4F56A

The bicyclic intermediate structure provides insights into the desuccinylation mechanism of sirt5
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
267
structure length
267
Chain Sequence
PSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Bicyclic Intermediate Structure Provides Insights into the Desuccinylation Mechanism of Human Sirtuin 5 (SIRT5)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords NAD-dependent lysine demalonylase and desuccinylase sirtuin-
total genus 90
structure length 267
sequence length 267
chains with identical sequence B
ec nomenclature ec 3.5.1.-:
pdb deposition date 2012-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4f56A02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4f56A01
1UPAA 3GLTA 5EJ6A 5EJ8A 4MQ5A 2H4FA 4JU8A 4RMIA 3CLRD 4BV2A 2Q28A 5BWNA 4V1CI 4FEGA 3CF4G 2C31A 2V3WA 5IMSA 3HWX1 4ZP1A 2JIBA 4KXQA 2EZ8A 4JT8A 1S7GA 2H2GA 4IAOA 4F56A 2OD7A 1Y9DA 1POXA 4TWIA 1YC2A 3PDHA 4Y6QA 1DJLA 2H59A 4UTRA 4BV3A 1M2JA 4C78A 4IG9A 4L2IA 4UU8A 4L3OA 2JLCA 2VJYA 3EA4A 2JI9A 4BVEA 2OORC 4MPJA 1U2DC 5EJ9A 2Q5QA 1SZDA 4JD5A 5BWLA 4JT9A 1PI3A 4FVTA 4R8MA 1M2HA 2FSVC 4J16C 1YHZA 1O96B 4BVFA 4MPRA 4GM4A 4UTNA 3U3DA 2VBFA 4UU7A 2A1TR 3GLRA 2H2IA 1T9DA 4COKA 3D4BA 2JI8A 1YI0A 1PO7A 4FZ3A 1T9BA 4BN4A 4GPEA 1UPBA 4RJIA 1V5FA 3ZGVA 4HD8A 5AHKA 4UUBA 3RIGA 3CLSD 3D81A 5MGNA 2H4JA 1XLTC 4TWJA 2H2DA 4BUZA 4C7BA 4V1CB 2QQFA 1EFVA 3CLUD 4K9KA 1S5PA 1E3TA 5MF6A 1JSCA 2FRDC 3GLUA 2H2HA 4J1TC 1MCZA 1M2NA 4Q9DA 4Y6LA 4BVGA 2Q27A 4GM1A 5K3SA 2NXWA 1ZPDA 4K9PA 3JR3A 1Z8NA 1OVMA 1D4OA 2IHVA 1OZFA 2Q5JA 5K6RA 3ZGOA 4MZXA 5D7NA 4FEEA 1V5EA 5K6TA 4GP9A 3IAEA 2OD9A 1V5GA 3FZNA 4O8ZA 4UUAA 2UZ1A 1PYDA 2PGNA 5EJMA 3PKJA 4JUFA 1PTJC 2A1UA 4I5IA 2Q5OA 4JSRA 3EYAA 1U31A 1M2KA 3GLSA 4MPPA 1PNOA 2OD2A 2W93A 2X7JA 1YHYA 2WVHA 2B4YA 1T9AA 3IAFA 5DEIA 3E9YA 1PNQA 1T9CA 1NM5C 1Q6ZA 1YI1A 2FWNA 2IHUA 2VK1A 3CLTD 4UTZA 2UZ1B 3F6EX 2Q29A 4JU9A 2PANA 1SZCA 1OZHA 4D5EA 3U31A 5FYQA 5DGDA 4GM0A 5EJ5A 2AG0A 3FLMA 5EJAA 4BVHA 2QQGA 1YNOA 3OE1A 3D7KA 4JUBA 5K2OA 2JLAA 5EJ7A 4X3OA 5MFPA 3RIYA 2WVGA 4G1CA 1BFDA 2JI6A 2VK4A 4K9OA 4K9NA 4RJKA 1Q1AA 5EJ4A 2Q5LA 4F4UA 4D5GA 2JI7A 1N0HA 3EY9A 4IF6A 1YBHA 2WVAA 4UTXA 4QQ8A 3ZG6A 4K9QA 1M2GA 2EZTA 1MA3A 1ICIA 2OO5C 4JUCA 4QELA 1O97D 3HWWA 5DGTA 1POWA 2NYRA 2BRUC 5BWOA 2H2FA 1OZGA 4RMJA 2VK8A 4RJJA 2DJIA 1J8FA 1HZZC 4RMHA 2EZ9A 3LQ1A 4ZZIA 1Q14A 4V1CA 2VBIA 4JUAA 1Q17A 1EFPA 4GG1A 1PVDA 3F6BX 4BVBA 4KPUA 2HJHA 1UPCA 1PT9A 1YC5A 1YTLA 5FEMA 4K9MA 2EZUA 5MFZA 4K9LA 2PGOA 4JUDX 3FSJX 4KGDA 3JWPA 2FR8C 4BN5A 4RMGA 2IHTA 2VBGA 4Y6OA 4QPZA 4X3PA 1QPBA 3PKIA 2EZ4A 1U28C 3K35A 2H4HA 2AG1A 4UTVA 1U2GC 4HDAA 2FN3A
chains in the Genus database with same CATH superfamily
1MU0A 4B7AA 3UMGA 4TLDA 1OROA 2GRAA 1GZ4A 3D3KA 3NVDA 4A9AA 1LVGA 3NGMA 2BDTA 3CUYA 2PMFA 3IUBA 4KWCA 4OG2A 2OV4A 1EX9A 2SCUB 4G0PA 3WLPA 4CKYA 4ALIA 1Z5GA 4UAUA 4ER3A 3D3QA 3V8VA 4YRMA 1DAIA 2EARA 1UBCA 4PO3X 2GZSA 1E3MA 4JYZA 1XG5A 3CRNA 4XJXA 4PO9A 1Q2XA 1VJRA 1LC3A 2Z2YA 3NHSA 2GQ0A 2JGDB 3GZNB 4XWOA 4PR3A 3QLEA 1NI5A 3S27A 4HUJA 1V35A 3PLAE 5T7BA 4YJDA 2NO0A 3ISTA 4PRLA 2B92A 5B3LA 3KB1A 1I7DA 2NXCA 1BDIA 3FSEA 4ZK6A 2P2ZA 5JQGF 4MQUA 2PGAA 2WAAA 1KYWA 3M4ZA 5AOAA 1TVKA 4XUDA 5IX8A 1MOQA 2CMGA 1R0RE 1EFRA 3ELBA 4O4IA 2FG6C 4B4VA 1OH5A 2DULA 3LXUX 3MT9A 4GAEA 4MQEB 3R74A 3W8FA 3GJ0A 2AUMA 2NXWA 5M5BA 3DLIA 3CY6A 4ZJUA 2AE1A 2Q3CA 2WIFA 3M6UA 2P9ZA 2QTGA 3SC6A 1Q3TA 1QIEA 1XAIA 1J70A 1MAHA 3IAM1 5D7NA 2Q0XA 1I8TA 5ALWA 5FBKA 4GZ3A 3OOJA 3EPHA 4O4LA 1NY5A 4PZCA 2F90A 2V1UA 3D8NA 3W6NA 1R7RA 1U4OA 4L57A 3I2KA 4PONA 3SZOA 3T7DA 4DMKA 4FZ5A 3UMMA 4ZTZB 2FETA 2WUDA 3O1LA 4LDNA 2NTVA 4TVOA 3RS8A 5SY4A 3FOWA 3HXQA 3H5AA 1JJBA 3IMCA 1GG8A 2FF7A 2LVBA 2CLFB 3NHFA 2Q1WA 2GAAA 4UNIA 1AV7A 3DZJA 1EP3B 2QTAA 3ZDEA 1RBQA 2C03A 1LF5A 2XF2A 4M21A 1JJVA 1I4WA 3KALA 7ADHA 1MH1A 3A05A 3VR6A 1XZMA 1XWFA 3QBVA 5HK8A 4C1BA 2GFIA 5F35A 2AMVA 1II9A 2OC9A 3BJZA 3KLOA 4G0OA 4UFOA 4GI7A 4AKEA 1QYDA 5IBCA 3BHNA 5B1IA 1PUXA 3H5VA 1YFKA 3NYWA 5BQ5A 3TLEA 1QQBA 3WGTA 1XJ5A 4RH0A 1Z18A 1T9ZA 4WLFA 4ENVA 4F71A 3Q3JB 3A1TA 2WF8A 3BKXA 3N7UA 4HRXA 5KTPA 3SQLA 3P71T 3ZHOA 1F38A 4Q00A 1ELOA 5F5LA 4HSEA 4OL9A 2UVPB 3BRSA 4Z4QA 4D02A 4O4JB 4BVKA 1NJFA 3TD6A 3FY4A 3GMTA 4LHEA 2NSYA 3AR5A 5KX5F 3WGOA 3HABA 4FMDF 4JR1A 3RJ5A 1FYXA 4F4IA 2NVWA 5JSZB 3WGYA 1YJQA 2X8BA 1ZIPA 4U9HS 4AJIA 4YFVA 2CL6X 4M0UA 5BQFA 1ZHFA 13PKA 3OMWA 1SUFA 4LOLA 3PNSA 3KLBA 1NBHA 3ZWDA 1L8AA 3HMKA 3LS2A 5E6RB 3DE1X 1W2WB 3OA0A 5H1YA 3SXJA 5DN6A 2ATEA 3OLCX 1MG5A 4WZBE 3GLTA 1C9NA 1L4HA 4PLTA 3HPRA 4ETNA 4D9KA 2C7VA 2GCGA 3CUUA 3U80A 3IP3A 1OXKB 2EIHA 3HBNA 1Q15A 2JIBA 5CURA 1ESCA 4OBBA 3U81A 1RBZA 4A8JA 1J00A 4BY9E 2QZ4A 1CNFA 3MUFA 1NWHA 2X8LA 1OV4A 2X9NA 4MQLA 4LF6B 1D1TA 4L8GA 4JK3A 2EF1A 5IKPA 2V4UA 2JKYA 3BC1A 2OXFA 3TOSA 3SZGA 3CVWA 3VDMA 1U0JA 2YMMA 2A3NA 2G67A 1YK1A 4QYMA 3MTQA 2Y9PB 2I66A 1XU4A 2GBPA 1P73A 2P6MA 3SQNA 2ZT8A 4RTLA 1CF2O 1CW2B 1Z0DA 5BV0A 1XU9A 1NXTA 4D41A 1BE1A 2WWYA 2AC7A 4FFSA 1G38A 2FX5A 5E7JA 2V0GA 4MDEA 1FPQA 1UDAA 2NZJA 1XZJA 2Z6QA 1CUBA 3QFTA 4L5YA 5HKOA 1UIRA 2PWPA 2RONA 4US0R 4ZYLA 3P26A 1E1RD 4KSBA 4O4JF 2DFPA 2FW6A 4TX1A 1J0EA 4ADSG 5BR1A 1RYYA 2OFOA 1RWMA 4TTVA 4TXLA 5COQA 1WLYA 4JC0A 4HQ0A 3N5KA 2JIMA 3KJIA 4TGLA 3GZ4A 2YYYA 5K0JA 2L19A 1P1FA 2NXEA 4XLZA 2F43A 2BY4A 5EQJB 3IOEA 5F4BA 3FPLA 5CK5A 1N6LA 1NYQA 2H1RA 5LU8A 2BC9A 1ECLA 4G56A 3S2YA 3B51X 3GCWA 1E61A 2C2HA 1F4LA 2CXPA 3H5WA 1L4GA 5CNMA 3HGQA 3B5JA 4HDRA 4TN5A 3EEBA 1F5SA 4R2LA 3R3ZA 1FDRA 2QY9A 4PTYA 3I6YA 2OV8A 3CPSA 4TTRA 1JKIA 2KPOA 1NC3A 2YVKA 4QBTA 2ATXA 4LDZA 4LMRA 2AWOA 2X23A 3TQFA 3MUNA 1IEWA 3AIKA 3EHEA 3LMKA 4I1RA 2GB4A 1Y5NA 1JQ5A 2VUSA 4NP6A 4OJNA 1WQ1R 3VR4A 2GEFA 2V54A 2UKDA 1D2GA 1T4DA 2NTNA 3QKRB 3QX9A 2J6CA 4LJ9A 4PG7A 1KDZA 3HVKA 5EAIA 2I6UA 4EO9A 2I2BA 3F4KA 2YRXA 1WSDA 5F77A 4KFCA 1CJCA 1UPXA 2HA3A 2OZLB 3S6JA 4Q5IA 3I01A 4YAIA 1ECPA 4TZ6A 2DKNA 1YBFA 2QIOA 4DC0A 1WS6A 5CGZA 2E21A 4REOA 4BX2A 3AY7A 5JHHB 1DRJA 2XLBA 2D7DA 1V1JA 3R4CA 1EVLA 4BBAA 3O9ZA 4A2QA 2IH2A 1UZAA 4Z99A 1FMFA 4P81A 1ZD4A 4DKJA 1FK8A 4E2XA 1KEKA 4B48A 2VHEA 5SZJA 5T6MA 1YR6A 4M9QA 1QU2A 3RKSA 2C61A 1I6KA 1GPMA 2HU5A 1E4EA 2VBGA 4U2KA 1C3EA 4Q9NA 2VNHA 2EG5A 4MICA 1DP4A 4PQEA 2WFAA 1KO8A 1KI6B 1ZWKA 2XMZA 3F3YA 3O0DA 4LSWA 4FB4A 2GZAA 2PUAA 1GZHB 1WXWA 1H94A 2P41A 2CYBA 4MW1A 5DLDA 2P3LA 2G9VA 2PWZA 5K09A 3OZCA 3WO0A 5KTOA 1IIBA 3JATA 4B3JA 4L3OA 3EQ2A 4Q21A 4H4CA 4CQLB 2BISA 3LPLA 3H04A 3N58A 3VHRA 2FU5C 2FR1A 2P9JA 3OVMA 4GPIB 4MLDA 4COOA 4GMKA 1XRQA 2OZKA 3QP9A 4JD5A 5EC8A 1Z4JA 1SUEA 1U80A 2J9FA 1NR7A 2GEDA 2J6HA 2NGRA 1K8RA 2OFWA 1NW5A 4XQGA 4ZQEA 1ZMXA 5LC1A 2JCVA 4M3NA 3WMGA 2PBZA 2AKYA 4BP3A 2G1UA 2H11A 5B58T 1QB8A 3DE2X 4GR4A 1KJWA 4XX0A 1GNTA 2JD2A 2QOEA 3R7WA 2PX4A 1Y48E 1KSGA 4ZKEA 4E88A 4OGGA 2O4UX 1ZJ4A 3K2QA 4EW2A 5JR3A 3K0SA 4PQYA 2O3SA 1SEVA 4XQ9A 5JDCC 4ARSA 5LDGA 1UANA 4G1EB 4DSNA 1N2XA 1XIVA 2XB8A 4LJ6A 4LJRA 3I9NA 3M5WA 4C7XA 3K6SB 3ES9A 4QEKA 3QQ5A 2GKGA 1KGSA 2HA5A 1V95A 4UQPA 3RK4A 1YDWA 5EIAA 1SBYA 3R8XA 3T9FA 4L02A 1JQBA 1XEXA 1Z83A 1ZO8A 1FU4A 2OGZA 3R5KA 3P19A 4PQGA 5B37A 2UU9B 4IVRA 2Y2VA 5BW6B 1Y6QA 3CX4A 2ZT7A 1JEOA 3BHMA 1LDBA 2QR3A 5EJMA 2RGWA 2YV3A 4C7KA 2PQ0A 1O6FA 1L7VC 2QGZA 1DHTA 3U09A 4Q4AB 4DLBA 1YQTA 2UXCB 5FWYB 3DA8A 4R2XA 3OF2A 4LXXA 1WZUA 2WILA 1T3TA 3HR7A 1PZFA 3K0CC 3TRHA 5ALYA 1A98A 1Z2NX 2BN4A 3KSAC 3BHJA 4LRYA 3TQQA 3HTXA 1H1DA 3JQ7B 2HPHA 3OAAD 3ZI4A 3HV0A 3S55A 3VISA 4BQQA 1XDZA 1ZGCA 1FBTA 4KSYA 3I5YA 3D54D 3PQFA 4IGAA 1XDDA 3GK3A 1EZZA 2EX1A 4G01B 4LOJA 4ZAZA 1D7AA 3ZWKA 5JSFA 1GU0A 2HLDA 3CURA 1MX3A 2GZDA 1HPLA 3EOZA 1MRNA 1GCUA 2VK4A 3GT7A 2JCXA 2YJ4A 3CC8A 4P7BA 4OLAA 3PQ3A 1USIA 3LUGA 2AN5A 1USWA 3EVAA 3K9BA 3W5JA 1OIWA 2ZB3A 1N1MA 3C43A 1CDEA 3LDGA 1ZOOA 221PA 4WZAE 4XIIA 2HL6A 1MRZA 4NU8X 4X85A 4MUGA 3FDJA 4IKOA 3G9UA 2I91A 1AHIA 1RI1A 1RI5A 1T24A 1Y8RB 2OUKA 1OLSB 5EUQB 1VJ5A 4Q39A 3MUEA 4BQEA 5BOSA 3GFSA 2H1VA 4BLTA 3O2SB 1CR2A 2ZI6A 4JMLA 3SICE 2AI3A 1FRNA 5JWRA 3DFKA 3Q5GA 1WIWA 4YB8A 1JEYB 3AILA 4P7JA 1H2XA 2NNLD 2FEAA 3IDQA 3UVEA 1FB5A 1X7XB 4DA4A 3QRWA 5I9IA 4Y6OA 4WN9A 3QTTA 3N2IA 1EU1A 2HN9A 2H2GA 4HDAA 1N2HA 2PYIA 1ZHOA 2P6OA 2HIAA 1NQAO 2Y9MB 3ZU6A 2PXAA 1LPAB 4G63A 3DB2A 1Q1ZA 4EKIA 4X1IA 1XKXA 2X0JA 5FO1A 1HEYA 2RHTA 3UUEA 4OI1A 5KOHB 2IH4A 1E8DA 3IJRA 4EHJA 2EJTA 1K98A 1VLQA 1VGQA 2J5QA 1B42A 2IPAB 2W90A 1V48A 5AHWA 3N5CA 1AKNA 4D6PA 1ZISA 2NXNA 2ZAGA 3HN2A 3LF2A 3WNBA 1UMDA 3T3HA 4BO8A 4BLVA 2OHGA 1GCGA 2VDNB 2AL7A 3K31A 3HJGA 5B7PA 4IJ6A 1I3CA 2WHRA 1VOTA 1Z4LA 2CJYA 1TYAE 1W73A 3AF5A 2JI8A 1OAKA 3TQOA 4PX3A 3UM9A 4KOAA 4MB2A 4ZVLA 1OLOA 2J48A 3DCJA 1GWNA 2FZKA 2RGEA 3NDIA 2H1SA 4B3BA 2F3TA 3GD5A 1V11B 5AW4A 3ZD9A 1LQTA 3GO4A 2PMDA 3TR0A 2REQA 4MAMA 4Q03A 4YJGB 2JS7A 3ZXXA 2NN3C 2OP1A 4Q3KA 1WLSA 2B5VA 2FV8A 2KI5A 5ECWA 3KB2A 1NF8A 3NI2A 4DV0B 1ARZA 5BYJA 3OO1A 4OGLA 1NT2A 4PFSA 1Z5WA 2JK0A 3Q9NA 1SHTX 2Y92A 3HYSA 4CE6A 1QG0A 3OFNA 4DMLA 1H65A 3HZRA 4B2LA 1WXIA 1LU9A 1O6GA 3CE9A 1Y7HA 2HCBA 2IY7A 2W2NA 3BWYA 3FJ1A 3P0HA 1C9EA 3TD9A 5ICCA 3DR5A 4JDPA 3PHBE 4TV9B 4KR9A 3GFBA 1WUJS 3R5JA 2C4KA 1L7PA 3I0MA 1JVSA 5K4AA 1U63A 1V5IA 1QNLA 3NUZA 4YRSA 1UKAA 1GNQA 3AR9A 2AFHA 4DBLC 1Q19A 4DUPA 4CI9A 4DLPA 5GM2A 1ISSA 1Z7BA 3M33A 1SQ0A 2R62A 1MAWA 4D9GA 4QUIA 3HMQA 3DHVA 1N2EA 1N34B 1VE7A 5DNVA 1TKBA 1JI0A 4D98A 4F6LA 5DTMA 5EJAA 1FXWA 5AKHA 4O63O 2ZI4A 1S89A 1AF7A 4EKYA 3A06A 3DAFA 2V7EA 1A9QA 3TKAA 4YV7A 5LBIA 1RM0A 3P2YA 1FZTA 4KWHA 3KHSA 1SA0A 5IBPA 2Q5EA 1NAHA 4DCGA 5FWXA 1XDUA 4IIDA 4FQ5A 1UIMA 3BCUA 2HM7A 1KAMA 1VIDA 4L15A 3A27A 4RL6A 3L0CA 1M7GA 3SR3A 5FAKA 3Q9UA 1D09A 3Q8WA 1UZMA 5KNBA 4L75A 4E4TA 5LUBA 2QDKA 5AM2A 2Z58A 5K8IA 3VUEA 1DXYA 3ED1A 1T15A 4PV7A 3UOAB 2Z43A 1YXMA 2VYCA 1BCSB 3HKEA 4GDMA 5C37A 1E9VA 3F6RA 1XA3A 3MILA 4K03A 1EAMA 1CRWG 5DHFA 5JWOA 3ILVA 3BSFA 1GL6A 3LD9A 4EBFA 4BCCA 1RLMA 1PFYA 2VQEB 2ZP1A 1YR3A 3E9EA 1RWOA 3HGTA 4ZC8A 2BZ1A 4CDNA 3L0IB 3DVQX 4X24A 5B6JA 1QIMA 1QP0A 3AF6A 1QZZA 3ULKA 2H1LA 1TZCA 2XB2A 4HYEA 4WXPA 3FTFA 5DEOA 4KYUA 1Y33E 4B2YA 1ZG3A 5JJBA 1T34A 4I99A 4X61A 1IM8A 1BS1A 1TZKA 2DFNA 5D01A 3M5CA 4I1SA 1IQRA 1HUQA 2E1PA 1VYTA 4GKAA 3SSNA 3VZDA 4FCWA 3AKDA 2CFIA 1QMPA 1TW3A 3V6LA 4NY1A 4LJ8A 4MW4A 5A7GA 4K6KA 3GPCA 2H8GA 1TYEB 2MDTA 2M6RA 1JHRA 1DU4A 2GF0A 3MRVA 4MPRA 1Z3CA 2ZIUB 1NZFA 5JDIA 2QI9F 2WHPA 3ESXA 4W6QA 1TADA 2GDJA 4QLAA 3HDVA 4RH3A 1OW3B 2ZRMA 4JUIA 1NW6A 1DEAA 2BJWA 1PNTA 2AMYA 2TECE 1X15A 3GARA 3VV2A 3GGSA 2VWGA 3HJBA 1U4NA 1EX7A 4AZWA 2W2MA 3E53A 5JG7A 5JO9A 2BHSA 2WSBA 2VDMB 2J9ZB 3CN7A 1KQGA 2I2DA 1AQLA 1SCKA 3SS9X 2OFPA 1IULA 5LMCA 4I2VA 3GDFA 3I58A 2GVNA 1NI4B 3QYJA 4CEJB 3NBZC 3EZ6A 1GYPA 4JNKA 2Z8YA 1BXZA 2PGDA 3C3PA 3CX6A 1XMIA 4R01A 4Z6KA 1U1CA 4B9AA 1YKSA 4CLRA 1JNXX 1X7GA 1QH1B 5AWFC 5KBYA 3A0UA 1B1CA 2IUEA 3M4YA 4UQOA 5HFNA 5LXTB 1WXFA 3VZBA 4D3DA 2PZEA 1CUIA 1U0GA 4EYQA 3BXPA 3NR2A 4D2IA 1PJRA 2RBKA 3TIFA 2R7AA 3SXUA 1YZTA 1SBZA 1GKUB 4NU6A 3ELDA 1Z33A 2RGNC 4FZRA 4PYRA 3D9QX 2V4MA 3NPMA 2NZ2A 4BX0A 2AZDA 4F38A 3OM1A 2G4VA 4CMIB 3LUCA 3IKJA 1VI5A 3TR5A 1TX4B 1PZNA 4OHCA 2V3CC 4G67A 4H1VA 3PL1A 1ZH2A 3EGXB 3ONVA 3MJEA 4XGNA 3IL2A 3ABQB 2CFSA 3L8MA 4PSDA 5JW6A 1GAXA 1MG0A 2ALJA 1A2BA 4I14A 5TQ0A 4ZMSA 5J9FA 4U8GA 4QARA 2IZ0A 2OCIA 3DHEA 1G5FA 2NQ2C 4KRGA 5ED0A 5FCDA 1N1GA 1EEXB 3B1ZA 1YASA 5KX5B 4MIEA 2DFVA 2I5PO 3B3FA 4UE2A 2ZSIA 4P0TA 1J6UA 3OFSA 3NGXA 4FFPA 3ANMA 1BE8A 3B9QA 3ROGA 3WLKX 4LISA 4WKBA 1FTNA 3C7CB 2HBZA 4WN9B 1Q14A 3PFIA 3RDPA 3ZHBA 1C8BA 1XCLA 3DZGA 4LHVA 2P8SA 3K8ZA 1NOJA 3O8OB 4ND2A 2BCJQ 2XV1A 4L3WA 1UMKA 3JV7A 3EDRA 5JXIA 4KGDA 5U9CA 3OOWA 4EKEA 4H35A 3NAZA 3AOGA 1VFPA 1NRJB 3H2BA 4I9GA 4JH0A 3G89A 1QPBA 1C9KA 2MSEB 3PA8A 4QFDA 3UBMA 1OLSA 1YBAA 4EMTA 5C5DA 4UTVA 1GL9B 1R0BA 5FR2A 1U7WA 1S8AA 5LQDA 1CK4A 1RQLA 1QLHA 2OM2A 4IQ8A 3RVBA 2ODQA 1BH6A 3HA5A 1KI4A 1NBOA 3WLNA 3HWX1 3LX4A 3ICOA 3RRZA 1R6VA 2MINB 3ITKA 5MHTA 4WI1A 5KNBH 3KTAB 5DU2A 4PN3A 1KYYA 2PA3A 4CHTA 4U7TB 5E0OA 4QDTA 4MUYA 2IOFA 2FSIA 5DH9A 3VR2D 3QEAZ 2ERYA 4I1YA 4YRRA 5BN5A 2R25B 2HIHA 3N74A 4PGAA 4D8XA 4DSAA 3HLTA 5HCNA 3I2GA 1CE8B 1JDJA 4RHYA 5G1PA 5EGSA 4CM5A 1N2JA 3T3DA 4IEEA 3EEQA 2LBPA 1QHFA 4F21A 1WB5A 2AEFA 3B1JA 5IVKA 5CYGA 1B14A 2XDWA 1IU9A 3L7BA 1CIPA 1NXWA 2QP9X 4B7CA 2ZYIA 1YRHA 2WMOB 5AESA 1UDCA 2YUIA 3BWBA 2ZRPA 5CT6A 3VI3B 3RIGA 1JG7A 2D0DA 5HJ7A 2DB3A 4XD7A 1W4CA 3D8SA 3EQ9A 4L27A 1EB8A 3B2EA 5DBIA 2NU6B 4Y2YA 1NPDA 3DGEC 3UW1A 4MVJM 3TNLA 4KXVA 3B1YA 5D87A 2XT9A 3A32A 5JBQA 3HDYA 1Q7RA 2W2KB 3DQZA 3WIDA 3IPCA 3NM5A 4KXXA 1WF3A 2VUUA 3COZA 5BN3B 2ISQA 5TF0A 3WTCA 3D0OA 4GNRA 1PGJA 4JSTA 4JVNA 2QNIA 3L7JA 3SDBA 1YVRA 2CF6A 4C14A 1P2FA 2BF4A 3B6KA 2IEZA 4EIWA 4E46A 3WXMA 4FYWA 1QH8B 4LHWA 1LPOA 1AKQA 3GROA 4ER0A 2YHUA 1QTRA 3AF0A 4LNHA 3GEPA 5CVDA 1QHHB 5PGMA 1T9AA 3LWZA 1UWCA 1I7PA 1GPUA 2ZE5A 4EJSA 1EK0A 5IKMA 2G36A 2G83A 1Y1TA 3GWGA 3KT6A 4IPTA 4RF2A 5K8VA 4B9EA 2PUHA 1I94B 3I0ZA 2QR2A 3K9FC 2FWRA 4CKEA 2YQZA 3HA7A 2WI8A 1V1RA 2PFSA 5LDDC 1MMFB 2FZWA 1HBJA 2DCMA 2VSXA 3TXXA 1AB5A 1NQUA 4YACA 5IKEA 4HAXA 3CKLA 4PZLA 2O1SA 2C4WA 5ENVA 3E3MA 3HN6A 3KB6A 1ZESA 4GVXA 4P1ZA 4AJEA 1BXRB 1NVBA 3FWKA 2AFHB 3OD1A 3PTZA 1O95C 2O7VA 2WDPA 3X1JA 4CTKA 2VTBA 3LC1O 121PA 5C46F 4X8HA 4KQ6A 1PL6A 5FBRB 1DE0A 1G8GA 3SVZA 2R6HA 2E5FA 1UAGA 5ABPA 2SKDA 2AN1A 1LJUA 3P2IA 1CQPA 3G7NA 5EUBA 4MITA 4AVYA 1RRPA 1G2PA 3FWHA 4P2BA 4GQBA 4FWBA 5FFFA 4CMJA 1NJ2A 3JYQA 5FDFA 1MRSA 3HLYA 4ZARA 3DPSA 1Z8DA 4M55A 3WYDA 1NVDA 1RLIA 1XR3A 2AYYA 2QP3A 2WJ3A 4JUDX 1L5KA 2FN4A 4YAEA 1KSFX 4OFXA 3RSFA 4RXUA 3SC4A 3CRQA 1KU6A 2I03A 4HLNA 4RMNA 1GG9A 2G06A 3GGPA 3IJEB 5G1OA 3K9GA 4GZLA 4OYLA 2QVLA 4H1TA 2IF0A 3PQ4A 4HB3A 1SBQA 4NFYA 4AP9A 3AHIA 3M9XA 4CKBA 1C41A 1XTUA 4O5OA 4CG2A 3KEGA 4J2TA 3E0XA 2ODTX 4NARA 4U9IS 2UYQA 3LHIA 1N2GA 1E4OA 2Y67A 3R3VA 4D0LB 2IUSA 2BTQB 5H16A 1L1RA 3PEEA 2PKEA 4NMWA 2QXYA 4JL8A 3TQTA 2FMTA 5EVJA 2RHWA 1FLAA 5FHQA 1UBGA 1ZLYA 4JGBA 1I9CA 2CVPA 3IB3A 4Q4LA 3ZY4A 5FOVA 1I7QB 2RSLA 1SCDA 4YCNA 3IERA 4FOLA 3U3JA 4KIFA 1UM9A 1QIDA 1WX1A 3RUHA 1SKYB 1P2BA 4L0MA 3RYCA 3B3GA 1Y1KE 3KYJB 4P3PA 3HCWA 3UJ7A 3L40A 3EVGA 1OYVA 2GHTA 5TGTA 2PZGA 4DSOA 2ATCA 3I6QA 4B81A 2P2GA 2P2DA 4PSCA 4WY8A 3I73A 2AYXA 3N3AC 5ALGA 4D57A 5CLFA 1CYDA 3B1XA 4C4RA 3VNAA 2Z2IA 2ACVA 1GGMA 4C7BA 2OA0A 2GXAA 3FW1A 1ORIA 1V96A 3QPCA 2DRIA 3BFJA 3QUSA 4M2LA 4MQ4A 4PWYA 1RYBA 1BS2A 2PRZA 4JJFA 4PO1A 2AW5A 3ROEA 2I6TA 4MRSA 3HA3A 1EQAA 1XVTA 1NG1A 4QFMA 5DXAA 2A5FA 2RHBA 3N86A 3FLBA 3DBLB 1HK7A 1DV2A 5JQWA 4EM6A 1L5VA 4AXXA 4ZCTA 1AZTA 1O9BA 3ESZA 3M7IA 3UHPA 5IKXA 2FKAA 1JR6A 1N9GA 2FXIA 4JBNA 5KWIA 1MB2A 5HKKD 2C7BA 5JADA 3CM0A 1L2TA 1KR2A 4B3XA 5BVHB 5HTOA 2DYKA 1DKRA 1DKNA 4LMPA 2JLZA 4HDSA 1CUZA 4NQRA 5IK2A 5JT1A 5L95A 4Z0NA 1DKQA 1VJDA 1XGKA 2UV8A 3T3GA 3U0VA 1A04A 2C5GA 1N3IA 2DUJA 3CLTD 2CNNA 2VF5X 3WHIA 3WP0A 3F4BA 4J0FA 3K05A 5DYGA 1QK5A 1UKZA 2BGJA 2ZSDA 1ML3A 1TIKA 3BK7A 3E1KA 3OQBA 4Q3LA 3N76A 4U7FA 4S3MA 3FMIA 3V1TC 4BMSA 5DGDA 5T3YA 1ZBDA 4MQBA 1R9GA 4B46A 3PC8C 4BMVA 2CVHA 3GPBA 1J2JA 1E9EA 3OQ1A 2FAXA 3SSAA 3TI7A 1ZL2A 2GXSA 2ET6A 1GEGA 4DNXA 2CDRA 2D5LA 2ZBDA 1RC0A 2BFNA 1GGKA 4DIKA 4ZI7A 2GVDC 2R1VA 1ODCA 4M1TA 4UD2A 2W6JA 4GPAA 4DRXB 4EBBA 3PWTA 3RC2A 4AI6A 1DTWA 3H1TA 4MV1A 4LSGA 3EXHA 4KR3A 2ACEA 1KJ8A 2VVTA 1DTSA 2DBRA 2A84A 3O9VA 2HW8A 2YJ6A 4OSOA 5DI3B 4D99A 3U7GA 4DA9A 1AURA 1PEKE 1OFVA 3FWNA 2IJGX 5CLLA 4QQFA 4CIDA 4DTCA 3CQ9A 3W77A 1QUFA 3KYCB 2B1RA 2WJPA 2IK8A 4KPUA 5EE5B 5HDQA 3ZHZA 5JFGA 1DBSA 1EKXA 1QR6A 1UUFA 2XXJA 6REQB 3ORSA 4OQNA 4BRWA 1E1YA 2Q3LA 2X8JB 2YIMA 3S2SA 1W2GA 4DWWA 1U1EA 3GZNA 1SQ5A 4NV1A 1YCDA 3R24A 4B6RA 4EW3A 5HUJA 1WVMA 5DX8A 1WZCA 3FNBA 3PFKA 1YMUA 4AZ0A 2FEMA 1IC6A 3L79A 4QNRA 3PD0A 2XVMA 3JR7A 5NLLA 3SKXA 3WSWA 2OBNA 4JU8A 3C4QA 3OY7A 1DSSG 5KTSA 6LDHA 2R1VB 1P4GA 1EM8B 4KQGA 2HMUA 2ZB2A 2BRUA 2FWBA 3O3OB 3W3ZB 2W2LD 1XOIA 3PI7A 4BNKA 2HF9A 4KKXB 4ARUA 1W36B 1JHXA 4RCZA 2VF2A 3BRCA 2ZJYA 3K9NA 3IP1A 1K5PA 2QXUA 3QI7A 2ZTUA 3NC0C 4X7PA 3UXYA 3INYA 3F90A 2CFRA 4FJ1A 5DCYA 2Z30A 1ZQ9A 3U3DA 1OFUX 4F5ZA 1ZNQO 2E48A 4N0MA 3NAQA 1W4LA 3FR8A 2C2BA 2YR0A 4C7JA 1W0JA 1M5UA 3JD2A 4UDYX 1I4OA 3BL8A 3OM0A 1H2BA 2IXDA 2NYUA 2PT6A 3PUWA 1RWWA 1HV8A 2VSFA 1UOPA 4BUZA 1PJ3A 2OP0A 2R85A 1ZH4A 4RHTA 2PKQO 1WHSB 3RK1A 1KMIY 3C8DA 4MDYA 4A0RA 2DSTA 5CDFE 1CBUA 1HC7A 1UT5A 3CYFA 5IFLA 2WE7A 5K8LA 2F1IA 1DL5A 2BBTA 2Q9CA 3JVVA 1J0AA 3RC9A 3ZJTA 2VSOA 4BLUA 5FUYA 4L16A 3MGAA 1T2CA 3DMTA 5TGDA 2CN1A 2YMQA 1M76A 3CF6R 3BN3A 2RGXA 3NBQA 4D4KA 1IEQA 3R20A 4JASB 4Q18A 1RI3A 3L0PA 4PGFA 2AOXA 4U1RA 4QQRA 1IUNA 1TC2A 2XOXA 4G1UC 1ORTA 3SIPA 3D1VA 1FVXA 2JLUA 4LHSA 4HATA 3RVQA 2O0JA 5DX1A 5B30A 1A5BB 3E8XA 4OFBA 4QOEA 9MHTA 3JXEA 2QI9C 3FOEC 4JB2A 5F7JA 1V1MA 4C7MA 3QMMA 4HV4A 1ZR2A 4NU5A 3GG9A 4DN6A 2H16A 3VDRA 3GYGA 3DBIA 3VTAA 3ZWXA 4LE2A 3UMSA 1BH2A 2J3HA 3HCCA 2B7BA 3PXXA 3AM4A 4GL4A 4PYLA 5FADA 4I50A 3SEAA 3WK9A 4F84A 3GLGB 1KMNA 2XCSB 1LBSA 2FN7A 2Q46A 4HZUA 4OI4A 3TOVA 2E4WA 3FJOA 2Q5LA 4CG1A 2VAPA 1PZEA 3BT7A 3GG2A 1UP7A 3UHFA 5AVJA 5JHGB 1QRUA 3A9CA 1AH2A 4GS5A 4JUCA 4R0VA 2O1WA 3I0NA 3IPYA 2DPXA 3LM8A 3KPYA 1IOZA 1CQJB 1KHHA 1U6KA 2Y66A 3NU1A 4XX1A 3D5QA 3QX3A 1QRDA 3TL6A 3NBAA 1CY4A 3MG9A 2YY7A 1VHLA 4P7FA 1JAXA 3F9IA 4KDCA 1TT5B 2IYZA 3CRW1 2GPJA 2WM9B 3A7DA 3JW8A 1EVJA 1HDZA 1SCUB 1ZNWA 5FB3A 5HZMA 3C3BA 5ALUA 5T4BA 3LDAA 3MSCA 3DAOA 4B31A 2EW8A 2YC4C 1B74A 1GNRA 1J49A 3ZZ0A 4BN0A 2YWGA 3CZPA 4YT8A 1Z7EA 2K2QB 3AH8A 4LN1A 1CY6A 2V7QD 2X22A 3ZJUA 3NVAA 3FTDA 1C9JA 3V1LA 3LCJA 2EKZA 4B74A 2Y1FA 4MWTA 3UUWA 4F9FA 4BB6A 4OBWA 3K09C 3QLVA 3JALA 4ZT6A 1W44A 3R5HA 2UZ3A 4JI2B 2JASA 1MPTA 2CCGA 5B7NA 4FD3A 4ND1A 1YHNA 2QSUA 3K5HA 2VC2B 3LCCA 5JWHA 4YUYA 1FMTA 3K3PA 4CT5A 1DRWA 2KYRA 3GC6A 1VA4A 5H9VA 3TMAA 4TZKA 1ST3A 2ZVQX 3ADBA 4KO8A 4C3OB 2WV9A 5I7OA 1YZKA 3OZSA 3RTDA 1M67A 3IAS6 4IDHA 5K4HA 1ACMA 2IYUA 3L4BA 2Y1XA 2ZR8A 2IL1A 2R79A 4QGHA 3TX2A 1M9NA 1RC1A 1GT91 1OY1A 5KOJA 5JAPA 4LDJA 3PXDA 4Z9AA 2FUNB 3RFVA 1I13A 5FFNA 3MK31 1KI7A 4RW0A 5AIBA 4YJFB 3H2YA 3U9LA 3ZDXB 4C5CA 3OEHA 5IJ9A 3Q2IA 2HGSA 5E6SA 4ZU1X 4RF3A 1QH8A 3RGGA 5H02A 4Z1OA 3U60B 4GKJB 3CGWA 2IU6A 1E3WB 1H9CA 4A73A 4J2OA 3BMQB 3W1EA 1AQNA 5AKGA 1U3WA 3L1VA 5KIAA 1ZN7A 4F60A 3IAS1 4DSUA 1UR5A 4QJBA 2DWCA 2Z5FA 2R6GA 3GGJA 1ZVKA 4CW7A 5JCZA 3P97A 1L5QA 1N3BA 3QIAA 1M6EX 4EATA 1ETHA 3B85A 3JTEA 2ZSUA 2XWPA 2ZSFA 3OMLA 3L0OA 3K96A 4OHRA 4EFKA 1DFIA 1WNFA 1OH8A 4EW1A 2OHOA 4ZOBA 4BQRA 3KHUA 2PRKA 3JQGB 5CVVA 3RS0A 3WJ1A 2I8LA 1QCYA 4FPXA 4C29A 5IXYA 5LOVA 5IAKA 1YFZA 2Z57A 1KOFA 5CIQA 4GR5A 1G5RA 1JUDA 1EGAA 2OHVA 3HVHA 4ME6A 4US2R 2DQYA 2RGCA 2CJPA 1BDBA 5AM5A 2QN3A 4G3XA 3ZHVA 1T3LA 2IT1A 2QUHA 3EGEA 4JS0A 1JLKA 1JDBC 4GWKA 5DF1A 1SU8A 3W04A 3BAFA 2W6CX 3D8UA 4Q1DA 5JH7A 3TBFA 3FDFA 3N1UA 1DTWB 3Q2KA 3E7DA 4Y2QA 1CUDA 4A1OA 1O9HA 3OD5A 3RF7A 4G1CA 5E4FA 4V39A 2R1UA 3FYUA 3ITEA 4FGKA 4NAUA 3WGKA 3WGVA 1V7CA 3QMVA 2EDCA 4GX1A 2ACWA 1XQWA 4DIUA 5J2TF 2VAMA 3CWCA 3B1FA 1QVVA 1UJNA 2ATVA 1UJMA 2ORYA 1SIBE 4O0LA 4AC9A 4RTKA 3MN1A 2DH6A 1S0UA 1SXQA 1U1GA 1ZUD1 2Q5HA 3PICA 4HYTA 4ZZ1A 2J07A 4FSHA 3IUJA 4URYR 4HGPA 2QUIA 421PA 3UENA 2Z95A 1MB4A 1M6VB 3BWXA 4I0WB 3SQXA 3QVWA 3FB4A 4EJSC 2IYVA 3C16C 1M1ZA 3DR3A 3CF4A 4FHZA 4H7IA 1RZRD 2C5BA 5LB4A 5TVKA 3SE7A 4HTAA 2MTBA 1OIXA 1L3CA 3V4LA 3OJOA 1KWGA 2VP4A 4RX1A 2N42A 2W83A 3ROMA 3JQAD 3WLIA 2I4OA 3C3XA 1BEZA 2J4FA 3RS3A 3TW8A 5AVTA 3T12A 2P0EA 4WZAA 4RZQA 1X0XA 4QEDA 2XSZD 5I4KA 4RMIA 3NONA 3QVTA 1G0OA 4UE3S 2D7CA 3KPJA 4TQUS 4GC5A 5MN4A 3MMPA 4RTSA 2TRSB 2XEXA 4RPKA 3IV9A 3LZDA 1AO0A 4D8YA 2VEDA 2A6PA 3GMSA 4X1OA 3TLKA 2IUYA 1U2PA 1Z28A 5CJJA 5EMMA 1V6SA 1TZJA 2JFHA 4NHOA 3EW7A 3AINA 3GJQA 1DO2A 2Y6UA 1KRHA 1P1HA 4CG3A 3TECE 2X13A 1IQ0A 1CEQA 1QIKA 1RRFA 1P4JA 2IOFK 3L1UA 4YQEA 3LUHA 5KYWB 2H2AA 2ZDHA 3SEZA 5K0NA 5IT9A 1E0KA 3IEVA 4AW9A 2WSSD 2J9GA 3BHIA 3O47A 4PYMA 3T7RA 4M1MA 3SDSA 1X1BA 3TW8B 3X2FA 2CJWA 5EG5A 1P7PA 4ER5A 2XZOA 1W75A 4ZN6A 1HKUA 3BE8A 4NEHB 3UCFA 5KSPA 2ONKA 2JJ1A 2WAYA 1JL3A 5EQTA 3WGZA 4BMXA 1R50A 3ABOB 4TKUA 4E1AA 4UVIA 16PKA 3ZGZA 1XRJA 1ZMTA 4NZZA 1JIUA 1KDRA 5H80A 4X54A 3R0XA 3HYRA 5KTMA 2A1TS 2X3FA 3VU0A 4CLXA 2FR0A 3H87A 1HDCA 2R87A 5HG0A 3NHKA 2H85A 4JLSA 2X0FA 5IFKA 1JXOA 2WKRA 2ZPAA 2BE9A 2GILA 3IAEA 3U7EB 1YSCA 1D2EA 4DV3B 1TJNA 2WD7B 3QMWA 2JK1A 1A97A 5AK6A 2HU8A 4D9FA 4KH0A 3IVAA 3WQRA 1YUMA 3IE0A 5E38A 3KYDA 1GP2A 5HMLA 4YRZA 1CJTC 1T9CA 4PLHA 1E2IA 1UJ5A 2A9RA 2FPUA 1HDIA 1B7GO 1PWZA 2HT6A 3BWEA 4KODA 4U6NA 5KO2A 4JYMA 5LA6F 2J0EA 2EYUA 2QLBA 4ZOAA 5FI5A 2O4CA 3KDSE 1MO5A 2FUCA 5FPQA 4E5KA 3FDZB 1MJGA 4X3OA 5I5GA 5CT4A 3AG6A 4OOFA 1E3IA 3AXSA 4LTDA 4D80A 1L5HA 1XPUA 4I1IA 2P9QA 3CUWA 1G7TA 2FPWA 3P0RA 2C5FA 1C1XB 4IS3A 2W2OA 5GMOA 4BU1A 2GM4A 4XCVA 4YX9A 4H6PA 2NPFA 2OGSA 5DGTA 4LVNA 4LMBA 3DOEA 4N7MA 4U5XA 4J0JA 4KNVA 3PZRA 4CF7A 1N57A 1OFGA 5AJZA 1HZZC 1AKUA 2VR1A 3GRRA 2VATA 4MMYB 1W46A 4M1YA 3IIMA 4XWAA 4IQ4A 1KTIA 4G5OA 1GPH1 2J9FB 3ZUPA 1SUCA 1XZCA 3GUHA 1PT9A 2B4AA 2Q3BA 2HMWA 2Q4TA 4X44A 3KM0A 5L3SB 2Q4BA 4LQDA 4C05A 3HVUA 4P5PA 1T8SA 3K0KA 4INAA 2ZRCA 5K3CA 3JQ9C 4LXHA 4HAIA 4QDKA 1COZA 4EF5A 2FOIA 1RI2A 4OI0A 1DARA 4TL8A 3A9RA 4L7VA 2HSDA 4M9ZA 3RH0A 1QGOA 4ARZA 5BNWA 5EJ6A 5IYZA 3BQMB 3EW9A 3I8XA 4PC1A 4N0EA 4Q9AA 1EFDN 5FNZA 4P92A 1N92A 2VXOA 3Q98A 4B4DA 5GM1A 1T0IA 1N33B 1Z5OA 2O52A 2EKDA 3I2YX 1AKMA 2JIZD 4BKPA 3RYFA 4EGFA 4B6OA 4E2YA 3QTBA 4R16A 4BVEA 2L0XA 4XDGA 4UOQA 2OK8A 2EV9A 1XWIA 2RD2A 3ZCRA 4LA4A 1E5VA 2WYVA 3D0QA 3FVVA 4HWKA 1ZGHA 1NHGA 1EWYA 5I9TA 3ZX4A 2JFYA 3PGXA 3DE5X 5L7YA 2LD4A 1X38A 3I01M 5IDVA 1IEXA 1FFYA 1U9JA 2ZQZA 1Q5PA 3Q6IA 1A4XA 3SAJA 4FR0A 2EFGA 3EE6A 3SKYA 3NKVA 3QEKA 1K4KA 1L5WA 3DZFA 3KAJA 2IDKA 3QY9A 3VM6A 1XNRB 3FCOA 4Y1FA 2CE7A 3PQEA 3VR2A 2UZ0A 1VPLA 2CYAA 1S9DA 1RE0A 2LDBA 3N8IA 2I1LA 3O38A 4FQ8A 3WQQA 3O21A 1QZ3A 2P5YA 3LGXA 5IVIA 1ZGAA 1T4CA 2YTZA 3HN7A 3HC7A 2J7PA 3GJ8A 3M1LA 1JYFA 2X0NA 3FB1A 4MO9A 2Y1OA 1XTVA 3AYXB 4U8HA 1Y5MA 2Y0EA 3OT5A 3D1LA 2ZBEA 4EL5A 2QLTA 1DIAA 5A0FA 2IU4A 3N0VA 1YJXA 4HWTA 4R05A 5ULLA 4J03A 2ATIA 4RPLA 4PNEA 4RK5A 3BXFA 4YV2A 4P80A 5DXFA 3GDOA 4DUGA 3TCXB 5JAUA 5E9QA 3V2UA 4DJTA 3RAFC 5DHUA 4W5HA 3LOPA 2QRNA 2OVFA 3CH6A 5G53C 3E9CA 3L7LA 4ZOLF 4O4IF 2XXAB 3VU1A 4AT1A 1W87A 3JU3A 5BYBA 3IEPA 2VTDA 4ETIA 1E59A 2NU9A 3QHPA 5HX7A 2F2TA 3OPYA 4CV1A 2YDYA 2CZGA 1IB6A 3HJHA 4NG5A 2IBSA 4IDOA 4IUDS 2FSVA 1EHIA 2WJZB 3JZAA 1VG8A 2PMKA 1TJ5A 2QN2A 1EWTA 1YU9A 4PFKA 1O77A 4IVPA 3HJNA 3ACCA 1QG4A 3FF1A 3FYHA 4BX9A 2ECQA 2KLBA 1WCWA 3AR6A 1UADA 1MD9A 3KO8A 3RBXA 1X1EA 4RETA 1Z2AA 3WGMA 1IDOA 3MIIA 4AJ4A 2YVQA 1VXOA 3RADC 3VC7A 1JT9A 1WCIB 3GB9A 1YR8A 3MCZA 5TMDA 3QKSB 4BCDA 3MC1A 3OFND 1E32A 4Y7DA 2AK3A 2YY6A 1Z13A 5G40A 3EGDB 1Y81A 5BPFA 4J2HA 2E1RA 1NHWA 4JUAA 3V1NA 2FWIA 2FPPA 3MZ0A 4BOYA 5AOVA 1SCJA 5REQB 5TRTA 4YDHB 2PL3A 1EP9A 5DLEA 1XTIA 4S2UA 1VSTA 2X58A 1ZNZA 3E4CA 3RW9A 1JU4A 3BJEA 3VYSB 1N7IA 4LKOA 3AR4A 2WQZA 2P6NA 2ETXA 3WY9A 4IGEA 3ZLVA 2WOJA 4FWIB 5YASA 3LX6A 3NHJA 4XQ0A 3SF8A 6NULA 2B5WA 3O8CA 1W0KD 4F04A 3TOXA 2CJXA 4YYZA 1XTPA 3Q3GE 2IZZA 2EZ8A 2FFJA 4ETWA 3HUFA 2B6HA 2YFKA 3IVRA 1E5XA 3G2OA 4HNQA 2ZYWX 1XI2A 2B8WA 1KZ7B 3FZGA 5CLIA 5FXMA 4UU8A 4JLVA 5ISMA 1KAHA 5LB2A 1HH4A 1ETUA 3QVXA 1UP4A 2V1XA 4NESA 4UCXA 3TYXA 4OLBA 4CTJA 3QENA 1TM7E 1W88B 3H3FA 3D31A 3R2JA 5TPWA 1Q0SA 1CJVC 4M0MA 5JEDA 3B52X 1RAGA 3JQEA 2Z1NA 4NCNA 4ABTA 4OXNA 2VKQA 7ABPA 5DFAA 1AQ6A 5KU1A 1HYHA 2R5NA 1W2HA 4AJKA 1FP4B 5JI2E 3U9TA 1WZ2A 1D3AA 2HJSA 1PW5A 2QG4A 2WJAA 3OIYA 1MHTA 2PIAA 1F4PA 5CMLA 4PYOA 5MGNA 5HZHA 3ZWNA 2IYAA 3W3AA 3T35A 3HZHA 3H5OA 4RF5A 1RT9A 1BEUB 2P91A 3D02A 4NE9A 5BMVA 5I8WA 2F9LA 1J5EB 1R2QA 1ZN8A 3BIJA 5ENZA 4NPAA 4JT2A 1X9HA 3BMXA 1IHDA 3EA5A 4IDQA 2JIQA 3Q88A 4I6JA 3JR3A 4R2KA 4WGGA 4ZDWA 3BWDD 1DVRA 1C30A 1Z4KA 1M7HA 3U19A 1XK7A 1OZFA 4EPVA 3PGA1 2MSKA 2ZXUA 1E7QA 2O8NA 1GCAA 3AXTA 2V7XA 4IDBA 3K20A 2A0WA 4TUYA 2RBGA 1Y8ZA 1R4MA 1ZD3A 3TVYA 4BO7A 3SLGA 4U0KA 4EPRA 3LT0A 2P3QA 2EWVA 1GFSA 1L4UA 1N5MA 4X95A 5EXSA 1A9OA 2GR9A 3BUSA 4LUCA 3VVMA 4ZMBA 1WW2A 3PTLA 3LFTA 4H1HA 1EX1A 1DEXA 1TRKA 4NR0A 4ALKA 1VZ3A 2BGWA 4WZBA 1KI1A 4GBJA 2NSHA 2XE4A 1PVVA 3FNGA 4NMHA 2R1TB 5CX1A 4N3AA 4OX9B 2ZYAA 3BJMA 1YFLA 1F0YA 3TCKA 2VHTA 3C6BA 5GZ3A 1Z82A 2Q6TA 1N6OA 3EIOA 5GV8A 5IVPA 2FW7A 3W2IA 5CA0B 3E5MA 1FP1D 2QM3A 3EWAA 4JP5A 5SY6A 4YYEA 4EA9A 3ZV7A 5C7LO 3AJEA 4P08A 3NDJA 3VAZA 1N5JA 3JRWA 5AJWA 1NN1A 4PYQA 3TOCA 5BUSA 1ZR4A 2BI7A 2HBYA 2I65A 3GF4A 4AFNA 2Z98A 3LK7A 1MEJA 3GQBB 1U7ZA 1Q57A 2G71A 1W94A 1LDYA 2RHCA 3PHLA 5A0TA 2GN8A 4G9GA 3C87A 4FFLA 1AHHA 2X14A 1I2AA 1NI4A 2HJGA 4CEJA 5HOQA 4TM8A 1Z5NA 1XFDA 2BEUB 4MEJA 1HQKA 1TK9A 2W00A 5DTRA 3GEBA 3D3JA 1L7EA 2V55B 3ZE9A 2QTNA 1JVBA 3FBWA 3G8DA 4MUMA 4L5JA 3QEBZ 5EP4A 3HFJA 4DLNA 2JVJA 3QA3E 4N9WA 2BFWA 2QYSA 3HJRA 1THMA 2A86A 4UJ3A 5AI8A 4HQNA 1PZGA 2I3GA 2XCOA 3OHPA 3NNSA 3PPVA 2K87A 1RYMA 2RB5A 4HCJA 2G6BA 4OATA 5AKZA 3H2GA 1EI9A 3HBMA 3CEJA 3FBTA 2YOHA 4FYKA 3WJ7A 2Q28A 3DNPA 1SHJA 4LQCA 1HMYA 1T5IA 1YQWA 3O7WA 3WLAA 3LRTA 1U65A 2LTAA 3K1AB 2XDYA 2OC4A 3O94A 4EHDA 5AJTA 4LHYA 3PQCA 5IWCA 3TX6A 4JLNA 5T6BA 1LLDA 2J7PD 3MOSA 1LI5A 3B1VA 1G6Q1 5BV8A 3RKRA 3UEOA 2ZG6A 3EA4A 2JAOA 5CT9A 4OHPA 1LDEA 3Q6MA 3TB6A 5FD8A 5JQGB 1QO0D 3KQMA 1ZUNA 3CN9A 5EJ9A 4AKTA 5KKAA 1U3DA 2BUBA 3GEGA 1KAGA 2NZ8A 3D6HA 1ISGA 4Y6SA 5JNSA 3T9BA 2IZ5A 3H5RA 3E8MA 3ABSB 4BASA 3MTDA 4FUTA 3TLJA 2O6HA 1USGA 1K9SA 1O94C 2DF8A 2BDEA 2ZBQA 2PX8A 3GRVA 3M5PA 1P5ZB 1BOFA 1BVRA 3OSUA 4MS1B 2DC1A 2O5RA 4FHEA 1L5SA 3NM4A 4L4ZA 5F5NA 5CA1A 3ZV6A 3DZHA 1YKGA 3UAVA 4URVR 2O7SA 1G41A 4CXMA 2IDMA 3VPAA 3O8OA 4TMXA 5B55A 2EHJA 1V3TA 2N75A 2ZPTX 1DBIA 3O8QA 3EIWA 3C4JA 1TA0A 3NUGA 3RG2A 2QN6A 4J1TC 2HHLA 1JQDA 1P2TA 2G04A 2SCUA 5AR1A 1JHOA 5P21A 3TPZA 3IE1A 1E2FA 1IZ8A 3UJ3X 3QU9A 4HLDA 4XDZA 1NW4A 3Q3VA 3THSA 3JTMA 3TE7A 4OU4A 4B6FA 2BKEA 2VLBA 3EASA 1QTQA 4CF4A 3EEIA 721PA 5EEGA 2O5VA 2GJ8A 2P6PA 4JR2A 4D81A 3PHIA 5ER6A 3PCTA 3BE4A 3PEUA 4JVLA 5KSYA 4NEGA 4NYMR 2HXSA 1AD2A 3HPQA 4G85A 4QPPA 5K0LA 4G0MA 4YXFA 3CONA 1VRWA 3TF5A 3FKSA 3HNPA 1FBNA 1NJ6A 2P62A 2WTXA 1IMOA 1BWPA 2IHUA 4J0KA 3RRMA 3DMGA 3ZXUB 4C4AA 3EBOA 1KS9A 2YC2C 2ZYGA 4BBZA 3ZCPA 4KP7A 2IYWA 4WL0A 1GDDA 5HCIA 4HJRA 2RC5A 4MR9B 2C7GA 1HTWA 1R18A 2R84A 1ZGBA 3W1WA 4DV4B 3T5BA 1Y80A 2N46A 2R751 3DC2A 3RJZA 5L9AA 1E2UA 1F48A 2OBYA 3TNYA 1FTQA 1P6UA 2H4XA 4BV8A 4NZNA 4J0CA 4K9NA 1ZIOA 2PM8A 1BHO1 4QPJC 5F2EA 3CPJB 1G3UA 4UXIA 1H22A 1M0EA 4DV5B 2GN6A 1H9BA 1VMAA 2YVLA 4O2RA 3F49S 8GPBA 1UBSB 2KSQA 2SKEA 3DKPA 1MC1A 2Q6VA 1I2DA 3E5HA 3L6RA 4RAQA 1H8HD 3UJCA 1AK1A 4C07A 2VAWA 1IPHA 1V8FA 4UHBA 1G5HA 3CBGA 4GVPA 4P34A 4IQFA 5JARA 5LIPA 5ALHA 4ZVUA 1IBCA 3H0EA 3HY6A 4HZGA 4FCTA 5TT1A 3PGMA 4DQ0A 2X6RA 5KQSA 2C0QA 4Q9LA 3F6BX 2CWWA 2TYSB 4CN8A 2P90A 3ZWBA 2J3QA 5KVQA 1E79A 5LP6C 4NJMB 3NORA 1F2UB 1G66A 4I4TA 1KARA 3H9UA 2KBEA 4W7IA 5SZHB 3WYGA 1X86B 4PW0A 2QN9A 2HK7A 4S1TA 4EYOA 1ULBA 4Q7JB 3R3HA 4IXNA 5ALLA 1K2VN 3ZDBA 1GU1A 4ZVOA 3WZLA 1UMBB 1YS6A 2E6KA 2O2HA 3C6YA 1UDXA 4RKFA 5K0GA 2H5EA 1XN4A 5FIUA 2Q62A 3L8ZA 2BHNA 3AZPA 4M87A 2CHGA 4RE6A 4YWJA 3VTKA 3GRZA 1OU0A 2VJOA 3FZQA 4KXQA 2PZLA 3MGGA 4D8WA 3JVUA 4MA0A 4J7XA 4PZYA 3COYA 5JMTA 1JWBB 4KPFC 3KTOA 4RIEA 4YQYA 3HL4A 1L5RA 3LTNC 2V7TA 3BIXA 5EIEA 1QGED 2JFBA 1SVMA 2Z5VA 4Q6WA 5BN5B 3P0EA 5JNTA 1E3LA 5AVWA 5B58C 4BFTA 2YZNA 3DE7X 2ZUWA 4XYEA 4N5DA 3FG9A 1OC4A 3SDZA 5KYTA 2R8BA 4ZGBA 3FPSA 4MIYA 1KDOA 3EPLA 4BO9A 4G8JA 1DBVO 1MOZA 1W5BA 5ALMA 2E4UA 4AG6A 4XB6B 3SNKA 5DHPA 4EHLA 2BR4A 2CXTA 4XVRA 4WZZA 1NUHA 3HCAA 3HKBA 1T0BA 4BZZA 1V37A 1GLGA 3W5CA 2JATA 4IRMA 5DNCA 1SU7A 1CV2A 4C3VA 1CY7A 1S5PA 3CLUC 4HMOA 4PSVA 5AXDA 1DG3A 1ZFNA 2SBTA 5B1EA 3DV0B 2BGNA 1RWVA 3N7AA 4RVFA 3FYDA 4QOSA 2WJHA 3NAGA 4X93A 1DT3A 5G0WA 4ND5A 4QOJA 5DGCA 1ZRMA 2GEJA 5LYYA 3VVLA 1JMKC 3B2NA 2QLJA 1DC4A 4K6HA 3V6MA 1Z4MA 2O07A 3UWDA 4DCOA 4BX3A 2ZS7A 1MIOA 1OE0A 1J2TA 5KVVA 1RQNA 3QU5A 2Q9BA 4DVGA 1PNOA 4YI3A 4D9CA 3KAPA 3ANXA 4GIBA 4H15A 5AFSA 5ECDA 2C2YA 4BNLA 2ZITA 3PDWA 4XD7D 4HK4A 5LJLA 1HM5A 1U8EA 3G5MA 4HBZA 3MHPA 2NU7B 3HU5A 1W88A 2GD6A 3VDXA 3LAWA 1NGSA 1T9HA 1X3SA 4NV3A 1JJFA 3N2ZB 2Q2QA 1Z68A 4G0YA 3NDBB 3WKAA 4HSGA 1LK5A 3NG1A 1UJCA 3IQIX 1NVEA 1SOAA 2ILTA 3CRMA 8OHMA 2F59A 3BIOA 1DUVG 4QTTB 4J91A 1XHLA 4DEYA 4FFWA 3JYOA 2HQSA 4FU0A 4ENUA 3UMBA 5FI1B 1OYYA 1YZYA 1ZH6A 3I2IA 3SPXA 3PITA 4AIRA 2GLXA 2GA8A 4Q82A 3VZCA 1IN4A 1T4MA 1VKHA 1D4FA 2I7DA 1KSHA 3U7RA 4AJ9A 2JLYA 4OJQA 1P77A 1TCBA 2XJ9A 1BC5A 3DCIA 2O8FA 2DBZA 1DWQA 2P3SA 3FHTA 4TL7A 1Y5RA 4DDVA 2Y05A 1QQ7A 2Y0CA 3OBIA 3QXSA 3S5JA 3W3AH 4AS2A 3UMYA 2R9VA 5J5VA 4UW9A 1PFQA 2GJAA 1L3BA 1YOVB 5JMOA 2ID8A 1KR5A 4FUQA 4EG1A 2NO4A 3DAGA 5I47A 1RAEA 4EUFA 2BUAA 4UAGA 1W5SA 2FUEA 1KVSA 4Y0NA 1ZXBA 3EG9A 4LK2A 4F45A 5GZ1A 1U2ZA 1MAAA 5HJ5A 3IGFA 2V9PA 3EZYA 4BGDA 4MVJH 3CLRD 4FEGA 4S2EA 5EVCA 5JUWA 2NW6A 3DDSA 2ZXFA 3FTQA 1RRMA 2I1QA 1V4BA 1WMEA 2I55A 4W8OA 5DX0A 2PFKA 4MYUA 5L3ZA 3TZ6A 4BEWA 2NSLA 6ABPA 1QH9A 1MQSA 1XZIA 2P2CA 3FZEA 4L5CA 3NH6A 1QWOA 2R0QC 3DXZA 2HU7A 2PQ2A 4Z53A 3T06B 2W6JD 3K92A 1FC0A 1SD5A 1IBSA 2M9MA 3PUZA 5DBOA 5FEUA 4DIBA 5JFTA 1RABA 3G1TA 2QPOA 2QAGA 3LLMA 4R5HA 5H4GA 3S2FA 1EK1A 3LWDA 3SHWA 2JDIA 4EL0A 5K1ZA 4MUIA 3SFVA 1WVIA 4MCIA 1QORA 3CNLA 3Q8XB 4WXMA 1T9BA 2O8EA 4IJQA 4N6NA 4QHYA 1M2OB 1KIFA 4OK3A 2VJCA 3HCNA 3V8QA 2UAGA 2QRJA 1EH5A 3IHWA 3VO1A 2NOAA 5BW5A 5CW2A 5FLKA 2BONA 2DY0A 2VHZA 2Y93A 5AKKA 4YUWA 3PXBA 3BCSA 3A4VA 5FOTA 2ZSHA 3FYUC 1DWOA 1FEZA 1LK7A 3I9MA 3PUVA 4M0FA 3WIOA 3MTEA 1LKZA 3A1VA 4PAMA 2PMCA 5EESA 4QASA 1JZSA 2ZXEA 1M8JA 3CLRC 4PC3A 1A27A 5FUQA 8LDHA 4DIFA 4J29A 2ORWA 3KSRA 4GECA 3BXOA 4I1PA 3R9XB 1MQ9A 3DOJA 4UM8B 2R8PA 1F9AA 2O1XA 1YE3A 2UXDB 1MVNA 1OGJA 2B2CA 1GZDA 2A58A 2RH8A 1DFHA 4MR9A 3MGKA 4RM3A 1SJ9A 4I9UA 1LW6E 3CKMA 1LBQA 2AOVA 2V8OA 2W93A 4FT4A 4U63A 1D4AA 1SOVA 1KAEA 5LN1A 2D62A 3RASA 4B2IA 3NTVA 3OT4A 2FWNA 3BJRA 1K27A 2FKNA 4Q24A 1O94D 1ZCFA 3EOBI 3OFJA 1DX4A 1X19A 4NYIQ 4D5EA 2Y1CA 1JLLA 4DE5A 4YAOA 2W5UA 5HGJA 1U6IA 4RSHA 3AVXA 1GYRA 4AY2A 2R47A 3HFGA 1HGXA 3GFOA 1G9SA 4EQ6B 4OUDA 1H2YA 1THZA 5TB5A 2YHBA 5JCPA 2O8VA 4F3CA 2WF6A 2HBQA 3KP1A 2ODBA 2REQB 5IH3A 5LA6B 1U3VA 2PX3A 3P9SA 4KDFA 2IQIA 5ELMA 1QGUB 4OLFA 3PG5A 5B4TA 2Q50A 3T4PA 3REQB 5EQDA 1KSJA 3I76A 5CD1A 1LVHA 1SH7A 1OCEA 1GAEO 2FQWA 1FYDA 4BRSA 1XMOB 4QECA 1AKVA 1BMFA 1U2SA 2RKOA 1ZK4A 3CPEA 3FROA 4NAVA 3IT3A 4Z9XA 3WMFA 4BKQA 5BXQC 5BVGB 3FN4A 3TM5A 5KYXB 3PR3A 4WQMA 4E2ZA 4G5YA 4N5MA 2FEWB 1P33A 3GJ6A 4OXQA 4PQRA 4Q4HA 4NFHA 4QYWA 1EQ2A 2H4YA 1YTLA 4BNVA 2FMUA 4LWZA 4B0PA 1NXQA 1GVHA 4DOMA 1DKLA 2GCOA 2FFRA 2P2NA 4CQMA 2O2ZA 2P35A 2QSJA 1NJ5A 1OLUB 2BMFA 2QRUA 4WJKB 2B4QA 3G5AA 4FOSA 4EELA 4GOND 4P5EA 4Z4HA 4Q3AA 3AW9A 5TXGA 4ENTA 3UPUA 1I5OA 2VJMB 1MGOA 4LJYA 4AX4A 1ND6A 4X1IB 3QY0A 1FDIA 4DB4A 3FH0A 5LBTA 5CG2A 1R9NA 1ZIYA 4G0WA 5FTMA 3U3OA 3K32A 3ELUA 4X41A 3UT6A 4DZZA 1J0DA 1M8PA 2OQIA 2PKRA 3INGA 4M9CA 4QICA 1USKA 4V0ME 5IDQA 1LBTA 3W5HA 2WKQA 4ZRNA 5CB4A 3UFBA 3OPXA 3QLJA 1RS0A 2AN4A 2F1HA 2XPCA 4KAXA 4N39A 3ROPA 4FMCF 5GY7A 4DMCA 4JKYA 2C3UA 4L1KA 2RIRA 1N5RA 3I1FA 4PHFA 1GUBA 5E7QA 5D5HA 2CFOA 3O75A 3IAM6 1O0SA 3UOWA 2REOA 1WCV1 1QQAA 1C9DB 3WGQA 4XYGA 3D4BA 4JXXA 2DHQA 3A6EA 4WBNF 4F1KA 3WYNA 4D1YA 5CJPA 5AK3A 4LZZA 2VTVA 1R9MA 3C6QA 5EL0A 4NK4A 3PF8A 1RBMA 4FKZA 3IP9A 3VH4A 2H3HA 3PRKE 3O5AA 2DP4E 3MCTA 3WK4A 2CB9A 1KO7A 5FQOA 4B2PA 1IM2A 1H8ED 3F9RA 3OLXA 1WL8A 4WOJA 3KFVA 2EFHB 5EHQA 3RNOA 4BNXA 3HYCA 3IHLA 3NT4A 2E4YA 1YBMA 1OFHA 1UWVA 2C9MA 1ST2A 3NALA 1AK9A 4UU0A 4Z5XA 1HR0B 1T3SA 3LC7O 4W9MC 4KVZA 2HY7A 4L07A 4EYKA 1BWSA 1Y98A 4G1MB 1WUHS 4L08A 3Q7EA 4M86A 3F1KA 3OP4A 4RM2A 5DT9A 3ZCXA 4L74A 4G36A 2Q5OA 4EI8A 2OV2A 3AJRA 1HKHA 4K88A 1NVKA 3H2SA 4YJHA 5AJXA 4A0HA 2FRDA 3ZV4A 4B6PA 2DPMA 4C9BA 1JHYA 4PR0A 5E9AA 3U49A 3UWKA 4BJ1A 2R6AA 4FX2A 4S1VA 1D0IA 1X3LA 4J3JA 5F7OA 2O19A 1N7JA 4CDGA 2IIBA 2G9UA 3B78A 3NYIA 1GFZA 1P4SA 3PPIA 2OCBA 3SJZA 3UAGA 3UJBA 4KXYA 5FHRA 2YBDA 4NJMA 4DC9A 2WPDD 3F74A 3FGZA 3NKLA 4Y2SA 2VQDA 2QT0A 4EHIA 4EH1A 1Z45A 3LJKA 3PKZA 4X9XA 3DDUA 1S02A 2RG7A 3DL2A 3EWIA 3WWZA 3ILXA 2CFTA 2E2WA 4KV9A 3IQXA 4TL6A 1XZNA 1XF1A 4YP6A 5MFPA 5BNZA 3TZCA 2EQBA 2IIPA 4K8OA 3CRZA 3KTDA 4EY6A 2I9PA 5GPBA 4X20B 2H7VA 5K0ZA 2W2QA 1AZSC 4K9QA 2H7XA 2NZVG 1T5SA 3CX7A 5AK0A 3TS1A 4OQFA 2G28A 2PUVA 5D3QA 3TQIA 4EARA 1ZEJA 1FYVA 4FYVA 1JQJC 1OZGA 2VH2A 5DGIA 3EVBA 2GS9A 1EFCA 3L5OA 5EJ7A 1NVUQ 4BYMA 2WYHA 5DNYB 2XNDA 2QTBA 1QS0A 1V8OA 2H31A 2VXYA 3D6FA 3PCXA 1MT3A 4UHKA 4AS1A 2O2EA 1H0KA 2JGKA 3K6SA 4M53A 4L5BA 3DKRA 3B53X 2GN1A 2FH5B 2YV1A 1J24A 2IHTA 3R7SA 3CFYA 4HQKA 4KQHA 1AS3A 1JPNA 1MW9X 1TJ3A 1X8JA 3Q72A 1IAQA 1OPRA 3NTQA 1Z25A 3CV3A 4H0CA 4UNQA 3K9CA 1LPPA 4JLAA 2NWQA 2IU0A 1BMDA 2JHAA 3Q40A 3L0ZA 3U44A 3PDCA 2HQBA 2Z1DA 4K81B 2PSEA 4PBTA 4RVDA 3IURA 5LSAA 3FYUB 3ITNA 3TUIC 2JD0A 3FF4A 5B3JC 3DKVA 5C4IA 3MLBA 2FK7A 5JNLA 5K4GA 1I14A 3T1VA 1RADA 4RK7A 4E13A 4Q4CA 5IABA 5KS2A 4FK8A 5A6SA 3DW3X 2FPXA 2G9ZA 3SOPA 4BNFA 3DBHA 2YXEA 1T4BA 4MPJA 1QYWA 3V4OA 4RXTA 2Q1XA 2AFIE 1WB6A 2CUKA 2HCTA 2XMSA 3HB9A 3MOIA 5G3ZA 5IAEA 2WK1A 3GUCA 3H5LA 4ENWA 3LHFA 4X62B 1A9TA 3QSGA 4ZQCB 2W6OA 4UU7A 3CGGA 3F67A 3V7FA 3LDFA 4EEXA 1Y5LA 1JKXA 3D43A 1J09A 3C3WA 5LMUB 2PS3A 5CLQA 5D8DA 2OFFA 1M2EA 3HDTA 1MA0A 1Z75A 2XZPA 1KHTA 2QUKA 4K0RA 1ZITA 3H8JA 2QQFA 5A71A 3LGSA 4F2GA 1LSSA 4NULA 2PMWB 2NPOA 2RK4A 4WK2B 2C5LA 3Q7QA 4IIFA 4M7WA 2X0DA 4EZIA 1JDVA 1UPTA 3T94A 5KSOA 4G5SA 1G2QA 3C5CA 4Z1MA 2R7KA 3GGDA 2Q07A 3WYCA 4FX5A 4Q7MB 3HWSA 3A1DA 2RAVA 4N3BA 1AVTA 1J22A 2QX6A 8AT1A 1FYFA 4WKCA 3TQHA 3TR6A 1ONSA 1NKTA 1OXTA 1UKYA 2GX6A 3CA8A 3D1JA 3FM9A 2P78A 1QX4A 3LT5A 3MTIA 3PXCX 4G84A 4YDRA 2GK4A 2A1IA 2OB1A 1PTJC 4DVJA 2OILA 1JDNA 5TR9A 1P9LA 1AA6A 1PTKA 1NUAA 1G9XA 3UH0A 3ZQ4A 2WFLB 2R60A 3JQAA 1WW3A 2ZVPX 2P4EA 4FGWA 3SXUB 2PQMA 1L5ZA 2VAVA 3IIEA 3NEJA 4B40A 4BGIA 3DT9A 5CAEB 1JZTA 1XLVA 1Y7LA 2IHBA 3HYLA 4N8EA 1GQ2A 3DYBA 3IR7A 2XW6A 3U62A 3QKTA 3DG9A 3DFZA 4MJ7A 5JC8A 1N8TA 4MUXA 2P1ZA 5TEVA 2AOTB 3VH3A 2JFXA 2ZIAA 3AB7A 3OJ0A 2H92A 2O6LA 1JBQA 2Q7DA 3W2FA 4J16A 1DJOA 3ESBA 3ETCA 5B3AA 2RMKA 4IOMA 4ZTBA 3S3TA 2BFMA 4B79A 1TMOA 2FMHA 2PXXA 4R5MA 4I1VA 3MBOA 1MJHA 1ZINA 1WM1A 3CCCA 3EFEA 3GLIB 4C6SA 2MSDB 4HGOA 5H4HA 3T0GA 1IN6A 1YZNA 2A7XA 2AR0A 3QPBA 3TZHA 4PG8A 3HNOA 4RMJA 3AUYA 2EG9A 1UOQA 1WULS 5JBIA 3SHFA 2OG1A 4MHOA 3AEKB 1G17A 1LI7A 3PUYA 1D07A 3UJPA 3BWVA 2D0OB 4GP7A 1NX9A 4OHMA 2I7TA 1G5IA 4OSEA 4IMJB 1JSXA 4MMXB 1RQXA 1ZM9A 4R1PA 3KK0A 1YH3A 3HR8A 3HEAA 4J76A 1GPJA 5LLTA 5JMWA 1TM5E 1T2UA 4ZHQF 5JDCA 3I09A 2O9JA 3TZKA 2EFEB 2C29D 1R8SA 4Q1BA 2VZLA 5DTJA 5HBRA 1DAMA 5T4FA 5C81A 3O31A 3FBGA 3OKFA 1DCTA 3F78A 1EVQA 1U3TA 3BMNB 4CG0A 5CEFA 2BGIA 3T95A 4U2DA 4F3KA 1FOEB 4KN6A 3DKIA 1ZH8A 3UTDA 3CEHA 1XKQA 1YB2A 3ZKWB 3UAWA 1YO6A 1Y9DA 3KVNA 1A9ZA 1KU0A 3I5XA 1YZVA 1RP7A 2YN2A 4MVJI 3L4JA 4ALMA 3PQ7A 3RF6A 4UTRA 1UZLA 1PL7A 5FNVA 5HF6A 3KKEA 3SY8A 2HPZA 1ZD2P 3DM9B 2O0LA 3N87A 2UYGA 4HH0A 2IU3A 2OOSA 1DAEA 3OPYB 4G4GA 4MROA 5JTUA 4TS3A 5D7BA 1BDHA 1UBTS 5D1NA 3DV9A 4LJLA 3L41A 1T1RA 4IGKA 1O96B 2JVKA 2Q5CA 2YWFA 4E5NA 5E6SB 1Q7TA 3D8TA 3SS7X 1A8PA 1L4EA 1P80A 2HGZA 4LCJA 3EVZA 3ZCSA 3V9PA 4C0HA 3AEUB 3FOFC 2VT2A 3OKPA 5BW4A 2XQIA 4LIPD 2PZKA 1KRXA 5KQLA 3AVPA 4RLHA 3V7UA 2VHVA 3LY5A 9ATCA 2O0HA 1CUYA 2BGTA 2XTJA 1LLQA 3F8WA 3TNDA 3G68A 4EO4A 3KE8A 5DSTA 2GJSA 2LR0A 2PL9A 3A4MA 3D3EA 3MFYA 3Q11A 2TMKA 3RBZA 1G98A 4M8LA 4LEIA 4RELA 4JT4A 3DYVA 1AC5A 3MWKA 2XNDD 3U48A 3A4NA 4FFBB 1TTHA 1U0TA 4ACBA 1JLLB 4JEIA 3WG9A 1G5TA 4ZYYA 4AB1A 4N48A 1H6CA 2D6FA 3T7TA 3A3OA 3PRYA 3TRKA 1KEEB 2Z8YM 3H4MA 1V8ZA 1E1CB 1XKTA 1GTL1 2WUWE 4WADA 3WDKA 4TMYA 3N53A 4KREA 4DXHA 4QGFA 1A50B 1CZUA 4O8CA 3BD6A 2JGNA 3Q3CA 1M2KA 1VLVA 4HDNB 3QLTA 2AWNA 1QIJA 4DY4A 3AU9A 4LX8A 4YVFA 5DWDA 5EJIA 3U3ZA 1OSNA 3EGCA 3QQPA 4NNJA 4JDUA 5B64A 4B3IA 2FRXA 1PP4A 2FJ0A 3WGHA 1YL7A 4CZ2A 3GNQA 4MHSA 4D43A 1P3DA 1WB4A 3OJWA 3FR7A 3N0TA 4OAOA 4QM7A 3KXDA 2OV3A 3VNVA 1U9CA 3CH4B 2H9AA 2XDQB 1PL0A 3W7VA 1JLRA 5IHXA 2PUDA 2JIOA 3N70A 1HDEA 4OMDA 1ZXLA 2YDXA 3IAHA 1H3NA 3OX2A 5JASA 2O2DA 1NQ5A 3UUGA 5LP6F 1C7IA 3CLTC 4RVSA 1U3FA 3LGAA 3FTPA 3L5KA 4CF3A 4CMEA 4EPYA 3CIOA 5J2UB 2OO5C 1LTKA 2ZZNA 3JQFA 1UEXC 5EE3A 3PR1A 5IAGA 4W5WA 2VJAA 1KAQA 2GFQA 4CBVA 3DFFA 2RH9B 4V1CA 3REFA 2HDWA 1D04A 4WKGA 4YRAA 1L9XA 4KE9A 1OA1A 3I9KA 5EXDA 1Z0UA 6CHYA 1QC5B 4ZO9A 4PWZA 1CUSA 2QZJA 1GTJ1 2HA0A 1NNSA 2WFMA 2XR1A 1YNSA 3A1CA 4I4NA 4K9MA 4KIGA 1DCFA 2PGOA 1WW8A 1E1QA 4REQB 3X3HA 1E66A 3ZS9A 1YRWA 2XXAA 1I4TD 1P61B 1W34A 2IZOA 2MMGA 3FCSB 1C2YA 1IXSB 2EQAA 3ONNA 3QKWA 3R5TA 2JFWA 5EZYA 1GXSB 4KBGA 4KLZA 1NQTA 1FNDA 2B34A 2K2WA 2OFXA 1Z34A 4L95C 3P45A 2B99A 4QOIA 1Z9BA 2OCDA 4IDPA 4BWGA 2Z6AA 3UGQA 2J0QA 2KE5A 4B6GA 4FBMA 2M2IA 3V7WA 5D3KA 4WA8A 3AUKA 1DG9A 4PVCA 4NJOA 2O1EA 1GKIA 3UWSA 5JATA 1MOSA 4HX5A 2IW3A 1NJGA 4NFLA 3A3PA 3N05A 4IG9A 1XRLA 4BMYA 3AKCA 1XD2B 3AVYA 2YMPA 3KUKA 1DBWA 2YBEA 4E22A 3HB1A 2XD9A 4C76A 4DTIA 1GM5A 3GWZA 4AZTA 1V6CA 3RCBA 3JQCA 2IYQA 2OCKA 4D42A 1EFVB 1CEXA 3IA2A 2FCRA 2ZETA 2HLNA 4NH0A 3SN6A 2VAXA 4Q05A 4E2WA 1YI0A 2QRGA 2X1LA 4XIFA 5FTNA 3W06A 3MOGA 2C99A 4GL2A 1C0LA 4W5RA 3AFMA 3WBBA 4DQVA 2O5CA 3VYVA 1LC0A 2BLNA 3FETA 2DUWA 3IUEA 5KTKA 1TD1A 1YDFA 2IHZA 5BO5A 4BAGA 5KYKA 3BH7A 4JLBA 2GERA 4RO0A 4MO2A 1YB5A 4KHZA 1ZPDA 1QHEA 3JWEA 1K8QA 4ISCA 4QU5A 3K1ZA 1TYZA 4BQSA 4EI2A 1E3QA 5MN5A 4B0OA 4L4YA 4C5AA 4C1NA 4WXEA 2GH1A 4ZPJA 3HYNA 4X1KA 1V5EA 1GFIA 2J3EA 5KOYA 2ERXA 2WIKA 3PNPA 4O8ZA 4OJMX 3U5TA 5CITA 3QVUA 4UQLA 2K7ZA 2COEA 3BICA 3AGPA 1OAAA 4ZEXA 1LRJA 5J4KA 2QVZX 3QXHA 3JSXA 4B76A 2KHZA 4U5QA 3MJDA 5EWLB 4BNZA 4ND4A 5KTRA 4I9HA 3D3WB 3S28A 4A8PA 1D0VA 1S1MA 4RCVA 4B4WA 1L4YA 2HDNB 2P6RA 2F4VB 1R5OA 1WD7A 1SKYE 5C1OA 4DR1B 5DTEA 2PLNA 3NCTA 2Q29A 1OI3A 3SZUA 1SZCA 1PS9A 1DMRA 3CNBA 4ZRDA 4UTOA 4RNDB 2BE7A 3GD7A 3JRXA 4YASA 3I45A 5EZSA 4YCLA 4MCHA 1UK8A 2Q0SA 1QGZA 1X39A 3D7KA 4G5HA 4H0FA 5F7ZA 3S68A 1W5FA 1M5RA 3OHSX 3K70D 1AK2A 3VAAA 4H18A 3O8LA 3O3NB 2UZ4A 4LHXA 4NMMA 4B8WA 4C7OB 1BZYA 3I39X 2R8OA 4GGMX 1CHDA 1C30B 2ZIXB 2L69A 3GJ7A 4DFDA 4DR4B 4L76A 3DHWC 3IIKA 4ZI7B 5HOEA 2I22A 3A9UA 2IHNA 2PR7A 4LYDA 2YHSA 3RE1A 2OGWA 2E5WA 4O4HB 1E6KA 4CMBA 1GCIA 3W4KA 2OCGA 2R4UA 3PYLA 3GLKA 2G88A 3R6DA 2GASA 2Q3MA 2VUTA 1IOVA 2I4RA 1S2MA 2ZI5A 2WU0A 3LT2A 4NDNE 2EKPA 1SKQA 3IDSA 1L9KA 2H63A 3RJMA 3UPDA 4K9LA 3M49A 3RQSA 2R8RA 1HX7A 4E21A 1V6AA 4KG7A 3WP1B 3W9SA 1UCFA 3FCYA 3NHLA 4A3SA 2CLHB 3C6XA 3I83A 3PQ8A 5FTJA 3PKIA 4D56A 2ECFA 4ZK2A 4C6TB 1UBEA 4LRXA 2EU8A 5COAA 1VKOA 1PW7A 2WD7A 2J45A 1JAYA 5F9MA 5A4FS 2CNOA 5D85A 2WJIA 4KE8A 1FFAA 3VUFA 1E9AA 3FNQA 5IMSA 3DBRA 3I4LA 4IZIA 4F7DA 4L8YA 4OFZA 3DWIA 3AI2A 4FNGA 1UODA 1QGYA 5JNVA 3HI6A 2H59A 4QQNA 4CL3A 4CM6A 3HRHA 2HFJA 4HXGA 2R65A 1KZ6A 1NVAA 2QE7A 1GKYA 3VGJA 4BLPA 1AX9A 1H0RA 1V45E 2FFAA 2WTEA 3SI7A 1CQZA 4BPRA 3ZVNA 2Q5QA 4YT5A 1A4RA 4MQEA 5I9MA 3RHTA 3AI1A 3R7WB 3IXQA 4D3YA 1XP5A 2II6A 1V43A 1AHPA 5AP9A 1CNMA 1H5QA 1OAOC 1WBDA 2ZQYA 3CRRA 3GQVA 2ZAIA 4DLAA 4ZXFA 1C14A 4KQ9A 2ZYTX 1OBCA 2IPXA 3R0IA 3Q4GA 1JPVA 4NBUA 2WOOA 1K75A 4PFQA 1CJKC 4IY1A 3AEKA 4HXYA 1Y1LA 5DISB 4BXOA 2FJPA 2QAIA 3TBKA 4AG5A 2EKLA 4B3RB 8ABPA 3LO8A 1N0IA 1L1EA 3O9MA 1KEEA 1IUOA 3NBFA 4YJ2F 5TJHA 1GV0A 2D8AA 3V4RA 3FLAA 1MB3A 4WK4B 5FBLB 4K9PA 2EP5A 1G8MA 2XQKA 1H6BA 1HE2A 4FR2A 1QAMA 1WV0A 4LNUA 1ZOPA 3OTIA 4AN4A 4QYXA 3QE3A 3R3XA 4Z4EA 1E4EB 3U61B 2VYQA 3GW8A 1XROA 4I5IA 3IAUA 4G41A 4N7RA 4FCVA 1UK9A 2XZDA 1E79D 4PXYA 3ZYCA 4LGYA 5H3HA 3JVIA 3UKJA 3KKZA 3EXG1 5A0VA 3GHYA 2FPMA 2YJ5A 3AGQA 4ARBA 4H3SA 2C07A 4RK0A 1C2TA 5KB3A 2LP4Y 4O2AF 3PIDA 5LLSA 3L93A 4M0DA 3T1NA 1VHDA 4O4LF 1RLOA 3EVCA 4RF4A 3SQOA 3PQ2A 4QTXA 2G3YA 2BGUA 3GGOA 5KSZA 3N0WA 3RYHB 3Q7PA 5AH0A 1TJYA 1UM9B 3IH5A 3WWEA 1RAIA 2AZTA 4URHA 5THKA 4YAGA 821PA 5ADHA 4DUZB 1K3FA 2AEEA 3C48A 3S2GA 4DDUA 2HKIA 4YH1A 2PD4A 2ZGVA 2GUWA 2H08A 5ALTA 5FI0B 4XRGA 3L4KA 2VDQB 2ILVA 3G0DA 3JD1A 2PZBA 3C7AA 3M2TA 1VLJA 3OECA 1A69A 1BXRA 1A7AA 3W8DA 3PDIA 1LTQA 2MJLA 1YS9A 3KBOA 4ZHQB 1BCRA 1T26A 4JJ7A 2X77A 5K3EA 4J1QA 2ZJ0A 1M73E 1PR0A 2LWIA 4BVJA 1YT5A 5F1PA 5HPYB 5JYCA 3AFHA 4WCFA 3DS8A 3LUKA 4ALLA 3ZZTA 1KY2A 1AUQA 1L5LA 2IOQA 5ERGB 1NW7A 1JHMA 2C3MA 4KQ2A 4OKIA 4Z2YA 3CWQA 3VR4H 1AE1A 1JTVA 4HH4A 4M0LA 5AJYA 1UC4B 3KCNA 4N03A 3WV5A 2Q9AA 3OHMA 3VSAA 2ENWA 5EGNA 1APBA 1Y6GA 4UCFA 5BT8A 5B1YA 4Q4AA 3E9NA 4DDHA 3B1KA 4WGFA 4NYJQ 1W9HA 1X0VA 3UNXA 4D0NA 1NNLA 2EP8A 5I3CA 1PT7A 5IPFA 1W36C 3WRXA 3F5MA 1AGRA 2ISCA 4FFVA 5C80A 4ZGGA 4HPJB 1MFPA 3UXMA 3WHKA 1C81A 4UM5A 1YQGA 3N3BC 4BKMA 1ZCZA 5JCJD