4E46A

Structure of rhodococcus rhodochrous haloalkane dehalogenase dhaa in complex with 2-propanol
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
293
structure length
292
Chain Sequence
b'IGTGFPFDPHYVEVLGERMHYVDVGPDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEWPEFARETFQAFRTADVGRELIIDQNAFIEGALPKCVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPALHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloalkane dehalogenase
publication title Expansion of access tunnels and active-site cavities influence activity of haloalkane dehalogenases in organic cosolvents.
pubmed doi rcsb
source organism Rhodococcus rhodochrous
molecule tags Hydrolase
total genus 105
structure length 292
sequence length 293
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2012-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4e46A00
3V1NA 4BE4A 1DWQA 3WK5A 1QE3A 3V9AA 5EI5A 5T4FA 2ECFA 4B9EA 3BJMA 3FLAA 1AMNA 1UK6A 3E3AA 1ORVA 4LYEA 5HF9A 3FYUA 4U2CA 1VLQA 2HA6A 1BEZA 2Y2UA 1VJ5A 5C8VA 5AKIA 2WJ6A 2VSQA 3D2AA 3BJRA 4FFWA 3EQ7A 5ALYA 2E3JA 2VJDA 2WHQA 2GZSA 1U2EA 1G42A 5CTAA 2BGNA 3STWA 5C81A 4LKOA 5LZ5A 1PFQA 2YYSA 1ZOIA 2Z3WA 5KREA 2XUIA 1R50A 4WFJA 2ORYA 5DJ5A 2VJCA 1H23A 2CEKA 4BC0A 2OGSA 4PF1A 1BROA 1GPKA 4DTCA 3IIIA 4GI1A 3C87A 5C7YA 5FKJA 3IVMA 2DQYA 2X76A 2PKYX 1QTRA 3PE6A 2XDWA 3WQHA 3HI4A 3WK9A 1D07A 1J06A 4OD0A 1MT3A 3CCCA 5LZ4A 1XKLA 1ZD5A 2WQZA 1MN6A 4BDTA 3TRDA 5AKLA 2WU3A 3WK6A 1XLWA 3IUNA 4Y2TA 2XQJA 2WFLA 2C0QA 2XMCA 3W9BA 3WZLA 4CCWA 1R9MA 3WZMA 5AKGA 4DM7A 1ZIXA 4KAAA 2FJPA 2WUEA 4BCDA 4BAUA 3WWPA 5AJHA 3RKSA 4B82A 4E46A 1FFCA 3ANSA 5AKXA 3R3UA 2BUCA 1Q84A 1QZ3A 2HA5A 1YS2X 3HLKA 4Y2JA 1HQDA 4CFSA 3SWWA 3WYNA 3VVLA 5IKXA 2JGJA 4AN1A 3QMVA 1VZ2A 3EBLA 1LZKA 1XLUA 1ZJ5A 1W75A 3ESDA 3STVA 4E15A 5ESRA 1HLGA 4QWWA 3W06A 2JGEA 1Y7HA 2DHEA 1CEXA 2Z8ZA 1DU4A 1GZ7A 1K4YA 2HFKA 4HTAA 1AUOA 4HXEB 3WJ1A 3G0IA 3K2IA 3R3VA 4OSEA 4FNGA 5FXMA 1XRMA 4H7FA 2ROQA 4ZI5A 4HXFB 3WYDA 2JF0A 1A8SA 3ED1A 1CUWA 1EVQA 4PQEA 5JASA 1EH5A 5ALOA 5JAHA 1R3DA 2QRUA 4H0CA 4J03A 4G5XA 3WI7A 4HZGA 4G4JA 2VTVA 3IUJA 1GQSA 5JZ9A 1UOOA 4RGYA 1UFOA 3AJAA 1VE7A 4U2EA 4N8SA 1WCYA 3BF7A 3G9XA 1BE0A 1RP1A 4QLAA 5YASA 1SCQA 2O7RA 1MAHA 5JADA 4PO3X 3PI6A 3WK4A 3FYUB 1P0PA 4IO0A 1UK9A 2BUBA 2G63A 2JGIA 1H2WA 3BF8A 5ISMA 1LLFA 1VXRA 2D0DA 3KD2A 4F5ZA 1CUBA 5CBKA 1EK2A 1Y37A 4N5IX 4B7ZA 3A2MA 3B3QA 1HDEA 3WL6A 4UHDA 4ZGBA 2GBCA 2V96A 3FBWA 5DLPA 2G5TA 1A8UA 3FVRA 4X90A 2VJBA 4GDMA 3DKRA 4ZV7A 5CRIA 2OAEA 3SK0A 1CUVA 1R4ZA 2P8SA 2XUQA 2ZJFA 2H7YA 3WLAA 4KAJA 2PVSA 4CIAA 2O7VA 3EQ9A 5LLSA 5DYTA 2Y1KA 4UFPA 2W22A 3IUQA 5ALXA 4QDXA 4B9AA 3H2GA 5A7HA 1ZIYA 1XRPA 4P93A 5K3FA 2WU4A 4OB6A 4BVJA 4ZXFA 4H7HA 3G9ZA 2I03A 1Q0ZA 3IDAA 1T4MA 5LKRA 5AKJA 2YASA 4EY4A 4W1SA 4I3FA 5AP9A 1BS9A 4Q3LA 1W4LA 4BTLA 1E8NA 2R11A 5A7FA 3M3DA 1HBJA 1C7IA 1HPLA 2B61A 1XZLA 4Y9SA 4M0EA 5LP1A 1THTA 2I78A 4FNMA 2PX6A 1W1IA 5DNUA 2HDWA 2XMRA 4ZREA 4FKBA 3C6XA 2XMQA 2AJ8A 5HKAA 4ARBA 2DHDA 3MUNA 3LIIA 4F0JA 1DWPA 4MJ3A 1HL7A 5T4EA 3O4IA 3ZWQA 5CT6A 1LBTA 2CMFA 4JYMA 2QMQA 5JZSA 2VQ6A 1A88A 3ZLUA 1GT6A 4FLFA 3OURA 5FDFA 4U2FA 3AZPA 5EIEA 5KWIA 4JH0A 3WKEA 1YA4A 4Y2VA 4BCCA 1ZGBA 5LZ9A 1H2XA 2J4FA 5AKYA 3BWXA 1L7RA 1CV2A 1UKCA 4W9RA 1GXSA 4QE3A 5CH5A 2DSNA 3DD5A 3GA7A 3TEJA 4DIUA 3VKFA 4U2GA 1VZ3A 1JT2A 2WTNA 3I1IA 4P08A 4FLMA 3X3HA 3O4GA 1TCCA 4EY8A 4CG1A 4W1PA 4J0DA 2ZYHA 1MPXA 3NUZA 3ZPXA 1UKBA 1F6WA 2C0PA 4IHAA 4X85A 4EZIA 5K3DA 3DLTA 3NGMA 5A2GA 2QXTA 3Q8WA 1LPOA 2WG1A 4BE9A 3G0CA 4K2AA 1VA4A 2HRQA 4HVTA 4GEGA 1PV1A 1X70A 4AO6A 3DYVA 3STXA 4BBZA 2GBGA 5EIHA 2X8BA 2OCKA 3I28A 1CUJA 4UHEA 5H3HA 2WUFA 4QEKA 4XWGA 4G9EA 3BDVA 4HRYA 1FFDA 2O2GA 4BZZA 3WKAA 2XMZA 5ALHA 2DQZA 3EQ8A 5ALDA 3FAKA 4DMKA 1YS1X 4N8DA 4Q82A 2PU5A 4EY7A 3VISA 3WK8A 4EB0A 4UBKA 4K6KA 1MTZA 5AM1A 1ACJA 4UFOA 5ALGA 1L7QA 4B6GA 4AO8A 4H18A 4AO7A 2DFPA 3ZI7A 3W04A 4UBJA 3RM3A 1XZEA 3A2NA 2JGLA 1W76A 4AN0A 5CT9A 1I6WA 3PICA 1SFRA 2GZRA 2XUFA 2HADA 4DMHA 3OC0A 4KAFA 2Z8XA 2WIGA 5AI6A 3HJUA 1LPSA 1ZJ4A 3WIOA 3AILA 4HRXA 1XRQA 1A8QA 3R3YA 1R9NA 3M83A 5K3FB 5BV7A 3Q0TA 3O9MA 3G9UA 3KXPA 2HU8A 1FJ2A 1XLVA 2PSEA 5CURA 5K3BA 1UOQA 5I7UA 5JARA 4DLNA 3KSRA 3HYSA 3E0XA 1QIFA 4G4IA 2QXUA 3HABA 3ESCA 5LYYA 3G7NA 2OPHA 5JIBA 5E4JA 3I2GA 3VVMA 4N5HX 3PDCA 5AM5A 3QBJA 5T4BA 4U2DA 5FPPA 3U1TA 1FSSA 2XUOA 1B6GA 2B20A 4CG3A 2I3DA 4H7JA 4WFIA 5AK5A 3U0VA 2CBGA 3R0VA 3BXPA 2XQGA 1ZI8A 3D3NA 4QDUA 5ALNA 5EHNA 3G0BA 5SYMA 3PFCA 1QLWA 1XQVA 4BTVA 4K6HA 4NVRA 5E4YA 1THGA 5HZGA 3WWCA 4QDZA 1F8UA 5JATA 2Y6VA 1ACLA 1UWCA 1K5PA 3C6ZA 3CN7A 2RONA 3ZV7A 1MX5A 4WY5A 5CMLA 2ONCA 3S2ZA 3HXKA 5JD5A 1ORWA 3LIPA 3LS2A 4AMYA 1EDDA 5LIPA 4GW3A 1WHSA 4X97A 3WWEA 1YCDA 2UZ0A 5JYCA 4OUKX 1CFJA 3DJYA 4M0FA 4X6XA 2ZSIA 4S0XA 3GBSA 5CT4A 1AURA 1YSCA 4CCYB 1OXMA 4FBLA 4H7DA 5DTIA 5AIBA 2VT7A 2PUJA 5EHZA 5J3JA 4WJLA 2XLCA 4QNNA 4F60A 3WL5A 2AXEA 2PSJA 2VEOA 3C5WP 2JGFA 5ALSA 1CRLA 1YR2A 5CXUA 1XQWA 4MEBA 5E2IA 2VATA 1DQZA 4Y2SA 4BZWA 1GKKA 1QIDA 5AM4A 4UHCA 4ETWA 3DQZA 1IUNA 4Y2XA 3FLBA 4K5QA 4FHZA 5AOCA 2VF2A 2CKMA 4YK7A 2C7BA 4Q34A 3WL8A 4LIPD 3AZQA 4KYVA 1AC5A 1N5MA 2Z3ZA 4C4XA 3LP5A 3R3WA 3FSGD 4WDRA 2XT0A 4GHWA 4DSZA 1ODCA 3EF3A 5DNWA 1QOZA 3H2HA 4JUIA 1EXWA 4PSDA 5AI8A 1C4XA 2HM7A 2PPLA 1U4NA 4AX4A 5DWDA 2K2QB 1BU8A 3RARA 2QJRA 1BN7A 1TCBA 2PBLA 3DOIA 2QM0A 2OQIA 3A2LA 2C5GA 2O2IA 4QA9A 5ALMA 5D6OA 1QIHA 2AJLI 4HAIA 1QTIA 2XUJA 3D59A 1QJ4A 2PUHA 3FLEA 4PSCA 5IVDA 5K3EA 4GXNA 1VXOA 3STTA 5KWJA 3F9CA 5JANA 3GFFA 3DDUA 4DYHA 1UZAA 1EDBA 5AOBA 2XB6A 1L7AA 2PU7A 4L9AA 2OAGA 5ALJA 2X5XA 4ARAA 1QIIA 1F0NA 2WHRA 4Z49A 5IVIA 3F8SA 3GZJA 1JU4A 5FRDA 3HACA 5D3ZA 2WILA 5BWCA 4HXGA 2HA3A 1CUIA 1CPYA 1MX9A 5A7GA 5KBYA 4CI9A 2EEPA 4EUSA 3O4JA 1Q83A 5ALZA 4FBMA 2V97A 5CT5A 5F4ZA 2AJCA 2J4CA 2RHWA 3T52A 1H2ZA 1E89A 4EBBA 3DYIA 2OCIA 2ZYIA 3JYHA 1CUXA 3G0GA 4KRXA 4A16A 3OPMA 1MU0A 2EDCA 3IURA 2ZVDA 2BKLA 4IH9A 3FSGA 1MNQA 3F97A 4DNFA 3NWOA 4G1FA 2XMGA 4WFKA 2XUKA 3H2KA 2PSDA 1T2NA 1ZD4A 3G8YA 1TK3A 1BEEA 2WUDA 4X94A 5AKHA 1CUEA 2CJPA 1ETHA 1Y7IA 5AM0A 1SCIA 4UBLA 4C01A 4B0OA 1DX6A 3WKCA 1BCRA 1ODTC 4B0PA 1QIEA 4X91A 5JAOA 3H04A 4GBGA 2WFMA 2C58A 2RHTA 1XZHA 1UXOA 2BUAA 3UUEA 1ISPA 5AK3A 2QUBA 3CCBA 3RLIA 3JWEA 5AOAA 4H7KA 4MWTA 4JEIA 4MXDA 5EIAA 5HF6A 4LYDA 1QIMA 4BC1A 3WJ2A 4W63A 3DL4A 2XE4A 5DYYA 1W52X 3D5EA 3C6YA 1WB6A 3T4UA 4DMCA 1SCKA 2V9ZA 3ICVA 1R88A 1YA8A 2BFNA 5JZBA 3KWFA 5HQ3A 3I2IA 1ZD2P 4XJVA 4IQ4A 3MVEA 2OGTA 1S8OA 1WM1A 2PSHA 1MJ5A 1CLEA 2BGRA 1CUDA 2I3ZA 2XQKA 2JGMA 2QR5A 2XLBA 1E66A 1O6FA 2LIPA 2EDAA 4LXIA 4J0CA 3UUFA 3WA7A 2G4LA 1JU3A 3H2IA 1X2BA 4KE9A 4U2BA 3L1IA 3ESAA 3G9TA 4PV7A 1UK8A 2H1IA 2RAUA 3I1YA 1WHTA 4Q05A 4BRSA 5T4HA 5AKKA 4X3CA 4J0GA 3OTQA 2VJAA 1Q0RA 4B83A 4AXBA 1WB5A 1E8MA 2DHCA 3O0DA 2WKWA 4X6UA 2WSLA 1USWA 3IULA 1G66A 1AX9A 1CUHA 1JJIA 2WG2A 3WKBA 3H17A 4B85A 2WIKA 4X92A 1SOMA 2ZJ6A 4XVCA 5JAPA 4X7BA 1LZLA 3F96A 4AMZA 5FOQA 1ZGCA 3PF9A 3EIOA 4NZZA 3I6MA 3ICWA 3WMRA 5AKZA 1DINA 4OB8A 2BCEA 1PJAA 1KEZA 4CCYA 2WHPA 2XQIA 3L1JA 4RE5A 4H7EA 2FJ0A 3QPCA 5SYNA 1VKHA 5LKAA 5IVKA 3E4DA 5AIAA 1P0QA 4OB7A 4Q3KA 3C5VA 2VA9A 3DL7A 3H1AA 3PF8A 5HFAA 4M0MA 3ZLVA 3G0DA 5ALTA 2QKYA 2OGZA 3PUHA 2DCMA 3AUKA 1QO7A 2C4HA 2JIDA 4X93A 5DNVA 1XKTA 2CB9A 3IUMA 2H7XA 3V1KA 4CIBA 4UHHA 4KACA 4UHBA 4OU5A 3C45A 1NU6A 5JAUA 2Y2VA 3O95A 1QIKA 3GROA 4EHBA 5LZ2A 3W2TA 1DT3A 3KDAA 4Q3OA 1ZI6A 5JD6A 3I6YA 3CXUA 4ZV9A 4G8DA 1IVYA 2XUHA 1MNAA 4LXHA 3FWHA 2W6CX 2XUDA 3K9BA 2XMSA 2QT9A 4O08A 3AFIA 1WPXA 5CW2A 5ALQA 4BATA 3VDXA 3C8DA 3HZOA 2V98A 1U65A 3HC7A 5ALPA 3ILSA 3BIXA 3AINA 5FPQA 1B41A 4X71A 5ALWA 1XRLA 1P0IA 5AM3A 5HQ3B 2GYUA 3QITA 4I19A 2QOEA 1JI3A 3OOSA 1CQZA 2XUGA 1EINA 3FNBA 3HEAA 2IIVA 2O2HA 5BWBA 4C6HA 1GGVA 3I2JA 4B81A 2WJ4A 2GYVA 3QZUA 3BIWA 1E8DA 3WIBA 2GYWA 1QIGA 5AM2A 5AI4A 4UUQA 4FFVA 3I2KA 3C8HA 3QPAA 1NU8A 2XMBA 4KJXA 4AZ0A 4BRZA 2G5PA 3QMMA 1LBSA 2HU7A 4J3JA 3LLCA 5AO9A 4BVLA 4J0HA 2GBFA 3O9VA 5D3KA 3H1BA 1AZWA 4ITVA 1J07A 4BAGA 1KU6A 1QGED 2VT6A 3S8YA 4GECA 2JEZA 3QM1A 3HRHA 3F98A 4KRYA 3D2BA 1QFSA 4G9GA 5HF5A 1XZJA 1LPAB 3STYA 3D2CA 2PSFA 4TPKA 4UFNA 1HKHA 4Y2YA 3MGAA 4C89A 5ALIA 1C7JA 3UMJA 4QDOA 3QVMA 4I4CA 2XMDA 1X2EA 1O6GA 3B5EA 1FFBA 7YASA 1JFRA 2WHPB 2B4KA 3WKDA 2HRRA 2J3QA 1YB7A 1UK7A 2VAXA 4CG2A 2QVBA 4W1RA 4WCVA 3FCXA 3W05A 1IUOA 4FLEA 1W6RA 5AKEA 5I8PA 4RNCA 4G8CA 5FLKA 1CR6A 1UKAA 1CUZA 2B9VA 4BVKA 1GPLA 2PL5A 3MUOA 2WIDA 1CIJA 3FYUC 4H77A 5AK6A 4DNOA 1XQXA 1BCSA 5C8ZA 1M33A 2JGKA 4DSAA 3CN9A 1CUAA 3JW8A 1GQRA 5K3CA 2RI6A 4NMWA 4PSUA 1QONA 3NOXA 1EVEA 1EK1A 2AJBA 2ZSHA 3I2FA 1J2EA 1CQWA 2QTBA 1JMYA 3V1MA 2QS9A 2WLSA 3TGLA 3BDIA 2JBWA 5BOVA 1WPRA 1XZGA 3F67A 5AH0A 1EDEA 2H7CA 1XZKA 1IZ8A 3PFBA 1P0MA 4TVKA 3AIOA 2WJ3A 3FOBA 2HU5A 2ACEA 1K6EA 3R41A 3R40A 1BRTA 3VJLA 4E11A 4UBMA 1YASA 4H35A 4DNQA 2HA0A 1RYYA 3W9UA 1Z68A 2ZJ7A 1JMKC 5FUMA 1SC9A 1LPMA 3M81A 3ANTA 4Y7DA 3H0CA 2ZYSA 4QZVA 3QYJA 5ALVA 1U8EA 1CVLA 4L0CA 1E3QA 4MEAA 5ALEA 3IB3A 3GELA 1XZBA 3WWOA 5DYWA 3WL7A 3BE8A 1GPNA 1YB6A 4B80A 4RE6A 4KE6A 3DNMA 4UBOA 2RGUA 1MO2A 4OU4A 2J3DA 2WM2A 4KEAA 3FVTA 4C4ZA 3H2JA 3RK4A 4AB1A 4ZWNA 1WOMA 3DKKA 4XIIA 3VJKA 2Q0XA 5EHQA 2YXPX 1IZ7A 1TIBA 1AQLA 4FWBA 1LPNA 4UPDA 4DNPA 1ZI9A 4AQDA 5EGNA 1LPPA 3YASA 4DMFA 2AJDA 5ALRA 2OCGA 1AGYA 1AKNA 4LHEA 5IVHA 4C4YA 1H22A 2FX5A 2OXEA 4BYMA 1K8QA 3O4HA 4P9NA 3VXKA 3E1GA 3H19A 1F0PA 5HK9A 1TAHA 2XUAA 2Y6UA 5ALFA 1N5RA 4L72A 3A6ZA 3PUIA 4J7AA 1DT5A 2ZYRA 4G8BA 1DWOA 5E4TA 1LGYA 2WTMA 4N8EA 3DS8A 4RPCA 4X6YA 4EY6A 4MQMA 1EA5A 1QIJA 5EHXA 4WY8A 1DX4A 4YASA 3P2MA 1EHYA 2GBIA 3R3XA 4UHFA 2VAVA 1FFEA 1TQHA 2XQFA 4BAZA 5HFNA 5CH3A 4X00A 4BB0A 3G02A 5CT8A 4C88A 5K5EA 3DOHA 1BN6A 1IUPA 1NX9A 2OG1A 4TGLA 3LCRA 1A7UA 1RWQA 2BAGA 3DCNA 2WFLB 1K63A 3WK7A 3AZOA 1VA5A 1QFMA 3ESBA 2RIPA 4J0IA 1DQYA 2CZQA 2OLEA 1QO9A 4KE7A 1FFAA 4OCZA 3SX4A 1YAJA 3B12A 3ZLTA 1XZIA 2FUKA 2HHAA 5AK4A 1EI9A 4DGQA 2IITA 1XZDA 1CUFA 1XROA 4GWLA 3IA2A 3C6BA 1VE6A 2XI4A 2CUTA 2ACKA 1JJBA 4PW0A 4BP9A 4A23A 1H2YA 1G5FA 5HK8A 4JNCA 3C43A 4KE8A 3H18A 1ZD3A 4FMPA 4W1QA 1CUSA 4MQLA 1JJFA 1CUUA 3D0KA 3I6ZA 4OPMA 1XRNA 3C70A 2R8BA 1CUYA 5ALKA 1YAHA 1EX9A 4J0JA 4QLOA 2QJWA 1ODSA 1KU0A 4PNZA 1CUCA 4UBIA 2C5FA 2OCLA 5D7BA 1XQYA 3HSSA 1ZICA 3WWDA 2BJHA 4Y2PA 5LZ7A 4KR0A 4A5SA 3L1HA 4FTWA 5ALLA 5CH8A 5CXXA 5FP0A 5JD4A 3KWJA 4HS9A 1TCAA 4EY5A 1XZCA 3FYTA 4YPVA 5ALUA 1XFDA 1XZAA 1VOTA 5DTJA 3K6KA 5C8XA 5LZ8A 4JYPA 2XUPA 5AI5A 2WFZA 5AHXA 3N0TA 1E5TA 4BDSA 4J0KA 3M82A 1OILA 4QWMA 1XRRA 2QUAA 4B84A 1R1DA 5JALA 4WDQA 4QDTA 1J1IA 3I2HA 4Y2UA 4AZ3A 4YX9A 5AI9A 3QMWA 4F21A 4C87A 3A70A 5A62A 2DR0A 2IX9A 2PM8A 3WA6A 3N2ZB 2QZPA 2D5LA 2WIFA 4E14A 5EFZA 4OYYA 4Q1VA 4BCBA 4UBNA 2HL6A 4MWSA 5AICA 4LXGA 4K6GA 3V1LA 5A6VA 3QPDA 2ES4A 4GLBA 4BP8A 4G4GA 1TKRA 2HIHA 3D4LA 1XZFA 3GUUA 4Y2QA 2HA2A 3FCYA 4XX1A 1EB9A 5IH7A 4INZA 3BL8A 3OM8A 4V2IA 2WUGA 4Y2RA 4FDMA 4OYLA 1N1MA 5HKBA 1DTEA 3V48A 5HF8A 5HCUA 1N8SA 4EA6A 1MX1A 5FV4A 1GKLA 4ZRDA 1XZMA 4ROTA 3R3ZA 4IH1A 2OQVA 1LNSA 3TJMA 2HA7A 2HFJA 4L3WA 4X95A 1WB4A 3IBTA 1LPBB 6YASA 3DEAA 1JKMA 1EB8A 3AIKA 3D7RA 2WG0A 4FOLA 4IH4A 4MYSA 1UOPA 4NS4A 2JEYA 4P92A 2NW6A 5AI0A 1OCEA 1UT6A 1G4HA 2HA4A 3QH4A 3STUA 3OG9A 2H9YA 2YH2A 5A71A 4H7IA 1TRHA 1MAAA 2WIJA 2Z5GA 5I9IA 3VJMA 4MYDA 3KOOA 1IMJA 3AIMA 5K3AA 3SC2A 4D9JA 1CUGA
chains in the Genus database with same CATH superfamily
1P1IA 3V1NA 2JC3A 2P5TB 2HK9A 3EEFA 2ECPA 4QU5A 1P60A 1RFGE 4MICA 2XZDA 4K26A 2P9JA 4KIFA 4YRLA 4C2AA 3GJ0A 3E7WA 4P4SB 1T0UA 5CHEA 3VZSA 5T4FA 2WSSA 4QICA 2FXIA 4CHGA 3ZY3A 4MI1A 2V7QD 1DC5A 3A37A 1DAHA 3ABSB 3ADPA 1XMSA 1XF1A 4K87A 4EUKA 3UAOA 3HVRA 5DTQA 1EJ2A 2HKIA 5CCBA 5LQMA 3GLRA 4WECA 3VZBA 1BJKA 2HU2A 2QX6A 3ABOB 4LYEA 3G23A 3OZDA 5DHPA 5HF9A 3FWYA 3VHRA 1QGZA 1ZONA 1ZISA 2EP8A 2VHCA 2YQ4A 2C7GA 3PA6A 4LHSA 4U2CA 5AUQA 3M1LA 3PEYA 2Y66A 3JQGB 4B3DA 3K94A 2RIRA 2VDJA 1WTAA 3ZK9A 1SKUA 5LMUB 2C2HA 1PQ4A 1Q16A 3BUSA 3I23A 4G01B 4BNIA 2JAPA 2WJ6A 4EENA 4UNIA 2LD4A 2D2XA 2IYVA 1JIQA 3EDCA 2DBQA 3DMGA 4Z4HA 1TK9A 1I5EA 5IJ0B 3SQLA 1POXA 1NULA 4CM1A 1NI4A 1YUBA 3DVRX 4X3OA 3FUXA 3OJXA 4B3RB 2PMCA 1MCZA 3N5KA 3AM1A 1K2VN 4KGVA 5BOSB 4XGQA 2CLLB 3O8CA 1LH0A 3NHLA 1U2EA 1MEOA 2NLOA 1LC3A 1GU0A 5EMHA 1MEJA 3OECA 4E4RA 4JBLA 5HMLA 2BGNA 1RMTA 4MWCA 4D8TA 2XVXA 3SZ3A 2JLRA 1PCXA 3WGZA 3LM8A 2OCDA 4I81A 4Z9AA 1PFQA 4R8SA 5LZ5A 1U80A 5LOVB 1C2YA 2AWNA 2IYNA 4ND1A 3UMRA 3BJZA 3B7GA 3PX3A 4CMBA 2H59A 2OEPA 2ZRGA 4NYJR 1B16A 1F48A 3QBTA 3IV7A 4QAQA 1WB9A 1DC8A 3RBAA 2Q5QA 1DAOA 2QPOA 2OXCA 3H11A 5B1DA 4A26A 1OKKA 2F8LA 3PYMA 3RF7A 5ITWA 1RRGA 1T1SA 2ZRCA 3JY6A 5KHLB 4Y1RB 4Q1AA 5L7TA 2ORYA 1QQ5A 5EWLA 3SYTA 3N6VA 3FNIA 3WYEA 4Z8XA 1HYHA 4JB2A 1YD7A 3JYPA 5FCDA 4BLWA 1H23A 1BXKA 4MZDA 4ZU1X 8ABPA 4QOGA 2B30A 4BC0A 1IL0A 5FFFA 3E2IA 5IC6A 2FP4A 1FVOA 1L8XA 1E62A 3A6LA 2O1SA 5THXA 3SS8A 1NWCA 2RC5A 3LWNA 4L3VA 5HKKA 4EUFA 3IIIA 3AUFA 2P1DA 3NVMB 4GI1A 3K1JA 4BNFA 5C7YA 1RLOA 3QV1A 3IVMA 2WMNB 1XL1A 3H9BA 3LHFA 2JH3A 2EBFX 1QTRA 4LXXA 3GJQA 4QDKA 2GZDA 2LE0A 1NKVA 3HI4A 4HD8A 1WV0A 1WCWA 3EY4A 4CTNA 5LPNA 1JHQA 4MLCA 4B4DA 1J99A 1PT5A 2ZBEA 1HUQA 2CFRA 2I8AA 3TQHA 1N9ZA 1KAGA 2QVXX 3LWZA 1J06A 2IEGA 1C0KA 1MT3A 1WKCA 3FE2A 3NRCA 4RK0A 4EB6B 2HZ7A 1P4HA 4EG7A 3SDSA 3MYYA 2J1LA 2QUKA 4I50B 3W3ZB 4JI2B 2VPPA 1KI1A 3KJIA 3D8BA 2OUKA 3EXHA 3CWQA 3CZAA 2H18A 4CRWB 3WK6A 1E3WA 3JWHA 3SM3A 4JASB 4A2QA 1SRQA 1ULHA 3PQCA 4C0LA 5BP7A 4YVFA 5KNDH 3EA0A 4NYMQ 2XQJA 3WIUA 1BHSA 2B25A 1M2EA 3HE3A 1OFGA 2VOEA 5IZ4A 2ZJ8A 3H87A 3JQAA 4YJ3A 2I5PO 3IFSA 1MO3A 2G77B 4CCWA 5K01A 4ZOEA 4ATNA 4B6JA 1EX6A 1E2UA 4AZ3B 4LBYA 2E4AA 5CDYA 5AKGA 4DM7A 2W2QA 3RD5A 3C39A 3F5QA 3OM1A 4BAUA 1M54A 5JAMA 4WBSA 5AJHA 5KVQA 1TZKA 2ZTLA 2PBFA 3VR6A 4B82A 1O0SA 2QMOA 4E46A 5LJLA 1DDOA 1FFCA 1T1JA 3CRW1 1Q6YA 3CMCO 4E2YA 2VDNB 1D2MA 1MKYA 1VFNA 3OPYI 2JIOA 1UZNA 1L1FA 5LUAA 4ZGWA 3OIYA 1V5FA 3HB1A 1KGSA 2VHYA 9LDTA 1JR2A 1KS2A 3N7TA 4K05A 4LBWA 3E7FA 3VPXA 1IY2A 1EFKA 4X8LA 4Z86A 5GJWC 1Z15A 5JJIA 1DBVO 2IYSA 5EP4A 4Z2YA 5B2FA 3OX1A 5F1KA 3U1VA 3WOHA 4HL6A 4PZUA 3WYNA 4YMLA 4XYEA 1D0SA 3SKXA 1KNQA 1VZ2A 1JLRA 3CEAA 3EBLA 5BYAA 5FLEX 2GJ9A 3QLUA 3HO8A 4BGUA 4IDGA 1Z5WA 3TTVA 1W75A 2EFGA 3GD7A 4IX9A 4LY3A 1XE3A 3NAZA 4X7RA 2XWPA 1EFVA 4WOPA 1PO7A 5M5BA 3NFYA 5A0FA 3I05A 1E9FA 4HX2A 2ZJ4A 3UG7A 2JGEA 2OOKA 5B53A 3CF2A 1Y7HA 1CY2A 4IS2A 4DIDA 3T7SA 4PS0A 1NXOA 2G28A 4QECA 1T4GA 1U2TA 2NSYA 2VDKB 1CBUA 3I53A 4RKRA 4V3BA 4BNDA 1K4YA 3NV9A 3VR4A 5J4KA 4PCAA 2GF0A 2FN4A 3VHLB 3EXIB 4O4JF 4ZK2A 1AUOA 3LQ4A 1K66A 2QROA 1PGJA 2XGGA 3UFBA 4JLDA 3W5IA 3WJ1A 4DAOA 2YN4A 4DQUA 4EKDA 2H1HA 5MGBA 2IOQA 1COZA 4D7AA 1X14A 2IOFA 1PHRA 2GO7A 1JQ3A 4KGZA 1YI8A 2J6HA 1XRMA 4OTZA 4BJ1A 1VLHA 1T91A 3EVTA 3PHBE 3VU9A 4TLAA 2G1UA 1R4NA 3NIFB 4ZI5A 4MP3A 4QYSA 3EZGA 1UJNA 5H7XA 1USIA 2LCFA 3L93A 3J7TA 3MUFA 1IYZA 2IPOA 3AEQB 3LZDA 1W8DA 2PX3A 2EIXA 4K2HA 1EVQA 4N6NA 4L5BA 2ZTMA 1WBJB 5M2QA 3DMTA 3GZTB 5JASA 1EH5A 5ALOA 4YLEA 1MW8X 2YV3A 4ESEA 2NUAA 2AFIA 4N3AA 1F60A 4KYUA 2N75A 2FMUA 4RMIA 4CLOA 1NKTA 1Z34A 3HKCA 4HZGA 3V2IA 2QMYA 2JAWA 2R4TA 4OHYA 3IUJA 5EXPA 3EVCA 1GQSA 4UE6A 1R4MA 3P0IA 1U6JA 3IAFA 5DP2A 1PR2A 3E7PA 3ZZ0A 2ZT5A 1NP6A 3KKNA 2R2AA 4A0GA 1Y3IA 5BQXA 3JX9A 4NV3A 3PQ8A 1QNLA 5A1JA 4RIIA 1DEOA 3ADKA 4D25A 1H5UA 4N8SA 5DI3B 3PCXA 4D9NA 2Q3LA 2ZIXB 1NY5A 3BHMA 2OVFA 2QQ5A 2VSYA 3DXZA 3LKVA 4L4XA 5HIIA 3V55A 1WDMA 3F0TA 3HBJA 5CLFA 1BEUB 2LDXA 4N3GA 2DFVA 3I0ZA 3Q15C 1U2RA 4IKPA 3Q41A 3VZPA 2CHFA 5GVRA 1ONBA 5D01A 1BE0A 1RP1A 1ORRA 4QVGA 4BUCA 5M7EA 2R6R1 4GNKA 4A1FA 4N7BA 1O5IA 1RBZA 5TJHA 2O7RA 2QL6A 4W99A 1MAHA 1E9AA 2FW0A 3DLHA 2D1QA 3S7ZA 3CEHA 4F91B 5AVTA 1AF7A 4FWIB 4Q1FA 621PA 4C78A 2GWHA 4CBVA 3WK4A 4NU5A 1WF3A 1QV9A 3IO3A 4IOKA 3K5IA 1Z7YA 1XBTA 1RTTA 2G63A 3HKEB 5HDQA 1GGFA 3DE5X 4F8EA 5CFRA 3ZGZA 3NHUA 1T6YA 3LG2A 4BS9A 1GZUA 4UMDA 1MIHA 3SU8A 1PLLA 2WAOA 1LQTA 2AK2A 2QI9F 3BF8A 1K7YA 3NO4A 1LLFA 3DDSA 4ND2A 1VXRA 2HK6A 3ZW9A 1OBCA 1JEOA 1VIMA 1D1SA 4TZ0A 3VOTA 3HUUA 3OD1A 3FPGA 1EK2A 1UEXC 1BC5A 1Y37A 2FMIA 3C3EA 1JDTA 3F2VA 4YMSA 3L7BA 2HAEA 5JH7B 1B74A 3ABQB 5K0EA 5B7GA 2GN6A 1HDEA 4RTRA 1M2FA 4J2TA 3TIFA 3WL6A 3B9PA 1PT9A 4Y2HA 1KMHA 5CYFA 3SF8B 2Z2IA 2AF4C 3A9TA 4CQMB 1ZD9A 4XWWA 5DLPA 5EY5B 5L4SA 3E18A 5GVSA 4X90A 1PEYA 3R2JA 2X7XA 3OLZA 3KSUA 1TVKB 2B4YA 3AL3A 4MH0R 2CLCX 2FPMA 3D8HA 5KNLA 3E9YA 3O3CA 4V1CA 5EJMA 4PLHA 4KIUA 3S2UA 2MT9A 2D5IA 3O82A 1QR6A 2ZJFA 2CMKA 4QATA 3OTOB 1EWYA 4CNQA 2IP1A 1SB9A 3NEPX 3WLAA 4YT5A 4KAJA 1IHDA 2NU8A 5KQPA 3EGVA 3T0FA 3TKAA 3GGOA 1C1XA 1SJ9A 2QG9A 5LLSA 5LQJA 3HYTA 2G07A 1AY0A 2O3UA 2Y1KA 1RWBA 3GMTA 4PZEA 4UTXA 5LA6F 5A4FS 4R7TA 2VCHA 3R6DA 3K8QA 4R3UC 2FEPA 4RHXA 4GZLA 1Q1NA 4JJ8A 4JLAA 5T3UA 4B9AA 4HT3B 1DVRA 2NZ8A 1MJGM 1PJLA 4MV7A 3GN2A 3OZWA 1JZQA 2JK1A 4L0DA 2LV8A 3OZRA 3ACBA 4R81A 4YN3A 1RDFA 3TSWA 1X74A 1NM5A 1O5TA 3WGHA 2NO6A 4PFQA 1WNFA 3ESXA 1OBHA 1HC7A 3FPBA 3QE2A 4L57A 4U39A 5B3LA 2I03A 3SQOA 5EIBC 4X62B 4MUGA 5EJEA 3GGGA 5CDGA 3PEEA 3DF9A 3GVIA 1BWSA 4Z4FA 2IW1A 3PX7A 3OCZA 4KKXB 2YASA 3PFIA 4RM3A 1DBPA 4WNIA 1JDPA 2CNWA 3ZE9A 3C1OA 2IXDA 1Y8QA 1Y5MA 4B32A 1GFZA 5F3RA 5KYUA 1BS9A 1EVZA 1N3LA 2XYQA 3A1VA 3C4QA 3DTVB 1OAOC 1W4LA 4BTLA 4EY3A 5A7FA 3WB1A 5A2QA 3K09C 3TM5A 2GPNA 4CKEB 1HBJA 1C7IA 1QS0A 2B61A 2RHBA 4GYKA 4QYXA 1W88B 4KIWA 3L3BA 3LMKA 4RTLA 2ZI9A 1C7QA 5EJIA 1GG8A 2IIBA 5FV7A 1THTA 5JVDB 1UBLS 1QK5A 2O5VA 4NP6A 4PGGA 4FNMA 1Z38A 2C2OA 1FP2A 3E53A 1ISSA 2XMRA 4M9CA 4OFWA 3QBEA 4IWYA 4ZYYA 2C61A 2WD9A 1FFXB 3WQRA 5DLQC 4LE2A 2AJ8A 3GJ3A 1UPAA 1ZKMA 1DRUA 1ZH8A 3MZ0A 5FOWA 5IK2A 2QN9A 3NAMA 3AF3A 3UCFA 4BIMA 4TLMB 4FHEA 1FXSA 2F8SA 1RU3A 1HNNA 1NRWA 5FL3A 4C07A 5LXTB 2LR0A 3WYAA 2H4FA 1QK3A 3P32A 1JHYA 2FP3A 3CEPB 3Q6MA 3V8QA 1DWPA 3ZGXA 4BJHB 5M3BA 3GT0A 2CLDX 2QU7A 3VYVA 1VP3A 3JQGA 3H86A 2EBHX 5J2TB 3RI3A 5JAQA 2O05A 2AN1A 4RHCA 2GK7A 3BXZA 2C2XA 3HVUA 4DLPA 4WXRA 1F4LA 1QV7A 1MF7A 1P9NA 2Z5VA 3PNBA 4RS4A 4JXZA 3TKYA 4BVFA 3D4PA 3P9KA 2ZZKA 3TZQA 1Z74A 3REOA 1Q77A 3DW1X 4RAQA 2JD0A 5JZSA 2DPGA 1GPDG 2EKZA 3WRYA 1Z4QA 1NT4A 3DBHA 5GIPE 2I62A 3A1EA 3SSOA 4DJJA 3EAFA 1CZLA 1GT6A 3ZWKA 3BCRA 521PA 4BNGA 2WJWA 4YIKA 7GPBA 1A9XB 1Z9BA 4FLFA 1WUJS 3AF6A 3K9WA 2PX4A 5BNWA 2TECE 3KSBC 2XTAA 3GI1A 4F8JA 5KYWB 2O06A 4HRAA 4WXYB 2J6IA 4RHTA 5K0NA 4WLFA 4ZMRA 2Y1OA 3C41J 1Z06A 3IODA 1XT6A 4UAGA 4BCCA 1L3BA 4YJKA 4LSGA 3VBEA 2BEUA 4ZHSA 2HO4A 2OBFA 3L84A 2J4FA 5CHYA 5AKYA 1ECLA 3ILHA 2RI0A 1OI7A 4DPLA 3JQ9C 1YVRA 4BVGA 1FNSA 5KZMB 1UKCA 3LGSA 4YJ2F 5DI9A 1E5QA 2CWWA 1T3TA 3ZJVA 2Y0PA 3OE4A 3Q5DA 1GN9A 3WGVA 5JTUA 1NL3A 2NU7B 4G84A 5COBA 5B3KA 3AM3A 4DSOA 1WMBA 1ZW1A 2BGLA 3GA7A 2D7CA 2FMHA 3TEJA 1XMJA 1LNQA 2NVUB 4U2GA 4QT0A 3B2NA 4Y0VA 4JQCA 2Y0CA 5FIUA 2H5EA 3FRJA 3FKJA 3G6KA 3QBVA 4G07A 5DRYA 1DJMA 3OJCA 3Q40A 2AKYA 4XYMA 4IUBS 3NIWA 3RU2A 2Z95A 4NS1A 4EL5A 3PLAE 3PQ4A 5E1OA 4HCJA 1QWOA 2OP0A 3PHIA 3FVVA 3ZS9A 4J0DA 1OGYA 4U00A 3ZPXA 2Y9MB 3IKTA 4G0VA 1ISJA 1F6WA 4KWHA 2ETXA 3URMA 4I1SA 4D99A 1TMYA 4P4TA 4Q16A 3NGMA 4FGLA 3X0DA 2FPUA 3Q8WA 3UMCA 3KKPA 2QZJA 3OU6A 4A15A 5EZYF 1HI9A 4GYYA 3VNUA 4FE4A 3G0CA 1R0YA 1VA4A 2WJZB 1GIAA 1TA9A 1PV1A 1NUQA 2R00A 1CVRA 3AEXA 3E1KA 3GDOA 4ME6A 5BMVB 3HXMA 1O08A 3ZKAA 3ZDDA 3L82B 4NK4A 8OHMA 2CJFA 3EUFA 4FFSA 5FBZA 3TZHA 4ED9A 3STXA 2XIJA 3DZ8A 3FMVA 3C3WA 4MNTA 1F1BA 4AD8A 2X8BA 2BMFA 1A50B 1CDOA 4M1TA 1VHWA 2X2PA 3GCDA 4TLDA 4KWCA 1UKVY 3WVNA 1C7ZA 1IAVA 3JQQA 3OX4A 3IO5A 3MCWA 4L1KA 4BP1A 1L4YA 1RS0A 4YDSA 1DQRA 3WE7A 5IKMA 1N5LA 1FFDA 3P9NA 3ZXIA 4OIFA 4BZZA 4M76B 3WKAA 5HUJA 3EPHA 1RWPA 4EYGA 4A10A 1V47A 2SKCA 4D9CA 1Y4AE 2DQZA 2ASVA 3L6DA 5ESWA 4CUKA 5ALDA 3OO1A 4UOZA 3NNNA 5IN4A 4YHHB 2FUG6 1YS1X 1RSZA 4N8DA 4EY7A 3Q3GE 3VISA 1JKXA 3LUBA 3THWB 1L8OA 4LV5B 1QG0A 1MB4A 3BVPA 1SURA 2PV7A 4FR0A 4II7A 2H48A 4GKVA 3AW8A 3WLFA 4ND6A 2JJ8A 4L74A 2KBFA 4CM9A 2ZETA 2A7QA 1A82A 5MGNA 4S2UA 4F06A 1QH9A 3IGFA 4PYLA 4L6CA 2IBMA 3RHFA 4D57A 3WXBA 5D51S 1XJ5A 3MGGA 2OECA 1C2TA 1ACJA 2C82A 2APJA 2OOSA 4NRDA 1KTIA 3ROEA 3IMFA 4NEHB 1I6MA 3JRXA 4XJTA 5BSEA 1HOXA 3GLFE 1HA3A 3QVUA 4IV0A 2RBEA 3ZWXA 4H18A 4LC1A 1G20E 4LF8B 1N4DA 3FHCB 4EECA 3TECE 5AYVA 3QFCA 4FZRA 4UU7A 2B6HA 4YRZA 3NC1C 5A4DA 3QFTA 1MJNA 1UR5A 2MYNA 2XAUA 2JLXA 3JVEA 2HC9A 2EJVA 4BFZA 1SBHA 3OIWA 4NC9A 3ZBTA 1XO1A 3DE7X 2O2XA 1QRRA 2BW0A 2B1QA 2X1VA 3DVSX 1VHLA 2G71A 5CT9A 3ISTA 5E9WA 4NDAA 3TXXA 3UYKA 4DR2B 1TX4B 2UYGA 4DA6A 4ZCSA 2YXNA 1CDDA 5E2BA 2QW8A 2P0YA 1MT0A 2XUFA 1M83A 1P73A 2ZYVX 4KAFA 2GSWA 1S02A 5DMXA 3TO5A 1ZVMA 1VPTA 1CYEA 2NSLA 1K06A 3LGAA 1Q1QA 1P5FA 3AILA 4BVEA 2FW6A 2H5IA 2F3TA 2NVOA 5F2KA 2SECE 3PUZA 2IE0A 2JDIA 3EE6A 1RRFA 2NT4A 1R9NA 3M83A 3P5BA 2UYHA 3AEQA 2JFUA 3CR7A 3O9MA 1NQTA 3DVAA 3EA4A 1XLVA 3T3NA 4AUKA 4UAVA 1EG7A 2ENUA 1J0AA 5K8LA 3KLPX 1OMOA 1NKSA 1XQ1A 2ONYA 3KXIA 2J9FA 4RGBA 4IEFB 4WLVA 2OB1A 1YQTA 2JI9A 3B13B 1J0BA 2RJOA 1YVPA 4WN9B 3HYSA 3S2FA 4QAJA 3SHFA 2FAXA 3KHUA 3SD7A 1DNPA 3E0XA 2WAAA 4OMCA 3OZEA 2YJ3A 4G9BA 4MKGA 3CSUA 5IKOA 3HABA 1P2GA 1PTJC 3ESCA 5H9WA 2OHGA 2BM9A 4HBZA 2OHFA 3G7NA 1DEAA 1XC7A 2Q3FA 1QC5A 2P5SA 2OPHA 4DMMA 1EE9A 1J8QA 4L95C 2VNJA 5K8VA 3ZWYA 2OHXA 3R4CA 1J24A 4M0DA 4MVJG 1NMZA 1QYDA 1YS4A 4R9NA 3VVMA 2X1LA 1HXHA 3W5HA 4E5KA 4IDNA 4OQFA 3BTVA 3QBJA 4WLOA 5DBEX 1MMFB 4FX5A 5M34A 4MARA 1S9HA 2PXXA 3ZDBA 4CIVA 2ZUBA 1VSTA 2YMMA 1Q1BA 2O4UX 3NRJA 4RPKA 4NPAA 4R2HA 5CBPB 5AK5A 1E94E 3U0VA 1EAMA 2R97A 2YQ5A 4BFTA 1AIPA 1JL3A 3M2PA 2C54A 4RETA 3UB3A 1FRQA 3RS7A 3BXPA 2O59A 2A86A 3D3NA 3TTSA 1LLCA 4O0MA 3JAMA 4UDNA 4D0LB 5SYMA 4X1IB 1M67A 1H8HD 1R37A 1ULZA 4RPJA 2X9NA 1ADGA 5IMBA 8ATCA 2V8BA 2NACA 3P2KA 3TLKA 2FR8A 4BTVA 2JJ2D 5FFMA 1JWBB 3LQKA 2Q5FA 5AJTA 1RE0A 4PLWA 3DCIA 2AEMA 4D98A 4JSYA 4NWIA 1G7CA 1UP4A 2ZQYA 3NH9A 1F9EA 3SJ7A 3PNOA 2VPWA 2NX2A 5EJAA 4B7XA 2EKLA 1J5XA 1F8UA 1N6PA 4QDZA 5LQKA 2Y6VA 2G0AA 1TKCA 5TNXA 4HAYA 2B21A 4L78A 1F7VA 2FLVA 3A4LA 2GDJA 3KZXA 3CN7A 3KNZA 5CNMA 5CP8A 3JD2A 4C2UA 4L2IB 1KJIA 3SF8A 3WQQA 1MX5A 3WMWA 2C9BA 4AJNA 4L16A 4WY5A 3CZQA 2ONCA 4DLTA 5CFZA 5IAAA 5DEOA 3HXKA 2IYTA 2OHVA 4YCMA 3LIPA 2BFOA 1TVKA 3KDPA 3LS2A 1QYWA 4X8HA 1UT8A 5CM9C 4AMYA 3SQNA 1EDDA 5B1HA 3H16A 4RJ2A 4YRKA 2IYQA 2EW2A 2AWOA 3I9FA 1E9CA 2P9CA 5IYZA 3DWGA 3KTOA 2UXCB 4KRGA 1TPYA 2C3MA 1SUCA 5JS1A 1H66A 3LOPA 4N0EA 4ZDWA 3F8WA 4S2EA 4YO8A 1WZNA 2I55A 3MCTA 2GD0A 4Q9NA 5FOXA 4M0FA 4XFJA 3PJDA 4OFXA 1MUUA 2FJUA 3AU9A 2QE7D 4NATA 4Q01A 4RJJA 4DQXA 5AQ1A 1C30B 1DBWA 1T0IA 2B0JA 4BQFA 4L8GA 1PFYA 4P53A 1Z4LA 2HJSA 3BCUA 3VDRA 3ZDCA 5IDWA 2W8BA 2FSGA 1DAIA 1ZN9A 2EBWA 4MYCA 2H4YA 2FRVA 3HDYA 4FBLA 5DTIA 2W00A 2VUUA 3DOFA 1NFRA 2A5LA 3OCUA 4GPAA 1D2RA 2WU0A 3F3SA 2BMEA 2C78A 2IDZA 1WXHA 3X1JA 4PHGA 5F9MA 2VT7A 4GVLA 2PUJA 3K4PA 3N8HA 4KMRA 5IX8A 2IS6A 1U4OA 3FHOA 3TW0A 5J3JA 3DLCA 5B12A 1U3GA 4ZZ2A 2CL0X 3BK7A 4I5DA 2W37A 4TYQA 3E5NA 5CU7A 1B15A 3GJ8A 1RMQA 1WTCA 2BEWB 3L8MA 1E5XA 4QIHA 4J9VA 1D6MA 4K9RA 3WL5A 5KNDD 2UV8A 5EPEA 2VEOA 2BRUC 2XNDD 1NQ5A 3P9ZA 4HGPA 3ZBUA 5ICGA 1JDSA 5CXUA 4J4HA 4KUGA 3QY9A 1PZFA 2G36A 2VATA 2OORC 1DQZA 2ORVA 2GAFA 2ID4A 1VRVA 1JEYB 3Q11A 4EF4A 1GKKA 1ZZGA 1G8AA 2QIOA 2R79A 2Q46A 3GRCA 2ZRNA 4D42A 1QIDA 3WGNA 4MW5A 4H4CA 3U81A 3OLCX 4NPCA 4B79A 4MV0A 3ZGLA 5JQGB 4B1FA 4F1WA 4UXIA 2Q1XA 2WU1A 3L7DA 5AOCA 1TM2A 2JFHA 1UT5A 2D8MA 1JN0A 3K6JA 2VC2B 3K9NA 4N01A 3C0KA 4A7PA 4HO1X 4K9KA 1LB1B 2OILA 1T4DA 3DQPA 4LIPD 2DB3A 1XSEA 5DYNA 2B2NA 2ZRDA 4NPHA 1GTG1 2C2MA 2FOXA 1QYVA 4LVUA 2ZYWX 5EIBD 5IW8A 1G6OA 3RJMA 4RH1A 5TR9A 1IB6A 4UPEA 2F67A 2WTEA 4J94A 4ZPJA 5J40A 5K0CA 4EOGA 3GP5A 3FSGD 1OH8A 3ECSA 3EXAA 1OVGA 1PYDA 3AHEA 1H2RS 3WNDA 3S44A 4PIVA 1JFFB 2XT0A 4GHWA 1UBFA 2ISCA 5B36A 3CURA 4DSZA 1ODCA 3RUIA 1ICIA 5J2TA 3LXXA 1DDIA 1N0UA 2H92A 3EFOA 4U3JB 2QX4A 1QOZA 4B3HA 1NQVA 1OV6A 2ZDGA 1H1LA 4JUIA 4PSDA 3KQTA 1GGMA 3PFGA 4K86A 3VTAA 4C6RA 2HM7A 3QE4A 3L0BA 3ZXYA 3L07A 2PWZA 3UGTA 1U5BB 3MWJA 2UUAB 3PT9A 4JB0A 2C9YA 4K6FA 1TO2E 1V41E 1PE0A 4C7VA 4MDEA 3ZWPA 1A9XA 1T3SA 1DBSA 3JV7A 3B82A 4ZN6A 2JH8A 3TDNA 2R68A 4OOEA 5EEGA 1GZVA 4AULA 2Y05A 3M8KA 4GM4A 5KYWA 3QKSA 2ZB4A 3FMOB 3S68A 4R8VA 4LBVA 1QIHA 3PG5A 1LK5A 1QH8A 3W8EA 3T5MA 1QRDA 1G5IA 2PUHA 2B83A 1TADA 3FLEA 4Q9JA 4ZHQA 5K3EA 1HTTA 2UZ1B 1L5LA 1BS1A 4KN8A 3DJFA 4NAHA 4O5AA 1N2SA 3KALA 4Q93A 5H81A 1WSWA 2Q6TA 2LPMA 4WVLA 2GPYA 4FYYA 1FP4A 2X8LA 4DM3A 3EGEA 4RA6B 4PONA 4C6TA 4EGSA 1UZAA 4NI5A 2CHGA 3PGMA 4I55F 1DC3A 2PMEA 4QTYA 2YHSA 5AOBA 2HWXA 3PZRA 4TT3D 1EX7A 4KAXA 4L9AA 4DQVA 2RKOA 2OAGA 1Z16A 2Y76A 3D3WB 2VSFA 1OYOA 3QIVA 3KJXA 1IOWA 5AHKA 3SOZA 4WASA 3S1AA 4HLUA 3T34A 2QRQA 4RVGA 2JKVA 1SG0A 4U7HA 4WHMA 3H4MA 5EZSA 1F0NA 4QTZA 1E2MA 2LBPA 1JG3A 2OGWA 1HNZB 3WJ7A 4GAEA 4R9RA 3U16A 3DWFA 4LV6A 1J8VA 5DNCA 3MMNA 4LYYA 5E6RA 2ZTUA 4KUEA 5FRDA 2GEJA 3HYNA 4ZEXA 2OLJA 4QDJA 5BWCA 5BR4A 5JLJA 1XD2A 2AFVA 1R9GA 4IIDA 5IAGA 4RVSA 4KXFB 3COPA 4JLVA 4QQNA 4XQEA 5A7GA 1YRWA 2NUBA 1PBNA 2YFYA 2PRJA 4NBKA 4YJHA 3U56A 1JIVA 4EUSA 2RGDA 4N82A 2X0FA 2I71A 4OGWA 4MS1A 4B48A 2AX4A 3V4ZA 3ZNQA 4FBMA 1KR5A 1YRAA 2O3RA 2V97A 2Y1LA 3C6QA 4NESA 1WW2A 2Q41A 4RELA 4ZYUA 4XGNA 4IJ5A 4TVBA 1K86A 1MC8A 1ZCBA 2I4OA 4ZPXA 4A6XA 4PZ9A 4KK3A 4PRKA 4Z0TA 3JYOA 1KYYA 3O03A 2C4VA 4D6PA 3OOHA 4GI3A 1SG9A 4JELA 1RZVA 4NENB 2ZYIA 4Y9TA 4NZMA 4DCVA 3GWZA 3DW3X 3LO8A 3A0RB 4RY2A 2A5DA 3F4BA 3G0GA 4KRXA 1VB3A 1Y9AA 2WJPA 4L75A 3TGWA 3J81A 1GQFA 2QTVA 4PPGA 3D64A 5D3QA 4RQAA 4CDMA 3ZHTA 3ASVA 3H5WA 2I91A 4AROA 1OX6A 1TPZA 2EDCA 3IKVA 5CUQA 2YNMA 1J9ZA 2GFIA 2NZXA 3NTQA 4ZCRA 2O8EA 2DR2A 2XW6A 2GN1A 4IXMA 4UAJA 3HO6A 2JIZA 1W5EA 2R6DA 1ZGJA 3GN1A 5I7EA 3VR1A 3BFKA 5L4LA 3GLFB 2OK7A 2Q5LA 5CG1A 3S5UA 1MC4A 5EMNA 2WB2A 3WRXC 1GFWA 3UB2A 1MQAA 2XMGA 3EHEA 3T6KA 4O8CA 2A67A 4MUKA 3ZH2A 4M0PA 3KR0A 2W83A 4D4HA 5JMOA 3CISA 2FB9A 1A2KC 2PKWA 3QXCA 4IMJB 3GT7A 4PO9A 3G8YA 3B9RA 3KK0A 4MWZA 2GTIA 1IQUA 4WZAE 3T0IA 1UQUA 5AKHA 2VHWA 3WLSA 3D6HA 1SVKA 3GEEA 5CJJA 2YKGA 1XU4A 2NGRA 1NE2A 4O0LA 2B92A 5ECGC 1AA6A 1RLJA 4IGFA 3GH1A 2JHAA 4KPUB 2LTAA 3EFBA 5KDDA 4ZANA 5LJIA 3LLSA 4KTTE 1IOZA 5AJUA 3PLRA 5TRTA 5KTMA 4LFBB 4OHRA 1Y1TA 1QIEA 5K3SA 4OH1A 1WZEA 3ILXA 3IPLA 3IKLA 4GOLD 1QJCA 2BEVB 4H6PA 2ZI4A 1JBEA 3H1FA 2HIMA 1JSXA 3GA0A 4GMDA 1LQUA 2HSDA 3H04A 1H85A 5CDFE 1ZYUA 2AOVA 2WFMA 4MUEA 3RQIA 4YYZA 2GBLC 1KDPA 2XD4A 3RUDA 1XZHA 1OA1A 2ZKLA 4L3OA 3J81k 3UUEA 3LSTA 1ISPA 4CMEA 1NVDA 1RBQA 2QUBA 2YDYA 4YJDA 4P7FA 4KN5A 3RNLA 3H9CA 1W2WB 3RLIA 3RS8A 3MILA 1WPGA 3L7CA 1GQYA 4DLZA 3TNLA 4YR7A 1RPJA 1FBTA 2CDRA 3MS7A 2X6QA 3DMYA 4I5IA 4LCBA 3PPVA 3TFWA 4IS3A 3CZRA 4LYDA 2BFMA 2YZMA 3F7TA 4UXJA 3RT1A 3ZG6A 1OPRA 2YW9A 4EJSC 3AY0A 1G4AE 3K0AA 1WF6A 1ZN8A 3SYRA 4DADA 3TTYA 1PYOA 2PQ0A 3OT1A 1L2TA 2UKDA 4IUYA 5DYYA 1WZ2A 3D5EA 2HK8A 2ZIGA 3C6YA 2FX2A 1NJFA 3I42A 3RV4A 1I3KA 1E2KA 4RZIA 4DMCA 2PSSA 1W87A 5LFAA 1QV6A 2V9ZA 1AS2A 3H5NA 1V71A 1R88A 3W8RA 4A8HA 2Q1YA 3LLUA 3RSLA 4PFJA 2CNDA 1QGUB 2QYSA 1B1AA 5HQ3A 3I2IA 1HZZC 4LW8A 3M2TA 5HBRA 2C3PA 3GNTA 1IEXA 4WSOA 2D13A 5B64A 2CYAA 3H5VA 4DV0B 1EQAA 4GWGA 4RV9A 3IQHX 4IFEA 4MP8A 2A8YA 3GCZA 3TQIA 1XDWA 4TRRA 4ZC1A 4MI6A 3JXEA 4DIMA 4KW7A 5EJ7A 2ZZMA 3QE3A 5FNZA 3AQ4A 1TL7C 1X3SA 1TTHA 2PR2A 4UVIA 4BQSA 4LJRA 2H06A 4EM6A 3JQ8B 4D4MA 1T9GR 3IUSA 3KQVA 1CR4A 4B2PA 1UMDA 3TQRA 3DLBA 4PEVA 1GP2A 3DVQX 3RTBA 2FPGA 2LIPA 3KAJA 3Q3IA 4QXQA 4BWFB 2D1YA 2DLNA 2EGUA 4PAGA 3A9CA 2BM8A 1L5VA 1XHFA 4KQIA 1XXHA 4C5CA 2VSXA 3F4KA 4INPA 1VKOA 4Y6LA 5JPIA 1YGYA 4Q1DA 1UBKS 3U5TA 5KX5F 5JCXA 1FFGA 3NHBA 4KE9A 3FZEA 4QPNA 4PS1A 3SSMA 1E4YA 3L1IA 1C5KA 4YUXA 1G8FA 4BEVA 5FYDA 1KY3A 2D5BA 2H16A 4BX8A 1JEQB 2PL9A 2ZR9A 1VCOA 4KO1S 4G0XA 4URHA 2R96A 2AE2A 2FCAA 4PLPA 1PI3A 1UFVA 2QX9A 3GJ4A 4RSRA 2B3TA 421PA 4BEJA 2GN0A 1XK6A 1ESZA 2DQ4A 4J0QA 4O4JB 4KMOA 3MERA 2DOKA 3PC7A 5E3IA 3UQYS 3GMIA 3ZBPA 3K0SA 2YVUA 2ZDHA 3FOCA 3NETA 4CKWB 3IMKA 5KKCA 4HAZA 2Q07A 1DZ3A 1Q21A 1IHOA 2VJAA 3L4BA 3RBZA 1Z0KA 4B83A 4Q9DA 4MUBA 4U9HS 1AXRA 3I5AA 4NBRA 4WZBE 3SR4A 4DR3B 1TLFA 5KNBA 3O0DA 3AL0C 4X6UA 4QARA 1NYLA 1USWA 2GN8A 2IHKA 4L2IA 5EKDA 2JGRA 1KOFA 1JVSA 1EFPA 1Q91A 3DBRA 1ZR4A 4HJXA 2WG2A 1U9CA 5ICFA 4R05A 4LMRA 1QO0D 2FSIA 3EVGA 2GPAA 3HN6A 1IU9A 4QQRA 3EIHA 4URWR 2JGNA 4QU0A 2QW0X 2XB9A 3E9RA 5EMJA 1MGPA 1FY2A 3QXXA 4TV8F 1UFQA 3ZH9B 2CV2A 2BGGA 1TM4E 1SXGA 1UQRA 2BL4A 1B73A 3DZDA 2OA0A 2Q7DA 4D0GA 3TZEA 3I8XA 3L4SO 1YTUA 5BNFA 5DHAA 3Q7TA 1NVFA 4EF6A 1P80A 1ADYA 2O9JA 4ARVA 4HNAB 4M9XA 3VYRB 1SNYA 3I6MA 1C9JA 3LDUA 3ICWA 1L6IA 3PR1A 4B3IA 2DTDA 2RH8A 3UH1A 1ZBQA 5DPMA 3PIDA 2BCEA 1RHJA 1QAQA 1W4BA 3L46A 3AETA 4YXWA 2W42A 4LDRA 1T5OA 1X9IA 1SKAA 1U3VA 2XQIA 4G5FA 2IBTA 3LDFA 1E7YA 1MH9A 4HEA1 4LNAA 5C53B 3LQFA 1QHIA 3C1TA 3OQBA 4NCJA 1LVUA 5C7OO 3LKBA 1E9VA 1T5LA 1E3IA 2ASEA 1ZJJA 1OLSB 1EJBA 1LSSA 5IDYA 1NRXA 5AIAA 2Y93A 2Q1WA 4E08A 1OHHA 1O89A 4UE3S 3ZYCA 1LBQA 1Q6ZA 5BURA 1VHTA 3GZNB 1XOIA 4OB7A 3CGWA 3OQHA 3RRZA 4R3NA 3MK31 2GPWA 1P9WA 4V0KA 2PLNA 1KC1A 3QRWA 2XGJA 3CM0A 3VR0A 4YMHA 5JMWA 4N39A 3JSAA 3W1WA 4JNKA 5K8UA 1JE0A 2JBAB 3UMFA 2QK4A 1FYWA 4ZIRB 1A2BA 3PGXA 5L95A 1YDEA 4BQOA 5HFAA 2ZAMA 4J3NA 3LFTA 4QUHA 4L5YA 2P90A 4D0RA 5JW6A 2CMGA 5CJPA 3AW9A 5EIXA 2QUHA 4XM0A 1KRHA 2JVKA 4MGKR 4MUXA 5JSKA 4N40A 2IYAA 1G1MA 4J75A 5ALTA 5JSYA 1WO8A 3BRSA 2QKYA 4Z5XA 3OZSA 4EKNB 2WE8A 3RC2A 2GD1O 2VWGA 2GA9A 1GNQA 3PUHA 2DCMA 4RGVA 2ZCVA 4LQCA 3SKYA 2LWIA 4PQFA 1MIOA 3DG9A 3ROMA 5DN6A 4UTPA 3G1UA 2P2ZA 3M1YA 2FX3A 3L49A 1MDBA 1UXKA 2Q9CA 4GLOA 3RRMA 1AF4A 4X93A 2C1ZA 4JUFA 4EYKA 5B1YA 5D1NA 5DM4A 3U49A 5G0UA 1BW9B 5JSQA 3IUMA 3LA6A 4UEQA 1MABB 5I4IA 1Z8DA 3LY5A 4ECEA 1UMBA 2C77A 3I5MA 3LUPA 4LJ9A 1E1RD 4GXQA 4EX6A 4F1JA 5KOJB 1R8YA 2JZOA 4IGIA 3BYZA 3C45A 1VI5A 3OIFA 3I1JA 3OEHA 5LA6B 3ZCQA 4PQRA 4CEHB 2G04A 5JAUA 4GOJA 1H6DA 2IY7A 1BFDA 1KO7A 3DC2A 2Y2VA 3O95A 4IMRA 1Y89A 5K1ZA 5TVKA 5FUVA 1JYEA 1FFYA 5LZ2A 3JARB 1LI4A 3ETCA 5ES3A 5D8DA 2H8GA 1OSNA 2PGOA 2Y1WA 3DB2A 3PKZA 3QLVC 5DWQA 4Q4HB 1YUNA 5FNVA 5I9MA 1XU7A 4YUAA 2YBDA 2DP4E 1O97D 2V1XA 1W47A 3H8SA 3LCCA 3KDAA 4Q3OA 4U8HA 4DEYA 3DO6A 5LQRA 4DYVA 1DX9A 1PJ4A 2PEYA 4NF2A 3ZWAA 1NG1A 3JZMA 3UANA 4JI4B 1GKUB 4Q39A 5JD6A 3I6YA 1T0BA 5K20A 3GV0A 3SC4A 1PIWA 2AN3A 1VLLA 3KT6A 4G1VA 2UZ1A 3WHLA 1IIRA 3KE9A 2JRLA 3HYRA 3K1TA 2TSYB 3PXDA 3WGUA 2AH5A 4AF8A 4L8YA 5AWFC 2I7DA 4LXHA 1T5SA 4FDLA 4JC4A 4BFSA 3UWMA 2F1JA 4G5HA 4BMVA 1DPGA 1QHHB 1YR1A 3QG1A 1C3LA 1XG5A 2J7KA 4GR9A 4LHVA 1ZITA 1M66A 1TDJA 1OJLA 2GK6A 3KEGA 3N0RA 2G8LA 3R8CA 4JGIA 4K9LA 1KHTA 2A35A 5CW2A 1G59A 1WETA 1FVXA 1VCIA 4Z0NA 4BATA 1UBCA 2WD8A 3D0RA 2JK0A 2REXB 2CLEB 2HGZA 4KFUA 2HUPA 1P2SA 3QLTA 5DV9A 3HZOA 2WK1A 3GLHE 3HC7A 4EPYA 3HI6A 3OZUA 2AYXA 1DEXA 3HCAA 4WKNA 2HSGA 2VJKA 4TMYA 3L05A 3KTAA 4IVPA 3A7DA 3IEPA 4E51A 2XNJA 5KJEA 1T8RA 5BQFA 2BKAA 1TM3E 5ALWA 3W9YA 3HZRA 5IAKA 1XALA 3FUWA 3NJ4A 5AM3A 2YWHA 1REQA 4BNZA 1L8QA 1NAHA 3R0JA 4JL5A 1FP1D 4ZDJA 1JI3A 3PRJA 4HDMB 3QWIA 2Z6VA 3O8NA 3Q87B 4QQFA 4COKA 4FCTA 4MSUA 3WWYA 3O2QB 5IKEA 2M6LA 4X8MA 1SEVA 2I3AA 3MIZA 1BYIA 1KZ1A 1IBCA 4EIWA 2LGJA 3OOSA 4TS9A 4ZT6A 4Y30A 1CQZA 1XA4A 4G0ZA 4Y6QA 1L5GB 5BSGA 3K0CA 1QH0A 2IIVA 4L5JA 2C97A 4A1OA 3M5DA 2Y99A 4MVJI 4KB5A 1ZESA 1ZM9A 1XA3A 2PX8A 4J7UA 3GEHA 1N7JA 2HPZA 3I2JA 1NJ1A 1B23P 1K98A 3M3HA 2GEDA 2GZ3A 3SXUA 1JILA 2GYVA 2IYEA 4JJKA 1P2BA 1TD1A 1VLZA 4FYMA 1DI0A 2JHFA 1ESMA 2WM3A 1JSLA 2EP5A 2PXHA 1N6IA 3OD5A 3WG9A 4HI0E 5LP6A 2I2CA 4PC1A 1PJRA 2FG5A 1G291 3C8HA 2VLIA 5EYPB 1BRMA 1N6OA 2AZTA 3MT8A 3E35A 1C8KA 4ETNA 3FNFA 3C3YA 4JROA 3FTFA 4ZVSA 3ZWBA 1WOYA 3HP4A 4JHXA 1ZJYA 4YUVA 1G20A 3TI9A 2KM1A 3ORHA 2PMWB 3R0QA 4KDRA 1RJWA 2Y3IA 4YJ2B 2WAMA 4BRZA 5LQCA 3AEUA 3UK2A 3UMBA 2VPZA 1DJNA 5IBQA 3EZ2A 3O74A 2HU7A 5CPFA 2QMUA 3NMUF 1QFJA 4NABA 5AO9A 1QK4A 2JGAA 3B3FA 4MPJA 4DLWA 5KQLA 2GBFA 1ZDMA 2VDPB 5CLIA 3OMXA 3SHVA 1YBAA 1AZWA 1KPIA 4ABYA 4M1OA 1K7CA 1T9AA 5DMHA 3EGDB 3M6MD 4GVXA 1I10A 4DHWA 1T2FA 3FGNA 3PFFA 2WUVA 3CONA 4L15A 4NV1A 3UFXB 1CD5A 3NFRA 4LJ5A 4NG4A 1Z36A 2WNIA 1HFJA 4GECA 4M21A 1J1UA 1ND5A 3I8OA 1D6JA 3F98A 4KRYA 3D2BA 4FDAA 1RKVA 1JQAA 1N5DA 1H5QA 3O84A 2CWDA 1Q20A 5EZYB 3SNKA 1I9CA 1E6LA 3I64A 2K7FA 3URKA 1FJGB 3QVOA 2RFLA 3D2CA 4HDKB 4D9IA 3JWGA 2MSWA 4B45A 1UAYA 1GZ6A 3UJBA 1H0KA 4CKZA 4PZAA 1C4WA 1ZD1A 4N3NA 3AXSA 4OG2A 2VSNA 1B8VA 2NMVA 2NNLD 5ITZA 4OQ4A 3RFXA 1Z33A 1GADO 4JKIA 1E6UA 1ZM3A 4F85A 1VKNA 1ZKDA 1E3DA 2JJMA 1MV8A 2W2LA 3GMSA 4GWKA 3QVMA 2OCYC 4IMIB 2WMYA 4PIPA 3LLMA 4I1PA 2PKXA 2V6FA 4A2PA 3FTQA 4MYTA 3OI7A 4E5MA 3BORA 3V8BA 3T8YA 2Q8NA 2BT4A 3GD5A 2IU4A 4C3UA 1JFRA 2IUYA 3VU3A 7YASA 1YQDA 2IPXA 4DCJA 3V1UA 4RDIA 2GNAA 1CDZA 1OXUA 2UUOA 3IAAA 3HXQA 3NHMA 2Z30A 3DHEA 1GV1A 3W6OA 4C14A 1SOVA 1UP6A 3P0HA 1WXWA 1K5DA 2ADMA 1PJSA 2VAXA 2Z98A 4FD2A 4HWSA 4DMLA 3ENKA 5JU6A 2GH1A 2NXJA 3QYAA 1QGUA 2XZTA 3KPYA 2ZWVA 1UJ2A 4NX2A 4RD4A 3K15A 2FPPB 5DW3A 4LCJA 4PRZA 2RHCA 2Z9BA 3W6ZA 1PFWA 3IRUA 4G0YA 3ZK7A 2ECOA 3UJ9A 3MFQA 3VFDA 4CQJA 4FLEA 1KDRA 1QF9A 5AKEA 1HV8A 2VA8A 5CYPA 4ZGGA 3V32A 4WLNA 1B42A 1NDQA 2QDXA 1X1SA 3T7AA 3W2HA 3I0MA 3ROKA 4EL0A 4MLDA 3PV0A 4RNCA 3OKCA 3TGPA 4G8CA 3BIFA 1IJFA 3NH6A 1E4EA 4RWEA 1UKAA 4XSHA 4CCAA 2B9VA 3DE2X 3L6RA 2HB6A 3W6UA 2HK7A 3U60B 2JI7A 2N42A 4LDZA 4Q47A 2HMTA 4E13A 2W7TA 2HBQA 3UC5A 1M76A 3HN2A 3DV2A 3KVYA 3BQ9A 4AG6A 4QREA 2WVGA 4P4GA 1EWKA 4J9UE 3R7FA 1HGXA 1DUVG 1XV5A 4H77A 4IZOA 2QT1A 4N0MA 4TSKA 4MZXA 3U7RA 1X80A 2GS9A 3N8DA 3QX3A 3AVWA 1QHFA 1TKBA 1X92A 3Q1LA 4PTLA 3CUKA 5EP1A 4E2ZA 2BFCB 3FF1A 4WZBB 2DUNA 1AKRA 3CNEA 2O50A 3D8SA 1ANKA 1R0CA 4DSAA 3KQNA 2AC2A 4O4JA 1AH2A 3RROA 3CN9A 1BJTA 3ZY2A 4B3JA 3H5IA 4DW8A 5B5SA 1CUAA 3IT2A 3JW8A 3QX7A 1PV2A 4KHZA 5EA2A 5AVKA 4CEJB 5KINB 2RK6A 3RRNA 2RI6A 4NMWA 1FSGA 4JS0A 4AIIA 3KSZO 1Y6FA 3WSWA 1DFIA 1ZNZA 1HY3A 2BKEA 1QU3A 5KHAA 3UT6A 4YRNA 2O0MA 1EK1A 4DV6B 2WM9B 3REFA 4DBLE 1J0EA 1B2LA 3H6KA 5DE3A 3RDPA 2C3OA 2IP2A 2WWFA 5AVJA 4DUPA 1JMYA 1S8AA 2XMPA 4EUHA 3EYAA 1RI5A 4F6RB 2JBWA 1PJZA 3NASA 2C5BA 4FJ0A 1WPRA 4RANA 5H02A 4BN4A 3F67A 4K9OA 1JA1A 3KQMA 1GO2A 4AKEA 1GRCA 1XDBA 2BFDB 3IHTA 3FCCA 3CVXA 3HPRA 1KJQA 4QJ5A 5HGJA 1SM4A 3LAWA 3EVFA 1IZ8A 1J90A 2J5KA 3UJCA 1P0MA 4DA0A 4FOTA 3OAAA 4TVKA 1OFHA 3GRPA 1FTNA 3LBYA 2QTAA 1ZNQO 2YMPA 3NG1A 5DGDA 1Y34E 4ZAFA 2ZBRA 2HU5A 3MAJA 2ZIEA 4IPTA 3T5DA 1W4RA 3SHTA 4MR9B 5FWXB 4QFDA 3GT3A 3Q7IA 3QX9A 4D8WA 1MGOA 2C4NA 1QLJA 3C6KA 2GPTA 2VPIA 3B7PA 3R40A 2Q6VA 4RPGA 2ZR8A 3ILVA 3VJLA 3P9XA 4BO5A 2ZUEA 2IP4A 4Z4GA 5LC1A 4H35A 4CL2A 3KVRA 4KL8S 1ZL2A 4DNQA 3AB3A 1LXCA 4OFBA 3KFVA 3ONWA 5H3CA 4Z1MA 3RVQA 4D92A 1RYYA 4B46A 1OLSA 4M3NA 5JXHA 4RAOA 5BQOA 3W9UA 1Z68A 4EO7A 4J43A 2QAGA 3Q8XB 1KAQA 3GLTA 2VNSA 5BQPA 3ZCRA 2IXAA 3GZNA 3VHXB 1GLVA 5FUMA 3IEUA 2A5JA 3MINB 2BSQA 2XBLA 4I66A 2J5XA 3PDJA 2OWEA 3U3JA 2ZYSA 5D84A 3T15A 1EKXA 1TYEB 4UM5A 1QCCA 3ZGNA 1ZQ1A 1YZQA 2JBAA 3VJRA 4H6WA 3BWCA 4OLJA 1X1TA 3ACDA 4ZIRA 3TQSA 1XDUA 1CVLA 3TK1A 4ZKDA 1SXQA 4HWPA 1QRSA 1TYAE 2X8JB 1ECBA 4MEAA 1KEUA 1KSFX 4MGHA 1PR5A 2PS9A 2CXTA 3V4SA 2OHOA 5KYYA 3IYLW 1K6JA 5C51B 1H3NA 2YHAA 1U5AA 3IB3A 3PC2A 4JFRA 4HC4A 3GFVA 2V4UA 1C9EA 1RJ9B 1QM5A 2YFQA 1IEWA 2OHHA 3VYTB 4NU6A 3PDUA 4GR5A 3AFGA 4G25A 4JOCA 3TL6A 3ROXA 5A4MS 2C5HA 2O07A 2ZUSA 3O4VA 1WEHA 3I62A 1GPNA 1LW6E 1YB6A 1ES9A 1RD4A 2ZJ2A 3R77A 4QBKA 4YIHA 2E49A 2IEAA 4RE6A 2XA9A 3AR9A 3V7WA 3UJAA 4B80A 1Z22A 5JFOA 4KE6A 4EG1A 2O8BB 1D04A 4ODIA 2FPRA 4TXMA 2JANA 2AHOA 2I1LA 3LUKA 1B76A 2ADFA 4AZ0B 2HLPA 3VA7A 1OZFA 3JWIA 4NMMA 4URFA 2VUTA 1BXZA 5TY0A 3RK4A 4AB1A 2CXQA 5BUZA 5HIAA 2WAXA 3GLKA 2IXBA 3GYGA 4N0QA 1X8JA 3LC1O 4I5GA 2HBZA 1GGNA 2Q6KA 3DAHA 4TM7A 2Q0XA 4XIIA 3T38A 3RS0A 1RYDA 1MO5A 1QVRA 2FEKA 5A1TA 1IZ7A 1U90A 1XCLA 3JARA 2X0JA 2GKGA 4ND4A 5DOVA 2NU9B 1Z0JA 2RHJA 4ML3A 4B4OA 1RKBA 5CCEA 3ROGA 4Z53A 3QW2A 3QW4B 2HF2A 1AQLA 1I2DA 4QUJA 1LPNA 3C7CB 1C9KA 4FGUA 2VDVE 4N0DA 4PNEA 2ZTSA 1QGDA 2RKWA 2QTHA 1PR4A 1LDMA 2J9GA 4J91A 1NJ8A 4YA6A 3N2KB 2DFTA 2I3GA 4D5EA 1V7CA 2FWNA 1L4HA 1D4AA 3KX2A 4EYEA 3TNFA 3U7HB 1ZMTA 3ESQA 4DMFA 2YRXA 2AJDA 3DSRA 2OCGA 2E4XA 1YRHA 1L5SA 2OHJA 2VHZA 2XDQB 3A4IA 4GUAA 1SCBA 3GJTA 2P9GA 4LHEA 1J9EA 2O5RA 2PL3A 2WSMA 4C4YA 1ONPA 2X19A 4BV9A 4NBUA 1DUSA 4HAUA 4BYMA 1Z29A 1F8FA 1KXZA 4B34A 1Q7BA 3O4HA 4QG3A 3H9GA 4AKTA 1WMDA 3AVPA 3VXKA 5B30A 4BB5A 2X22A 3C1UA 3EK2A 4QL3A 3D4IA 4ZQGA 2C3UA 1Y4UA 1L5RA 5CFNA 1T9CA 5BN5B 2OESA 1ZMBA 4FR5A 1TAHA 1U0EA 2Y6UA 5F5XA 1AGRA 2B78A 1XPUA 2PUTA 5DVZA 4L72A 1BDMA 1YCGA 5THKA 3A6ZA 3EB9A 3PUIA 1FDWA 3G2QA 1FYDA 3FPLA 3JS5A 1PSZA 5L6MB 2ZYRA 3E82A 4KXQA 5HDBB 2BIFA 4JZYA 2BCGY 3CW9A 5KOIA 5E4TA 3AR3A 1LGYA 4D0SA 1BDJA 4KR9A 5CVVA 2QL5A 1GPYA 1V1RB 3DV0B 3K72B 4IXWA 4X24A 5BQ5A 4X6YA 2WYVA 3EEOA 3C74A 4OSPA 3NTOA 5LDDC 3MJ4A 4RXUA 3HVJA 4YRTA 1X7ZB 1OLOA 1RHQA 4GLLA 4Q1CA 2GEFA 4UUPA 3IP8A 5I47A 5CFQA 5JDIA 3L4KA 2O5EA 1DX4A 1D0IA 2PR7A 2WJIA 3B1KA 3FROA 4MPPA 2E4ZA 3OZFA 2VF8A 2GBPA 3G17A 3P2MA 1EWTA 3LW7A 3PHLA 4GMGA 1G6Q1 3VH2A 2H8KA 5K03A 1IQRA 3VO8A 1RXWA 2PWPA 3UEOA 4ZEMA 2C88A 4QUBA 5EUMA 5EQJB 1Z2NX 4MPDA 5J63A 2HEGA 1JYSA 1U7UA 3V33A 2BP7B 2IHJA 5JRDS 4ALIA 2QTNA 2AFHA 2VRWA 3EAQA 1BD3A 3PPXA 2G25A 4KQKA 1TIPA 4AJLA 3K0HA 1ZM4A 2QPAA 3QA9A 4AYTA 1VI6A 3HA2A 4C88A 5EMKA 1V3VA 4ZVQA 4XIJA 3DFZA 1CHNA 1PW7A 1H4VB 4MWEA 3EEQA 2I7XA 3BERA 3MSCA 3R74A 3WDMA 3KXKA 5FL7D 1ML4A 4LY9A 4YAJA 2Q4OA 1U31A 4WZAA 4RMNA 5EYPA 1A5ZA 1YRYE 2OG1A 1ZUNB 4LF5B 1KFEB 4HH4A 4TGLA 5A3RA 3DKPA 2I33A 2R66A 1NVVQ 3HUEA 5C31A 4HUJA 2BAGA 1Z7BA 1Q0LA 5ICMA 1VJCA 3I76A 5D1HA 1ZUD1 5LB4A 1K63A 2QRKA 2IHZA 3LFHA 1YKSA 3U13A 4YJ2A 4ZOLF 3PFKA 3S81A 3Q85A 4I55B 2MR5A 4J0IA 2CK3D 2FLKA 3HR7A 1D8AA 2Z4TA 1QO9A 2C59A 1GR0A 4CR7A 1FFAA 4PNHA 3CU5A 4RC9A 3WDKA 4OXRA 2HO5A 3ES9A 1GD1O 4RV5A 3CXRA 1QVWA 2WSYB 4FW9A 2FUKA 5GJCA 5C0OE 3ZLTA 4F4HA 4C4TA 5FUXA 1X7HA 2GF2A 1XZDA 2P69A 2O2YA 3W3AH 1GITA 1FIUA 1E0DA 4GWLA 5EKTA 4TSRA 1TTPB 4ZXPA 4NYIQ 1Z4JA 4YECA 4CLHA 5HVNA 1EU1A 2C0CA 1N33B 4JUCA 2Q6IA 4TRNA 2A1UB 1RZUA 4D26A 2C07A 5EZYA 2E0IA 2F6RA 4TMTA 3TCNA 3MWDB 5KVSA 3W90A 1BD4A 4HDKA 5EXXA 1MRZA 1RT9A 4PW0A 1XKXA 2MWMA 1J97A 3LT1A 4DJ5X 2REQA 1NMXA 5C7IO 2EWWA 3AF0A 1EXNA 3AX6A 2AUMA 2EAUA 3GHYA 3JSXA 1YOVB 3O4RA 3RVDA 3AO0B 3CNHA 1D9ZA 3C43A 3PL5A 1GZ4A 4JNCA 5HCNA 1EWQA 1TUIA 3K7EA 1Q7RA 4A8JB 2ZXEA 2W98A 4GP6A 4YTEA 1T3HA 1ZD3A 2AGVA 1ACMA 1S7GA 2FMKA 1A8IA 4GYWA 4K9DA 3CR8A 2OBYA 2CLHB 1E1DA 4HX9A 4GICA 5CM8B 1VBMA 4AXXA 2A0WA 5JAIA 3C70A 2R8BA 2HYIC 3BWDD 4FQ8A 5HQJA 2CW5A 4IDPA 1TUEA 1WQ3A 1U8FO 2OXIA 1EFCA 1A2QA 1PZXA 3MOGA 4LVCA 2G9NA 2FUEA 2V03A 3EZXA 3JQ6A 3LUDA 1M8JA 3WHIA 5IT4A 1EDZA 4WNCA 2QJWA 1KDZA 1ODSA 3FBGA 3USES 1QYCA 4E1BA 1CUCA 3O8BA 3ONEA 2AN5A 1VKRA 2UZ3A 4FC6A 3GRZA 5DHQA 4MKFA 2A5FA 1MENA 1V4NA 2J08A 1E6EA 4US1R 1XQYA 2BHSA 3BL6A 4FX2A 5LIPA 3WP0A 1F1JA 3IUPA 1ZICA 2D2EA 3KL4A 3QFRA 1JPNA 3A9WA 3UPDA 5CPBA 4Y2PA 5DGIA 4WGGA 2IA5A 5LZ7A 1YJ8A 2V7UA 2VF7A 3GDWA 1K3TA 4M86A 3K8ZA 3VDNB 4EZBA 5JUWA 5ALLA 5KYVA 2GCPA 3G5UA 1AQNA 2FG7C 2ZE7A 4RWZA 4U7DA 4CTJA 4KQ1A 1U7DA 4CUZA 4LY6A 4RSMA 4M37A 1O9GA 3BB1A 3NHPA 4IINA 5JD4A 3KWJA 3I9JA 2QRMA 1NONA 4CMIA 4LHZA 4EY5A 3P9RA 4PZPA 1U8TA 2ODBA 3B53X 1UC5B 3OQVA 2J0EA 5JOQA 5KTNA 4MVCA 4R5HA 3X1MA 1XFDA 2ZYDA 1ZO8A 3A9RA 4UQOA 1T9GS 2IHTA 2G17A 4Q9KA 3OIDA 2XUPA 3ADBA 3GRUA 2QMHA 3GGJA 1SQFA 4ZDIA 4AUNA 4RJKA 4OGGA 2BFCA 5J4YA 3L5KA 1E5TA 4WZBA 3SBDA 1Y1PA 3MB5A 4J0KA 1QX4A 4E3WA 1XRRA 1VJGA 4MS3A 3ID6C 3AUXA 4MRNA 4ZDKA 3IEVA 4JR0A 3TBHA 2R5FA 3A3KA 5JALA 5AXAA 1GDTA 5GQSA 2J4DA 1H2FA 3I32A 4QJ3A 5FPKA 2B7LA 4PLGA 3EAGA 2NNWB 2A1TR 4YX9A 3IQEA 2IH2A 3Q2OA 3SFTA 2DWUA 4RTOA 4RZ2A 3BE4A 1N2JA 4D9KA 2R84A 3A70A 1GZ5A 4HNRA 3VMMA 3KVNA 3PI7A 4K40A 1NBEA 2GEKA 1AHIA 3RIGA 4EB3A 4EP1A 5L3ZA 4V0LA 5T3YA 5C4IA 4J16C 2FA9A 2QZPA 4J1TC 3RIXA 3RVPA 4MJXA 2WHXA 3QXSA 4QSHA 4UBNA 2OWDA 1I4WA 4ZP1A 1A4RA 4TWZA 4CM5A 4RFVA 4PC7A 4K6GA 5FOTA 3ZE8A 1V8OA 1J21A 1Y9EA 4TQAA 5U1PA 1G5HA 5ECDA 2EFJA 3C7KA 5C1IA 4YT8A 1VC2A 2DBVO 1VE5A 3L7JA 4G4GA 2A9QA 1G0NA 3P4XA 2KS6A 3N74A 2P40A 4HV4A 3G2IA 1XTIA 3VU0A 2EBUA 4EO4A 3D4LA 2PGXA 2O0KA 3EY9A 3LC0A 2HA2A 2LCQA 2Y77A 2X3FA 4G37A 3L5OA 4NCAA 1E96A 1U1IA 1EB9A 1Z75A 1KH2A 2B98A 4INZA 1PWZA 3KLNA 3R3SA 4J1QA 5KTTA 3OETA 3AR5A 4Q9IA 4V2IA 3D7NA 3H2BA 3ZKWB 2QAIA 2ACWA 4RKYA 5B3JA 3WV5A 4ZJPA 1EXDA 3OE7D 1Z2OX 4OYLA 4EW2A 1N1MA 3KAKA 4ZOAA 3VUEA 2ZJBA 5HF8A 4Q6BA 5HCUA 3AR8A 3OICA 4LOLA 4ZVTA 3SAJA 1C1YA 3HCFA 1GTL1 3BD7A 2BTQA 3A1CA 1GR1A 5DXFA 1GKLA 2OM6A 4ZRDA 2WPDD 4ROTA 3NCTA 2VK8A 3BEOA 4LJ8A 5KX5B 1CNFA 1T8PA 1LNSA 2CNOA 1IOVA 1T6XA 2WINI 1NBMD 3R6WA 3S4YA 3NHKA 1YZGA 4M0LA 5J59A 1WB4A 1BDIA 1F3OA 2H9IA 1DLIA 1WMSA 1W93A 3VKGA 4NE7A 1V37A 2CL7X 2VDMB 3JATA 3VHXA 1MEEA 3MINA 1KQNA 1RWOA 3VC1A 4EGQA 3AIKA 4BJ6A 3Q5GA 1E58A 1EFTA 4JVLA 2PIAA 5BR1A 1WUIS 2HF7A 3TOVA 1Z4NA 4A5OA 1KBZA 1YF3A 4TMKA 3VTZA 3VNRA 4B6OA 2PBZA 2H1VA 4PZLA 3PSAA 1UOPA 3FFTA 4BPRA 1W1WA