWA 2HMSA 4H1TA 1XPOA 1WBBA 1Y8RA 2HIAA 3BFPA 3CXRA 2BGUA 2OCDA 2R1TB 4FD3A 4C14A 1VKNA 5CP8A 1MIHA 4WXYB 1ULHA 2D3TA 3OMLA 2GM3A 3PHCA 4Q9HA 2HXGA 4ISCA 1SXJB 2QTBA 1LH0A 1XRQA 1RTTA 1VYTA 4J1TC 2JFXA 1C2TA 1S4QA 2ACWA 4DLKA 4QC2A 4CM9D 5ELMA 1PCXA 5IDYA 1K8ZB 4YR7A 4CM4A 1ZESA 2I2WA 2ZWVA 4JLSA 4BECA 4W5QA 2FSSA 4GWGA 9MHTA 1YKGA 1T4MA 2AJCA 2HQOA 2J5XA 2XEDA 3DTVB 3DDSA 3G88A 3GC6A 3L1JA 3LMKA 4J90A 1YT5A 1Z8DA 4MLPA 4C7KA 4DA6A 1W36C 3FDXA 3DVLA 4X6UA 2VP6A 3L18A 3GFBA 3OZVA 4JB0A 1JQLB 4RSRA 5JEEA 4X6XA 5BSVA 2AGVA 3G0OA 2ZSKA 3D8RA 3I9V1 4H7IA 2GI4A 4WTOA 3NTVA 4MINA 3UHAA 3VPHA 4LV5B 5CJPA 1YHNA 4G4SO 5KYKA 4CM9A 3IAAA 2AI3A 4NPCA 2JEZA 3G8CA 1GYPA 4HVCA 1F6DA 3DONA 1UPXA 2FN9A 2KLBA 3BF7A 3I04A 4FDMA 4Q39A 2HU7A 3SXUB 3FYDA 1OAOA 1SBTA 1WZEA 5C8YF 3VPAA 5J2TF 1VKZA 2VF7A 4QU9A 2V9PA 2XE4A 2OVFA 2XITA 3G6WA 2IY8A 4FYXA 3P96A 2QAGB 3V32A 2MT9A 3K35A 3GUYA 1QH1A 5HCNA 4YCMA 3W4KA 5EXEA 1SU6A 2PSEA 3H87A 4WT7A 2D1RA 3CWCA 4LDPA 5DP1A 3VR4D 4O8ZA 4D2IA 2VDNB 2VDWA 2W8BA 5ALHA 1SZPA 3PC3A 3SWWA 4OO3A 4FNMA 4Q34A 5FBRB 4JT8A 2CE7A 1Y33E 2JKZA 5A0TA 4Q00A 5CB4F 3WNZA 4JEUA 1T3TA 4G8BA 4J6EA 1VTKA 3HA7A 4OQQA 2OG1A 5IFKA 4BVBA 3VZBA 3SZOA 1VL6A 3I2FA 1ODSA 5EKTA 1SZCA 2EP5A 2F8SA 3COSA 1J9ZA 4FOPA 1RQ2A 4DCCA 1P1BA 1F8FA 2YVLA 2AQKA 3VISA 4DEYA 2H17A 3NOOA 5A0FA 2DT5A 1O94D 4Q9AA 3HMQA 4GXQA 4QG3A 1Z83A 2HHHB 5JSKA 1O0CA 3V33A 2JI4A 2QG4A 3BREA 3WTCA 4Q6BA 4EFMA 3EXFB 4WINA 1KJIA 5TE9A 3WA6A 5A5DA 3V3TA 4MVJF 5L53A 2I1VB 5L3SA 3M4NA 1KERA 1V0JA 1FQOA 3MXOA 4QDXA 3TR0A 3CF0A 3RUIA 4H1WA 5IT0A 4QBTA 2VK4A 3II6X 4BFZA 3RT9A 4L5CA 2J9FA 3JVIA 2Z5LA 1S7GA 3DFIA 3QYFA 3LVFO 4L57A 4UBMA 3SEFA 3I9NA 4DMKA 5HHTA 1R6DA 1J0BA 3IUPA 1KY3A 2NVBA 2BTQB 5E6SB 2HLHA 1J8DA 4UM8B 4C4AA 4X6LA 4F5EA 4Q4AA 5EINA 4DMMA 4ZOQI 5EZYB 2ENWA 1LNZA 2O3RA 3HI6A 4HTAA 2ZT5A 3FFTA 1ACJA 3BXPA 1GNPA 2DR3A 2J48A 3L7OA 3QLUA 5CCEA 1WIWA 3WWEA 2YOHA 4P86A 1KGSA 1D0SA 2CYCA 2GQ0A 5IT4A 1ISFA 3P0JA 1W75A 2HEIA 3C24A 1R6TA 1VMDA 2BGLA 3ZNQA 3ZWBA 4MVJH 4BNDB 1X38A 4Y30A 1J09A 2WR8A 5EI5A 2BHRA 5FL7D 5KHLB 3SKVA 1DG1G 1PJAA 1G7RA 1WPQA 3BSFA 3MHPA 1L5ZA 4RJKA 4EYKA 5AKJA 3MWJA 4OSPA 4EVRA 1WB5A 2B5VA 2I78A 4ZZ1A 3REGA 4XYGA 4J0FA 2HRDA 4FYKA 3AT1A 3U3MA 5JE8A 1FB5A 4DSAA 3IV9A 3W7BA 3AUXA 1PE0A 3DNPA 4BLQA 1UP7A 1HE8B 4LDRA 4X94A 3RUPA 2QBYB 2HRCA 1MQAA 1XXHB 3AF5A 2GTPA 1EQ2A 1M0WA 5EMLA 3NEAA 3LCJA 5EN4A 3QU4A 3IOMA 5HX7A 5AKIA 4GPEA 4MMZB 4OUKX 2AG5A 4ZZ3A 3OUUA 2FSIA 3AR2A 2FRDC 2OGUA 4AZ3A 3ORHA 3IESA 1N3LA 5J59A 5J58A 1SKUA 2Q5JA 4MW6A 3BM5A 3GG2A 4A82A 5LFAA 1GFIA 1QM5A 5DT2A 1DC3A 1CVIA 4IHJA 4JUFA 1ZVKA 1R4ZA 3BRCA 1UPCA 3IALA 3PNKA 1SUDA 1RP7A 4HDNA 1KDYA 4M60A 4RO0A 3BWBA 1FX1A 1U9JA 3OQBA 1I6MA 4NV0A 3QUSA 5G4KB 1ODKA 2WIGA 3K32A 4MAAA 4UVGA 2P30A 2H48A 4X8LA 3TO5A 4RPCA 3RYFB 3VPDA 4ER5A 2R4UA 4M83A 2NUTB 4UEQA 2YMQA 3FVQA 1N2BA 4IJ5A 1GPYA 2GPNA 2NUPB 2VT2A 3HACA 5CTJA 4YYZA 1QOPB 1GU1A 5ED0A 1M6VA 4CL0A 3RTGA 2J4CA 2OBNA 3A31A 3KEMA 4ENRA 5LIRA 1LLUA 3HKBA 3AB8A 1PQUA 4NZNA 1I2MA 1PEAA 1W4BA 2R7MA 2DTEA 1YFZA 2G1JA 4IUDS 2QM3A 2PJZA 3E48A 5CUQA 4CDNA 2VSFA 1JA9A 4LCEA 4DDKA 2ZKLA 1K88A 1T0UA 2XMGA 3EY4A 3LDFA 3OIDA 2JCGA 4DYHA 3UNXA 4BKQA 5T41A 4NU0A 3D1LA 5FPPA 1KEPA 3GEMA 2XJ4A 1VGQA 2D4AA 2DLNA 4GMKA 3V4PB 3SSAA 5AUPB 1A8HA 1N5DA 1NVVQ 3N75A 4GKAA 4W9NC 4F71A 1K9VF 3OQHA 5IEJA 4WV3A 3IXMA 4M0EA 2EX0A 3IPAA 4ZCTA 4TROA 1TVCA 2JHAA 4KL8S 1A2BA 4MUNA 1KR5A 1E2GA 2IF0A 3PKIA 4RF3A 5SY9A 2X9NA 3FNQA 1P5HA 3RAJA 1YOVA 2IOHA 2VCYA 2HCRA 3KJFA 3VSDA 4AX4A 2GB4A 3EPPA 2XLCA 5E38A 4WSOA 4XYEA 2C29D 4W8GA 3L0IB 1ISHA 2HK8A 1U31A 4BO9A 4YIHA 1TYCA 1C81A 3OPYA 1JG7A 4MVJI 1KKLA 4QECA 4IY1A 2E87A 4KI0A 3RYTC 2C92A 3EC2A 3M2TA 3DF9A 5BV8A 3H5LA 4H0NA 1XKQA 1I2ZA 2XUDA 4NZOA 3GZJA 1F9AA 1NP6A 5CAEA 4BFCA 4ZDJA 1DX9A 1PAUA 1C3OA 2RK6A 1MB9A 1AZTA 1GG2A 4XH9B 5B1SA 3TOCA 4V0KA 3AVUA 3AF4A 4QRIA 1AHHA 3PTLA 1NOJA 2WOJA 5H3CA 3SVLA 3FOZA 4KNYA 5J5CA 3OCWA 2ZYGA 4B6FA 1BQ4A 1COWA 2CK3A 4XE5A 4DRYA 1IZ9A 1T3LA 2FPGB 1BFUA 3AKDA 1XD2B 2VPTA 1DC7A 1TLFA 1Y81A 4PNHA 1BDHA 4X1KB 2QLMA 2NSLA 3R3ZA 2AMVA 2RGEA 2NWQA 2HQBA 4XLTA 4MV5A 3S8MA 2QN8A 5DYWA 7AT1A 4PG7A 1IN4A 4Q9LA 2WIJA 3QF4B 1YVDA 1ZH8A 1DPFA 2HUPA 5CW1A 3DVRX 2VBCA 3V2HA 2GRJA 4RHTA 5DEOA 3A6EA 4Q93A 1NX9A 4N40A 4Q7EA 3AEKA 2Q07A 1Q1NA 4RZXA 3ICPA 2MSCB 1RHQA 1F51E 1JAYA 1YZLA 1C8LA 1GGEA 3CRZA 3F6BX 4XQ9A 2MMGA 2E4UA 4KFUA 3DYVA 1CUJA 1U4OA 4NG5A 2FTKE 2FEWB 1R66A 3FUUA 4HRAA 1JXMA 4HZGA 1EUCB 2G0TA 4DDVA 4Q5IA 1PR1A 2C0CA 3CTPA 4X90A 3KYBA 4FEAA 1I80A 4ZOLB 1C0EA 5J2UB 3KKOA 5CTAA 1VBFA 2INGX 3UK2A 2TRSB 2CDBA 3DM5A 1UMDB 3FOWA 1XZAA 3SQLA 3JARB 4PC7A 5LQAA 4IOMA 2XW6A 4ERXA 1TECE 1YUMA 5LD2B 2QD2A 4QDKA 3E4DA 4CXMA 2YXNA 2JFGA 4HDSA 4IV0A 2YJ6A 3AJDA 4BLSA 1V1JA 4LX0A 1BE1A 3HC7A 3GVCA 4IQ8A 5L9AA 4ACBA 3OPVA 4N8SA 1RBQA 4OHZA 3TN7A 4A91A 4NBRA 4US0R 1SKMA 4GECA 3V34A 1B74A 1OCEA 4QLBA 5HGJA 3D81A 3I34X 3U44A 1GKUB 4PG4A 1X19A 1XJ5A 2XECA 1RLJA 1QCZA 2HXYA 4L2IB 1BJRE 3CRNA 4C89A 3C8MA 1BHJA 3OIVA 5FOSA 2WG0A 3GU3A 3VJKA 1OFUX 3BE6A 1UXJA 4Q9JA 2H2WA 3KT8A 4JOBA 4DWWA 1CD5A 4D79A 5KNCH 2PBFA 2UV8A 1F2VA 4XCQA 1KEVA 3UOAB 4OI1A 5DNUA 1JLKA 3I6BA 3EZXA 1WHSB 3GRUA 4BFXA 2DC1A 3TK1A 4U7TB 1JQEA 5SYMA 1GCAA 1JYFA 4RZUA 3BWXA 3F46A 1NBME 3C87A 5CPFA 3MWGA 2ERCA 3G5AA 2AR7A 2B7LA 3BPSA 2GJSA 2DU8A 5K8LA 3B1KA 1GZUA 1TYZA 2AOVA 4UM9B 1WHTA 1MV5A 4IGIA 5LWQA 2OPHA 2H7YA 1ADYA 1C3EA 2JJ1A 4XR9A 1EK5A 4CIXA 3HKCA 5BORA 1QF6A 1P17A 2COEA 2WSBA 2DH6A 2WMDA 3WOVA 1EIZA 2Y99A 2HMWA 2BSQA 4YCDA 1XZHA 4EPVA 4HH1A 2WT9A 4BAZA 1ADBA 2H16A 4ES6A 2HRBA 3FYUA 3H84A 4YP0A 1YF3A 2G40A 3U49A 4UVDA 1A8UA 1D6NA 3H0CA 3THYA 4D3YA 2DFNA 3Q72A 3PFFA 4XDZA 3OURA 4Z53A 4OXIA 2L69A 1TM2A 3D3WA 3H2YA 3KJGA 3EIHA 3ONDA 1K98A 3AM4A 4O8CA 3VZRA 1F2TA 4DA0A 1LDGA 2NIPA 5LLSA 4EEZA 2H4HA 3HXKA 2JRCA 3INGA 4FEEA 3PUVA 4KFTA 4C3OB 4J0CA 5BV7A 3U5TA 5GONB 3I4LA 4EPXA 1GO2A 2HU8A 3I6ZA 2O8FB 4B6RA 1H42A 5G41A 5HPYB 4B3RB 2QX8A 4LNUA 3AVVA 1QIDA 2YWGA 3T1QA 2FF5A 2C4TA 2QJOA 5FLXA 5CFPA 1YS7A 2PO5A 4DHWA 5ENZA 5BOSA 5CCXA 2J3MA 3DDUA 3IEPA 5K9ZA 4DLAA 3VU0A 3KSBC 1Q7RA 1GZHB 4C9BA 3OZIA 4MR7A 3UKOA 2MMCA 2QUHA 3VPCA 4QXOA 2ZBQA 2JGKA 1EA5A 1P0QA 1QHEA 2NVWA 2OTCA 3JALB 4MEJA 2P4HX 4LIPD 3RIMA 2UXCB 4G81A 3UYLA 4HMQA 3OEYA 3WQRA 2P9FA 4R0NA 3N58A 3TQIA 3AI1A 3L5OA 3CRVA 3DWFA 1JAIA 5JJ5A 1A77A 1C7QA 1YRQA 4PN3A 5I01A 4M88A 4ZHQB 3Q2IA 2IEAA 1GA4A 4NF2A 1M34E 4PICA 2R8YA 4Z9BA 2BI7A 1X1BA 3SMQA 4KVAA 1WEKA 1IM2A 8GPBA 5K05A 4XLZA 4PZDA 3C7CB 4G41A 5D2CA 5EMMA 1L5KA 3NBUA 1KO7A 1BSVA 1TKRA 2FX2A 2G83A 1TF5A 3L1HA 4PNZA 1W0KA 2IITA 4JHXA 5EKSA 3S99A 1LI5A 3EDYA 4F8JA 4YRSA 1QRUA 3GJRA 2WF5A 2WF6A 3TAUA 3KOOA 2FG6C 1FSZA 1RXEA 1JS1X 5TV2A 2IGTA 1G5HA 2NVOA 1O8CA 3LK7A 2RHWA 2R5NA 3ND5A 3X2FA 3GK3A 4D9JA 3ZDYB 4NEGA 4WEQA 4Y7DA 4GX0A 3T4EA 3FBGA 3COZA 3STXA 2JLSA 3CF4G 3PEUA 4RVSA 3O3CA 1GARA 2L2QA 4BB6A 4N5IX 1PBNA 2EW1A 2QTCA 1YACA 2YN0A 1SU8A 3V97A 2FP4A 4GO1A 1IUOA 1XAGA 1X8XA 4CL2A 4UUQA 1I4EB 3PQ3A 3FFBA 3HPQA 3AF0A 8AT1A 5T7BA 3GLFA 1RC8A 2Q6LA 1ZINA 1TD9A 2NU8A 4TLMB 3U7RA 1T5IA 1NM5A 2V7TA 2J3EA 2X9QA 4NC9A 4UCXA 1MORA 3G9UA 5CCDA 1G5IA 1FRZA 3C3KA 3HUEA 2IYSA 4Z4CA 4NY1A 3HJBA 2OQIA 4IIJF 3EZLA 3G1TA 4PYJA 1P60A 1YZFA 1P72A 2G0NA 4KVZA 5L4SA 4I6GA 4MUJA 5T4BA 3M9LA 3V1KA 1E1CA 3CH4B 5JECA 2EJUA 2XUOA 5EIBD 3SP1A 4IXMA 3UH0A 3X44A 4NICA 1W49A 4OATA 4XIFA 4QQRA 4JC5A 2VEDA 2AOWA 1V96A 2EWVA 2YZ2A 1OPXA 2J41A 5GOTA 1ID1A 1ZS9A 4E5DA 3PJEA 2Q8QA 4K87A 4HNGA 1YASA 2HBRA 3E3AA 4HYYA 1U2SA 4TYMA 5C0OE 3TPFA 3ETNA 4CQLB 4EG7A 4W82A 2XUGA 3L8HA 3L7KA 5K4HA 2Q50A 3T41A 2OZPA 4F93B 1CK4A 3RU3A 3NIBA 3SZRA 4BLWA 1V47A 1JVSA 1W46A 5T8KA 4OHUA 1CJTC 3T1YB 4ZEWA 3QVUA 5EJ7A 1DARA 3LBNA 3AUTA 2GRAA 3D7NA 1KFEB 4QU8A 1PJSA 1NUTA 3SYTA 2NAFA 3OFND 5FTKA 1GRNA 3VDXA 1NQXA 2GGSA 4D42A 4BRSA 3FTFA 5ALGA 2RBKA 3H2JA 1AV6A 1DXQA 4PAGA 1X94A 4M7PA 4D92A 1ZHOA 2VTBB 1YRBA 3INNA 1H1TA 4MUFA 4EUNA 2PZ8A 3EOBI 5TQ2B 3ETEA 2RKOA 3NTUA 2QNIA 1EFRD 1OPRA 1T5LA 4HDAA 5JMOA 2WU3A 2GBLA 4MUGA 4RETA 2P5TB 1Y89A 5IK2A 4EY4A 1WUKS 3X3HA 3ZV3A 2WNIA 3MTQA 3OEHA 3HRKA 1Q0UA 2HGSA 1SB9A 1N8TA 1SWWA 1YRYE 1EVZA 3M1AA 2FDCA 4QU0A 2XH8A 1JFLA 4IGAA 4KNVA 1MABB 4F97A 1RI5A 2ZDGA 4INJA 4BLPA 5CDUA 4GLOA 1MA3A 1DNPA 2IU4A 4X24A 5GJCA 2IYPA 3OY2A 4G0MA 1A9XB 2J7KA 2JIDA 4OJNA 3UJ7A 2V55B 4TMVA 4Q7LA 1LFAA 4AYTA 1F1JA 3FHLA 4UD6A 2N3ZA 3JU3A 3LT4A 5DCLA 1F5SA 3GMIA 3ROXA 1J90A 1SRRA 4JU8A 5B2ZA 1YQGA 2XDYA 1AHPA 2ZBDA 1J2JA 3Q7PA 3WGVA 1OX4A 1SC6A 2F1HA 3LQ1A 1PP4A 3OU7A 5HXAA 2H3EA 2GBGA 4QUJA 1L7XA 3ZU6A 1UMCB 4MRMA 1NYLA 4OB7A 4TTTS 2AH5A 1IIRA 3VX4A 1OJ7A 1BGWA 2WVAA 1CS4C 4RZ2A 2GFIA 3DT6A 1TIPA 1EWRA 1Y7TA 4G09A 2Z57A 4ER3A 5AJVB 3VKGA 3IBYA 3IJRA 4WKCA 3G02A 4AF8A 2F8LA 2XYGA 5NLLA 2BDUA 3GEPA 1P9WA 1CS0B 1QYDA 3KKMA 3RS9A 2Z9CA 1UKAA 5ALPA 3ZEIA 4ETMA 2AWNA 4JI0B 3HSKA 4WFKA 2R62A 3WRXC 2WJYA 1E0JA 2V97A 1V16B 1UDCA 1T5TA 5L3QB 1Z26A 3FUXA 3D02A 2P67A 1GHTA 3KB8A 2AKAB 4EMTA 4Z3KA 1JQ5A 1WNFA 3QBTA 2X3YA 4UE3S 2F3QA 2GF2A 5CDSA 4K9RA 4S12A 2BDTA 3JY6A 1OY1A 2PX6A 2CL0X 3KHSA 2NO5A 3U39A 1E4YA 3A7DA 3HVUA 1NW3A 2IX9A 1DAFA 2O7VA 2XYQA 3I9OA 3JR7A 3ETHA 3JTMA 4Q9IA 2I6XA 4ZVNA 3L0SA 4PWZA 1KNQA 5DGTA 2XA2A 1J2EA 2FK7A 2SKDA 1VMKA 1JB1A 3F7MA 2NZVG 1U8AA 4UOZA 5CG2A 3NAGA 4RPJA 1R3DA 1B6TA 1HG1A 4LGCA 3B1FA 1DOZA 3RKSA 1UJ6A 2BFBB 2BRUA 2YXEA 3JVEA 4YMTA 3SPXA 3VJLA 3IAXA 3UW3A 4BGUA 1DTWB 2H1IA 1XZJA 4JL8A 5LLTA 3HXPA 3CVXA 5HA5A 3MIIA 3I2IA 2ZSEA 4JEHA 4NBTA 3UQYS 3FPJA 2AEMA 3PNSA 1KOLA 4GAEA 3D7SA 1AKEA 1TA9A 1RHRA 1K68A 4QEZA 2VJMB 1XEWX 2GA9A 3IPRA 5KHOC 2NXNA 4E15A 4QVIA 1UDAA 4MQ5A 1R64A 4GE3A 1ACLA 3WC4A 3GLQA 3A05A 4AY4A 4N7JA 4NX2A 1BTOA 4FNAA 3R8XA 4B7CA 1H4TA 1VBMA 5FEUA 5I9NA 1OLUB 5EZSA 4KIJA 1VSVA 4TLDA 2FRXA 3L7CA 5JZ9A 1OB2A 3PYMA 3A6PC 1YIDA 1F8YA 3Q9SA 1HR0B 4RVCA 3N76A 2A59A 2IXFA 2C0PA 3KKNA 5LP6C 2HTFA 1J97A 4X0EA 3WR5A 2I3GA 2BEVB 1X1QA 1QXSA 2PCJA 1J24A 1QHNA 2I33A 2XHZA 3CE9A 3FCXA 3O2SB 3OX4A 4K9LA 5FQOA 4EELA 4WDQA 3EAQA 2OHGA 2R8ZA 4JAVC 1MGOA 3MCWA 5K20A 5FUXA 3L7MA 3T7JA 2C94A 3PGVA 3QHQA 5CLGA 3W78A 1JU9A 1UWCA 4CM8A 3ADKA 4GE0A 2EEZA 4KH0A 4IVPA 1YR7A 3B12A 1IZZA 5C1PA 1WMBA 4RLFA 4A8JB 3CLSC 2XY4A 2LKDA 2XVXA 3A14A 4MV8A 5BRNA 4GMGA 2OK7A 3CH5A 3Q1KA 4RVDA 1JFVA 4MW2A 1VQ1A 3H65A 2H52A 2M98A 2ZS9A 4S1VA 3BMNA 1I5OA 1WOMA 3CW2A 2ZRDA 4FXPA 4M8KA 4OKIA 5J5VA 2H2GA 1CIJA 1UXHA 4LXHA 1BVHA 4PYQA 4E5UA 4CM5A 2OLKA 2ZRCA 1QKJA 3PFNA 3J81A 4LBZA 3KQHA 2FUCA 3ADOA 3FUVA 5FORA 3TZKA 4K9PA 3DHNA 3WLFA 3G9TA 4QJ4A 3DZ8A 2O3QA 1ZUNA 2GDJA 4WI1A 1K7FB 1PTKA 3TTYA 3WQSB 2NLOA 4WAUA 1GAJA 3MBKA 3Q5GA 2HDOA 4O5AA 4FFOA 5HJ7A 5F7XA 4IS2A 1Y7PA 4C0BA 3QVSA 4BO4A 3IUBA 5CX1A 5I7SA 2O19A 3JV7A 3HK2A 4YX9A 3TKLA 1ONOA 1N33B 4N0DA 4UEWA 1MVLA 5ALQA 1ANKA 3WXBA 5I51A 1XD8A 1ATZA 1OI4A 3VZPA 2EF0A 4DDUA 1PR6A 2F43A 2ZCVA 5SZJA 3U4CA 2WM8A 4A6EA 1I51A 4G4IA 1GKKA 5K09A 3EFOB 4V0MA 1ORIA 4QJ3A 4KO3S 1MR3F 4L1KA 4FUTA 3KAPA 5L4NA 2CVZA 1K97A 1N2SA 4XJVA 2P4UA 5HP4A 1RQGA 3O5AA 1Y9ZA 4LY6A 1I33A 1SCDA 3M5DA 1W5EA 1UC9A 2PUVA 3NHRA 3REFA 3U31A 4ZQFA 1A9OA 3MEQA 2YZ7A 2J59A 1RYNA 4PBRA 3DWIA 1T2UA 1ZH0A 4ZYXA 2YFHA 3I52A 1PJ2A 1RQXA 4IXNA 4IQ4A 4JLVA 3TZEA 4M7RA 1VHDA 3VQTA 2E9SA 1OGJA 3AR6A 3NGLA 3AJ8A 3VTFA 4MHSA 4W7SA 1QB7A 1TM5E 2OKGA 3Q3IA 4PIMA 3FF4A 3WSWA 2XOEA 4FW8A 4K40A 2UXDB 3T34A 3N6RA 2QP4A 3UXYA 4RFSB 4JB2A 3J7TA 2AK2A 4HJXA 3TE7A 5DBFA 1K5DA 1E7QA 1MO6A 1C3JA 1USUA 3W9YA 2IQIA 3D7KA 3E22B 4OQLA 4V0ME 5DI9A 4ZALA 4E7PA 3FAZA 4JHLA 2HA2A 2O07A 3QI2A 3PPVA 4UULA 2OZVA 2AN3A 3CW9A 3MOGA 3AR7A 5JCJA 1F6WA 1U2GA 1SUFA 1M75A 2PKQO 1VI2A 2Q0HA 4UDOA 4NXNB 2V5VA 1E1DA 1TPYA 1YA4A 3E22A 4W7IA 1XF1A 3PF9A 5IMBA 2HSDA 5DNDA 3TKYA 3M1YA 5C8ZA 4LQDA 3HU3A 1RCUA 2C88A 3A36A 3RS8A 3HZZA 1GQOA 1L5LA 4Z9FA 3BXGA 5TS3A 3HDJA 2NPOA 4TSKA 1M0EA 2AE2A 1YHYA 4FN4A 4PBSA 3T9BA 1G21B 1O87A 3EYWA 4OUDB 1YNSA 1BX0A 3T7TA 4M0KA 1NX6A 1YB5A 3GO4A 3PVSA 2PAFA 4G8DA 4JP2A 2OHVA 4XM2A 2VR1A 1YCDA 1S6YA 1T34A 1OC4A 1E4EA 2Z8YM 1TCUA 1WMEA 2HIMA 2QJWA 3N53A 4GYYA 4RF4A 3VU1A 1GKLA 5CLIA 4AJPA 5IF3A 3PNPA 1II9A 3JD2A 3PB3A 3UG6A 1Y8QB 1L4YA 2FB9A 3P94A 4P31A 2P6PA 1IWOA 5AVVA 2JEYA 1CDDA 5HZGA 2I7CA 2PQMA 5COQA 4I3HA 2WIFA 3EXG2 2F43B 3GAFA 4FNOA 1N1DA 1M2JA 3EZ9A 4OM7A 1RHKA 4EYGA 2F9MA 2YJ3A 2R6DA 5AUOB 2IE0A 2XUHA 4LOJA 4X9XA 4KNWA 2EWWA 2V0NA 2ZJOA 3BWVA 2DUNA 1J5XA 3W5DA 2J9ZB 1V1RA 4M89A 1HDIA 3P9NA 3IP9A 4B4UA 3EF0A 3EQ7A 2PE5A 5ALXA 2I7DA 4RTLA 4W1QA 4ZT6A 4DZTA 4X20B 3U1VA 2CFRA 3OH8A 1Z0DA 2GESA 3EARA 3KJHA 1PZNA 5DSZA 2ZRKA 1G291 1V8FA 3NEPX 3TSCA 1N5IA 3LRPA 4FUQA 4FZ3A 5KU7A 3ACCA 1CUAA 3CT4A 3KO8A 3DT8A 1W35A 4KQ6A 4P3NA 4TRMA 1H05A 4KQFA 1U8TA 2CUNA 4LQCA 4LYHA 4QT0A 2C7PA 2R1UA 1EH5A 2OD2A 2OAQ1 1V4NA 2QG9A 1QGUA 3H5VA 1MMFB 5TPWA 3D8NA 5KTKA 5JW6A 1QVRA 1ZUIA 1VL0A 3ESZA 4EJSA 3THXB 3F4BA 5K3EA 1E6MA 4A8JA 1XB2A 3KTFA 4GX5A 4N5DA 4RSHA 5FBLB 3WNCA 4LISA 4AICA 1DPGA 1H2AS 2VAMA 4RTPA 1UMBB 3L0YA 1LBHA 2GJKA 2G25A 1ZH4A 2HD4A 1HH4A 4NESA 1HDYA 2P40A 1VMIA 4TWIA 4V1CA 1GNTA 1T8SA 5DWVA 3WWOA 4DHEA 1ZLYA 1XTVA 3AI7A 5ABPA 1PG5A 3U7QB 1Z17A 2GAOA 3FFWA 1ONPA 2IGBA 3OHMA 4Q15A 5DYGA 4MROA 1ZU4A 1G9XA 1SR8A 3HR7A 2GFHA 3C6MA 5BVHB 2WTEA 2Y1OA 3EJ6A 4DQUA 3I72A 1R0YA 2JIRA 3ZJYA 4C6TA 2P9QA 1FU8A 1YFKA 2WUDA 4OMUA 2BGMA 1JAXA 5ALOA 5A06A 5LP6F 2P65A 3TRIA 1MW9X 4F11A 3VDMA 3NVKI 3AX6A 4C08A 2Q45A 2GHIA 4YP5A 1DOHA 5EJMA 1K6IA 3ZE0B 3YASA 2ZS7A 3K20A 1ORHA 1KO8A 2IZOA 4JFAA 3DMGA 3M5PA 2C42A 5HM8A 1IY8A 1FRNA 2PZMA 3R5JA 2X42A 5EL0A 5CFZA 2IFTA 2HRZA 5L51A 1ILEA 2NYVA 2PSJA 5KJFA 5L3VA 3NMUF 1IHPA 1T24A 3FKJA 3R23A 1WSDA 4GGOA 5JVDB 5BW5A 2C5FA 1EAMA 3K4PA 5JSUA 4KRYA 1FDVA 3WFZA 1WF6A 2O6HA 3ROQA 3RSOA 3Q7EA 4WZ6A 2NACA 3HZHA 4MDEA 4H77A 4XM1A 3DG9A 1P4RA 3ZDFA 4RJTA 1O9GA 5K8IA 3B2NA 4WASA 2BP7B 3FTCA 4YP1A 4M1ZA 2O8CA 5CLLA 4K5QA 4HQRA 3RVOA 1Z62A 4HUJA 1CP3A 2ISSD 1VG1A 3B1ZA 3FPAA 3QUAA 2NNLD 4K86A 3WNDA 2F9FA 1E20A 4MVWA 4UHFA 4J76A 1PVOA 1NW6A 5IAJA 4FYYA 3CUKA 4LF6B 1P91A 4MYCA 3WGMA 1EFVA 3DEAA 5HIJA 2FSGA 4NR0A 4QYMA 1QZ3A 2J3KA 1MIOA 3ABOB 4R4JA 3IUMA 4KIGA 3C45A 3NG1A 4P33A 1EWTA 1V1MA 2CLLB 4XCXA 4A2PA 3GPLA 2RGRA 1MFPA 1P5FA 3GA5A 4RA6B 4KXUA 1VKHA 4QLOA 4HZUA 4PO8A 1SHLA 1L5QA 2OCAA 3KFVA 2YV4A 4I4CA 4AN0A 4OHVA 4P5PA 3H5IA 3L6BA 4F6LA 4D1YA 1USGA 3I6IA 5K0GA 1A8PA 1RPTA 2BGRA 3IP6A 1T2AA 4CV0A 4QG7A 3FGZA 3EBOA 3PHJA 3UWMA 2V6GA 4EKIA 1C1XA 1ZD2P 5IXJA 2XCOA 3ZD6A 1UEIA 1OX4B 1YULA 3C5WP 3FSJX 2GN4A 3C6KA 1RIFA 1W48A 3AILA 4XIIA 5ERGB 3UA4A 3WFJA 4AL4A 3GLVA 3UN1A 1G64A 3K1YA 4JI6B 3GFRA 3M9XA 3N07A 4HQNA 4JLUA 3GPBA 2YASA 4LF7B 3WQQA 4WESA 5KQMA 1NJGA 2C5SA 3OZGA 5DBHX 3FNFA 1RPZA 1JJIA 3T54A 5B6JA 3ROTA 5IXSA 1MABA 2UYOA 3D3JA 1PL6A 1BHSA 2QY9A 2Q9BA 3GF4A 3H8JA 4HGQA 4IVNA 3W04A 1S3IA 2O2SA 4EYSA 1UWKA 5J4KA 4WN9B 2BBOA 2P62A 2VLIA 2FJUA 2HKIA 2IHBA 4D8XA 4M22A 3CVUA 1C30A 2M32A 1AO3A 1U3FA 5A5EA 5BQFA 3VHQA 4XXHA 3N2GA 3LQKA 1UINA 3ZHZA 4TTAA 3EOAI 5DYIA 1Y7IA 1Q14A 1YIOA 4O4IA 3VU9B 3D1VA 4Z4FA 4JSYA 1UJCA 1A2OA 2IXDA 4ZPXA 3PHGA 2PMCA 1AQIA 3HKDA 1KYYA 3GI1A 5EWLA 4HI0E 4MUMA 3VNUA 5BN1A 1HZZA 5FBZA 3D2CA 3I30X 4H4DA 4M8SA 5E2BA 3DMDA 4Q3BA 1OFHA 4MB0A 2QKYA 1DRVA 2EP8A 1T3HA 1WV1A 3FMIA 2F1RA 4KQEA 1SKAA 5A02A 2GA8A 4CLDA 1SHKA 4YO8A 3D0QA 1XK7A 1F6BA 3AY6A 2H00A 2IZ6A 3GGSA 3HB7A 3OC0A 2P79A 2HHJA 4DJEC 4F92B 1XZKA 3G85A 2PUBA 1YR9A 1NZFA 2IKSA 4L5YA 3ES9A 2ZIEA 2AOUB 5A9TA 3WLTA 1UBNA 4I1RA 3S4YA 3UWKA 4IHKA 4D4LA 1Z36A 1SZDA 1R9JA 5KZMB 2R68A 2Q1YA 3UAXA 3H4TA 1NULA 2G0AA 2RHDA 3LO8A 4JJ7A 4YS6A 3W2HA 4HDRA 3ZU3A 2GJAA 3GLGA 1DKMA 1TTTA 3RSGA 2F3RA 2B7CA 4P82A 4RHCA 5LYJA 4JI5B 5KKCA 2GEVA 4JJKA 1TJ3A 3A1DA 5KKAA 3O1IC 3W8DA 2B36A 4CLRA 5KOJA 5LUAA 3RQIA 4NJMB 1TUIA 1VYHA 3IOCA 3PL1A 2JH3A 1W73A 1LBQA 3RTCA 4C3UA 1JVBA 4TSRA 5DM70 3N9IA 5JV5A 3DBRB 2EKBA 1P3JA 1S9DA 3X1JA 1IPFA 4F2GA 3IUJA 2BGWA 1F2UB 1GZ7A 2QM8A 2W4QA 3LYAA 4MVCA 4WK6A 3TMAA 4M1MA 2X9VA 2HSEA 3TRDA 3MT0A 3TTSA 3WKBA 1UK8A 2V74B 4Y6GB 3NTRA 5ALMA 3NGXA 4MPDA 3HXOA 3UCFA 2G17A 1U0OC 4R8KA 4Q0MA 2GILA 3LNCA 4KMSA 3QOWA 2WJHA 3WQBA 2HMVA 4HFNA 3PUIA 4Q21A 2J1LA 2OZKA 4L4SA 2EJCA 1HLGA 2IOYA 4HGPA 4C4ZA 5KX5F 1USIA 3TOSA 4LZZA 3GWGA 3W3AH 2AC2A 3SI7A 2GX6A 1FXSA 1GR1A 2X23A 4LQ4A 4RESA 2A8YA 5FDFA 3VO1A 3TG8A 3TZCA 5C3UA 3A26A 3HYCA 1BH6A 2VPIA 2CLKB 3K1TA 4E0BA 4HMOA 3QEAZ 2O3TA 1E1MA 1JKMA 4JVNA 1IG3A 2P2CA 1VA5A 3STYA 4ARCA 2NZ8A 3IPCA 3C7DB 1NN5A 4QA9A 3AEUB 3IJ5A 2GUGA 4FQ8A 1A9RA 2XYHA 2EYQA 2YW9A 2Q3CA 1EDOA 1UM9B 2Z5VA 1YS4A 1ORRA 3OQ6A 1MKYA 3IA7A 2VUUA 4G1BA 4U7DA 4TL7A 4PZ0A 4N3CA 2BI8A 2QV7A 2IVFA 1KK1A 3MD0A 3ANTA 3JZFA 1U81A 4OYYA 4RKEA 4ZYZA 1R5NA 1XXHE 3ZHSA 4U02A 3EBPA 4YA6A 1G8MA 4BKOA 4YUAA 1YA6A 4WHMA 2FSVC 4TKUA 4YMSA 4AJEA 3EG9A 4FPXA 1O1YA 1UWLA 1P19A 3L0BA 2P0EA 3V8PA 5EPUA 2ZJZA 5FTNA 4B4DA 3PLAE 4QOJA 1I4WA 3AIIA 2AVDA 4ROTA 3C3JA 1GZSA 2VVTA 2RSLA 2DHRA 3MJ4A 1CV2A 1PJZA 2V7EA 4U3JA 2CV0A 1QK3A 1X9GA 2IOQA 3BB4A 5FWYB 5G1NA 1XPUA 3M0EA 1CDEA 1S8OA 3T3EA 1LPAB 1EX1A 1BDMA 1YZTA 3HB4X 3NKLA 3W2IA 5AVRA 4RKYA 1JIIA 2NXJA 5HF6A 4EDFA 1FDRA 4XCVA 3RFFA 1UZAA 2VHZA 2WVGA 3R44A 1O7JA 3U6KA 4HP8A 4EA9A 1SWVA 3HJAA 2BCJQ 4GZ5A 2VJAA 3B85A 1KU0A 4QAQA 1X0VA 3P9CA 4Y98A 3ZHVA 3EVCA 3QEMA 3L8YA 4BAGA 4MUAA 1J7KA 1YCGA 4I9NA 4F6RA 1VL8A 2VUSA 4EFNA 5I6DA 2WFAA 2P6MA 2SBTA 3CX3A 2K2QB 3NJRA 1BU5A 3LGXA 3Q2KA 4OQDA 3L1VA 4L0MA 4EZIA 4P4UA 4KGZA 3RSCA 5BSKA 4OD0A 3AZOA 2COUA 1Z6YA 2WKQA 3KHTA 5JS8A 2A4MA 4UUMA 3HUUA 1TUGA 4B79A 1DJPA 1OF1A 4MYDA 4MS1A 1QFYA 5TQVA 3HZRA 4KKXB 1JSRA 1V48A 2NU6A 4W8HA 3DLCA 3MVEA 1EHCA 3AWIA 3CUVA 1S9HA 5AYVA 1DGQA 4R9RA 5ALKA 4TWZA 5E0OA 5AVSA 2JFZA 4E2WA 3CX4A 2QU7A 1JR3E 3E7DA 1YJ8A 1BOOA 2QZ4A 1KZ6A 2HSGA 2BFFA 3DMYA 3B53X 2B4RO 1A5ZA 2REOA 2B8WA 3EF1A 3L9WA 1TRHA 2WILA 4Z0PA 4XIGS 4DABA 1NKVA 3MERA 4Y9TA 5AI9A 1IJFA 1DRWA 3I2HA 4Q4CA 2FJPA 4BY9E 1KI2A