4YO8A

Crystal structure of helicobacter pylori 5'-methylthioadenosine/s-adenosyl homocysteine nucleosidase (mtan) complexed with (((4-amino-5h-pyrrolo[3,2-d]pyrimidin-7-yl)methyl)(hexyl)amino)methanol
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
238
structure length
238
Chain Sequence
b'HENLYFQGVQKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVATQLVQHDVDLSAFDHPLGFIPESAIFIETSGSLNALAKKIANEQHIALKEGVIASGDQFVHSKERKEFLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISDNADEKAGMSFDEFLEKSAHTSAKFLKSMVDEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminodeoxyfutalosine nucleosidase
publication title New Antibiotic Candidates against Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase/hydrolase inhibitor
total genus 85
structure length 238
sequence length 238
chains with identical sequence B
ec nomenclature ec 3.2.2.30: Aminodeoxyfutalosine nucleosidase.
pdb deposition date 2015-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4yo8A00
1Z5OA 1PR6A 3KUKA 2AI2A 1B8NA 4GKAA 4QASA 4UC0A 1N3IA 2ON6A 1RT9A 1CB0A 1NC3A 2A0XA 1Y1SA 1SD2A 1PR5A 4QFBA 3UAYA 4G41A 5JPCA 4M3NA 2QPLA 3KVVA 2H8GA 4RJ2A 1YQUA 2XRFA 4DABA 1TCUA 5I3CA 1U1EA 1VHJA 5CYGA 3P0FA 4PNPA 3BGSA 1V45E 4BMYA 1RR6A 1OTYA 4BN0A 1PK7A 1JE0A 1ECPA 5CXQA 4TXNA 4DA8A 2OECA 5EPUA 1Y1RA 1Y6QA 3NM6B 4NY1A 4TTJA 1U1GA 1U1FA 2ISCA 1K9SA 4R2XA 2I8AA 1V4NA 1RXSA 1SJ9A 1A69A 1Z5NA 2AC7A 4LZWA 3MB8A 3OF3A 3D1VA 3UAVA 1PWYE 3BJEA 2OXFA 1ODLA 3DPSA 1T8WA 3NM5A 1Y1QA 1RYZA 4L5CA 4U2KA 1LX7A 3GGSA 2A0YA 4JOSA 1RXCA 1NC1A 1ULBA 2QSUA 5CCEA 1U1DA 4TS3A 1A9OA 2AI1A 3OCCA 4DA6A 1OUMA 4DANA 1T0UA 1V2HE 1ZL2A 4QATA 5CYFA 3F8WA 5F7ZA 2B94A 4KN5A 4TTIA 1I80A 1TD1A 1QE5A 2P4SA 1Z37A 2HSWA 1ODIA 1SD1A 1A9QA 5CCDA 2Q7OE 4BMXA 1YQQA 1RXUA 4JWTA 1ZOSA 1XE3A 3IEXA 4F3CA 2I4TA 1Z5PA 1Z36A 3DDOA 5DK6A 3K8OE 1JE1A 1YR3A 2QDKA 1RSZA 4OY3A 1ODKA 1Z34A 3E9RA 5F7XA 4LNHA 3FUCA 1NW4A 4TS9A 1PBNA 1OV6A 1G2OA 4OGLA 2A8YA 1V48A 4R2WA 3U40A 3GB9A 1U1CA 5KB3A 3OOEA 1JDUA 3BL6A 3MMSA 5EFOA 4MCHA 5F7OA 3FNQA 1FXUA 4K6OA 1Z39A 2HN9A 3ONVA 1A9RA 5B7GA 3ENZA 4GMHA 3OZBA 4DAOA 4QAQA 1JYSA 4F3KA 1VMKA 5EUBA 1Z33A 5F76A 1M73E 3KVYA 4NSNA 3DF9A 3KVRA 3FAZA 4EARA 2IQ5A 3SCZA 1JPVA 5IU6A 1JDVA 1PF7E 3PHCA 1Y6RA 2PGAA 2HRDA 4DA0A 3PNSA 4OEHA 1JDZA 1PR0A 5F7JA 3EMVA 1K3FA 1RFGE 3K8QA 5IFKA 2BSXA 3O4VA 1V41E 3PNPA 4JP5A 3DP9A 1YRYE 1OTXA 1SQ6A 1LV8A 1LVUA 4NS1A 4G8JA 1RCTE 3E9ZA 4DA7A 3E0QA 3C74A 2OC4A 4WKOA 5B7NA 3UAZA 4L5YA 4TXJA 5ETJA 1OU4A 1CG6A 3EUEA 5F73A 1VFNA 3UT6A 4IP0A 1YBFA 4F2WA 4D8XA 4E1VA 4TYMA 5C80A 5B7QA 3FB1A 3LGSA 1TGVA 4LDNA 1JDTA 1TGYA 4TXHA 4M1EA 1PKEA 4BMZA 1T8RA 1A9SA 5F77A 3T94A 3EUFA 5B7PA 1RXYA 4D8VA 4YO8A 1T8SA 1B8OA 4F1WA 2QTGA 3FOWA 4FFSA 4TXLA 4G89A 4GLFA 2AI3A 1PR4A 4I2VA 4WKNA 3UAXA 4OGKA 4DAEA 3KU4A 1PR2A 4WKCA 1T8YA 4TXMA 3EEIA 5CXSA 3IOMA 4GLJA 4QEZA 4P54A 3TL6A 4ECEA 1Z38A 1JDSA 3NM4A 4WKBA 3QPBA 2RJ3A 4LNAA 4WKPA 4OF4A 3LBAA 4LKRA 3FWPA 4L6IA 4D8YA 1OVGA 3NBQA 1V3QE 4L0MA 4L5AA 4EB8A 4TTAA 1PR1A 2A0WA 4DARA 4MCIA 3DJFA 4YMLA 3ODGA 4OJTA 1VHWA 1ULAA 4PR3A 5K1ZA 2GUWA 3PHBE 4YNBA 4F2PA 1Z35A 1TCVA 2OC9A 2HWUA 1ODJA 3OZEA 3BSFA 1PW7A 3KHSA 1K27A 4QARA 3UAWA 3P0EA 3O6VA 4D98A 3OZCA 5F78A 1Y1TA 4D9HA 2QTTA 3OPVA 1PK9A 1A9PA 4M7WA 3OZDA 1JP7A 3INYA 5FAKA 1WTAA 3LA8A 4H1TA 4MARA 4YJKA 3OOHA 1Q1GA 4X24A 4R31A 1C3XA 1A9TA
chains in the Genus database with same CATH superfamily
4J1SA 4JLNA 2XMBA 1HUQA 1W9HA 2ZUDA 4G25A 1EFLA 4MUMA 1KI1A 2W7TA 1IBKB 2QS9A 4GM0A 2G5GX 1X1BA 3ECCA 1AKVA 3OEHD 3SZ3A 2J6HA 2ON6A 2YICA 3IIIA 3IIEA 2OG2A 1X1SA 2KBFA 4HSGA 5FPPA 1BX0A 2VUSA 2RGDA 3RHTA 4JITA 3L4JA 1G59A 2HHHB 3TZQA 3DOUA 2D62A 2GA8A 2ID7A 5JUWA 3L8DA 1ZK1A 4MAAA 2PA0A 1IUKA 5KOHA 4F46A 2YIVX 4BZPA 4LOHA 1XFDA 4CXMA 2IV3A 1AUXA 1L4FA 1UFKA 5AVKA 3FLMA 1CY1A 3B1FA 4FIZA 2PL3A 5C32A 4GGOA 3VH1A 1ZIXA 3FHLA 2XMSA 1XDGA 2AF4C 4ETWA 4C4SA 5CEFA 5FOVA 4GKJB 3R5XA 3FPGA 1DQYA 3V4FA 5DGHA 2HMUA 1Q7EA 1ZJ6A 5DGIA 4Z0TA 5AJHA 2DUWA 3QEAZ 4PNPA 1HSOA 4GVXA 4RM2A 2QR5A 3ORSA 4ARZA 4D9MA 1MVOA 3MWYW 1C41A 1R5BA 5KTTA 2HY7A 1V9CA 3DXFA 3L6DA 4HNAA 4XGKA 1GADO 2WD7B 4L4YA 2NV6A 2ZYUX 3QEMA 1HEYA 5F2KA 5AK6A 2XX3A 3RH0A 3EZYA 3WR5A 1EB9A 4ZDKA 3FFXA 1N6IA 3BF7A 3O4FA 4U2DA 4ZVUA 3CCCA 5K05A 3PK0A 1A3CA 4G5RA 3OZRA 1QE3A 4L5JA 1QTIA 1ZHHA 4S3MA 1V4VA 5J5AA 1U5BA 4GZLA 4DPKA 1T36B 2PWZA 3H2GA 2CYAA 4BVJA 1YDFA 4FINA 5LL6P 4KHPB 1UH5A 2FZLA 3ZGOA 3AEQA 4DQXA 4F71A 2E18A 1Y6QA 3EXIB 3GYBA 4HQNA 4R5HA 3HA7A 4OYYA 1TYBE 3EZNA 1I24A 4UBIA 4B7UA 2VTKA 5ALDA 1TEVA 2AG5A 2ZBQA 4Z1MA 4UTVA 2R79A 3MT9A 1IHOA 2CLEB 3MCZA 4MW2A 1GFIA 4XD7A 3TW8A 3WJ7A 4F9EA 1WW2A 4RTPA 1IXKA 3B78A 4MRPA 4ND6A 2CWDA 4J90A 4TRNA 5JCJA 2AD5A 3C8DA 3PEEA 3VV2A 2X6QA 2P6PA 2W2LA 3AHJA 3DXXA 2BDEA 1SVLA 4I1UA 4IDNA 5CB8A 2QNRA 4QHTA 5I8ZA 1TF2A 4MVJF 2XB9A 5J59A 4E2XA 2OHVA 3ANXA 4KLAA 2DFPA 1HTTA 5EMJA 2CF5A 2FG7C 2PBFA 3OHSX 4AO8A 1B2LA 1EFVA 3V3TA 4QPCA 4V24A 5BV7A 4CIWA 2EFGA 1ND6A 1Q17A 4TTQA 3KG2A 3NCHA 3IERA 5HGJA 3COYA 5GP1A 3ILXA 4Y1GA 1CS4C 1OI4A 1KP3A 4R16A 3VO8A 4DF3A 4XWWA 1PJZA 2PUJA 4H7HA 4S04A 4WZBB 4EQ6B 2BRUC 3OG9A 1KDYA 2E4YA 2OCYC 2JIDA 3T5PA 3AR9A 2NQ8A 3VTZA 1XXLA 3WTBA 3RFFA 4ZV7A 1QGUB 2DQZA 3UTDA 1V1MB 3QVUA 1K6IA 5JV5A 3GMIA 4BGDA 1ZNWA 4HH4A 3WC4A 3U17A 4BLPA 5KS2A 4JOSA 2PX4A 1JDBB 1WVMA 4QO7A 1QHNA 5KYWB 4B40A 2L19A 1DG9A 2YJNA 4K9MA 1LRKA 2X3FA 1GUYA 2C54A 4PZ9A 1YI1A 1XCGB 2W48A 4K6MA 4TV8B 1T5BA 1AT1A 3T41A 2IVZA 4GDFA 2V7QA 4HGZA 1H6DA 3QEOA 5DK4A 4ENPA 4KN5A 3KOYA 4PPQA 1RIFA 3FY4A 1P4RA 2D3TA 3I9OA 1OJLA 1L4KA 2OCXA 2SKCA 2KPOA 4OOFA 3MTEA 4WLUA 2M6KA 1DHRA 4HEA1 2RHWA 1MC5A 2ZWAA 4AKSA 1H4VB 4QTYA 3ORRA 4P83A 1N78A 3HR4A 2H5JA 3CF2A 2IHZA 1ABEA 2ZRJA 4NDZA 4Q9LA 5E2AA 2NP7A 2H2AA 3E3NA 2CE2X 2PUFA 1RXUA 1XE3A 1D0IA 4WBNF 1ABFA 2IHNA 3ZLTA 1F5NA 2AC2A 4UBKA 3FPAA 1ZUNB 2RKOA 3DVSX 2QDKA 3AF3A 1QH8B 1G2QA 5F5XA 3THWB 4B6RA 1YFLA 5JU6A 4CM7A 4WMLA 5FA8A 2D59A 2C9CA 1G20A 2Y0EA 1CNEA 3DVAB 5KDLA 2VQ6A 1Q7CA 1KAQA 5C8XA 1XEXB 3L8YA 3FUCA 1FUKA 2FPMA 5TMEA 1KZ7B 1OA0A 1AGNA 5SYMA 9ATCA 1EBFA 4JT9A 5CVTA 4O0LA 3U4QB 1R10A 2HLNA 3SYKA 1C1DB 4XSVA 2HMTA 2QNBA 3LQRA 4N5DA 1U0JA 2EATA 2UVPB 3M4ZA 4ZPJA 3WLKX 5IT5A 2BTQB 1GL3A 3B13B 2XEXA 1K8YB 1SCBA 3BSWA 4MUGA 2QA5A 3C2QA 5CMLA 3CUKA 2VRCA 1ZUWA 2RHCA 2V9PA 1QS0A 3MCVA 4DBVO 3DTNA 3O4RA 5ICEA 3TD2A 1Z17A 1IZ8A 3O74A 4QOSA 3EGEA 5TEWA 2JAOA 3QVVA 1SB9A 5EFOA 2GXSA 2HQRA 4MQ6A 2N3ZA 2HLDD 3IVCA 4I7EA 4P0TA 1DL5A 3WRXC 2O57A 5AO9A 3TKYA 1LTQA 2WT4A 2Z56A 1Z39A 3OCYA 2P91A 2PL1A 2ZM6B 2VDOB 5BSWA 1BROA 4WESA 4XYLA 3IBFA 3TFOA 2R6JA 4JFAA 3B5EA 2CV0A 4NI5A 1T34A 5JO9A 1BH6A 4JFRA 4L5IA 1P73A 2DFVA 2X7HA 3GJ6A 3WX0A 3BXGA 3NT5A 3EH2A 4FJ1A 2FVXA 2N1BA 2R44A 1W93A 2WUEA 4R1OA 3S1AA 4ZMBA 1X80B 4N76A 1R6DA 1SKUA 1L7VC 2C2MA 1T13A 3F2IA 3AQ4A 4XUDA 5A5VA 3HRHA 2ZRAA 4X45A 1FBTA 3A1DA 2EWVA 1AKWA 4HUJA 1RWVA 3PXBA 4XQEA 3S2SA 5TMPA 1VP9A 2A0KA 2Q1SA 2REOA 4C3UA 1XDZA 2JH9A 4ZT7A 2FV8A 5EZYA 3VX4A 1NYRA 5CJ2A 1G2PA 1Q1QA 2BM0A 3P2YA 5EN4A 4NZZA 4RUKA 2Q2NA 4HDAA 1F0PA 1RXIA 2HA2A 4LWZA 4PBRA 1EWVA 1BVUA 3C3KA 3TZBA 2V3CC 2V1UA 3N75A 1KJWA 4PGFA 3HVHA 1QQBA 4MJXA 3R09A 1XQVA 2C4HA 4NE7A 4OKNA 3M4XA 3IUBA 1KOJA 4JBHA 4DR7B 3Q85A 2ZQYA 1CJTC 2UZ1B 2J32A 1RMYA 3K9BA 5KUTA 2PK3A 1R37A 4ZEXA 4NYIR 1EFCA 4HPXB 4B4WA 2WVGA 2JGFA 4EUNA 4OLFA 3D31A 3RYIA 3GNTA 3KJEA 5DEOA 1HYHA 1SC4A 2VNKA 3W5CA 2NUPA 2ZUEA 2E48A 1JLKA 2FRDC 1GR1A 3ELDA 2VT2A 1SUPA 2VYVA 4RA6B 1FQWA 3K5IA 2AC4A 4DMUB 5KX5F 4WFJA 2BEUA 3JZAA 3K8QA 5KQMA 2IZZA 2A1UB 1RAHA 3I5MA 4N03A 4YACA 1OB2A 4MKZA 1I2ZA 1YFKA 2HHCA 3N7AA 3DEKA 4ZK6A 4LI3X 3NORA 3IMKA 3C3DA 2VSXA 1FSZA 5EXTA 3WLNA 4C3ZA 5EPEA 5FUVA 3AILA 2JLSA 1O97D 3I2YX 3FYSA 1QLHA 2DWUA 2JJ2A 2LUOA 3KOMA 5COBA 1V96A 3K70D 5JZBA 1AB5A 2QMZA 2E37A 2GBCA 3ZJVA 1U81A 2A0FA 5HIIA 4HH1A 5CTAA 3DMPA 1PT8A 1SUAA 5JD5A 3A6PC 2CEAA 4R8VA 5BW5A 1AURA 4O4IB 1KO8A 4QYSA 3GRVA 4RPIA 3MG9A 2B82A 4HRAA 3R8XA 3W5AA 1Q0RA 4H08A 2PJDA 3FN4A 2QG6A 1AKEA 5GJWC 5D00A 5CFNA 3W2HA 3GJYA 1P81A 4JOQA 4N3AA 3V2HA 3LY8A 1AKYA 4N5LA 4D5GA 5E1OA 5KSZA 4X94A 1X7XB 3MJCA 4FXOA 4QQRA 5AVSA 2Q5EA 1Y6FA 4C89A 1ZMXA 3IE1A 1RXWA 4IYRA 4R0NA 3FTFA 2SCUB 3KJFA 1UUFA 1U3DA 1C1XA 1F8GA 1QOPB 1DSSG 4ND5A 5I9TA 3DCIA 3VR4D 4C0WA 3KEOA 5AVWA 4JLVA 5IXSA 1HRKA 1YA4A 2D4AA 3E05A 4N0MA 1U7UA 4LISA 4PRYA 4PC3A 2Q4DA 3F4BA 2OYRA 2TSYB 3L8FA 5CXXA 4FU0A 1JEDA 2ACVA 3WGMA 5IVPA 1JFVA 1ULSA 2HV9A 3RVNA 2AEJA 1AS0A 1DX4A 2BKEA 3A4LA 1L8OA 1PFGA 3ILSA 4M7PA 1OZ0A 3OE7D 3SNKA 3RB8A 3K1TA 3V8EA 3GG2A 3ICCA 3VJRA 3R41A 3R5JA 2O48X 1H2EA 1MAWA 4MRVA 1IIRA 5ERXA 2NO5A 5IN5A 2BVNA 3HVJA 1JEAA 1HLFA 1EFAA 2P9JA 1CS0B 1WL8A 4NULA 4XGRA 2XR1A 5AICA 1K4KA 4D8VA 4XVUA 1WZEA 4AJJA 1T8SA 2IY7A 5IW8A 3IHLA 4Y1EA 3U2QA 1GRRA 4I3GA 2X8AA 4GLFA 5EMKA 1O5IA 4ON9A 4FI3C 4MMYB 1NFQA 1XMSA 4OGKA 1EXMA 3O8LA 3TI7A 3T1NA 1JMYA 2VUIB 5K6TA 3T0GA 2X77A 5EE3A 2P69A 3OLZA 3QELB 4GNKA 1GN9A 4WZZA 3KSUA 4CIYA 1KEPA 4LYYA 1K86A 2VSNA 2YDXA 2YR0A 4FCWA 4W1PA 5TGTA 2J0EA 4CLRB 5K45A 1XQWA 2WLSA 4YGXB 4AKTA 3HFJA 2BMWA 3H9JA 4R1QA 4IR7A 4RFSA 3S28A 4S0ZA 4ZI5A 4LZLA 4GYYA 3IUYA 1P9WA 4PQFA 3FW1A 1FU7A 1YS2X 2HCRA 2X86A 1H5NA 3IOYA 1KAGA 3D8NA 3FD8A 3LFUA 3ZZNA 5KVAA 1N6PA 1YVEI 2OKGA 4M1QA 1AUOA 1G8YA 1LSOA 1BMQA 1Y3DE 3D3QA 5D3QA 2C8JA 3TZEA 2ADFA 3GQVA 3QWIA 2LDXA 2QZ9A 3C1UA 3ONFA 3P7MA 5K3CA 5JFTA 2AN4A 2R6FA 1TQ2A 3FUWA 4HEA6 4CRWB 4ZGBA 3L8ZA 2HL6A 1EP9A 4UM9B 1OI7A 3D8HA 1SOVA 2HDWA 3LM8A 1H69A 4EY7A 4PQEA 2GQ0A 2GSWA 1HQCA 4NCBA 2QLMA 4QRIA 3R3WA 2FCAA 5FYDA 3GZNB 3ECAA 4MMZB 1BDJA 3U13A 3AERB 4L16A 3H7IA 2DSTA 4GR9A 4XPZA 4BMSA 1DBVO 1TNDA 4HWOA 2ICAA 1W0KA 1JHYA 4CE6A 2AG6A 3NT2A 1L4NA 3G6KA 2OGZA 4J1QA 1HORA 5ALLA 2PX6A 1R88A 5FOWA 3HU5A 1XYVA 4B5LA 2OB1A 2F1IA 2WF9A 3U3JA 4AN4A 3ICEA 4BVFA 4WOPA 3KT0A 1YB6A 1JIIA 2ZBGA 3GRAA 3IVGA 4EBFA 5IJ9B 1H94A 4ZWNA 1ZUD1 4KUHA 1XTUA 2J5BA 3I30X 3OKFA 4M9ZA 1CUGA 1H9BA 5KO2A 3RAFC 2ZZKA 4YRAA 4L95C 5CA1F 2G8NA 3D3WA 3GUUA 3KR1A 4MCAA 1LNZA 5G0TA 1E2KA 1R0YA 2PYIA 2ZIEA 4RIGA 3JRNA 2H1SA 3WGUA 1J0BA 5C18A 4F93B 2Y1CA 3IXQA 4M8KA 4N8DA 2QRKA 2W5UA 3KLMX 4DTCA 3D2CA 1X3SA 4WPGA 3HB0A 1VZ2A 3BSFA 2ZXEA 3L6OO 3LBIA 2IEGA 5I51A 1CIPA 2BMFA 2ZI3A 1E8MA 1L8QA 1YZQA 4UVGA 4B2IA 4JXXA 2ONZA 3OT1A 3EPKA 1Q0UA 1YOVB 1DEAA 4CKCA 1NA5A 1TUGA 2AXQA 2DX7A 1VKHA 1UMCA 1YZGA 1UCFA 3AEKB 4XQGA 4EP1A 2L17A 2V59A 2F3RA 3JYOA 1D03A 2FZ4A 3L46A 5IBRA 3E35A 1JQEA 4PGGA 5IXJA 2QTTA 2YUIA 3CW2A 5I7WA 1U2PA 3PQFA 4X0EA 1GYPA 2HH9A 1MJNA 3FB4A 3WWEA 4DV7B 3B12A 3G23A 4DG8A 2JFWA 3R9KA 3IKLA 4D25A 2ZUBA 4WOBA 2JGMA 4DCSA 4JIMA 2RE8A 5HTOA 4MGHA 4B73A 5L6MB 1K97A 1VGQA 1FS6A 1ZEJA 2G63A 4DXHA 3HP1A 1EQ2A 1W5FA 2X0NA 2JZOA 3I01M 3A4TA 4K88A 2QJWA 3HJNA 2VHZA 4E08A 3AH8A 1CY7A 2ZCVA 2AT1A 5LB2A 4YP0A 5KYXB 4D80A 3ZOKA 1MX1A 1QU3A 2A86A 3WB9A 4OOEA 3BMNB 5A1TA 4U9HS 1Z2AA 1HK7A 1O96A 4UNQA 3V2GA 5BNZA 2N9UA 2O2EA 2QLTA 5FHRA 1R18A 4UC0A 5H81A 3ROMA 3RC9A 1MF7A 4CCYA 5GVSA 1GCUA 3WISA 1YV9A 5K3OA 5LN1A 1SMKA 1H2HA 2C9MA 4QFCA 3TX2A 2GZ3A 4IXWA 4FVTA 4QOFA 1JXQA 2DMRA 5JJIA 5K6RA 1MB4A 1Y1SA 2LZ0A 4JP2A 5J47A 3H7AA 5JEDA 2UZ0A 1Z45A 3FTEA 4UUOA 3PL5A 3GWGA 3LIIA 1C80A 3JQGB 1T2VA 1U8EA 4O5AA 2O2JA 3B6EA 1EFKA 1Q1AA 2HCTA 1AQNA 3L4BC 4MULA 6Q21A 2WF7A 4BFZA 2FJPA 3EVFA 4OMUA 4RJ2A 4MQFB 3E7PA 1OWMA 2D00A 4FZJA 3VSBA 4ZO6A 3N3BC 3R40A 3LT0A 2BFCB 1NR5A 4QHYA 2R7LA 1YCHA 2YXNA 4KQHA 3TZCA 4AN1A 3WGQA 1Q0QA 4BQRA 2CWWA 3NOXA 3PCRB 3TOSA 1Z2OX 5MHTA 5M29A 2CY0A 3EQ9A 2IIBA 5CYGA 3MW8A 2DCMA 5A2GA 1J33A 1D7AA 2C61A 4E5SA 1T1IA 4FOTA 1M2HA 3ZV6A 4TYQA 2O3RA 2FW8A 5LQCA 1PNQA 1SM4A 4QGBA 2C5SA 5YASA 3LIPA 4GP9A 5B53A 4Q37A 5C4GB 4BN0A 4IUBS 2GESA 2PRSA 2ST1A 3ZDEA 1PWEA 4ZVTA 6LDHA 4P0QB 1A2KC 2NYAA 4O4JF 1ORRA 4XH9B 4KBGA 1R0XA 3WIEA 1MRNA 1REQB 2BP7A 1IEQA 4J0IA 4MUJA 4AYXA 2GEBA 2CLSA 1F3LA 2ZVDA 3BBLA 3L77A 4PLFA 4ZI7F 3ZHYA 4ZEOA 3SE0A 4RH1A 5DM0A 2JLXA 3TPZA 5EYPB 2FGKA 4GR4A 4JLUA 2VH2A 4TUYB 2WVHA 4PZCA 4XDZA 4IXDA 4CL2A 2AD1A 2XOXA 4BV3A 2ZWPA 2Z04A 3CN7A 4IXTA 4TTJA 3B5JA 4YMHA 4KXNA 7ABPA 1UZAA 1QXSA 2AMJA 3DZDA 4B85A 1K9SA 1KYQA 4XWOA 4R2XA 2PV0A 3N9IA 1QK4A 1V4NA 3QKTA 2REXB 3D7KA 1KAMA 1NWCA 3NANA 4D9FA 3EAQA 2E7ZA 4RY9A 3EUWA 4NU6A 5SY4A 1GARA 1XLWA 1J2JA 2YHIB 4P22A 2GZ1A 1KFJB 1VIMA 3KLOA 2GTHA 2CMKA 5EESA 1PJCA 1HWYA 1CJVC 1XLTA 2QIOA 4ZYWA 1E4EB 4J1TC 3QWHA 1CC1S 1J9ZA 4LYDA 4NEHB 5FJJA 4JL5A 2SHKA 4BECA 4EGSA 5K5EA 2RGRA 1CZKA 1BWRA 2PTHA 3DOEA 1XEWY 2R65A 5B1IA 5KREA 4OMCA 5IYZF 1JTFA 1QM5A 1BMFA 1VXRA 3MTQA 1RXEA 2YV3A 3OOWA 1TCCA 4GOXA 4F4UA 4US2R 2GARA 5D87A 2FPIB 1VIYA 3PJEA 3B3JA 1ADJA 1TFRA 2H92A 4KXMA 4U3JA 4XARA 3D3JA 1NF3A 3JVUA 4YMWA 3UY4A 3KVOA 4JMPA 5A3SA 2NU8B 1UP7A 1M34A 1K7YA 1R64A 3U3RA 3GRKA 3IUEA 5JSHA 1PJ8A 1E2GA 1WQ1R 1XF1A 3G2LA 3TI9A 4EJFA 3O8RA 3T5AA 2XT9A 3GBSA 4GMDA 1BDMA 2DPXA 3LKDA 4RVDA 4AW9A 1AK2A 1OLOA 3KXIA 2QSUA 4I8IA 3M9WA 3S27A 3ZD8A 3PEYA 3H9QA 2A5JA 4RJTA 3ZU3A 5BN4B 3OCCA 4G4SO 1E9RA 1G21A 3USCS 4U02A 4D9IA 2WIJA 4KJZA 1TA0A 2A59A 1UC4B 4LE1A 5SICE 5CT6A 2XT6A 3VOTA 5HFJA 1JVNA 4L4UA 5MGBA 3F5SA 1Z63A 2NYUA 3GF4A 5BN3A 1PL6A 1KQ3A 1XTVA 1ZMTA 2ETVA 4GUAA 8OHMA 3KKQA 2Q8QA 3AINA 1F17A 4HD8A 3AR3A 2YKGA 3WV4A 3P9SA 5TQ2B 3AC0A 3T3PB 4RGVA 4OQEA 3AVVA 4WY5A 2DGDA 3U3MA 3M6WA 4L9WA 3M5PA 3ZWXA 3ZCSA 1W4ZA 2Q3JA 2W83A 2I8LA 2G36A 3A9VA 1SC9A 2APJA 4J7UA 3UMBA 5H9WA 4KPYA 4O4LA 3LVFO 3L6UA 3NOVA 4DXDA 4NFSA 4CHGA 3G2NA 1LEHA 1UDWA 2GHIA 3IKVA 4JWTA 1DBSA 3B1JA 4ZCMA 1T29A 5KOHB 1W5BA 2V6BA 3E0XA 2BF7A 1YB7A 3ZHXA 2WJ3A 1C7JA 2O8NA 3KTFA 2B1GA 1RSZA 4FEAA 2NPFA 1UODA 1IEXA 4E0BA 1Z34A 1L7QA 5LYJF 1GNTA 3PKZA 3IAHA 4L15A 5ECDA 1Q15A 3ZYZA 3SQXA 1YI8A 3AP3A 4MYRA 1ZO8A 1PUIA 1R3DA 2QMUA 3R7LA 3UN1A 1UBGA 1OV6A 5DLPA 4F1KA 3CYFA 2C5AA 3ITEA 4HAZA 5G1OA 4MI9A 2I4OA 2QP3A 4ZCIA 5CLFA 2Q4RA 4DM3A 5JSUA 4BJ6A 4I36A 3CF6R 4D1YA 1HXHA 4HNAB 4YUWA 4F5ZA 2PEZA 2ES4A 2ATEA 3QEMB 3U40A 5KYYA 1WB9A 5BMVA 1XJQA 4G0OA 1U1CA 3AI7A 3UM9A 3ZTYA 4BY9E 2OXEA 3ZJ4A 3FYTA 1JH9A 2HLDA 2YN4A 1NNLA 2ID8A 2JAUA 2XWBF 4C4YA 3VOSA 1B2RA 1BS1A 2I2FA 2FJ0A 4L4ZA 2CJYA 3GFGA 4N8SA 4O0MA 5FYQA 1U5BB 3MB5A 3QKRB 1NVXQ 4M6WA 2NVOA 5CGQB 5GIOE 1I94B 2XZPA 1L7MA 3TAUA 1QLJA 1UBNA 3AEQB 4XAQA 2QE7A 1MCZA 1Z29A 2OL4A 2XHZA 4BOYA 1RHUA 3DFIA 2W22A 1KC3A 1MB9A 3OOSA 1A9RA 3WFJA 5JADA 3TW8B 4YRFA 3T3EA 2ZAIA 2TRSB 3LVQE 4CMKA 3WS7A 1L7DA 4FE4A 3KQQA 4GXRA 2BKAA 2OILA 1W2GA 4LHVA 1V1RA 1EUQA 4L7QA 3P9KA 1DRUA 5GOZA 3OLQA 2OORC 4GUDA 2ZAYA 3R44A 1QH1A 4D4KA 3KPYA 4LV8B 4QX6A 1DQSA 4RVUA 2YV1A 1M2JA 3ESXA 5DGTA 5IAGA 3SZGA 3ZHRA 1EFVB 2WJGA 2PSHA 2B4YA 1RWXA 2R1UA 2ZVJA 4HS4A 3KVYA 2YS6A 3FMIA 1PU2A 1XRMA 3G85A 4B44A 2C0CA 2IQ5A 2EBWA 1BXRA 1G1MA 1QQ7A 2EL9A 4TZ6A 4BB0A 2GPJA 3U6KA 1W36B 1Y5RA 3H3JA 4LJ4A 1VL1A 2X5XA 5ALGA 2J46A 3OZAA 2R1VA 3JD2A 4GBJA 4BJHB 1BU8A 1Y7PA 3SIPA 2DBYA 2X1HA 5JNUA 1FY2A 1B6GA 1XTJA 3X44A 3ZDZB 3QYAA 4YO7A 1U3GA 2FZEA 3DOJA 2N75A 4W5OA 3LH5A 3L05A 3HADA 4TMYA 2H52A 3UWMA 5JPDA 2H1IA 1LDGA 2HRDA 2QMEA 3PNVA 3PFHA 4OGWA 3DE5X 5CPBA 4ZEVA 4OEHA 3U1BA 2FZKA 3WWOA 4C5AA 4B74A 1ZONA 4NAUA 4WIAA 3TNYA 3QXCA 1LLUA 1SEPA 2QZZA 4NZMA 1IHXA 4HWTA 3L0OA 4JVMA 3A1SA 1C9NA 3DBVO 5TJ9A 1C0KA 2Q46A 1RFGE 5CIWA 5CX4A 4I2NA 3W5SA 1ULTA 4LGCA 1U7HA 5FWNA 4L3WA 3HA2A 1TQ8A 1LDYA 4LXGA 1PEDA 1N34B 2XH8A 4IQ0A 3RRBA 2XQVA 4O2AF 3O31A 1YRYE 4OO3A 5F4ZA 4EO7A 3RV4A 1A95A 2RHTA 2ZBPA 3ICOA 4H7FA 3QVXA 4I5DA 1Z0ZA 2QVBA 4YMVA 1SQ6A 2C2ZA 1Y0BA 1N2JA 4UHDA 4JV5B 3VSAA 3NBUA 2BGJA 1FMCA 1XFAA 2QD4A 2RGNC 4WOCA 1M7GA 4WOKA 4EQZA 2VCYA 2IC5A 2VWGA 3RU3A 3BEOA 3D6HA 2O5RA 3D6FA 2PRZA 2KI5A 3GPDG 4ZT4A 1G20B 1QHYA 3O0DA 2A9RA 4BBAA 2A9JA 3P4XA 1XR3A 4ZXFA 2CE7A 2R4QA 3ZE8A 3MJHA 3HDJA 1JIVA 3DBHA 1SGWA 5IDWA 5E7JA 4JYBA 3NHFA 5DYTA 4BMCA 4DDUA 3Q9NA 1P61B 1L5RA 3RSSA 1QRRA 2PIAA 4NARA 3F5FA 3OQVA 4AAYA 3ZZ1A 5IM4A 3PLAE 2JAHA 4P5PA 1PSZA 4AB1A 4ALMA 2K2WA 1R66A 3G5MA 3A05A 3FCCA 5CYOA 1UPTA 4G9EA 1PHRA 1XKLA 2QZ4A 3TQSA 1QS0B 1V6AA 2JJ8A 1CZOA 4L4RA 3RVSA 1YJAA 3DHNA 4JUAA 3CF0A 3SIXA 4TV9F 5BQOA 2GCPA 3R0VA 2Q07A 1YS6A 3EMDA 1YCFA 4FCTA 2ILTA 3AEZA 2P35A 4S24A 3PUYA 1P80A 3ISJA 3FF4A 3EIFA 3FSEA 1GD1O 3HBJA 3L5KA 5F77A 5FI3A 3TPFA 3O82A 3VVBA 4WESB 1RHQA 3HV0A 4IDGA 4B6PA 1OYVA 1KWKA 3PE3A 3UMYA 1UANA 1TXGA 3NNNA 3HEMA 4HQKA 1OXMA 4CV3A 4PFQA 3ZWNA 4EI7A 1I36A 2D1SA 2EYQA 4HS9A 1KZ1A 1UDCA 4TXLA 3HYCA 4M49A 2PKXA 2ZSUA 1T5TA 2ZAGA 3CLRC 3S1AB 2I2DA 1JDBC 4BVKA 1CKEA 3MA0A 4KWTA 5CP8A 3JPYA 1IPFA 1F6BA 5FV7A 3BJRA 2VAPA 2NSDA 2G8LA 2PZFA 5JIBA 5D5QA 4K9OA 4PAOA 3QNUA 1ZBQA 4C0HA 3MQ4A 3UYLA 2AE2A 2VPWA 1JR3D 2ZRNA 5EZYB 4R9VA 1CW2B 4ZRNA 2VJPA 5JMTA 3DYBA 2BTEA 3A27A 3CKKA 3BG5A 1NM5C 1J99A 3OLXA 4XYBA 5I7FA 1YZTA 4LF9B 1XN4A 4GLJA 4PSDA 3RU2A 3ST7A 5L3QB 2WE7A 2JAPA 2ODNA 3IQFA 1RPNA 3NMUF 4PANA 4TLLB 2ATIA 4M8LA 3IDZA 1WOMA 4A8JA 4DZZA 1MH1A 3FKSA 3VISA 3QSYA 1F9EA 2DHQA 5TEVA 4BLUA 2MHCA 4ABTA 3K09C 3X1MA 5IJZA 1I33A 3AUSA 4I55F 4WLNA 4B33A 4FLFA 3FSGA 4PYMA 1SPXA 3RUEA 4MQBA 3ZE6A 2CNWA 3SYTA 1K7SN 3RYIB 3DVLA 3UBMA 3QF7A 2FSFA 3TQFA 4XGIA 1SEVA 4BQFA 3CBGA 4MYDA 5DCLA 1TQ4A 2NUPB 1Q92A 1FFHA 2QRMA 1W5TA 3EPRA 3ETCA 1SXIA 2NPOA 3HG7A 1O7JA 1P62B 4QUDA 2GK3A 3NVKI 1WBDA 3SN6A 5E3JA 3TLEA 1AGRA 2FR8A 1W85A 1SR8A 1WKBA 3TQOA 4O6VA 5JXWA 2DQYA 4DMLA 5DTQA 2ZJ6A 3I62A 3ICVA 1NWHA 3OBIA 3G9ZA 4G01B 3DHVA 3I1JA 4HDKA 2GO7A 3SNHA 2UZ4A 3P9IA 3EZLA 1DJOA 3OLWA 3MJDA 1WE2A 4XOUA 2DKOA 2ZYHA 4FYXA 3DT6A 2MCFA 1XMOB 4JUDX 3ANMA 3BWDD 3I9V1 4M9QA 3OQIA 3WNDA 3WMGA 4LY9A 4HWKA 4A0FA 2KSQA 4GNRA 1SQSA 4IICA 1KSGA 2HMAA 1Z35A 4YCLA 3UKJA 5KQGA 1QZ3A 4J3FA 1NU8A 5FXMA 2JJMA 4IGFA 4AY6A 1B8VA 3D64A 4CKWA 3OEED 2C57A 2VXYA 4R40A 1UFOA 3BE4A 4KDCA 3MN1A 1EWQA 2VR1A 2R87A 4IMIB 2HWUA 1ZGGA 1ODJA 4NJMA 3F71A 3GUZA 2EIXA 2P5YA 3KYIB 4M87A 4O02B 5AK3A 4DA9A 4QM7A 3SSAA 2F00A 3CQ9A 1SQGA 1COWA 1C1XB 1G42A 2REQA 3HA3A 3KHSA 5HQTA 5HJ5A 1X94A 3TRKA 1IXSB 4ND2A 4X3OA 5LD2B 3PQ6A 2WR8A 3P0EA 4EAQA 2F1KA 1Y3BE 1IWBB 1U2GC 1XCOA 2GN1A 3LJKA 1R74A 3MTDA 3SR0A 4PG8A 5F33A 5BSFA 5JYDA 4RHXA 1KY2A 1ZITA 1SIUA 1P2SA 5FADA 3STUA 2X6RA 2PD4A 2HXSA 2VSOA 4E4RA 2W11A 1NZJA 1J2EA 3PEFA 3HBFA 1QDLB 1R0KA 2CUTA 1JG4A 1C3JA 1UK7A 3GI1A 3HNPA 5HJ2A 2F4VB 1WTAA 1ISHA 3JQAA 3UV6A 1E63A 4D9EA 2D2EA 2JFYA 3OU2A 2P40A 4Z4CA 1KC1A 1KF0A 4GKBA 4BDSA 9LDBA 1NMZA 2A88A 1EGVB 2ZI7A 3B85A 3EW7A 4NYJQ 4RTMA 4AMVA 3GGJA 2KLHA 2H07A 2J67A 3GL9A 1ZU4A 1GWNA 3NP9A 4OBEA 4C05A 4EPXA 2FW0A 2OZLA 3B7GA 3I2HA 4BMYA 4EY8A 2ZYAA 1DG1G 2EEZA 3F3MA 4GL4A 4DWJA 5DM1A 4E1BA 5IZ4A 3BXEA 1H0RA 3GA5A 3U3ZA 3IYLW 2H2WA 1WQ4A 1D8TA 1GPMA 1RT9A 1X8LA 3D5TA 3H8JA 1E5DA 2GZMA 3NHYA 5BWNA 1ZPDA 4RC9A 4LK3A 3PZRA 1Z22A 6NULA 4XIYA 1S02A 3KXKA 1H1DA 3V34A 3PE6A 3Q5GA 3VBEA 2WICA 3KKNA 1P0MA 5EHZA 2AUNA 1SD2A 1PR5A 2J5KA 3CUSA 2UYOA 3DLPX 5KIAA 1XZDA 4RFSB 5KSYA 2O8VA 2YHAA 4B3JA 1G38A 1D2CA 3UUWA 3H1PA 4HCJA 3BIWA 4N6GA 1UK8A 5FWXA 3ZNNA 3GJSA 3EWIA 4BN4A 4BDTA 3PNMA 2WA2A 4PG6A 5KNBA 5LLTA 3DDUA 1N7GA 4GXNA 4FW9A 3T1TA 4ZOLA 1Y9AA 2R00C 3HKBA 5K0ZA 2V7UA 2VJOA 1F1JA 5JSYA 1YL5A 3E4CA 3P0FA 5GJBA 1FRFS 5DLEA 5DTRA 3SKVA 1V45E 1O9HA 1NXSA 3OPXA 4OLBA 4JEIA 4L74A 3BPSA 4KNYA 1FU4A 1OXUA 2IF0A 3PRYA 4W5JA 2OD9A 3TLJA 3A11A 2EOAA 3II6X 2CLHB 1SKYB 1XTQA 3AIIA 5AM1A 4AQDA 5FTJA 3ZU4A 2PY6A 4JWKA 1JU9A 2KHZA 3IE0A 1K98A 3ABSB 4Q24A 4R8RA 4D5EA 1NT2A 3ZHBA 2BCJQ 5JD3A 1SUCA 4ROTA 4RIIA 5IFLA 3U39A 1SC3A 3LO8A 2NO1A 1VBMA 4LFCB 3FMOB 4CMCA 3PQ7A 3R5SA 1E9SA 4D8TA 5E4TA 4OLAA 2I1VB 2ZT8A 3KQHA 4JGGA 3M3DA 4TTTS 4DV1B 3UIEA 1BWPA 2RK4A 2FMTA 1MT0A 3W5JA 1GZ4A 2VHWA 5MN4A 4F3RA 4A5OA 2D0IA 5JZMA 4Z4QA 1TK2A 2DH5A 4QOHA 2VPPA 3D3WB 2YYYA 4JBGA 1H3FA 4C6RA 4J0JA 1G7RA 1JSZA 2B9EA 3G49A 3O83A 4JB0A 1O57A 4C1BA 1SRRA 4RAQA 4CG0A 1HEUA 2ENWA 4JLJA 3KK0A 3EMKA 1PCXA 1FXWA 2QJOA 4R1TA 1S1MA 3A7DA 3WRVA 3DMDA 3TVTA 5PGMA 3HM9A 2QENA 3AXSA 4ND4A 4XX1A 5CRIA 5AUOB 2WM9B 5G4KA 2QBYA 2W2MA 3OT1B 1KE1A 2JEZA 3SS7X 5J1SB 1NHGA 3I37X 3KHTA 4JOCA 4RBNA 4CKCB 5HFAA 3E7XA 1UMCB 4Y0VA 2W8BA 3MILA 4K9DA 1GUDA 2WAXA 4EKGA 2XD4A 4PN3A 1PGOA 3UMRA 1C8VB 1GQSA 4JJ6A 4PC6A 5J2TF 4EG3A 1M8FA 2AR9A 1N33B 2PKQP 3RPEA 3FPHA 1IBRA 3IRUA 1YE5A 4F3TA 1K4MA 1YDMA 1ZLYA 1PD0A 2OFOA 2RAFA 1FVFA 2YVAA 2EFYA 3CA8A 3FPLA 1E6EA 3HPRA 4IWYA 3GGSA 4X7MA 4HDCA 1K0FA 1F12A 2G80A 3RJ5A 3BFVA 1X87A 2E4XA 4MYCA 3GBVA 3AOEA 4FZVA 5IDYA 2WQ6A 2IH4A 8GPBA 4PG5A 1XU4A 3AWIA 3TO5A 3IPCA 2AI1A 4HYYA 5HE9A 4C0LA 4KVAA 2QI9F 2ZYSA 2EX0A 3BKXA 4ER7A 1H1LA 3ELBA 2Z2XA 3T9AA 2AXPA 2FSUA 3UKOA 4Q3LA 1T5IA 2HHAA 2YNMC 3RAPR 5C5EA 4QGHA 3A4VA 1PNRA 1XJ5A 1O96B 2NXWA 5AW9A 3O8BA 4RZQA 4AO6A 2BAGA 2COKA 4CCYB 2YYAA 1P2TA 4MLPA 4UU8A 5KNBH 3FTCA 1SD1A 2HCBA 2VI5A 3FXAA 4NE2A 5CHYA 1XTRA 1YGPA 3R3HA 4NYJR 2YZMA 1BZYA 4U39A 4G9BA 3FX2A 1YQQA 4PVDA 3VPXA 1WEKA 1YCDA 1GPKA 2DRIA 2W6PA 3IO5A 4UE2A 5GOTA 5EHGA 5H83A 4B46A 2E6KA 3O91A 1V8OA 1Z36A 3NKFA 5JTTA 3HM2A 3LUBA 5DK6A 1VGVA 1XD2A 4Y1RA 4OY3A 3PX3A 4F92B 1NR1A 2VP9A 1E3MA 2W6QA 2QD2A 3UMJA 2C3PA 1NDQA 1R2QA 4E22A 2JVJA 1M6YA 3OLCX 2GBFA 2B36A 3RVDA 3STHA 3DDSA 4UTNA 2PUGA 1LPOA 3C3CA 1NW4A 1HDZA 1ADCA 1J2YA 1PBNA 2ZRBA 4NZOA 1W7AA 2Z8ZA 2VG8A 4Y2TA 1P7CA 2A92A 3AG5A 3FGZA 3H4IA 3LY5A 1PUXA 2EKLA 3FKQA 1VJTA 4M88A 4MS1A 4UZEA 5BXYA 5AUPB 1GNSA 2D7DA 1DBWA 5EP1A 1D0VA 1A1SA 1K89A 1ADFA 2VCEA 3EG5A 3I9V6 4NDAA 3RS0A 1KVUA 1HYGA 3F4KA 5KB3A 3N59A 1N1MA 2AG8A 2R84A 3I6QA 3WL5A 1GHTA 1ZR4A 3KX2A 3OZVA 1USWA 3REOA 3ZE7A 4BU0A 1DI0A 3FI0A 1M5TA 1ZXBA 1J7KA 2HJWA 2BP7B 4TKUA 2EXXA 4BKMA 4GFDA 5HM8A 4EHKA 1LY1A 4POAA 4R5MA 1JHPA 3FNQA 3HS3A 4OATA 5DNDA 2QLLA 4HH3C 2QD1A 1SKYE 2X3UA 4MTLA 3WHIA 2C2GA 4RH0A 2M98A 2GD1O 3NH6A 1S8AA 4I4NA 5EJAA 5CJJA 5FUYA 4U8HA 3EJWA 3K2EA 3PEUA 4MVYA 1GFSA 4EG4A 2D6FA 1WF6A 2AMLA 1N57A 1N5MA 3V6MA 3FROA 3GFSA 1N3BA 3OZFA 2IXAA 4LJLA 4NAHA 2QTZA 4ACAA 4YGYA 4DAOA 2ORVA 2XITA 1PKXA 2YWBA 1OBVA 4TMFA 2ZEJA 1IHUA 1U0FA 2B8EA 4L8YA 5EUBA 3GCZA 1JL3A 1KO4A 2XRMA 4PC2A 5L3RA 3U49A 5HNKA 8MHTA 3S68A 2PZGA 2B1JA 3ZV7A 4IIJA 4E6PA 5K8TA 1LUAA 2GK7A 5BR1A 4B0PA 3TLMA 2XXAA 2FEPA 4XFJA 3SEAA 1NXVA 3LBNA 1EI9A 1ZRNA 2GJSA 4FZ3A 4MOWA 3MJFA 3SCZA 5AM2A 5EG5A 3G8YA 3BWEA 4C7OA 1I5EA 4U3JB 1C8KA 1LBHA 2QRUA 4EA7A 4ARVA 2K6GA 3WGLA 1JPVA 4B8ZA 3QMMA 3EX7C 5J58A 2GN9A 1FTSA 1M34B 4Q15A 1JDVA 3B1WA 3DFFA 2HBRA 2VN8A 5CEJA 2WWIA 1NN0A 2AZDA 2X9VA 3WQQA 4MKFA 4BKQA 4JYCA 4P86A 4RK0A 2VUHB 3H8WA 4RELA 1FDTA 4B83A 3QF4A 1JA1A 1KYIA 2PBZA 3PNSA 4JBXA 1OZHA 1G0OA 3L0BA 4UARA 4XM1A 1DIGA 1ZOOA 1MENA 3DLTA 2BR3A 1JALA 5AHKA 1K3FA 5BN3B 4IWXA 4ZZ3A 2VOJA 4KXFB 3S70A 3PRHA 1TM4E 3VZPA 1TAHA 3UUGA 1Y8ZA 3K4PA 1ECCA 3EF1A 2FR1A 1Z5GA 4DMHA 5TSDA 3TE6A 4KU4A 4RU1A 3SY8A 5KTYA 5B1EA 3LG2A 3TB4A 3VO2A 2PDAA 1Y48E 2JFOA 4DR3B 4HNVA 3MK31 2J9GA 4ECAA 1XZKA 3G8DA 1K6JA 4O4LB 1BMDA 4AUMA 4DCGA 1GILA 5DW3A 1SELA 2Q3BA 3ZE9A 4YDHB 4JBIA 2XVMA 2Y1EA 1LS6A 1RM4A 2YJ3A 3AVQA 2WDZA 2OC4A 1G9XA 4TTPA 1QNFA 1UMKA 3O7MA 4YXWD 3BHJA 5AM4A 1C8BA 5IUJC 4CNBA 3ZG6A 3NVDA 3V8NA 1FYFA 2B69A 1IM2A 3TD6A 4D0RA 3U5TA 1SKAA 3Q7TA 1YZHA 2DFKB 1J49A 2AIRA 4NH0A 3TDKA 1CRLA 2WZDA 3WMWA 4UEWA 4HRYA 4W99A 1GFWA 3CNQS 3A9RA 3F8TA 4J91A 2RFLA 4EF4A 1Y6GA 4IHJA 5CH8A 4ZDIA 2DJ5A 3ZCUA 1T9DA 2C5LA 4JDUA 1H1TA 1HDIA 4L6CA 3B53X 4BO5A 4C0SA 5C5IA 4PX2A 4IRMA 3P71T 5KYYB 3CJQA 5BMVB 3E82A 3PC7A 2H0QA 3EGIA 4D8XA 4IDHA 1ZP6A 3IJPA 5DHPA 1UBKS 2AEFA 2XMGA 1DQRA 1SG6A 2ZJZA 3DPUA 4MZDA 4NONA 4YAWA 1PE0A 2ZUSA 3D6AA 5L3ZA 1SOWA 2TMGA 1YR9A 4KLRA 4M6WB 1AUPA 1CXZA 4FYMA 1EFRD 4NLLA 4HATA 3MRSA 1UT5A 1U3CA 3CCFA 3QE0A 3D4IA 3E3MA 3SDSA 3BKWA 3SM9A 1O94C 2Y1WA 5FNZA 3EDQA 4PU0A 4LDJA 1CF2O 1L8XA 1VM6A 3ADKA 2R7KA 4K0RA 3EY4A 4PCVA 2XUIA 4P1ZA 2VF5X 1YTUA 3IJRA 3L92A 5T8KC 4NABA 3OX4A 3WYEA 3DJYA 1V1RB 2HJGA 5FEUA 4YT5A 1X86B 5AVVA 3K71B 4FX2A 4R3NA 1ZL0A 3F1LA 1MT3A 3ANNA 4JI4B 2JHAA 1QH1B 2VHTA 1JR3A 3QBEA 3L0YA 5IKPA 1TT5A 2J6CA 5C8YA 1D2GA 4FMCF 3CH6A 1DKOA 2IZ5A 2RB5A 3G1UA 4XYGA 3DL4A 4M22A 2Y1XA 1A8HA 2AEMA 4PO1A 1ZD4A 5DT2A 5IH7A 1U6IA 1PR3A 2I8CA 3DWGA 3E2MA 2IYZA 1OFUX 1XQ1A 3ABRB 2JCGA 3C4JA 3ILVA 3OZSA 4E2FA 4X66B 4IH4A 3PSAA 2RGWA 4J0EA 4BGVA 4HKTA 1IBMB 3STYA 1BXRB 3IOMA 3B89A 1DIOB 1SHTX 2JCBA 3QG5A 2G77B 3T54A 2JCSA 4ERXA 2IXFA 2QN2A 5H4GA 3BL5A 3F6CA 3OFVA 3JWHA 1Z8NA 4GRDA 2NU6A 2R1VB 4NPAA 1Z6XA 3DEYX 4ZCSA 1QGDA 5KJ1A 1C1YA 4YAIA 1DHTA 3Q7IA 2OVFA 4ZVQA 2PUDA 1EDBA 1K2VN 1ML3A 3O84A 4KIGA 1LPAB 3OIDA 1U9ZA 3NM4A 4DJDC 1J0XO 2Q9CA 3GIWA 4LNAA 3ENVA 4X91A 1ADGA 1GAQA 3RE1A 1C9MA 1M72A 1OAAA 2NSHA 4AMGA 1IZ0A 2I7VA 3BA6A 4MGZR 4L6IA 4LDQA 1M34E 4D8YA 3R4VA 4Z4EA 3BE5A 1V3QE 1XAIA 3GY0A 1BVHA 1UXKA 4PRLA 4HX9A 2P6RA 1J1ZA 3SHFA 2BGKA 4ATNA 1R8QA 2AJBA 4KWHA 5BN5A 3K70B 1P3DA 2JCVA 1P7YA 2QKYA 2VLIA 1NUQA 4FR2A 3U48A 1K8XB 2R5WA 2ZQZA 3KOUA 3LUDA 4IX9A 3B3AA 5KHAA 1OHHD 4GH5A 2H11A 3DJFA 2JZNA 2Q3MA 3DE0X 4MKXA 1HV8A 1WOYA 4B3XA 1QGZA 4PR3A 4RKWA 3VGJA 2OSVA 3EE6A 4HDQB 4NMWA 3UJHA 2HDNB 1FW8A 1CUYA 1UKCA 3BWYA 2W6NA 4JVOA 4RKYA 1Z6TA 2REBA 3TIIA 4EEZA 3UGJA 3OEEA 3LCVB 4LX8A 4M0UA 1XHLA 1UBFA 2XYPA 4Y2JA 1EXNA 4WY8A 1PHPA 1J9EA 3H1GA 3RBZA 3VMMA 3I6ZA 3WB0A 2JAQA 5AVTA 4BLVA 3REFA 1WXGA 2Q1XA 2WAYA 3Q8WA 3DCJA 4TL6A 4L8LA 2RK6A 2E3JA 4R83A 3DBHB 5M3BA 4L73A 3VH4A 1PJSA 4ZAXA 3KZCA 4D2IA 3PCTA 3K31A 1WNFA 5JJLA 2G88A 4KYVA 4TSRA 3LPCA 4DLAA 5CM9C 4IM7A 2J30A 2NVBA 1PYGA 5KJEA 5T4EA 4DXAA 3IBGA 1JIXA 1R12A 1WLYA 4Z3KA 4PHTA 1JILA 3D3NA 4EDFA 4QARA 2NN3C 5CB6A 4RPHA 3UAWA 4PCAA 1T5HX 1XZFA 4YAKA 1SCIA 1CV2A 2GPWA 3JWEA 3RSHA 3ZGYA 4EW3A 5JFGA 2OXTA 3ZKAA 3L0IB 1XWFA 3DXYA 4F84A 2RHOA 3U09A 4PQGA 1TZCA 5FQNA 4M9SA 3COSA 4DGSA 2BBTA 1FF9A 1PK9A 2JAWA 3OD5A 5IHPA 1P91A 4BO3A 3SFVA 4EKYA 1T4DA 4M7WA 4ZVVA 4OL0A 1OOEA 1E5TA 1M54A 2HRZA 3EXG1 4AZ3A 3K20A 1W36C 3WWYA 2XUAA 2ZRGA 3LA8A 4B8WA 4C7KA 3FOBA 1C9JA 2QRJA 3I2GA 1XDBA 3KQWA 4G1BA 2E89A 1RYNA 4JLOA 5F51A 4BB5A 1M2OA 1V7QA 2WKRA 3AL3A 5B2ZA 4RGBA 5TDHA 4C4ZA 3OFNA 3WYAA 4ZYVA 5I7EA 2CD7A 3WBFA 2CL7X 1XMXA 3CEHA 4RTOA 3O0TA 5F35A 3P9RA 3GUYA 2HWYA 1N0UA 2NACA 3T95A 1MD9A 1BKSB 3V1TC 4UQOA 5IWCA 1HFEL 2X8BA 2I6SA 3UMGA 3PUWA 1OLSA 3DMNA 3DM9B 2YC2C 3O38A 4LZJA 3AVPA 3U7EB 3F9RA 3QVGA 1AHHA 1VA4A 1VCIA 2V6FA 5A0FA 4R71A 4RD4A 3WWPA 4JYZA 1KVRA 3PCXA 1H65A 3H5WA 3DEZA 4H0NA 1NTRA 1EWKA 2HIAA 3ASZA 3AHCA 4PQRA 1ZIYA 1MC8A 3E3LA 1FC0A 4KP7A 5HIAA 1I10A 1BJRE 4FNGA 5LQRA 5JARA 1BA2A 3LUGA 3URMA 3PBKA 1LJLA 1PT9A 4M3NA 4Q05A 3KVVA 4A8JB 1N2BA 1YQUA 3DKVA 4JEMA 5CJPA 1K08A 4B3CA 2XRFA 5FUWA 1N77A 2PRKA 1R5NA 1KEEA 3BDAA 2VYNA 3DM5A 4BNKA 5I3CA 2O2ZA 3VFDA 2GCNA 1UBJS 1D07A 4GDMA 3BJMA 4KNVA 4ZT5A 3AVXA 1NW5A 2DBQA 2G6BA 1FNMA 4N54A 1ZM3A 3JX9A 4PW0A 4BWVA 4D97A 3TSCA 4F7WA 3ZCRA 1EESA 1ZM2A 3NV9A 3O9MA 1QO9A 3R0XA 4GOLD 1GPDG 5DMXA 2X58A 3RKUA 5CFLA 5J2UF 1XZJA 1YF3A 5ESWA 1AQ6A 3FBWA 3QE3A 4UHJA 3NWPA 5CX1A 4C7JA 3AHEA 2IKSA 3KKEA 1W85B 4PGHA 2JS7A 2WJVA 5BSMA 4HDKB 4PM4A 4ER0A 4LOKA 1BCRA 1D2AA 1KP9A 3CHYA 2AH5A 2X2PA 4TX1A 3OQIB 3V48A 3I72A 1P6XA 2PSSA 2CMFA 3KT8A 3DUFA 2E4UA 3R0ZA 4TQ9A 1FYEA 1KY4A 4UNNA 5LBTA 2VWQA 3VM6A 5ARBA 1D1QA 4NY1A 1UT8A 2GAOA 4FYPA 4OG2A 3QUQA 4LV6A 4RMIA 5DHRA 5F1KA 3LYHA 3QVLA 5IH3A 2V9ZA 4TSFA 2VUUA 3PUKA 4N0PA 4EUKA 3QXSA 4ZICA 1D2MA 2VJBA 4G1EB 3TW4A 4CKWB 2GXUA 4MRSA 3UMMA 4X64B 1E69A 2P9YA 1DC8A 1YVDA 1QAOA 3ANYB 3JALA 3JR7A 3MLBA 4NJMB 5DRTA 1FFBA 5HG0A 4D7AA 1TT7A 4EATA 4F45A 4HV4A 2C3OA 5JRJA 2Z6QA 3LA6A 3O95A 4PZEA 1APBA 1SBCA 1GN8A 2FZVA 2OUIA 1DNPA 2A1TS 3SG0A 2QN3A 1T8TA 2VTVA 1VLQA 3L0ZA 3I61A 1O6FA 4KLCA 4QBHA 5KJFA 2REQB 4S0XA 3WO1A 4P35A 2PVPA 2RH4A 1MJGM 1OXXK 2AN5A 2C7QA 3GEHA 2JGLA 3GPCA 3KBOA 4IUCS 3H87A 2CDRA 2OESA 1DIAA 5EMMA 1M0EA 1EGQA 3ML1A 1PUJA 1JKFA 2G5CA 3HR8A 2DG2A 3MJVA 4XUCA 1LA2A 4G2NA 1K5PA 3LUPA 4OB8A 3GLSA 3ZVLA 1U7OA 4FN4A 4F6RA 1Q21A 1IVNA 1G18A 1O0SA 4DV4B 3GEEA 1JBQA 5D01A 4KTTE 4JI0B 3LPAA 4PV7A 5DISB 3G2KA 4NU8X 1U0BB 1AHIA 1DTEA 1ZUIA 4MVJP 3HYRA 3GBPA 1RLUA 1Q50A 5LKAA 2NW6A 3R7FA 5DGCA 5L7YA 5BOSA 3JQAB 1GZ7A 3RUFA 2IHJA 1JW9B 1U1DA 1UP6A 4TS3A 3WSTA 4ZQEA 4DA6A 1LWNA 4HWSA 1IN1A 2W9XA 1QHSA 3TKAA 1V2HE 1ZNQO 4DJJA 2EFCB 3FYDA 3HK2A 3N5CA 2BR4A 1AA6A 1YHYA 5L40A 1PO7A 2OZLB 2A1IA 4Z9AA 1JX6A 4LOAA 2FWMX 3MUFA 2CW5A 4Y9RA 3VPDA 4BNGA 1RADA 3Q3JB 4JUCA 4RSRA 3X2EA 3UO8B 1VFPA 5E2BA 5FKJA 2VXOA 5E4JA 2LW7A 4NOMA 1VSUA 1EUCA 1TL7C 4FFLA 4W8HA 4F4JA 4LSZA 3ZEAA 1LD3A 3TVDA 1FMTA 3RJZA 1PP4A 2I66A 1TO1E 2P30A 1J1UA 4OA8A 4DYDA 4F3CA 1FFAA 2AX4A 4PYLA 1WD7A 3RS8A 5JYCA 5LZ4A 1ISGA 2IOFA 4TV8F 3CW9A 3ANLA 3WMRA 1WKCA 2CLOB 2HD4A 3L7CA 3S5JA 3RKRA 4EG0A 1XPOA 5KNCA 1USIA 3E9RA 4M1KA 2JLVA 4PLVA 3ONWA 1YVRA 4DUGA 3VVCA 3HKBB 1F2VA 2EGGA 2PKEA 4KLZA 4I50F 2I5PO 1VIDA 5TMDA 2H18A 2GJAA 4KMMA 1R6VA 1NRXA 4CQJA 2OPBA 4EECA 3NWOA 1U65A 3NU1A 2XA2A 5CG2A 4RKEA 4UUQA 3FUTA 2Q99A 3WK4A 3TIFA 2AJLI 1LQ2A 3GRFA 3KYDA 3U80A 3KQTA 3Q7EA 4OI4A 3HXMA 5DOVA 2JVIA 5FULA 4EENA 1KEKA 4PSCA 4MHSA 4PZUA 1T2NA 1II9A 3OPQA 3ZQKA 3FOZA 3BGDA 4TSKA 1UINA 4HLDA 3NZEA 4G9GA 1C4WA 4LVOA 4EG7A 1JAYA 1VCHA 2CYCA 3ZWQA 2QHXA 4KVZA 3EDOA 3IP1A 4M86A 4ZIRA 2UZ3A 3T61A 1C2YA 2G70A 3EZGA 3H4TA 3IMEA 5JW6A 3QI2A 2A5FA 1U99A 2OMKA 2Q3LA 3GFVA 4AJPA 4KX5A 2IP4A 3SLGA 3PC8C 1Z18A 5LJLA 4E5KA 5JOQA 1JHAA 1YK0A 3VU8A 3RV3A 1WR8A 3C8ZA 2QTHA 2C5GA 4OXRA 1Z5UA 3FPCA 4FMBB 4S2UA 1TVEA 3VO1A 3SQLA 3WIUA 3HFGA 2AW5A 3FNRA 4D46A 2E82A 3WBKA 3O4GA 1ONBA 1UFVA 1YWGO 2XIJA 7GPBA 2QQ5A 5HUHA 2BFDA 2QM7A 4AN0A 4RF3A 1HURA 1C81A 4TWRA 3D2LA 3BH7A 5JS8A 2OG1A 3CRQA 1LKZA 3N53A 3KKPA 2CNBA 1P5ZB 5G4KB 2G4VA 2QBYB 1RAGA 1DWPA 2QTBA 4BMPB 5H16A 3ZUGA 1A8SA 1PS9A 4MRNA 4XQCA 2RAUA 2YX1A 3ZGNA 4Y2UA 4TVOA 2W8BB 4OQ4A 3O8QA 4RSMA 1WLSA 4ZYLA 1GTVA 4CMEA 4O2LA 4U7JA 4P3NA 1QDEA 3INTA 2PKQO 4NFLA 3TE7A 3X1WA 4EKEA 5JJBA 3OJFA 3TUZC 4O25A 2FSPA 4XRRA 4ZT2A 6REQA 4U2CA 3KR9A 4HN2A 2GF9A 1Y4UA 2FX2A 2I2AA 2VDVE 3KKZA 4KIJA 4MPDA 4RETA 4C29A 1BWQA 2X9NA 4G5QA 5EJ9A 1NV8A 4ZRDA 3NV7A 1TZ2A 3PNYA 1QNLA 4UVEA 4D74A 3W5IA 2W58A 4BNTA 2CXPA 2ZWMA 4REMA 5F7JA 5KYTA 3EMVA 3TVYA 1H1LB 2ZR9A 3WLAA 3B8EA 3O2QB 3VAAA 3PFGA 5AW4A 3KAJA 1H2RS 4S2EA 2D13A 2LVBA 4AYWA 3JV7A 2PANA 3OEWA 4PTLA 2BSXA 2B8NA 3V97A 1MOQA 1MQAA 1U8ZA 4ZXPA 3WNZA 5KNCH 3V42A 5FTLA 1Z75A 2ZSIA 2QRQA 3SQDA 4JIGA 4C4PA 1EWTA 2B25A 1OTXA 3HXQA 3CVXA 1ZMRA 2BGRA 3KWMA 4GBGA 4IS2A 3ZW8A 3NIGB 4Z2AA 3RKSA 3IEMA 2ZJYA 1CP2A 3NUZA 2ZATA 4YXWA 3G9TA 3C7AA 1AKRA 2QAJA 3A04A 4RPJA 4YP9A 5EJ8A 1KDVA 1U2EA 4G36A 3VYVA 4DA7A 1OZAA 2EDCA 2PSEA 1QHHA 4OSOA 3DOOA 2V0GA 1XD2B 4GOKA 4JQCA 1N8NA 3CFYA 1H2AS 1S2GA 2WJ6A 3WHLA 4EMSA 1QRDA 1QVWA 2GK6A 2QGZA 3MUNA 4WK2B 4GS5A 1UOEA 4C08A 3UXHA 4F4IA 1JEOA 1BC5A 4OUKX 3Q72A 4EHLA 5LPNA 2PLWA 2XUQA 2YFHA 3HY3A 3CB4A 4RVFA 3LTNC 3SFZA 2V9CA 2Q6KA 1U7WA 2DBRA 3EUEA 4FYWA 4OFXA 4RF5A 2VH5R 3JQQA 3UT6A 5TXGA 3KZXA 3DQQA 3LYAA 4OU5A 3ROFA 1DOHA 4NV0A 4ALLA 1EQAA 1W8DA 1WXFA 3CGGA 4UEJA 3PXCX 4XDGA 3CU5A 1KIFA 3FWKA 4KE7A 4O4IF 4B35A 2J5XA 4J6EA 1Y63A 1PGQA 2X5NA 4HAUA 2L82A 3BULA 1E1YA 2Y05A 1QB7A 1I0IA 4X8OA 1GPYA 1Q44A 3G9XA 4BMZA 1P0IA 4TKUB 4GSLA 3ZW7A 1OLXB 4WHMA 3LYLA 4FNAA 4KR6A 3L1IA 2FLVA 4H60A 4LTMA 3S40A 1YNSA 2FEOA 3ENKA 1UZNA 1BSVA 2HKIA 1D09A 2PKYX 2R0QC 1KQPA 4I5EA 1IRXA 2ADOA 4K2AA 2QY6A 4GOMD 3UB3A 1B0ZA 3PT9A 5HUJA 5TIIA 1RXYA 3OT4A 3N2LA 4UDOA 1VG8A 3QJGA 5IRCD 2XBUA 2V96A 3QW2A 4CKZA 3EFHA 4NZPA 2EZUA 2IEAA 4AUNA 2XGGA 5EZ5A 5EJ4A 5EP4A 5FL7D 5K51A 1XRRA 5GADl 4AKGA 4LQLA 4DDVA 2PAFA 5T6BA 3TD9A 3VKVA 4M21A 4YRLA 1RJWA 3BT7A 5SY6A 5A3QA 1GT6A 1RBZA 5A05A 4JCOA 4IIJB 4DAEA 1QIMA 4B32A 4LVUA 4ALIA 1SVIA 1JR2A 3T52A 5HKOA 2XVXA 2YC4C 2XXAB 5A7FA 3HH8A 3LUKA 5ALMA 2PXXA 3UJ8A 2HFJA 3WB2A 2RKWA 2Q4EA 5IDQA 1RI4A 1DRJA 1N9ZA 3JAMA 5EHNA 3HCEA 2GB4A 2H2FA 2MT9A 3JQ7A 4C7OB 3BCUA 3HP7A 1S3IA 1TYEB 3NGMA 1ZG3A 4IIXA 4HFMA 3ZDYB 4YAUA 5HDBB 5F1PA 5JNVA 1M7BA 2EG9A 1C9EA 3ZJYA 1UBEA 2C3YA 1GV0A 3O47A 1BE6A 3LTEA 3UCFA 2X2EA 3UAGA 1M8PA 2VQDA 1K92A 2B2CA 1RHRA 2DLDA 3LNTA 3IAS1 3T7EA 4ESOA 3J81A 5C7IO 3KXDA 1Q0TA 1E99A 1O5OA 3L7OA 2R60A 2ARKA 5GTDA 3QF4B 3SHQA 3AUFA 4BV9A 1OI2A 2JC3A 2JK1A 3PGMA 4OF4A 3OWHA 3I34X 4QFMA 5T6MA 1NVWQ 2ZB4A 4CU2A 2IHUA 3D7SA 1M2KA 1OVGA 4RLQA 4U7WA 3UWKA 1ZISA 4DYVA 2CXRA 1RI3A 3ZQ6A 3ZZUA 2R3SA 1QCZA 1TIBA 1U11A 2Q5FA 3ZBPA 3Q9SA 1KY5A 4RLFA 3OJ0A 1YHZA 2ZIZA 3ZHZA 5CB0A 1OTHA 5DKFA 4HFJA 1DPGA 3L6EA 4AROA 2B99A 4I1RA 4YALA 3G0HA 3PPVA 2C4NA 4U2EA 3KFVA 1OFGA 1YRBA 1KYZA 4E94A 3ODGA 2XCTB 5TPZD 2YXPX 3NGXA 2OAGA 4BVBA 4CLDA 1HDXA 2GAAA 3G6WA 4I99A 4TMKA 1E3SA 5D84A 4DKJA 1QC5A 1T2EA 1DE0A 2MMGA 3CZPA 3NB0A 1M0WA 2GPYA 3OQJA 2PSDA 3CISA 4H0CA 1BQ4A 3PLRA 4WJZA 2O7QA 1DZ3A 3RUPA 3IQDB 4IHKA 1XF9A 4EYQA 4M55A 1P2UA 1QANA 3BRCA 4J2TA 5DULA 3FR8A 1WVIA 1DBPA 1WDMA 4OLHA 2X9QA 3UOAB 4OFZA 3ZNPA 4FEGA 4Q0MA 5G0VA 4AZSA 1KYXA 2FK8A 4IHJB 2G9RA 3OPMA 3PVSA 4RHYA 1M6HA 4RK6A 5HRCA 3UFXA 1CP3A 3HN7A 4YH1A 1W581 3MINA 1UAAA 4S1PA 2Z5LA 4Y6GB 1QRSA 3U4CA 1MJGA 2H1CA 1DG3A 3KP1A 4Y9DA 5E38A 2M32A 4OHZA 1JRLA 1NBMD 5AM3A 5CHEA 4UUAA 1XB2A 4QSMA 1XLTC 2QRHA 3PC4A 4DR5B 1QQAA 1M33A 1P39A 1TLFA 3AIOA 4R3UC 3CZRA 3FSRA 1FSGA 2BFOA 4KBFA 4DSNA 5K01A 3D1LA 1HT2E 3LKVA 4YMGA 1QHIA 1VA5A 5FQOA 1ZH4A 5KVQA 2VLBA 4FZ5A 2XKJE 4PG7A 5HZKA 1KI4A 4Z4HA 3P52A 1JSCA 1UJ4A 3QG1A 4YJKA 1NSYA 2IPOA 3TOXA 1PDOA 5I9MA 2JLUA 2VS1A 3P8ZA 3VAYA 3GGDA 1IULA 3EBPA 1DCFA 1BE1A 3CB2A 1C3XA 2GILA 4ZD6A 2VKTA 1EEHA 5IPFA 4G37A 4UMDA 1KJNA 2CFSA 2GPBA 3FR7A 3T1HB 2UUAB 4UHHA 3KL2A 1TT5B 4HBZA 5C8YB 2XE4A 1OPXA 2W70A 2QX7A 1NSFA 3NEYA 5E4FA 4B76A 3ID6C 4CF5A 3QM1A 1T5LA 1SVKA 3LBFA 3L04A 4JEHA 3RC2A 3GJ4A 3DYVA 2WSIA 3R0IA 4JXKA 4YI5A 2Y76A 4G5GA 3O94A 5DCWA 1OREA 2AZ4A 4CCSA 2FW7A 1H93A 3GW8A 1UKZA 3HI4A 4N18A 1CUXA 1J09A 2V5VA 1UWCA 2NU6B 4J4TA 3TMAA 4DWOA 3H18A 4R1MA 3B1VA 4WXEA 2JHFA 3NHWA 3CIOA 4Y7CA 3DNFA 4TVKA 4BNFA 2J85A 2VPZA 3LFTA 4HI0E 5J5VA 4DPMA 3AW8A 4M0CA 2VSYA 1HKHA 2EKZA 2ZKLA 3G9UA 1AD2A 2BUCA 4MW1A 1YZYA 3V2UA 4MINA 2EKDA 4DCNA 4WJLA 4EHAA 5B64A 1VL6A 3QYJA 3SI7A 3TXYA 3VUEA 3IBYA 3RT1A 3VR0A 4I14A 5ICGA 2C4UA 3QPDA 4EGFA 2Q6TA 2KE5A 3R3XA 3H42B 4XWKA 5BN5B 1P31A 5EOVA 1RRCA 3WXBA 3H1BA 2HA6A 3REQA 4K8OA 3NC1C 5G2OA 4DCJA 5LNK1 4C6HA 1XPUA 2IBSA 1RAIA 4YHBA 4UNPA 1WXHA 1JN0A 1UPBA 3LO5A 2XZLA 4RL4A 3ZH9B 3DTYA 1YIOA 1RS0A 5JYEA 1V11A 3NAZA 1A7UA 2XAUA 1VKNA 1FX0A 1QAMA 2XNHA 1WSWA 4BO8A 2F59A 1SOMA 1ZK2A 1UK9A 3C6KA 4HRVA 4C20A 2D1RA 3KB1A 1VZ3A 5JS1A 1RKBA 1W49A 5E7IA 3E5HA 4AJ9A 2CCKA 3GEPA 3P9NA 1M2FA 2PR7A 3LAWA 3FZQA 3QLVA 3RM3A 4D9CA 2HTEA 1GGFA 4EI2A 3EMBA 4LW8A 4YCAA 2ZBVA 1SJ9A 2JGKA 1Y3FE 4N6OA 4TLBA 5FUBA 3R7AA 4EVQA 3LQYA 3OTQA 1GPBA 3O1HB 3C3XA 4KFSA 4COOA 3T3GA 5IEBA 3ZY6A 5EIOA 1GPJA 4MVJD 1UQRA 4IS3A 2QRVA 1SCJA 1EG2A 4GPBA 1PNVA 1PS8A 4MR7A 2RHJA 3GARA 1N9GA 4OBXA 2PQMA 4NTZA 1BDIA 1CNMA 1P2VA 1XCBA 4AQ7A 3WMXA 3BD6A 4GGPA 5B2EA 4X1IA 4MQ5A 2EW1A 1T8WA 2H2IA 2ATXA 1PZMA 1NOJA 1U90A 3FI9A 1Y9ZA 4XR4A 2AMVA 2Z1NA 3PDWA 4DLVA 2GS9A 1SBTA 1ZIPA 2MSNA 2QLJA 4KQMA 1UDAA 5F21A 1R00A 2BFEA 3NTVA 3WL6A 3AUKA 4EUSA 1EZ1A 4D9BA 3M4YA 4JELA 1T1GA 1TAQA 2D4HA 3DO8A 1JLMA 3KE8A 4ZMSA 1KDTA 2FUEA 3IVRA 5C53B 4M1TA 1RXCA 2G1UA 2HWWA 5FB3A 4F8YA 1EE2A 2A33A 5KWJA 4ZDWA 1H2BA 3IQIX 2H16A 1VOTA 1M2OB 2R25B 3W3AA 2BWJA 3E4DA 1GDHA 1A9OA 4QL3A 5FNVF 4DIDA 5I7RA 4N12A 3NASA 4KQKA 3WKDA 1FA9A 1U0RA 2V3VA 2XYRA 2HXGA 3U7GA 4Z9FA 2W43A 1OWLA 2IY9A 5BQXA 1OLSB 4GWGA 2VK8A 3QVGB 4EI8A 2PSJA 2I7TA 5C7LO 1WMAA 2R48A 4PYJA 2NO6A 3CRVA 4L8WB 2WWFA 1Z28A 5EMLA 3VPBA 1P5JA 1V5WA 3HE3A 1ZM7A 4LG1A 5AHRA 1P74A 3T3IA 2VPYA 3S2EA 4UVHA 2JGAA 3IAS6 3NGLA 1PRYA 1XOIA 1TQHA 2O07A 3AKYA 1YC5A 3M5CA 2WU3A 4OBBA 2QTRA 1NMYA 4BMXA 1JR3E 2X42A 1R8SA 1S2IA 1NXPA 5HF6A 4NV3A 1R6UA 1NVUQ 3C98A 1DQZA 3K8OE 1YR3A 3ETLA 1GRCA 1X1CA 2R6AA 4YLGA 2XE8A 5EINA 5AW1A 1Y7IA 3SZOA 1DUIA 3VYWA 3VZQA 1KEEB 2GM5A 1OGYA 4Z8YA 1EVKA 1K7EB 5A5DA 4QPZA 1J9GA 2WHXA 3DD5A 4M0LA 2JGDA 3F7TA 4KH1A 4UJ5A 2FZGA 4B4VA 4Y6RA 1TECE 5DBFA 2RBEA 1ZN2A 3NAMA 1B76A 221PA 2GTIA 2ZE6A 3A1UA 3CLKA 3ESDA 3K30A 4H7EA 2WF6A 4NZYA 5DYYA 3H6KA 4Q4JA 1WP4A 1CY8A 3IDAA 1D6SA 1ENPA 2V4MA 4INOA 3V7UA 1ZWLA 4FUQA 4LPKA 1CDEA 1R6XA 3C48A 3GG9A 1DKQA 1I13A 2IA5A 2C59A 3DLAA 5CX1B 3V1YA 5A03A 1XAHA 2EQAA 4UMEA 3L8EA 2ANCA 4FYVA 1QYDA 1GLGA 3ZV3A 4FJ2A 3P20A 5CURA 5E6SA 1KIMA 1LLQA 5AXAA 5HS6A 1GQYA 3VZRA 3CRRA 4L85A 2Q6OA 1BCRB 1V5EA 4HXFB 1WUIS 2WWYA 1RFLA 1CUAA 1SXJD 2ZE7A 1ULZA 3NVAA 2GLXA 1AKTA 1CUDA 1RWPA 4LYGA 4U6NA 5AVUA 1NW8A 4G5FA 5H3LA 1TZMA 2RHGB 3DUFB 4N01A 1A8QA 1JB1A 4K6HA 4PYIA 4KGVA 4QT0A 1OH6A 2JARA 1RACA 1T0BA 2W00A 4RLHA 1PSWA 1NZFA 2QY9A 2R8XA 3C5VA 3NRBA 3PIRA 5LVAA 2CVPA 1Y8RA 4HDOB 4YAJA 4B1FA 1M1ZA 1Z0AA 1R8XA 1U9YA 1NI4B 2R2AA 1JJBA 3SC2A 2IE0A 3B51X 4Q4HA 5KZMB 4G65A 4LHWA 3U7JA 5IWAB 3JALB 3KB2A 1JSLA 1J1IA 3GEIA 4JGBA 1J00A 2XT0A 1MV5A 3IHWA 5K0LA 1GUFA 4I5IA 3RC3A 1E4OA 1TZKA 1PJQA 1J21A 3PXUA 2BPOA 4NBLA 4G24A 4PXAA 3BF8A 1B15A 5HR5A 4NHEA 2JDID 1O95A 2EZTA 1W88A 2HQSA 3IUJA 4Q02A 2PSFA 4B3HA 5AW6A 1E2BA 4FK8A 2JIOA 2Q9UA 4TM8A 2FRVA 1JDPA 4ES6A 3NDJA 3F6SA 4TT3D 3B6KA 3I4FA 2J3MA 3A6EA 3GMSA 4Z7JA 5KOJB 4FKBA 3M5DA 3W3AH 5KYUA 1MR3F 1IBSA 4J43A 5SYNA 4CL8A 1GEEA 3AV3A 5CXUA 2MSDB 4BX8A 4UJ3A 3B48A 2BZ0A 4F6RB 1BE0A 3AYZB 1XRNA 3LUHA 1G7TA 3IKMB 2MYNA 4YRZA 2E55A 2ZRKA 2JATA 3B82A 1DTWA 4LSWA 4JQYA 2B1IA 2UXBB 2J7PA 3H4MA 3HXKA 4YJDA 3I1IA 4B9EA 2OFWA 4ZEMA 5BOSB 1XMQB 4TM7A 4MS4A 3KFXA 2WNHA 2ZSHA 4RA9A 3DFKA 3O1JC 5I7VA 4DDHA 2QB5A 1NYLA 3ZWOA 3LOUA 4A8JC 4Q5IA 2Y0CA 4YWHA 1SCNE 2WIBA 1GTMA 2TS1A 3M1IA 2ZBUA 4IMRA 4MA0A 2ACEA 1UM8A 3SC4A 1BVRA 1NN1A 2XUHA 1WW3A 4TGLA 5K09A 5KJCA 1CR2A 2BF4A 5LIPA 1NQVA 2W90A 4IEFB 1P8AA 3L18A 3PT5A 3CZQA 3UXEA 2PG3A 3HNOA 5CVCA 3IX7A 1RE0A 1Q83A 1Z4NA 3OFJA 4K6CA 1AG9A 3AVWA 5DI9A 1P5HA 2BMDA 4RSHA 4BGEA 1EUCB 2QUAA 3DQPA 1CWUA 3C39A 3CPEA 4NS4A 4IXMA 4WBSA 3VXKA 3IEPA 3Q3HA 5CB4A 4DUPA 2R4TA 2BMAA 5HKKD 3JZIA 1E5VA 1KFEB 1KS2A 2FR8C 3ZV4A 1HGXA 4F72A 4GC9A 4WGFA 3H8VA 1AS2A 1I7QB 5G41A 1YIDA 1KMQA 2CKMA 1KORA 2YBDA 3RYHA 3O4IA 3RREA 1BJTA 1GCAA 4BFVA 3ABQB 1S96A 2HAEA 2VJAA 4IZHA 1I4WA 4KXWA 4XB6B 1IN4A 3ZDRA 3H99A 1CE8A 2HYDA 1C7FA 1X2BA 4DSTA 3PR1A 2LTAA 3W2IA 2Q8NA 2ZRPA 3FPFA 3OKAA 1T9ZA 2O3QA 1RQ7A 4HGRA 3RC7A 1WXXA 1N5JA 5LNK6 3HTXA 4DBLC 4XZ3A 5F73A 2CXOA 4GICA 4UTZA 3ZWCA 4RMJA 3BMCA 3SHTA 3LDAA 5CT9A 2JBAA 1VLHA 3MWJA 5EQDA 3PFCA 5J5CA 5KMGA 1QQTA 3KPWA 3TR5A 1E3DA 5IBQA 4HFNA 4REQA 3D43A 5AK5A 4UU7A 3RQSA 1EMDA 1T3GA 3W2GA 5TRTA 1EUDA 1BS9A 2H4XA 3N3AC 2WUWE 4ZVRA 1X14A 5C3MA 2P2ZA 1U3TA 1YB2A 4OU4A 4WXYB 2XW6A 1VPTA 3KWJA 1W59A 4O5OA 3PD1A 4RXTA 4CIXA 3B38A 3BXFA 4ENSA 3FDIA 1GGMA 2PH7A 3MTBA 1XYGA 5EE0A 5DXFA 2IUUA 4YXFA 4KO1S 4ZIRB 4D41A 3CNNA 3K4HA 5HILA 3T3MB 1GV1A 2C7VA 5BQ5A 3B5IA 4N39A 5AI9A 5BSVA 5B3LA 1QTQA 1UOPA 4CDMA 1UK6A 3CKMA 2EJWA 1UIRA 3V1UA 2ZUVA 5JY6A 5BQPA 1UJBA 2OBXA 4CR8A 1OROA 5JI3E 5JHGB 4MWDA 1NF9A 1FK8A 2CJFA 2GVDC 3G2QA 5A71A 3ZC3A 2JHGA 1NVAA 3IV9A 4IZOA 1QMPA 3QYPA 3T9EA 1P6QA 1Q7RA 4OV6B 3IHTA 5IXYA 4RZUA 4C4XA 2AOWA 1T6ZA 4B82A 2BFDB 2X23A 2Q2WA 1L5ZA 5I9LA 5IG2A 3P1JA 4U4AA 1CDZA 2EBUA 3TF5A 3AQIA 4G8CA 4MEAA 3VR5A 2Y0DA 3H0KA 5EY5B 4BQEA 2WABA 3DHWC 5FH9A 1NYQA 4AFNA 8ABPA 1L8AA 2DKFA 1MFPA 1LW7A 2VXBA 4WV3A 1S2NA 4B84A 3L4KA 3ND6A 3SR3A 2XWSA 3LQ1A 4HADA 1FW6A 3RO7A 3O8QB 4NU0A 4O4HF 2C1EA 1U2SA 1Z68A 4MB0A 4ISBA 2C8VA 4EW2A 1E89A 4YX9A 5CFOA 2O4UX 1G5PA 3KEQA 1A27A 2QVCA 1OX5A 2JFQA 3CKLA 5ILQA 3HJCA 3Q15C 4TVSA 4DNFA 4NZNA 2C2KA 1MRSA 1NBEA 2GN6A 6REQB 3MNFA 1QRUA 2I3GA 2GDJA 2XWJI 4LMBA 4YBRA 3U44A 2DZDA 3C24A 4F60A 3PIDA 5EIBC 2VBGA 3L7DA 4DJTA 5JJ5A 5DN9A 2BGWA 4MO2A 5EZYF 1QG2A 2PLAA 4XVRA 1EHYA 3U0VA 4YRIA 4ZJUA 1N3YA 3W04A 5BSHA 3FWPA 2EF0A 4C4AA 4HQFA 3MS7A 1L4UA 2IEIA 1ZIOA 3I6YA 3VYSB 5GV8A 3ZIDA 1BYUA 1ICEA 4NX2A 4R68A 1ATZA 5I9SA 3UA3A 1A7KA 1EFDN 2C07A 2JHCA 3DZGA 5LSAA 4JYAB 5LUBA 5DLDA 5TPZA 5ENDA 4CWAA 4TTAA 3FOFC 5ITWA 2GAJA 4OSEA 4YT2A 5DDIP 1C9DB 3BWBA 4QUJA 5FR2A 5E7QA 4ZYYA 5E3IA 1VHWA 1CRQA 1MC1A 1OLUA 1USVA 5DLQC 4D3SA 1J20A 4GWKA 5ALUA 4MR9A 2WDPA 1ZSYA 4QDJA 4RPKA 3ZQUA 1WUHS 2PVSA 1NRIA 2PBRA 4YNBA 4ZQBA 2JRLA 5HF8A 2CSXA 3VZCA 1QHHB 1E1LA 1KP2A 4MR8A 1CJUC 3WRYA 1GGKA 5I4CA 3N5KA 1IN5A 4PO8A 3VC2A 4P08A 9GPBA 3NO4A 4RPLA 3D7LA 3F73A 5AJZA 2XMQA 1GP2A 3OM9A 4ENVA 1J25A 2QTLA 5KCMA 3SEQA 5GONF 4IDOA 4X9XA 1U9IA 2IU3A 2R47A 2W93A 3KYBA 2VPIA 2QPOA 3P2MA 5DN6A 4MI1A 4LXIA 4EJSA 2XYVA 5K4HA 1CUHA 4P92A 3RWMB 1MEEA 2RAPA 2XQFA 3VR3A 4OI0A 2JIQA 2HU5A 1X7ZA 2I4LA 1R4MA 5T3UA 1N6OA 4BV8A 4PYRA 4BB9A 2NZJA 3JCZA 4R8SA 4EGJA 2EWWA 4NJOA 3LCUA 4BMVA 2HR1A 1UQUA 4YR9A 1O54A 4P7JA 3AL0C 3HXOA 1FS5A 3I32A 4OJQA 4BNYA 5CDYA 2DTDA 1E58A 3IFSA 1AGYA 4KXUA 2R1ZA 4HQ6A 2VZEA 4DM7A 1HFKA 2OCIA 3HUDA 3CLTD 3UA4A 2ZJ8A 1XNGA 2P9FA 3VZDA 4REOA 2XE6A 4ARSA 3TRIA 1Z7BA 3ONDA 4KO3S 5DT9A 3OTWA 3M33A 2F4NA 5EHXA 4F9TA 1SCAA 1EB8A 3JQ6A 3QJ5A 4IJMA 3VR5H 2YZ7A 2NSLA 1CDOA 1GRQA 1RZ3A 3BIOA 3DZIA 1Q1GA 1XZAA 4HPJB 4JL6A 3STVA 3OQNA 3ABZA 5KNDA 4GF5A 4LUCA 2QV0A 4BJ1A 2XWPA 5JRZA 1S8NA