4F56A

The bicyclic intermediate structure provides insights into the desuccinylation mechanism of sirt5
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
267
structure length
267
Chain Sequence
PSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent lysine demalonylase and desuccinylase sirtuin-
publication title The Bicyclic Intermediate Structure Provides Insights into the Desuccinylation Mechanism of Human Sirtuin 5 (SIRT5)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 90
structure length 267
sequence length 267
chains with identical sequence B
ec nomenclature ec 3.5.1.-:
pdb deposition date 2012-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4f56A02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4f56A01
1N0HA 1YHZA 3JR3A 3EY9A 4K9NA 2PANA 2VK1A 1T9AA 4JT8A 1MA3A 1YNOA 1UPCA 1Y9DA 1T9DA 5MF6A 4K9LA 2H2GA 5K6RA 4GPEA 2EZUA 1SZDA 3K35A 2Q5JA 2Q29A 4FEEA 5BWOA 3D4BA 1PTJC 2EZ8A 3LQ1A 2AG1A 2VK8A 2WVAA 2EZTA 1V5GA 1PT9A 3FLMA 4V1CA 4GG1A 2IHVA 2H2IA 2H2DA 4BVGA 1EFVA 4QELA 2H2FA 5EJ9A 1PNQA 1J8FA 1OZGA 2B4YA 4QQ8A 3PKIA 4Y6OA 4K9MA 5DGTA 2FSVC 3PKJA 5EJ4A 4UU7A 5K6TA 2Q5OA 5EJ5A 4GM0A 3U31A 3GLSA 1NM5C 4TWIA 2PGOA 4ZZIA 1YC2A 4HDAA 5AHKA 3E9YA 1M2NA 3EA4A 2OD2A 1O96B 5D7NA 4I5IA 4K9KA 4BVFA 2UZ1A 2H2HA 2EZ9A 4COKA 2WVHA 4RJKA 2VBGA 3IAEA 1M2HA 5EJ6A 4J16C 3IAFA 4IAOA 2OO5C 4F56A 3FZNA 4K9PA 2DJIA 3HWX1 1YI0A 2HJHA 1PVDA 1M2JA 2X7JA 3RIYA 4RJIA 4Y6LA 3CLUD 5BWNA 3GLRA 5EJMA 4F4UA 1POWA 4MPRA 4RMIA 4QPZA 1Q14A 4GM4A 2JI8A 3CLRD 2H59A 1ZPDA 1PI3A 4UUAA 1D4OA 1Z8NA 4HD8A 1U31A 3JWPA 1DJLA 4KXQA 2JLAA 2Q5QA 3ZG6A 4MPPA 1YI1A 4G1CA 4MPJA 3F6BX 1EFPA 1E3TA 4GM1A 4Q9DA 2JIBA 4ZP1A 4JUBA 2OD7A 5MFZA 4JU8A 3EYAA 2FR8C 4FZ3A 3OE1A 2QQGA 1PNOA 1UPAA 1BFDA 2AG0A 4IG9A 4C7BA 2Q28A 2H4JA 2W93A 4IF6A 2VK4A 2VBFA 2UZ1B 4BN4A 5K3SA 2EZ4A 5FEMA 2C31A 2BRUC 4KGDA 2JI9A 4BV2A 4Y6QA 1T9BA 4L3OA 3F6EX 1S7GA 2JI6A 2PGNA 3RIGA 4UTNA 4L2IA 4JT9A 2IHUA 1UPBA 4RJJA 1Q17A 1PYDA 4TWJA 4K9OA 5DEIA 4RMHA 1OVMA 1S5PA 2H4HA 3U3DA 3D81A 2OD9A 1ICIA 2VJYA 5FYQA 4O8ZA 1T9CA 4X3PA 2V3WA 4D5GA 1OZFA 4V1CB 4UTRA 4UTXA 5BWLA 1QPBA 1YBHA 5EJAA 2VBIA 1M2GA 4RMGA 4R8MA 1OZHA 3GLTA 4MZXA 2QQFA 1MCZA 5MGNA 2IHTA 4X3OA 1Q6ZA 3CLSD 4KPUA 4FEGA 1V5FA 3D7KA 4BN5A 5EJ8A 4K9QA 4C78A 4JU9A 2H4FA 2FN3A 4JUFA 2NYRA 5MFPA 4BV3A 1YHYA 4GP9A 3HWWA 3CLTD 4UTVA 2JLCA 4UU8A 4FVTA 1YC5A 2FWNA 4D5EA 4BVHA 3ZGOA 4BVBA 4BVEA 1SZCA 1V5EA 1PO7A 2FRDC 5IMSA 2WVGA 1XLTC 4MQ5A 3FSJX 4UUBA 4JUAA 4JUDX 2A1TR 2NXWA 2A1UA 2OORC 4J1TC 2Q27A 4BUZA 4JD5A 1HZZC 4V1CI 1U2DC 1YTLA 3PDHA 1JSCA 3CF4G 5DGDA 1Q1AA 4JSRA 1U2GC 4JUCA 4UTZA 2JI7A 5K2OA 3GLUA 3ZGVA 1U28C 4RMJA 2Q5LA 1POXA 1M2KA 1O97D 5EJ7A
chains in the Genus database with same CATH superfamily
4C07A 5I9MA 3EY9A 1MOQA 2RFLA 2TYSB 2WSBA 3AFMA 4WACA 3GDOA 1SEPA 3TLGB 3HYSA 3WJ1A 2F8LA 1U3TA 4W8OA 3G8BA 3MBIA 3C7KA 4QOFA 3GOQA 4ZANA 2HRDA 3DOEA 4GVPA 3V2IA 3R5KA 4K6HA 5KKCA 1C14A 1JWBB 2W4QA 1BHSA 3G8AA 2IP4A 2OCPA 1MA3A 1UKZA 3DV0A 1F4PA 4WEQA 3IUNA 3NEPX 3VU3A 3A4YA 1TYCA 4CL2A 2AFHA 2PSEA 4HAYA 3FNRA 4JEIA 2Q4RA 2DP4E 2FKNA 4JYCA 4N6NA 4Q82A 1VIYA 4PSVA 2B36A 4H4CA 1QGDA 3Q41A 4LKOA 2JFZA 1R6VA 2GFQA 2HU5A 3HDJA 2FPUA 2HQRA 2ZBFA 1CNEA 2W8ZA 4GQBA 5BSGA 2NO5A 2FZVA 5ED0A 3ESQA 4Q3AA 4WK2B 2I6SA 3HHPA 4X1OA 1FB5A 1G2OA 3OO1A 4ZOBA 4UUOA 3U48A 2NVOA 4KYTA 4TSKA 1PSZA 3K8YA 2P77A 3RIHA 3KQNA 1YKFA 1NN1A 5LNK1 2I2FA 2XDQB 4N5LA 4EKDA 2NUBA 4Q12A 5HM8A 4GH5A 1RKXA 2VYND 2OAP1 5LPNA 3J80A 2VK8A 4MYCA 2IYQA 5F3WB 4PG7A 2NP6A 2VHWA 2YN0A 4DXAA 2ZJ5A 3EEFA 1UOOA 3HO8A 3UKDA 1CZNA 3K6SA 4J2HA 4JXJA 4KPGA 4RSHA 5IC6A 1XTZA 2EFDB 1VJ5A 4FCVA 4L8GA 4N9QA 3WP0A 1C3LA 4GE3A 3ZHCA 9ATCA 5KC9A 3QYPA 4YJFA 3JQ9C 3X2FA 5JXIA 2FSUA 2XIQA 2YC4C 2CLSA 4GG1A 4HC4A 5HS6A 3RRNA 4EI2A 5A6SB 4EW2A 2H2IA 1PWHA 2B5OA 3D3WA 3LCJA 4QELA 1QBGA 1BEUB 1WO8A 3PXAA 1SU6A 2XUZA 4IKEA 1AN0A 1YA8A 2CL6X 4GPZA 1SUSA 1XEWX 4AN0A 3H16A 4HDRB 1Y7IA 4O02B 5IBQA 4F71A 2B4YA 1AV6A 4DSOA 5JCZA 1RJEA 2AA3A 2Q21A 2ZSJA 2VDMB 3BK2A 2CDRA 3LUJA 5TQVA 1AIPA 3IE0A 1LLFA 5HFJA 3BS4A 3DLTA 1NJ1A 3OM9A 3EGXA 4F9TA 3EMBA 3MJVA 2BKXA 2Z8ZA 1Y8QB 2K5UA 4HWOA 4CR7A 2K2QB 3OHPA 1N1DA 5CUQA 5BPHA 2XCIA 4B6RA 4MHSA 2DWQA 1XT6A 2WQZA 3WOVA 4B73A 1HWYA 2F3UA 2HRQA 4Y1FA 4ALMA 5K6TA 7GPBA 5JBQA 4DA6A 3N76A 1SC9A 1T1SA 4BV8A 4ZO8A 1F1BA 4MV1A 3NIFB 5GJCA 3EDQA 3JWEA 4AROA 4XGRA 1WHTB 4BMSA 1PZFA 1K2WA 1JKIA 2IF2A 2R8BA 3GEPA 1FP1D 2GZSA 5LA6B 4PC1A 2FF7A 1W87A 4OLFA 3UMBA 4ALJA 2NVUA 4HEJA 3SP1A 1GZ3A 3UJ8A 3DO5A 3BZBA 1Z6TA 3I2IA 3KELA 3R24A 2ZBVA 4O25A 1GFIA 4PRKA 3JQ8A 3K2IA 2VDPB 4MGKR 3SX0A 4M1YA 2WB2A 4LVUA 5FO1A 1N8KA 2GT1A 2BDEA 3ETDA 2C2HA 2HWKA 2VAVA 2Y0CA 1ONPA 5EFOA 1EJ6A 1ICEA 2F64A 2H7XA 3E9YA 3NGMA 5HFAA 2Z8YM 5A3VA 5L7WA 1WXXA 5D51S 1YGYA 5B1IA 4DVJA 3R7NA 3ZWVA 4A6PA 1U02A 3SZGA 3NWJA 4BVFA 2WRZA 4F5ZA 3OJCA 3R4CA 4ZYYA 2IDJA 2WVHA 3CG0A 1QIDA 2JBWA 3IDAA 4WKCA 1CEXA 2J3MA 5LCXA 4CMKA 3R6WA 1YCHA 2AGVA 2G40A 4PEVA 2Y9MB 2C9MA 1XFDA 3GT3A 3B1WA 3JPWA 3NHAA 3K3PA 3AFGA 1HQYE 2GSWA 4AG5A 2ISQA 4U8HA 5KNDD 1GD1O 4BNLA 4C43A 2BEUA 2XGSA 3LUKA 1GFWA 2ENUA 4I81A 2VDQB 3GC6A 1ADFA 5IM4F 2RGYA 2F3PA 4ZOQI 1JR3E 1X6VA 4D3XA 4PVCA 4EUHA 3BEDA 1XP8A 3I2GA 4I4TA 3KU4A 4ZEWA 4FLMA 5CFOA 4HAZA 5I01A 5J2UF 3HKEA 4BLRA 3AEUB 3DZCA 3GZNA 2XR1A 2O50A 4TUYB 3RYHB 1QANA 5SY9A 5JT1A 4IPTA 1OKKD 1T26A 3EAGA 4L5IA 2YWXA 4GPIB 2IEBA 6CHYA 1N3IA 2YV4A 2V7XA 1SCUB 1UXOA 2ZJBA 5JVDF 2LXNA 4BNGA 1FDUA 2ZB4A 4KGZA 3PXBA 5H82A 3VHXB 4DCVA 1S2LA 1K8RA 1N9GA 2FQ1A 3B1KA 3C45A 1X7DA 4BZXA 4F46A 3KWFA 5IJ9B 2WSMA 4PZ0A 1MHPA 2UVDA 2OK8A 3MWEA 3ZCVA 2NWQA 2AF3C 1PGJA 3ASYA 3CWQA 1GL9B 1X7YA 4KO2S 1KU6A 1NXXA 2JGAA 3FZEA 4NMXB 3E48A 4Z7JA 2X0DA 3HXMA 1RIIA 1Z2PX 2OCXA 4RH3A 1RM5A 5JNUA 2UUAB 3JPYA 2RKBA 1LRLA 3A06A 1HDIA 1XCGB 2C2WA 1TJ3A 1UXGA 2H08A 3KFLA 2FA9A 4JKOA 1SQFA 2O1WA 1PDWA 4GUDA 3F9CA 1RNLA 5FBVB 1B8OA 1JAYA 2VH5R 4HUJA 1HOXA 4OJYA 5HZHA 1NR5A 2OCYC 4P22A 4AZSA 1CY0A 2G36A 5IUJC 1LSOA 1GUYA 4DLAA 4OYYA 2OG1A 2X41A 5KNDA 1DU4A 3N0RA 4I1RA 4H27A 1PR1A 3A2KA 3NT2A 1JA1A 1Z0UA 3K0CA 3QPVA 1AT1A 3UAGA 3GLFA 4YJGA 2HWUA 3PS9A 1I01A 3DC2A 3IHWA 4R9RA 1S2DA 5JLAA 1SK8A 2A1TS 2CWDA 1XZBA 5CVVA 3EDMA 3H1AA 5HWSA 4U3JA 3KR0A 1CZUA 2C83A 4QGFA 1D8TA 2ZAYA 1E2EA 1OKKA 1K8YB 2PY6A 3FYUB 3GRCA 3NXSA 3K4HA 2BKEA 4LDRA 3DZHA 4OB8A 3N8GA 3ZDXB 3H18A 5FNVB 3EY4A 4ZU1X 3LK6A 3GCZA 3ASUA 5HVNA 4REQA 5HUJA 1XQYA 1IHUA 4ENTA 5F35A 2DHRA 3CGGA 1CF4A 4M7OA 4PF1A 1T9ZA 1MGOA 1VLVA 2VHQA 4WZAE 2HREA 3QEMB 1AMUA 5EOVA 2N47A 2GAFA 1DTWB 1EM8A 2IHKA 2Q2QA 4HUQA 4F9EA 2POCA 3P2JA 3N6XA 2WZBA 3AYZB 2QMHA 4BV2A 4R69A 3UUGA 1T9BA 2C54A 3OZUA 4DR5B 3UGTA 1F20A 5K01A 1DG3A 1KL7A 2Z6UA 3SBXA 2J3DA 1OXTA 1XXLA 2Y1LA 4AY6A 3ROFA 1K7YA 3UOAB 4EIWA 1BVRA 1W4LA 1PQYA 1BCRA 5JPCA 1V96A 3ZU5A 4KXUA 2VATA 4F93B 5ITZB 3RS0A 3BJIC 2NXEA 2WD9A 1DT5A 2FPWA 4I55F 4Q3LA 3SZOA 3T9EA 3PXEA 3OHSX 2Y99A 3HO6A 1EZZA 3K9CA 1Z8FA 5IF9A 2IUEA 5CDUA 1B3RA 1JQDA 1X7WA 3TLMA 1TVKB 3HU3A 3PFKA 3OTWA 4UBJA 4JBXA 3RSCA 4FLFA 3R7AA 3ZOKA 5CT9A 4EJMA 3FMOB 2QPAA 2ETXA 1Z7GA 4NFHA 3KKQA 3KOZA 3MM4A 5CEFA 2ACKA 1C9DB 1KZ1A 3QFTA 1K8ZB 2Q3LA 3E22B 4J1TA 5DMHA 2JRCA 2ZAGA 4DMKA 2QW1A 5AVSA 1LCIA 2XSZD 1PFKA 2EYUA 1A9YA 2FJUA 4FNAA 4WTOA 4E21A 3DCJA 5HS4A 5LM3A 1RRPA 1QQBA 3WFZA 3JZAA 4TTSA 4YB8A 3RIEA 4GS5A 1KJQA 1TNDA 5TS2A 1R4NA 2JHCA 1Z0SA 2HCTA 4TV9B 3R4VA 3LA8A 4R9UC 1KVUA 2OD9A 1R18A 3VVBA 4E5DA 1M5RA 2DOKA 2DQ4A 3DQPA 5EHQA 5IKPA 2AKYA 4K6CA 4E03A 4G56A 3WL5A 1Z39A 4O8ZA 5AWFC 3ZX5A 1JIJA 4ZI7A 1XCJA 4PGMA 2F9FA 4YRDA 1GPLA 3SKYA 2ODTX 5JE8A 2XXAB 1W8DA 5ALQA 3FM9A 2QUIA 2GN4A 5FULA 3NTUA 3O7WA 3T1QA 3VSEA 4YP0A 5EWLA 3SYKA 5EJFA 5BWLA 4N8EA 4NCJA 1YULA 4GZ5A 3Q1KA 5KYYB 2QN6A 2E48A 3NUZA 1M6YA 3DDOA 2GA8A 2H1VA 3KYDB 1UZUA 1ZN8A 4OK6A 2BFAA 2WQ6A 2CL5A 1H3EA 4R8MA 4B3FX 5EE1A 3BWVA 4B3MB 3OPMA 4YDHB 3HB7A 3H3XA 5I8WA 3GQBA 4D1YA 3A6HA 2RHOA 1BWSA 3MJCA 3SQWA 2HMWA 2KS6A 2ZYUX 2CLFB 2I66A 3B9RA 3TDMA 1XELA 4TQ9A 4A82A 1CUFA 3B9BA 5TF4A 4H1WA 1SWWA 2O7QA 3ZK8A 4PG4A 1UJBA 3CV3A 3SJCA 3KUUA 2YIJA 1COWD 1RKBA 1Z5UA 3EVGA 2J1LA 2C92A 5FYDA 4D46A 2OZEA 1YB1A 3A4MA 4OREX 3QKWA 4LTDA 2WWGA 3CT6A 4YRCA 3JVIA 3UTCA 4CGYA 2JJ2D 1G59A 1Q0RA 2Q3HA 4A10A 1YMUA 1V3QE 4DRZA 4H0CA 3UO8B 2XSZA 4WFKA 4YAGA 1IOZA 4F9FA 3UPDA 4L5AA 2I9PA 3AINA 3TE7A 5DM4A 2QZSA 4WL0A 1R8XA 1PTJA 4KPFC 1VYTA 1Q7BA 4G4IA 4QOJA 4U2GA 4ZOLA 4U7JA 4LXUA 1A9XA 1G3UA 4LQDA 1U9YA 5AOBA 4HLQB 3EXAA 2P9GA 2Y4NA 4CL3A 5KYGA 2XJ4A 5EZYF 2PKXA 3BFKA 4PZYA 4ESHA 3WLNA 2VZLA 2UAGA 2VHCA 3D3QA 2DPYA 1EZ1A 4EEXA 1Q0HA 2RG7A 3H3JA 4OCZA 3GPDG 1T8YA 3MS7A 3EWSA 3SSMA 2VNHA 3BKXA 3V6LA 5EE0A 3C14C 2M1XA 3W05A 3PRJA 1B42A 1TQ2A 3OAAD 4OFXA 4OHKA 4XJTA 3V7NA 1YIAA 4JCOA 1LQ2A 3PFBA 1ZOOA 3P71T 4Y3UA 3VC3A 2E21A 3JYOA 2OQVA 3NWOA 2KJQA 3UJDA 5J58A 1G8KA 4RTOA 3DKIA 4NENA 4HBZA 1LWNA 4AZVA 3NYWA 3CPSA 4FSHA 4GSKA 2JHFA 2F7SA 4EGCB 3GEMA 1T8UA 2IXTA 1U3CA 4US2R 1WXGA 4LX0A 1IQPA 2Y71A 4RHYA 4WOJA 4AS2A 3O8DA 1A76A 3PCTA 3TZBA 3ZNNA 1FYFA 3A9RA 3T61A 4XIYA 1BN6A 2PTHA 2Q2NA 4QUBA 2J4FA 2TMYA 4O2BA 2PMEA 1OAAA 2ISSD 1LFDB 2D2XA 2B21A 5HQJA 2JJ2A 2JGJA 1VDMA 3NHSA 2JFGA 4BMPB 3BMQB 3Q85A 2X2EA 3BCHA 3EBPA 3QPDA 1K3UB 4XE5A 3GAAA 2EBWA 3UMMA 1J8QA 5BSRA 2YRWA 2IS2A 1CS0B 2PO5A 2PRSA 4MVYA 1A8QA 2OXEA 2IUSA 2QSUA 4A5SA 3A3NA 3GH1A 4JDUA 3REQA 4MR8B 2A1TR 3CUKA 1IZZA 5KSZA 1P7CA 3IAS6 5LD2C 1KI3A 1E32A 4PXAA 5KOYA 2WLTA 2WJPA 2VT6A 3QKSA 4UM9D 1Q91A 1BYUA 3EARA 2Z8YA 4FYXA 5AOVA 1NR1A 3N0VA 4FE7A 5DK4A 4UQLA 2AN4A 4YPVA 2GRUA 1J06A 3U4QA 1GG9A 4X64B 3H99A 2WUWE 3A3PA 1MEOA 1E2HA 2QMYA 4HADA 4XLLA 3ZDYB 1W75A 2GK3A 1KFBB 2XA2A 3OAAA 1PX0A 4DAEA 2XYPA 5BRAA 4LXIA 4IXNA 2WIFA 2GS9A 2QHXA 3F96A 2C2OA 4C7MA 1JR6A 3WKDA 3QVSA 2ZM5A 4FE3A 2NU9B 5I6DA 2OZKA 3BD9A 4C05A 2QQ5A 1NBME 4FSXA 4EMSA 1ILWA 4RMJA 1ZISA 1NYQA 2HK9A 4Q01A 4YH1A 1NJ8A 1I10A 1POXA 1Z0AA 3BE6A 2QAIA 3CKYA 3LF1A 1NRWA 2LNDA 2MR6A 3FYCA 1GU7A 1KO8A 2DR3A 1ST2A 4PHGA 1Y80A 3DH0A 3ESYA 3KPYA 4XM1A 2Q5CA 3L6EA 1VSUA 4KPUB 4OQMA 2A1IA 2J07A 1JLKA 1N0HA 2VJDA 3QJYA 4X1IB 4YO7A 5IJXA 3TNFA 2RJ3A 3D3EA 4XI9A 3BERA 3IA2A 3PYMA 3DSRA 4M8IA 3R5SA 1MXHA 1V4VA 3IVAA 5IM4A 4GZ3A 1V8PA 4C3OB 4LXHA 1L5RA 2ZATA 2VPYA 1T4BA 5AUPB 3BK7A 1JXQA 2BTQB 3KC2A 3C3KA 4MA5A 4Y8VA 1EYZA 3UYLA 3MPUA 3K1AB 4JB8A 2CVZA 3NGLA 2ADMA 4J1SA 1G98A 1TGVA 2FNAA 1FSZA 4LVCA 4J8PA 4P36A 4NU8X 3TTUA 4XVHA 3UC9A 4TS3A 3SX2A 4JL5A 4R84A 4MEBA 4B0OA 4Y30A 2WBLC 3TG2A 2O8BA 4JR0A 4OPMA 4FI3F 4BO0A 1JEQA 1XROA 1IHOA 4Q15A 3AR3A 3Q9LA 3MCTA 4KCGA 4L07A 4LEIA 4F92B 2EERA 2OZLB 3TRJA 3VYVA 3HYTA 3UK2A 3IUSA 1L4LA 2V7GA 5AVQA 2AOUA 4RVGA 1L4GA 4BO2A 2VP3A 2D0OB 1C30B 3Q0IA 1RYDA 5EHIA 1Z06A 1B15A 1RRVA 2EFYA 5ECDA 2SECE 4H7EA 3W8RA 2YBDA 4OFBA 2IXEA 3ONEA 2Z2IA 3TNYA 4BPBA 1YJBA 1H65A 4MYHA 3IQFA 4UJ5A 5HIIA 3ULKA 1A4UA 1ZMOA 4BJ1A 3R0QA 4KIWA 3RHSA 3C3AA 3MCZA 4QAJA 4R1PA 4JY7A 1VE1A 3D7RA 3L7AA 3S2UA 4BNFA 3EPJA 2UYOA 3OTQA 3Q0TA 3WAGA 3Q8XB 5J4VA 2I76A 1UDRA 2H07A 4LJ8A 4IXMA 3RG2A 1ZYUA 1JJ7A 2ZVQX 3AJ9A 1THZA 2YMLA 4YN3A 3EFBA 3S2SA 3LM8A 3A9TA 5EUQB 3SI7A 1RQNA 2OCBA 3F1LA 1ZC4A 3U49A 1PJ2A 2DLCX 1TZJA 1HBJA 4LY6A 5H5JA 1OWNA 1A1VA 5IVDA 5EJ9A 4KFTA 2I4RA 4O59O 1X7XA 4BFYA 4D80A 3DUFA 3F0TA 1ZNWA 3HUFA 1MAUA 4RA6B 2H7CA 2OQ2A 3NBXX 5IH7A 2WEKA 3G88A 1LPNA 2FP4B 2H1OA 1J21A 1WTAA 4JIGA 2IS6A 3IP5A 3DKPA 2O8VA 4HVAA 1EVEA 1W73A 5CB4F 2XZTA 1ISMA 1ZNXA 5C1DA 3I5AA 4F3CA 2PXAA 5KO2A 1V37A 3VU0A 4DNQA 1E0KA 4K46A 2BGJA 3AFNA 1OFUX 2TSYB 3FMGA 2EBHX 5B7GA 3A4NA 3QVGA 3K0AB 3CF2A 4RZ2A 4EY3A 4PZZA 3PNOA 4HKTA 1SBQA 2HADA 2RHRA 1BEZA 2H1RA 2JH8A 4NF2A 5KU7A 3T5DA 4NK4A 1C0LA 2O2CA 4GMKA 1TYDE 4JB3A 3PJDA 2BJHA 1Q0ZA 5JARA 1II9A 1LX6A 4MH0R 2C9CA 2H4WA 1H23A 2XNDD 2OGZA 4HB3A 5AKLA 4ZN6A 1U04A 3EW7A 1U6JA 3KUKA 3ROMA 4DY4A 4QVGA 2LIPA 2VF2A 3B38A 3MWGA 2PJRA 1J1ZA 3SJZA 2DWOA 2ZXFA 3T3NA 1H1LB 3CE9A 1GXSA 3DL7A 3ER6A 4CDNA 4EPTA 2OD2A 3I05A 2KM1A 3DMTC 1MO5A 2XGOA 1ZBQA 2P68A 3BRQA 3K15A 1RMYA 2GEFA 3ZH9B 2W98A 3DV0B 1KYTA 1XA3A 2FN4A 3NWBA 1S02A 1Y48E 4CKBB 5AFSA 2OXRA 2VPZA 3DGFC 2AFHB 2PH3A 4PC6A 1ZEJA 4LK3A 3CUVA 1DXHA 1K3FA 1Y3BE 4KO8A 5KCZA 1A5SB 1MMFB 1G7CA 2C04A 3P2YA 5EXDA 1W49A 4NK5A 3A10A 2P2YA 3G85A 3QLVA 4RK5A 4S05A 2OORA 2G8NA 2HF2A 3ZDCA 4EABA 1YR7A 1Z62A 1UR5A 2J33A 2XMBA 2Y27A 4NU6A 1SM4A 4WKBA 5AOAA 1Z13A 4LVNA 5CB4A 3LV8A 4QULA 2IEAA 3NTRA 1G1MA 2WA1A 3DP7A 3KJQA 1VG1A 4FD2A 1ZM4A 3IIIA 4R51A 5DOZA 3LIPA 3W3AH 3N9IA 5IH3A 1QFYA 1ZJ4A 4URYR 3RHZA 4BO5A 3A37A 4DSZA 1HEIA 1SCBA 2VN8A 2BL4A 4N03A 4AJ1A 1SKMA 1PVDA 3CYFA 2QTGA 1AB6A 4FWIB 4A0SA 3DE7X 4PAMA 2FSSA 5E2AA 3T3EA 3HEBA 3OESA 1JL3A 5KYTA 5HRCA 3S2ZA 4DDMA 3CLUD 5KEIA 5BWNA 1R74A 2JLUA 4NAUA 5H9WA 3A0RB 2VSFA 2IYEA 1JWLA 1VZ2A 5EJMA 4TTAA 3LVBA 1B8UA 5BRJA 2B61A 3JWIA 4MW5A 4D45A 1KO4A 4RMIA 4L08A 4YJFB 4GPTA 4GYWA 4W9MC 5B3KA 5JMTA 3NHYA 1E2PA 4JODA 2GKGA 3L1IA 3C4JA 3AL3A 4Z7QB 5C8ZA 1DQYA 3T95A 2HAEA 5B7PA 2VUSA 2X13A 2JGLA 1XKTA 4EYOA 4HRVA 4V0ME 4Z0HO 5FB3A 3EUAA 4QX6A 3FCAA 3HYRA 2Z3ZA 1GRNA 3I04M 3LC1O 4FHDA 4LDQA 5FPTA 4Z4CA 4TZ0A 4GD3Q 3PC8C 3VSBA 1LRKA 4BZPA 5B12A 5IBRA 1RWOA 1IMOA 2VPIA 4JA0A 4NE7A 3RAEC 2AUTA 1LLCA 4RTKA 2ZG6A 1S9DA 4TTJA 3EGXB 3KUDA 4DXHA 4TN5A 3OIGA 1RBZA 3H9QA 1Z12A 2FFAA 2JJ8A 1LBHA 2RHGB 3GJXC 1W1IA 2XUHA 5LDDC 5JS1A 3G68A 2F3TA 3ISTA 2D1FA 4GGPA 2I6XA 2RHJA 4KYIB 3ADBA 1USKA 2HRCA 4K2HA 3IR5A 4BKUA 3OFKA 1G20E 4MW2A 1JQJC 3GB9A 5D8DA 3R09A 1DDIA 1GPBA 3HJTA 3FZYA 3KFXA 3KQMA 2O7SA 3R1IA 4E46A 1TEXA 3HH8A 3ODGA 5K0CA 4TN1A 2PD6A 3HCPA 2CLIB 3QG5A 3MRVA 2IT1A 4G5OA 4GM1A 3BWXA 4IDDA 4MLZA 3V7YA 3JATA 1JIVA 2FUNB 4HB4A 2OD7A 3ORHA 4PONA 3EH1A 1SAYA 4FDAA 3LNTA 5ECYA 5AYVA 2NVUB 4NMMA 3IEMA 3GCWA 1YJ8A 4I8IA 4X7BA 5A4MS 2HA4A 4XIFA 4R71A 4FKZA 3JQ8B 4YGYA 1Q3KA 3W7VA 5LNK6 2PDAA 3ED5A 1YZQA 2VP6A 4Z7NB 3RYFA 1RJFA 4BX8A 1P9LA 4RACA 4G1MB 4C2BA 3RFFA 4YUWA 2BLNA 1WRBA 4QQRA 3RJZA 2CFIA 3S2YA 5JZOA 1M8JA 3QV1A 4GOOD 2FRVA 3DZKA 1YUMA 1M33A 3HJNA 5CDFE 1HYGA 2PS1A 1R64A 4YYZA 1ESMA 1XLWA 3ORRA 4G26A 1UOEA 5C8YA 1DE0A 3VVLA 4WCFB 1ZJJA 4YLGA 4MPTA 1SXJD 2NV6A 3NBMA 4R7TA 3OQPA 3IOCA 3OOYA 3WIVA 1LBQA 4TROA 3EZ2A 4JASB 4E13A 2VDRB 1HO3A 1NLMA 1Z7WA 3PPVA 3ZZ0A 1J5XA 4H1UA 4BO8A 4C4PA 2XVZA 5TEVA 4FKBA 2QTMA 4R0NA 4JOCA 1XZKA 3M33A 1IG3A 5LR6A 2ZETA 4FFPA 2KX7A 1YBMA 3SEQA 2CDCA 2FOXA 1R6TA 4DJAA 5IHXA 4P5EA 1MJGM 2QLMA 2A0XA 2E2WA 3ORFA 4BGEA 4DV4B 4U9UA 1IB6A 2GSDA 2BEUB 3T5CA 3U6KA 1QV6A 2Z6AA 4PWZA 3UJ7A 2VJOA 1W2WB 4C9BA 2ZB2A 4BNTA 1ULUA 2PAAA 2PSJA 4I4TB 4TKUA 3H2BA 2Q6TA 4LZOA 1E9BA 4P3KA 4YPOA 4S12A 2RJOA 1XEFA 3RIGA 3HKEB 3GZNB 2I3BA 3FVWA 4PPGA 4FYVA 5JAPA 4H31A 4LWZA 2A7XA 1YJQA 2FP3A 3G0GA 4HNGA 2QU7A 1U0EA 3EDOA 4R6XA 1QRTA 3MUNA 3VOTA 4IS2A 2JFOA 3LA6A 1KVTA 3BXOA 4HH1A 2YL2A 2VQSA 4U7FA 2JJQA 4EJSA 3ABRB 5J4HA 5K8UA 2RKWA 4R8VA 4AQDA 2HW8A 4JI5B 3HZRA 3L7NA 3N28A 2Q9UA 5FCDA 1UKYA 2AC2A 3Q3VA 2BGTA 4OMDA 4RZ3A 3RTGA 1XHFA 5B3JA 1HZZA 4ZVKA 2CBXA 3EEIA 4PIMA 1BGWA 1GA4A 2ICAA 2N3ZA 1ENYA 2X6TA 3MWEB 2OBNA 5IBCA 3AJAA 1W0KD 5ILGA 1BHJA 4FR2A 1CP2A 2PKCA 4AULA 4E6EA 3C7AA 2WU8A 2PU7A 1SXJA 3OE5A 2JHAA 3OE7A 1TW2A 3NB0A 1N5OX 1ZGGA 2BBTA 4H3KB 4X8HA 5FHQA 5JQGA 2OCLA 3KQUA 3G5AA 1UKAA 1JEJA 1VCIA 2ERYA 2YW9A 4A1OA 4E2WA 2ZWMA 3QRWA 1NI3A 1J70A 4P7KA 1YFZA 1KNXA 1SB9A 2IUFA 1F8UA 1U3WA 3N87A 3ROPA 2XCOA 5JATA 3LBNA 2CHEA 1P61B 3WGOA 1B6TA 1M8PA 1AKTA 4TRNA 4YUYA 1VLZA 2QD1A 1M2GA 1KPGA 3DT9A 4I3HA 1GUDA 4KXVA 1EFVB 3D0QA 4M46A 4RK7A 2PX6A 4EUEA 4YV1A 3K71B 1PZEA 1XGKA 3GLFB 4JI4B 3BHJA 3P9ZA 2GILA 1JG4A 1Q21A 1Z0IA 1Z5OA 1DLIA 2QN3A 1X1SA 4MZDA 1KDVA 1TM3E 1XFAA 5J2UB 2JHGA 3NWEA 3W4IA 2ARKA 2J9GA 1EUDA 3HVKA 1RYBA 1I32A 1K63A 4PHCA 4PQRA 1MRSA 5G2OA 4BQQA 2EBFX 1OW3B 3GELA 3O38A 2Q8PA 1TUBA 4U6QA 4UE6A 4WFIA 1NQUA 3DEIA 5HUQA 3EIFA 3VR0A 1MU0A 2V97A 3GMDA 3Q8LA 4G85A 3M1AA 5KKAA 3DOCA 4ZHQA 1VGQA 4R54A 5K3FA 1GM5A 2O3TA 3CXRA 4UOZA 3IEKA 5BYKA 2QZZA 4REQB 2J5RA 2GHTA 2Z9DA 1A8HA 3CO0S 5A05A 1Z68A 2GGSA 3TTSA 3W8FA 3F4LA 4D4JA 2COKA 2NO0A 3RWBA 2ENWA 3O9ZA 1R4MB 3G2LA 4IO0A 5E4FA 5CM2Z 3C87A 4E7OA 4YT5A 1W0KA 4YRSA 2HQBA 2R8RA 2G17A 3QX9A 4LMRA 5DXAA 3SC2A 1AN9A 1EM8B 1IQRA 2ZE6A 3FLBA 4FEYA 2H92A 3RTDA 3IOEA 4BTVA 3QPBA 1QX4A 4U5QA 4AZWA 2HV8A 2PX3A 4NDZA 4B4DA 1KYXA 3SR3A 2PQ2A 2DZDA 3HVIA 1YJCA 1ZD1A 3X1XA 2D00A 1FMJA 1NI4A 4KR2A 4KC0A 3L8CA 1Q92A 2XBUA 4MV6A 3SCZA 1JJAA 3CVUA 1MC4A 1WULS 1BCRB 1WB4A 2ATXA 2FG5A 2PK3A 3GGSA 2C5BA 4OYLA 4MVXA 4K8RB 3FYSA 3FKQA 2Y92A 1XZQA 2X1HA 3PNLA 1JHYA 3MELA 4KXNA 4Q9AA 4C0JA 5EZ6B 5JDCA 1Z3CA 2DPLA 1SVWA 1E2DA 1ZGAA 4X8OA 4RPCA 1X7WB 1A8IA 3WO0A 1SC3A 2QN9A 3EFOB 3DQZA 4QTXA 3MMSA 1XAGA 4TWZA 3WDKA 1RQ2A 2O06A 3AJRA 3ET5A 3X3HA 4U7PB 1T1RA 4B31A 2BGRA 1OBFO 2RMKA 2FR8A 3BICA 1MTOA 4BVHA 5GZ6A 2QX6A 1CJCA 1L7EA 4BJHB 4YDRA 3PV0A 3E9CA 2WMOB 1OYVA 4YTEA 5BW4A 1P8JA 3ZE7A 1RC0A 5G02A 4BFTA 1BROA 1SXGA 4GUAA 1PW7A 3DVRX 5D3MA 2FQXA 1WP9A 3QNUA 4D6XA 2REQA 1I8TA 1PO7A 4MUFA 2AFIE 1G18A 2FN9A 1DRKA 1R4NB 3HNRA 4BO1A 4D3SA 3PDWA 4L4XA 3HNOA 4L15A 3TJZA 4IIEA 1SC6A 3FUUA 3LNCA 1E5DA 4LJ6A 4UM7A 1JDJA 1K2VN 2F1OA 3DDZX 2H4XA 3CTPA 1FEZA 3EF3A 3ESZA 3P2OA 4Y2JA 3V97A 2YZ7A 5IWCA 4BMCA 4E08A 2R00C 5F1KA 4NE9A 2QE7D 5KCMA 5DMXA 5EWLB 4CZ2A 3QBEA 2COEA 4OIFA 5LUBA 1P4RA 4QTTB 2QAGA 3JYNA 2RKOA 5E1OA 6Q21A 1I94B 4ZODA 3S5UA 2X4DA 1Z6GA 2JJ1D 3AMVA 3OFSA 4IH4A 2RCYA 3KXKA 3KVNA 2ZBEA 4G5HA 4D9CA 5D1HA 4NU0A 4AUKA 1M34A 4JBYA 4A0RA 2HHJA 4N3CA 3DWIA 1C4KA 1V1RA 3GQBB 3QPCA 4WPGA 1Q1BA 3IO5A 3TPZA 3IP3A 1P9WA 3DTVD 1OBOA 1CUAA 1TJNA 3IUPA 4HXEB 2V7EA 2MYTA 1QM5A 1ENZA 1RZUA 1T5SA 2V0CA 1U28C 2VH2A 3Q6MA 2IOFA 1ZXBA 3C5VA 5CB0A 4PC3A 4FLEA 2ZVJA 2AYZA 2VJAA 4UNSA 3FETA 3OJ0A 1NVWQ 3EPRA 3F4KA 1YUBA 1KY3A 5T3UA 1QWSA 1Z4QA 2HTFA 2ZYDA 4IBOA 4XW2A 1OXMA 3V48A 1TTQB 2Z4RA 1AV7A 4WCDA 1K88A 1JR3D 4TRRA 4D42A 3DKRA 4S1VA 4AJOA 5KC8A 3WQHA 2YUTA 3GLHB 4OFZA 4RJLA 2O7NA 1BD3A 1N5LA 1NKVA 2ZE5A 2YV1A 3KZNA 3T0IA 5KYKA 4QFDA 1KFEB 2UU9B 2A0FA 3NAZA 4ZOLB 2XT6A 5JC8A 4D9KA 3FR8A 5F23A 3AONB 2D2VA 5CX4A 4MW7A 5FEUA 2X19A 2GFHA 4JLOA 3LXRA 2QJFA 4CEHA 2R0QC 1UQUA 1YH3A 3EIOA 3IEIA 1VKNA 2EQBA 2UYCA 4P1ZA 2XOKD 4K9RA 4PLCA 3V4FA 5HXAA 1AO3A 3NAQA 3P0IA 1DV2A 3C3WA 1NASA 4PCVA 3R8CA 4ALNA 1Y3HA 2ATEA 1IDN1 3W2TA 2J3EA 4DIBA 4MTCA 2JJ1A 2Z8XA 2XYVA 3DVAA 5LU8A 3A9UA 1TM2A 2UYGA 2FQWA 3I04A 4YT4A 4NENB 3ZIUA 3TB6A 3QYJA 5G1OA 5LLDA 2R62A 1XB2A 3HBAA 1T3SA 3RHFA 1A7AA 1GNPA 4PX5A 4D79A 3SC3A 1P17A 1L5YA 4IIJA 2I4TA 1GYQA 5K8IA 5DJ5A 4XFDA 2H85A 1O8BA 5TX7A 5KWVA 3DTVA 1XUOA 3OTHA 1J5EB 4RTLA 2CKDA 4KBFA 2BHTA 3ZXSA 3KSMA 4DPKA 4ETMA 1V5GA 3I6QA 1ABFA 3IPCA 1V9SA 4FFRA 3V8QA 3E0XA 1SIWA 3DMPA 1HI9A 2OUKA 2JCXA 3M4JA 4MV0A 2KB0A 4FCCA 4B6EA 2Q5FA 3FI0A 3PTLA 4IOKA 4YLEA 2OKGA 3A04A 3JQPA 3VQTA 2X3FA 2YQ4A 4AX8A 1JHVA 1W59A 2UZ3A 2ECQA 3TW4A 1O0CA 3R44A 4BVGA 1L4MA 2BONA 1GGFA 2JFXA 2XWSA 5AJUA 1O0SA 1JR3A 1MH9A 3E8MA 3LT0A 4OU4A 3CRQA 3LPLA 5FRDA 3FNFA 3U1TA 3TTYA 1VCNA 2QS9A 2YBEA 1OZGA 1HDRA 4FYKA 1E62A 3UJ6A 4IWYA 3PEUA 4B79A 2QLJA 5JC1A 3REQB 5EMJA 3QA9A 1X3LA 2B30A 2NUPA 5KQSA 1Q6YA 4X1YA 1TQDA 2YHIB 2OBLA 3KHUA 2QQ0A 1Q77A 3KSUA 4QDTA 5ESWA 5KREA 3IBSA 5B1YA 3R2JA 4ERXA 2QXTA 3V8BA 2R25B 5F2KA 2G25A 3NOOA 4Z9AA 4UU7A 1UXIA 1SU4A 1QK4A 4YXWD 1EGQA 2XOKA 3NETA 3F3KA 3BDAA 1FMFA 2EFCB 1BDJA 1ZI9A 3N39C 1GR1A 1NUPA 3HJHA 4FCTA 4KSCA 1MNAA 5ULLA 2I8AA 2P4QA 1MC5A 3A6EA 4J0CA 3O1JC 4OGLA 4X97A 4ENRA 2R3SA 1F3LA 4EG6A 4INAA 3OQOA 3DLBA 2MSLA 2HC9A 3BMOA 4ZQBA 1P6UA 2Z3WA 1K6IA 1N2CA 2NQ2C 4U3JB 5H80A 4IOMA 1MJGA 1TM4E 1J7KA 7ADHA 5AKKA 4QYIA 1FJGB 2AC4A 4G09A 4F72A 4JCCA 4TLEA 3CBGA 5F77A 1AKYA 5BUSA 3ETJA 1KXJA 1F8XA 4OHFA 5JANA 2B83A 1KQOA 1TFUA 1A72A 4GP6A 1QHIA 3TW8A 3GYBA 4EW3A 1EXNA 2K2WA 4JI6B 1EWQA 5DVZA 2HQ1A 1G42A 3B1JA 1JE0A 4R2HA 3JCZA 3L6BA 5L53A 3A2LA 2G1UA 1XG5A 2J6BA 3CY6A 4DCOA 4R98A 2VF8A 2NMVA 1NF8A 3O1LA 3AF0A 3ID6C 5EIEA 3THOA 2EKQA 2BCGY 6GPBA 1LKZA 3QLUA 4Z51A 1PT7A 4YMVA 5KAMA 1EIZA 5ALHA 2ZRAA 1ORVA 5IUKC 3TQOA 4ZDWA 2QTHA 3EQZA 4OQNA 2CUKA 4V3BA 1H69A 2VDNB 1I2CA 2CC2A 1W85A 1NNI1 2ZZMA 2PRZA 2NO1A 1Y1LA 3FFBA 4RD6A 3JAMA 4QTZA 3ZIAD 4UM9B 4P38A 2AQ8A 3U1BA 3BJEA 3SLGA 3ADCA 1RJ9B 3WYBA 3KOXA 5AI9A 2AJ8A 2AOUB 4BFVA 1U7ZA 1X74A 5JASA 4YXWA 3OZEA 3S4YA 4FFNA 2G3YA 2R4TA 5DBIA 3ZEAA 3ITNA 1A82A 3IXLA 2LTAA 1V16A 2H1SA 3X44A 4E5KA 1T0IA 1OH7A 1GZ4A 1NULA 4DJTA 4C2TA 2CXQA 3LPMA 1TX4B 3UGJA 2AZTA 3DM5A 4L85A 1P2TA 3HADA 2BKUA 4B82A 3MBKA 2O2EA 2ANBA 2EGGA 3WL4A 4TLMB 2HBQA 4QUKA 3FCSB 4IXTA 4ZCLA 5HKKD 4AICA 3DW3X 3LDHA 5EKXA 4R01A 5KNCH 4DLZA 1LTKA 5EXTA 1ND5A 2A9FA 4MPRA 1AHNA 4GC9A 4OM7A 4QPZA 4BNIA 4BP3A 3EZXA 4EKEA 2EJBA 1FW6A 2F17A 4D9FA 3OJFA 1KZHA 2GEJA 3LOQA 2ASVA 2O7RA 4L8WB 5LSAA 4PSUA 2KSQA 1JEOA 2H52A 4I3FA 3VSAA 2X5XA 4LJ4A 1E66A 4R1NA 4YMUA 3BGDA 2IDMA 4CETA 4WJZA 4U8GA 1X7XB 1YCDA 2YV2A 3DUFB 1TEHA 3G0DA 3Q2IA 4RVSA 1V7ZA 4PSCA 2JLZA 3NU1A 1AQYA 1W5AA 4IJVA 4RYDA 1KAHA 5AKGA 1CJBA 1U11A 3KLMX 3AEKA 2J0UA 3KEQA 1B0UA 4KTTE 4FXPA 5JD3A 2BM9A 1W5TA 1GPH1 1JN0A 3BM5A 1UBLS 2NSJA 3KZCA 5EFZA 1D0SA 4Y67A 5A0VA 1KYZA 3MTDA 4B2YA 2I2XB 2WPNA 1R0BA 4PYOA 4GEKA 1MQ9A 5ALXA 2PWPA 3ICPA 2O8FB 4HNSA 4RKQA 1OA1A 3EXHC 3WIOA 3QVGB 4Z53A 4C4ZA 1JG6A 3DP9A 3PEEA 5H7XA 4PCLA 2X77A 1V8OA 4Q21A 1G6Q1 3G0IA 3P0RA 3NLLA 5DNAA 5EMMA 1QVVA 3I12A 4RU1A 4BCCA 1VLLA 3GPCA 3WWYA 2HRZA 4MP6A 1P60A 1OXKB 4HYTA 1XPOA 2MT9A 4JBLA 4XSVA 4XA8A 3C4VA 4CTJA 5D6NA 3DO8A 1QUFA 2BISA 4ZOEA 4X9XA 3PQEA 5LDGA 2DFLA 2WT8A 4BJ6A 2DT5A 4CMBA 1VL5A 2QQGA 4QT4A 4B7AA 3NC4A 1H0HA 2GO7A 3GFQA 5HKKA 3AYXB 1GXSB 5CDTA 3M4XA 1MT3A 3LF2A 1JMKC 1G5PA 4OHCA 3A31A 4IGAA 4OI1A 1KR5A 4FMCF 3PHCA 1WXHA 3DZIA 3QKRA 4Y9DA 4OU5A 2QM8A 1UKCA 3K32A 3OC0A 5DPMA 1DAKA 5K3AA 4UUPA 4TYYA 2Z56A 4TTIA 2P79A 1QHYA 3RS5A 1JDPA 1DEXA 2VZ0A 1KRHA 2A35A 2JA1A 3BCSA 3UCEA 4LV6A 3VKUA 4II3A 3QXGA 3WRXA 3S2EA 1U8FO 3VOBA 4LECA 3OPQA 5ILQA 2P41A 3P4YA 2FZKA 3SAJA 1WQ4A 2H1CA 2J4CA 4AY3A 5CB4B 1X87A 2B3DA 2FW9A 4F60A 2W70A 3OTOB 3HFRA 3NBUA 5AI0A 4G0XA 3UWKA 5BWMA 4BKMA 1ZMTA 1CIVA 4W99A 3RUAA 3Q7QA 1E8NA 3GFPA 2W6OA 3ZZ1A 1TTPB 4LC0A 2FG6C 1EGAA 1AGNA 4JX9A 3TSZA 5LMUB 1XLTA 3L41A 4YT8A 1C3OA 4I4LA 4KVZA 3WI7A 3EPLA 4L2IA 2JLXA 4JT9A 2FKAA 3IPYA 2VLBA 4AJPA 1CTQA 2YOHA 3PX3A 3U9SA 3UMSA 4AIIA 2HDHA 4AS3A 2H54A 1Z4KA 4BKRA 5LYJF 2TRSB 2VPWA 1QHHA 1UZNA 2QRVA 1N6IA 3DZBA 5EUBA 1HFEL 4UXIA 2EIXA 1W5FA 2FW7A 2I80A 4YMWA 5EL0A 4UNRA 3RVSA 1E9VA 1P29A 4S2UA 2GAJA 2WPDD 3BTSA 4ZKEA 3WV5A 4DGQA 5C37A 3GLGA 1WD7A 1KH3A 2ATVA 2G1JA 2KHZA 3H5AA 1HFWA 4L73A 1EXVA 5IAEA 3AUKA 1R0WA 2D4AA 4MAAA 5F3DA 1RCFA 3G2PA 4ZJZA 5I7UA 3IHKA 4NZNA 5JG7A 2CFTA 4WBNF 1CR4A 4NMHA 1GTMA 3OZTA 3N7TA 4EG1A 3PA6A 3NDPA 5C80A 1THMA 4H18A 2HMAA 1YRAA 2DBRA 2WB4A 3B6IA 3CE6A 1ESEA 3IHLA 3ILYA 1NBMD 3JAKA 3NNDA 4JB2A 4LE0A 2R1ZA 3K8OE 4TXNA 3ZD8A 2HOQA 4B7UA 3LXMA 3WGHA 5JZBA 3P0FA 4XDGA 3SLKA 4GRAA 2JLVA 3SMQA 2FRXA 2VC2B 3ML1A 1T0UA 2Y0DA 2Y1DA 3KJHA 5G0WA 4XQ9A 1XO1A 1DEKA 2IL1A 4F91B 2JCSA 2QRQA 2VJMA 2WA2A 3SEZA 3T1VA 4OXQA 1WM1A 3AOEC 4KITB 1KSHA 1E2KA 2R86A 3CNOA 4J7AA 2UZAA 4TV8F 3JATB 4QBHA 1CHNA 3LP8A 4BO9A 1RWBA 5BT8A 1ZVVA 5CB8A 3BTUA 1OF1A 1GN9A 3L7DA 5EHXA 1I3KA 2IS4A 5MN4A 1WMEA 4J9UE 2VDWB 1Q11A 1WY5A 3NIGB 3WRWA 4XVRA 4E15A 1TF5A 1O3YA 1CK4A 3VHRA 1JE1A 3RYFB 3VPHA 4RQUA 4MRRA 4UEKA 3ZQ6A 2V0NA 3N2KB 1XZJA 1X38A 3U80A 1VSVA 3C85A 1NOKA 4OXXA 5A5DA 2ORVA 4P4NA 3V8NA 3SHOA 1SIUA 1XXHE 2QMOA 3T4EA 5C8YB 4RO0A 5A2GA 3NGXA 4O4HA 1L5HA 3GHYA 4ZGWA 3EPHA 2GBFA 1XEXB 2EX4A 1DTEA 2WPDA 3SYTA 3NDJA 1H5UA 5D5HA 3QXHA 3NIBA 3VKHA 1XDDA 2ZQZA 4UNNA 2CHGA 1HL3A 2H5LA 4BN5A 4OOFA 3KEOA 4UHEA 3EC1A 3UBMA 5K0BA 2C2MA 3IUJA 3HV0A 3AW9A 4KMRA 2NZUG 4Z54A 4Z7OB 3RYIA 3RWMB 4N6GA 2DTDA 5IVIA 2PUHA 2GNAA 3EVTA 3QYAA 5F7JA 4MKZA 1KOLA 5CTAA 3OT1A 4DEXA 1NBMA 1P18A 4JGIA 2VTDA 2JF0A 4II2A 3NYQA 3SS9X 4CMJA 3TLAA 1A0OA 1RHKA 1T2EA 1E1DA 1U98A 1VGVA 1O5IA 2GZDA 3DC7A 3R0IA 4TKUB 4IEEA 3WLKX 4GP9A 3V8PA 1NJFA 5HSGA 1IQUA 3ZKWA 4FC6A 4O08A 2PUCA 2RH9B 5AVZA 3ISVA 2XIJA 2JKVA 4L4RA 1HM5A 1BOOA 3Q7SA 2DWUA 1E0DA 2X1LA 3GGDA 3NP7A 3TPFA 4B7ZA 5JJBA 4RV9A 1F7UA 1V4NA 1QUEA 3I9NA 1CD5A 4R1UA 3T34A 3MWDB 1AKEA 1NZDA 4QOGA 5I4IA 2IBSA 2ATIA 4EJSB 4DR4B 4GLJA 1RAGA 4LYJA 5BN1A 1LU9A 3T7TA 3UV6A 4LOLA 4CPDA 1XPUA 2AKAB 3LY7A 2Q1SA 3BFJA 4MYRA 3RQIA 1M2VA 2HMUA 1MO3A 4BVBA 1CVLA 1NXOA 4Y18A 2CJWA 3ZHRA 4YJ3A 1H94A 1Q7CA 1IBMB 1Z29A 1BHQ1 3I6ZA 2HCJB 4TKLA 4AKSA 4EH1A 1BMFD 3VYUB 1ZLXA 4BLPA 2IW3A 4KB5A 2FUG1 2QDXA 2QV7A 3TI9A 4F3KA 1DHRA 1A7JA 2ZUUA 2QYSA 4IYRA 5ARDA 1SXJB 2UZ4A 4NHOA 1GTSA 1IAQA 1U90A 3VFDA 4LGCA 1YGPA 4FFBB 4KQJA 3I2KA 4R2LA 4E4TA 4YUXA 1I51A 2HV9A 3GIDA 5IRCD 1H2XA 1ZM9A 5HJ5A 1TF7A 3OCVA 2I62A 2X5KO 3OU6A 5G4LA 2F4VB 1Q1NA 4CL8A 1B1AA 2FSHA 1XCOA 5CX1A 2JL1A 3C16C 2B1IA 3K4QA 1TD9A 3QITA 3URMA 3WWEA 5EYPB 4F1KA 4CIWA 3L4JA 3A1SA 4AYXA 3PXXA 1QP0A 1QGUA 4M22A 2FPIA 2WAYA 2ZSDA 3DR5A 4JIMA 2H9IA 3T5BA 4F45A 2YZGA 5F76A 3VYWA 4RDXA 2HI0A 1ZEMA 5CFZA 2Q8QA 1QIFA 3UJHA 4HNTA 2EGHA 4EFNA 2BI8A 3GBSA 2ADFA 2A5GA 2WM8A 3ONDA 1SHZA 1NUAA 1U7XA 3ZHVA 4MUJA 2IYTA 1GNLA 2YWCA 3PWZA 4KZPA 1KDTA 4RCVA 3KVVA 5HZGA 1JA9A 2CCKA 2PMDA 4XTCS 3RI3A 4CM4A 1M5TA 3GI1A 1TUBB 3SOZA 1Z4JA 4YRBA 1D09A 1CRQA 4JR1A 5KTTA 5LXTF 4FYJA 3OX1A 5A3SA 1Y3DE 3A0UA 1IEXA 4M37A 3DFUA 2YFYA 3HKDA 3RG8A 3NRCA 1PEDA 1K9VF 3HKBA 4RQBA 2F1RA 3O2JA 4R2MA 2NPFA 1XQ9A 2VS1A 5FR2A 5JNWA 2CXNA 2RCNA 3AW8A 4PO1A 1YHZA 3EE6A 4A5OA 2ZI3A 2WHYA 4D9EA 1U1FA 4WOCA 5FT9A 1CJUC 3DHWC 1EDBA 1BMFA 1VIAA 1UWVA 4PY2A 3QFCA 1E61A 1G6KA 2ODEA 3NIDB 4ZC1A 4KGVA 2DB3A 2JJMA 1Y9DA 4BMVA 4CI0B 5JJIA 2CD9A 3AK4A 4I50F 3IUYA 4TMYA 3FMVA 1A04A 4UHCA 4ONEA 4Q4JA 2J30A 4QSMA 1NI4B 3PL5A 3EOBI 3VR4H 2AOVA 2A92A 1ECBA 4E14A 3BE5A 1U99A 2XE6A 4DC1A 3ZLUA 4D0SA 4F12A 2BEJA 4DCNA 4UXJA 3OM8A 1L7AA 2INGX 1U0TA 5JH7A 3ZI7A 3VAZA 3RUIA 1KEKA 2GVDC 3AIIA 3GP3A 4TMZA 5DM2A 5J5VA 2JLQA 4EP1A 3M6XA 5JXGA 2IEZA 4PLYA 2G83A 1TC1A 1GR0A 2E4VA 4EQZA 5KJ1A 2ZTUA 3R7LA 3D4BA 4C7XA 4EI8A 2LV8A 3CEHA 4POAA 5TS3A 1CJVC 1PJSA 4Y1RA 5CAEB 3D4PA 3T52A 3UM9A 3HTXA 3A1EA 3ROGA 2QVYX 1H9BA 2AJLI 2GJKA 3W1EA 4LYEA 1ISHA 4MWSA 4PZUA 2VK2A 3O21A 2ESRA 2HCBA 2IYFA 3PD0A 2YWRA 3GP8A 1J8YF 4J76A 3OEWA 3J7AC 4PXSA 4OP1A 3R5JA 4EY7A 2OCGA 3AVPA 1OLSA 5IDWA 3ZHSA 3Q72A 5KWJA 4G86A 5LXTA 5D3MB 3A3YA 3JYQA 2OOSA 1J0AA 1L4NA 1LF0A 1R2QA 1YJXA 2REQB 1J97A 1M10A 3FWZA 4IIBA 4Q3KA 4ZV9A 5I8ZA 2Q7XA 4GKAA 4OBXA 2RGNA 1QQ7A 1EGVB 4EHFA 2XCRB 1RM3A 3PHGA 1EX1A 2VNJA 3G17A 3EZ9A 2QB5A 4W5OA 3I1JA 3SZRA 2CVFA 1RPTA 3KKMA 3ANTA 1SCNE 3AL2A 4X20A 2IPOA 1TB4A 3NI2A 1TLTA 1U9JA 4QEZA 4UCQA 4XOUA 2YN2A 1MOSA 1IDOA 1T9HA 2QVGA 2I2AA 2VR1A 2ZIEA 2HH9A 4IX1A 4YK7A 5EKDA 3U3OA 3W90A 5J43A 1XAHA 5DK6A 4BAGA 3OQIA 4ER5A 2QAGB 1DRJA 2OCDA 4DEYA 5K3EA 5JEDA 4MUNA 1AC5A 4PR0A 4DPLA 1TA9A 1TAQA 1L5QA 1RWVA 1ZGCA 2WF8A 5DYIA 3H7IA 4UFPA 1XTVA 1P75A 1VI2A 3A4TA 1M34B 3EMDA 3CJTA 1V1RB 1ADJA 1E3IA 2VSYA 4Q3OA 1UAAA 1NF3A 5CFNA 3OMLA 1I36A 4CMEA 3CSUA 4MARA 3UT5B 2D5IA 4TL7A 3U7QA 2YWEA 4PLWA 2I1LA 4Q3NA 5C5DA 3K2QA 1UEJA 1XTRA 3GLSA 1N9KA 4HNVA 2D1YA 4D26A 3V80A 2AUNA 2DCMA 2PGOA 3KQYA 1GU0A 3TI7A 4JI0B 1E3MA 4F4DA 3K9BA 2RGEA 4N8DA 1NVMB 1YC2A 1UBMS 3DMYA 3HGTA 3R74A 3VZDA 3ZKAA 3P9SA 3O8BA 4P0PB 2GHIA 3JD3A 1ZK4A 3KV1A 2WWWA 2OXCA 2M6KA 2ZKLA 1NBWB 3ZGZA 4GLBA 3KTAB 5T41A 3TDKA 1CR2A 1JP7A 3HCBA 2RGCA 3R3WA 3SNKA 5B2FA 5ICMA 1SELA 2JGFA 3VRHA 2PZKA 3AB7A 4DWOA 5FV4A 4G0OA 2Y9PB 4GKVA 4BP9A 3OOWA 3M6VA 4RZSA 4UHFA 1SRQA 4P9NA 4GI2A 1K6MA 4ZI2A 2UZ1A 3RVBA 5JZVA 2PLWA 3THWB 2EZ9A 3OM0A 3WGYA 1U9ZA 1W0CA 3EZ6A 1E3DA 1QYCA 3CGWA 4MXDA 3BF7A 4CEHB 1ECFA 4NYMQ 1L1FA 2LKDA 3U13A 3RU7A 1AY0A 3THXA 1DAEA 3CUSA 1WPGA 5BW8A 1Y3FE 1TGYA 1APBA 3IE1A 1NTOA 1YT5A 4DTIA 3RVQA 4GDFA 1INLA 4GWLA 2C88A 4BE9A 3EA5A 5C5IA 4K3UA 1M75A 3DMNA 1G8FA 4AKIA 3DVAB 1DEOA 3BQ9A 1HEUA 4B3XA 1C1DA 3EG9A 2HHHB 2V4UA 1KIAA 3GJTA 1Q57A 4OHPA 5B2EA 1URPA 4BFSA 5HOEA 4A73A 1BEEA 2GBGA 1JJFA 3M49A 4FUQA 1YDWA 2GX6A 3FYDA 1SXPA 1QV7A 2P1RA 2Q4EA 2QN8A 3ZI4A 3OQNA 3GNQA 3QX3A 3E9DA 2UZIR 3DTVB 5IJZA 1Y4AE 5DNEA 2VI5A 3C3YA 4M0EA 3U7RA 2QR5A 3BQNB 1JYSA 3PSHA 3MFQA 4H0NA 2YOGA 4MAFA 1HLPA 1VZ3A 4CLRA 1PK9A 5DASA 2RJNA 2QROA 4PYIA 2CYAA 4R8KA 1N7IA 1QYVA 3VZBA 3WGVA 2Q9AA 2JKYA 1KZYC 5EPOA 4KE7A 1CDOA 1UT6A 3K4PA 2C1XA 5CGQB 4BV9A 5HTOA 2NZ2A 3FIUA 4WZBA 3DMFA 4G0NA 3DAGA 3AF6A 2P91A 4ID9A 4W5TA 5AK0A 2QG4A 1JDUA 3O3MB 1GRQA 4IXDA 5AI4A 3W77A 1ZPDA 2WT9A 5CXSA 4QATA 3CKLA 1PG5A 3W79A 4CWAA 2D2EA 4QRIA 3EYWA 3AM4A 4QG7A 1EEXB 2NUPB 2PMKA 4QPCA 3WIDA 5BURA 2CHFA 3CKMA 4DR2B 3NALA 2ZWVA 9MHTA 5GV7A 2HR1A 3OFVA 2C3PA 3SZUA 4QXOA 4C3ZA 3LQQA 4R05A 2EAUA 3D4LA 2PV0A 1ZU5A 3ETEA 5KSWB 2DG2A 1M8GA 1SCJA 3WQRA 2C4WA 4YGXB 3F8TA 1ULBA 2GYUA 3CVYA 4MPPA 5FXMA 5D5PA 3ROXA 3IP7A 1E3TA 3WLHA 2ID9A 1R8JA 4WBXC 2VEDA 2QIPA 3I72A 4Q1CA 1NMEA 5CMLA 4CLEA 6PFKA 1NDQA 1WEKA 3GJ8A 1JRLA 3JQAD 4MUEA 2Y6UA 4KN9S 2CLLB 2UUBB 3IAAA 3BMOB 1MJHA 2J46A 2BHSA 2C3MA 4EFLA 2PUTA 3QUTA 4RY2A 5FOVA 3OZWA 4D9HA 3PC3A 4QYIB 2BFWA 2AVNA 3HCNA 2B1RA 2XYGA 2C9OA 4IDCA 3OE1A 4YX9A 2HFKA 4FT4A 3S81A 1DI0A 2GKSA 2LZ0A 2EWMA 4ARBA 1MZPA 2GQ0A 3QI2A 2DX7A 3RVDA 5HKBA 3LWNA 4RD4A 3TW8B 3R9WA 3TR6A 3OZDA 4RWEA 1NE7A 4RTPA 5AK5A 3TIVA 1GHTA 3RJMA 5REQA 3T7RA 4NE2A 1ZK1A 1S01A 1N6OA 4M9ZA 1L5VA 4UHBA 4KKXB 2X0EA 2EZ4A 3QEOA 3OF2A 4EEZA 4KMOA 3LUHA 1XPJA 5CFRA 3N8NA 3DT8A 5IXJA 2VRNA 5H81A 1Y8AA 4KL8S 5I9IA 1C7QA 4NWIA 3FG9A 4LWPA 1Y6RA 1W85B 1NONA 1QTIA 2BFCB 2WU4A 2PA3A 1B6RA 3GJYA 4GP7A 1LDGA 1L2TA 2PFKA 4OOEA 4PSKA 1L4EA 5DM1A 4ALLA 5FI1B 1BFKA 1I3LA 1XZGA 4MYDA 4JGGA 1NQVA 3SD7A 2I2CA 4B3HA 5JYDA 1KTIA 2MSCB 3OWXA 2JCYA 1IBLB 1V16B 2X8AA 5LB4A 5T4HA 1KFJB 3BPSA 4UNPA 2ALJA 3AX6A 3V2HA 4DYDA 4ZYTA 4KPYA 1LQUA 1WBBA 3JQAA 3KYBA 3RKRA 1PGQA 4IDBA 4AWBA 3HU5A 2E7ZA 2GD0A 3Q3EA 5TJHA 3U61B 4JYMA 1VXRA 4JC4A 1KI8A 2B92A 2VHTA 3DMHA 3P27A 4NOLA 4IH9A 4YRLA 2MSKA 3HA2A 2C97A 4P93A 2NYAA 4C4SA 1EK6A 3O4VA 2HPHA 1XJ0A 1C0KA 3QHPA 3SM3A 3ESDA 1Z4NA 2NSLA 1DUSA 5THQA 3F6SA 1D9XA 2C07A 3GUCA 1K7FB 1P1HA 2IYYA 3K0FA 4N18A 4RPGA 2D0IA 5GM2A 3WMGA 2YXPX 5ALIA 4M6WA 5TSDA 3KR2A 1T2FA 1OWPA 1O5TA 4MUIA 1EWVA 2X7HA 1S2IA 1WIWA 2J0UB 3AEKB 3DTNA 3DWGA 4M0LA 1Y82A 5E8JA 2VJNA 4QPDA 4QECA 4G23A 4L9SA 3RS2A 2AHOA 1YKSA 3S27A 1D7OA 3QGMA 3SIRA 4NARA 3EVEA 3ENZA 2HJRA 2A3NA 5ALEA 1PL7A 1PV1A 3DOOA 3ADDA 3FUWA 4NOMA 3GEDA 3N86A 4UTRA 2QT0A 2WR8A 3S8YA 3UOGA 3FPAA 1FRFS 5BUQA 1KP3A 3N2ZB 3QEJA 3U4IA 3EULA 5AJWA 4NC9A 2W42A 1XALA 5GY7A 4Z4EA 3FLEA 1EP1B 1C7ZA 1NAIA 1WOMA 1ATZA 1X70A 3DAHA 1PSWA 3F6PA 3GHHA 2VSXA 1A9TA 2AFIA 4MV4A 2AEFA 1R5BA 3B70A 3QW4B 5CA1A 3JQRA 1YR3A 5L9AA 1ZAYA 1T2NA 1MNQA 2CW5A 1SKBA 2IVZA 1R4ZA 4IV5A 3IDOA 3IEXA 5DP1A 5LC1A 1J2TA 4F38A 1QCZA 2ZYVX 3NM6B 3PLNA 1IXRC 3CRNA 1E8DA 2VJPA 2XVYA 3C6ZA 4DFDA 3KLNA 2GZAA 3A4VA 3CNBA 4DANA 5TRTA 2VYVD 2I91A 1A3CA 3B52X 3E1KA 4ANFA 2G1KA 2B8JA 2WDPA 2F3SA 1DMSA 1XKXA 2NADA 3LYLA 4DLWA 3GROA 4L0MA 4N01A 5HRUA 5H68A 1C4WA 1UP4A 2FFRA 5LWQA 1E2JA 3LT1A 1G6OA 1OWMA 4BP8A 2WK1A 2OT3B 2NW6A 3T3HA 4ZU6X 3ADPA 4OY3A 1QYWA 4DZTA 2YYZA 1IZ8A 3KPWA 3LQ2A 5CDHA 1KK2A 3VKGA 1BQ4A 1RHJA 4JU9A 1NRJB 3D6MA 1HETA 1K8XB 4LZWA 5IHPA 3TIGA 3R9XA 1E3EA 4HO1X 3ZY6A 3EWNA 4Z4QA 1KSFX 1L7QA 2CF5A 4P2BA 5ITVA 4FOLA 3C70A 3RO7A 4HUTA 2PGXA 4RXTA 3GNSA 3S7ZA 1X1BA 2WLSA 4CHTA 5DX1A 1AF7A 2XCUA 3JVDA 4M49A 5IEJA 1G9TA 2PL9A 1C3VA 2GRJA 2QTVA 3GW8A 5AVJA 1A9OA 3UH1A 1NT4A 2G82A 3M6AA 3ZXIA 4MUGA 5ENDA 1U7WA 3DXYA 2IUTA 2FTKE 4QO7A 4R16A 1RFGE 2IQIA 4KWIA 3T6KA 3W5HA 3NCTA 1KZ4A 4ZVLA 1W25A 2BN4A 5CNIA 1UBHS 4OM8A 3EXIA 4Q9NA 4QIHA 4B48A 1U9IA 5GP1A 4BLTA 4QM7A 1O58A 2C95A 1C3OB 4MQUA 1ZH8A 2W2KA 3R0XA 2ZREA 1D0IA 4L2IB 4PLGA 4WBSA 3VPGA 5AUNB 3K0SA 4LRQA 4YIKA 5EJGA 5J5AA 4I0WB 1G7TA 4DIOA 4EUNA 1M6EX 2QRVB 4MMZB 4C0KA 4D5EA 4H9GA 4HVLA 5I7OA 1Z4LA 1TU3A 2Y2UA 4GGOA 3BREA 2PNJA 5KJCA 3NNNA 1JA0A 1SVMA 2VL7A 3N75A 1SHJA 5K2MA 3GLGB 3HB0A 2RGDA 2O3RA 1T4MA 4Z2AA 1A7KA 1KHHA 2VYVA 1Z22A 4KFUA 1U2SA 3AERB 2W37A 5KOJA 2QW0X 3S2FA 4AZ0A 1V8DA 2HSZA 1S3FA 4OJNA 3V2GA 1N77A 2EKDA 4QJBA 2CNWD 2IH5A 3FOBA 2GXUA 4G1VA 4M86A 1K7SN 3LHFA 5BV1A 5TMDA 1NT2A 1V4BA 1E99A 1NYLA 2WVGA 2WZCA 3FOFC 1N36B 2G4VA 1ZFNA 2CV1A 2FMIA 4DCUA 1UMBA 5AQ1A 4YYEA 1JAXA 2C5FA 1ID1A 1QDLB 2YJ6A 5DLDA 4KE8A 2Y1FA 4K05A 1CJTC 1EUYA 1OPXA 4Q3BA 1LBEA 2YICA 4JYAB 4DNXA 2UZ0A 2WQ7A 2DUWA 2HIHA 1P33A 2W8BB 5DH9A 4LY9A 3NHBA 1C7FA 2VJMB 3H5LA 4JJGA 3U4HA 4E32A 2IUYA 1VB5A 4BUZA 5BQ3A 3QPWA 4G81A 5H0IA 4C0QC 3TXAA 2HMTA 2J6HA 4U6NA 3HCRA 3Q40A 1CY8A 4PWYA 2FDCA 2I8CA 5DE3A 4YHHB 5CYFA 1J49A 1N2IA 4ZT3A 4BJ5A 3LE8A 1GARA 3VYTB 4TQGA 3OT5A 4YNBA 3ZQJA 3EC7A 1D1PA 1M2OB 3U3RA 3EVBA 3HJRA 1L5MA 1YL5A 2C58A 4XXHA 4UTZA 2HZ7A 2DE0X 2B99A 1SUPA 1WZIA 1AG9A 3I9KA 4U5XA 4ZIRA 1YZHA 2FEAA 4NSNA 5E0OA 1MC8A 4O3MA 3JQBA 4I8XA 1OV4A 4L75A 2C8JA 1L5HB 2CNDA 3MUFA 2MYNA 3AM3A 5AOCA 2ZU6A 5LZ2A 4IFBA 3PQ8A 4FBGA 3VV2A 1SBYA 3B51X 4I1IA 3CZCA 4O5OA 2O07A 3ZEIA 3ZDQA 3MILA 4DUYB 1D6SA 1P2UA 4X92A 4XYEA 4CM8B 3V32A 3RVOA 4A8JC 2IU3A 5BWCA 1VE9A 2RHLA 3BXXA 4FONA 2PZMA 1WXQA 5HE9A 5ED4A 4QQNA 2CNWA 1K4YA 3SYMA 1YFKA 4M9UA 1JIIA 1WSWA 2R87A 4DILA 2BFOA 4G1UC 2G0TA 1O03A 3OT1B 3X1WA 3MN1A 1NW8A 3UKOA 4OQYA 3RM3A 1LK0A 3TBFA 2O6LA 3WB1A 5CCXA 1QO0D 3O8NA 4L22A 5G0VA 5GONF 3VPXA 1RLUA 3NHZA 1CB0A 2EOAA 2I33A 5FTWA 3DWFA 3GU3A 3V7FA 5BN5A 1X86B 4JJEA 3O3CA 3M81A 3ZKWB 3DB1A 4OXRA 1A9SA 4NDNE 4R68A 1FU8A 4QGAA 5LJLA 2REOA 5H4GA 1VCOA 5TMPA 3K5WA 5FFNA 1A88A 3C1TA 2NZWA 2GEBA 5E7QA 1I6KA 2W58A 5BQFA 4G4GA 4DV5B 3HFJA 3CQ9A 421PA 5LZ7A 3OZAA 1ANKA 4LE2A 1M2VB 4C1BA 4F4IA 1P91A 3O95A 4G24A 1Z0JA 5TY0A 5DHSA 2CJWB 2JZOA 3D8BA 4KQWA 4KIUA 4GECA 1JLLA 2DULA 4LJAA 3PQDA 4DIMA 1F60A 3N0TA 4QGBA 4CMGA 4FHGA 4QKQA 2OOKA 4ZAWA 5IDQA 5K45A 1JSRA 2JRLA 3A7EA 3H5RA 4DCJA 2H0RA 2ZFUA 2ZT5A 4BZWA 3MJDA 4KP7A 1BDHA 1UWKA 4DQDA 3E3LA 1UDCA 1Q0SA 2WYVA 3C3BA 3LRXA 3WHPA 1FP7A 4X3CA 3FDIA 3PNVA 3SBOA 1R0LA 2IZ6A 1W0JD 1ULTA 4UUNA 2Q8NA 4WJKB 1K75A 1WQ3A 3KT6A 5DBHX 4EA8A 4CDGA 4DG5A 3T5GA 1AUVA 2HF7A 2Y0BA 3HFSA 3TJRA 5DM70 1QGUB 4Y2RA 2ZJAA 4LIPD 2FPIB 2OFXA 4K88A 4WZZA 4F6CA 1XMVA 1R8SA 1JG3A 3T4UA 5FOTA 4QEKA 4DQ0A 3W8NA 2I65A 1XTTA 4E07A 5KJFA 1QO0A 3GA0A 2O54A 3W04A 3R7FA 5HIJA 2XTAA 4OAOA 5DDIP 3SKVA 1AGYA 1ND6A 3HCFA 3M6FA 3RPEA 5KMGA 4YLYA 1F14A 1FLNA 1DARA 2ZXUA 3MMPA 4XCQA 5JXJA 3QM1A 3KK0A 4XLTA 2OMEA 1ISJA 3OD5A 5K03A 2WU1A 4O2AA 5CVEA 5BP7A 1KMNA 2QZ9A 3LD9A 4PNHA 3C3EA 4J4BA 2SKCA 3ANLA 3HKDB 1QFJA 1KAMA 3Q3JB 1RIFA 3MTGA 4MW0A 1MX1A 1JDBB 1RAAA 4L6CA 2NV0A 3GDFA 4CDMA 1CQJB 4FGKA 3FZGA 3ER9A 4Y98A 1R9JA 4QQKA 1UANA 2R1TA 2NOAA 1OLOA 1OASA 2XA9A 2VLIA 3EA4A 5TQ2A 1W48A 3GV0A 3A32A 1LZKA 2I7CA 4G8CA 1QMPA 1C1XB 3URKA 4CV2A 2HQSA 3DMGA 5TEWA 4H0FA 3V8RA 3N53A 2H1HA 1GTJ1 4NOKA 3UB2A 3WDSA 1SBZA 4L51A 1FUEA 2WUFA 2HCFA 4Q4JB 1VJGA 1BHO1 1E9SA 2Z4SA 5EJ6A 1O4WA 1W0JA 1C29B 2R6JA 2IX3A 1OAKA 1OI7A 4J0HA 3DEAA 1ZM7A 2B5WA 2FFQA 1T8TA 2PJZA 2XI4A 3ZU3A 2ZLBA 3MCWA 1G21E 1Z82A 5HK8A 2PE5A 1P1CA 1E96A 1SCAA 2XVAA 3HWX1 3OZBA 5JJCA 1X15A 3S68A 2C29D 4NIMA 1XSEA 2H1LA 2AXEA 3DLAA 3G9QA 3SIWA 2C78A 1FW8A 2OM2A 1L3IA 1IN4A 1JEDA 1XMJA 3RT9A 3ORQA 4OD0A 4CKEA 4Y1RB 1IC6A 2VQ3A 1IHDA 5DX8A 1M2JA 1TKRA 4A7PA 3CUTA 1WU7A 4YUZA 5KOIA 4ZTUB 3U1VA 1QB7A 1U2GA 3OIWA 4IDFA 4QOSA 3PQCA 1UOPA 1VJRA 4NFLA 5UKDA 1K6XA 2NAPA 4Y6LA 3BORA 4BGVA 1OLSB 3UJCA 2BBWA 1PT6A 4CKZA 5LXTB 2PPVA 4LHYA 4NMWA 2PBFA 1BMDA 3TQQA 3NFYA 1R10A 1Z7BA 1Q15A 2HHAA 3Q88A 4U7TB 2O5CA 4IOLA 4C29A 3CRZA 1J2YA 2H1IA 1CNFA 3A1TA 1Z5GA 2ZR9A 4YFYA 2EU8A 1DAPA 1GZ6A 2O3SA 2UYQA 3CRW1 1G8HA 3EIQA 5AKIA 3FOZA 4FHFA 4TYQA 5CLFA 2ZU0C 2H16A 1Q7RA 4X20B 5I45A 2DBVO 3BMXA 4NY1A 4HLDA 1S6YA 3NS7A 4HZUA 1W5BA 2N1MA 5CVDA 1JEYA 1YRWA 1KQ3A 3WLTA 4OH7A 4DA0A 3O84A 4MI6A 4OI4A 1YA4A 2ZAOA 1DPGA 3KBOA 2P6RA 4PPQA 4DMGA 4XM0A 3MF4A 4KQCA 4K6GA 4BECA 3DXZA 2ZIAA 1A96A 1K7XB 2JVKA 2PV7A 4RORA 5JO9A 3BL8A 1OYYA 1LRJA 5A5EA 1ZOIA 5C1IA 4MDFA 2XYRA 1R5OA 3EXG2 1V48A 1K5GA 1PR4A 3O3OB 5IMBA 4ICIA 5JXWA 4WN9A 2ZR0A 1I7QB 3DHYA 3HEAA 1NKTA 1FS4A 1YB7A 4X0EA 5EVCA 1XZCA 1Z7YA 3U7QB 1TZ2A 1ZMXA 3H17A 3SNHA 3GN1A 4P6VF 1E2GA 2EF0A 2G9ZA 4FE4A 3VNBA 4EYKA 1PVOA 1J2UA 1N2ZA 2BZ0A 3RUDA 3SVLA 1R15A 4M0KA 1WA5A 2XTNA 1M6HA 3FOWA 4OJMX 1D5CA 4DQLA 3IRVA 4RVUA 2VA9A 2VT7A 2OGTA 2YASA 3N2EA 2WTBA 3PDUA 1W4ZA 2IPNA 1VIDA 1NVXQ 1SVSA 4E5NA 1OFGA 3H2ZA 1OY1A 3JALA 4HAXA 5DBEX 3VM6A 2ZRGA 1R50A 1P9OA 1G19A 1S2OA 1YDFA 3W4KA 1FS6A 1LNQA 2QPOA 1DBQA 3ZYZA 2AEMA 1JDZA 1PJRA 2O6HA 3ODPA 2W2MA 4EY4A 1V3UA 4B9EA 1FMLA 1PUIA 4IQ0A 3LLMA 1VLMA 5A4KA 1KZ9A 2UZ1B 1JYFA 5LYYA 3DULA 2MINA 3QENA 3I9MA 1VHJA 4PG5A 3FFWA 5E1MA 5CITA 4GLLA 1A2BA 1ZGBA 3TEJA 3ZJYA 4AM8A 2PGAA 1QXSA 4N0QA 4D96A 1WABA 4NV3A 1N2HA 1NQAO 3V4RA 4GXRA 3WBKA 4OJQA 4JLVA 4O1MA 3GRYA 2A5DA 3N8KA 3PUKA 4KVGA 3THXB 1GRRA 1O6GA 2C4VA 2C0CA 4DT1A 3GVPA 1EJBA 1TAGA 2L18A 2Q62A 3MIZA 1LLDA 1Z2AA 4J75A 4CIBA 4JP1A 2HHLA 1OQAA 3VXKA 3WL6A 1XZLA 3QW2A 5LQJA 3T3OA 1QV9A 2Z58A 3RFVA 3FNEA 3OCXA 4KQIA 4YRFA 1C1DB 3B12A 1B14A 3EG9B 4MNTA 4XCVA 4RQAA 4N5IX 1DG1G 1QOZA 2VAPA 4H3HB 4LF8B 2HGSA 4HZIA 5LZ5A 2FX5A 3DPIA 4IUYA 3IOYA 4BMZA 1I7LA 1RXEA 1CT9A 2NM0A 3RARA 3KG2A 3C5CA 1XN4A 2DPXA 4FJ2A 4TTQA 4QXRA 1ZN9A 2C4MA 5JRZA 3TOSA 1QHSA 3AZQA 2I99A 3G9ZA 4EW6A 1B16A 3EQ9A 5F2OA 3WAKA 2B5VA 4CLRB 2G9NA 2ODNA 4CM3A 1ZW1A 5F73A 1DUVG 1ZCJA 3CZRA 2C5AA 3CXUA 4G1FA 3TCKA 1E1RD 5GMOA 2GXAA 1S2MA 2PSFA 4LOIA 4BQNA 4IDNA 4WZBB 3S1SA 3M9WA 3MYRA 3GLKA 4KRGA 3BHNA 4FFOA 3ONNA 3W9UA 4D0GA 1ACMA 4CRWB 4BEJA 4MINA 3INNA 2AN3A 4YCAA 1YQWA 4BATA 2PT6A 4LPKA 1SJ9A 4PX9A 1GNRA 2EJUA 3PUJA 4ND2A 1QR6A 3HCOA 4RVHA 3ZVRA 3QLTA 3ABSB 1R37A 1A5TA 4FQ5A 3H3FA 1FFDA 2QZJA 5FOXA 2VTVA 4JYZA 4OLBA 4AZ3A 4Q6BA 3GL9A 4DS3A 1PF7E 1Z4MA 2RH5A 4XEUA 1RC1A 2CWWA 4FJ1A 4LJ9A 3UT0A 1G3RA 1CRLA 3NAGA 4IIGA 1CDZA 1DBSA 2J6IA 1O7JA 1U0OC 2GM5A 2H3EA 3DZGA 3LUAA 4Y1GA 5EE9A 1DX9A 1Q1EA 3AY7A 4L72A 1MOPA 2NU6B 3KDAA 5CH3A 3I76A 2HLHA 2EJCA 4A9AA 3BIWA 1JVNA 4YROA 3BHIA 2UUCB 3MS2A 2R5WA 3O75A 5E6SB 4HXYA 2A78A 1CY1A 4RPKA 3H4TA 1OBHA 1VKHA 4EKYA 4Z0PA 3EBOA 1K97A 2I4MA 3PHLA 5B1HA 3AJEA 4RDIA 4YAFA 2XPCA 1YR1A 4E33A 3G2KA 3OPXA 2ZUEA 3QIVA 4KSYA 3ANSA 3NTXA 2QQFA 1M8FA 5EJ2A 1YZFA 2VUIB 1QTQA 2HJGA 4K5QA 2IHTA 1SD2A 4I2NA 2ODPA 3LECA 4FYYA 4LE1A 1YQDA 3NV9A 5MGBA 3PCRB 2XQVA 1U2RA 5FWXA 1MQSA 1CJSA 1LFAA 4K1XA 2FZEA 1E1RA 5BSTA 1E2UA 2GXQA 4J91A 3E7PA 2OB2A 4YACA 4XR4A 3L8ZA 5IT4A 1E92A 2V96A 2WM9B 4QBTA 1L6RA 3GJ0A 1B0PA 3MTJA 3E6AA 4ZTZB 1AKWA 4YCJA 4OB7A 5CCBA 1KMQA 5C8XA 3BN3A 1GG5A 4DWJA 5JNSA 1ZNYA 2XNCA 4JP8A 4JBGA 1QQTA 3E7XA 3H83A 1ZGJA 2QM7A 3EA0A 4D8TA 4OX9Y 5IVPA 1T6YA 1BW9B 3E8SA 1VHWA 2IYWA 2ZW9A 5SY4A 2V03A 3CWZA 1TJ4A 3SJUA 4BTEA 2JBAA 4PX3A 4CKWA 1N0WA 1TM1E 4UHDA 2CHUA 1NMSA 3W2IA 2ZITA 3FNIA 1SVIA 1DX4A 1G5FA 3MD9A 4JJIA 4BV3A 1D1QA 3A4LA 4Q1AA 1JALA 2R6HA 4GXTA 3NUGA 1JFTA 3G8CA 3DL0A 1YD7A 5DCUA 1AGPA 2X0NA 4N48A 1UK9A 3A6GA 1XYVA 1ODCA 4MJLA 2JLCA 4XB6B 2BZ1A 5EEGA 4UU8A 2XDYA 3U9LA 2WU0A 3EOAI 2ZUTA 2OAGA 3N2YA 1QC5B 4IDGA 3V7WA 1BVHA 2GCOA 1T3TA 1J7JA 1NVGA 3JQAB 1V45E 4E5MA 1LH0A 5CB6A 2D1QA 2VNSA 1EXMA 3CMMA 2V4MA 5A03A 1HMYA 2LE0A 4Q34A 1B00A 3MLAA 2NP7A 4CT4B 4KPEC 2VQDA 5DX0A 1NJ5A 3NM4A 1GU1A 4I1OA 1UQTA 4RTMA 1FMTA 3FAKA 2X2OA 4AFNA 3G0HA 4JJ6A 4LYFA 1H0SA 1M8KA 3L7OA 1H2EA 2I7DA 3KCQA 4I1UA 4GE0A 1ODJA 2FY8A 4WNCA 2GUGA 1QH8A 1K0FA 1VPWA 2AFRA 5GVRA 3A7DA 3K0FB 3OEYA 3OD1A 3PUHA 1KKLA 1T8PA 2D2IA 4DR3B 5FI3A 1DO8A 4M6WB 3CG4A 3WGGA 5J2TA 4D8YA 2JA2A 2JVJA 3KZXA 1VI5A 5DCWA 4DLKA 1ZJYA 2J9YB 3HMQA 3H75A 2O48X 1P0IA 4DHWA 4PYKA 3V1UA 1ZVKA 4YRPA 1CBUA 1UM8A 3GAMA 3OEED 4YQEA 3SR4A 4D92A 2DFKB 3ZNQA 1VMDA 2DSNA 4RF4A 1EDDA 4EDFA 1B6SA 4BGIA 4PANA 1SCIA 2NSDA 2PYZA 4H4DA 5DLQC 4ZVOA 4D74A 2PLFA 2IJGX 3MYYA 3RODA 4NAHA 2B4RO 1OZAA 4MKHA 4PV7A 5CTJA 1RXSA 2Q27A 4CF7A 4IGEA 3E4DA 5BSEA 1WKVA 2AFIB 3B7PA 3R5FA 3UCXA 1GUAA 2MOKA 4CVNA 3PTZA 1K98A 1DVRA 1N1MA 1UDXA 3F8WA 1MB9A 2AVDA 2P62A 4M8KA 1JVBA 2PZAA 3KJEA 4MQ4A 2AWOA 5G53C 4AIRA 5IC4A 1P81A 3PA8A 5I3CA 4JSRA 2IU0A 3D43A 1WDLA 1GPWB 4U9HS 4EO9A 5IZ4A 3BGWA 2WM3A 4O1IA 3KDSE 2FYTA 4OHRA 1I4EB 2BEWA 1BS2A 3A9CA 4Q4AB 5MN5A 2ORWA 2IV2X 1H8HD 3IOMA 1RI5A 1UADA 1V8FA 2IELA 4GVXA 4HB2A 1XA4A 4HXFB 3W5CA 1II8A 4ZAXA 2DFTA 3P4XA 4ERNA 2XBLA 2GYYA 2BSAA 3DDNA 3BBPA 1ZJ6A 3HBJA 3RNLA 3CZ5A 2PBZA 1NC1A 3FBTA 2GJ9A 5K8JB 3M82A 4NLLA 1OB2A 1W9MA 3QU9A 3BUSA 1CUUA 3THRA 5BQ5A 1KVRA 5JTUA 3IVRA 1P19A 4DSTA 1YA6A 3O83A 4O63O 3ZTYA 1TCCA 4B1FA 3CX7A 1XZFA 2O5RA 4DCGA 4RV4A 4DWVA 5K8CA 3L1VA 1LD3A 2QTVB 3OEEA 4Q4LA 1H4QA 1Y6GA 3D1VA 1HY3A 1ULSA 1V1MB 3LLUA 4A0HA 3N58A 1FVXA 1W5EA 5K0GA 1US8A 3QOXA 5K8TA 2HLPA 3I53A