4E46A

Structure of rhodococcus rhodochrous haloalkane dehalogenase dhaa in complex with 2-propanol
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
293
structure length
292
Chain Sequence
IGTGFPFDPHYVEVLGERMHYVDVGPDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEWPEFARETFQAFRTADVGRELIIDQNAFIEGALPKCVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPALHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase
publication title Expansion of access tunnels and active-site cavities influence activity of haloalkane dehalogenases in organic cosolvents.
pubmed doi rcsb
source organism Rhodococcus rhodochrous
total genus 105
structure length 292
sequence length 293
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2012-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4e46A00
4ZV7A 2GYUA 4X6YA 4QE3A 2EEPA 4AMYA 5EHNA 5JASA 3PUIA 2XI4A 2ORYA 1HLGA 4ITVA 3FYUC 4ZREA 5AKKA 1AZWA 4U2FA 3AZQA 3SWWA 5CMLA 5ALPA 3WKDA 5AJHA 1TCCA 1A8UA 4U2GA 3CXUA 2QJRA 2V9ZA 5ALSA 3FVRA 1BROA 2CEKA 2ZYIA 1GT6A 1N8SA 4BAUA 4G1FA 2JEZA 3W9BA 4N8EA 2I78A 1WB5A 3U1TA 4OUKX 1ZD5A 3JWEA 4XIIA 1ZJ4A 1IVYA 1MJ5A 3FYUB 3B5EA 3I2KA 4AZ0A 1TIBA 1T4MA 2GYVA 3ESAA 2JGJA 1AURA 5CH8A 2OQVA 2OCGA 1H2ZA 1LPMA 3OOSA 5D7BA 1Z68A 3QM1A 4J0CA 3IDAA 2FX5A 1A7UA 2PPLA 1K8QA 1LNSA 3SX4A 3WK6A 1P0QA 1UKBA 2QUAA 3ANSA 1CR6A 4X3CA 5AKJA 3E4DA 4LYEA 5C81A 2I3DA 2C58A 4UHDA 2YYSA 5K3CA 3VJKA 3AZPA 3C70A 3PE6A 3KDAA 5HK8A 5KREA 5LYYA 1S8OA 3DLTA 4PSUA 2C5FA 1LZLA 3L1HA 2QTBA 2OCLA 1CUAA 4BYMA 4UHHA 2AJ8A 4WDRA 2X8BA 1TCBA 3I2FA 3C87A 1TRHA 5AOAA 1UZAA 2BUCA 3V1LA 4WDQA 4UHBA 4NMWA 1MAAA 5CURA 4KE7A 1THTA 3A2LA 1U8EA 5A6VA 1ORVA 1C7JA 5JD6A 3DDUA 4JH0A 2K2QB 1CUJA 2WLSA 3QBJA 4GXNA 1CUXA 4H0CA 3OM8A 1EDBA 5HQ3B 1SCQA 3KD2A 3VVMA 3AFIA 4QDOA 1VXOA 1WB4A 4OYLA 3VJMA 1HQDA 1FSSA 2V98A 2UZ0A 1ZIYA 1UWCA 2XUAA 3O4JA 1XROA 1E5TA 2GBIA 3ZLTA 5ESRA 4RGYA 5K3FA 4J03A 4KAAA 5A62A 4G4JA 4DLNA 1TK3A 4B85A 3A6ZA 4TGLA 2C4HA 2H9YA 3ESBA 4A5SA 3GZJA 3D2AA 5K3DA 2XB6A 2WHPA 1MN6A 4Q34A 5JZSA 5ALKA 4QWMA 3HLKA 2O2IA 5C8ZA 5LZ4A 2JGFA 3LIPA 1GKKA 3H2GA 3STWA 3DCNA 2WHRA 5ALQA 2ONCA 3DQZA 3R0VA 1KU0A 1USWA 1SCKA 4N5IX 1JU4A 4BP8A 3EQ9A 2DSNA 2P8SA 4BCDA 2RAUA 4WFKA 3WWCA 3WA6A 5LLSA 4BZZA 1XZEA 4JNCA 4AN1A 3R3ZA 5ALMA 4ROTA 1MX9A 5FUMA 4OB8A 3I6ZA 3DKRA 4H7DA 5AM4A 3C6ZA 4PV7A 3C6XA 4W9RA 4U2BA 4DMFA 3N0TA 1CUCA 4BZWA 1A8SA 4I19A 3HC7A 2WUEA 3I2IA 2QUBA 3WWEA 3WQHA 3FBWA 2XQJA 5FP0A 2JGIA 1VOTA 3M82A 1X70A 1FFDA 1CLEA 4QLAA 1QZ3A 3FCYA 4ZGBA 1LPBB 4U2DA 2WU4A 2GZSA 4HAIA 2WG2A 4CCYA 4QLOA 2OLEA 4QDTA 1GPNA 3TRDA 3IA2A 2O2HA 4IQ4A 1YB6A 4UHEA 1GGVA 2HU8A 2VJDA 4K6KA 5CW2A 2WFLA 1YB7A 5DLPA 1UOPA 4GW3A 3ESCA 1WHSA 1BU8A 4DYHA 4B81A 1UXOA 4KR0A 5AKXA 4G4GA 3DYVA 3IVMA 5C7YA 1FFBA 5AK4A 4FNGA 5DYYA 1G5FA 1F0NA 4C4XA 3O4HA 2CKMA 3G9UA 4EB0A 4KE8A 5CT6A 1EVQA 2HIHA 2AJLI 5DNWA 3KWJA 3VKFA 2XUQA 2V96A 3TEJA 2R8BA 4BDSA 4OYYA 1OILA 5AK6A 4UBNA 1N1MA 3BDIA 2J4FA 3TGLA 1XZJA 3AUKA 2WFZA 1Y7HA 5I8PA 4EA6A 1KU6A 1E66A 3DYIA 3FWHA 4X00A 3V1KA 5IVDA 5ALUA 5E2IA 5D6OA 1DQYA 2JGLA 3I1YA 5ALZA 1JMKC 3FOBA 2XMRA 2BKLA 1R3DA 5AHXA 5AI9A 4KAFA 3W9UA 1UOOA 2HU7A 1VZ2A 3H2HA 2ZVDA 1UFOA 1P0PA 4E15A 1SFRA 2V97A 4UPDA 3V48A 5T4EA 5CBKA 3GBSA 5LP1A 2QXUA 4IO0A 3WL8A 1QO9A 4GI1A 3D59A 4BAZA 1C4XA 4LXHA 4L72A 1XLUA 4FOLA 1JJIA 1NU8A 4BE9A 2Y1KA 4DSZA 1LPPA 3O9VA 3ESDA 3QH4A 4UHFA 4B0PA 1H2XA 5ALHA 4INZA 5AKZA 1LPAB 5JADA 5AM1A 2ZJFA 5ALXA 2XQGA 4DMCA 2Z8ZA 5ALWA 1YS1X 4S0XA 1Q84A 1EB9A 2IX9A 5KWJA 3S2ZA 4G8CA 4BVJA 3DS8A 2AJDA 1WB6A 3WI7A 3W06A 4X93A 1DWPA 1H2YA 3IUJA 4BDTA 4Y2VA 2C0PA 5LZ7A 4K6GA 5C8XA 4P93A 2YXPX 4UBIA 2HDWA 5JAPA 4AO8A 5HKAA 3LS2A 1LPOA 4X90A 4UBMA 3GA7A 4ETWA 1QO7A 4DNOA 4X95A 3HYSA 4KJXA 2JF0A 1K4YA 4K5QA 1TAHA 4MQMA 1QTRA 4BB0A 2X76A 3IULA 5A7FA 1CVLA 1DWQA 5HF5A 4HVTA 3I2GA 1CFJA 1EDEA 3PUHA 3FYTA 3LLCA 1D07A 1O6GA 5AI0A 2G5PA 4HXEB 3O4IA 4AQDA 2WIKA 3MVEA 5T4FA 4Y2JA 4FFVA 4RNCA 1DX6A 2XUGA 4KYVA 4J0GA 4G9GA 4L3WA 4GWLA 1R50A 2JEYA 4CCWA 3JW8A 2BJHA 4KAJA 5ALGA 2WSLA 4HXGA 5T4BA 4RE5A 4YASA 3WWOA 2W6CX 1VLQA 4FLFA 4B9EA 4MYDA 4DM7A 3DJYA 5AKGA 2PBLA 1I6WA 3RM3A 2XUIA 1XRNA 5E4JA 2ZJ7A 3RLIA 3T4UA 2R11A 4V2IA 2WQZA 3C6YA 4I3FA 4W1SA 5JZ9A 1YSCA 1MNAA 3I2JA 2IIVA 1BN7A 4Q05A 3RARA 4DNFA 2WJ3A 5HKBA 3G9TA 4UUQA 4IH4A 5K3FB 3GELA 5DNUA 4FKBA 2VJBA 2XLBA 2WIGA 4DTCA 4GECA 4G9EA 5CT4A 3CCBA 3G0CA 3QPCA 3D2BA 4CG2A 4EHBA 3MUNA 5C8VA 2QS9A 6YASA 1CUIA 2QT9A 1XZDA 2FUKA 5EGNA 3ILSA 3H04A 1QJ4A 5HF6A 5A71A 3FSGA 3PF8A 3D4LA 1EK1A 2WHPB 2WKWA 4GHWA 4P92A 3WYDA 4O08A 2G4LA 4DMHA 1EA5A 1X2EA 2G5TA 4EZIA 3VISA 3VDXA 1FFCA 2XDWA 5JANA 2RIPA 2WIDA 4X94A 3AIOA 2ECFA 2WIJA 4Y2RA 1BEEA 3P2MA 5FKJA 4HXFB 1EDDA 4L0CA 4QDUA 2XE4A 3ANTA 3A2MA 4C4ZA 5DWDA 1R9NA 3WYNA 2HA5A 1ZOIA 1BCSA 3STUA 2XUHA 3S8YA 2XMBA 1XRLA 3STYA 1GQRA 4B0OA 1XZGA 3OTQA 2CMFA 4L9AA 2OGZA 3W05A 1MTZA 1H23A 1AC5A 4YPVA 4B84A 1VE7A 2QVBA 1IUPA 1J06A 5AKIA 4OU5A 3STVA 1NU6A 4N5HX 4EY5A 5IH7A 4KE6A 1M33A 2C7BA 3QITA 4KRYA 2XUOA 5FPPA 3HI4A 2RHWA 3MGAA 3QMMA 4AXBA 1YA8A 3C43A 5LKAA 4H7HA 1DX4A 2WJ4A 4WJLA 5BV7A 3WL7A 5AH0A 1XFDA 5EHXA 1R88A 3BWXA 3G0IA 4C89A 2PUHA 2VATA 4B6GA 3WKBA 5EI5A 5IVHA 1HPLA 2WFLB 4UBOA 4H7FA 1YASA 1CUDA 1ZI8A 3D2CA 2H7YA 4UFOA 4UBKA 3WIOA 4ARAA 1DT5A 5LZ8A 1ZGCA 1NX9A 4LXGA 4TVKA 2WIFA 4EBBA 4UBLA 5ALTA 5IVIA 1T2NA 1U2EA 5J3JA 5E4TA 1F8UA 3DNMA 1UT6A 1CUGA 4MJ3A 1QIIA 3DOIA 4YK7A 1CEXA 4X6XA 5DTJA 3FCXA 5AM2A 2XMSA 1Q0RA 3STXA 2QR5A 2OAGA 2B9VA 2HL6A 3IUMA 1DT3A 5JYCA 5AKHA 3BDVA 4HRXA 3LIIA 1XZMA 3C8HA 3AINA 1YAHA 1U65A 3G0BA 4BRSA 4WFJA 2H1IA 4ZXFA 4Y2TA 1ETHA 5JD4A 1K6EA 1YCDA 1AGYA 5ALNA 5AI4A 5AK3A 1FFEA 1QGED 3LCRA 2X5XA 1QFMA 4FTWA 4OB6A 3C6BA 4PQEA 3E0XA 4G8BA 1QOZA 3NWOA 2WJ6A 2HA7A 3I6MA 1DWOA 1XRQA 5EHZA 4CG1A 3V1MA 3WKEA 1H22A 1JU3A 1QTIA 2HA3A 4B80A 4H7KA 4MQLA 3DOHA 3K6KA 3HJUA 5JAOA 4GDMA 5CXXA 3WK5A 3L1IA 3OC0A 2Q0XA 3PFBA 1XZLA 1ACLA 1XZKA 4F0JA 2HFKA 3R3UA 1QIHA 4Y7DA 4E14A 1CUWA 5DTIA 1WHTA 4PSDA 1QIJA 3CN9A 1CUFA 3FLAA 2AJCA 1CUSA 3CN7A 5AI5A 3IBTA 2JGKA 2Y2VA 2BAGA 1UOQA 4BAGA 1KEZA 2DQZA 3EF3A 1ODCA 4A23A 4UBJA 1LGYA 4AO7A 2QJWA 1P0IA 1CV2A 3IURA 2ZSHA 1AUOA 2OGSA 2OCIA 1EH5A 5HFAA 3O0DA 3BIWA 3WLAA 4QDZA 5CTAA 4F21A 1HBJA 4J3JA 4KEAA 4RE6A 5CT5A 3HZOA 1W6RA 3HACA 1UK6A 1GZ7A 2ACEA 2BFNA 4LYDA 3YASA 1SOMA 2OCKA 1GQSA 1GXSA 3HSSA 4LHEA 3JYHA 3DEAA 5BWCA 5JAUA 1BN6A 3KSRA 4Q1VA 1H2WA 1QIEA 4P08A 3WZLA 2W22A 1Y37A 1VKHA 2BUBA 2AJBA 3WWDA 3AIMA 4X71A 3BJMA 4Y2QA 2HRRA 3WK8A 2GYWA 1HDEA 2JBWA 4PNZA 2GBCA 3FSGD 2Z3ZA 4W63A 1ZD4A 2WUGA 5IVKA 3WL6A 4PSCA 1ISPA 1QIMA 4LIPD 3PF9A 4WFIA 2PU5A 2XUJA 1G66A 3DL7A 1XQYA 2XQFA 3H1BA 3R41A 2VSQA 4B82A 3EQ7A 5F4ZA 2RONA 1EB8A 2BGRA 1VE6A 4BC0A 1CUEA 2D0DA 4B83A 1W75A 3WK9A 4OPMA 2JGEA 4J7AA 3ZV7A 2VQ6A 3K2IA 1LPNA 4XVCA 5ALJA 5KBYA 3WL5A 4EY6A 1B6GA 1R1DA 2XLCA 1ZI6A 3N2ZB 5EFZA 2B20A 5AI8A 1EVEA 1L7QA 1DTEA 4FBMA 3STTA 4XJVA 1E89A 3C8DA 3ZPXA 3EIOA 1ODSA 3F98A 5LKRA 2CBGA 1O6FA 5CH3A 4U2EA 4OSEA 5EHQA 1XZIA 3GROA 4UFNA 5AKYA 2FJ0A 5JALA 4ZI5A 2VTVA 1MNQA 1ZICA 1PJAA 1CUUA 1QIDA 1XKTA 1PV1A 5AKLA 2WTNA 3WKAA 1W52X 1CQZA 5K3BA 3UUEA 3M3DA 4W1QA 1G42A 3FLEA 4P9NA 5JAHA 4IH1A 3BF8A 3W04A 2VAVA 4AZ3A 3AJAA 3Q8WA 4X92A 1BE0A 2H7CA 4GBGA 1QFSA 1ZD3A 1THGA 1IUOA 2ES4A 5CH5A 5AM0A 3O4GA 4E11A 4AN0A 4H7EA 5CT8A 3FVTA 3D0KA 3H1AA 5AIAA 1X2BA 3R3VA 5EIEA 5HZGA 2OXEA 3ICWA 4U2CA 5CT9A 4X7BA 5DJ5A 5DNVA 5LZ2A 5IKXA 5ALIA 4QWWA 1R9MA 2OQIA 2ZSIA 2O7RA 4BBZA 3G9ZA 1MX5A 3IUQA 1EK2A 3WA7A 4C87A 2J3QA 1UK7A 3ZWQA 2VF2A 1YR2A 1G4HA 1XZBA 1LLFA 5SYNA 2QRUA 1UK8A 2XQIA 2DQYA 1VA5A 2Z5GA 5ALRA 1Y7IA 1XZCA 1XLWA 4FHZA 3H19A 4EUSA 4H77A 4B9AA 2ZYSA 3O9MA 3H2KA 2PKYX 4M0FA 3AZOA 1WCYA 3H0CA 4BTVA 1MU0A 4BRZA 2ZJ6A 4HZGA 4OCZA 4B7ZA 4WY5A 3U0VA 3EQ8A 4DNQA 1CUZA 2B4KA 2HHAA 3QMWA 4H7IA 1XRPA 1EINA 5D3KA 1N5MA 4Z49A 3A2NA 1GPLA 2YH2A 3I6YA 3BIXA 5ALDA 3RK4A 3BJRA 3G8YA 1QLWA 1YAJA 2PM8A 1BRTA 5A7GA 1AQLA 4K2AA 1EHYA 1OCEA 4Y2XA 2ZYHA 1W1IA 3PICA 1WPRA 1CUYA 2CB9A 2DHCA 4MEBA 3VJLA 4HS9A 5JIBA 4H18A 1VA4A 4BATA 3FNBA 4KE9A 1VXRA 4CIBA 4J0JA 4WY8A 3F67A 1MPXA 4CIAA 5ALOA 1BEZA 2Y2UA 4GLBA 4J0IA 4LXIA 5AK5A 3WIBA 2ACKA 3F96A 4J0DA 3L1JA 5AOCA 4MWSA 1MO2A 3IB3A 3AILA 5EIAA 1XZAA 4Y9SA 1HL7A 1JT2A 3I28A 4M0MA 1AKNA 2OAEA 5FXMA 5CXUA 1ZI9A 2GBFA 4X85A 1LBSA 2GBGA 3C5VA 1WM1A 2VEOA 5AIBA 3IUNA 4CFSA 2DHDA 1K63A 2OPHA 2RGUA 1WOMA 3BF7A 3WJ2A 3QMVA 2NW6A 2XMCA 4QZVA 3PI6A 3ZI7A 1QONA 5HCUA 4CI9A 4DGQA 2G63A 4CCYB 4DSAA 4RPCA 3AIKA 3V9AA 3I2HA 2XQKA 3X3HA 2DCMA 3QVMA 5AM5A 4DMKA 3GFFA 3HRHA 3SC2A 3SK0A 1LPSA 5FPQA 2PVSA 2Z8XA 5AO9A 2HFJA 4JYPA 3R3YA 3TJMA 1OXMA 4KRXA 4PW0A 3C5WP 3ICVA 3PDCA 3WK7A 3BL8A 5LZ9A 5AKEA 1R4ZA 1MAHA 1UKAA 5FV4A 1JMYA 2E3JA 4AB1A 1L7RA 5HF9A 4QNNA 5ALLA 4QEKA 3F97A 1ZJ5A 3QZUA 3F9CA 3M83A 5K3AA 2WG0A 4Q3KA 2WUDA 4YX9A 2BGNA 1XKLA 2PSJA 4E46A 4N8SA 4Y2SA 3ZLUA 2HA4A 1RWQA 2C0QA 2Y6VA 3FAKA 4MWTA 3WMRA 1HKHA 4F5ZA 2J4CA 5K5EA 4LKOA 1PFQA 4DNPA 3O95A 4UHCA 2JGMA 1XLVA 3NOXA 1ACJA 4BVKA 5I9IA 1E3QA 1J07A 2B61A 4OD0A 2CUTA 3G9XA 5HF8A 1XQXA 1YA4A 3WZMA 3NUZA 5JATA 4QA9A 1LBTA 4J0HA 4GEGA 7YASA 2I03A 1SC9A 3B3QA 2PUJA 2VJCA 3I1IA 4D9JA 3DKKA 2BCEA 1DU4A 2QXTA 3QPDA 4WCVA 2OG1A 3G0DA 4DIUA 2XMQA 4W1PA 2RHTA 3FYUA 4AX4A 1RP1A 2XMZA 1AMNA 1MT3A 4EY7A 5EIHA 2VA9A 3E3AA 2RI6A 4EY8A 4G5XA 3HEAA 1CRLA 4FMPA 1TCAA 1DQZA 4EY4A 4HTAA 2DHEA 5JZBA 1A8QA 1ZIXA 1F6WA 1BCRA 1Q83A 3LP5A 1ORWA 4K6HA 3E1GA 3BE8A 5H3HA 4H35A 3UMJA 1BS9A 4A16A 4FWBA 3QYJA 2ROQA 2QMQA 1XRRA 4FDMA 3UUFA 1RYYA 1QIKA 1N5RA 2H7XA 1CPYA 3DD5A 3D7RA 3CCCA 1J1IA 1EX9A 3B12A 1E8DA 4Y2YA 2CJPA 1ZGBA 5A7HA 2WG1A 2PSFA 3OG9A 2WU3A 2DFPA 2XUFA 1IZ7A 5JD5A 5JARA 5AP9A 5E4YA 2EDAA 3M81A 3R3WA 2QZPA 4M0EA 1E8NA 2AXEA 3K9BA 3A70A 5BWBA 2FJPA 4BTLA 1IMJA 5ALEA 1U4NA 4JEIA 3PFCA 5DYTA 4X6UA 4ZWNA 5AOBA 4G8DA 1XZHA 1L7AA 2HADA 3G0GA 3HXKA 3T52A 4CG3A 3R3XA 2C5GA 1TKRA 3WJ1A 4UFPA 1DINA 1F0PA 2HA2A 2HRQA 4OB7A 5K3EA 1MX1A 4FLMA 4JYMA 5HQ3A 2WHQA 4TPKA 4XX1A 2WTMA 2VAXA 4HRYA 2XUDA 4MXDA 2VT6A 3H17A 1JJFA 4X91A 2IITA 5DYWA 5A2GA 1JKMA 2VJAA 3BXPA 1FJ2A 4FFWA 2QM0A 2BUAA 1UK9A 4FLEA 1JFRA 4H7JA 2XUKA 3H18A 5FDFA 2JIDA 4N8DA 2DR0A 2Z3WA 4ZV9A 3V1NA 4OU4A 3OPMA 3R40A 2LIPA 1JI3A 5AI6A 5I7UA 1GPKA 4PF1A 2HM7A 3W2TA 1AX9A 1EI9A 4KACA 3NGMA 4MYSA 1QIGA 1P0MA 3G02A 1CUVA 2WM2A 3C45A 4C88A 2PU7A 4IHAA 5AICA 3H2IA 5LZ5A 5YASA 4C6HA 4IH9A 3FLBA 1W76A 3VXKA 4XWGA 4BP9A 1K5PA 2XMGA 1B41A 4MEAA 1XQWA 5KWIA 5D3ZA 1ODTC 4BC1A 4NS4A 4Q3OA 5SYMA 1VJ5A 2HA0A 1TQHA 1CIJA 3F8SA 4NVRA 4W1RA 3WK4A 4FNMA 2PSHA 1IZ8A 2I3ZA 4Y2PA 4AMZA 1XRMA 1QIFA 2XT0A 5FOQA 3VVLA 1EXWA 1CUBA 4C4YA 3HABA 1SCIA 1ZD2P 2XMDA 3IIIA 5FRDA 2WFMA 1IUNA 5AM3A 2O2GA 4BCBA 1JJBA 4FBLA 2J3DA 2PSEA 1W4LA 3Q0TA 3KOOA 3QPAA 2YASA 4C01A 5ALYA 4BE4A 1QE3A 1YS2X 2WILA 4J0KA 5HFNA 4G4IA 3D5EA 5FLKA 1GKLA 1XQVA 2O7VA 1UKCA 3KXPA 5ALFA 2VT7A 4Y2UA 2PSDA 1C7IA 4F60A 1LZKA 3H2JA 4BVLA 2CZQA 4BCCA 3MUOA 2OGTA 2HA6A 3G7NA 4ARBA 2QOEA 2Y6UA 4JUIA 3DL4A 1FFAA 2HU5A 2PL5A 2XUPA 2ZYRA 3RKSA 5ALVA 2WUFA 3D3NA 4X97A 4Q3LA 1WPXA 4AO6A 1A88A 1CQWA 2QKYA 3ED1A 3GUUA 3ZLVA 1Q0ZA 5HK9A 1CUHA 4I4CA 5T4HA 3KWFA 3OURA 4ZRDA 2EDCA 5ISMA 1J2EA 5BOVA 4QDXA 4NZZA 4Q82A 1VZ3A 3WWPA 5CRIA 3WKCA 1E8MA 3EBLA 5LIPA 2D5LA 2PX6A 4PO3X 2GZRA 1XZFA
chains in the Genus database with same CATH superfamily
1SHZA 1E2KA 2OO7A 3NWBA 1WMSA 2FXIA 3AV0B 4YAUA 3Q7PA 1HH4A 1XF1A 5AHRA 2BZSA 5DV9A 5EHNA 1DXHA 4LZZA 2XZTA 4H3VA 1M2GA 3UKDA 5C1OA 3MHTA 2JC3A 3HU3A 2J45A 1GZVA 4E21A 4EJSC 1P17A 4DLTA 4GC5A 1NVEA 4MP6A 1WSWA 3CIOA 4IBOA 3VAZA 1BMDA 1DKLA 4S1WA 4Y1RB 5CFQA 2IQIA 2BMEA 1SQ0A 2RH8A 3AONB 1L7MA 3MBIA 1F5NA 2HK6A 3NIFB 3QNMA 4PNPA 5EJ7A 3UK0A 1YUMA 3TL6A 2O8BB 4O2AA 3DWGA 1Z18A 2JW5A 1JDSA 2Y1FA 3AB3A 2ONJA 4X62B 3B6MA 2HJVA 5EZ6B 3EQZA 1HOXA 1A8UA 1G2PA 2I2DA 4PLWA 4U2GA 3K4HA 3BQ9A 4GPTA 2OUIA 2QJRA 2ZT7A 1WDLA 3T8YA 3PC2A 5JJKA 4ZDIA 3AHGA 4L74A 3OTGA 1HUQA 4K7JA 4R7ZA 2QJTA 3FVRA 4IQ0A 4R2WA 1AXGA 2GTPA 3VDMA 3DE1X 4HLUC 3W8NA 5LDHA 1T36A 1GT6A 3H83A 1V5WA 2HMTA 5L51A 5TY0A 3DE4X 4G1FA 2W48A 3SDSA 3GRYA 3NJ4A 4LHYA 4LGYA 4B6EA 2I6UA 5ER6A 1K92A 2FXVA 1U0HC 3UCEA 3AFNA 5BSEA 3WGOA 2BIFA 4N8EA 3V5NA 3QEMA 2I78A 2CSXA 2ZIEA 4ZAWA 4LYGA 3UWKA 1DOHA 2YV1A 1M74A 4FPXA 1G7SA 4OUKX 3SLRA 1ZD5A 4JT8A 3UTCA 3T9EA 2JLYA 4HDKA 2AQKA 5JSHA 3D4OA 4NDAA 1L1FA 4XIFA 4ZOLB 3LDFA 3GWGA 4LRWA 3ZJYA 4OHCA 1PR9A 3CMMA 1ABEA 2GN4A 3O82A 3TTTA 4WBNF 4R84A 3MIZA 2D2XA 3E6AA 1CB7A 2CB0A 3EZXA 3MWEB 4RK6A 1N32B 2A3RA 3FZEA 1L4EA 2CN1A 4GE3A 4TN1A 2R84A 2GYVA 1W2WB 3BFXA 4BMCA 1AURA 1M6NA 1W2HA 1FP7A 2F1IA 3L0ZA 2BEUB 2JCXA 1CDZA 4IEFB 4GKJB 3BFJA 4FUTA 1W59A 2OCGA 1H2ZA 4QGBA 2PVCA 3AR7A 2J0VA 3FUXA 2FMFA 3QM1A 4DABA 1UAGA 2XSZA 3DDZX 3ZK7A 2R85A 4J4BA 221PA 3VNUA 4BLRA 4MLCA 4NYIR 7MDHA 3GLIE 1PYGA 2J7PD 4PLGA 2P3LA 2GEUA 4B6QA 3QE0A 2FZKA 3U9TA 5BRAA 4LXTA 1TF2A 3SX4A 1HX7A 4LEIA 3UGKA 3T7DA 4X1YA 1UKBA 2FSSA 5EXTA 1J24A 1XX6A 4ZT3A 5AKJA 4GNKA 4B6RA 1ND6A 3QELB 1PLKA 3BMXA 5IAEA 3N2KB 4NU5A 1YR1A 1U7HA 3V2UA 4BHTA 2J32A 2ECOA 3HJBA 3RVRA 3VR6A 4E7PA 2G5CA 3BIFA 5H83A 4CMBA 5K3CA 1G9SA 2XJ4A 4I50F 1N1DA 2JD1A 2IXDA 3LCUA 3TQOA 2TRSB 3QWHA 3ESXA 2AH5A 3E58A 4RD6A 3AX6A 4IHJA 3E35A 3NNSA 4N0DA 4MW9A 5LYYA 1W8DA 1S8OA 1XQ1A 3OZUA 3FPAA 1EJ6A 1K9SA 4EL5A 3R6LA 1YJCA 5HUHA 4B3SB 3GIDA 4XUCA 2XB4A 4G5HA 4Q7KA 3R6WA 5EXPA 5HE8A 4RZ2A 5LXTB 3NG1A 3K16A 2BGMA 4E4YA 1Z8HA 4JSYA 3DMDA 4H4DA 3AESB 2JFHA 4ZEOA 1A9TA 1KF0A 2QNRA 1T0HB 5HM8A 1IOWA 4U7DA 4E07A 2ZBVA 1B74A 4YB8A 4BYMA 4D6YA 2GB4A 4RA6A 2M98A 2W4QA 3S3TA 1J2RA 4X45A 4PPNA 2NNLD 2GWRA 4DARA 2PZKA 3UEOA 3V32A 5F33A 3DDHA 4DREA 1F3OA 1YB1A 3H3XA 3L9WA 1SCJA 5CJJA 1NN5A 1QNLA 3C87A 5G1OA 4KO2S 1MB4A 5AOAA 4PSKA 3OZEA 3TG2A 1UXKA 2Z2KA 4CLRA 3OD1A 4DEVA 4JZYA 2OV6A 3KKNA 1GSAA 3QV1A 5LU8A 1EWVA 1TM5E 1XVLA 3F3MA 1P1KA 3PD7A 5CJ2A 1MAAA 1Q7RA 3LC0A 3P2OA 1XBTA 4EDFA 3M5DA 1TZJA 3AHCA 4B79A 5MDHA 3K31A 1XPRA 1R0SA 3RVSA 2V6GA 4NY1A 2DBQA 4L6AA 1FFSA 2R1TA 1XEXA 3IUBA 3LVQE 4BMXA 3A2LA 3L8HA 1SBYA 2R5FA 1GKUB 2D5CA 1U1DA 3AERA 3CZ4A 1XD2B 1E18A 1XCJA 3RC9A 3ZBQA 5JD6A 3PT5A 3D3WA 1QYCA 4IWYA 2C9ZA 5EZYF 9ABPA 2BLNA 2K2QB 2JI6A 1CUJA 2UVDA 4UE3S 1Z6ZA 4GMDA 4W8OA 4EW3A 1WXDA 1AF7A 2OZLA 2IDJA 3OSZA 1GQYA 1Z6AA 2GAAA 1TTQB 2NUAA 4IFBA 2BM0A 2O6LA 1SUCA 2B8TA 3IT2A 4K6MA 1C0PA 5F35A 3TDNA 4ENWA 1FRNA 1SCQA 3RS3A 1Z29A 3PVZA 2QJOA 2DLNA 4PINA 4JI7B 3TOSA 4QDOA 3NHPA 4OYLA 3VJMA 1FSSA 2V98A 4DYDA 3KQKA 2UVPB 2ZOSA 2UZ0A 1BEUB 2V8BA 1PJQA 1JYEA 1PUXA 1M1YA 1YDEA 3CG4A 4G5OA 4NOJA 4Q6WA 3O4JA 4EYGA 3Q8MA 3DMNA 2CLOB 2KB0A 3AWDA 2GBIA 1NFRA 3S0JA 4X8MA 3TM5A 3ADKA 3NX4A 4RGYA 4WXPA 5ESRA 3BFVA 5KWVA 1GNTA 3Q8LA 4NCBA 3QFSA 1G8JA 4J03A 4OL0A 3CSSA 3MTIA 4KAAA 3FWKA 2NSYA 1XGKA 4G4JA 4TMXA 3IDSA 2B37A 3GLVA 4ZVOA 4DLNA 1TK3A 1XALA 3EA4A 2QL5A 3SP1A 2C9BA 1W8IA 3ABOB 3IUSA 4JVOA 4JI0B 2FSFA 1R0CA 2C4HA 2QI9C 4R2LA 4ASUD 2CJWB 3TCKA 4YJ2F 2IY9A 4XVQA 2Q1YA 4G0ZA 5KVQA 5TT0A 3VSDA 5KQRA 1T2EA 1J2YA 3H86A 2AI3A 4M3NA 2FKNA 4X3PA 1E9RA 4ZODA 1QQ6A 2HQOA 1SB9A 2VYNA 3JZMA 4QOEA 3NYQA 1T6ZA 4NENA 5FYDA 2O50A 1T5SA 3NIBA 3NT5A 4OMDA 2FMXA 2PUGA 5JJBA 2WOOA 3LHIA 1GPWB 1GCAA 3LQYA 5JZSA 3R77A 4ZCQA 5ELXA 4QWMA 1RE1A 4IG9A 1SCUA 3C5CA 2O2IA 4Q4AA 1PS0A 5EUMA 2GKOA 1X1RA 2ZWPA 3MWLA 1GKKA 3PC3A 4DV3B 3UJPA 3H2GA 1VHLA 4CW7A 4H59A 5ALQA 1QUFA 2ANBA 2CXNA 3DQZA 4CL2A 3KCQA 2Q99A 4GOKA 4KKXB 2GFQA 4UTVA 2BFEB 5J59A 3ZX4A 3LK7A 4OAPA 3F6EX 2NZJA 3RC1A 2NTEA 4DJJA 1VSQA 4F5DA 5EIBD 1Q1GA 4B8YA 3B6JA 3N3AC 2H6EA 4WFKA 1QANA 3WA6A 2EF1A 3DHNA 2OHHA 4LOJA 2XTJA 3EN0A 3KS9A 4FI3F 5LLSA 4F3NA 3TKYA 3ZGLA 4DLVA 1U2QA 2YY5A 2P90A 4M87A 1OIWA 3SR3A 7AT1A 1SH7A 3MMZA 1GEEA 4GM4A 4OV6B 2PLWA 1RWPA 3R3ZA 3TLGB 4ZIRB 1GFZA 2DY1A 5K6TA 4B2PA 1S2IA 2R8ZA 4IQFA 1JFFB 4O25A 5IJAA 3UN1A 4EJMA 5ALMA 4U4AA 1YJQA 4RWEA 5FUMA 1QNFA 1TZ2A 4CTKA 4E1AA 1IQPA 3DKRA 5FCDA 3X43A 4HMQA 4OHOA 4LWZA 4ZA2A 4EP1A 5C18A 3LW7A 3QY0A 1RYBA 1VPWA 2H17A 2NO7A 4NR0A 3L93A 4U2BA 4MQUA 2O7QA 2QV0A 1IHOA 4X63A 4REQB 5EKDA 1ENPA 5BSWA 3ENNA 1U2RA 4CGYA 4XRGA 1O95C 4RSMA 2RK4A 1OWLA 4XR9A 4MQ5A 1IG3A 1TE2A 2HGZA 2RGNA 3F7NA 2X9GA 1K1EA 2GEBA 4IDQA 2UYGA 4O2BB 2JH9A 1XYVA 3Q2IA 2B1RA 4JLVA 3KT6A 2DFLA 2H51A 3BFKA 4MYCA 4TT3D 3ZZ1A 2QAJA 2F9LA 1QO0D 3GRUA 3WWEA 1J20A 5CVTA 2EATA 4NOMA 3AVVA 3IVGA 4POAA 1S7GA 3RTDA 1VOTA 3ETLA 2X9QA 1EJ0A 2H1OA 3PT9A 4PBRA 4W7HA 1Z2DA 3SYMA 2IKSA 4FYWA 2C2MA 3PP8A 1WOYA 2WAXA 4GMGA 4JJZA 4OGLA 2OA0A 1Z36A 3OY7A 1C3VA 4I4IA 2BM8A 2IXTA 2ID7A 1TDJA 3KO8A 4AURA 4I9GA 4LISA 5HA5A 5I3ZA 2IYSA 3B2EA 2AW3A 3K1AB 4BBJA 1HEUA 4RHYA 1V8PA 3BRCA 3T7EA 4FDVA 3JATA 3UFXB 3O8OA 1L4BA 5BR7A 4JENA 1R16A 3AF4A 1X15A 4H7PA 1E61A 3UHJA 2I7VA 3OE4A 2X5KO 4UC0A 1CDOA 1QK5A 1BFDA 1XDBA 4QDTA 1UDBA 5JNWA 3OLVA 3TRDA 3OQ6A 5CB4F 3E15A 2O2HA 5DOZA 1GPBA 1GTVA 4KGDA 4TWRA 3UB2A 1O94A 1P7VA 1YB6A 2O0MA 4UHEA 5BYBA 4IGAA 3QIAA 4EI2A 3SHTA 4NU0A 2E48A 1FVFA 2HU8A 2VJDA 4LXYA 4OXNA 4QXAA 1H1TA 1NLYA 2WFLA 3K6JA 4GPAA 4K6KA 5CW2A 3RCBA 1IQ0A 3CNQS 1GUDA 4OSOA 2H2AA 1H2HA 3QEKA 5TSDA 4UU0A 2RHOA 4RXUA 2B8WA 4MZXA 3TD9A 1PNRA 2AFIB 4MV9A 1BU8A 2CNLA 2OBNA 3OIGA 3L7AA 4B4UA 4NE7A 1MPTA 2B2XA 4GM0A 1H0KA 1T5IA 1XWWA 2XBUA 4N7MA 4KR0A 2PJUA 2BGTA 1YFKA 2R6CA 4ZI7B 1O3YA 4G4GA 1SZPA 2CY0A 4LI0A 2XQVA 1Y82A 3B82A 3TB4A 1Q16A 5AK4A 1U2GA 1KNXA 4MRNA 1GADO 3KQPA 3VHXB 1WPGA 2QGZA 1F0NA 1ZK4A 2F67A 2Q50A 3RE1A 5C4MA 1O77A 5CD9A 4UEKA 3U39A 1X13A 3R24A 1D3AA 1VLMA 2GLUA 4LBWA 5DI3B 4C4XA 2YQ5A 1A77A 1GU7A 4BASA 5LQNA 3G9UA 4REOA 2IZZA 3N7UA 4W9MC 5CT6A 1EZZA 4RD3A 2BFFB 3C48A 3ND7A 4WLFA 3MT9A 1TGVA 2AJLI 2JGDA 2OFOA 2GHRA 1HURA 3Q1KA 4FS3A 1KBOA 2E1PA 3S7ZA 3ONNA 3TEJA 3CKYA 1H8HD 4EKYA 2AOWA 3COPA 2AFHA 1HQCA 4ND1A 2R8BA 4II3A 4BQPA 1DWUA 3B1JA 1GG5A 2GXUA 3UYKA 2AG8A 4QRHA 5G2OA 5E6SA 4PGFA 1N1MA 3BDIA 5DGCA 4D2IA 2RGRA 2IHUA 3E4CA 2PQ6A 3FPBA 4KR7A 2J4FA 4BQRA 1J5EB 5E6RA 2X3UA 3RVKA 3TGLA 4Q00A 2B2CA 2QRVA 2WFZA 1Y9DA 1C50A 2PX0A 1GQQA 2PCLA 3MXTA 1XLTC 4PFJA 5I8PA 2H52A 3ISJA 3MFYA 5H8WA 4MHSA 1E66A 1PT7A 1V8ZA 4K8RB 3V2GA 4XD7A 1PNVA 4MI9A 4F8JA 4UD6A 2IEAA 1L7OA 2AE1A 1Q1NA 4MW7A 1KIAA 3F6YA 5K03A 5D6OA 2QENA 2X2PA 3V46A 1X86B 2LPMA 4PCAA 5FPKA 1GTRA 1JMKC 1QORA 1VJGA 3FOBA 4BLTA 2XMRA 1Z38A 2ZI9A 4BWYA 1OC4A 4TQGA 3VR5D 1E6WA 4LWQA 1N3YA 3ZIDA 1T2FA 4KAFA 1W36C 3KJNA 2OBYA 3P9SA 1Z06A 4ZQGA 3B1VA 1T34A 3PNKA 2VHUA 4OQXA 4KFTA 2FEAA 1P5ZB 4HUQA 3H2HA 2QNIA 4PO8A 1ZM3A 4WQMA 1UBUS 2AHRA 3UC9A 1BDMA 3M6WA 3C2QA 1JQ3A 1OIXA 1HYQA 1HZZC 1NZJA 2M9MA 4Y98A 5BO5A 3UCXA 4ENUA 2TMGA 3P9PA 3PQ6A 2X4DA 4GC9A 4O2AB 5DGIA 1BFKA 1KSJA 4UPDA 2GLTA 4W8HA 1ZLXA 3IBFA 4BE7B 2FHSA 4DKXA 4K9NA 3GBSA 3D1LA 4BLPA 2VAPA 4URZR 4TZ0A 2I4OA 2QXUA 2KLBA 2ZRCA 1QO9A 2X0RA 2P91A 1R5OA 1XK7A 3QGMA 1VP9A 4GI1A 4RCYA 2ZAYA 3RUPA 5E0KB 3NHFA 3LQ4A 3V1TC 1ECCA 3NJRA 4YFVA 4BAZA 3T1HB 4C4RA 4KQGA 1YO6A 4Q9LA 2AHOA 2I29A 3GLTA 2VP6A 3JZAA 1WA5A 1LJ8A 3U9SA 1JB1A 1XLUA 3HG7A 3B1FA 3D6VA 1JJIA 3BCUA 1T36B 2YJGA 3G85A 4J1QA 4M8LA 4Q7MB 3RQIA 3TLKA 3ZDRA 2HR1A 4ASUA 3C7TA 3NIDB 5LBUA 3JSXA 1G5RA 4BQIA 1TC1A 1X7WB 5CVVA 5KAPA 2AN4A 3OJXA 2QN1A 1HSZA 3BAFA 4JU9A 4RF3A 4D46A 3N5KA 3EEBA 3LQKA 3R23A 1H2XA 1IFXA 3ML1A 4INZA 2BMFA 5ALHA 4KNYA 4AF6A 4C7BA 3EHEA 1P44A 5BVGA 1RWOA 4CEHB 1V9LA 1EGHA 2GXSA 5ALXA 4DMCA 1PEDA 3IIEA 4HDKB 4JL6A 1YS1X 3EMDA 3EARA 3FKSA 3QPBA 4DPKA 4DUGD 2IX9A 2P9YA 3AVOA 4ZGWA 5JCXA 4ESOA 2REQA 4IUYA 1KA9H 4UCFA 2CBXA 3S2ZA 9LDBA 5HOEA 1VIYA 2GN9A 4MO2A 5KX5A 2W0SA 3T7CA 1YONA 4ATNA 2PTHA 1F3LA 1UBTS 4GI2A 4L3OA 1BX0A 3GEBA 3LRXA 1QWOA 1DRWA 1UPFA 1NUHA 4IY1A 3QWAA 4K40A 1T8RA 4XFDA 4EFKA 2ZIAA 3KJHA 4ON9A 3RS4A 4KIGA 1QV6A 3F6SA 4PZ0A 4BDTA 3MGKA 2X3FA 1JTFA 4NARA 4F4JA 4F46A 2IC5A 2WAAA 1EP1B 4E13A 5B2FA 5C8XA 3K0CA 4HHEA 3SZUA 1MIOA 3JYLA 2A8YA 1W9HA 4G37A 1MHTA 4M99A 1JR6A 4L76A 4X90A 2EBFX 4RKFA 2FLVA 1M8GA 1SZJG 2G82A 2QX4A 4X1YB 3SQNA 5JH7A 3OQOA 4FOOA 4OG2A 2IIPA 3PQEA 4ETWA 3FOWA 3K8OE 4IDHA 4KQKA 3UHOA 1DXOA 3L8DA 3OIDA 4PLYA 2BTOA 4HK4A 5ADHA 5JPDA 1P62B 4EAQA 1TAHA 3OQNA 1EIZA 1WVMA 1N6NA 2MINA 1CF4A 2QU8A 2FPKA 1F6DA 1R6TA 1NJSA 1QTRA 1PDOA 3AT1A 4HQ6A 4N5MA 5A7FA 1WIWA 4GLLA 1CVLA 1DWQA 3EUFA 5E2BA 5I7SA 3MINB 3ZDAA 1EBUA 4I1YA 2VZLA 2R6HA 4HVTA 5J4HA 3MD9A 2K6GA 4IHJB 2D4HA 3EUWA 3C3EA 4PXYA 2FR8A 2P2CA 5JS6A 1WV1A 3G2PA 4O63O 3K5HA 5AYVA 5FI3A 3LLCA 2BGIA 4EGQA 4J90A 1O6GA 3A4TA 3CZAA 1NW9B 4GSYA 4LJ4A 4D9IA 4DEYA 3BXOA 3N9IA 5ICSA 3FCEA 1QO0A 2QY6A 4PX9A 4CMGA 3JQ9A 2RBEA 3UMSA 3GN1A 3SQMA 5IVHA 3O4IA 3OIWA 1R00A 3UJDA 1EMDA 2WAMA 3EIEA 3GPCA 3OEWA 5CLGA 3K5WA 3PEYA 3L7BA 4ND7A 2VAMA 3UAOA 1BVRA 1FW8A 1U8XX 4BUJA 5BSHA 2XE7A 2L17A 1P31A 2Y71A 4AMUA 4GX2A 1U8ZA 4HLNA 4EUNA 3AY6A 4IRMA 3BORA 1U0OC 2Q4OA 4UXIA 4YC7A 3SHOA 1IONA 1L8QA 4RNCA 4IJQA 3K0AA 1XA4A 1I0ZA 1OBVA 1P7ZA 1T3TA 2XUGA 4KYVA 1CE8A 4MKHA 5TPZD 1HI9A 4EFLA 4JUAA 3UG6A 3QA3E 5JECA 4AKGA 1P7PA 1X7XA 2Y66A 1KK1A 5E9WA 3ZCXA 1R50A 3U3JA 2I9KA 4GSKA 4BFWA 4RGBA 2JEYA 4CCWA 4CM8A 2PVPA 3WYBA 1SXPA 1H6DA 3WTCA 2CHUA 1N2EA 3DR3A 2J08A 4HXGA 3OQMA 2O19A 3CE6A 4MKFA 1Z63A 4YP7A 5G02A 5T4BA 1XEXB 1SOVA 5JFOA 3QVTA 2WNSA 4HH3C 2Q2NA 1JQ5A 2I34A 1B3RA 3HB0A 3L41A 2I4MA 4DM7A 3IVRA 2H0QA 2DRIA 4R1PA 1BHJA 1PX0A 1KDPA 5AKGA 1I6WA 3VQTA 2UKDA 2I55A 3N8HA 3UBTA 4RFSB 2PCJA 4LZLA 3RM3A 1V71A 5DMHA 4L4ZA 1Z4PX 1I51A 2X58A 5H82A 2HBQA 2HWKA 3TOVA 1KAGA 4ZVVA 1CJKC 1J22A 4PZUA 2OZLB 5E4JA 1P1HA 5EWJB 1ARZA 3W5SA 2NUAB 4V2IA 1L5SA 4YN3A 3D1JA 3TVTA 4R05A 3R3HA 3ME5A 1I3OA 1Z82A 1WF3A 4Z6KA 3GDHA 3D02A 4EX6A 1X9GA 4WW0A 1ESDA 1ZRMA 2XT6A 4F2GA 1JE1A 4O5OA 3GT4A 1M9NA 4W1SA 2WZBA 3T1NA 1MNAA 5FTNA 2IOFA 3QOXA 1J09A 5E9QA 3W8DA 4UCWA 2KHZA 1QF9A 1XJ0A 1YMVA 2JFVA 3CWCA 4UDNA 4O4IA 4CKXA 2JHFA 4DNFA 1PQUA 2VAWA 2DVMA 2WJ3A 2E21A 3G9TA 3EOAI 1O6BA 1R5NA 3GLSA 4UUQA 3GQBA 4S05A 4LZWA 4AFNA 3JYOA 1MJGA 3RS9A 3LL4A 1XAJA 1M5TA 2F17A 1UBHS 2FN7A 3GELA 4IEEA 4FKBA 3JD0A 3UQZA 3FX2A 4NPCA 1Q7CA 5EJ9A 1DO0A 4DTCA 1H8HA 1RKVA 4PN3A 4WKOA 4G9EA 4M88A 1ZMBA 4JMLA 4E88A 1NI5A 2HJSA 3QPCA 1CHNA 5CW1A 2IUTA 5KOYA 1AE1A 3GX1A 1YULA 3TBKA 3UQYS 4BNIA 4AT1A 3MMXA 2QS9A 5AHWA 1Z8DA 2J09A 3NOOA 4KN5A 3PV0A 3C5EA 4XQ0A 4ZCRA 3U6KA 3H04A 4HH1A 1H2FA 4WLOA 3VOTA 3FSGA 1EP3B 3B2QA 3MJVA 3NALA 1G21B 3D4LA 1EK1A 2ZT6A 1D2GA 2IXAA 4YI5A 3WYDA 4M4SA 3ZW8A 3IAAA 4ILKA 4N7RA 1E4EA 1C7RA 1NJGA 3PXBA 5B3AA 4DMHA 1SCUB 3TLJA 1EWKA 3L6DA 1NPYA 4TZKA 1UBOS 1FFCA 1XRJA 1OI3A 4J7CA 2CFRA 3SOPA 1RZRD 3QUTA 3TQSA 2WIDA 3WWYA 4M9ZA 2IU0A 1GDTA 3DDCA 4UNSA 2C4MA 3OWHA 4EZBA 3K96A 4LF9B 4B43A 4YMSA 3SNKA 4HWTA 3F74A 3PHGA 3VR5A 1SO8A 5FKJA 4BO1A 5HGXA 4DXDA 3ZKAA 4HXFB 1IY2A 1MH1A 4JKIA 1G3IA 4QDUA 1G20E 5K0ZA 5GV7A 2OORC 4TTRA 1NLZA 1OWPA 4C4ZA 3QTTA 5DWDA 4OMUA 1XHLA 2QVLA 1AKEA 2YBDA 1VG8A 4MAFA 1IBRA 2ZREA 2WM3A 2YX1A 1ZOIA 3OPYI 1BCSA 4G24A 1ODLA 3L4JA 4MCAA 3W7AA 1SELA 1XRLA 3STYA 4M54A 2H59A 2VPQA 1SKBA 2PZBA 4KC0A 3T7IA 4CKYA 5JXIA 4PC6A 3GDWA 2J67A 2NADA 1OLSA 3I4CA 2M6SA 3VO8A 1A04A 1ZCJA 4L9AA 4BLSA 4AY5A 2MMCA 2A5FA 2OYSA 3B1ZA 3GEMA 1NYRA 4C2TA 3D0QA 3OZCA 3KQMA 3U19A 5CLQA 2IBSA 1D2EA 5CLIA 2D7DA 5KYVA 3SQOA 3WADA 1RAAA 3BB4A 2QVBA 1FVHA 1KTVA 2C4VA 2B35A 3LQQA 4N6OA 3SEFA 1J8MF 1G63A 4OU5A 3OY2A 2G7MC 1NU6A 4CMJA 1KEWA 1VP3A 5KWSA 2JIQA 1U0RA 1WTAA 1J70A 2C7BA 1XU7A 2I6GA 3QITA 3K6SB 1W5SA 4ZMBA 1PT5A 3WX0A 3ANLA 1XNQB 1Z3CA 2O2ZA 2YRXA 3BK2A 4EEZA 5FPPA 2VRCD 4OIFA 2VR1A 5BR4A 2DBRA 1I6KA 2N1BA 3IE0A 3KQOA 2A35A 2R6ZA 4DLKA 3QVGA 2IE8A 4BEWA 3MGAA 5CNMA 4GXQA 3QMMA 1FXWF 4AXBA 1XEWX 4AYTA 4NH4A 4PYMA 3IMEA 1HK7A 1YVDA 3CUKA 3R8CA 4I4NA 2Q2WA 2PMCA 2UYOA 5IUKC 5B36A 1QX3A 1ZITA 1C4OA 3MS7A 5EUBA 3JATB 2ASEA 1YR3A 5JQGF 3O8OB 4DA8A 2H9AA 1U1CA 3WL7A 5KKNB 1OD6A 2JGRA 2EWWA 1AK1A 5JPCA 2YWXA 4AYWA 2UZ1B 4PRLA 3JR3A 1XFDA 3UGQA 3W78A 2B30A 1R88A 1IU9A 1LSJA 3BWXA 1XDZA 1FTQA 4C89A 1WZCA 2PUHA 1KI3A 2Q3CA 3B5IA 3ISTA 2JFGA 3EGDA 5KSPA 3V7UA 3TRFA 4LJLA 2BKVA 4B6GA 3WKBA 2WMOB 3RRNA 4KCGA 2WFLB 2EAUA 3N2GA 3CG0A 4WFQA 1RC1A 2ZBEA 4D7AA 1W44A 3GRAA 4TRNA 1OPRA 1YASA 3ZDEA 3RSOA 1ZRHA 2FEOA 3C7CB 4CM7A 2R9VA 3VYWA 4V1CA 1JKXA 1WSBA 3CZCA 3BRSA 2HCFA 4P4TA 1C8VB 8LDHA 2NXJA 3HPQA 5IXJA 4ARAA 4V3BA 1VKZA 3LLSA 5IDWA 3TW0A 4V02A 1TQ4A 2AFVA 3OLWA 3N2IA 1TU0A 1FP4A 1I33A 2ZJBA 1FNBA 4WIAA 5CITA 521PA 2E89A 3A1UA 3C74A 1MJNA 1Z33A 3RD5A 1YJXA 3TVYA 1KQPA 5ALTA 4TKUA 1I2CA 3R0ZA 4LS3A 4M1ZA 5JD3A 2IS4A 1R64A 1YB2A 1U2EA 5K8JB 3FTNA 4FYYA 3IV9A 1NKVA 3RC3A 2XKJE 3LT0A 4P31A 3DBRA 4MVJM 4Q1BA 2Z0MA 1L6IA 2XCQA 1W5AA 5K8IA 4MJ3A 4BNUA 2XZOA 1ZGHA 2JGDB 2Q46A 3CX6A 2X77A 4Q24A 4XSHA 2DBVO 5HUQA 1X0XA 1CEXA 3FI0A 4RTSA 1SVIA 2WIAA 2BBOA 2ZUBA 1JXAA 1DSSG 1VECA 1W6UA 1Q0RA 1JR3A 3ZJ5A 1KY4A 3DMPA 3ILVA 4LJ8A 3ZGOA 2RGGA 3V1YA 4FR5A 1NLUA 1YL6A 2C59A 4Z9FA 3U81A 4PX5A 1VIDA 5E6SB 1RM5A 1KE1A 5JYCA 4BUCA 5K8UA 5JNTA 2JG3A 3ROXA 4RCZA 4ZAXA 2AD1A 5E6RB 5DULA 4X9XA 5B4TA 4MS1A 3G0BA 3U4CA 4BRSA 1YE5A 2OVBA 3EZGA 3IAHA 4HPJB 3K1JA 2P5SA 4MHTA 2QN9A 3GGOA 4QVGA 1AV7A 5KC8A 1JJ7A 3O7MA 4C7VA 1X42A 3O9ZA 1YCDA 2CWWA 1AGYA 4OQQA 4P84A 4XB2A 5DGDA 4C14A 2FDXA 1QQTA 5C7OO 1W73A 4H1UA 5L3RA 2IUEA 2SECE 1PJ4A 4TV8B 5C5CA 3VHLB 4KMMA 3HWWA 3ECAA 2X5XA 4QPPA 4YCSA 4GVPA 1U63A 2QG6A 1KETA 3K9LA 4Z4HA 3ET5A 4FTWA 3C6BA 1AA9A 1CLUA 5K3OA 3ZNOA 3ZXUB 3G2JA 5DTMA 2CW5A 3AFOA 3H9QA 3P7MA 1SIWA 1HSOA 1EZ1A 3H6HA 2P6NA 1ZG3A 3IHWA 2B3TA 3EC7A 4CMHA 4M21A 3PHBE 2HMUA 1CB0A 5KTNA 5B7QA 2C29D 3I6MA 1MZPA 3I62A 1XRQA 5EHZA 5ILOA 4HFNA 4JYAB 1AB5A 2ZBUA 4CG1A 1O9GA 3OZTA 4E94A 3PUYA 3UO8B 1H22A 3FF4A 4RKWA 4MYTA 4ARSA 2CXTA 2Q6IA 1TJPB 2C2ZA 4MQLA 1JEJA 2ZRLA 3R5XA 5KTOA 3DOHA 1ORIA 3A7DA 3VU9A 3HJUA 1YHNA 1ONSA 2VXYA 2X9LA 4FD3A 1JFSA 3NEYA 2WHEA 2AQHA 1X8JA 3ZWKA 1JHQA 4GOMD 4WA8A 4PQFA 4YPOA 4KBFA 1D4FA 2ECQA 3FJYA 4KQMA 3E7XA 3C8MA 1U1FA 1XZLA 1D6JA 1UMCB 4XDZA 1I4EB 1WKBA 4HNAB 1XZKA 4Z4EA 5IWAB 2QN8A 3Q2KA 3WJ7A 1KXJA 1NLMA 3KKQA 2A9QA 1Y5NA 2IYAA 1QC5B 4HYYA 4Y7DA 5AHOA 4YUVA 4Q1EA 3PJEA 1SOAA 4M83A 3NC1C 4OXKA 2X0EA 4RJTA 1QIJA 2VIIA 3QX7A 2AEEA 3MCTA 1AF4A 2UUBB 2CVFA 1RI5A 1NM5A 4C3ZA 3VR4H 3KQUA 1ZAYA 1PWYE 3TI7A 5BVGB 3O3NB 5HR5A 3JCZA 1FUEA 4RQUA 2Q1WA 3VPGA 4ARZA 3HN2A 3KVYA 3I6QA 2Y2VA 3DVSX 2PV0A 4YA6A 2YVKA 4BNWA 2FN8A 4DLYA 4EB8A 1JFVA 2BAGA 1UOQA 4DHWA 2REQB 4FFDA 4N41A 1UXHA 5D3MA 1KEZA 2FG7C 1YR8A 3EF3A 4DDKA 2AZ4A 5KX5B 4A23A 2CVZA 1N2CA 2P3QA 3RUDA 3B51X 4ZT6A 1LGYA 4KMRA 1G3RA 2WDPA 3CF0A 1W96A 3F5DA 5LP6A 3LBIA 2MT9A 2WF5A 3B5JA 4X1OA 4C9BA 2ZSHA 3GJ5A 2VNJA 5FA5A 4TLLB 4ODIA 3GD7A 1V9CA 1F60A 2OGSA 3MN1A 3TMYA 3H99A 1U6IA 1EH5A 2HHJA 2QGNA 1QTNA 5HCIA 4F1WA 1A5ZA 1B3BA 2I8AA 1Q0SA 5KDDA 1U5BA 2W2LD 6ABPA 4XWKA 3RS0A 3CW8X 4DMMA 1MIOB 2BEVA 3D4BA 3DW1X 2P2YA 2QTGA 3BTVA 4CTJA 3L7CA 1GILA 2WRZA 2VUSA 3AEKA 4GMKA 5KKCA 1H2BA 2YL2A 3DAYA 4BFCA 1QXSA 5JH7B 2YV4A 2QRHA 3OX4A 1I4OA 2W6JD 4AL4A 5GZ3A 3BTSA 1IOLA 4GYWA 4CM9A 2JS7A 5E7QA 4MIKA 1NDUA 4F21A 1EBBA 2F1RA 1HBJA 4EPVA 1NMZA 1O54A 1AUXA 1G3QA 1YCHA 2E5WA 2MINB 2VYFA 1QKJA 2G71A 4MW1A 3G8DA 5J5VA 1TECE 5I7AA 3EXEB 1GKIA 4Q16A 4BVBA 4ETMA 3HZOA 4L28A 4A0RA 1KI1A 2EJVA 4P36A 1WZUA 4DBLC 3JX9A 1D09A 1HM5A 1MG0A 1Y7LA 3TKAA 1QX4A 1VYHA 1GZ7A 3PE4A 4O02B 2BFNA 1ZCFA 4I36A 4EZEA 1SOMA 2AKYA 4I6GA 3K71B 5AW7A 4LHEA 2HJRA 2QP3A 3EMBA 1RQNA 4K9RA 5F2EA 1Z7EA 3DEAA 4EITA 1AK9A 1Q57A 1FBTA 4Q48A 5JAUA 1G0OA 1BN6A 4CQLA 3DLPX 1LB1B 3F5QA 3KSRA 1V4NA 3TDMA 5B7NA 1ZCZA 1W4ZA 3NM4A 3RWOA 5H70A 1H2WA 3VR4D 4MI1A 3Q8XB 4GPD1 1K6MA 2P3SA 3IGFA 4P08A 2J31A 2JA2A 3OCYA 1OWOA 4EG3A 3FOEC 1Y37A 1G1AA 1RZUA 1U0TA 3DMTA 3PHLA 3PU6A 4ISBA 1C9YA 4QFCA 3AXSA 2GCOA 2AJBA 5FPSA 3AIMA 5TMDA 1CE8B 1IWPB 4OGKA 4Y2QA 4MCIA 1A7JA 5C53B 3A1SA 4PYNA 3HI6A 3BT7A 1X7XB 2NO4A 1WNTA 1TVMA 3ID6C 1Y63A 3HJRA 1Z0UA 3RSSA 3RK0A 5JNUA 1AA6A 2V54A 4FP9A 2IU3A 1DC7A 4GQBA 3GLHE 3AJ8A 4A15A 1RLJA 2ADFA 5L4SA 5IVKA 3CVVA 1GZ6A 1VCMA 1DBVO 1YR7A 1L4HA 1B7GO 2ZUVA 2AMYA 4MQ4A 2IEYA 3DLHA 4IPTA 4G65A 5C46F 1RC8A 4NV3A 2X4GA 3FMOB 3HCDA 5HJ2A 1ISPA 1Q17A 2O1SA 2YCBA 5IN4A 1QIMA 2WJVA 2GNPA 2N9UA 4WFIA 1TD9A 1NHGA 1RAGA 2E55A 2Q4RA 2YXEA 5DRTA 5TQ0A 1LS6A 5GZ6A 4KLRA 3HNPA 1CY1A 3AG6A 2YWRA 3P27A 1U3CA 4LXQA 4EELA 2PU5A 2XUJA 3IS3A 3FTEA 1M6EX 1G66A 1KOJA 1VRWA 3BZBA 5JE8A 4EGFA 4F92B 3A26A 4XB1A 4LF5B 4EHAA 2BP7A 1Z4JA 2FUG6 5EIWA 4B82A 1Y4DE 3N0RA 2RONA 4OOFA 1H5QA 1P6XA 1G18A 2BGRA 2OHXA 1RPJA 2QUHA 1WABA 3HFSA 4HQFA 4RLFA 2D0DA 4B83A 1GTL1 4JC4A 3FUWA 1Z5UA 2JJ1D 3WISA 5K09A 1VKOA 4LRYA 3GGCA 2WSBA 2X7JA 3PEEA 2FWJA 2FB9A 3Q3JB 4F3KA 4L75A 4UOEA 1D7OA 4G5QA 2XODA 4C7JA 4XVCA 1MRZA 3G6KA 2TECE 3HA7A 3GQBB 2HWUA 3OEED 2TS1A 3DEZA 3WL5A 4TSFD 3WR5A 3HFJA 2BEWA 5DBFA 1VL8A 4YXFA 2XLCA 3WAGA 3JQBC 5EFZA 3GP3A 1Y3IA 1NI3A 1DADA 1JG3A 1DKUA 1ZL0A 1PO7A 2DWQA 2FEWB 4J16C 4TXMA 5A9SA 3FFXA 3UMRA 3P4XA 4BKQA 4D3YA 4S24A 2MU1A 1F14A 4AJKA 1DRKA 1EVEA 1SC6A 3V7WA 3FUTA 5I01A 1OT5A 3F0TA 1JW9B 3DMHA 1W34A 3V3TA 1NVAA 3DULA 3I5UA 3R5SA 4EYKA 3B8EA 4GXTA 5IANA 1W7AA 1EHIA 1QZUA 3IKLA 4V0QA 3GXBA 4N47A 4HSGA 4I5IA 3C3JA 2ZIZA 3WGYA 2FJUA 3ZY5A 2DLCX 2VHJA 4TWJA 5A1JA 2W11A 2QROA 4XVHA 2NYUA 3P5SA 5JHGB 2HKIA 4ZTZB 1PIWA 4TYNA 1WB9A 1QP0A 5EHQA 1XZIA 1HLDA 1ODJA 3GROA 2IY7A 4UFNA 5EXDA 3SGLA 1ECGA 3NIGB 5JCOC 2FJ0A 3SLGA 3KR1A 4DB4A 1T4DA 5JALA 3T5PA 2G80A 4C08A 3OPQA 4BGVA 4Z2YA 5C8YA 2QL9A 2NXNA 2YDYA 2D8MA 3JWGA 3HCNA 4P58A 5AK0A 3DLIA 1KJ9A 4CM3A 5A4MS 1Z28A 4LHVA 2M2IA 1C29B 3HM2A 2CXHA 4L4UA 3MJ4A 2A0YA 4EHHA 3L7MA 4RDIA 4DDWA 2PWZA 1EUCB 1WJGA 3JVVA 3H9GA 3BMCA 5F2NA 3NVMB 2RBGA 3EPHA 3LQFA 1NONA 3PVSA 3M3DA 4BQSA 1GL6A 2E18A 4W1QA 1YRWA 3CX7A 1DAMA 5TE9A 1IM2A 1HFKA 4CIXA 1YBAA 3FKQA 4G0QA 4ZYYA 3WNBA 1BCSB 5EINA 1ZK0A 3HFGA 5JAHA 3GWZA 1N92A 1BD3A 2IPMA 3KLBA 5IFLA 1QYRA 3FPKA 4JOBA 1EFPB 4QLBA 3DJFA 4GI5A 3EYAA 2VHVA 2VZ0A 3BF8A 3FGPA 4R1NA 1ZXLA 2GTIA 1H8EA 4GR5A 3UG7A 1B23P 4KFSA 4AZ3A 4L9RA 1LK5A 1OLSB 3AJAA 1C0LA 4HLCA 2EKDA 4MRMA 2PN1A 3PYLA 4LTDA 4L5YA 4BFXA 1PJLA 3O92A 2DB3A 2YOFA 4PLVA 1KPIA 1ZOPA 2G9QA 2XTZA 3QWFA 4YMHA 3ZR4B 4LZAA 2ODEA 1PR1A 2FPPA 4FGKA 3N1UA 4W5JA 3TH5A 1ZD3A 3X44A 4D4LA 1DBQA 3UT6A 1THGA 3FFAA 4ZVMA 1ZUD1 1WDTA 4Y9RA 4TWZA 2ES4A 1HL3A 3I30X 2FW8A 4L73A 5AM0A 5BUCA 3ORHA 4DUPA 1RRMA 4J3NA 4PYJA 3MWFA 1NV8A 3D0KA 1JB9A 1VGVA 2OILA 5TGTA 5DHSA 4M9SA 5IH3A 2G5GX 4P5DA 5K6AA 3R3VA 4PYQA 5HZGA 4E1VA 2JH8A 2JLZA 4JP2A 5FOWA 3QVGB 3DFIA 2PBFA 3UXHA 3NIWA 2C20A 5CA0F 3DDOA 4P0PB 1TKAA 4HR7A 4GDFA 3F1LA 1WXQA 2PUWA 4NAHA 1Y81A 1GNVA 5BSUA 3KFVA 1V43A 2XITA 1E6EA 2HCJB 1I6LA 4KSCA 5IKXA 1AM4D 4BNFA 4PE5B 2ZTHA 4Q03A 4TQ9A 2Q7XA 5CU7A 4D0SA 1R9MA 3PCXA 3LP8A 2ZSIA 1GD1O 1T26A 4ZVPA 1Y1RA 3GBVA 2O7RA 3H4MA 4MUAA 2OG2A 3LG2A 4BBZA 1WF6A 3A1CA 2CC2A 5G1NA 4I08A 1FS4A 2Y1OA 2VJLA 2C83A 2IOYA 2JFBA 5AW9A 5TDHA 3Q0EA 1LSSA 3KZXA 4BMYA 2PGAA 3TL2A 4PCUA 3WA7A 1YS6A 3FSJX 3EGDB 3WGUA 3OJOA 3R2JA 5J2UA 2H5JA 1HE8B 4TQUS 3GUCA 3ABIA 4LX8A 5CB6A 4LC1A 2O8CA 1BQ4A 2W6JA 2P2NA 4WT7A 3T7SA 4TL6A 3D3QA 4V1CB 4FYMA 1EJBA 3SMVA 1XB2A 1GSHA 3TR0A 4M36A 3ZWNA 1QHNA 2AC4A 2P7IA 4BB5A 1NW6A 1E1RD 1ZY2A 2IODA 1XL1A 1FLVA 2X7HA 1AKRA 3ZU2A 3OX2A 4N0PA 3W6OA 4YT4A 3ZDCA 2DQYA 3MC1A 5CYOA 4YALA 1JFTA 4R7GA 1IULA 3KOWA 5ALRA 5K3SA 1V2HE 3AF1A 1XZCA 4IJMA 3LCCA 2QVCA 3L8EA 3IRVA 3DAGA 2GBLC 2VSOA 1CJBA 1USVA 4IJKA 1CTQA 1IBCA 3QWBA 4TKUB 3B7PA 2EC5A 3TAHA 4A10A 1I6MA 1PG0A 5BYJA 2L18A 2HO4A 4YFYA 4B9AA 2JAWA 1DG1G 2VNAA 1R8QA 4H6VA 5MGBA 4BFZA 2HZBA 2SICE 3JWHA 1LTHR 1HMPA 3DBRB 3L92A 3O9MA 2HHHB 4EVQA 2PKYX 4M0FA 2VHTA 2O3SA 5BR1A 4PXAA 1N78A 4S1VA 2P67A 1U5CA 1MU0A 1LDBA 1NR1A 2D1YA 5LD2C 1TTHA 3EXHA 5A5GA 4HZGA 3ZU6A 3E9NA 2FWIA 5ECWA 4B7ZA 1XQ9A 1QF7A 4ZCIA 3PRYA 1RFGE 1FUUA 2YMLA 2Z2JA 2XUZA 2CJXA 2A0KA 3O4FA 1KIFA 3PXUA 2CXQA 4KXQA 3BD7A 3USES 2IYQA 3L7DA 4FDAA 2ZB4A 1XRPA 4DFDA 1EINA 4HGOA 4MNTA 4Q1DA 1R6AA 3G68A 2E87A 3R7WA 4ZAYA 1JPJA 1TUGA 3WGQA 2QE6A 4RMHA 2HLHA 1FZTA 3V4RA 2KQUA 1KGSA 3A2NA 4B3BA 4Q1CA 3BWDD 3RT9A 1FLAA 2REOA 3DHEA 3K0SA 3PDWA 1ZN2A 1GSIA 3OMXA 1KKUA 1EVYA 3DZBA 2WJHA 3VJRA 1ZEJA 1N4DA 5K05A 3OPNA 3NDBB 2HRBA 2WHXA 4AKSA 1RFLA 1AQLA 2XVXA 2WZQA 4K2AA 3ZQKA 2RAVA 2MR5A 3AM3A 3RF6A 3UUFA 4B3IA 1W1IA 3PNOA 1WPRA 2CB9A 2DHCA 4MEBA 3R7FA 4DSOA 1D2RA 3OTOB 2XECA 4MUJA 3RVJA 3C1UA 5A4FS 3IAXA 3RAFC 1S1MA 3KUCA 3JRNA 4D74A 1L5KA 4DY6A 3SYLA 2B1QA 4KE9A 2AXQA 3EZ6A 5EE3A 5B53A 2R7KA 3EC1A 3NO4A 2ZULA 3A9VA 3KPWA 3F67A 3N59A 5EHIA 5KYXB 1FTWA 4KLNA 5BW6B 1MPXA 5LQJA 1G5IA 5DSZA 4QVKA 2O2EA 4R9RA 4X60A 4NZYA 1MEEA 1P9NA 1QKKA 1ZHHA 4UHJA 3W8RA 1XTQA 1BEZA 2PLRA 4CIAA 1OFGA 1UP7A 5CFLA 4GLBA 3X1JA 2GF0A 4PWYA 7REQA 2UZAA 1YDFA 5T67A 3ZJUA 1NZDA 2ZRPA 4F96A 3PHHA 3VNQA 4MPTA 4BFVA 1EEXB 2BM9A 1WL8A 3H8WA 4RVNA 3VC3A 3SZGA 5L9AA 1IBKB 1XZQA 1U7OA 2GM3A 2N47A 1FPQA 4P0TA 5AOCA 1W85B 1MO2A 3IB3A 4HT3B 1FX0A 4GBJA 1XZAA 4Y9SA 1JT2A 1U3UA 4ZOEA 3L8GA 3UJCA 2OEPA 4CU5A 2QTNA 2W8BB 3FPLA 3WGKA 1LFAA 4OLBA 3KXLA 3H42B 1RCFA 5D00A 1T9CA 2OAEA 2VJYA 2IEGA 3AI7A 3SMQA 1A8IA 2H00A 5CXUA 2VTKA 1RMQA 2GA8A 2WSYB 1RKUA 4ZOLF 3GPIA 3E70C 2BI7A 2ZBQA 3F8TA 1SC3A 2CNNA 4P7JA 3UA3A 4BZQA 2HJGA 2OAQ1 3AGQA 2I4LA 1WW8A 1I1OA 1D2NA 1Q1QA 1Z13A 2PXCA 1YVEI 3C16C 1XUOA 1YZHA 1T43A 3WB1A 4MRRA 4ARZB 4B4OA 3IUNA 1KRXA 5THXA 3HBFA 3IDOA 3OM0A 1UDWA 1Z8NA 2IZ7A 2QUJA 3KUDA 4LRTB 4P4LA 2RGUA 1WOMA 2MYTA 4G8JA 5D3MB 4ZVQA 3BX1A 4LV8B 4RLHA 1N2CB 4WL0A 5IC6A 3TVDA 3PCTA 1GTSA 1FK8A 1A72A 1LUAA 3U26A 2A9OA 2ZBRA 3U1VA 5FOSA 2BBWA 3I4FA 3HNOA 2P1DA 3L6EA 4QICA 4BMZA 4JYCA 3QFHA 1SG0A 2GILA 3G2KA 4X61A 1TD1A 5EHGA 4Y0VA 4XTRA 3IT1A 1EFRD 2B1GA 4DCVA 5ERYA 1OFUA 1U9ZA 1U5BB 5BSMA 4RPCA 4DSAA 5D51S 3WB9A 4GKKB 4DY4A 3DAFA 1EG7A 2HMYB 2MSDB 3MTQA 4I6EA 3AIKA 4NSNA 1CDDA 4E5PA 3VA7A 1QH9A 2LKCA 1BS1A 4DZTA 1W19A 4EPTA 3BYZA 1UBFA 1COZA 2EGUA 2QW1A 2VWPA 4OQMA 5CNKA 4BYGA 3MXOA 4Z4CA 1SKMA 1W48A 3QVMA 1DEAA 2XJ9A 2FEMA 3GFFA 5IJWA 2QY9A 2YYAA 3SC2A 1EQAA 2NSHA 3MCUA 2WC1A 3L6OO 4UJ3A 4Z7JA 4QG3A 1Y4SA 4GZ6A 2Z8XA 4H6WA 3GMSA 1WQ3A 2QQGA 3IV6A 4ABYA 3VKHA 2YY7A 4TQAA 5B4VA 3FZNA 1P0CA 2QM3A 3OBIA 3A6LA 4GU5A 4KNVA 3UWPA 3DO6A 1U4SA 3C5WP 5LXTF 4B4KA 3GRZA 4PPQA 1MB0A 4QYIA 4CM5A 4OO3A 5K0CA 2PXXA 3EVBA 4N3CA 4BEVA 4J7UA 2O59A 3BL8A 1OU4A 1K0UA 5EJAA 1R4ZA 2I6QA 2APJA 3NUQA 1V5FA 3TN7A 3LU1A 4CQLB 1Q15A 3WNCA 2NO1A 1B00A 1MEOA 2W58A 5BNZA 1GLVA 2B4TO 3AQIA 3CGGA 3E9ZA 3O03A 4JQOA 4XDHA 3IAS1 5HF9A 2CVHA 3TOZA 3HM9A 3BXZA 1M2HA 3CM0A 1N5LA 5BN3A 1UDXA 4DJ5X 5FBVB 3CVXA 1RQGA 1KI9A 3F97A 3L4EA 1LBHA 1ZJ5A 3QZUA 3IO5A 4JGIA 2QW8A 3AR9A 4N82A 5K3AA 4Q3KA 5CEFA 3LKBA 4BO6A 4FM9A 4C2UA 4E12A 3KOZA 2F3SA 4YX9A 4QM6A 2GCOB 1NRXA 3CF4G 2BHTA 1L5GB 4QQFA 2JARA 5EKXA 3VSCA 4JBWA 4ISCA 4NH0A 4QXMA 4ZEVA 1S2GA 4YREA 3J80A 2OO3A 4Y2SA 4ZKDA 5GJWC 1B6TA 2HA4A 3JYPA 2C2OA 1RWQA 1W46A 4H08A 3CSDA 4RTMA 2OXTA 4MWTA 3FAKA 1JHZA 2EEZA 5C80A 4F5ZA 1RZVA 3K09A 1HORA 4ZEMA 1KYVA 3ND6A 1G17A 2D62A 4LKOA 1PFQA 4I0WB 4DNPA 3BEOA 5K5EA 3FCAA 2VBFA 2OE2A 4LV6A 2VL7A 1WMAA 1XLVA 4ICIA 5T8KC 1ACJA 1H6AA 3BWCA 4BPBA 2NP7A 1ZM7A 4FOTA 5CR9A 2GKSA 5BVHA 1SBHA 3ROTA 5I9IA 1SXJA 1E3QA 1FC0A 3TSWA 4WBNA 1J07A 3RC7A 1HE1C 2JZCA 2B61A 4P35A 2RGBA 3H8SA 2CUTA 2VDUE 2OUKA 4E4TA 1Y6GA 5FHRA 1XQXA 3BHJA 3OM9A 4FINA 4GMXA 1YIAA 4Q4HA 5TQ0B 3F2IA 3AYXB 3WAJA 3LPAA 1ZINA 1E63A 5EWMA 3K70C 1PJBA 2PLAA 1LWOA 1SBZA 2VP4A 1D4OA 4P3NA 3ROPA 4ALMA 2O9JA 1OTXA 2BP7B 4KPGA 3DBIA 4M49A 3CYFA 3KLNA 2ZUFA 1ABBA 2NXEA 1G6KA 2VEDA 3AR4A 3C7DB 1GQOA 3O8QA 3OHSX 3PL1A 1Z15A 4WCVA 3RYHA 1GGJA 4E3ZA 1K2WA 2JNWA 4DIFA 4C1NA 2HXSA 4Z4FA 2CDNA 1KHTA 3SJZA 2O5CA 4DIUA 2XMQA 3DH0A 5DE3A 1M34A 3CLUC 4TZTA 3FYUA 5K0GA 2PLFA 3O6VA 2XMZA 1NRWA 2IYTA 4ENQA 1SWWA 1TM1E 2N75A 1NBMA 1E3WA 2RH9B 2W83A 2FSVA 5GOTA 4AJEA 5A9SB 3KSAC 1AUPA 1T1JA 4GYKA 2AMLA 3CZ9A 3E3AA 4KVFA 4YECA 4EY8A 4CETA 4ZGGA 2XB8A 4G5XA 4YXWD 1QWSA 1EVJA 2Q8QA 2GETA 1CRLA 3AOGA 3C98A 4Z8XA 3U80A 4FDUA 3ETNA 2HU2A 3MERA 4IICA 1NNLA 4OVKA 1V1JA 3QUQA 3BMOA 2P65A 3HYLA 3CVOA 4HTAA 5HIIA 4Z8YA 1KZGB 3IDZA 2CLHB 2DHEA 4UEOA 2FF5A 4G5YA 1SG6A 2HPAA 4RK0A 3FFWA 4XGRA 3NBUA 2XZPA 5HQJA 1NA5A 1PFWA 3R0QA 4FFBB 1BCRA 1Q83A 5EAIA 1IM8A 2GAOA 3ASYA 3HMKA 4AYXA 4BLUA 1XMJA 2ETVA 4K6HA 3HKDA 1U28A 5DBGA 1ANKA 4HV4A 4G07A 2ISQA 4H35A 3M33A 4CR8A 2DUUA 1O0CA 1OH8A 1U2DA 4M8KA 4HDMB 2H1RA 1QP4A 1QP7A 1C41A 1V6CA 1M83A 3NWJA 4FWBA 3WNQA 2HT6A 5C1IA 1KP2A 2ROQA 1XMVA 4LVNA 2QMQA 1XRRA 4FDMA 2QLTA 4RW0A 3JALA 5FF9A 2C04A 1E0SA 3T7AA 1NURA 5BWLA 2QPOA 2LNDA 4FILA 4CDGA 3JV7A 4KJZA 5KYNA 3FGZA 2CFTA 3QMPA 5DVZA 3AY7A 1N4AA 4BJHB 3DD5A 4HAUA 1O57A 1PQPA 3P2IA 3EH1A 4QDJA 2YZ2A 2OCDA 3AJEA 1WXXA 1WW3A 5CDSA 2IA5A 1FJXA 1PZHA 2QG4A 3DMYA 5LBIA 2NUBA 2V0GA 1C30A 1QG6A 1Z22A 1AO3A 1E0DA 1VDMA 4RY9A 2F7SA 2I1WA 4BMNA 5KNBD 2QE7D 3F3KA 1TM2A 4I66A 4Q47A 5ENVA 3H13A 1ZGBA 3QVOA 2IE0A 5EZYA 4CVNA 3K53A 2PSFA 3BCSA 3OG9A 4AZ3B 4QIHA 2WU3A 3TOCA 1W581 2C5AA 1JWLA 4WNAA 3L82B 4XGNA 3SM3A 1MQ9A 1RMYA 2DFPA 1XTRA 3B9PA 4MRMB 5B2EA 4QXPA 3UJNA 5JARA 2C99A 3SVTA 2I3GA 3CUEF 2WTXA 4ZCLA 2EDAA 4MV0A 5FEMA 2QZPA 3OAAD 5EJGA 4LF8B 1JG2A 3RVBA 2FPPB 4J29A 3LPLA 3MPUA 2AXEA 4Q3AA 1ISGA 1MJGM 1UPCA 2FJPA 3AHIA 2DLDA 3C39A 1IMJA 2Y4NA 1CR4A 1U8UA 2GGSA 2F3QA 3H1FA 4MWCA 5ALEA 4G9BA 5K4AA 4FGJA 1L1RA 1OLOA 2VF5X 5CNJA 2ZIXA 4X6UA 3WLKX 3PA6A 5FYQA 5CHEA 4I3GA 4D81A 2JGAA 1ZLYA 4UTNA 2VSNA 1L7AA 3HXKA 3G0GA 4OQPA 4XGKA 3T52A 3HQ4O 4CG3A 4KQHA 3RU7A 4B3CA 3Q11A 4PBTA 4XOUA 2VHCA 4DRZA 3TRHA 3TTXA 2WWGA 2IYRA 1KZ9A 3AEUB 1WUJS 3LDHA 1NKSA 4MZDA 2BEJA 1F0PA 5EEHA 1JZSA 3ZD8A 4QFBA 1FNNA 3H65A 4OB7A 3WQSB 3OCUA 4OI4A 1X7YA 1ENYA 2EZ9A 2Q62A 4Z7QB 4KXWA 3EXIA 3TPFA 5A3SA 4JC8A 2DUMA 1ML4A 3CW9A 1FRQA 1R0BA 3CEJA 1IXSB 4YJ2A 4CEIA 4EKNB 2WTMA 4IV8A 2DHRA 3IDQA 2QT0A 1X8LA 3SAJA 1P9RA 3H17A 4IUDS 3GVXA 1NVGA 1TYDE 3EDRA 3W6UA 5HMMA 3PXCX 1EFRA 4DM3A 1ITZA 3ZXYA 1JKMA 4I46A 4CLEA 3AETB 4DLAA 4IQ8A 2C9OA 1WR8A 5I4IA 2FFBA 4X41A 3P19A 4DBVO 5FWDA 3VDNB 1J7JA 3IOBA 5LMCA 2NV6A 3QK7A 3I61A 2QD2A 2CMHA 4U5QA 4QU9A 2R47A 4TTIA 4E1BA 2O8CB 2OC4A 3BQNB 1C81A 1XG5A 2HJ9A 2X42A 4GBMA 4LOIA 3FWZA 2PO7A 2QM0A 3TFWA 4CDNA 1XRSB 4GPIB 4H7JA 4IJWA 3FCCA 4LC0A 4KLZA 2XUKA 5E8JA 3D6UA 4ZI7F 3GGSA 2H0AA 4QARA 1OXXK 1E1LA 2CFIA 1WCIB 3SYTA 1VPDA 4K0RA 5T3UA 5BQFA 2AZDA 2Y0PA 2H4YA 2NQTA 4JT9A 2Z3WA 4ZV9A 3G8CA 2ZI5A 1FMFA 1P18A 1Z34A 4GZ5A 4AJNA 4CR7A 3T1YB 3BH0A 1WO8A 4JODA 2VBGA 2YCLA 4ZDKA 3Q7IA 3OPMA 4LZOA 4HEA1 3HH8A 4WADA 1O0SA 2EYUA 2FZ4A 1IWBB 1Q92A 2QAGA 2QTLA 3DOJA 5DX8A 4XLZA 5IP5A 2W6PA 5IYZF 2JB9A 3ONWA 5HKLA 3UV3A 3V33A 1E1MA 2FW1A 4F6CA 1T8PA 1MOPA 1V5EA 2ZE5A 1KEPA 1P1FA 1AX9A 2WYWA 1EI9A 2V7GA 1S3FA 4KACA 1E32A 3MTGA 3GLIA 3PR1A 2PA3A 3VR0A 2IELA 4MAMA 3FB1A 1MH9A 2Z43A 1CUVA 3EVEA 3I0ZA 1Z26A 4UQPA 4C88A 4N18A 2I3AA 2W2QA 2CEAA 3MZ0A 2J7KA 3SR4A 3I37X 3EG5A 3OO1A 5AD1A 2G77B 1AZSC 5LZ5A 5HQTA 3DZDA 3EXAA 4LHWA 1LLDA 1YBHA 3GMDA 3VSEA 4YO8A 4DDUA 1P7YA 2WR8A 2RHHA 3VXKA 4N3BA 3HWX1 1CVRA 3QYAA 1K5PA 3CKKA 3D2LA 2IGTA 4ID9A 1KH1A 3R7WB 3S2FA 4BX3A 3U4QA 4JJ4A 1XQWA 3NJ8A 1ODTC 1OAOC 3HZRA 4WAUA 3RFCA 3ZE0B 1PV4A 2GZAA 1KPGA 4LE1A 2IZ1A 5AUQA 3QW4B 1G2OA 2XHZA 2VP5A 4NS4A 4Q3OA 1A7AA 2HA0A 3COWA 3Q6IA 2AA3A 3V80A 1NE7A 1TQHA 3ZW9A 1GHTA 4NVRA 2Y1XA 3I9MA 1ZGAA 1S3IA 2CCGA 4NBWA 1JGTA 4TWBA 2G0NA 2ZB2A 4LXXA 3ZVNA 1QB8A 1DRVA 1E79D 1OYYA 2BC9A 1IZ8A 1EK5A 2A5LA 3M34A 4Y2PA 4D0LB 3S8EA 1DP4A 3UANA 2W71A 4NK5A 3UJAA 1KMHB 4RULA 1AKTA 1QHFA 1TRKA 1J2JA 2Z6QA 1IM5A 2EKZA 1QRDA 3I52A 2GEDA 3VVLA 1RD4A 5CEJA 3I8OA 1GWNA 5ETJA 3TFOA 5CB4A 1U80A 1A9YA 2Q9UA 1DAEA 1ZD2P 1LX7A 4WNCA 2HNBA 2Z1NA 2QMEA 3IIIA 5DNDA 4DRYA 4ZAGA 2I87A 3FRHA 3KQNA 4R8LA 3BBLA 7GPBA 1XKXA 3MMPA 3KQLA 3IQXA 4JIGA 4QPZA 1ZOOA 1US8A 5AM3A 7REQB 3I09A 2SKCA 3M6FA 2B92A 3UMGA 4BCBA 5EYPA 3K20A 1G21E 3CKMA 2BHRA 1L5HA 3RF7A 1DC4A 2F8SA 2CYBA 4FBLA 2J3DA 3IELA 2PSEA 1MT0A 1W4RA 1Z35A 4L8WB 2JBAA 4F93B 1EE9A 1FX0B 2ZZNA 4DCTA 3KOOA 2YASA 4Q9HA 5DGHA 4LG1A 5JAQA 4YXWA 2J5KA 1ORHA 1ST2A 4EYOA 3PRHA 2GMWA 1K68A 4QQ8A 4NE2A 1BO6A 4XPZA 1RLUA 5H5JA 3WLNA 1IY8A 2XWQA 1ZM2A 4FQ5A 2QUIA 1F06A 2P1RA 5HFNA 1W88A 1Z6TA 3F9IA 1W1UA 3PQCA 5GIPE 4G4IA 2XBMA 5FLKA 3U48A 2H1SA 2GYYA 4TN5A 2NZ8A 4JP3A 1K86A 3QKSA 3QF7A 4K9PA 5DLEA 1GKLA 4AS1A 2LKDA 3HL4A 1XQVA 3A25A 3PL5A 1DQPA 1UKCA 5ALFA 3NBMA 3RFVA 2VT7A 1U3GA 2CLCX 1GA6A 2ZVJA 2W6ZA 3WE7A 2R1ZA 2V1XA 2BTQA 4I55B 3S44A 3VTFA 4JX9A 1Q0QA 3H2JA 3MQ4A 1IH8A 2A7QA 1A9QA 5SYAA 3EJWA 2CLFB 3DOFA 1USKA 2DT8A 3FD8A 4RK4A 3N6RA 1AGPA 4KQIA 4LHSA 3F3YA 1EFLA 3G7NA 5IF3A 2RGXA 4KAXA 3IR6A 3RUAA 3H2YA 5P8WA 4ARBA 1EXMA 1ZISA 4JUIA 2C5LA 4IIJB 4F5EA 5LWHA 1M72A 1PJSA 2HK8A 4X8HA 1JAXA 3V8VA 4XGIA 2Z56A 4D3XA 2D7CA 4GSLA 2XUPA 3IP9A 1II9A 4WA7A 1TNDA 3CSUA 4D1YA 3L7IA 4I8IA 4JUFA 3NBYC 3G79A 1J56A 3NT4A 4YEDA 3UA4A 1XTJA 5HVNA 1L5MA 1WPXA 5KNBA 1ZM4A 2PT6A 1M54A 2QKYA 2V3VA 2I2CA 3O4VA 3SC2B 1DQRA 1M6VA 1WUTA 4D45A 4ZO9A 2KWIA 5DM70