4E46A

Structure of rhodococcus rhodochrous haloalkane dehalogenase dhaa in complex with 2-propanol
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
293
structure length
292
Chain Sequence
IGTGFPFDPHYVEVLGERMHYVDVGPDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEWPEFARETFQAFRTADVGRELIIDQNAFIEGALPKCVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPALHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloalkane dehalogenase
publication title Expansion of access tunnels and active-site cavities influence activity of haloalkane dehalogenases in organic cosolvents.
pubmed doi rcsb
source organism Rhodococcus rhodochrous
molecule tags Hydrolase
total genus 105
structure length 292
sequence length 293
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2012-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4e46A00
1ISPA 1CUFA 3RM3A 1VLQA 2H7XA 2ACKA 3WIBA 3WWOA 5DNUA 3O0DA 1W52X 2C4HA 1RYYA 1A8QA 4MQMA 2B61A 1AGYA 4HRXA 5AKXA 4H7DA 5AK3A 1WB5A 1SCIA 1BCSA 1QIIA 3BF8A 1R50A 1EVQA 1XLVA 3AIKA 3PF9A 1M33A 5IH7A 1NU8A 4G1FA 4WDRA 4I3FA 3WK9A 1EXWA 4NMWA 4LIPD 1NU6A 1XZIA 4H35A 3BDVA 2Z3ZA 2PL5A 3I2GA 3VJLA 5T4HA 4U2EA 4EY5A 4M0MA 5DWDA 4AN1A 5E2IA 2WHQA 2G63A 4H77A 1W75A 3M3DA 5SYNA 3G9ZA 1ETHA 3FAKA 3I28A 1AKNA 5D6OA 3ESAA 2WUDA 5EI5A 4BCDA 4Y2PA 4FWBA 1XRRA 4QNNA 1K4YA 3VJMA 5KREA 3WIOA 3OM8A 4MWTA 1LNSA 4ITVA 3EQ7A 2UZ0A 5D7BA 2C0QA 4AXBA 3D59A 1WHTA 5EHXA 4LKOA 2PBLA 1THTA 2C0PA 1RWQA 5KBYA 1AURA 1TAHA 3O4IA 1FSSA 5ALWA 1CUXA 1VJ5A 2VSQA 1WHSA 2ZJFA 3R3XA 1GPLA 3AZOA 1WOMA 2JGKA 3VVLA 2ROQA 3FCYA 4BVKA 4XVCA 4KRYA 1MAHA 1CUYA 2XQFA 1YA8A 4KACA 4PF1A 4PSCA 1ZD2P 2AJCA 3E3AA 5HQ3A 4G8CA 4XX1A 4ZWNA 1FFAA 4PSUA 2HL6A 2LIPA 1LLFA 3EQ9A 2OAGA 1XZDA 1UK7A 1QONA 3IDAA 1XRMA 3FLEA 5AOAA 4EY4A 2QS9A 5HF6A 3WKCA 3U1TA 4B0OA 3MUOA 2WG1A 2VJBA 3BWXA 4LHEA 2G4LA 4HZGA 3H17A 4B83A 1MNQA 3ZLTA 1VE7A 3SX4A 2CKMA 2ONCA 3STYA 1XRPA 2CBGA 3NOXA 5ALNA 2JF0A 3V1KA 3UMJA 4J0CA 1EK2A 1ZOIA 3VKFA 4BE9A 3C70A 3WK7A 4B6GA 5ALVA 1LPSA 1H23A 1ODCA 4Q05A 4LXIA 2B4KA 4QWMA 5E4YA 2QXTA 2WFLB 2H9YA 2Z8XA 5CW2A 1QIHA 3WWEA 3KXPA 5CT6A 5C8VA 1XZBA 2PM8A 3VISA 2XDWA 5HK8A 1A8UA 5JALA 2OCLA 5AHXA 3R3ZA 2GZRA 2Z3WA 3EIOA 3SK0A 3O9MA 5AICA 3IULA 1SFRA 1CUJA 4FLFA 2JGEA 4MWSA 4U2FA 5JADA 1BEEA 2VAVA 4HTAA 4KAFA 5CH3A 2W6CX 5JZBA 4Y2YA 2WJ3A 1SOMA 5CH5A 5H3HA 4FNGA 1LPOA 1N1MA 4WFIA 4UHDA 2PKYX 3AILA 3WI7A 1DWQA 2RHTA 1Y7HA 3O95A 3TGLA 2HHAA 3I2FA 4W1SA 1XZMA 3GUUA 5HKAA 1E66A 3G8YA 1WPRA 2HA7A 2HFJA 3HSSA 1Y7IA 3AFIA 4L3WA 2RONA 1BCRA 3BDIA 3S8YA 2HADA 4DLNA 5AI9A 4P08A 4EY6A 5ALPA 4K2AA 5C8XA 1THGA 4OUKX 3NGMA 2XI4A 4C4XA 1P0IA 2BGNA 4N8SA 1CRLA 3ICWA 3WZMA 3DJYA 1H22A 5AI6A 4E15A 2Y2UA 5DYYA 1O6FA 1QO9A 3OPMA 1DT5A 3C87A 1CPYA 4B0PA 1E5TA 1R1DA 3HEAA 2WHRA 1VKHA 3BF7A 3I6MA 1ZD5A 4UUQA 4EZIA 1F6WA 4CG1A 5EHQA 4UHHA 4MYDA 4TVKA 2AXEA 1F0PA 1AX9A 1W76A 2HRRA 4ARAA 4W1RA 1QFSA 4HS9A 1JT2A 1DX4A 1EX9A 5ALQA 1LZKA 4FHZA 3DL7A 3ZLUA 2OGSA 3E1GA 5AI5A 4OPMA 3H19A 1XZJA 3DL4A 4MQLA 4UBNA 2G5TA 4LYDA 3C6ZA 2HRQA 5CTAA 1HKHA 1EB8A 1U65A 3AINA 1CUBA 4HAIA 2XQGA 3DKRA 4OYYA 2OG1A 1AMNA 2GYVA 2WU4A 3R0VA 2XUJA 3JWEA 3ED1A 1RP1A 2YXPX 3L1IA 2OPHA 4AO6A 4IH4A 4H7HA 2V9ZA 4DMKA 4GEGA 3IURA 5JARA 2QJRA 3I2HA 1YB7A 1DTEA 4KAJA 1F0NA 4RE5A 2JGLA 3PE6A 5CRIA 1JFRA 1CIJA 1ZGCA 3QMMA 3A2NA 2E3JA 4KE7A 5FKJA 5ALMA 2BKLA 3CCCA 5DTIA 1E3QA 5FV4A 2HA3A 2WU3A 2J3DA 3KWJA 3HYSA 1R3DA 4PNZA 4FOLA 4C4ZA 5EIHA 5F4ZA 5A6VA 3A6ZA 1EA5A 5SYMA 4GLBA 2FX5A 1DQZA 4J0IA 1YCDA 4IH9A 4N8EA 3BIXA 5JASA 1CR6A 2K2QB 4I4CA 1OILA 1Z68A 3WK4A 2WIGA 4AO8A 4QWWA 5EHZA 5CT5A 4RNCA 1L7AA 4X71A 3O4GA 5AI0A 1XZLA 2OQIA 5AKZA 4ZI5A 3DD5A 1IMJA 1YAJA 5AK4A 2QVBA 5E4TA 2I03A 3AIOA 3WMRA 3BXPA 1BN7A 4UHCA 1J2EA 4C6HA 5EIEA 4CIAA 5JD5A 1U8EA 2BGRA 2HM7A 1AUOA 3GA7A 3NUZA 4S0XA 4Y2QA 3Q0TA 5HZGA 1QIFA 2DHDA 4CG2A 3BIWA 4X6YA 4F0JA 4FNMA 4FLMA 5AI8A 4QEKA 2GBIA 1JMKC 1XQYA 1CUWA 2V96A 3H18A 4Y9SA 3WWPA 1FFDA 4A5SA 3WKEA 2Z8ZA 4LYEA 3WJ2A 3WKAA 2WILA 3HC7A 3VXKA 3C6BA 1DX6A 2GYUA 4CCYA 4BE4A 4QDOA 1H2ZA 2X8BA 3VVMA 4HXEB 4FLEA 4QA9A 2C7BA 3WYDA 5EIAA 4UBKA 5HF5A 3DLTA 4OB6A 3WQHA 5ALRA 3WL6A 4AO7A 4G4GA 1K63A 1SCQA 1BROA 2XUKA 1YR2A 1WCYA 3B5EA 1HLGA 2PSFA 5AK5A 3DOIA 1TQHA 4A16A 3IUQA 2FUKA 2OAEA 3Q8WA 4DNOA 1N5RA 1ACJA 4Q34A 2D0DA 3SC2A 4K6KA 2DHEA 3A70A 4ZRDA 2IX9A 1QE3A 3STUA 4BTLA 1AQLA 5CURA 4GW3A 4DIUA 4WCVA 4M0FA 4MJ3A 5T4EA 1E89A 4TGLA 4U2CA 2JGIA 2PSHA 5JAHA 2J3QA 4CIBA 1L7RA 1GQSA 1HL7A 5AM1A 4UFNA 1XZAA 4OU4A 3B3QA 2ZYIA 3IUJA 5AM4A 2O7VA 3D5EA 3VJKA 1XROA 1T2NA 4FMPA 2VJDA 1QTIA 4KAAA 4QDUA 4Q82A 3DCNA 3OG9A 4EB0A 1DWOA 3ZV7A 2HU7A 2XMZA 2EDCA 3V48A 1J06A 1UK8A 2D5LA 4W1QA 4EUSA 5LZ2A 5JD6A 1MU0A 1IUNA 1CUUA 4IO0A 1ZI8A 1BEZA 1I6WA 5LLSA 1CUSA 3W2TA 4DSZA 1UFOA 4DGQA 3MUNA 1A8SA 2PU7A 2RAUA 3BJMA 1P0MA 2WJ6A 5CH8A 2WG0A 3PDCA 4DYHA 2J4CA 1BRTA 2DQZA 2QXUA 5ALSA 1X2BA 2HIHA 1ODSA 3WKDA 4Q3OA 4ETWA 4NS4A 1YSCA 3MGAA 2WUFA 2XMBA 3PFBA 2C58A 3DYVA 3WL7A 2QZPA 4UBJA 2IITA 1UKBA 1XFDA 4ZV9A 1ZJ5A 4BATA 2WLSA 1W4LA 5K3EA 1SC9A 4AX4A 3ILSA 3WYNA 1MN6A 2XUIA 1AZWA 3G0GA 5DLPA 7YASA 2XT0A 1LGYA 1OXMA 1D07A 1F8UA 1VZ3A 2XB6A 5HKBA 5FXMA 1XQVA 2ZYRA 2GBGA 5FUMA 3PFCA 3BL8A 2CB9A 5AOBA 5FLKA 2OCGA 1CUZA 1KEZA 5JAUA 2PSDA 4C88A 1E8DA 1G42A 3A2MA 3QBJA 1EINA 1HDEA 2WFLA 5CXXA 5DYWA 1J1IA 3V1MA 2ES4A 3DEAA 3HJUA 3FYUB 1ZI6A 4GWLA 5JANA 2XMSA 1JJIA 4J03A 1CUDA 4BZWA 5YASA 4DTCA 4QDXA 1MX1A 2HFKA 1WB4A 5CT4A 1ZJ4A 3W04A 3E4DA 2GZSA 2XLCA 1R9NA 4XIIA 4X91A 5BV7A 3I2KA 5A2GA 4BVLA 2JGMA 2VA9A 2WTMA 3N2ZB 4B84A 2VT6A 1XZGA 1VOTA 1H2XA 3TEJA 4FBLA 5BOVA 1TRHA 1UOOA 3G02A 1LBSA 5LZ4A 2EDAA 5DNWA 3WKBA 1IZ7A 5CT8A 4AZ0A 4LXHA 5ALHA 4DMFA 1IVYA 5T4FA 1UT6A 3A2LA 3WWCA 3O4JA 2BUBA 1YB6A 3QYJA 4WDQA 2OXEA 5A7HA 4O08A 3K6KA 2PU5A 4D9JA 4GBGA 4KEAA 4XWGA 2QUBA 4MEAA 2WTNA 5LYYA 3HXKA 3E0XA 4G9GA 3WA7A 3H1BA 1ZICA 4OCZA 4PQEA 1XZHA 2H7CA 4EBBA 3F97A 3W06A 4BAUA 2HA0A 4U2BA 4BVJA 3KWFA 1MT3A 4X90A 1XQWA 3PICA 4H7FA 1WB6A 5A62A 1QZ3A 1CUHA 3G9UA 3S2ZA 5EFZA 1S8OA 4JEIA 4X97A 1JKMA 3WK8A 3IVMA 1X70A 4PO3X 3I6ZA 2P8SA 1QIEA 1IZ8A 5DTJA 3C6YA 1OCEA 1LPAB 2X76A 3GELA 2QUAA 5A7GA 5I8PA 1XZFA 5I9IA 2JGFA 5AM2A 5HFAA 1GPNA 4MXDA 3H2KA 1L7QA 1GKKA 4E11A 3FCXA 4BBZA 5BWCA 3D4LA 2V98A 1WM1A 1JJBA 5LKAA 3LIPA 3FBWA 3GFFA 3UUFA 2VF2A 1A7UA 5IVDA 5ALOA 2H1IA 2Q0XA 2W22A 5BWBA 3QMVA 1W1IA 3R40A 1MNAA 1P0PA 2WFMA 1TKRA 3C43A 2X5XA 4ZGBA 5AP9A 1VA4A 2JGJA 3R3YA 4FFVA 2WJ4A 3WJ1A 5ALZA 1IUPA 4WJLA 5HFNA 5K3BA 2OCKA 5C81A 4X00A 3H1AA 4JNCA 1HBJA 1KU6A 2CMFA 4V2IA 5AKJA 4AMYA 3PF8A 1Q0RA 4X93A 1CEXA 4DMHA 3STXA 5CMLA 2EEPA 4X94A 4F21A 5JAOA 4AMZA 1TCBA 3HABA 5K3DA 4QDTA 2QT9A 4AN0A 2JIDA 4UPDA 4AQDA 1ZIXA 4E14A 3BE8A 4B9EA 3TJMA 1E8MA 1Q84A 3ESDA 3HLKA 4K6HA 3D2AA 2XUPA 2I3ZA 5AIBA 4N5HX 1FFBA 2DR0A 3OTQA 1UZAA 4INZA 5K3AA 2CUTA 4UFPA 1YAHA 4CFSA 2ECFA 3FWHA 5HK9A 2PSJA 1Q83A 3F96A 4FDMA 4Y2SA 1ORWA 3QH4A 4DNPA 3R41A 2HU5A 3UUEA 2R8BA 4X85A 4H7EA 1K8QA 1K6EA 5I7UA 4DNQA 3IB3A 1J07A 5JATA 2HA6A 2VJAA 1EK1A 3G0DA 3LS2A 1YS1X 3PUIA 5AK6A 1LPNA 2XLBA 4GI1A 3ESBA 3QITA 2O2GA 3F98A 3H2JA 5D3ZA 2WHPB 5C8ZA 2ZSIA 2B9VA 4N8DA 2XMQA 4Y2RA 5LZ7A 1DU4A 4EY7A 3WL8A 3AJAA 3CN7A 1MX9A 5ALGA 3QVMA 1CQWA 1B6GA 2I78A 3AUKA 3QMWA 4IQ4A 3JYHA 3LLCA 4A23A 2XE4A 3MVEA 3AIMA 3FSGD 4FTWA 4U2DA 2Y6UA 5ISMA 4GDMA 4UBIA 5T4BA 2ORYA 2PUJA 5FPQA 3STVA 3H2IA 1VA5A 3ZPXA 3R3WA 4JYMA 3K2IA 2HDWA 2VT7A 2GYWA 4P92A 5AIAA 1TK3A 1ZGBA 3KOOA 5JIBA 2RIPA 2XUQA 2QJWA 2RI6A 4G4JA 3ANSA 3X3HA 3IIIA 3DQZA 4UBLA 3EF3A 3O9VA 3RLIA 3I2IA 4H7KA 4C01A 4PW0A 1BE0A 3HZOA 4RPCA 4C4YA 5HF9A 4EY8A 5FDFA 1BU8A 1UOPA 3DKKA 2C5GA 5ESRA 1R4ZA 4FKBA 4K5QA 5K3FB 4W63A 3U0VA 5ALYA 3W9BA 2JEYA 1EDBA 4TPKA 5JAPA 3FLAA 3AZQA 2H7YA 3WK6A 2O2IA 5KWJA 1IUOA 4Y2XA 3KDAA 4J0HA 3LCRA 3CXUA 1XLWA 3ANTA 3WA6A 5CXUA 5AKLA 2ZJ6A 2JBWA 2XMCA 3BJRA 1GT6A 2ACEA 2BUAA 4BCCA 3H04A 5K3CA 4G8BA 3ZLVA 3K9BA 5FP0A 4AZ3A 5LZ5A 4UBOA 2QM0A 3O4HA 5A71A 2QRUA 4KE9A 4OD0A 1X2EA 4BP8A 4BYMA 5E4JA 3FVTA 4WY5A 4ROTA 4H7IA 1TIBA 3RK4A 4BB0A 4H7JA 5EGNA 3DS8A 3QPDA 4EA6A 3C8HA 2XQKA 4X92A 5AI4A 1UXOA 1ODTC 1Y37A 5FOQA 1C7JA 1R88A 4XJVA 1QOZA 1BN6A 1XZKA 4RGYA 1AC5A 5DJ5A 1NX9A 4BAZA 4PSDA 5AM3A 3FYUA 3IUMA 1EHYA 5FPPA 1CUVA 4YASA 3STTA 3DDUA 1SCKA 4P93A 1ZD4A 4BRSA 1PV1A 5LP1A 1C7IA 4X3CA 3B12A 3SWWA 2ZSHA 3ZI7A 3JW8A 2XMRA 4FBMA 5D3KA 3R3UA 3YASA 5HCUA 2WG2A 1QJ4A 4C87A 4OYLA 1XRLA 5ALLA 1CUAA 2R11A 1WPXA 4UHFA 2I3DA 3F8SA 4Q3LA 3H0CA 3C6XA 4X7BA 2J4FA 4Y2JA 4DNFA 4F60A 4BCBA 1DWPA 3DYIA 1P0QA 3FYUC 1TCCA 2WSLA 2ZYHA 1VZ2A 4RE6A 2BCEA 2GBCA 2ZVDA 1Q0ZA 1FFEA 2B20A 5CBKA 1DT3A 5IVKA 1XLUA 1QIGA 3FOBA 5AJHA 2QTBA 5ALEA 2WFZA 4W9RA 4L0CA 2BUCA 1G5FA 4J0KA 3WWDA 4FFWA 5LZ8A 1W6RA 2O7RA 1XZCA 4HVTA 4QDZA 4X6XA 3GZJA 5FRDA 2Z5GA 2XUAA 1UK9A 4CG3A 3RARA 2WUGA 4BRZA 2DQYA 2DSNA 4JYPA 5AM0A 1QO7A 2XQJA 2Y6VA 1UOQA 3WL5A 1GXSA 2OLEA 1XKLA 4K6GA 1GQRA 3I2JA 2PSEA 4YPVA 3F67A 1FFCA 4ZXFA 4QLAA 5AKIA 4J7AA 3G7NA 1XQXA 1CLEA 1DQYA 1R9MA 1VXRA 3FLBA 5ALXA 1QLWA 3IA2A 3D7RA 5DNVA 4KE8A 1XRNA 4JH0A 5J3JA 1PJAA 5AKEA 5AKKA 5ALIA 4OSEA 1EVEA 1A88A 1CUEA 2XMGA 3NWOA 3OURA 1ZD3A 5HQ3B 2VAXA 2QMQA 1XZEA 2HU8A 5AO9A 1HQDA 1QIDA 3LIIA 4Z49A 5JYCA 2OQVA 1LBTA 3QPCA 4Q1VA 4MEBA 1QIMA 1EI9A 2YASA 5ALDA 3QPAA 4CI9A 2XQIA 4B82A 5IVIA 1XRQA 5ALFA 1MJ5A 3IBTA 2XUHA 3ESCA 4G5XA 5JZSA 3C8DA 4N5IX 1BS9A 4NVRA 3C5VA 4G9EA 4DSAA 1QGED 4Y2UA 1U2EA 3M83A 2Y2VA 3D3NA 1EDDA 2CZQA 2PPLA 3DOHA 3KD2A 1T4MA 4B9AA 1GGVA 2OGTA 3HI4A 4GHWA 4H0CA 4Y2VA 2PX6A 1MPXA 5LZ9A 4HXGA 1EDEA 4L72A 1MAAA 1ZIYA 4ZV7A 4GECA 1U4NA 3FSGA 3T52A 1UKCA 4IH1A 3C45A 3AZPA 2CJPA 4UHBA 4E46A 2DCMA 2WUEA 3H2HA 2WQZA 2AJDA 5AKGA 3I1YA 1GPKA 2G5PA 2WKWA 2XUGA 2O2HA 4B81A 3G0CA 4DMCA 3FYTA 4WY8A 4F5ZA 4OU5A 2ZJ7A 4CCWA 3EQ8A 3N0TA 1B41A 1QIJA 4KRXA 1GZ7A 5EHNA 2IIVA 1UKAA 4M0EA 2RHWA 4B80A 6YASA 4X95A 3G9TA 5JZ9A 1PFQA 4WFJA 5A7FA 3M81A 1QIKA 2WM2A 3V1LA 3OOSA 4KYVA 3M82A 3V1NA 4BC0A 2YH2A 2VATA 1QTRA 2AJLI 2JEZA 5CT9A 4G8DA 5LIPA 3EBLA 4EHBA 4QLOA 2NW6A 3CCBA 2AJ8A 1DINA 1LPBB 3DNMA 4B85A 1EB9A 4DM7A 2VEOA 1GKLA 3QM1A 3WZLA 1ORVA 2OCIA 1E8NA 4YK7A 1CQZA 2WHPA 3P2MA 3WK5A 2PUHA 3FNBA 3QZUA 3CN9A 2DHCA 4C89A 2HA5A 5AM5A 1CUIA 1VE6A 1C4XA 4HRYA 4OB7A 3ICVA 2XMDA 2VQ6A 2OGZA 3VDXA 3WLAA 2V97A 4QZVA 2QOEA 3KSRA 4J3JA 1UK6A 4G4IA 5AOCA 3D2BA 2QKYA 4UBMA 2GBFA 5HF8A 1XKTA 4HXFB 2HA4A 5AKHA 2C5FA 4Q3KA 3G0BA 3D0KA 2WIJA 4J0JA 1VXOA 1EH5A 2DFPA 1YASA 1FJ2A 3I6YA 3TRDA 4MYSA 4I19A 3HACA 2FJ0A 4GXNA 4KJXA 1JU4A 1O6GA 1LPMA 2VTVA 1JU3A 2YYSA 2WIFA 1H2YA 1KU0A 1LZLA 4Y2TA 4J0GA 1USWA 3W05A 1TCAA 5ALKA 3C5WP 4Y7DA 2WIKA 1QFMA 3OC0A 5AH0A 2BFNA 3GROA 4AB1A 3PUHA 5K5EA 1MO2A 5ALJA 1CV2A 4H18A 2AJBA 1YA4A 2BAGA 5ALUA 4X6UA 1CUCA 3LP5A 4QE3A 3L1JA 4KE6A 1CUGA 5K3FA 1YS2X 4NZZA 4BAGA 2Y1KA 2VJCA 3F9CA 2XUDA 3V9AA 2QR5A 4OB8A 1CFJA 2BJHA 4UFOA 3RKSA 5IKXA 2PVSA 2WIDA 5IVHA 2XUOA 3ZWQA 1ACLA 3STWA 3FVRA 1JI3A 2RGUA 3H2GA 4P9NA 3R3VA 4UHEA 1K5PA 4WFKA 4YX9A 3PI6A 4BDTA 3G0IA 4PV7A 4BP9A 1MX5A 2XUFA 4JUIA 3GBSA 3IUNA 3W9UA 4L9AA 5JD4A 3I1IA 5DYTA 2FJPA 4BZZA 1G66A 1UWCA 5AKYA 4IHAA 3HRHA 1H2WA 4U2GA 4LXGA 4J0DA 3T4UA 4BTVA 4B7ZA 4BDSA 3G9XA 1JMYA 4ZREA 2HA2A 5ALTA 1N5MA 4W1PA 4CCYB 1N8SA 1G4HA 3D2CA 1HPLA 2ZYSA 5C7YA 5KWIA 1MTZA 4KR0A 1ZI9A 2CEKA 1JJFA 1CVLA 3L1HA 4ARBA 4BC1A 5LKRA 1LPPA
chains in the Genus database with same CATH superfamily
1ISPA 2HY7A 4PYIA 1BQ4A 3BWEA 4X1KA 3IDQA 4Z3DA 3HB7A 2X19A 1GTL1 3EZ9A 1GZVA 1H8ED 1XCBA 2I66A 1JMVA 3E05A 1W52X 3E5MA 1RYBA 2C4HA 3E7XA 4GMDA 4PG4A 3UJPA 2IA5A 1EU1A 1A8QA 3OX2A 2JFFA 4MI3A 2IDJA 2Y76A 2UYGA 4MYUA 1AGYA 5IM4A 2CVOA 2H1FA 1X3SA 4ID3A 2H59A 3VYSB 4O0LA 4P4TA 4TVOA 2C77A 4H7DA 2G36A 3SC2B 1N5IA 2C2HA 3IQZA 4O8ZA 1NUAA 1BIFA 1QIIA 5AHWA 3BF8A 2CMGA 3SHWA 4TYPA 2EJBA 5EL0A 5MN5A 2IXDA 3FVVA 4AIRA 3EZ7A 4CDNA 3NHKA 3VYRB 5JI3E 5DSTA 1NV8A 5JCZA 2R48A 2YJTD 4IDBA 4HAXA 4KXYA 5F7ZA 2PH1A 4P5EA 3AIKA 5JNTA 3PF9A 1O97C 1MAUA 2HHHB 2IL1A 5F78A 4XE5A 5EVJA 4JASB 4G1FA 1M72A 2XRZA 1FU7A 4G0YA 1K08A 2HF2A 1PZMA 4I3FA 4MPRA 4QHTA 1KOJA 4MVJI 4DC0A 5H4GA 5KMGB 2UUBB 1DDGA 1PR3A 1UBOS 3LNCA 1Z0IA 3LX8A 5JWHA 1ZR2A 5HMLA 4AS2A 4DL9A 2FQQA 3G1TA 1Y1SA 4PZ0A 1GAXA 3I45A 3RC1A 3UJ9A 3NI2A 3DSRA 1KL7A 1ND5A 1Z4MA 1U0TA 2BFEB 3S6JA 1ECCA 2XGOA 2YUIA 4AN1A 4P98A 1CY4A 1PBNA 3K6SA 5KQLA 1KS9A 1QMGA 1Z5WA 3JVDA 3BERA 3DL2A 4I50F 3ROPA 4KVGA 3CR3C 4BLQA 2G63A 2KS6A 1T9BA 3TS1A 4J1NA 4M1ZA 2PA3A 3RTBA 1U5AA 1JZTA 1W4RA 1KKLA 1JAHA 1UINA 1W75A 2ZSKA 3CONA 3KIPA 4NBVA 4N47A 5K99A 1EGMB 3FDXA 5SYNA 3G9ZA 1O1YA 1QBGA 1X38A 2J5QA 3AIIA 4MVJD 4LF5B 2PK3A 4DDTA 5KNDD 4KPYA 2BTEA 1G6HA 1GNTA 4XEUA 3G5AA 3WTCA 2XSZA 3SSNA 4IXNA 4ZVKA 4WBSA 4TMWA 1Z06A 2AS0A 1N1EA 1CZOA 2LW7A 3CZQA 3Q10A 4LOHA 3TW6A 2YL2A 3A3YA 1AD2A 4OBEA 3HXQA 2HWKA 5FWXB 2JIRA 3F2IA 1SM4A 3L7KA 1XRRA 2W0MA 4FWBA 4MP6A 3SQNA 3EC2A 3MLEA 5KKAA 4BLRA 1FFYA 3NATA 4EHIA 4P4LA 2XWSA 3D2LA 1LNSA 4HDCA 2RHHA 5HRAA 4AY2A 2DWPA 2QLLA 3ZEIA 5CA0F 1W0JD 2ACVA 3P0IA 3CF2A 3ADKA 3GPCA 3HY4A 1NBEA 3GYBA 2RHBA 4DDUA 2WA2A 4BLTA 3VHXB 3ILYA 1T4CB 3TQOA 4KZPA 3A31A 1FRQA 3FDZA 4LKOA 3EXIB 4B09A 4D4IA 5IJ0B 2XWBF 3KVVA 1WMFA 4W5TA 4JD5A 5JNUA 1L6IA 1QAMA 2DY1A 5EJGA 1RJEA 4BO2A 4K1LA 1RWQA 4Z7NB 2H8KA 3U3OA 4EYSA 4Z51A 5KBYA 3TPZA 2NUBA 2IHUA 1TAHA 2LBPA 4YP9A 1FSSA 1I7SB 2H4WA 1PEYA 4JOQA 2F8TA 2AWOA 4JP2A 1O03A 2FMTA 2R8ZA 2CJXA 1DC4A 2B4TO 2J7PD 2RIRA 3GCXA 2OZLB 2X4DA 4NXNB 5T6BA 3A4IA 1KA9H 3LWDA 1GPLA 4MKIA 1Y4UA 3AZOA 1LX7A 2H11A 3DAGA 2JFXA 1YGYA 4EVQA 1QK3A 1YR9A 5FBLB 1TNDA 1WZCA 4NX2A 4RHYA 1ID8A 3B2QA 5HBRA 1W87A 1GAJA 3O8OB 3L8MA 3CLSC 2FPIA 1NPTO 3ECSA 2X1VA 4Q48A 4NCAA 3I30X 4JLNA 4PF1A 3ICOA 1B76A 4PSCA 3A9TA 2AJCA 5BT8A 2Z3VA 2C7OA 1JQLB 1TOAA 3EUAA 4L9RA 1OTXA 4MB2A 2B3DA 3WLIA 3LUCA 5HQ3A 3WY9A 4XX1A 4LDZA 4TLBA 5IT4A 4EITA 4FZRA 4BEWA 3UTCA 1LSOA 1NYQA 3O4RA 4K28A 4DKXA 3L93A 3GMTA 1IM2A 1I7PA 1LLFA 1ZGAA 2LCFA 4KXQA 4LGCA 2OAGA 3GH1A 4OP2A 1UFKA 5EERA 1YC2A 2FP3A 3KSDO 5EXSA 4MR7B 1R4NA 3VZDA 3U7HB 3IDAA 3T3HA 5KS2A 5I4IA 5LSAA 1JH9A 4ND7A 1GZ4A 1JG6A 1Q7EA 3KTDA 2QS9A 4FEEA 1D4ZA 5KINB 4MYHA 4V2UA 2X77A 3WGKA 1XU7A 3MUOA 2WG1A 4J94A 5IKMA 4LHEA 2QVYX 1C4KA 1GWNA 2P2GA 2O3UA 2OZKA 3IDFA 3HI6A 2ZE6A 3Q2OA 3ZDDA 2GEBA 5JY6A 3BMNB 5DNDA 3OX1A 2ZTMA 1ZR4A 4HLUA 2CKMA 5DU2A 4G0PA 3EWAA 1ARZA 5BR1A 1XMXA 3GGPA 4BX2A 2QR3A 3V1KA 1GR1A 2IXBA 3UMJA 1AGPA 1O97D 3C3AA 4J0CA 2H1CA 3DMPA 1B6TA 3HKBA 5F2KA 3SZ3A 3W7AA 4DA0A 4BE9A 2WTAA 1WVIA 5FBVB 2Z6AA 3Q6IA 3KWMA 4GKJB 4NFHA 2J48A 3OZAA 2C95A 3NMUF 3LDHA 3KQYA 2PCJA 2QL6A 4KBYA 5HJEA 2H8GA 4QPDA 2XTNA 1KI6A 1LPSA 2CZCA 2Z6UA 4LXIA 2GXQA 4G5GA 3TNFA 1W5AA 2B0CA 2DPLA 2EX1A 4B3BA 2QXTA 3N0RA 2H9YA 5EJ8A 4M9XA 5BN4B 2PWZA 3K8OE 3VKUA 3DGFC 4ER3A 5KDOA 2BFBB 1R4MB 3WWEA 1F5SA 4BFVA 4DADA 4WA8A 4ZOLA 3OKPA 2CL6X 4IDEA 1RR6A 5EJFA 4W6ZA 5JMWA 3MUEA 4ZU6X 3G2KA 1HR0B 4BFYA 3FFTA 2MR6A 2VNIA 5JDIA 2BGLA 2X23A 3H5VA 4ITRC 2PGAA 4JVOA 4DKJA 4W9MC 4WVFA 1JH8A 2B1IA 5JALA 5AHXA 4K9MA 3DV9A 3LUJA 4WKNA 4UUNA 2ERYA 1MB0A 1DEXA 1XTUA 2BEVB 3EIOA 3AHHA 3BB3A 3MPUA 4IDQA 3O9MA 4P3KA 1J8VA 3SK0A 4E5PA 4KXXA 1AV6A 3ADCA 1W85A 4AG6A 1SFRA 3D3QA 2EXXA 3I04M 3U4GA 1VE9A 4FLFA 4FT2A 2QW8A 2HPVA 2CK3A 2JGEA 1M2WA 2WP8J 2CVPA 3VZPA 1BEEA 3GAMA 1LLDA 3R23A 5FBHA 1PFKA 2XW6A 3D6VA 4FR2A 1XXHB 4OK6A 4RY9A 4M60A 1MC5A 5BR4A 4N1AA 2ZZNA 1RYEA 1RMTA 1OGYA 2CXUA 4GPEA 4KAFA 5CH3A 3ROEA 4ID9A 2I0FA 2OAP1 4CKWA 3PKIA 3PLRA 4M55A 5JZBA 3W5AA 4Q5IA 4Z2YA 3ZXSA 1Y5LA 5COAA 5BT9A 4DIMA 4WVLA 2FSSA 4ZAVA 4DT1A 2XCTB 4FYJA 1KP9A 3NTQA 4WT7A 3GIDA 1Q15A 2HZBA 4H3SA 2IEAA 2FEXA 2QMEA 3P9YA 4BFZA 4PU0A 1OWOA 1Y7HA 1VE5A 1J25A 2QA5A 5B53A 5B4TA 3N8GA 3NHZA 2K4MA 2ONYA 3C39A 2J5XA 3CKYA 5WRFA 4NHOA 1E2QA 1ZVQA 5HKAA 1SK9A 3UOAB 3GDGA 1ZWLA 5B3AA 5LXTA 1LQTA 2XRYA 3RFTA 4HEQA 2GLTA 4ZA2A 3E1SA 1E9RA 4HRAA 1RWVA 4LSWA 3FYCA 4P4SB 2FCAA 3AFIA 2JIPA 2Y05A 1GKIA 3ORYA 4L3WA 4MV7A 2CBZA 5M3BA 4DR6B 2I4LA 4ZJUA 1BHSA 1DADA 4EKEA 4TROA 3BDIA 4QBKA 3MOIA 1OFTA 4DLNA 4E5DA 3WSWA 2KQUA 4HY3A 3I52A 3CLSD 1RTKA 3LV8A 5JCJA 4RMNA 3FWKA 2JIMA 5AW4A 1E1RA 3HHEA 3UMSA 4YPFA 1E64A 1T1JA 1UM9B 2RG1A 1M0SA 3C3BA 3FYSA 3HDYA 4P08A 1DDIA 3UGKA 1F5NA 2WD7A 4QX6A 1PTJA 3KOUA 4BEBA 1GCOA 2BBOA 4LZNA 1E3MA 4EY6A 7REQA 3ZWXA 2O8DB 3JASA 3VKGA 4XIYA 3VKWA 4ENRA 1NW4A 1PD0A 2VHTA 1NW6A 3E3NA 5LPNA 2BD0A 2RH9B 2G1JA 3HO6A 4K9NA 4IUCS 1DP4A 4Z8YA 2IKQA 1AN9A 4CMJA 1CRLA 4S04A 4QYXA 2FN4A 1VSBA 4V0RA 3VH3A 3DQQA 2V7VA 3MCZA 2RJOA 3DJYA 1VSUA 3BXEA 1A5TA 1MJNA 3RRZA 4WUVA 4XPIA 4E15A 3HFRA 1P44A 2G88A 4QODA 4JJ6A 3T4PA 3NDJA 1DBVO 4QQFA 4WOKA 3MBOA 1T2DA 2H5JA 4RM2A 4NMMA 3TLAA 4PVCA 1NJ8A 1DT5A 4BQSA 5L3QB 2ZULA 1HMYA 4ZVLA 3A04A 1ZCZA 1WO8A 4FS8A 3OLWA 2P75A 1VFNA 5KDLA 4MJ7A 1VKHA 2R65A 3I6MA 4MIYA 2QY9A 2QHXA 5CFRA 4NATA 5LP6C 2CY0A 3I0ZA 4CEJA 4PLVA 5TT0A 1L5WA 3WO1A 2ONJA 3EIFA 4LQLA 2GN2A 1GVNB 4UHHA 4TVKA 1NW3A 3EODA 4EF4A 2AXEA 3M1YA 5SZKB 1F0PA 4QT0A 1NBOA 3PZBA 4JGIA 3VR4A 2A0WA 1GGJA 1GLVA 3MPOA 4U7WA 1Q2UA 4GPIB 1QHSA 1JBQA 1DX4A 1OV4A 2PMDA 6Q21A 1GKUB 3MAJA 1SURA 1OWNA 4CKWB 3DO5A 3LVFO 1GTZA 4MR9B 3UUGA 1W34A 2UDPA 3ZLUA 1EAMA 3LVBA 1JTVA 2EBUA 2H31A 3PKJA 3FTNA 1FDRA 2I2CA 2LZ0A 4QU9A 1ADCA 3DW1X 3HUUA 4WNIA 1UP6A 2GM9A 3ELYA 1GTSA 1W29A 1ONBA 4UBNA 4D8VA 1PAUA 2R6ZA 3IV7A 4LPKA 1SIUA 3EDOA 1VYVA 3JPWA 3SF8B 3LX5A 1JPNA 3BQ9A 3Q72A 4RH1A 4FUQA 5I01A 5CTAA 4QAQA 4BNVA 2VPWA 5DN9A 4GPAA 3NEJA 4NH0A 4HQFA 4HWTA 3G7UA 1GTJ1 4IJVA 5B1SA 3SZOA 5J40A 4HAIA 1YQEA 3DKRA 1M2HA 3HJNA 4OYYA 3ZGYA 3GEDA 3E5RA 1WVMA 2GYVA 5EQTA 1SCDA 2NV2B 2CLSA 4DB2A 1RRCA 3ZNPA 3ED1A 4M88A 2CCJA 1Z3CA 4D9EA 2H5IA 1SWVA 4WNAA 5CNMA 1KTVA 1IHDA 3W8RA 3SQMA 5KVCA 3BWCA 2B35A 2BN4A 4R16A 1O94A 1ULAA 4HDSA 3GK3A 5G0TA 1JLLB 1ICEA 4CM7A 3AR5A 1E4EA 2V58A 4DMKA 4I1RA 5JPCA 4GEGA 4UW9A 5EKSA 4QU5A 1NSYA 5CLGA 3VYVA 3JALA 4WQMA 3TTUA 4K6OA 1X8KA 3MQ4A 1DTEA 3EWNA 3OTOB 2LDBA 2J0VA 4OM7A 1SU8A 2QPAA 5LQKA 1HLPA 1CEEA 2WJWA 5F1KA 1SVNA 3VZQA 1IULA 1ADGA 3C6QA 4RK4A 1GRRA 3MJTA 1C4WA 3VPAA 4PZYA 1Y4SA 5DPMA 3QMMA 3ZDQA 3PPYA 2AMFA 4L4RA 1TVCA 1Z2CA 3INTA 4QT4A 1MOPA 5HTOA 3MCVA 3L04A 1SK8A 5ALMA 4ALIA 4MDFA 2Y1DA 2OBFA 3SQLA 4NYIR 2B5VA 1E3QA 4WCFC 3SX2A 2EW1A 4R1TA 1IJEA 2NNLD 1ZMBA 4XTRA 3QVOA 2KPOA 4FSXA 1IN5A 4OHOA 2WPDA 1IZYA 1L1RA 5E0KB 3FVQA 5K0BA 3HYSA 5IBQA 1H4QA 5BV0A 1YOVB 3ER6A 1FTQA 3PIIA 2N42A 2GAJA 5B6IA 1UJ2A 1I7DA 1B93A 1XZPA 2HSEA 1J2YA 1CY0A 2B1GA 2DPGA 4M76B 4C4ZA 3U5ZB 5F4ZA 4WIAA 3A6ZA 5D85A 5FUWA 2WWXA 1J2UA 3OZUA 3RIEA 4G23A 5SYMA 2FDCA 3TK1A 2AFVA 1F9AA 1L7DA 1T0HB 2ICAA 1L5KA 1LJUA 4DCNA 3E22B 4CIAA 1DQZA 5L3SB 1V2GA 1J6UA 1YCDA 1OXXK 4GAEA 4N8EA 3P9RA 3BIXA 4V0OA 2EBFX 4BFCA 1JFVA 1Y6JA 2K2QB 2VAPA 3JATB 3BUSA 3LLUA 3NGLA 5ITZA 4I4CA 3ZGZA 5DH9A 4AP5A 1OILA 1D2GA 3BE6A 3CNEA 3OCVA 3ZIAA 4BGDA 2ATEA 4AO8A 2C2GA 2C4UA 4XDHA 3DFUA 4I4TA 3VVCA 4YCMA 1YJ8A 4LFAB 4D9GA 5IKPA 1ZUIA 1NR5A 1VB3A 1AXGA 5CYGA 4RTMA 5A4JA 1JJVA 3EIQA 4J1QA 1OOEA 4LYHA 4LRTB 1XZLA 2OQIA 3TE6A 3H5LA 4ZODA 5FI5A 2QP4A 4Z7JA 2NSHA 3GRZA 2DU8A 3KAQA 2VKQA 1P4AA 2A35A 5COBA 5DWQA 3U31A 2VH1A 1C29B 2MDTA 1P4RA 4PRZA 5F9HA 4EG1A 1YCFA 1G2IA 2QJFA 1YB1A 5AK4A 2FW8A 1DIBA 1LK5A 3D4PA 3K8YA 4M1SA 3AIOA 2J6HA 3NIWA 3QV1A 3WMRA 3LPMA 1P1IA 3HL0A 3ZDYB 4R1OA 3BGSA 1W94A 4P2GA 4AROA 4B6PA 4YMGA 3L41A 1QJCA 1A8HA 3BB4A 5DNAA 3X1WA 5EIEA 3N0WA 4URFA 2Q1WA 3CJQA 4ARUA 3QYPA 4I46A 3JSXA 3RVRA 4S0XA 5CG1A 4J90A 3WDSA 2BGWA 3GVIA 5DMXA 4GWKA 3AR4A 5INTA 4CG2A 2BKAA 3RAJA 1M5UA 4FNMA 4FLMA 2J8ZA 5AI8A 2RD2A 3H2YA 3UAWA 3E9DA 3ZN2A 4JEMA 2GBIA 3ZHTA 4BX0A 1G64A 3GLFA 1VDMA 3WP0A 4BMCA 1CZNA 1P72A 4R8SA 1Y5RA 3FAZA 3OJFA 3OESA 2CNOA 1ZD1A 3LBHA 3R6DA 4MUFA 2BHNA 1Q44A 2Z8ZA 4LYEA 4BECA 1B2RA 3PLNA 1K0UA 1TKCA 3TKYA 1EHIA 2X0NA 5G0WA 3RVBA 2WILA 3HC7A 1UQUA 1K6JA 3EISA 3X44A 1Z0DA 3V6LA 4ZI3A 1HNWB 2Q9CA 4EHDA 3IV9A 1I2BA 3QHQA 1DX6A 1FNSA 2GYUA 5E3JA 5AT1A 1N0HA 3TLEA 5BUCA 3SJ7A 2B92A 2F1OA 1NW7A 1IHUA 2AQ8A 1MQ8B 3U49A 4YAEA 3HVJA 5CYPA 3ASYA 4CODB 4PG5A 3ZV6A 5CFMA 1Z16A 2X1MA 1XD2A 3F4LA 3IQIX 4QA9A 2C7BA 3OTWA 5L40A 1MC1A 4LRQA 3VC1A 3STHA 1IUKA 5EIAA 5CX1B 5EYPA 1BGXT 1Z73A 1ESZA 2PN1A 2X41A 4KMRA 3RTDA 3ANYB 1IM5A 3N07A 3QE2A 3QVGA 4YT4A 4A91A 1MEJA 3C98A 3H4TA 4ND4A 3WL6A 4B3TB 3NB0A 1OXTA 4EGCB 2C78A 3IJ5A 1COWA 3IPLA 1BROA 4J7XA 5ULLA 1H9CA 1Z56C 5D1NA 2XUKA 1EESA 1FVXA 1GRNA 3QEOA 2IYFA 3B5EA 3ACDA 1QRUA 2B25A 4FVTA 2FQ1A 1WMAA 2PUEA 5AK5A 2I8CA 2XNHA 4MO9A 4G4SO 3NM5A 1VC2A 4CN8A 1TQHA 3T9FA 3BSFA 3K96A 1G7CA 1K3TA 1XOIA 3HNOA 5CFZA 3PX3A 2OAEA 4DNOA 1UQTA 1MXFA 4XUGB 3W8EA 1XEXB 1KDRA 1TCUA 3AF2A 4NLLA 3SC2A 3DOOA 4Y9UA 3KXIA 4QXQA 4B3FX 1L7XA 3A70A 1YKGA 2QI9F 3LG2A 5AVYA 2J41A 4ZRDA 2IX9A 2ZAOA 4QECA 1Y8RA 4LYFA 3K0HA 5F73A 3STUA 3VKVA 4UMEA 4EJSC 5A3SA 2PJRA 4MHTA 1B43A 2ZS9A 3BFJA 4QQNA 1CZKA 1U9IC 4M86A 3COWA 3RU3A 4GW3A 5B4UA 4K9KA 1JSRA 2HDOA 3H42B 4WCVA 1NSTA 5JEDA 4TKUA 2EF1A 4GOLD 2ZRCA 2CUKA 1X8XA 4RD0A 5T4EA 3L0YA 4EFLA 3LT5A 1QYCA 2PZLA 3CVYA 1D03A 3LPDA 4CKCB 3JQ8B 1O8CA 2XOKA 2VDMB 3T7CA 5AM1A 5GZ3A 3M3HA 3RAGA 5LNK6 1Z35A 3RG2A 1E2GA 2AIRA 1QK5A 4AKGA 2YUTA 1QX4A 2ZYIA 2PX8A 2BF7A 5TQ2A 1W5BA 1F3LA 5DV9A 1JEOA 2O7VA 2UUPA 2X9NA 3KVOA 3NX4A 1GLGA 2P67A 3FCUB 4P36A 4DAOA 1NBMA 3LTNC 1XROA 3JYLA 1T2NA 4ARZB 1SB9A 4FMPA 4IHQA 2HIAA 1QGOA 3JAKB 4NAVA 4QRIA 3PC8C 3JZDA 4KOEC 2DQKA 5ARDA 4CKXA 3TFQA 4EI9A 3BOSA 4QDUA 4XQEA 5IT5A 3DCNA 1C3EA 3GFSA 3OPVA 5E6SB 5CB4B 3NH9A 4EB0A 4HGNA 4QQKA 3UT6A 4D9KA 1XVIA 2GZMA 4PIVA 5FYDA 3ZV7A 4I50A 2XVYA 3KQWA 4KO1S 5BOSB 1IBKB 2EDCA 1XPUA 3HB1A 3ORQA 1J06A 3L4SO 3OU6A 2G70A 2XIJA 4IJQA 3BRWD 4MJLA 3PTAA 3PYMA 4J7UA 3ADOA 1IUNA 1I3OA 1HFKA 3KC2A 1U3UA 5FWXA 3VBEA 3IDZA 1UZLA 1ZO8A 2CXHA 5LLSA 1TLLA 3T7RA 2VNHA 4HTFB 4COKA 4OJNA 4MGHA 3U4CA 1X1TA 4EENA 5A3VA 3DMYA 2GN6A 4LJYA 3MS4A 4XVHA 2O4UX 3INGA 5IN4A 2V45A 2R1TB 3O5AA 3QG5A 3VHXA 1T4CA 5IEBA 2MINB 1A8SA 5EEGA 1KY2A 2PU7A 5EMJA 5CHYA 1I6MA 2P2DA 2YVLA 2PX4A 3HUEA 3PHLA 4HAUA 4L2IA 5CAEB 3UWOA 5IJ0A 4DZTA 1XWFA 3OF5A 4Q9DA 3BJMA 2ZBEA 3I64A 1KAOA 3PSHA 2WJ6A 3F3KA 3HSKA 4RVGA 3PNLA 1THMA 3HDHA 3UTDA 4MTCA 3ZXXA 1FP7A 1RI4A 1FQWA 4K8RB 421PA 2ZB2A 3ZWNA 4DYHA 4MCIA 1EQ2A 4IZOA 1PR0A 2DEUA 4OHVA 1CP2A 1K2WA 2VNKA 3C7KA 3D7MA 3JY6A 4K3VA 4NJMA 2IWRA 3ZY5A 3I62A 1NC1A 3B9RA 4HD8A 4ASUA 4HDNB 4NBWA 3S0JA 1ODSA 3LSYA 2L42A 2W2TA 2H4JA 1AKTA 4BNJA 5CPFA 3ZHUA 1G20B 4IZ6A 1H93A 1IXKA 4GZ6A 4BLVA 1J20A 2BJWA 4RABA 5DDIP 1JDNA 1YT5A 1NOKA 2ZSAA 4ETWA 9LDBA 3QEMA 3QKRA 4F2GA 1I6LA 1J22A 1SOVA 1YSCA 3NBFA 2BBTA 3HR8A 4FBGA 4RKFA 1TMGE 1VIAA 2HUPA 3OWHA 1MT0A 2C58A 5KVAA 1EMDA 3SVLA 4KLCA 3EG9A 3PRJA 3B6MA 3DYVA 3WB0A 3WL7A 4LPSA 4UBJA 4U00A 3IUSA 3DA8A 3A26A 3BXOA 2FLWA 2XXJA 4HMOA 4KOAA 5TB5A 2XBLA 4KQ1A 3S8EA 2HW8A 4TWRA 4BVBA 3DP9A 4ZV9A 4E7OA 4BATA 4HO1X 1VSQA 3D7SA 3T7KA 1JQ5A 1RACA 2CLLB 5DULA 5K6AA 3UHOA 1OFHA 4OV6B 4NCBA 4MR7A 4AX4A 4LFCB 3IKJA 3ILSA 1CB7A 1MN6A 4GSYA 4JZKA 3O83A 5LQRA 2XUIA 2PKWA 3P9SA 4HEA1 2RHDA 2HN9A 4AS3A 3ONWA 7YASA 1LGYA 1Q7RA 2PUCA 1D7AA 1WNFA 3FKSA 2WWVD 1SKAA 4K9PA 2Z9DA 5K0ZA 5DI3B 2BM1A 1HYGA 2XB6A 5E1MA 3RS5A 1ZNZA 4GYYA 5AW0A 4BLOA 1LY1A 2ZYRA 3BMNA 4XM2A 4CMBA 3K30A 1C30B 1D0IA 1F0YA 4KXNA 2GM4A 4M2LA 4JOSA 1IJBA 3RB8A 4CM5A 3HRIA 4G65A 1J9EA 3EQ2A 1ZSYA 1JEJA 2E1RA 3QXSA 4G86A 1L8OA 4BHTA 2HX1A 2OCGA 3ROKA 1SQGA 2M98A 3IAM6 4CV3A 3LYLA 3TMAA 1R6AA 4RTSA 1X94A 2OFOA 3PC6A 3U4MA 4TKLA 1B74A 3HFGA 1N2GA 1PQ4A 3A2MA 5C1PA 1R0ZA 1MGPA 2QTCA 2TYSB 5CCXA 3FUCA 1AB6A 1RDFA 4NK5A 1AKWA 4IGAA 2RAFA 1MQSA 5I3CA 1S2IA 3DEAA 3IOYA 4RK1A 4ZZ0A 5BN4A 2VNSA 2VDKB 5JWOA 1V8BA 3KPVA 4E1VA 5KYXA 4GX1A 1ZI6A 1PP4A 4M1WA 1R4MA 3VR1A 2OZPA 1QGUB 2V4MA 4HAYA 4LOIA 3RHFA 5BV8A 3N7AA 1U7DA 4Q4CA 1M6WA 4KO3S 4QGGA 1YI0A 3O82A 3PXGA 1IQ0A 3N0VA 4DIKA 1O87A 4DY4A 4HUTA 2FPRA 2Z2JA 2Q46A 3BWVA 2AFIB 2HFKA 4M8SA 1A96A 1SUPA 3PQ4A 1WB4A 3RSHA 5K9ZA 4YLEA 4L16A 2B83A 1ZJ4A 1PW5A 1Q92A 2BR5A 3D0OA 2BEVA 3SDZA 1Z74A 4K88A 4JI1B 1XJWA 3PIDA 4GXQA 4U7TB 5PGMA 3A1SA 3D3KA 3ZWDA 1SQFA 1XIVA 2YYZA 2GZSA 2ZRAA 2IKSA 3GLVA 4LDJA 4XIIA 5J4YA 1I01A 1EJ2A 1G8KA 5EPOA 3IVCA 3JQ7B 1XXHA 1II8B 3D1VA 5FJIA 4W6QA 3ZU2A 4YMTA 2WT4A 2DFNA 5BV7A 3VJRA 4IF6A 2G9VA 3LKBA 1KBOA 3DHWC 5TC4A 3RJZA 1NR7A 2VP2A 3OE5A 4XJXA 4PLFA 3HL4A 2VA9A 3IUPA 2F3PA 4BVLA 2G4CA 2VHWA 3AF1A 2QENA 2CF6A 1H2BA 3N2ZB 4YCNA 2I6FA 2JFHA 4B84A 2VT6A 2A5LA 1SD1A 1XZGA 1VCMA 2HPZA 2QNBA 3SQDA 1NOIA 2J33A 2FSFA 3DDCA 2PUGA 3L1KA 4TYYA 4OQPA 3ZBUA 4Q4HA 4OA5A 4P32A 2VRNA 5THKA 3CKKA 4CQMB 5AD1A 2PVPA 2Z0MA 5AESA 2C54A 3R0IA 2X8JB 3HVUA 1LBSA 4XJTA 1BD4A 4ZOEA 2WU1A 2BKEA 1YMQA 3C74A 3NWJA 3NM6B 1Q1ZA 4AN4A 1G8HA 4EA8A 4BV3A 4DLLA 2RB5A 2WF6A 4ZAZA 4P4SA 1WUJS 1HDIA 4DMFA 4DR5B 5L6LB 1JA1A 4HGZA 5T4FA 1EXVA 1M2VB 4ZMBA 1NBME 3L0ZA 1GYQA 3A2LA 4L6AA 4BBAA 4HQNA 3BRQA 4LE0A 3K5PA 1S2OA 3RVSA 4BO4A 1E9EA 1Z26A 3LW7A 4UQOA 3V1YA 3TXXA 1KZGB 3BEDA 1LK0A 3PWZA 5IX8A 4ES6A 2O54A 1N7IA 4LYGA 3U7RA 4LF7B 4LCEA 2YWGA 4TZ6A 3KQLA 1UM9A 1JLMA 1P1KA 5A7HA 2WVAA 1A50B 3GXBA 1NF3A 4OI4A 1QS0A 4ED9A 2BM9A 4O25A 5AVTA 2O8DA 2HXYA 1DIRA 4QYMA 4OAOA 1OE0A 2QE6A 2NPFA 3SXJA 3V97A 1Y3HA 1ZUD1 2PU5A 3W5SA 1R64A 3FOFC 2WWGA 5BYKA 2QUBA 3DJFA 3QU5A 3L7OA 4GDFA 3KOWA 3HXKA 1B14A 2BL4A 2OBMA 3G13A 4G5FA 3H65A 4H27A 2GUGA 4MP3A 3THRA 3V7NA 1XZHA 1EG2A 1DO2A 1H5NA 5DM4A 2FW1A 1CJBA 2H7CA 1FX0B 4KXMA 5FADA 2OCXA 1OY1A 1AU9A 1U3VA 3F97A 3L1VA 4FFRA 4LYYA 2VTBB 1M9NA 1P4JA 2A57A 1DB3A 1K5HA 2GESA 3ROMA 3N8DA 4BAUA 5L3QA 2K7FA 1OYYA 3G0HA 4BVJA 3KQOA 5HRCA 1BHJA 1X8LA 1XSEA 1M5RA 3GUZA 1DRKA 3AY3A 1U7PA 4UZSA 4C4AA 5HTKA 2PXCA 1WB9A 3PICA 1H5QA 4OHCA 4FXOA 5G40A 2ZQYA 2AR7A 3TLJA 3WYCA 3NNSA 5GVSA 4Q4LA 1TKAA 1ZRNA 1Q12A 4PR0A 3CUSA 2QN1A 4WN3A 2FFQA 4GKAA 1Z08A 3GMDA 5B7NA 1CJSA 3IVMA 1QO0D 1HTBA 1YZYA 4ARIA 1E3LA 2I8AA 4UD2A 2P8SA 1IOZA 1IZ8A 5DTJA 4JC8A 5FUXA 5JYBA 5CVEA 3WTBA 3C6YA 3ODPA 2ZVJA 4MR9A 4WXPA 2NZ2A 3ZE2B 1UMBA 3TD2A 3KP1A 5A7GA 1L4LA 4Y9TA 5I9IA 1B26A 1NXVA 2OHIA 1BTOA 4FGLA 5TJHA 5HKOA 1GPNA 1O4WA 1N3LA 2R00A 2HCJB 2VOJA 3AY7A 5K20A 2F8SA 1SIWA 3L7MA 3KHSA 4N3NA 4CM1A 1J2TA 2O07A 2Q5QA 4J43A 3RVKA 3H2BA 3EH2A 5GWXA 3F0TA 2RBEA 5FBZA 4K6FA 4BBZA 2HQBA 3QHPA 2HNBA 3GLSA 1Y63A 3DE2X 1DAGA 3ZXIA 5E3HA 5BWCA 5JLJA 2YY6A 1VRWA 4FYWA 4F97A 1BW9B 3I0MA 3QBDA 4MGEA 1ECFA 4R1NA 1CY7A 1QNFA 4J16C 2RGNA 4UU7A 3UUFA 4DIOA 2IEGA 2VF2A 5GJBA 5IVDA 4DLWA 3I6QA 1CQJB 3USES 3IT2A 4ZHQB 5NULA 1EGHA 2BI7A 2CXOA 5JSQA 3TNYA 1I0ZA 1R6DA 1I1HA 1X1AA 3AJ8A 5DCLA 2QAIA 5BSTA 3Q0IA 1RPAA 1UMCA 1U4OA 1YRWA 5EUBA 3C0KA 5C9ZA 1E2UA 2VSFA 1WDLA 2REXB 3QMVA 1W1IA 3D1LA 3R40A 5CTJA 3RSSA 3MWEB 1GGFA 4DRYA 2I91A 3PNVA 3ILVA 4NL4H 3SR0A 2IH2A 3ZXUB 3RIHA 2ODPA 1FFXB 2P0AA 3H5NA 2XNDA 1RHRA 3FD8A 3UMCA 4CCAA 5T7BA 4JXZA 3S2FA 3ZY2A 4QREA 4ZGBA 1TUIA 5AP9A 1VA4A 4LC0A 3LWBA 4B40A 1MEOA 4F6CA 3J81k 1U63A 1QAOA 3A1VA 5BNIA 3GEEA 1Y1TA 4YMVA 4KX3A 3CVWA 5FUVA 4KG7A 3U56A 4EOGA 1VIDA 4FFBA 3B20A 2CFTA 4WSOA 4Q9JA 2JKYA 3L7AA 3P9CA 5TLSA 2JAWA 1IHYA 4MRPA 4X00A 4EABA 3F4BA 2IGBA 1IPFA 1VG9B 2J6CA 1LRKA 2J31A 4QASA 5JH7B 3EXHB 3N2EA 1K89A 3RTEA 1KAQA 4OOEA 1X15A 3IGFA 2JJQA 2C31A 4PAOA 1YOVA 1Z7BA 4U7GA 5HFJA 2FEMA 4Z4HA 3AF5A 5K03A 2I76A 3WIEA 4DZRA 2B7CA 2BR3A 4ENPA 1Q0RA 2GAOA 3OVMA 3SNHA 2BTOA 2PX5A 4KQWA 2NUAB 3PXEA 4YCAA 2UVQA 3U1BA 1CY2A 4DG9A 1KDPA 3E22A 1DLJA 3ZE6A 3B9BA 4BJHB 1B4DA 3OLXA 4X94A 1Y4ZA 3MN1A 5L3SA 1AUXA 1GTG1 4GYKA 4EYGA 2RC6A 3DLCA 1JXQA 1W2WB 4IDFA 3FJYA 1M3SA 3KJIA 4YRJA 2GA9A 4S2EA 4U1RA 5DYNA 3I5MA 3OEHD 4E88A 2B8JA 4AJNA 3PUJA 1XXHE 1G8YA 3CXRA 4C7BA 2QT9A 1OVGA 3D8BA 5F35A 3KS9A 4TSFD 5HIAA 2EAUA 2OCBA 2BY4A 2HF8A 3GJ0A 4E14A 1Z29A 1PHRA 2J3LA 3B9QA 4PG6A 4QUEA 3I9V6 4B9EA 1A71A 2AVDA 2B4AA 3TCXB 3T5AA 1N32B 2Y1FA 3FTDA 1FNMA 3ASUA 1E8MA 1RZRA 2NGRA 3KOYA 1P7PA 1KDTA 2JDIA 2C82A 5GOTA 2BEWB 3A2KA 2CBXA 1JDBC 4BMSA 1Y6GA 3PJEA 1QCYA 3F74A 4O0MA 1WZ2A 1LJ8A 2V7BA 1SQ0A 3JTMA 4PLCA 3ONDA 4XYMA 3S1LA 5AIBA 5KTKA 2R8PA 4LRWA 1FFBA 2WD8A 2CFIA 2ERCA 3EDRA 4UUBA 2V0CA 1E3DA 2QVGA 3I0NA 3UJBA 3HM9A 3CPSA 5T8KA 3IOEA 4Z7QB 2DLDA 2QRJA 4XLTA 5K05A 4D25A 3AFNA 3VUEA 3AM3A 2QORA 1CZHA 4IG9A 3IBSA 2AKAB 4TXHA 4WZBB 2VCEA 2ECFA 4WI1A 3A6EA 4IW3B 3H11B 4LXTA 1C7EA 2CNNA 4O2RA 5DVZA 2O8CA 2HF7A 3FWHA 2PSJA 2HQRA 1Q83A 3K0KA 3ND5A 5I9TA 1L4YA 3DZJA 2H17A 4M3NA 5KMGA 2OB2A 4L74A 2R5NA 3GFTA 2QBYB 3QH4A 4L57A 1NR1A 1K6XA 2HWYA 3TSOA 3S70A 2DUJA 2HU5A 4DNPA 2Q2OA 3RR2A 1SAYA 2G8NA 3FNIA 4XLZA 3UUEA 3R5XA 3VM6A 4BFWA 2IHNA 1K8XB 3NJ4A 3A6LA 1XU9A 3KSAC 1PJRA 4FQ8A 3AEXA 2DJIA 3HEBA 3ENNA 1MQAA 2NADA 1VJ0A 1PZNA 4H4EA 4PGHA 4ZU1X 3ZD6A 1CWUA 2G1PA 1JT9A 3WNCA 4EY3A 2FE4A 2FPXA 2JARA 4PZAA 2PMEA 1WPQA 2QX4A 2VJAA 4FINA 3U0BA 1JSZA 1VJDA 1FUUA 3EVFA 1P2VA 3TJRA 2HBRA 2PS0A 4URUR 1UPCA 5C8YF 1MV8A 3C7CB 3VBCA 1T9KA 1OI7A 3EIXA 2P9YA 2AXPA 4JWKA 4PPNA 3TLBA 5B36A 5C1DA 5K2OA 1XPRA 4XWKA 2OEPA 5AK6A 1LPNA 2ZTUA 4TTPA 5FI1B 2Z2IA 4HZIA 2O2GA 3AESB 1BEUB 1M54A 3PNYA 4X3PA 2UUCB 5D3ZA 1QLJA 5IJZA 1ZL2A 2QM7A 3AV3A 2E55A 5K8VA 4LGMA 2BOVA 4MULA 2V5AA 3TKLA 1S1CA 1DEOA 3PDHA 4IM7A 1WETA 2F7SA 4HPXB 1G98A 1SR8A 4Y2RA 1J5PA 4Z0NA 4D9JA 1T8WA 3EVGA 1H65A 1U94A 4WZ6A 4D9BA 3IEIA 2ZCUA 5FPHA 4F3TA 3BD8A 3JRXA 4Q1BA 3BAZA 4QYTA 3OEYA 4Q03A 3GNQA 3TF5A 2Q3FA 4L7VA 4D3SA 3OLCX 3QVMA 4LDNA 4BMVA 1ABFA 3WGIA 3BCHA 3L8GA 1ADYA 5EJ4A 1I6KA 4IDAA 1HYEA 2ECPA 2I78A 3AUKA 1RE1A 2Y66A 1XEXA 1DJPA 3P19A 1NNLA 4C43A 2FG6C 2JZCA 3LLCA 4TMZA 1PR5A 4H6WA 3RVNA 4HR7A 1ECBA 1G8AA 4ZQHA 3SCZA 3WLLA 4YONB 2WF7A 1BXGB 1Y9JA 1LRJA 4Q01A 2QPOA 4E08A 2PZJA 1XVLA 2D5BA 2Y6UA 2P3SA 3EGIA 5KYVA 4CXMA 3M89A 4GDMA 2ZOSA 2PT6A 2CWDA 4HB0A 4UBIA 2GZ1A 4HNRA 4RDIA 2VK1A 2W2MA 3K9LA 4G5YA 1Z75A 3D8RA 3BWDD 3ZGXA 3ZK8A 5EIXA 4A0GA 3BG5A 4A36A 3AI1A 1B2LA 3LBAA 3LVQE 1E9FA 4MSUA 1E79D 2D1FA 3RUAA 1BQ3A 1PE0A 4CKCA 3UC5A 2OHXA 2GPBA 4AJ4A 1EXMA 3IAS6 4JJ7A 1QPBA 1VA5A 3EMDA 3R3WA 4G67A 1KK0A 5BVGB 3M6FA 4UDYX 5TGZA 2VT7A 4MA4A 5BQOA 1N8KA 3W9SA 2JI7A 1DKPA 4C03A 1FP6A 2C3OA 3ON5A 5EJAA 2JZOA 5JSHA 3FZNA 2C7VA 5JCPA 4ARZA 3OJWA 5CLFA 5JIBA 1C5KA 1TL7C 2RIPA 2ZT6A 4BLWA 5I4CA 3T7TA 2X8AA 1W8DA 1ABBA 4RETA 1LWOA 2Q4BA 3EGEA 3WZ2A 3X3HA 5CB4A 5AVUA 1INLA 1OAOC 1T0IA 3DQZA 4DV5B 5JD3A 4LBYA 1QRDA 3H5AA 1XEAA 1CZLA 2AOTB 1HOTA 2PRYA 1PV2A 4ZO4A 1DAKA 1N2HA 2IEBA 2AOXA 3F78A 1RNLA 2WTXA 2X0RA 3OJXA 3RLFA 3UHPA 1RLOA 1RXSA 4C01A 4E6EA 3OLYA 5IKOA 4H2DA 5FOXA 1DAHA 1RQLA 2FWIA 3UCEA 5BP7A 1APBA 4OHYA 4XI9A 1SHJA 2YWXA 2SECE 4KQ2A 4JWTA 4EF6A 1BDIA 2AW3A 4M46A 1P6XA 5LA6F 3TH5A 4LOLA 1UC9A 1YZTA 1PG0A 3I9FA 4HTFA 4EW6A 1BA3A 1VMAA 1OU4A 1BU8A 3H5IA 3AWIA 4FKZA 3H5WA 3ZHQA 4KQJA 2DWOA 1GNLA 4ZV4A 2C1ZA 2VP3A 2V7GA 3PKZA 4UTOA 2R1TA 5ESRA 4D7AA 2MINA 3HCOA 4M6WA 1R4ZA 3AHCA 5CJJA 1SEPA 3PGKA 1EZ4A 4PCLA 4M99A 4P58A 1LXCA 4Z4QA 5TQVA 3SZUA 5DCYA 1T1IA 3JV7A 3JCZA 1RPJA 2UXDB 1T9ZA 5A9SA 4NSNA 5FPYA 5EWJB 3FETA 1QANA 1YB2A 1H9AA 3V4OA 4TPKA 1FVHA 1RM0A 4POOA 5JAPA 1Y3DE 3OPQA 4HDNA 3F5QA 1Z7EA 3V5NA 3N70A 4C7MA 3KAJA 3DBLB 1G20A 4KGZA 1IUOA 1PJ3A 4PAGA 4O4JB 5CW1A 3AR8A 3QEBZ 4G0VA 1D2CA 2Y8EA 5A1JA 4OXRA 4ME6A 2YV1A 4BO0A 1V2HE 3U7QA 2HXSA 4OXNA 2C88A 3DT8A 3GWZA 2VNAA 1DGQA 1MO3A 3EC7A 2W6NA 3GEGA 4FU0A 3KR2A 4JBHA 1JYEA 2HMSA 3M6MD 2ZJ6A 2AC7A 2XMCA 2IYPA 3BJRA 4NU0A 4R98A 2BUAA 1GGEA 2FWMX 4NQZA 1Z4QA 4Q39A 1D6JA 5ETJA 2OSVA 3B13B 1U2GA 3FGZA 3VX4A 1OX5A 5FP0A 2C9ZA 3AI7A 3T5PA 1P45A 4EVIA 3CMMA 2H16A 1KIMA 2C3PA 4ZHSA 5CIYA 3K9FC 2PS9A 2PS1A 4PQRA 4B6EA 4H1HA 4RFSB 4RMHA 3SEQA 4CKEA 4J1TC 3D43A 2CXXA 3RABA 3B78A 2JLUA 3KG2A 4W4TA 1E5VA 3O0TA 3W34A 1E3JA 1QH0A 3RSGA 1TC1A 4BP8A 3T1HB 1OLXA 1T35A 3U37A 4RORA 2PT5A 4BMDA 3F5MA 3SKVA 4G56A 1F1BA 3K70B 4R9SA 1DBIA 3U40A 1WTAA 1K1EA 4UU8A 4Y1RA 1E5LA 2JVJA 1P75A 4HQKA 3VZCA 4BB0A 2OO3A 5EGNA 4Y98A 3DS8A 2YHAA 3TG8A 2EIXA 2CL7X 5C1IA 2XRMA 1GIAA 1NONA 3BGIA 4M0PA 2ILTA 3HHPA 4D0RA 4E4YA 1RSZA 2W6QA 3CJRA 1N6PA 5FOQA 1Y37A 4UTRA 3SBDA 4IMPA 1E20A 1JTEA 1V9LA 2NYUA 1Z4PX 4C08A 4M37A 5D5HA 3LTEA 2F1KA 5LP6F 3QEAZ 4RGYA 2B1QA 2FP4B 3O93A 4N82A 3UV6A 1SPXA 1CDDA 1J49A 1EHYA 5FPPA 1RC8A 3HZRA 3MM4A 3T7DA 4YASA 1QGUA 3DDUA 4KYTA 3BILA 1IN4A 3DD1A 3QX9A 4WOCA 1AKMA 9LDTA 3ZD7A 3AXSA 4L78A 3LPCA 1KGDA 3NAGA 4D4HA 2I2FA 1FTGA 4M8KA 4NMHA 3F7MA 1NJ5A 3QMPA 4B76A 1RJ9A 3U3XA 4MHOA 1CQIB 3SWWA 4KSCA 3U09A 1QKJA 3F6CA 3JW8A 3KPUA 5CGZA 2FX2A 2PL1A 2C9MA 2O2XA 2VDLB 3DT6A 4A6DA 2Q5HA 3O8LA 3R3UA 4J2TA 4OHPA 3YASA 1QJ4A 1O57A 3R8XA 4DN6A 5LLTA 3HKDA 2R5FA 3O2QB 4IX9A 5CJPA 1WV1A 1RHQA 2IODA 4D2IA 1MGOA 1T24A 1YZLA 3DC2A 3JQ7A 3W1EA 1NW5A 5ICGA 1OC2A 1II8A 2PGNA 2WT8A 3FUWA 5DXFA 1XRLA 4DC9A 1FLAA 3L6OO 2J87A 3IHTA 3QSGA 4FYIA 4WOPA 3CRQA 5B58T 5LDGA 3IVRA 5HR5A 2M9MA 5BMVF 3DKPA 1BCSB 2AB0A 1JNXX 3Q11A 4IILA 1AGNA 2Q0HA 3JWJA 3ZV5A 2VYCA 2OL4A 3UK1A 4JNKA 2H48A 4NCKA 4MTLA 3DDZX 2HWUA 2LR0A 4X7BA 1K7YA 5ITSA 3ST7A 5JS7A 4DNFA 1XD9A 3AF4A 1PW7A 3KUKA 4PWYA 4MI1A 1QX3A 4JLVA 4DUPA 1HG1A 1VKRA 3IMKA 1DWPA 4KTTE 4MS3B 3R9IA 3NDBB 4C6TB 1JG2A 3CMCO 4ML3A 2BMVA 4X6LA 1TCCA 4OXYA 2OXIA 1QC5B 2X8JA 3SJUA 2OGWA 4EHAA 1SXHA 3KNZA 2QUHA 3TX2A 1XL0A 2E18A 2ZYHA 4B75A 4YEDA 2NO0A 1Z33A 3CH4B 4RE6A 5TF0A 1FF9A 1ATIA 1O08A 1Q0ZA 1XVVA 2ZVDA 1M2VA 4Z1OA 4CEIB 2QG6A 4CL0A 4L4SA 1C1YA 2YVQA 3A6HA 2YV4A 3FFWA 4YP0A 2BMAA 5ARCA 2ZM6B 1HKUA 2ZYAA 1QIGA 1TUBB 3E18A 2AN5A 3FX2A 3FJOA 4M36A 4ZAWA 5SY9A 4CU2A 2ZP1A 4ZVUA 5IWAB 3IPXA 3LUHA 1A9QA 1YZFA 2ZQ5A 2VXYA 2WJVA 3NASA 1RIIA 2P90A 2CWWA 1KFBB 4BZQA 2M2IA 2WJGA 1W35A 2R1ZA 1TYBE 2P9EA 2RBGA 2PLRA 5CXQA 1NVKA 3DV2A 1TEVA 2VYVA 3D8HA 2HIMA 3WP1B 1OI3A 4MUGA 4D81A 3GR6A 2VHEA 3R7LA 2X2FA 4X6XA 1K3FA 4O2BB 1JSCA 5IK2D 3V8NA 1S5PA 1DUSA 4HCJA 1CYEA 1KKMA 2V4UA 5L7WA 1BWQA 3KT8A 3UVEA 1ZLXA 4P0PB 3O84A 1G8GA 1XZNA 4I2NA 1I33A 2ATCA 4RIEA 3SS7X 3RARA 1NZJA 4MV4A 4L5YA 2AL7A 2Z43A 3FSRA 1XF9A 1FX0A 3PJDA 1IXSB 5IDWA 5AM0A 2VA8A 2VTBA 4QM6A 1JYFA 2X0KA 3H1GA 1BWPA 2Z83A 3N2GB 2R7KA 1IN6A 1UOQA 1BZYA 1GXSA 2Y6VA 2PWYA 2GD6A 3IAAA 3WL5A 1XKLA 2QRZA 1V8PA 4Y1FA 4HVCA 2CHEA 4S12A 3H86A 3MCUA 3IX7A 1CE8B 4MINA 4BIIA 4ZTUB 1GQRA 1KETA 3SICE 3LT0A 4TZ0A 2PSEA 4M1TA 1IXRC 5LJLA 2X9QA 4TUYF 2DTDA 4RUKA 3ZHYA 4RHEA 4ND5A 4Q9IA 3TLXA 1V26A 2JIOA 3JARB 4NPCA 4ZXFA 4E4TA 5JNVA 2VL7A 4QLAA 3RIYA 5JS6A 1D0SA 1QZXA 1M75A 1RAGA 4XXHA 1A95A 3G7NA 4G0ZA 4ZQBA 4O5AA 4ENQA 5J2UF 1XQXA 3EFHA 2NU7B 3GUVA 1CLEA 3NAMA 4IGKA 4MAAA 1N2EA 5DN6A 1BKSB 3ZE8A 3U60B 1JIXA 4BNUA 5ALXA 1G20E 1QLWA 3D7RA 5DNVA 5JXIA 4PAWA 1FDVA 3O38A 3ORRA 2F59A 3EZGA 1J7KA 2HC9A 3KZKA 4WZAB 5AJXA 5E1BA 4I5IA 3GLIB 2VZEA 1ZS9A 3CT6A 3CUYA 2D06A 3VV2A 2CD9A 5J3JA 1Z6XA 1PJAA 1XAIA 4JLDA 4KPUB 3OX4A 1EVEA 1DAFA 1MOSA 3QBVA 4F85A 4XYBA 1IE3A 3H9QA 1A88A 2E5LB 3KU4A 1NXQA 3EGDB 1SG9A 1CUEA 2GBLA 2G4VA 2XMGA 2BMWA 4JOBA 4P53A 4ECEA 3FTCA 1HH4A 5JAMA 5LVAA 3OURA 4CL3A 1KGSA 1ZD3A 3BZUA 3GQBA 3S99A 4QG3A 2VAXA 1II9A 2X4IA 4EM6A 1V8ZA 1E0JA 2A3RA 4RTRA 3C48A 2A30A 3M8KA 4LHXA 5DNEA 4WLNA 3VYWA 3ZJUA 4B33A 3IB6A 1HQDA 1R8SA 5JYCA 4X24A 4IEEA 3K4PA 3QPCA 1GZHB 4R2HA 4COOA 2Q6KA 2Z4RA 3LW8A 4E07A 3D4OA 5HW0A 1BAPA 1V9CA 2PMBA 2XKKA 1ZMOA 2H4XA 4H08A 3EPJA 2WICA 1T34A 4KAXA 2GJ9A 3H99A 2FZLA 4R5MA 1QQ6A 2BZSA 2ZRHA 1WOYA 4HLUC 1J97A 3MS2A 3SIXA 1RQ2A 3EJ6A 4IGEA 1QV7A 3BN3A 3QPAA 3IBFA 2WY2D 4W5OA 2QVZX 3I39X 2V3WA 3JQFA 5ALFA 4RS4A 5F5XA 1Y1PA 4CQNA 1P9OA 2IXAA 1P4HA 3CRNA 4UTVA 3U4IA 2PAAA 1JBKA 4NVRA 3RC2A 5ILOA 2CFCA 2P30A 3GUYA 2AG5A 3UZUA 3IKLA 2O8FB 2ZFUA 1U2EA 2K2WA 1GP2A 4RSGA 4Y2UA 2IUUA 1RLIA 3CLKA 2YWBA 1RXIA 1ZRMA 2B8TA 1IQRA 4AQ7A 2VSNA 3Q8MA 1KDOA 2MYUA 2J9XB 5B2FA 3I1FA 3CO0S 3D3NA 3I83A 4D3ZA 5JJIA 5L3VA 3HXTA 2HCFA 4IIJB 4URYR 3JD2A 5D51S 3MS7A 1T4MA 1U7HA 3ZQJA 5C5DA 2KYRA 5JH7A 3IP3A 3KKKA 3EXHA 3HI4A 3UW3A 1DCKA 4J29A 4JELA 1VHLA 1YIAA 5JDIC 2GPAA 3VR6H 4CR8A 3ZHBA 1P4SA 3ROZA 3UPUA 4CDGA 4WEOA 1MPXA 4JC0A 3TIXB 3WMEA 4UATA 1Z36A 2N75A 2I29A 1EDEA 2WDZA 3BH7A 3UQZA 4B3SB 4OFXA 4MITA 2QG4A 1UIRA 3VYUB 4B87A 2XSZD 2NUAA 4EAAA 4MRSA 1HYBA 1WDTA 3C7DB 4L0MA 1T8SA 2HSWA 3EEBA 4IS3A 4AS1A 1U4NA 4D0NA 1J9GA 3N2IA 2VWHA 4YUAA 5LYJB 3SEFA 3C45A 2JFQA 2XTMA 2BGJA 3HYRA 1AM4D 1VM6A 2GZAA 3MK31 4R9NA 4CIXA 1V45E 2HNKA 2I3GA 3CPEA 5JT1A 3RYHB 1KJWA 3HJFA 3AEYA 4OP3A 4TRNA 1SB8A 3B6ZA 1VKNA 4R7ZA 1CRZA 4MB0A 3ZHOA 1CG6A 5CLHA 5AMXA 1VLMA 4R0NA 1AG9A 3JD4A 4Q4DA 5F3RA 2AJDA 2NVWA 5AKGA 2P5SA 1L9XA 2G5PA 4RPLA 3R7WB 3PC7A 4LJ8A 2B7LA 4F46A 3P52A 2IUTA 3AFHA 6ADHA 3FYTA 3G2NA 2W4QA 4PC2A 5G1OA 2I4OA 1A4IA 5GINE 2CL5A 2JC3A 4JLMA 5TV2A 1KFCB 2CVFA 4LZLA 2BEWA 1DG9A 4O1MA 4EPYA 4N18A 5DMHA 5CDHA 4BVGA 3EA5A 3VR5H 1V39A 1JEDA 1L4EA 4HYTA 2QUIA 4LJSA 3FGPA 1NSFA 4PHCA 3ZY4A 1XTRA 3NTOA 4B2LA 5ICEA 5KX5B 1I4WA 1C0LA 4IF4A 3WDLA 2AW5A 4GGOA 1W96A 2XF2A 5CIQA 5EHNA 4R3NA 5FULA 2X0JA 1XQ9A 2FSGA 1Z4IA 1PF7E 3MBIA 5DGIA 3T3EA 3VOAA 1XTTA 7ABPA 5JFTA 4DV7B 2QTHA 1DV2A 3IAFA 3K4HA 3L7IA 1S4QA 4WZBA 3TQIA 3LUAA 2CJWB 4I2VA 5HQJA 3EK2A 3ZVKA 4RGBA 2QL7A 4GICA 1TC2A 4U0KA 1S96A 4FZJA 4UUMA 3FOZA 1NNEA 4ZANA 5EGSA 2IF0A 3JVEA 3I09A 1NE2A 5CLJA 2GN8A 1AKYA 3M81A 1L5SA 2N1BA 3P9ZA 2QBYA 1G0NA 1PTJC 2ISSD 3DVLA 2P9QA 2IFTA 4DB4A 4J6EA 3V7UA 4B34A 2YH2A 3TIIA 1QTRA 2CB0A 4LE1A 4PX9A 1ZHHA 2FPPB 1AO3A 4C7XA 4GPZA 2NVOA 2W7TA 4CNBA 2CLCX 2QRMA 3RVPA 2R7LA 1KHHA 2ADOA 2PGLA 3EZFA 3I4CA 4ZCLA 2HWXA 3CCBA 3AJDA 5IAJA 2ZDGA 3WLHA 3CRZA 4K40A 1DINA 3ZU4A 2ZB4A 4GLFA 1KC1A 4OKNA 4EK9A 3COJA 4AJJA 3DNMA 5B7PA 5F98A 1G6KA 4KLRA 2NIPA 2PA0A 3GBVA 3RC8A 1RQRA 1HA3A 3LOPA 1X13A 3QM1A 2VWGA 3SVZA 4ACAA 3T1TA 2BDTA 4ILEA 3LGAA 2YICA 5C8YA 3JVUA 3WGHA 4AX8A 3AESA 3OJOA 4ZOQI 2OCIA 1E8NA 3RRJA 3ASVA 3COVA 3LBIA 1C0IA 2CL0X 2P2NA 2QVLA 3I53A 4P2BA 3T7EA 3EGWA 4WECA 3P2MA 2MYNA 1AA9A 2COEA 7GPBA 3OPXA 3PV0A 2J9GA 2YINC 3WK5A 4IJMA 1N9GB 5GAJA 3SXUB 4PR3A 3C5HA 1Y3FE 1HLFA 5HJ2A 4ZCSA 1TO2E 1YRBA 4B31A 2HJWA 4CE6A 3QZUA 4TQGA 3URMA 4QOJA 1GN9A 1NVTA 2VLIA 4LYAA 1DJNA 1M2JA 2G3YA 4NV1A 2AUNA 3AHEA 1VE6A 4BXOA 2FWNA 1CF4A 1AUQA 3N2YA 3WYGA 3NIDB 4UQLA 2QVXX 4MX8A 4JJ8A 5HCNA 2XMDA 5TMBA 4XDYA 3RVOA 1YNOA 5BY2A 4DJJA 1ZK3A 2E5WA 4JLOA 4ND8A 1GEEA 2MU1A 2G5CA 5CEFA 1HORA 1HDZA 2NQ2C 3FSEA 3D2BA 4N9QA 4TL8A 5BXYA 4ZO8A 1E2LA 1I2MA 2ZWIA 5FOUA 2SCUA 1N3YA 3H3JA 2AT1A 1NW9B 2HLPA 4D1YA 1VPEA 4WCFB 3LQRA 1XKTA 1B1CA 1UQRA 3HCEA 4WOBA 3KL2A 2CK3D 3KETA 1YDGA 2JLWA 1GSOA 5DCWA 1JI0A 2PRSA 1TZKA 2R86A 4OJMX 4R69A 4AL4A 4ZYTA 2FWPA 3N8NA 4KQXA 4C5BA 5J2TB 3X2FA 4A6XA 2J0EA 1FLVA 2J1LA 3N8KA 1OTHA 2WIJA 3D0KA 2VC2B 1VXOA 3NWEA 4HSEA 3UT5B 5HNKA 4B8YA 3MTBA 2F90A 2FZKA 1O94C 1QUEA 4LJ6A 3CO5A 4MWDA 3KYCB 1QRAA 2G6BA 4G85A 1P74A 4MYSA 4RJJA 5C18A 1SXPA 2R0QC 4C3VA 4I19A 3HACA 1E9BA 2JH3A 5KNBH 4IXTA 3ZVRA 1R0RE 4KJXA 4N76A 1O6GA 2B7BA 4TWAA 1UEXC 1OYOA 2QYHA 5KNBA 3R5JA 4KNVA 5CVUA 1V5EA 1JU3A 1ZXXA 2Z9CA 1DFHA 1F20A 3OHMA 4LWZA 3V46A 2OCAA 4JI2B 1F2VA 3TLGA 3VPFA 4MYTA 1GUFA 1WQ4A 2VF7A 1PVDA 4JKIA 2Q4EA 4PLZA 3IRUA 4TTAA 4UCQA 3VH2A 5JNWA 1H2YA 5LQAA 4M38A 2I87A 2J0UB 2O3TA 1SXQA 2HSGA 3AVQA 2Q5JA 2AOTA 3HLTA 4ZMRA 2DT5A 3QPBA 4J0GA 2AI3A 4NJEA 4Y2TA 1KERA 1USWA 3RRYA 3W05A 3IV6A 2VWQA 1NGSA 2DJ5A 1BGWA 1JVBA 2VHQA 3M5WA 1HXHA 4LFBB 3JQGB 4FMBB 1U6JA 3C5WP 3OZTA 4PIPA 4WASA 3B1XA 1Q22A 1QFMA 4GLOA 4P22A 3GROA 3G59A 3NTXA 5AH0A 3PUHA 3SZGA 1OH6A 1B8OA 2VYNA 5IKEA 1US8B 5K5EA 1FDIA 1PIWA 1Z7WA 2ZUVA 3GA5A 4RF3A 4DWOA 1P62B 1E1RD 3QUAA 3GDFA 5F1OA 1HK7A 1CC1S 4I6EA 4D3XA 2AJBA 1IPEA 4ESVA 2LWIA 5LA6A 1V4VA 3D02A 4TRJA 2H18A 4MGZR 1RAAA 3L4JA 2VPQA 3ECCA 3P0EA 4JP5A 4KL8S 1CUCA 3LP5A 4A6PA 2WT9A 3D54D 3AR2A 4RCZA 2H9IA 3C7TA 3RD5A 1YJCA 2W98A 3L1JA 4C0BA 5KJFA 3EDQA 3KJHA 3TUZC 2EYQA 1CUGA 1U1FA 4UPEA 3UGJA 5K8CA 2BRUA 2VJCA 3UFXB 1S3SA 2Q4DA 1I4OA 1C2TA 1P2TA 1VMDA 2P4SA 2XUDA 3U81A 3NVKI 1U5BB 4XX0A 4NCHA 4BYGA 2YKGA 1GCAA 2ZJBA 4WX2B 1KSGA 4GG1A 3I5XA 1VP3A 4CMCA 2IIQA 4FFSA 4DW8A 5AW3A 1K8ZB 2R751 2AWNA 3ZOKA 5EMNA 1TI7A 2OV3A 1J56A 2QU7A 4OXXA 2PVSA 2PE5A 5IJ9B 1WCV1 2HJHA 1FRVA 4QFBA 3Q5GA 5J5VA 1TA9A 4DPKA 2WIDA 5B5SA 2I1LA 3EA4A 5KTYA 4KWEA 3SFZA 3WO0A 1ACLA 4K9RA 4ZYUA 3AR3A 3BRCA 4EKDA 4XJSA 1JHQA 4YROA 1X1BA 3R0JA 3SY8A 3VR4D 3PDIB 4ZVPA 1DC7A 1U0SY 2ATIA 2GPWA 2XRFA 3RTAA 2QM3A 2YJ4A 4YX9A 5AVWA 4BDTA 4X7MA 4BP9A 3KJQA 1OGIA 3H1TA 4JUIA 1BYIA 3MWFA 1W5TA 1ZUWA 5HUJA 5JD4A 1BQEA 4HH4A 2Q1UA 4RFSA 1N5DA 3A14A 4JIGA 4U4AA 4WZBE 5EWMB 1KWKA 1AIPA 4UEWA 1PHPA 3BRSA 1R5BA 1RXCA 3OUTA 5DYTA 5J59A 5DFAA 5IS2A 1EE9A 2A9QA 1C8LA 3IAXA 2IZ6A 5DB4A 5AKYA 3QYFA 1JEQB 2AYYA 4K6CA 3RNOA 1QU3A 1H0SA 4KLAA 1PN3A 1U0GA 1MTOA 1Y34E 5JZMA 3E2IA 4YJ3B 16PKA 4U2GA 1U7UA 4DREA 4ZZ2A 2XV1A 1NYRA 3EIHA 3TZLA 3K16A 2NP7A 3KVRA 1U9JA 4NTZA 1KY5A 4AIIA 4BDSA 1VJRA 3BICA 3PE3A 2N9UA 1UXGA 2P9BA 3A0RB 4D79A 3P7MA 3G7SA 1XD8A 4DYVA 5F2OA 4PHTA 4R8VA 4IRMA 4EJSB 1N5MA 2ZREA 3EFOA 1N8SA 2NVBA 4LWPA 4IICA 4PFQA 4WL0A 4A2WA 1TO6A 3H83A 1O94D 4IINA 2IQIA 4B46A 4DILA 1PGQA 4ZT4A 1AY0A 1QCCA 2FP4A 5FV7A 5C7YA 2JH9A 4RYLA