2XOXA

Crystal structure of pteridine reductase (ptr1) from leishmania donovani
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
276
structure length
216
Chain Sequence
TVPVALVTGAAKRLGSGIAEGLHAEGYAVCLHYHRSAAEANTLAATLNARRPNSAIPVQADLSNVAPVTLFKRCADLVAACYTHWGRCDVLVNNASREAMEAAAADLFGSNAMAPYFLIKAFAHRVADTPAEQRGTNYSIVNMVDAMTSQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLAEVSDVVIFLCSSKAKYVTGTCVKVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE
publication title Structure of Recombinant Leishmania Donovani Pteridine Reductase Reveals a Disordered Active Site.
pubmed doi rcsb
source organism Leishmania donovani
total genus 78
structure length 216
sequence length 276
chains with identical sequence B
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2010-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2xoxA00
1PWZA 4GWGA 2ZIZA 5BSGA 1DIGA 3BTOA 4BO1A 4OH1A 3AOGA 1OZAA 2AQIA 3C1OA 3U9LA 3GGGA 3ETEA 5AXDA 1CQIA 3O03A 4C4OA 4KMSA 1A72A 4QUKA 4PG7A 4A03A 5L95A 1AN9A 3W4IA 2I76A 5T6BA 4WLNA 1GZ4A 4B8WA 4J2OA 4OOFA 1H2HA 3AY3A 3LC1O 2PY6A 4Y9DA 4DQXA 1HZJA 3AU9A 4MVJH 1ADGA 3GMSA 4WEOA 3ZWAA 3SLGA 4Q3NA 4N54A 4RJTA 1XU7A 2P4HX 1HDOA 4I9HA 5EJ2A 5AVOA 1KVTA 3GUCA 4GVLA 1E3EA 4PLWA 4TMFA 1PJ3A 4BNVA 4CQLA 1SB8A 4P4GA 1ZUD1 4EDFA 2YV3A 1NQAO 3VVCA 2WYWA 2HMUA 2JKVA 1JKJA 5LCXA 3GOHA 1EDZA 3NUGA 2C5AA 1LBEA 3ZU3A 1DPGA 1MP0A 1P1IA 3OM9A 4BNKA 5KKAA 3WGGA 2OOSA 4E2YA 4AJ2A 1L7EA 3Q1LA 4CQMD 3S2FA 1DAOA 1MXFA 1B8PA 3ITDA 1CEQA 2YW9A 3EY4A 3TZQA 5JAIA 1N7GA 3F47A 1T25A 4CMKA 3GNQA 2EERA 2TMDA 2WM3A 3GG2A 4QFCA 4E5PA 3IS3A 4J7XA 5H82A 3CEAA 1VJ0A 2PZKA 4H15A 1PJSA 5AXAA 3AI2A 5JYDA 1QORA 2VN8A 3OQ1A 3QWHA 2EKLA 2IE0A 2OUIA 2CDCA 1Y8RB 4FW8A 4M49A 5I8ZA 2DBZA 3WGZA 3JYQA 5L7YA 3AY7A 1HE3A 4WECA 3JSAA 1MG5A 3DZJA 4ZN6A 5JO0A 1YH3A 4ZQGA 3UW3A 1Z75A 2O48X 3IUPA 3RUFA 3Q11A 1GD1O 3QJ5A 3JYPA 2QZZA 4GPD1 3F1LA 2YV1A 1J0XO 4E21A 2DC1A 2GRAA 2WD7B 1VI2A 1M2WA 2IEBA 1C1DB 1QKIA 4YAIA 2DT5A 2NACA 4RZIA 2BMAA 1DFHA 1BDMA 6LDHA 2VT3A 3V1TC 3ZNOA 1YBAA 3ONEA 3WR5A 3DQPA 4LVCA 3WSVA 4TZKA 2RIRA 1A27A 3LT1A 5L7WA 3PGXA 4CM8B 3KYDA 4IPTA 5JLAA 3EAGA 2X8LA 3AI1A 1IOLA 1HF3A 1MA0A 4XWYA 4PN3A 3E8XA 4J4BA 4Z0HO 1IB6A 1U7HA 1GTMA 1PGNA 1J5PA 1T2AA 4M8SA 1BXGA 3HSKA 1G0OA 2OBNA 1GCUA 3OF2A 3DBLB 1JKIA 1HLDA 4CJXA 2GF2A 1E92A 2PD6A 1XEAA 1LC0A 2NVBA 4PLHA 2OP1A 2X4GA 5JSFA 3D7LA 4K28A 5CG2A 2O2YA 3L6DA 4OGWA 4CM9D 4B3IA 5DCYA 2ZJ0A 3PQDA 1HLPA 2D2IA 3PFFA 1ENYA 1F17A 4PRLA 5I7VA 5F1OA 4GMGA 1R16A 3X2FA 4NBTA 1PZHA 2LDXA 3GG9A 1UZLA 5DT9A 1PJTA 1NPTO 3ZWXA 1JKFA 3KEOA 4AJ1A 4HFNA 5AXBA 1LSUA 2NVUB 1EBUA 2E4AA 3L0DA 4XYBA 4TVOA 2ZB3A 4ZQEA 4YB8A 4QEDA 4BNJA 1DIRA 4D45A 4G2NA 2VTEA 2G17A 4BNIA 3PJEA 4JJIA 3BMCB 2CY0A 2BHLA 1H5QA 4XGKA 4PRKA 2O3SA 3ROQA 1YL6A 4GVXA 3JQ9C 1LNQA 3OQBA 2Y68A 2VZ9A 1SB9A 1OC4A 3GAZA 3B6ZA 1ULSA 2EJVA 2JJYA 2AEMA 4W9NA 3S1LA 4CUKA 1G1AA 4TRRA 4BO3A 3TOXA 3ZV4A 2OO5A 4XRRA 3ZU5A 3RROA 2LDBA 4QX6A 4IM7A 4D0RA 3GFGA 1ZZEA 4RQTA 1UDCA 4D3DA 3ZW8A 1RJWA 4BHTA 2Z1NA 4CM6A 1HZZA 2UUOA 2ZJ1A 1ZK4A 1HDZA 2IXBA 4YJDA 5JYEA 3N7UA 4G5HA 1B7GO 4CLOA 2R00C 4XIJA 3TF5A 2A94A 1TXGA 1O94A 1XU9A 1PJQA 3ZDFA 2HUNA 3NGLA 4FJ1A 2AW5A 4WUVA 5DBIA 4RV9A 3MWDB 3W8DA 1N8KA 1DIHA 2H9IA 2RBEA 3AUSA 4YJGA 1E6WA 4AJEA 2PD4A 2AQHA 2EGHA 3PGJA 5EESA 1E3JA 5KTKA 3ZHYA 1K3TA 1UDBA 2NNLD 1R4MB 3C24A 4IUYA 3W6UA 5F5LA 3FHLA 4MINA 1LDEA 4IDDA 5G0UA 2FOIA 2Q1TA 4ALMA 3FTPA 3KEQA 2ZYGA 2ZQZA 4E5MA 2H6EA 3QP9A 3I4CA 2QHXA 5EIOA 1PX0A 1BRMA 3WGYA 1XYGA 4IZIA 3JQEA 4K1LA 3UUWA 3ZN2A 5DF1A 3H9JA 5U1PA 5BNTA 4BNWA 3I9NA 1P1KA 1ZVMA 3G0OA 3Q0EA 1W6UA 1XSEA 3KV3O 1LQUA 3KSUA 4L76A 1HWYA 3WWZA 5BSFA 1HKUA 3B20A 3U09A 4I9UA 2JCYA 2VNSA 4H16A 2DTDA 2ZB8A 2QRJA 4D43A 1LDYA 2J5KA 3S8MA 4DL9A 3JV7A 2B4TO 2H1SA 4BO2A 4FOOA 1A7KA 1R0LA 2X5JO 3TSCA 5A06A 1C1XA 2QZ9A 3HQ4O 1T2DA 4HFRA 3O4RA 4Y67A 3GRPA 5F21A 3OH8A 3DFZA 4IJUA 1PU2A 2F1KA 2BFOA 3JQCA 3ETDA 3L77A 3RUAA 2WE8A 1GAEO 4MVJF 3UF0A 3GEGA 5DOVA 2EJWA 2C0CA 2ZTLA 3LT4A 5A4DA 4CQMB 3FPLA 4XDYA 1TVEA 1AXGA 2UV8A 4NBRA 4ALJA 3ZW9A 3CKYA 4Z3DA 1NFRA 3ZWVA 2Y05A 3DHYA 3KM0A 4JIGA 4BV8A 4CV2A 1ZW1A 1DO8A 2HMTA 1JW9B 2NSDA 3S2GA 3CE6A 4W7IA 3VTZA 4Q39A 1WZEA 4JBHA 4J2HA 4TKLA 2IODA 2WE7A 4BO5A 5FEUA 1A5ZA 5TJHA 5ICMA 5TQVA 3NYWA 1R4MA 3VDRA 3HADA 4GL4A 3K8ZA 3QVOA 3H8VA 3HDQA 4W82A 1B3BA 3WDSA 1V6AA 2RH4A 3OECA 1BSVA 2O23A 1DFIA 3ZU4A 2V6FA 4B4OA 4FFMA 2QRLA 3PYMA 4FJ2A 1I30A 1JWBB 3OJ0A 1A4IA 2DPGA 3DDNA 4RVUA 3BHJA 4Q3AA 2D4AA 1NPDA 1PJ4A 4WCFA 5COAA 2AEJA 4BGUA 3SVTA 3H5AA 1BMDA 1RM3A 4NH4A 4R3WA 4YR9A 4B79A 4U0KA 1T1RA 1C14A 3EZYA 5IZCC 2VTDA 5ENDA 1BW9B 2VHVA 4TRJA 5G4LA 3VOSA 2Y93A 4RO0A 2NU9A 1M6HA 4PLGA 1NR1A 3TN7A 1NASA 4J16A 4CMIB 4XQCA 5JDIC 3KUXA 2NM0A 4OIMA 3KSZO 1HE2A 3C1AA 4Y8VA 4FGSA 1J6UA 1O89A 4NPCA 4W6ZA 4HKTA 1GQQA 3EZLA 4YT2A 1KEWA 2Y1FA 3H2SA 1WMAA 4TQGA 4BNUA 1U8FO 3DMTC 4NBUA 3UVEA 3VH2A 3WLFA 4DQUA 5CG1A 4B3HA 4YWJA 3NKLA 2BGMA 5JAMA 4A0SA 4LCJA 3DBRB 3PHJA 4AFNA 4AG3A 1LDMA 5CDGA 4BGVA 3GRKA 2DPHA 3O9ZA 4O5OA 1DRUA 3T7EA 3JQ8B 4R69A 4LVUA 4RVDA 2CDBA 4RDIA 5BQFA 3PJDA 4RCVA 4RPLA 2NADA 2VWGA 4YTEA 3UCFA 4YYZA 1XG5A 4E3ZA 4FCCA 4ND4A 3GC6A 4KOAA 1PR9A 1O0SA 4MVJI 1EVYA 4CM5A 5HA5A 1YXMA 2DM6A 2X1HA 1ZKMA 4B7XA 4PCVA 2JFHA 3GVIA 1E7WA 1K0UA 2YZ7A 5CDUA 2VZ8A 1JA9A 4XB2A 1N9GB 3GDFA 4OXKA 3C7AA 4PLYA 1B15A 4R3NA 1IZ9A 3ROKA 5HRUA 3RU7A 3AFMA 1A7AA 4DGSA 3D64A 3SEFA 1O6ZA 2RCYA 3OJLA 3OA2A 3QRWA 1YQGA 3HJAA 4HY3A 3GEDA 1LLDA 3QWBA 3QWAA 4A5OA 5G0TA 1ZXBA 1DLJA 3OJEA 4GX2A 4WK6A 1Z74A 4OM8A 1LLUA 5J23A 5KVCA 2D3TA 4P4NA 3OIDA 3K31A 3H7AA 1H0KA 1DBVO 4GBJA 4QO7A 5G4KB 3AW9A 4M89A 3HE3A 4AVYA 4LRTB 3U0BA 4XD2A 4UUPA 2GSDA 4OOEA 2FRDA 4CPDA 4UVHA 3ANNA 3BA1A 3AK4A 1HDCA 3PYXA 2J5QA 3NRCA 1F06A 3F46A 4OQYA 4JCOA 2JL1A 3EW7A 3VKUA 1Q2XA 2BI8A 1MC4A 1GYRA 3VPXA 3GMDA 1EEHA 1PEDA 1I2CA 2A4KA 4J4TA 3I5MA 3L9WA 3ZH2A 2VNAA 1V35A 3RIHA 4ZRMA 5DDIP 4CM9A 1UAGA 2HK9A 2UDPA 3QA9A 1OMOA 1FJHA 4JBIA 3WYCA 1WW8A 1H93A 5A04A 1CF2O 3FN4A 5FFFA 3RC2A 3ST7A 5CAEA 4MVJA 4BKPA 3L4BA 3QQPA 4HV4A 4BNYA 1GV0A 4UREA 2E6UX 5B12A 1ZEMA 4N5NA 3RC1A 3NTQA 5BSEA 1U3VA 2B36A 2PGDA 1OFGA 1S7CA 4ID9A 4IDCA 1B16A 2C20A 3RU9A 3WTCA 2YY7A 3JQFC 4TSKA 2EW2A 3QW2A 3KLPX 1W0CA 4OSOA 5T5QA 1N9GA 3LT2A 1ZO8A 2CUKA 4Z3KA 4KDEA 1YOVA 3PIDA 1Y6JA 4KTTE 5FWNA 4LCEA 3QV1A 3G1TA 3GUYA 5T64A 4I1IA 1KETA 1BVUA 1ZXLA 4O6VA 1W73A 2CSUA 1X7GA 4NDNE 4AJLA 4RPHA 1MUUA 3OJOA 3QVSA 3TZ6A 4DREA 2G0TA 2JCVA 3BMOA 2PH5A 1FXSA 3R1IA 3MEQA 4BKQA 3T7CA 3UCXA 1Y7TA 4WOKA 1VJ1A 2D5CA 1SZJG 1M75A 1E6UA 1UXJA 3PDUA 3BYZA 2NTNA 2YFHA 4P38A 5IXYA 3U49A 3R0IA 3P2OA 1T2EA 3NV9A 3GGPA 4E5NA 5A3JA 1U5CA 4D3FA 3G79A 5EQDA 4NFHA 3WGIA 3GFBA 3GVCA 3IQDB 3NAQA 2FZEA 1DLIA 1WAMA 5G2OA 1B2LA 4F3YA 1L7DA 4TRMA 4R1SA 4YPOA 1K89A 1ZJYA 1IUKA 1QLHA 4YACA 1KBZA 4DLBA 2E82A 2YDYA 4E5YA 3WNQA 1P1FA 3RVDA 1U28A 3JD0A 1DXYA 1I8TA 4MOWA 4Z9XA 3ENNA 2X9VA 4GX5A 3V8BA 4L9RA 3L07A 3K2EA 4FFOA 5ILOA 1IL0A 2AG5A 3QHAA 4ND2A 3JYLA 1HDYA 2QYSA 4H7PA 3RWBA 2Y0CA 3AUUA 2J8ZA 1QV7A 4RLHA 4AJJA 2O7QA 2PGLA 5ADHA 4CQLB 3MJEA 4WNCA 2PZLA 4MIEA 4I08A 1LX6A 2J3KA 3E5MA 4Z9FA 3H9QA 1ZBQA 2BLLA 2P4QA 3SXPA 3UICA 3IDSA 2J3HA 3UGKA 1YDEA 4KQXA 4LSMA 3V1UA 4D79A 2FR8A 4JJGA 4PLTA 5COBA 3SJUA 4J49A 2ILTA 5CEEA 1GYPA 2EW8A 3WGTA 1UXIA 1D4FA 3GZNA 3VTFA 4GGPA 4EGFA 1NVMB 3GAFA 3K96A 4YJFA 1CWUA 1MGOA 1H6AA 5C5IA 5ICSA 2GCGA 3K30A 3WQSB 4GMFA 2EWMA 4BQRA 3PVZA 1RWBA 4BNGA 4KUGA 1ZCJA 1I5RA 2X0RA 4UVGA 3ONFA 1JN0A 1PQUA 1LTHR 4ZHSA 3HN2A 2ZTUA 3W1VA 1QP8A 4B7CA 1P0CA 4NBWA 5LDGA 4QQRA 3JD1A 2ZYAA 1ZK0A 3TL2A 4NG5A 3LU1A 5JO9A 3OEYA 3MJVA 3V1YA 5TGDA 1P45A 2Y1CA 4BNFA 4EBFA 3IUSA 3OBBA 4EZBA 1N1EA 3DWFA 5TT0A 4YQYA 2O2SA 1FDUA 4ITUA 5IDXA 4WPGA 2JD0A 3HWRA 1YS4A 3D1LA 1KEVA 1C0KA 4F46A 1N92A 1YBVA 2W4QA 3WICA 4E4YA 3AU8A 2DUUA 1H9BA 2QG4A 1XIVA 2BFPA 5C37A 4FIZA 1GUFA 5I7SA 2B69A 3KB6A 3M6IA 2Z5LA 3L4SO 3ANMA 1P33A 3KYDB 3K5PA 1GZ3A 2EGGA 5I9NA 1PZGA 1ORRA 2Q49A 4D46A 3AUTA 3PLRA 4JP3A 1QRRA 3HNPA 1GU7A 1ADCA 1OC2A 3TWOA 1XWFA 1Y81A 3Q9NA 3WB9A 3C3XA 1BXGB 2Q1WA 2YHIA 2IDZA 1CQJA 4DVJA 3NTRA 1E1MA 1CYDA 2W2KA 4I5DA 1AHIA 3PHHA 5H83A 1KY4A 3WYBA 5I9LA 3PTZA 1FDSA 3ZWCA 1QXSA 2OZPA 1UAYA 4GX0A 3W4JA 4OO3A 3ZNPA 3C8MA 1H6DA 2HJSA 3K6JA 4OSPA 3H65A 4QT0A 3MCVA 4DMMA 1JVBA 4LISA 2P9GA 5H81A 3DEYX 3BZUA 3KXDA 5DBFA 1KVUA 1XQ6A 1P1RA 4PLVA 2NUAA 2UVDA 5HTOA 1QYWA 2VUTA 3EC7A 3I6QA 4XQGA 1MC5A 2X7HA 4GWKA 1DDOA 2Q1SA 4HFMA 4B8ZA 3GPDG 4CM1A 4YXFA 4L4SA 1QSGA 4TKMA 3M1AA 2DBVO 1J49A 4EJMA 3H6KA 3LF2A 1RM4A 4GH5A 2RAFA 4HXYA 2AXQA 4CLHA 1GUZA 3GEMA 2PH3A 2VYND 5T8KC 4WLVA 1DIBA 3K92A 2EXXA 3OJFA 1XR3A 5CPBA 4DRYA 1LSJA 4BO7A 1VL8A 3T4XA 2VHYA 1K6IA 1BGVA 3I9KA 3G49A 4FFNA 4DYVA 5FI3A 1E7QA 1TT5A 3I4FA 4CLRA 3IKTA 3RD5A 4Z0PA 4Q3CA 5A5EA 2OP0A 5K6AC 3GVPA 1B26A 2G1UA 3WX0A 3VZRA 3C7DB 2GN4A 1VC2A 1VLLA 4ND5A 4NMHA 2HQ1A 1RKXA 3UKOA 1PTJA 3E82A 4JX8A 2AE2A 2HU2A 3CZMA 3WWYA 3QWIA 4BL5A 4NQZA 4LMPA 4YAEA 1A9ZA 3CUKA 3E1KA 2Z95A 4FBGA 5C7IO 4UVEA 4KWHA 5GMOA 4HWKA 1ADBA 4KWIA 1U3WA 4KTVE 4CLOB 1FDWA 3UFXA 3PHIA 5F5NA 3AOEA 3AM3A 1GZ6A 4IDBA 5K0ZA 1N1GA 4FD3A 5KJFA 4J1QA 2UYYA 4U5QA 4IS3A 5JY6A 4IS2A 1HYEA 2IYPA 1UR5A 4OL9A 5JAQA 2Y66A 2FSVA 1ULUA 2WD8A 4YJGB 3U4DA 4BNHA 3FNFA 4EUHA 1DC4A 1Y8QA 4MVJD 1FK8A 2P9CA 4R16A 1P0FA 3IP1A 4CMEC 2O4CA 4DLLA 2HDHA 2Q1UA 1Z45A 1Q7BA 1VPDA 1JU9A 2WEKA 1SMKA 1XDWA 3K2BA 1NQ5A 4L75A 4P22A 2GYYA 1VJTA 2D0IA 4ZQHA 1P9LA 5F1KA 1PGOA 3CPSA 2PKRA 4RF3A 5JDCA 2VWQA 3PQEA 2VCYA 4IXWA 6ADHA 1ZK2A 1DJNA 2D5AA 4O59O 2X5KO 2XXJA 3FRJA 4J0FA 3E03A 2F00A 1C0PA 4CM7A 4NJOA 5A9TA 2HAEA 1IPFA 4RPGA 3SC6A 4OYRA 4I8XA 2NU6A 3K9QO 3L9XA 1EVIA 3WBFA 5JMPA 2JD1A 4PFJA 3BTVA 5IN5A 5DP2A 1AUPA 2GERA 3A1NA 4YAGA 4JGBA 3LSYA 5CDSA 4E31A 3WG9A 1F8FA 4FJ0A 1RM0A 1GQ2A 3NDJA 4CV3A 5CEJA 4W99A 2NV6A 4BNZA 2DKNA 3D3WA 2YUTA 1C1XB 3W6ZA 4IDAA 1HDGO 2A35A 4DC0A 1DJQA 1PJBA 2BFMA 2GN6A 1U2DA 4LMRA 3WXBA 1NWHA 1IY8A 2XPCA 3R3JA 1DOHA 2PA3A 4RLSA 5JBIA 1N7HA 5KNLA 4J7CA 1V3UA 1YKFA 4O0LA 4ZD6A 5I7EA 1E1LA 3I1JA 5TRTA 2VT2A 1C0IA 4CM3A 4J0EA 4DBVO 1HE4A 1PS8A 2XOXA 3JQBC 2J3IA 4ONEA 1MLDA 2I65A 5A3VA 3GY0A 1V8BA 4N18A 4EITA 1NPYA 2FMUA 4R1NA 1E5QA 2AQKA 1RYEA 2DTXA 3I3OA 4Y98A 3RSHA 1A4UA 4Y6SA 4IGFA 1QV6A 5KJ6A 3DBVO 1PL8A 1YB5A 3QE3A 5AOVA 3AM4A 3KSDO 5KCZA 1CJCA 1YJ8A 2HMVA 2V6BA 4BB5A 1HETA 4XX0A 4PZEA 1EVZA 4YVFA 5C7OO 3MJCA 2IYOA 4KZPA 4WLFA 1B0AA 1PZEA 4WCFB 1R37A 4R4JA 3EK2A 3RI3A 4BB6A 2I99A 4M55A 5ER9A 3OIGA 2AE1A 2O7SA 2GPTA 4I5FA 1SOWA 3BAZA 3OA0A 1EK6A 3ZHBA 5IJZA 4N5MA 1Z7BA 3GQVA 1XCBA 2I6TA 4IDFA 4IZHA 4J91A 5THQA 4B3JA 4RF5A 3KTDA 3Q2KA 1ZMTA 4XDZA 3IJRA 2ZKLA 3WOHA 1U2GA 3VH4A 5U4QA 1EK5A 1Q0QA 1F8GA 1U4OA 4NI5A 1HXHA 1X7HA 2QYTA 2O3QA 3HUDA 3WTBA 1XQ1A 2AMFA 3AUAA 1GEEA 2EG9A 2CDAA 4IGEA 5BNIA 1O9BA 4E2ZA 2ZYDA 5JMWA 3WQRA 4EEXA 1S6YA 4UVIA 1MX3A 1G0NA 1EBFA 1UXGA 2IEDA 1ONNA 3RKRA 4D44A 1I33A 4XA8A 3RASA 5JC8A 1NHWA 2C29D 2JAPA 3EHEA 3VAZA 1PJ2A 3ZWOA 2H63A 4BQPA 4D0SA 4TVBA 3ENKA 4AJ4A 1LXCA 2O50A 3VZPA 5CDYA 4JQCA 5DCWA 3LC7O 5GY7A 2JFFA 4OAQA 1LLQA 1TB4A 4XIYA 3W8EA 2HLPA 1E6EA 2CVOA 2VHXA 1DEHA 2PGJA 1IHYA 3RJ5A 1W4ZA 1X13A 3U4HA 3W4KA 2GN8A 5A02A 1IYZA 4NJMA 1WNTA 4IIUA 1KOLA 3KBOA 4UUOA 4J90A 1XLTA 1F14A 1ZIDA 1ZNQO 3PHGA 2QQ5A 3KOUA 3NT4A 2YV2A 4U8GA 4EUFA 1LI4A 3E9QA 1E7SA 4ZRNA 1DB3A 4B4UA 4YAKA 4QO8A 5AYVA 5KJCA 2G76A 4CMAA 4R01A 4FQ8A 4MVJE 1DAPA 1ML3A 1P44A 5TNXA 5EL0A 2FR0A 1JTVA 5JY1A 2HCTA 1ENOA 3HG7A 4DPLA 2BGKA 4DIOA 1EDOA 2C2YA 1UDAA 3H3FA 3INRA 5JFOA 3EGOA 1ZK3A 3P19A 4WE3A 1ZSYA 1KVRA 4TZTA 3JQ9A 4LSWA 4KUHA 1X0VA 2C07A 1NP3A 4DWVA 2R2GA 1PJLA 1RPNA 2PFGA 2DAPA 2J5RA 3JQ6A 4ND1A 3ZU2A 1WP4A 3G17A 3WJAA 3QVXA 1FF9A 3JQAA 4MO2A 3ADPA 4NU6A 3C85A 1T26A 2Y1DA 2HO5A 1PL7A 5JCJA 3DTYA 3LDHA 4K26A 1MFPA 1Z73A 4AICA 4U6SA 1BTOA 4JK3A 1P1HA 4OKIA 1Q0HA 5IXSA 4YAJA 1LRKA 3LK7A 2R00A 3C7CB 5A03A 1DRWA 2E48A 3HDJA 3PJGA 1T4BA 2V6GA 3CINA 4MVJG 1E3IA 3ICCA 2X9GA 1JAYA 1PSDA 5EINA 5L3ZA 3PFWO 1Y5MA 4MJLA 2DLDA 1R6DA 3BIOA 4ZQBA 3NGXA 3C1TA 1KY5A 4CMJA 2VYNA 2FSSA 4ZICA 4DUPA 4DBZA 2B5WA 3DZGA 2AA3A 3ZHZA 1NYTA 2Y0DA 1YOVB 5KJ1A 4S3MA 3I9OA 3FF4A 4JNKA 5CHEA 1N2SA 1GCOA 9LDTA 3TQHA 1A9YA 2PD3A 5A1TA 3F4LA 1WXDA 2BELA 3RBVA 2WYUA 4LRSB 3ZWBA 2PKQO 2OGUA 3MZ0A 2BKAA 3BMOB 3CMCO 2Q3EA 1K6JA 2X0IA 4NFYA 2FPGA 3BMNA 1R66A 1DC6A 5F1PA 1Q7GA 5ITVA 4N7RA 2OHXA 1WVGA 2QRKA 4E5KA 4DPMA 3NX4A 2FP4A 1EFKA 1UZNA 1VRWA 4MVJP 1EUDA 2ZCVA 1SC6A 4UULA 5AXCA 1U4SA 4IDGA 4DYDA 3FBGA 2XXBA 4MIYA 3TRIA 2O4UX 3M1LA 3H9EO 3ZWMA 3FI9A 1LEHA 1YL5A 1H94A 3A4VA 5FYDA 3D3EA 1YDWA 5K9ZA 1YQXA 1P31A 2BRUA 2CF6A 4PG8A 1XELA 1YO6A 3ONDA 5DBGA 4GQAA 3EUWA 3NTOA 3W8FA 3I6IA 5EQFA 4ZU3A 2X22A 1T4DA 1OOEA 2UAGA 1CRWG 2CVQA 3F9IA 1YWGO 2EHDA 2BF7A 2Y99A 4M54A 4J4HA 3NDRA 5L4SA 3IMFA 3GDOA 4UEKA 4BMSA 3N58A 1VM6A 1VSUA 4U0JA 3IC5A 1EE2A 2W8ZA 1B8UA 1NNUA 1I24A 1MFZA 3NT2A 3FWZA 5KOIA 4YBZA 3ULKA 3Q6IA 4KUEA 1UP4A 4YT8A 4A73A 3ZNQA 3MJTA 1M6WA 1AHHA 4G81A 1P1JA 2FPPA 5ES3A 4CL8A 2NQ8A 5A9SA 3DO5A 1KC3A 4B4VA 3GZNB 5I8WA 2J6IA 3BMQA 4UEJA 4ZQFA 1GPJA 4YJFB 1Z7EA 3RFVA 5COQA 3GH3A 5DN9A 4WLEA 3RC7A 1PR3A 3QWFA 4PGFA 3KVOA 4TWRA 2QIOA 2Q2QA 2NWQA 1SNYA 1ZK1A 5JCXA 1T2CA 4IINA 4JJFA 4NU5A 3RQSA 1CETA 1O5IA 3CXRA 3F3SA 3IP3A 4OQZA 3L6EA 1ISMA 4RZHA 3WGOA 3MTJA 4YRDA 5G0WA 5JAZA 2SCUA 2GN9A 3PI7A 4A7PA 4D3SA 2I3GA 5DP1A 1BDBA 4R41A 5GZ6A 5IZCA 3DZHA 4ND3A 4EUEA 4OMUA 1PS0A 5IZ4A 3U3XA 1YL7A 4XGNA 4EJ6A 2I9PA 4Q3BA 1E77A 5JDIA 1ZFNA 5HWSA 4XRGA 3N74A 3GVXA 4NR0A 3JQGA 3COSA 3QIVA 1U3UA 4AL4A 2EF1A 4E2WA 1X14A 4MPDA 5ILGA 3VPFA 2JD2A 4YA6A 3AFNA 2JHGA 3TNLA 3H9GA 3DONA 1PGJA 1HDXA 2POQX 3WBBA 4U6QA 3DMTA 1PGQA 1IE3A 3ZWWA 3JQ7A 1RYDA 2AHRA 3DZBA 3RJ9A 4JLWA 3DOCA 3JTMA 3Q3CA 5KJEA 3ASVA 1SBYA 2OFPA 1GY8A 2HRBA 1LC3A 4L4XA 3BTSA 2VYVD 3L6OO 1YE3A 3B1JA 3LF1A 1LDBA 3F5QA 1K6XA 1V9LA 1P3DA 4EW6A 2V6MA 3PJFA 2YHIB 4EJ0A 4BO9A 2PK3A 3QSGA 3CTMA 2IZ0A 2W2KB 3OSUA 3TZCA 3O26A 4BO8A 1TLTA 4L8VA 3DAFA 4OKNA 5BSHA 2GD1O 4YDRA 3IIEA 3P5SA 2ZK7A 1WWKA 4I5GA 3VPHA 2YDXA 2B5VA 2ZATA 4PG6A 4FFRA 4DQVA 2YFQA 5DZSA 4J1SA 3OIFA 1FMCA 1HL3A 1HYHA 4HFJA 2HRZA 3R6DA 2WWRA 4ROSA 3GR6A 4D41A 3TDKA 3Q9UA 3R3SA 5GZ3A 4WLOA 2AEFA 3RUCA 3GA0A 3AI3A 4YJHA 4W7HA 1M67A 3TL3A 4A2CA 2H5LA 1H6CA 2C7VA 2YHUA 3RUDA 2ZB4A 2ZTMA 3OMLA 4X54A 3JYOA 5TF4A 3F1KA 3O8QA 2P9EA 1JWAB 4AJNA 4ILKA 1C3VA 1M66A 4UAGA 3VH3A 4D42A 5B37A 1YJQA 1O8CA 1R4NA 1PQWA 5CPFA 2GGSA 5L9AA 3PEFA 2YQ5A 1I3NA 3P7MA 3RFXA 1NWCA 3I9JA 4KQWA 1E1NA 1U9JA 1T2FA 1LSSA 3UHAA 1TT5B 1UXHA 1R12A 4MKZA 4R51A 4CLRB 1VKNA 4RF4A 4N5LA 1GDHA 4PLPA 2CZCA 1U7TA 4WOJA 5IG2A 5KVSA 4CODB 4Z0TA 3GNTA 3AJRA 1WPQA 1EMDA 4W9NC 4XB1A 4CM4A 3ICPA 4TROA 4YT5A 4GSLA 3KLMX 2GZ2A 4DMLA 4Z9YA 2I67A 5B4TA 5HM8A 1BXZA 3VPSA 3AY6A 1CDOA 3SBOA 5KKCA 3CIFA 1GFSA 1TEHA 2VOJA 3G1UA 1ISJA 3GT0A 4INAA 4XEHA 2QW8A 3OFSA 3V5NA 1E3WA 1Q1NA 1DRVA 2DU8A 2GR9A 3JQAD 3JQFA 1GYQA 3PLNA 2WJPA 4GI2A 4U7WA 3DB2A 5T57A 3VZQA 3X2EA 5L40A 1UZMA 4BGEA 1ID1A 2B35A 3CZRA 3RUIA 1X15A 3CSDA 3V2HA 3GN1A 5JCJD 4A27A 4CV1A 1YB4A 3D5TA 4BNMA 3KYCA 5THKA 3TZKA 3VZSA 1NTOA 2VZ0A 3BXXA 3MJSA 3DBHA 4DLAA 1Y8QB 1SEPA 1U1IA 3U62A 5BR7A 8ADHA 2DBQA 2JHFA 3ADOA 4DXHA 3TOZA 3GF4A 2DFDA 3HHPA 3EYWA 4ESOA 5TT1A 2Q46A 1JAXA 2D8AA 5HS6A 3TFOA 2GZ3A 4MVJM 2FN7A 3QLJA 3GVHA 2VRCA 4OXYA 1YGYA 2IZZA 4L73A 4O63O 5EN4A 1ENPA 1WDLA 4II3A 3JD2A 4BUCA 2Y1OA 1XKQA 4IJWA 5JXWA 1Z82A 4UVDA 2PNFA 3A14A 4CUZA 2D1YA 3FTNA 3HDHA 4XKJA 2JCXA 1M76A 1AXEA 1LDNA 4P4LA 5L45A 9LDBA 4J6FA 5I9MA 3PXXA 3PYLA 2GUGA 1Z6ZA 3GLQA 2V7PA 3P2YA 4CL3A 1KEUA 2WYVA 4WNIA 5ENVA 3PIIA 4XJSA 1ZEJA 4XR9A 1A71A 3PZRA 4CR7A 4Q3EA 1X1EA 3HN7A 2OMEA 1JQBA 4RPKA 4RVFA 3VKVA 2C82A 3WYEA 4CLDA 1GV1A 3IOYA 5IDQA 5FI5A 1QLJA 1HTBA 2HMSA 4PIVA 3EMKA 4J9UE 4E12A 5FF9A 3MWEB 3ANLA 3UCEA 3ZZNA 3D3WB 3ZNNA 3TJRA 1XGKA 1NQTA 2Y1GA 3B1KA 4PZDA 4H3VA 4KP7A 3WMXA 4C7JA 5L53A 2CFCA 8LDHA 4NK4A 4IJKA 1ZJZA 3RUHA 2B4RO 1HEUA 3DHNA 4CLEA 1EUZA 4BO4A 1D3AA 1HE5A 2G5CA 4GKVA 2NU8A 4II2A 3DZIA 2V65A 4IXTA 4RORA 3VDQA 3FR8A 4RL6A 4PVCA 1GL3A 3CMMA 2X86A 4E32A 3NJ4A 4DIFA 1ENZA 1MV8A 2HK8A 2YYYA 3M2PA 2GO1A 3GZ4A 1QYCA 3FD8A 1PWXA 4F45A 3DOOA 4KDFA 4BO0A 3VC7A 3E9MA 4MDHA 1E5LA 4DA9A 5MGBA 3E6AA 4XYEA 4HP8A 7ADHA 5GZ1A 1YVEI 3BTUA 3INGA 1WDKA 2J3JA 3VHRA 3VPGA 3ABIA 2PLAA 4BMNA 1ISFA 4IQGA 5L51A 3I23A 1D1TA 4K9DA 5DOZA 3E48A 3TPCA 2CF5A 1WLYA 3ETGA 3ZHXA 1LLCA 4M87A 4E2XA 2E49A 3OICA 3KYBA 1Y8RA 3M2TA 3VVBA 1HSZA 1HSOA 1SPXA 3DFUA 4CMCA 4WCFC 5L4NA 4HUJA 1HRDA 1I2BA 2DBRA 2W2LA 4K6FA 3PK0A 1GUYA 3CH6A 4IJVA 2AG8A 2FR1A 3F4BA 3ROMA 4E30A 4W4TA 2IXAA 4NFSA 3PWKA 4E6PA 1EE9A 1WZIA 1J4AA 4JXKA 4R1TA 4CLXA 3ON5A 2WD7A 1NQOA 3S2IA 3GGOA 1C1DA 2UUPA 3WNVA 1R15A 3HB4X 1V0JA 4ZJUA 1VL0A 2YJZA 1X1TA 3FR7A 2PTGA 1BXKA 4RVGA 3WGHA 2GASA 3MOIA 4EI2A 1T1SA 3JD4A 1F0YA 4OHUA 4CM8A 5IF3A 5T67A 2W98A 4A26A 1HDRA 3D4NA 2A92A 2C2XA 4XQEA 4NZ9A 4XYMA 1BHSA 1I36A 5A9RA 2EEZA 3DC2A 3KRTA 1NM5A 2NLOA 3MJ4A 4IY1A 3PDJA 4FOSA 4DC1A 1R0SA 4IDEA 1YRLA 3DBLA 3QVWA 4AJOA 1QYVA 2CD9A 3KETA 3NJ8A 4JN6B 2EKPA 3U5TA 4J43A 5KVVA 1UH5A 2XF8A 1T24A 3OEWA 4MIOA 4XJTA 4NJMB 4R5HA 4AJHA 1AGNA 3UH1A 4HNHA 1KVSA 3BHIA 4MKXA 1QR6A 1ARZA 2DQ4A 2EKQA 1Q7CA 3WJ7A 3DZFA 4NHEA 2R6JA 5G0SA 4GSKA 2DVMA 5L4LA 3DXFA 5HS4A 2Y1EA 3HZZA 3S2EA 5KIAA 3GPIA 4GLOA 1EQUA 2XAAA 4F6CA 1UXKA 4WEQA 1KIFA 4FN4A 3LLVA 4NNJA 5C7LO 4QSMA 2PZJA 2NVUA 2VHWA 3LLSA 4BKUA 1Y1PA 4HBGA 3GDGA 5T8KA 4ALKA 4QXMA 1E0DA 1L1FA 3NEPX 2X23A 2GZ1A 1NR7A 1NVTA 2P5UA 2HSDA 2VYVA 3BHMA 3BMCA 5HBRA 1EUCA 1LQTA 2VWPA 3B70A 4HADA 4BGIA 3E9NA 3ZWPA 1H9AA 1E1KA 5K6AA 5A05A 1H2BA 1HT0A 1P74A 3PRJA 2O3TA 3I83A 1E3SA 1UP7A 2FZWA 4BS9A 4HNGA 5TJ9A 3JQAB 2PR2A 2O3UA 1IZ0A 1UP6A 3SX2A 4IMPA 4FC6A 4WCDA 4J1NA 2C7GA 1DC3A 3HDYA 4GAEA 1EVJA 2JAHA 3DOJA 4GLLA 2Q4EA 1D7OA 3WFJA 2E37A 3NDIA 5JNLA 4BV9A 5A5FA 1LSOA 1AE1A 4I9NA 4J1TA 1E7YA 4EEZA 1Y9EA 1PJCA 3PWZA 4J7UA 3ZCXA 1XA0A 1F12A 1QYDA 2B0JA 3L4BC 4CR8A 1NBOA 3A9WA 4YCAA 4PLCA 5BT9A 2ET6A 5LC1A 3FWNA 2ZB7A 1XHLA 2NTJA 3U4IA 2RH8A 2Y0EA 3JQDA 3AWDA 1KVQA 4UEOA 3V2UA 4QECA 1V3VA 5IDWA 4MP6A 3B1FA 1B14A 3WIDA 5IN4A 2Z1MA 3DTTA 2BI7A 4IQ8A 4CMEA 2BD0A 5AQ1A 4QFDA 1WMBA 3D4OA 3DZKA 3FNHA 3H5RA 3OETA 4CR6A 2B83A 4JBGA 3WGQA 3H3JA 1QYXA 2GDZA 4FFLA 2WDZA 2YQ4A 4GX1A 4R1UA 3FNGA 3TZHA 5U9CA 1ONOA 2I3AA 3WFIA 1JDJA 2CMDA 4PLZA 4RDHA 1SAYA 3TFQA 3BMNB 1LA2A 2AQ8A 5JS6A 4RVSA 4ZGWA 2X6TA 4BMVA 3IJPA 4YQZA 4O1MA 5EERA 4NK5A 4RQUA 3ITKA 3FBTA 4XCVA 1BWSA 3AM5A 2Q4BA 5BNFA 1I3MA 4L4RA 2RHCA 3WQQA 2B37A 4R9RA 2WSBA 4FC7A 2Q2WA 4M1QA 2VRCD 4PVDA 3H4VA 1IPEA 4XYLA 1LRLA 3RAJA 1LJ8A 4CV0A 1GPDG 1EZ4A 4GGOA 2I5PO 3RBZA 1E7MA 2PZMA 1PIWA 1VL6A 1I2ZA 4J3FA 2HJRA 4J9VA 1NX6A 2FPIA 1G6KA 2X5OA 2VHZA 3PPIA 4BNLA 3MOGA 1ZSNA 5B4VA 3D0OA 2PV7A 1ZH8A 3IKVA 4DPKA 2NQTA 4CQMA 1VKOA 5DULA 2X0NA 2OL4A 2Q45A 5TS3A 4P8RA 1H6BA 2X58A 1ISIA 2C5EA 7MDHA 4AJKA 3JQBA 1GQYA 1MG0A 3LC2O 3EVTA 4BKOA 1K5HA 3U4CA 5DNAA 5ITWA 4FS3A 2C59A 2B4QA 2BGLA 4MKRA 4RF2A 2FY8A 5JPIA 3DHEA 4XQ9A 2HKIA 3EVNA 4IIVA 4BNXA 4E0BA 5CFZA 1D1SA 2P91A 3ZGYA 1I3LA 2OXIA 3LVFO 4GKBA 3H5NA 4FSHA 5KVQA 1B3RA 5TSDA 3SJ7A 4CMGA 5B1YA 1W8DA 4BNNA 3IL2A 5JE8A 4IBOA 4BO6A 5A9SB 1IHXA 1PGPA 3BMQB 2Q2VA 3SC4A 4NBVA 5IAAA 3D5QA 1JVSA 2P5YA 5C3MA 4LK3A 4A10A 3ASUA 3ZI0A 3ZV5A 2NTVA 4B7UA 4B4WA 3JYNA 3H9UA 3WSWA 4ALLA 1QMGA 4CMHA 5DCUA 2HK7A 3INTA 5CEFA 3WMWA 3HFGA 3RFTA 1GR0A 2JFGA 4RVHA 3MTGA 4ALNA 1OAAA 4JP2A 1NXQA 2EIHA 2FWMX 3FCOA 3LQFA 4WASA 1NAHA 3WLEA 1DHRA 3NT5A 4OJNA 2Q50A 5I7FA 5MDHA 5L7TA 4FR5A 4Q3DA 1KC1A 1BW9A 1HYGA 3DMYA 4I5EA 3T4EA 3FSRA 1DSSG 3PQFA 4D7AA 3O38A 1U8XX 1B8VA 3LYLA 3OP4A 4LGVA 1OBFO 2IZ1A 2PWZA 3JQGB 4R5MA 4CMIA 1GADO 4FGWA 3GN2A 5CP8A 2EV9A 4YT4A 4FB5A 3DAPA 4Q9NA 1UJMA 4C7KA 2FHSA 4CMBA 2ZQYA 1ISGA 1PZFA 1MB4A 2G82A 4AJPA 3ZWYA 3F6YA 1LRJA 4ALIA 3RKUA 3JQ7B 3H2ZA 1VE9A 2W2LD 3KZVA 1DFGA 1RM5A 3KO8A 5TC4A 3PZBA 4XYGA 1X7DA 4BVAA 1YBMA 2GNAA 2IRWA 1YONA 3DBRA 1CERA 2VUSA 4S1VA 3GK3A 2TMGA 1DHTA 3HB5X 4PG4A 3GHHA 4Y6RA 2Q99A 5EPOA 1X0XA 3JQ8A 1ZSVA 1SEVA 2GLXA 4FFPA 2BFAA 5JW6A 3F5SA 2QX7A 2WTBA 1I01A 4ZVVA 1I32A 1NFQA 1Y5RA 3ZV3A 5TIIA 1SOVA 3DL2A 1PL6A 3GNSA 4CUJA 2VQ3A 3DAGA 2OBYA 2A9FA 3GHYA 4UUMA 2EP5A 2ZCUA 1UUFA 1K2WA 4DTIA 2X9NA 1C0LA 1U5AA 4WLUA 5KWEA 5TX7A 1OI7A 1D8AA 1EQ2A 4F6LA 1WDMA 3I9MA 4Z6KA 1I3KA 3PWSA 4YJHB 1NFFA 2W90A 4PZCA 4L0QA 3ZWNA 4E33A 4R9SA 1I10A 4WJZA 2VUUA 3S55A 2CNBA 3UOGA 4EYEA 1BG6A 4IMRA 4R68A 3RCBA 3O8QB 4RGBA 5ER6A 3EDMA 4YRAA 4YRBA 4AJIA 4MP8A 4Y6PA 5CDTA 3IAHA 3I52A 5G4KA 4DIBA 1I0ZA 3RUEA 1R4NB 4L74A 2OORA 1O95A 4BNTA 4URFA 1BVRA 1MXHA 1ADFA 2O3RA 1Q0LA 3RBXA 2VWHA 2C54A 3Q2IA 4TRNA 3E18A 5JC1A 1FDVA 2D59A 3ROPA 2BH9A 4PLFA 4XR4A 4PG5A 1EFLA 1NAIA 3SLKA 2NU7A 4UUNA 3PP8A 2DFVA 1QG6A 1TI7A 3DR3A 1PQPA 1YB1A 1NHGA 4YEDA 4CM4B 1LUAA 4MP3A 4WGGA 5G0VA 3K73O 3LT0A 5EMHA 4QTZA 4XZ3A 1U3TA 1SO8A 1YQDA 4FPXA 1KYQA 3UN1A 1IULA 3V2GA 4LN1A 1DIAA 1ZMOA 2I66A 3QVTA 1FDTA 1E7RA 1LDGA 3JD3A 1P77A 3STHA 3FPCA 1ISHA 2P68A 3OHSX 1E3WB 3G3EA 3QY9A 1VSVA 4K6CA 3LZ6A 2RHRA 4LW8A 4ZA2A 3AOEC 3UXYA 1N5DA 3A28A 1PS9A 4OXNA 3KYCB 3KHUA 5B4UA 2P2SA 2CVZA 3ORFA 3UAGA 2ZTVA 1CIVA 1KS9A 1SCUA 2WMDA 3DBHB 4G65A 1TT7A 4BOYA 3ZV6A 5F3RA 4IQ0A 2EP7A 3E5RA 4BKRA 1JLLA 3A06A 3WIEA 2Y67A 5IFLA 2VRBA 4NIMA 5LDHA 4HX5A 3OQ6A 3WS7A 2PKQP 5TLSA 4FDAA 4M86A 4WKGA 1LU9A 3JCZA 1KERA 3D4PA 3I9LA 1DC5A 3VH1A 1TA4A 4R54A 5JDCC 3RC9A 1ONPA 2DUWA 2O3JA 1NVGA 1KEPA 1GEGA 4RPJA 2HMWA 2DTEA 5IDYA 4XGIA 3HFSA 4E13A 1Y9AA 2VOEA 2X0JA 3FNEA 3PHLA 2NVWA 4JROA 4BIIA 1R0KA 1E3LA 1V3TA
chains in the Genus database with same CATH superfamily
4MQBA 2BMJA 2FFBA 4R40A 1W0KA 3C6KA 5K99A 4V0QA 4ZOBA 3AV3A 5IABA 2XYQA 1IZYA 4KKXB 1CQIA 2QE7A 4Q7MB 4PG7A 3FYUA 2Q6LA 4G4SO 5AKKA 7GPBA 5L95A 5D00A 4Y2XA 3OVMA 4PC2A 1GZ4A 2KBFA 2E87A 4DLVA 1GTSA 3EZFA 1H2HA 3FGZA 1JG6A 2MR5A 3A0UA 3IOEA 2IS2A 3K1ZA 4J29A 5KX5B 4GKAA 4C5CA 4H2DA 2WVJA 4YMIA 4EP1A 4RJTA 2WJ6A 2P4HX 2Q0QA 5DTRA 4I9HA 1EB8A 1P39A 1FFEA 5EJ9A 3FPHA 5EGSA 3PL5A 4LPKA 1PJ3A 2JI6A 1Q11A 2AUTA 2P9BA 3HYLA 1CDZA 2INGX 4RIHA 1NC3A 2F3UA 1DEOA 3DA8A 4U4AA 4EDFA 3A31A 3EH1A 1R9MA 1GCIA 2V7UA 2JKVA 4EGQA 3W34A 5DTEA 4V0RA 3HU3A 4LF5B 1X42A 4NTZA 1BJKA 1EDZA 4FR2A 1ZL2A 2C98A 1LBEA 1LJLA 4CKEB 4ZI7A 1MP0A 5INTA 1KI6A 3OM9A 2VBGA 4BNKA 5KKAA 4QEZA 1W5TA 4N0MA 2XWBF 4DDMA 3THYB 1CCWA 4IWXA 4TMTA 1QGUB 4AJ2A 4GD3Q 4C29A 4DCPA 4G4GA 3ZIUA 3PFHA 4CQMD 2MT9A 1MXFA 4EMSA 3K72B 1CEQA 1E64A 2YW9A 3TZQA 4IJQA 3F47A 1Z38A 4IEEA 4YRIA 1AZLA 1FU4A 1VIVA 2MSEB 2DKOA 3IS3A 2REQB 2ZSKA 2NZWA 3Q8WA 1Q2UA 1VJ0A 3AQIA 5EUQB 4EJSC 1T5DX 3F4KA 1K2VN 3PFIA 1I4OA 4WDQA 1N0WA 4DV7B 2XXAA 1MW9X 4YWHA 1RP1A 4UHCA 1ZVVA 5SZKB 1J2JA 4A2WA 3FCSB 4KIGA 2CYBA 1Z9BA 4M1EA 4BFTA 3WGZA 3JYQA 2GA8A 2QR3A 4KH1A 3DZJA 3H6HA 2HC9A 4MTLA 2Z3WA 3EYAA 4EPRA 4ZQGA 2QN9A 5ICCA 4B82A 1YJCA 2QWXA 4G23A 4ZOLF 4RZ2A 3O47A 3TBHA 1HLGA 2ZSFA 3TQQA 2AN1A 4DAOA 2WJ3A 2ZYUX 3EVEA 3PFCA 1MJGA 4JLDA 4M0UA 3ZQKA 2PLWA 1QP7A 1IDOA 5HIAA 3DE6X 1J0XO 3M6XA 1T8UA 5FWXA 1DX4A 2DC1A 2PRJA 4IQ4A 4C4RA 4NENB 1EUYA 1CIJA 4CG0A 2GBGA 4I8DA 1JMVA 1OV4A 4D9IA 4N76A 4GOKA 3PC8C 1VSTA 1PD0A 2JNWA 4JQYA 1L4LA 4RJLA 4O4LF 3RYFB 5HSGA 4NS4A 1FUEA 2X19A 3ONEA 3WR5A 1EFAA 4HVTA 4TZKA 2QZ4A 4RABA 3U4AA 2RIRA 1IEWA 1YC2A 3LT1A 4HB2A 2XQFA 3PGXA 3HC7A 4CM8B 5CDFE 3KYDA 2FMTA 1TCAA 5FUQA 4IPTA 3TZBA 2WHXA 3WZLA 2X8LA 4QTYA 2GEDA 5BN3A 4BFZA 2WSMA 4J4BA 4QU8A 4X9XA 2E0IA 1IB6A 1FSZA 3PDIA 1J5PA 4DM4A 4QTXA 1NJ5A 1G0OA 3HSKA 3OF2A 2H1IA 4LTMA 2D1TA 3FMOB 3HK2A 2C92A 3LZDA 1QIFA 1E92A 1ST3A 4BVFA 5AICA 2ETXA 1XFAA 5BPHA 5LKAA 2JJ1A 1PTKA 3NHJA 2JAOA 4P0TA 4QUHA 3EEBA 5JSFA 1PR6A 4XX1A 3V8NA 5DGDA 4GM1A 4K28A 5CG2A 4X65B 1OWMA 3L6DA 4UM9D 4NOKA 5DCYA 3AUJB 2OO7A 1F1BA 1RTTA 2V7EA 3OTIA 1HLPA 3DXXA 2VJPA 3VR3D 1GNSA 4OTZA 4FMDB 3NUQA 4BKMA 3A1WA 3LPAA 1XLTC 1MF7A 1VBNA 4YXWA 4GMGA 1RD4A 4DJTA 3SK0A 2NUTA 5CB4B 1RPZA 4ZREA 3P2JA 3Q8KA 1TYCA 5GONA 3ZWXA 2QTFA 3KEOA 2WOJA 5C1PA 4AJ1A 3TR0A 1MOZA 1OXKB 5DGXA 1Q12A 1H8HD 1XVVA 4F1WA 3WKDA 3GJ7A 3R5FA 4YB8A 2ZRPA 3PCRB 4QEDA 4RK4A 4BNJA 2OE2A 3OQNA 1O4VA 3N39C 3NIFB 3D2LA 4D45A 1KMHA 1U94A 4DRZA 1NXPA 1TQ6A 3PJEA 3B3QA 1P2TA 1QIEA 2ZP1A 4PZZA 1JDUA 4CIBA 1Q3HA 1H5QA 4TKVB 5ITWA 2C2MA 1RJDA 2XTAA 1SZCA 2FZCA 4OXRA 1LNQA 3VR4H 2Y68A 3DOIA 2OMKA 2PKXA 2VZ9A 5JAUA 5DX8A 4GQBA 1OC4A 2JFXA 3GAZA 3KOWA 1N5KA 1ZQ1A 2XCOA 4L4UA 1II8A 1MD9A 2G7ZA 1EEXB 1XK7A 1Y0BA 2XUJA 3BE4A 1ULSA 1FVXA 4N12A 1C9EA 2DQKA 1WHTA 3NNSA 4ZJPA 4DZRA 4DR1B 2IV3A 4CUKA 4OVKA 2VDMB 2EBUA 4MAMA 5A6SA 3ZV4A 2OO5A 4XRRA 3MSXA 1SM4A 4M8LA 2HZBA 1H8ED 4MAFA 4QX6A 1ECFA 3TZLA 2OGSA 2V6IA 5DE3A 3BXOA 4OU4A 3VNRA 1OBVA 1EI9A 2D5IA 3GUHA 4D3DA 2A0UA 4OQNA 4R9VA 2CEAA 5ANRB 4R1LA 4CIYA 5CFOA 1AU9A 1ZK4A 1H22A 2B61A 2IXBA 5DWDA 4TS4A 2XDQA 2BKXA 3N7UA 4G5HA 4FINA 4NWIA 4DNOA 1E2MA 2WSLA 3IBSA 3QFSA 4L8WB 5L8VA 1JLMA 1PJQA 2BMEA 4FJ1A 3ILXA 1NLZA 1ZD9A 1USVA 1YASA 2AW5A 4NSNA 3MWDB 4PCAA 3S5JA 3SHFA 4DIUA 2Y77A 4TYPA 2CHGA 3UMSA 4P81A 1BJTA 2NO0A 3AR4A 3DE1X 3OX1A 5FLEX 3PNPA 4ETIA 2B9EA 3OD1A 1M0SA 4HLQB 2PD4A 3CM0A 4MKHA 2EGHA 1UBHS 5KYTA 5BWOA 1ZOIA 4NATA 3VZBA 1GRQA 4IJ5A 3ZHYA 2IYSA 1ZAKA 3HY3A 3KQWA 1UDBA 2NNLD 3QEMB 3B3GA 4MINA 2J0UB 1NLYA 2WSYB 4U2KA 3KWMA 4N5DA 2ZR7A 3CUVA 3LLUA 2ODEA 3R6LA 5CDFA 4ZVNA 1D2NA 4U2CA 5GJWC 2ZYGA 4E5MA 1OFVA 2QHXA 3HV2A 5EIOA 1F4VA 1PX0A 1XA3A 4EHNA 4GO1A 2XDAA 3F8SA 5E3HA 3P52A 3UUWA 3OOYA 1FRZA 1WOYA 3DSRA 4BNWA 4PZ0A 4LUCA 3LQKA 3E05A 1W5FA 1GU1A 3TSWA 1OB5A 4FUTA 2XX3A 5KNCA 2OK7A 4B6GA 1NZFA 3DLTA 3IUYA 1JX6A 3K9LA 3LBFA 2BGTA 1Z8NA 5BSFA 4RM3A 4C3ZA 1XV5A 3IODA 2R1VA 1HKUA 1P19A 4LNUA 4MKFA 3B6KA 1S0UA 1T9KA 1A9XB 5CXUA 3U09A 1LZLA 4U63A 2FV8A 3B5IA 3BULA 2PS3A 4U7TB 2ZB8A 5KYVA 4FW9A 2EBFX 4L5IA 1JBEA 1QE3A 4YGXB 1NBAA 4G0UA 1DV1A 3CBGA 4N03A 1U5BA 4F85A 1Y3CE 4IJMA 4N5HX 3U0VA 1G9SA 4MVYA 2BRUC 2QMOA 4KYUA 1SBTA 2X5JO 3LX5A 4AZTA 4BMOB 5KNBD 2W4MA 4EW2A 4MR9B 1Q84A 3HQ4O 1T2NA 4IF4A 1LWNA 2AI3A 3THOA 3OH8A 5EHNA 2F1KA 3UF0A 3ETDA 3LDFA 4QG3A 1IRIA 1WB5A 1WTAA 2I3ZA 2OBBA 3GEGA 5HK9A 2B30A 2HHAA 2HGSA 3BX1A 1QGZA 5DN6D 4XDYA 4QHYA 3EQ8A 1W36B 1NBHA 1ECPA 3DAYA 2QT9A 2Y05A 4BQOA 3V48A 4JLPA 2QE7D 1DO8A 2XIQA 2WHRA 3PFGA 4HUQA 5IC6A 3RBAA 1FZQA 2WYOA 3SNHA 5TMBA 2WTXA 2HXGA 4JBHA 4AS3A 3I32A 4FOLA 3MCWA 4TKLA 1XZEA 2IODA 5B1IA 1GPMA 3ZD8A 1A5ZA 1JQJC 4O4HA 2H3HA 5FWYB 1SVKA 4IYJA 3EISA 4QU9A 1AQIA 1MJGM 3VDRA 3HADA 1L5ZA 2VK4A 4IJ6A 3GRUA 3QVOA 4R84A 4BLVA 1PFWA 1VBKA 3HDQA 1AS2A 2CXUA 4L95C 4M1KA 3CF2A 1N9ZA 4URXR 4EY4A 4NH0A 3M4JA 2QPLA 2YVLA 3ZGNA 2I2DA 1B3BA 3TZEA 4O2AF 1MEOA 3WDSA 4D9EA 1SHTX 2O23A 1DFIA 1IZZA 2Q9UA 3RB8A 3EG9A 3PYMA 1I30A 4YFYA 5H4HA 3G6KA 1ULTA 4TLAA 3AEUA 1A4IA 2ZJBA 3C4QA 3H11B 3DNPA 1CUGA 1ULHA 2RSLA 1D2AA 2ZETA 3HSSA 4JDPA 1REQB 4RGYA 4G0WA 2VZLA 1LI7A 3DDNA 2D4AA 5ICFA 3BJRA 2HA5A 3FMPB 5A2QA 2AEJA 4LZLA 2R1ZA 2QJFA 3ZGVA 2AFHA 3NPAA 4R3WA 4C9BA 4B83A 3DHWC 2GPYA 1CRPA 5GWXA 3F8TA 4E14A 1EBBA 3UG6A 5IZCC 4E1AA 4HGZA 1NI5A 2VBIA 1GZHB 3NBXX 5ENDA 2RGCA 3UKJA 4RO0A 3ZIDA 4PWZA 5ALIA 1KQPA 3I6BA 2ISCA 2HA2A 4J16A 2C8KA 5LB2A 4CMIB 3LPNA 3OSZA 1R8JA 4PYOA 4DCVA 4ZPJA 4DDVA 3AVYA 1TO2E 4URUR 4RTMA 3OFKA 2C2GA 4Y8VA 1II0A 4FGSA 1KQFA 3W2EA 4JS0A 2GNPA 2GM4A 4KO1S 1SWVA 1GQQA 2H1VA 3GRZA 5BN5A 2QRPA 1MJFA 1Y3FE 4FDVA 2QRMA 1J1IA 3VO9A 2AN9A 2CWWA 3UVEA 5BMVF 3VH2A 4DQUA 1G5HA 4X8HA 1SXQA 5CG1A 3Q3VA 5JAHA 4DMKA 4YWJA 3HABA 3FHCB 3CLUC 1Y7HA 2D1SA 3RV4A 3ZEIA 4A0SA 3D8TA 5LOVB 4LCJA 4L5YA 2H9YA 2CWDA 4LMBA 4PN7A 1LDMA 4G01B 1U0GA 3MMZA 3ESYA 1R27A 2XYGA 3PDCA 4UDYX 2DPHA 4XM1A 5ALHA 5HJ2A 1CULC 1UBLS 1QK3A 2Q3FA 1WLSA 3DDSA 3NWEA 3OP1A 3PNVA 2CDBA 2WJJA 3HJNA 4LVUA 4CKYA 3A6FA 4GKKB 4L3VA 1VTKA 4RCVA 2NZ8A 2KSQA 4ZV9A 1AK2A 4X8OA 1T9HA 3LA6A 1XG5A 3ACCA 1TOAA 3AGQA 2II6A 3KHSA 4NFLA 1KSGA 4E3ZA 2XZOA 3A2LA 4PYNA 1PN3A 1PR9A 5LBIA 4MVJI 4CM5A 4MB6A 4REQA 1UDRA 1JB1A 1LFDB 5HOQA 2GARA 4D4JA 2J31A 1E7WA 4Y9SA 3WB1A 1YBFA 3ELDA 4QUEA 2BZSA 1APBA 3OZTA 2MYTA 4ENRA 2BM0A 3UXMA 3KKMA 4QC2A 3HWSA 1NE7A 3ROKA 1W49A 5HRUA 4W5QA 4XFJA 3TG8A 1A7AA 1XDDA 1HH4A 4C4SA 3RWMB 2HQOA 3KL4A 3QFTA 4R83A 1U80A 4FFWA 2HF8A 3HBAA 2NW6A 3QWBA 4A5OA 1T9AA 3DYVA 4WESB 4BRUA 4OX9B 1QANA 5EXSA 5G0TA 4TYQA 3VJLA 3DTVA 2V1UA 3ZY4A 3ICEA 4D99A 5KVCA 4QLAA 1C9YA 3NG1A 3OIDA 3K31A 3H7AA 4GBJA 4HGRA 4QO7A 1SD2A 3AW9A 3VU8A 1PF7E 2JEOA 3M6UA 3C6XA 5JNTA 1Y37A 2XUQA 1JUDA 4PBSA 5AM0A 4X1IB 1U7OA 2GSDA 1T8YA 4B80A 4EM6A 1LPMA 4CPDA 4YXWD 4UVHA 3ANNA 2OECA 1FNMA 1M9NA 4M9RA 2J5QA 1KK0A 1XQWA 3DV2A 1JIJA 3LW7A 3VKUA 3ZK8A 3STWA 2BI8A 1MC4A 3VPXA 1XPUA 2O59A 3BKXA 1KHTA 1PEDA 3FPGA 3UHFA 1BE6A 4Y18A 4J4TA 2CMKA 1WXWA 1ORTA 2ZB2A 3J7TA 4PBTA 2AV6A 4UPDA 1QDEA 3RIHA 4A15A 2C9ZA 3T95A 2TRSB 2HK9A 4YAOA 2C57A 3U80A 2Q5OA 4E6EA 1FJHA 3COZA 4NMXB 5EHQA 5LQDA 1CF2O 4LAFA 5B7GA 4R3UC 2IUYA 4MQFA 3RC2A 1DGQA 5EJFA 3L92A 4MVJA 3V4SA 2JB9A 3A3KA 3SQNA 5AT1A 3L4BA 5AW3A 3NJRA 1T2UA 4BNYA 1USUA 4QYIB 5I5EA 4UREA 1B0PA 2FPUA 4FYMA 5B12A 4FLEA 5THXA 5LQKA 4MITA 4L0MA 4N5NA 3RC1A 2B36A 4FHCA 4ID9A 4RQBA 2DWQA 1B16A 4XLLA 3RU9A 1T36B 3FUVA 3WTCA 1E6KA 4A4DA 2E85A 2YY7A 5C1BA 3ADBA 1RC1A 5CYPA 3KLPX 4OSOA 4IH9A 4YP7A 3OU7A 4KO8A 3V8EA 1JR6A 4ARAA 1W2WB 5JWOA 1RWQA 1FCJA 1JEYB 3NAGA 5F7ZA 2XCIA 4BCBA 1YFJA 4MX8A 4KTTE 5BVGA 4LCEA 3QV1A 2HV9A 1JA0A 1VLQA 2OHHA 3HVIA 3IILA 4DJDC 3W78A 2C97A 3DFIA 4BZZA 4EKIA 4IICA 1BVUA 5I3ZA 2I78A 1X8LA 3L18A 4O6VA 1E9DA 2JJ2A 4UQOA 4P5DA 3NC0C 4QTUB 1WPXA 1Q19A 4OCZA 1MUUA 2Z9CA 1FXWA 1OXMA 3H99A 3QVSA 3ZCTA 4IIGA 4UDNA 4XGQA 3BRQA 4F86A 4RDXA 1NZJA 1V5FA 3M3DA 3TH5A 1UFVA 1TJNA 3F7MA 4UAVA 1FXSA 1MDFA 1Z2CA 3V4ZA 3MEQA 3TNJA 4UTZA 3WXMA 3WIVA 1USWA 1IBSA 1U3GA 2K7ZA 4FDLA 1Z6AA 1MRNA 2OWDA 1M6NA 1GG9A 2ODAA 1WJGA 1WXEA 1A50B 1XAIA 3E81A 3QG5A 1VJ1A 1XTJA 2D5CA 3AZQA 4I50A 1Z6TA 4WRRA 4YMGA 5K01A 1A9PA 2ECQA 1V4BA 3PFKA 2H5EA 3EC1A 1E6UA 1UXJA 4OBEA 4W8OA 1OPRA 3W9YA 1YVRA 2W2XA 2YFHA 4P38A 2BDTA 4AU1A 3GAMA 3P2OA 2IP4A 4EENA 1TTTA 5A3JA 1C1YA 1UKYA 1OE0A 2GESA 2QE6A 3PR3A 4NFHA 3WGIA 1LD3A 2FF7A 1RBZA 3NI2A 2PJUA 3GVCA 4XWTA 2FZEA 4QUDA 4R31A 3FVRA 2EYUA 1B2LA 4RMNA 2PAAA 4OYYA 1RACA 1Y1KE 4HG2A 4KMRA 2IVFA 3AF2A 3TNDA 4C6TA 5MN6A 1X7YA 1IUKA 4NG4A 4QAQA 1V6CA 2W22A 1KBZA 2E82A 3K9NA 3KPWA 4E5YA 3V00A 1I6MA 3RYIA 3NV7A 1U28A 3CBQA 3JD0A 5KNCD 3PITA 4BTEA 3ICQB 2NO4A 1KQNA 3L8ZA 1ND5A 3N2GA 4AROA 3R9XB 4WXMA 2QQGA 3V8BA 2CBXA 1SR8A 2XMGA 3L07A 5F5XA 5LMZA 3AR7A 3DUWA 3TEFA 4DR5B 3MOSA 2PZGA 3JYLA 4L08A 3AUUA 3OQIB 4EPTA 1QV7A 13PKA 1XT6A 4G36A 2PGLA 2V7QD 4Q9AA 5JWHA 4HDCA 3O7MA 4WNCA 5KSYA 1ZR4A 4KE7A 2PZLA 4MIEA 4CTOA 1Y6GA 5I9SA 4P7GA 3OCWA 4MCJA 4Z9FA 3H9QA 1WXIA 1O7JA 2J3DA 5LQMA 4B1FA 1XQ9A 2BLLA 2P4QA 3FHOA 3G5MA 4LBVA 3IDSA 3SXPA 3UGKA 1YDEA 2XTJA 4PC3A 3KFLA 1NW5A 4JJGA 3K1AA 2G07A 4BJ5A 3T3IA 2VCEA 4ZKDA 3NHZA 3SJUA 1THTA 4V3BA 5CEEA 4YMHA 2C94A 1EFRA 1UXIA 4W9MC 3A3NA 1EP9A 1NVMB 4EGFA 4F2PA 2TS1A 4FDUA 1XMOB 1XAHA 1CWUA 2HHCA 4K9OA 2RGGA 2OB2A 3D8NA 5ICSA 1R1DA 4X6XA 2FUNB 3O9MA 2ZT8A 3ROXA 1H69A 2QTHA 3S28A 4BQRA 3L5KA 1CUXA 1RWBA 3QMWA 1YCHA 2VJQA 4RPCA 3T7AA 2AUNA 1XN4A 1I5RA 1FSPA 3ONFA 1YVUA 1XTKA 3AEQA 1JNXX 4MPJA 4OFXA 5HZMA 3HU1A 3X1XA 1Z07A 2ZTUA 4G0XA 4ER5A 1QP8A 1L5GB 4JZKA 3RIGA 2G72A 1P0CA 4NBWA 4P0QB 3TLEA 4J07A 4B2LA 5E1MA 5FBKA 3TL2A 4NG5A 1NBWB 3OKCA 3LU1A 3N8DA 3MJVA 3FTEA 1GRCA 1P45A 4CI0B 3EBPA 3JPYA 4INOA 4RMIA 2O8CA 3D1JA 1XAGA 1N1EA 5DLYA 4EZBA 1RWVA 1JJ7A 3HCAA 2OV1A 2QMQA 4Q0MA 4GM4A 1NONA 4XJXA 5AOBA 5KOJB 1FOEB 3GJXC 4QICA 4WPGA 5KYYB 3DCYA 1YS4A 3LK6A 5CNKA 1RQGA 2E4VA 1UBNA 4CQJA 4I4CA 2YYSA 5FHQA 1E9AA 2W4QA 1VHWA 1TC1A 3A9SA 5BR1A 1CUBA 1PEAA 2DUUA 3CGWA 2BFPA 4LX8A 1W1IA 3GWZA 3SM9A 2FOLA 1GUFA 3KB2A 4NY1A 1W7AA 7MHTA 2B69A 5KMGB 4UFPA 2WIKA 2Z5LA 1NQWA 1DIOB 1DRKA 3DB1A 1IPHA 2A0FA 3DJFA 1ZJJA 2WTAA 2XH8A 2G6TA 5IJXA 1DAHA 1U8YA 1WBBA 3I28A 1XJWA 4Q4CA 1ZD2P 3PLRA 1QRRA 3PNSA 4NE2A 2B3DA 1A5BB 2BFEA 3GA5A 1YZTA 2GA9A 4Y6GB 5K8VA 1GU7A 4I4TF 3WB9A 3Q9NA 5BW5A 2RHBA 3EDQA 1ZJ5A 2PSJA 4EI7A 2P0YA 3O95A 1BXGB 2IDZA 1TJ4A 4FZ5A 4DQDA 4DR4B 1XRSB 3H1EA 1TUGA 3L6BA 1E1MA 1CYDA 1NXTA 4HQFA 1AHIA 3TD9A 5H83A 1TVKB 2YWBA 1TD9A 3CPJB 3KR2A 1ZKDA 4OFBA 3O1HB 1E8MA 3F7NA 3ZKWA 2HJSA 4V2UA 3H65A 4QT0A 3BE6A 3J81k 4LISA 5H81A 3VYWA 1IMJA 4EHBA 2BTQB 3QJYA 4WN9A 5T41A 4F2GA 1TCBA 3E23A 4K40A 1P81A 4MUNA 7REQA 1A8UA 2ZYIA 2EP8A 4RD4A 5IK2A 4YASA 1UKAA 2UVDA 2J87A 3NETA 4DT1A 3ZXYA 4KNVA 1QHHB 2I6QA 2ZJ8A 3EC7A 3I6QA 3SC3A 3WP0A 2J9FB 2WFMA 2B25A 1DKPA 1MC5A 4ENVA 2DQYA 2YMPA 4BP1A 4HNRA 4M36A 3GPDG 4LRUA 5LL6P 1N5JA 1QSGA 4CF7A 3A11A 2ZUSA 4TKMA 3S2YA 4J0CA 1WQ3A 1LK0A 3TXYA 5AKYA 1J49A 4PEVA 4QPDA 1Q7EA 3L0IB 4HL6A 3LF2A 4RW0A 3SM3A 3UUGA 1P0MA 3ZWWA 5JZMA 1SG9A 4FKMA 2RAFA 2ZI6A 3SIPA 3T7SA 4DCTA 4JYAB 3IR6A 2O8NA 3QUBA 1YTUA 1JJFA 1F8YA 1XVLA 2O1WA 3BB1A 5T8KC 4FLFA 5EJEA 1MOPA 2QVZX 5CPBA 2CV1A 2I33A 1CY1A 1D2CA 3GELA 3BZBA 3H1BA 2MCFA 1VL8A 4GMDA 4TKZA 4DB2A 3PR1A 2BFCA 2PGIA 2BZ1A 1UWKA 1BGVA 2FMKA 2PRKA 5C3UA 5DLQC 1CVRA 1T6XA 2WA2A 3G49A 4NYJQ 5FI3A 4KL8S 2JIPA 4X84A 1KKLA 1WS6A 3KLNA 2J08A 3G5LA 4MS1A 1CW2B 1VIYA 1OU4A 2APJA 2X41A 3B51X 3O2JA 4OUDA 1SH7A 3RSFA 2OP0A 2WC1A 3WLPA 4B3CA 1YKSA 3LGAA 1N4DA 4MUFA 1C80A 2WJYA 4YROA 3VZRA 1MTOA 1VC2A 3ZS9A 2FFRA 1YJAA 2HQ1A 3L7OA 2GYWA 2HIHA 1IY1A 1YZFA 1EESA 2GHIA 3E82A 4E4TA 1JDPA 3BKWA 3V7YA 4BL5A 5JD5A 1Z4NA 3ECAA 3T34A 3ZDDA 4LMPA 4JYMA 1JG7A 3CUKA 3ZDRA 1VI5A 3PQ5A 1DKQA 2RCNA 4P93A 3ZDQA 1DAKA 3LUBA 3UXEA 1GZDA 4TLMB 3GFTA 3NVKI 5MFZA 4KWIA 4RD1A 1UKZA 4LXYA 3UFXA 2OA0A 4O2BB 2VJMA 5GM2A 3IA7A 3J80A 4O8CA 2GHRA 4GLBA 2A7QA 2UYYA 1G9TA 2IELA 3IXQA 2O2JA 3HO8A 4X1KB 5JAQA 2HEGA 2Z6UA 2WD8A 2QR2A 3JU3A 4YJGB 5DJ5A 3U4DA 1JYEA 3B6EA 4OY3A 4FYKA 4EUHA 4WI1A 3FFXA 1M2OB 2IXTA 4G0ZA 5AJVB 1Y8QA 3EARA 4MVJD 1XKXA 1RHRA 2P9CA 1BO6A 2I7CA 3EF1A 2JGRA 5LYJA 4CMEC 4BWVA 3V97A 4DLLA 2HDHA 3TW6A 1RJFA 2VJCA 3IBGA 4QG7A 1Z45A 2YC2C 2Z8YA 3FFBA 1W4BA 1Q7BA 1VPDA 1JU9A 2WWIA 4D92A 1XDWA 4L75A 3I2HA 1RI4A 3W5HA 1VJTA 3DXZA 3THWB 3KJFA 2PKRA 2H65A 1YR9A 5JDCA 4BPRA 5CK4A 2JLWA 2HI0A 4X6LA 2A67A 1XZIA 2JGJA 4U7JA 2FZ4A 4DMHA 4JUBA 3DL7A 2XXJA 4H77A 4LNAA 4PO3X 1C0PA 2X42A 1JFFA 1H2WA 1JR2A 1L8QA 3MSCA 3L1UA 3HBFA 4ZO9A 4CL2A 2IX3A 1I7DA 4ZO7A 1TE2A 4ND8B 2RBGA 4FFBA 5JSYA 2FEPA 4I8XA 2WF6A 3NM4A 1TM1E 3K9QO 2JJ2D 2QBYA 1NKSA 5J47A 2B1RA 5JPCA 1V16A 4KYVA 4QNMA 5IN5A 5DP2A 3BDAA 3AV0B 2GERA 1KFEB 5JVDB 4JGBA 2P2GA 1KJZA 5ESDA 3TUIC 4E31A 2YWHA 4LF8B 2QORA 5HRCA 1I9GA 4GYJA 4MI1A 1OYOA 1R9GA 1ECJA 3ENVA 3NDJA 1WUTA 1OFIA 1TA9A 1K92A 1WE2A 3A04A 3AEKB 4QPZA 2LTAA 4TV9A 1H0HA 5JATA 1I2AA 5E3JA 3O4GA 2EKDA 4BNZA 1MPXA 1RKVA 4JLKA 5A2GA 4E88A 2W6CX 1E6MA 1VFPA 4P53A 2BFMA 3WXBA 3TMKA 3AB8A 2P2DA 3NONA 2YC4C 2DPLA 3R3JA 4RLSA 3IUQA 1QLWA 3P2KA 1PR2A 4G6ZA 4BFSA 1NF8A 1LBQA 1SIWA 1IXKA 1GNLA 4J7CA 4ZD6A 1BXRA 5LP6B 1E1LA 1QRAA 4AY4A 1KYYA 1EP3B 3TDNA 2H7XA 4GOOD 3EULA 1C0IA 1G19A 2JAXA 1CJVC 2XA1A 3T41A 4HVLA 4GRAA 4A91A 1KFJB 2VS1A 1MLDA 3KBBA 3IAAA 1U0OC 2I65A 4WA7A 4DTCA 4NMMA 5BR4A 3GY0A 3B6JA 4N18A 1ZGBA 5DWQA 3IHWA 4PPYA 1NPYA 5JISA 5A7FA 1CFZA 4D9FA 1RAEA 2XAUA 3UJCA 2HT6A 1RYEA 5JAPA 1EGAA 2BMFA 4X92A 1A4UA 1FFWA 1KYWA 1QZ3A 3I2FA 5FPKA 1UODA 2ERYA 4MNTA 3DBVO 1PL8A 3QE3A 4JR1A 1YMUA 4F5ZA 3E7PA 1RADA 2FEOA 2N3ZA 3KSDO 3OZVA 4WK0B 1OR8A 3V8VA 3K2QA 2ZRFA 4BBPA 2F48A 5KB3A 3LX4A 3DW1X 4MS3B 2QUJA 4Y2PA 1Y5LA 3BK1A 3RHTA 5C7OO 2C4MA 3HBMA 4DADA 3DDOA 3FM9A 1FS6A 1RRMA 3D6UA 4F7DA 1Q1ZA 3UJBA 1CJTC 4X64B 3RI3A 3KFXA 3NALA 4M55A 3TXXA 2AE1A 1EFRD 2BGGA 2GPTA 1DKOA 2XSZA 3UV6A 2O0LA 1MJHA 4MR8A 2CLSA 3SS9X 3HGTA 3WLSA 4NZYA 1O6BA 1C8KA 2O6HA 3O9VA 2C42A 3QNWA 5CH8A 4N5MA 3CV3A 3WDMA 5IJZA 4IZHA 3VR6A 4J91A 5THQA 1F7VA 1CR6A 4QKQA 2PBZA 3AR8A 1WMDA 1X8XA 3ZK7A 3U7FB 3FCEA 1SCNE 1ZMTA 2OCPA 2NUPA 3Q2KA 2ZKLA 4P84A 4PZYA 3Q6NA 1UMBB 3RYHB 3WOHA 3ADCA 4Z7QB 2XBMA 3E84A 3AKCA 5U4QA 3T3MB 1Q1GA 3DVSX 3MINA 4ZAFA 4NI5A 2O3QA 3S1SA 1Y3BE 3D8SA 3D8RA 1EFHA 4LXIA 3X1JA 2AMFA 3U60B 2A0KA 4WL0A 2KW5A 4J0HA 1VRVA 5J5AA 4WSOA 4E22A 3BDVA 1MDBA 5JMWA 2LIPA 4H7EA 3VR1A 2H1CA 3ORQA 2X15A 1UBEA 3B7GA 5IVKA 4KQJA 1MX3A 1QHNA 5T4BA 1IXSB 1IM5A 1CLEA 3DF9A 1NHWA 2C29D 2JAPA 2XNDA 3EHEA 1PJ2A 4P33A 4L5JA 3OE5A 1GA1A 2I6GA 3VAZA 3ZWOA 4F12A 4AQ7A 1UK6A 1X70A 2XT9A 3VZPA 5CDYA 2OZLA 1EDBA 4N3NA 5DCWA 2JFFA 2C9DA 2ZIVB 4N1AA 4BAUA 1TB4A 2Y6VA 3JQRA 2PX5A 4XIYA 4HB3A 4KQEA 3W8EA 2HLPA 2OSVA 2QAJA 4PHTA 2AOUB 2QN7A 4PYIA 1EFCA 2CVOA 2XUZA 3K5HA 4LC0A 3RJZA 4OQEA 1IHYA 1CX9B 2O57A 4S1WA 5REQB 1DAIA 3WY9A 4XPZA 1XLWA 5TGTA 1K63A 3UK7A 1GNQA 2H51A 1WNTA 4P31A 4IIUA 2GCEA 3QKSA 3C39A 2YWEA 1WSDA 2DX7A 4UUOA 1GZVA 1I7LA 4HJXA 3VU9A 5JEDA 3EGXB 1M1UA 1ZIDA 1ZNQO 4P9NA 3ZTYA 3IUJA 4LXHA 2YV2A 4L3WA 5C1OA 5IKPA 2WWYA 3NVDA 4KQCA 3L0CA 3T06B 3B7PA 2ZRAA 1Q0SA 1SWWA 1WQ1R 2P9TA 5KJCA 1T13A 2XADA 2ZPTX 3GRVA 4R01A 1MEJA 4MPRA 1XTRA 1YB2A 5DU2A 1KGSA 4YJ3F 1DAPA 3NANA 1TQ2A 3N8HA 4HZGA 1U0NA 2ZGVA 5SZIA 2HCTA 3F5FA 1OZGA 3T35A 2PMFA 2YVQA 3L5OA 1G21B 1GKYA 1G8HA 1JIUA 3INRA 5JFOA 2OUKA 2DZDA 5CJ2A 1XYVA 2YZMA 5IK2D 4MVCA 2R68A 3P19A 1KVRA 1A2BA 4TZTA 4A1FA 3ABQB 3JQ9A 2ZYVX 1O95C 3PC3A 2AN4A 5LQRA 4JFRA 4DWVA 5JIBA 1QK4A 2R2GA 3G0CA 4H60A 5EHGA 3QLTA 1RPNA 3PD0A 1XOIA 3O31A 2J5RA 3QKRA 4ND1A 1EQAA 1KR2A 2C1ZA 2C78A 1W29A 3RAFC 4M0CA 3VDMA 1OWPA 3JRXA 1EAMA 3NTLA 3JQAA 1P7CA 3O5AA 1UMDA 2QLFA 3EIFA 3ADPA 3AIOA 3VVLA 3ZHOA 3EGWA 5BV2P 1ESCA 1EGMB 3NH9A 4HGQA 4XEUA 2VSQA 3ANSA 4AXXA 2D0DA 2G3YA 2WT8A 4H1WA 1Z0JA 1WTCA 3SR3A 5DSZA 1GPLA 1M6VB 2H16A 5DHFA 1K97A 3D2AA 5CAEB 3VA7A 4U6SA 2KS6A 1ORWA 4YAJA 2PCLA 4JX9A 1LRKA 3NDBB 2DETA 1LCIA 1WEKA 2DUJA 3C7CB 3WWOA 5A03A 1DRWA 1E58A 2WAXA 5CB8A 5K0FA 1C8BA 3PS9A 4MVJG 4ESEA 3ICCA 1ZMRA 1F3OA 5EIFA 2BKVA 1E59A 1X19A 3L46A 5L3ZA 2HRDA 1Y5MA 2OV4A 1TQHA 3P9RA 3QMVA 5JUWA 4HSEA 2BDUA 2GCIA 1I5OA 1HLFA 1ODKA 1RHMA 1O97C 3C1TA 4FT4A 3QSYA 4ZAXA 3EN0A 2G06A 2J09A 2OV3A 5DGTA 3JR7A 2NYAA 4BQFA 3I9OA 3NTUA 3CCBA 3FF4A 5CVVA 1XROA 4JNKA 4RADA 5LA6F 1X7WB 2G5TA 3SVLA 1R5NA 1NR5A 2GRUA 3R5XA 4KO2S 3K20A 1A9YA 3RU3A 4AZ0A 3NBZC 4EHFA 5A1TA 4X71A 4Y0NA 1PWYE 4C7OA 1CUHA 3LA8A 3W1EA 2BM8A 2B92A 4TVKA 2PKQO 4XD7D 3D59A 3IA2A 3UAWA 2HF2A 4J0JA 4CCYB 3I5UA 5LMCA 2ATXA 3L7JA 5HDQA 2V0GA 4CT4B 4UZSA 1W44A 4D9MA 5JXIA 1RXYA 1E63A 4NFYA 3OM1A 1DC6A 3QF7A 2OHXA 3U31A 1WVGA 3I3SR 4E5KA 4ZCRA 4KR7A 5I7UA 3ZDXB 4DKJA 2ERXA 4DPMA 2FP4A 5E7QA 4L0DA 3ACDA 1EHCA 1GP2A 1EFKA 4JYPA 1UZNA 1VRWA 2JIRA 1RQPA 2GZRA 5HQ3B 2ZCVA 4UULA 3FHJA 4BFXA 4X7BA 1U4SA 2XNHA 4OQFA 3JSXA 4QOEA 1EFPB 2FPKA 3LPMA 4HDRA 3TBKA 3TRIA 3M1LA 2D1QA 3H9EO 3QPAA 3QW4B 2DHEA 3H1TA 3ZWMA 1PK7A 3AJEA 1LEHA 1XZFA 1YL5A 3TTXA 2GCNA 1H94A 3H18A 4N6GA 1N2BA 4D4GA 3D3EA 2N46A 1YQXA 4YRMA 4Q1AA 1P31A 1QUEA 1XYYA 2CF6A 4IP0A 5DTQA 2QRVA 3N0WA 5AW5A 1SUAA 2C4NA 2O20A 4GQAA 4DA4A 1NNI1 1QBKC 4AW9A 3EDCA 5EQFA 3S27A 1KHHA 2P41A 2X22A 2HIAA 1UADA 2IUTA 4EY8A 4K7JA 3ETLA 4Q3LA 3TLBA 2RAPA 4OBXA 2I9KA 3VYVA 1OOEA 2UAGA 1HX7A 3F9IA 1O5OA 2OXRA 8AT1A 2C9YA 5AKIA 3VR2D 2J0EA 2BF7A 2Y99A 1B6RA 4Q1EA 4YRFA 5KTNA 4M54A 3GLIB 2H2HA 4Q4DA 3L93A 3UNXA 4AD8A 3EFHA 3A6JA 2A9RA 3V8MA 1S9DA 4MHOA 2V3WA 3JASB 1O0CA 1UJ2A 4C0QC 4DLZA 5JOQA 3U1BA 4U0JA 3W2FA 1EE2A 3C2QA 2GWRA 1B8UA 3NT2A 1MFZA 4PU0A 3ULKA 1UMCB 3OF5A 3Q6IA 2IFTA 1UP4A 3FWPA 4KUEA 3UEOA 1NU6A 1M6WA 5LQUA 4DLKA 3IESA 5AVUA 3WVNA 3EIEA 1NJFA 1X9IA 1R8YA 2NQ8A 3BXZA 3PUWA 5DGIA 5A9SA 1FPQA 4ZI7F 1KC3A 3MHTA 4B4VA 1ORVA 1F5SA 1H85A 1SIOA 1WXFA 1YIOA 1OA0A 2VUIB 2YXNA 1GPJA 1WB9A 1Z7EA 3VC3A 5D6NA 1SA0A 1U7XA 4WLEA 4L51A 2PA0A 4Q48A 4AP6A 4YJKA 3H05A 4J0IA 5BNWA 3PEEA 1B73A 3GJ3A 2QIOA 2CCJA 4Q19A 1YZYA 2XHEA 3HU5A 3R7FA 5JCXA 3FWHA 4PZUA 4IINA 2C5FA 4DMCA 3CXRA 2QT0A 3VZDA 2X9LA 2AJBA 3F3SA 1YDMA 2VP3A 1Q0TA 1DMSA 3MTJA 4YRDA 3NHPA 5ALNA 1V1RA 5JTTA 4MDYA 4JXJA 3PPXA 4TQ9A 1MB2A 5L3VA 2I3GA 1I94B 1WCXA 1J07A 3JWGA 4MCIA 4MUXA 4UCWA 4A8TA 4EUEA 1Z8DA 2CJXA 2QI9C 1PS0A 4EELA 3SOZA 3KU1A 1YL7A 1MAHA 2O2HA 5KYNA 4G0VA 1E77A 3FDZA 3MD0A 5JDIA 5B6IA 5HWSA 3HLYA 2QV7A 2I6SA 3BAFA 4NR0A 3Q5DA 3COSA 1IHUA 4BJ1A 1U3UA 1NLUA 1XN1A 3QVJA 4GPIB 1N7IA 1JHYA 5H9WA 3VPFA 1QKJA 4S2EA 4M0FA 1IVNA 4YA6A 3AFNA 2B82A 2JHGA 1Y5IA 4S1NA 3I9V6 4YLGA 4ZTZB 3DONA 1PGJA 3AWIA 1SQ5A 2AVNA 3WBBA 5DT2A 3ZE9A 4RENA 3EA5A 4PF1A 2XSZD 4LI3X 3USES 1GAJA 3MLBA 1JPUA 3JQ7A 3T9EA 4UE6A 4Y2UA 4F4HA 4Y6LA 5C8VA 1OGIA 4C4AA 2AOXA 3FIJA 2BFBA 1ZINA 3COVA 3DOCA 4JSRA 3LXMA 5EP4A 5GIPE 4JBNA 1L5NA 5AK4A 3Q3CA 5F12A 3CNLA 1NVVQ 3UKDA 1CZKA 3KTAA 3VR6D 1KY3A 1NXVA 1B6SA 1LC3A 3FSGA 4L4XA 1WKBA 5DB4A 1QKKA 1CP2A 3N2YA 4EKGA 1AX9A 5DNEA 3ZXIA 1OLSB 2PKYX 3BWMA 5ICGA 2Q7DA 3FAKA 1QF9A 2FKAA 1N32B 1C41A 4YMLA 2YVKA 4EW6A 2QAIA 2ZI7A 3DT9A 2PXXA 3UHPA 2YHIB 3CH4B 4GOLD 4EJ0A 1JL3A 1BROA 2W2KB 3OSUA 1Z22A 4GOJA 2B8TA 1YKGA 3F3MA