4YO8A

Crystal structure of helicobacter pylori 5'-methylthioadenosine/s-adenosyl homocysteine nucleosidase (mtan) complexed with (((4-amino-5h-pyrrolo[3,2-d]pyrimidin-7-yl)methyl)(hexyl)amino)methanol
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
238
structure length
238
Chain Sequence
HENLYFQGVQKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVATQLVQHDVDLSAFDHPLGFIPESAIFIETSGSLNALAKKIANEQHIALKEGVIASGDQFVHSKERKEFLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISDNADEKAGMSFDEFLEKSAHTSAKFLKSMVDEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Aminodeoxyfutalosine nucleosidase
publication title New Antibiotic Candidates against Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori
total genus 85
structure length 238
sequence length 238
chains with identical sequence B
ec nomenclature ec 3.2.2.30: Aminodeoxyfutalosine nucleosidase.
pdb deposition date 2015-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4yo8A00
3K8OE 3IOMA 1Y1RA 1NC1A 3FAZA 2OXFA 2HSWA 1B8OA 2Q7OE 1T0UA 3FWPA 2ON6A 4EARA 3BL6A 4TS9A 2HRDA 1Z33A 2RJ3A 5EPUA 1T8YA 1RXCA 1Z5OA 4F1WA 4F3KA 4QASA 1WTAA 4JWTA 4P54A 1Q1GA 2QDKA 1PR0A 4NSNA 4DA8A 4BN0A 1M73E 4DA6A 3BJEA 1YQUA 3MB8A 4EB8A 3GGSA 1TCVA 1Y6RA 4D9HA 4NS1A 3BGSA 1SD2A 1PW7A 3FUCA 1U1GA 4L6IA 3C74A 1Y1QA 4L5YA 4F2WA 4DANA 4M1EA 2QTTA 5B7NA 2ISCA 1I80A 3DDOA 5C80A 1RXSA 4R2XA 1A9OA 3PHBE 5F73A 3UAWA 3O6VA 1Z36A 4TXMA 3OOHA 1YQQA 3FB1A 5F7JA 1V3QE 3KUKA 4R2WA 4D8XA 1ULBA 4X24A 1A9QA 2I8AA 4L5CA 3ONVA 4TXJA 3LGSA 1K9SA 2AC7A 3D1VA 3NBQA 3DPSA 2XRFA 1C3XA 4QAQA 3UAVA 2A0WA 3DP9A 1FXUA 5F7ZA 5CCDA 2B94A 1ZOSA 3KHSA 4M7WA 1OU4A 4G89A 3K8QA 3OF3A 1XE3A 5CCEA 1V41E 1OTYA 4TTAA 4KN5A 4BMYA 3UAZA 3ENZA 4JOSA 4D8YA 3PNSA 3FOWA 3SCZA 3OPVA 3OZCA 1N3IA 1JDZA 3E9RA 3OZDA 4TXHA 4QFBA 3EUFA 1VMKA 2OECA 3NM6B 4LDNA 1QE5A 3BSFA 1OTXA 2QTGA 4YO8A 5F7OA 1G2OA 1RXYA 1OV6A 5F78A 2PGAA 1PR6A 3INYA 1JE1A 3KVVA 4YJKA 4TXLA 1Z39A 3LA8A 1A9TA 1PR2A 2I4TA 3OZBA 1JPVA 4DAEA 3TL6A 5B7PA 3EEIA 2AI2A 1V2HE 4MCHA 1PKEA 1U1FA 3QPBA 3NM4A 1TCUA 2P4SA 4OY3A 4OEHA 4L0MA 1U1DA 1ODLA 1JDTA 3O4VA 5CYGA 4OGKA 4I2VA 1LX7A 4QARA 4H1TA 1SJ9A 2IQ5A 4OJTA 2H8GA 1YRYE 4JP5A 4GLJA 1ODKA 3KVRA 4TS3A 4G41A 3OOEA 3EMVA 1VHWA 3UAXA 3UAYA 3GB9A 3U40A 1Z5PA 1ZL2A 1PBNA 4UC0A 3MMSA 5K1ZA 4TTIA 4YMLA 3ODGA 2AI3A 4F3CA 1YBFA 1K3FA 1ODJA 2QSUA 1VFNA 1A9PA 3DF9A 1PK7A 1JDVA 1NC3A 3NM5A 4E1VA 4LZWA 4LKRA 1PR5A 2AI1A 5EFOA 4TXNA 4RJ2A 1B8NA 4U2KA 1JDSA 4WKCA 1JYSA 4GMHA 2A0XA 5EUBA 4M3NA 5B7GA 5KB3A 3OZEA 4F2PA 4NY1A 1JP7A 1Z5NA 5F76A 5JPCA 1CB0A 1A9SA 4WKNA 5IFKA 1OUMA 4ECEA 1OVGA 4DARA 4L5AA 4WKOA 3EUEA 1PK9A 4YNBA 1LV8A 4R31A 3KVYA 4WKBA 1A69A 1TD1A 1SQ6A 3T94A 1CG6A 1PWYE 4GLFA 3PNPA 1NW4A 1JDUA 1U1EA 5F77A 1VHJA 3FNQA 4GKAA 4DA0A 5CXSA 1Z34A 1ODIA 4BMXA 4OF4A 2A0YA 3E0QA 4D98A 1TGYA 1JE0A 1PF7E 5CXQA 3DJFA 1T8SA 1V4NA 3F8WA 5IU6A 1Z35A 2GUWA 4DA7A 1A9RA 3PHCA 4G8JA 1RCTE 4TTJA 4PR3A 5F7XA 1SD1A 1Z37A 1PR4A 1RSZA 5DK6A 1U1CA 4DABA 3OCCA 5FAKA 1ULAA 1Y1TA 1Y1SA 4D8VA 1RT9A 3LBAA 2A8YA 4QEZA 4BMZA 4DAOA 4K6OA 5I3CA 3P0FA 4IP0A 1ECPA 1V48A 4OGLA 1RXUA 1RYZA 4WKPA 3E9ZA 1K27A 4LNAA 5ETJA 2HN9A 2QPLA 1RR6A 1Z38A 2BSXA 1LVUA 1TGVA 1YR3A 3UT6A 4FFSA 4TYMA 4MARA 1Y6QA 3P0EA 1T8RA 3IEXA 2OC4A 5CYFA 1V45E 1RFGE 5B7QA 4LNHA 1T8WA 4PNPA 4MCIA 2HWUA 2OC9A 1PR1A 4QATA 3KU4A
chains in the Genus database with same CATH superfamily
1W4CA 1ORRA 5G3ZA 4MRMB 5LA6B 1U8XX 2YJNA 5EIBC 4JBIA 5K8VA 1O5TA 2QM3A 5KYGA 1GKKA 3TQRA 2OUIA 3A6JA 3L1HA 4LOHA 4U02A 3FWPA 4GF5A 4P36A 1D1SA 4DG5A 3CUUA 5EXPA 3AETA 3IV9A 5DGXA 3ETJA 1GQOA 4OPMA 4QTTB 1A96A 1GJRA 4U2EA 2HRDA 1M72A 4CMEA 3WI7A 5BWBA 3VKHA 2JHAA 1XNHA 3M3HA 4JLNA 3ZHQA 3P9KA 3EULA 1SKMA 1XQXA 3TJZA 4Q18A 1P4SA 3AEQA 3AF1A 5CVDA 4X64B 3PLNA 3ZCRA 4A36A 2VKTA 5IH3A 3TG8A 4MB0A 3OQNA 3PI6A 4KYVA 5JD4A 3PICA 3ZY6A 4TL6A 5LR6A 2CT8A 4R2HA 1DXYA 1R4NB 1T6ZA 1WZCA 3TLZA 2VJNA 3L6BA 5H3CA 4UU7A 4Q4JA 2CKDA 5B1HA 5J47A 4MRMA 1U6KA 1GAEO 2HBZA 3BJEA 3NBAA 2RHCA 2ERYA 1Q1EA 2VJQA 1IRXA 1Y7TA 2FSUA 3CLHA 4PZ0A 1YQUA 3JATA 1GITA 3AFHA 3SIRA 3T3DA 3QEBZ 2O54A 2Q50A 1BMFA 3WBBA 1YGYA 1WCXA 1JA9A 2E4XA 3Q0IA 1TCBA 4C6TA 4ZI3A 5C1PA 3PNVA 4U2CA 3LNTA 1ZBDA 3MC1A 1TCVA 1BN6A 3A3NA 2HMTA 2TMDA 4EVRA 1SUBA 3PEEA 2M6SA 3VJMA 3WQHA 3NZEA 3JQAA 1PW5A 3VX4A 4ENVA 2PG3A 3PA8A 1K6EA 4PLTA 4D6PA 4F2HA 3FUCA 1KI6B 1BWSA 1YZVA 4AKIA 2W6JA 2JIDA 3BE4A 4L27A 3GJ7A 4DSZA 1N5DA 3CF0A 3IPXA 1KIAA 4PXYA 5CFRA 2BFOA 3DQZA 4MW5A 2TRSB 2FW8A 3O4RA 2I1VB 5H1YA 2F3RA 3SXJA 3EPHA 1ZCBA 4G9EA 4DR7B 2QRLA 4QUAA 5MN6A 2AXNA 2FCRA 4ISCA 1K8YB 4QUBA 4REMA 4X7PA 1OFIA 2W70A 3SC3A 1I80A 3R6GA 4ZOEA 4F5DA 1R00A 2PCJA 4XLTA 2HDHA 3W3AA 1N2CE 1OAAA 1IM2A 2EX0A 2JAUA 4LYYA 1XCLA 3N3AC 3U4QB 4LBYA 4P7KA 2AXQA 2QP9X 4ZAZA 2W6ID 1QG2A 3O6VA 3O82A 4RPKA 3C8HA 3V2HA 3S55A 3O8NA 4OAQA 5JZ9A 1JVSA 3THWA 4KYTA 5YASA 1L4KA 3L8CA 3E9CA 3SD7A 2NQ2C 1DKOA 5EPOA 4Z4HA 3GFRA 4BLTA 1U28A 2PGXA 3T9EA 1WXGA 3AFNA 1X1RA 3AU9A 1R18A 1A7UA 2Q6KA 4FD2A 4H18A 4KWEA 4ODIA 3ZTTA 1AGPA 1FDIA 4BMDA 3EDMA 4YASA 1FMLA 2ECPA 3GA7A 2PUDA 4OI0A 3FVTA 1KI6A 3LDUA 4G1FA 3DE2X 3RYIB 2UXDB 2XMPA 1SM4A 2CLLB 1ATIA 2GHTA 1CT9A 1DQPA 3JAKA 5DDIP 2PT5A 1D9XA 4M7RA 4D0RA 1LVHA 2NSHA 5FR2A 2JLBA 3WA6A 1SVWA 2DLNA 4JB8A 4FU0A 3K0EA 4MIEA 2IT1A 5LQDA 3QE4A 4GL4A 3W6NA 3LRXA 3ZY3A 3DDWA 2HF7A 5KSWB 1ZOPA 3ICQB 2XAUA 1EBFA 1TZJA 2G17A 4WZZA 1J8VA 1HXHA 1UBTS 4IQFA 4MS3B 4PTYA 1HNZB 1ACLA 2A9RA 4FYVA 2JLAA 2W9XA 3G5MA 4H1UA 1W85B 2FWMX 4KCGA 3L4SO 4X6XA 2QX6A 4BQQA 2C1XA 3P20A 5CDFA 2VYFA 1WUKS 3EWAA 1LK5A 3BKWA 3LWZA 5DSTA 4AO7A 1QH1A 3N0XA 4HAVA 4I8DA 1Q1ZA 2Y93A 5AW3A 3CVVA 2AFIE 3KKMA 3JALA 4JSYA 1GGJA 4DWVA 3KQVA 4I1OA 4BMYA 3RYIA 2FN9A 5K8LA 4OBXA 1H65A 2MSKA 3IAUA 4RAOA 1IBMB 5F9FA 1V1MB 4GDMA 3BFJA 3H42B 2R4QA 4O3FA 1BS1A 3KKLA 3NTQA 4BZPA 1ZI9A 1A5AB 4YR9A 1Q0RA 3STUA 1VKHA 1N6OA 4LZLA 4P08A 4XB6B 2R8EA 3NRJA 1OGIA 2BF4A 4QPCA 1K0UA 3GXOA 4NK5A 5B53A 5FDFA 3ANLA 1PZFA 2ODPA 3B38A 2DCUA 4HYYA 4PM4A 3E9RA 2XDAA 1W85A 2FZWA 1Q0TA 3ELWA 2I71A 1PFVA 3MS2A 4R8KA 5D51S 4B7CA 2Z9BA 1HG1A 1SXIA 3PC8A 1JGTA 2Y6VA 3T1NA 1EDZA 3VR2D 5BUZA 2E5LB 2GPTA 3V8EA 4D82A 4RJIA 1CSEE 2JHPA 2QVGA 3DNMA 2FGKA 2X5KO 2BUAA 3ZZMA 4DDUA 3WMEA 2AFHA 1ZJ4A 1J4AA 1OTXA 4LRXA 1R9GA 2W58A 1Y8CA 4E7PA 5LNK6 5DNCA 3AWDA 3FZGA 3GGCA 1NRJB 1V1MA 4DV3B 1UBCA 2HREA 3VMMA 2JCSA 3ZV3A 2ZDGA 1K0FA 4DLVA 4Z6KA 1KETA 1N25A 3RO7A 4QU9A 5CDUA 2NVWA 1XBTA 2WF7A 1R0XA 3KVVA 2J0SA 1TUBA 3NT4A 4ZCLA 2ECQA 1P8JA 2J6BA 5TQVA 2XZPA 5IAEA 1PL8A 2HTEA 2QMQA 1DKUA 3FI0A 5CH8A 3WXBA 3HO6A 2JA1A 3OZBA 2JJ2D 4FBMA 5IEBA 1UL1X 3JWEA 4GKVA 5EZSA 1NXTA 5JADA 2D5CA 3VXKA 1YI0A 4UBKA 3A1VA 3KKOA 5E6UB 3V00A 3WFJA 1QRDA 5K8IA 1U9JA 2EX1A 4AQDA 4ZDIA 1TCUA 2HV8A 4NE2A 1ZHHA 2QTRA 1L4UA 2GPAA 3LWBA 4BC1A 4BQRA 3FGZA 4EFDA 1PEAA 1NY5A 3LO5A 2Q21A 5JSZB 4C7BA 3OLXA 2UYHA 4EFKA 3OD5A 4OHZA 2W2TA 1LX7A 4I2VA 3QNUA 3UW3A 4EGQA 4ER3A 1Z2DA 4G84A 5K0FA 5MN5A 2OL4A 3SS7X 4GKKB 3UYKA 5DX1A 1DIBA 3AEYA 5MDHA 3I72A 4HGNA 4JP5A 4GX5A 4GLJA 3I5XA 4OA5A 4OK5A 3DTVD 2O3SA 1YS1X 2EF0A 2GPBA 4IQGA 4TMWA 5KNCD 1N6HA 2FRDC 2G76A 1IOLA 4MQLA 4D44A 4M0LA 3A9WA 5EZQA 2GH1A 5GM1A 4B6FA 1KMHA 3UAYA 3T54A 5K01A 2ZS7A 1Y8RA 1MABB 3U7FB 4DR6B 2GN2A 1X9HA 1P6UA 4JHXA 3G0HA 4BKPA 5E6UA 4W8HA 3J7TA 1EUZA 2CLIB 3QXHA 4QXQA 3OP1A 3IO5A 4CMJA 2UZ4A 2Y0CA 4O1IA 1N34B 4GP6A 4U63A 4QSHA 1FP6A 2PRSA 5CIWA 3HZOA 4X94A 1SVOA 2FK8A 3ENQA 1ZZEA 1WAMA 3JD2A 3AF5A 3HP4A 5TQJA 4CGYA 3OUZA 5CT6A 1Q2XA 1ODJA 1GHTA 1PJBA 3AUAA 4KBFA 5A1TA 4KX5A 3VA7A 4EMTA 1XZNA 1HE5A 3C1TA 1GEGA 2CLDX 4CTJA 3QXSA 4Z2YA 3K5IA 4LKRA 3CX3A 1Y63A 4H27A 2OB2A 2VXBA 1IB0A 4C0HA 2OV4A 4MUEA 5FUMA 1ICEA 3MCAA 4YRRA 4M8NE 4Y1FA 1XRNA 1RQ7A 4NECA 1FTWA 3FETA 4B2YA 2V6GA 2FK7A 1C9YA 4J1NA 5LSAA 1J8YF 1VCHA 1M1YE 2IA5A 3CSUA 4LSWA 5LQKA 4GLLA 1KYQA 4GLBA 1MVNA 4OQDA 2D7CA 4KMRA 5CU7A 2Y1GA 2A57A 2JLCA 1NFFA 1N9ZA 4Q48A 5CJ2A 3I30X 3RGWS 3OZEA 2ZCUA 3PD7A 1PVVA 4ZO8A 3SBOA 4C2BA 5FO0A 1QLWA 4Z4EA 2G9QA 3I9FA 1UJBA 2WIFA 5E3HA 1CZLA 1ZK1A 3DONA 1QPGA 2HA5A 4L78A 3BWXA 3CWCA 1X7XA 3E7PA 3H3XA 2J3QA 2PUTA 3LC1O 3NHRA 4IH1A 5HCNA 3TUJC 3UG7A 5KOHA 1XSEA 2N46A 3O2JA 3ROKA 4C0LA 2PBRA 4L5AA 4WCFC 1U7OA 2OHFA 4ZYLA 3LPDA 1QIIA 1IC6A 3M1IA 3B82A 4RD4A 4JJZA 1G16A 2BY4A 5F21A 4I8IA 4LSGA 1P73A 2R66A 2FSVC 2V7XA 5BSTA 5BNTA 3E9NA 5FAXA 1FLVA 3G6KA 2H1WA 3KU1A 1Y3IA 2ZKIA 2PSFA 5FNZA 2G4CA 4O4IF 3W78A 1CG6A 4LHVA 2RGNC 4RFLA 4N39A 3F3SA 3UA4A 4A2CA 5AVYA 4MEBA 3IQDB 3OCUA 4IGIA 3S2FA 3DXZA 1ESDA 1IU9A 1JDUA 3FSJX 4EF4A 3KUCA 3OVMA 2ZSBA 4V03A 1T1EA 3UB4A 3JAWB 2GPNA 4C4ZA 4P34A 1EWKA 3EGXB 2JKZA 1SELA 3ZW7A 4D3DA 2X77A 1IPHA 2W6NA 1KMNA 1XXLA 5FRDA 4ZKDA 5B5SA 5F64A 4CDNA 3W2EA 3WS7A 1F1BA 1JR2A 1MHPA 2WAAA 2WM9B 4BNTA 3CT6A 5E6SA 4DLAA 4E2XA 1BX0A 2OWEA 4X1KA 5EERA 3QNWA 4N3NA 1AH2A 4AXBA 1BE8A 4IKOA 1VRVA 3LP8A 5F1OA 3NJ4A 3S5JA 1FP1D 4UKDA 1W59A 4B9EA 4NCAA 1DG3A 1KQ3A 4MUGA 3A9CA 2IOHA 3H84A 2HEIA 3PS9A 4JX9A 4N82A 2VO1A 2RGAA 4G97A 1NF9A 4YUXA 1EHIA 4IHJA 3B53X 2WZBA 2ZP1A 1B2RA 3AINA 5U1PA 3GLRA 1UBOS 3ZDQA 4CV2A 3L7DA 5JASA 4DLSA 1NM5A 3ZWQA 3WIOA 1EFPB 5HFJA 5ALVA 5LU9A 2J48A 4FXOA 4OX9B 5THKA 2WAMA 1DOZA 3PGVA 1Z4KA 3ZK7A 3OJFA 5JAOA 5DHAA 2SCUB 4DUGD 3UBTA 4FSDA 5JOQA 4H77A 4P7BA 1MIHA 5C81A 5EYPA 3OE1A 1PE0A 2HCFA 4ML3A 4MI6A 4D9JA 1U2GC 3JV7A 5DTMA 3A05A 1R5BA 2ZLBA 3CWQA 4AJOA 5FBZA 1JQLB 3WAKA 1SRRA 1HBJA 2MOKA 3SYMA 1Z88A 2IHZA 2JH9A 3JWHA 4Q9HA 5KYKA 1NPTO 1XDWA 2E6KA 1CZNA 4RORA 1CP2A 1PLKA 3IE1A 4IPTA 3ROXA 4AQ7A 2L17A 5AFSA 1H05A 2OCIA 3GJYA 4ZODA 5C7YA 1TF2A 4AJLA 3LSYA 3R3WA 4MVJH 3WKCA 2B37A 3TZEA 4B45A 3FDFA 3Q5GA 5I9BA 3INTA 4B83A 3MOSA 5T3UA 2FN4A 3P2IA 4GOND 1CKEA 5C34B 3T9BA 4BRZA 4GEKA 1NVVQ 3S2IA 2HPAA 4KUEA 2IHNA 2AX3A 4C1BA 1Y7PA 2B30A 4DWOA 1DHRA 1XHLA 3RUCA 3TIGA 3L1KA 3MYRA 4IGEA 3T38A 2XADA 2XQVA 5C8YB 1C9KA 2HA0A 4YRIA 3GZNB 2XCTB 3VTFA 3QVVA 3LCMA 3RG8A 4QBFA 4XWKA 2FMFA 4J29A 1QMPA 3W3ZB 1EP9A 3K1YA 1OH5A 1Z8FA 2POQX 3WGYA 2MYTA 2X41A 3FUTA 1BKDR 2OV1A 4FGLA 4KFCA 1OHHA 5JLJA 3PUXA 4UQPA 2IXGA 1JBQA 2O7NA 3DVAB 4AYXA 3TR6A 3ZJ5A 3UMGA 1JJIA 4QTZA 1IVSA 3HH8A 4K0KB 2AS0A 3VUEA 1AV7A 3DPUA 4C4PA 4EJSA 3THSA 2OPBA 2ZJ3A 2BSXA 2JIMA 3Q72A 4U7GA 3SLRA 3NYQA 1E3DA 2LBPA 4KSCA 2G7ZA 4BO6A 4GOJA 1T6XA 1N7HA 2WF5A 3HYCA 3TDNA 4GM1A 1TU3A 1PS0A 4F4JA 3ROZA 1PNOA 5T41A 2JB9A 2LE0A 5AKIA 1NBMD 2BCGY 2VC2B 3QWBA 4Q3BA 5FBRB 4CF5A 1I2BA 1RJGA 1QM5A 4D45A 2PYZA 1NVGA 5DXFA 4G5QA 5DV9A 5IT9A 1FJHA 1JH8A 1GQRA 2FPRA 4OOFA 4V0NA 1W8DA 1JIUA 5B1IA 1U02A 1KI1A 2WF6A 4RTJA 4LQCA 3WYDA 5IK2A 3MRVA 1KWGA 1HX7A 3TFOA 4QWWA 2RFLA 4PC7A 4C7XA 2DGDA 2Q3FA 3ADCA 2Q3HA 4EHLA 3TCXB 1RYDA 1Z0DA 4H3HB 3G2LA 3Q3HA 1URPA 3A2MA 3W34A 2HWUA 1Z47A 3CKYA 3CGGA 3TMKA 3O0TA 1GU0A 4X54A 1JEEA 4ZEXA 1A8HA 1ZESA 3ETEA 2XBLA 3CVXA 4EYSA 3ZE8A 2IXFA 2CUKA 2ZROA 4GSKA 4OKNA 3SNKA 4Z54A 1U3FA 1M3SA 2X2FA 2WZQA 5JMOA 3FAZA 4BB9A 3G2HA 2D5LA 3PJDA 2OR3A 4UE6A 4ZT5A 3OPQA 3DAGA 4ZFNA 2B7CA 3CZ9A 4CHGA 4FPXA 4RACA 1BKYA 3RF6A 1JHYA 2YXEA 3RS4A 3HJHA 2DPGA 1K63A 4W1QA 2Y05A 2R48A 3SIXA 4RXMA 2HWKA 4FOLA 4F1WA 3TS1A 3R75A 2HHLA 1Y98A 1HT0A 3CEMA 3M5PA 5AKJA 3TG2A 2C5BA 1O0SA 3G2IA 4JWTA 4QQNA 2PZFA 1N2ZA 5T4FA 3ROFA 2FVXA 2Y9MB 3U4AA 4H7JA 4I9GA 1NP7A 2PWBA 5E3IA 4TN5A 5FV7A 2OXIA 2O7QA 4BJ3A 1UDCA 1JIIA 1V8PA 3O83A 1XQVA 2L42A 4MRRA 5H3LA 2CLSA 4AKEA 1UBNA 3JZMA 4K1XA 3RFCA 5JS6A 2OEPA 4DA6A 3SS9X 3B6JA 1LFDB 1LDBA 2QRUA 3V2GA 1EIZA 3VR6D 4BLRA 2ZM6B 4AG3A 1YR2A 3IMEA 3OWXA 3FNHA 3O9MA 4LXHA 1SU6A 4MV6A 4RSGA 3FWNA 3NUZA 3V4PB 5DN6A 1QGYA 1RLIA 1E7YA 1T2FA 3E7WA 1B00A 5IVIA 4TVKA 4PEVA 4L4SA 3RDPA 4E5DA 4Q12A 2YWRA 4C78A 2VQEB 4HATA 4NS1A 2OQ2A 4ETNA 5FV4A 2DFDA 3FCCA 4QEKA 4RL6A 3GEHA 2IUFA 3FVWA 1BC5A 1PSZA 3LKDA 2YZ2A 3AVOA 3M4ZA 4HEQA 2DQSA 4MJLA 3ZI7A 1FW6A 1XTTA 3PRYA 5ALSA 1JS1X 4NATA 6AT1A 4CXMA 3OFVA 5LYYA 4MSUA 2B83A 2JCBA 2ZRMA 1NR5A 5CX1A 4IX1A 3WK9A 3CH7A 4ZXFA 3ESCA 4H60A 3VV2A 1KOGA 5GJVC 3IIIA 1JKJA 4CF3A 1TK9A 1ZR2A 1XNJA 2B34A 4MQ4A 1NUHA 1MF7A 4F2WA 5JJKA 4DANA 3TJMA 1ZD5A 1T35A 2WAYA 4AS3A 1GKIA 1MTOA 2QKYA 1ZKMA 5CEEA 2J41A 1XKLA 5HIKA 1KAQA 2EZ8A 3A70A 3I6ZA 1Y80A 1TUIA 2B4KA 5IJXA 3MNFA 1J2RA 1CQJB 1OYVA 3W2GA 4URZR 3FWKA 1JAXA 1CY1A 2QYOA 3PHBE 4B3HA 3L0ZA 1YC2A 3CKLA 4GSLA 1OA1A 1SZCA 3LXRA 3KR9A 3ND9A 4L16A 4Y2JA 3VYSB 6LDHA 1Z36A 4I9FA 2NX2A 4U3JB 3UENA 1WULS 4F56A 2RHBA 1DS6A 4UUAA 4JZKA 4JDPA 2IYOA 4GI7A 1P4JA 1UPUA 4INAA 1NLUA 4JH0A 3E18A 2J85A 3VKWA 4AJKA 4CI0B 3ZNQA 1NYRA 2PDAA 4FK8A 4BEBA 2MHCA 2PWZA 1J90A 2Y8EA 1V11A 2DUNA 1Z62A 2WJGA 3QUQA 2ZBUA 4B7AA 4HMQA 1U0SY 2YJTD 2HIHA 3IP9A 4TZ6A 4DV0B 1EFCA 3Q87B 2FZ5A 1JQBA 1YJXA 2VJYA 4KDRA 1C3XA 3HG7A 2JDID 3DBRB 1RAAA 3UAVA 3ZK8A 2QGZA 5EMJA 4LCBA 2EGGA 2QN8A 3EW7A 2NO9A 3PIDA 4CI9A 1NF8A 4IRXA 1Z7GA 5EFZA 2FOLA 4E5YA 5EJEA 4DMKA 5BWCA 3W5JA 4N41A 1V9CA 2YJ4A 3D8BA 2WWTA 4G89A 4PXSA 5EAIA 5EE3A 1TVCA 5CVEA 2E37A 3E3LA 1LLQA 3U9LA 3C8ZA 3BH7A 4HH1A 3SVZA 3FCAA 5ALZA 3F97A 3D0RA 4W5OA 1F0KA 4PZDA 3U3ZA 4F1JA 2XWPA 5L3SB 4C7OB 3PU6A 5HE8A 3ZIDA 4BNUA 4QXOA 1USWA 3H11A 1NMSA 1TZMA 1LI5A 1XUOA 2CYAA 4O4LA 3NHFA 3QGMA 5GZ6A 4EL5A 2RGUA 3CRNA 1BG6A 2CF5A 2ZYRA 1AK9A 3I9V6 3UTDA 3HVRA 3NBKA 3LQKA 5A3JA 3EXEA 3GLQA 4ZZ0A 4Q1EA 1UBJS 1H42A 2IPMA 4K9PA 5H4GA 1SC9A 3GA0A 1JU9A 4F71A 5DK4A 4DBVO 1QHHA 1U31A 1GCUA 1FTGA 5D3ZA 3ONDA 3HFGA 3VU3A 5JI2E 1UQRA 1Q1AA 3H7IA 4HX5A 4TXHA 4BAUA 4YREA 3AUYA 4EG6A 2B5VA 3O2QB 4GZ6A 4LTMA 4FS3A 1YE8A 2Q5LA 5GY7A 3WMXA 4Y2SA 1I3LA 3BHMA 3G2MA 1IWBB 3PZRA 3TQSA 5BNIA 3CSDA 1EI9A 2PR7A 4KE8A 3SLGA 3CZCA 4DJJA 1HQKA 3M5WA 4A15A 4QUHA 4RSMA 3AEZA 3VR5D 1GPH1 2GAOA 2FKNA 3RVRA 3TZKA 2COUA 5K2OA 1MRZA 1OD6A 1U8YA 4CM1A 1A5SB 3BEDA 5F78A 2ZIFA 1CUWA 3OG9A 5CBPA 2YWEA 4MWSA 4PIPA 2J0QA 4FKZA 4GH5A 4PHGA 3MLBA 2KM1A 3K9FC 1OA0A 1S2NA 3MYYA 1XJQA 3DOJA 4U6QA 3U0VA 1K4YA 2KE5A 2XDQB 3A1FA 1MVLA 3GAZA 4MVWA 4PZ9A 3FFXA 1ESEA 1SHKA 3V7NA 4W5RA 5C7OO 1R10A 4NAHA 4XM2A 2GCOA 3VR4A 4R1SA 1E5LA 3CR3C 3W5VA 4BYGA 3HJGA 4NPHA 2LWIA 2KS6A 5GJCA 5H4HA 1ZUHA 1N4DA 3GVHA 4YMSA 1J1IA 3NHSA 2A7QA 3I61A 3ROGA 1QSGA 1UBRS 1T9BA 3IPYA 1VJTA 2P1RA 3V1KA 2O0JA 2F3QA 2GJ8A 2ZG6A 5HQ3A 1X8KA 2GZ3A 1C0IA 3TIIA 5DWQA 2YY5A 3NC0C 4W5TA 3ZJTA 5FYQA 4L73A 1J2EA 3DMTA 4DLKA 5JW6A 3UH1A 1MMFB 1FTSA 4DMFA 2CHVA 3O4VA 3BHJA 1M75A 3NTLA 2YFQA 4H16A 1ZS9A 2VPZA 4U9UA 4EI7A 5JSHA 5AVVA 1D04A 1RWPA 2JBWA 2ZJ1A 3GRRA 3ILYA 3RYCB 1RBMA 4YRQA 3T35A 1W87A 1G7CA 3PR2B 4LG1A 4WK4B 3BEOA 3QKRB 3V8NA 1JKXA 3OC6A 3GLIA 2O8FA 4LXTA 4DA4A 2P65A 2BFPA 3AP3A 1PG2A 2XUAA 4M76B 2Y6UA 3N76A 5AIBA 4Y2RA 3HU2A 4BFCA 3IKJA 2OFXA 2YVUA 2ZTUA 1CULC 3RYFA 4E32A 1HDRA 5JFOA 3UAXA 3O8QA 4KU4A 4QNRA 2QX8A 3D64A 1C4XA 1U3VA 2X7XA 1D2RA 3DMHA 3FCUB 3GB9A 3MBKA 4GQBA 4MVJG 1UKYA 3ZE6A 2A0UA 4WXHA 4EITA 2AA3A 4PANA 3R40A 1N3BA 1KNXA 1U9YA 2OP0A 4BX3A 4V0KA 1Z3CA 5KINB 3HYTA 4TT3D 2P2DA 1N78A 1YJQA 1EJ2A 2J33A 3KQWA 4NMMA 1XDGA 4NZOA 4PFSA 5LDGA 2RHDA 1FVXA 2JEYA 2W6MA 4GVXA 4QBGB 5DWDA 3U44B 5IC5A 2AI3A 5KTYA 3Q6NA 2QVXX 3GY0A 1BEUB 3USES 1U6JA 2GJ4A 4BEJA 1MOSA 1P1KA 4OQFA 4OK6A 3IAAA 1JQ3A 1ZEJA 2C3PA 3RJZA 2NTYC 3AC0A 1MTZA 3P52A 1H2EA 4IMRA 1TMYA 2RH9B 4O8ZA 5FL7A 4D4IA 4ZGWA 3RYCA 1WCIB 1ADFA 5DB4A 3CX7A 1NKSA 1JKFA 1NC3A 1K2WA 1NXQA 2I0FA 2IC5A 3TXAA 3EZ2A 3UY4A 3ZWNA 5EFOA 2W4IA 1ZNQO 1NLFA 3FKSA 1B8NA 1YFKA 2V6IA 4IF6A 4BFVA 4QQRA 4AMUA 4ETMA 3AIKA 4FI3C 2LVBA 3QJ5A 4MOWA 3SC2B 4YUWA 1LLFA 3N28A 2VHWA 3KCNA 3O3NB 3AYXB 1Z82A 2GEKA 2GZHA 2IYUA 2WJVA 3GC6A 3M8KA 3PDCA 3PXEA 3QEOA 1WG8A 4IZHA 4MB2A 1INLA 4F2PA 1DAEA 3R77A 2HFKA 4MGZR 1J09A 5AVKA 5CT5A 4MWBA 2YXDA 5I7HA 4ZPXA 2P78A 3GVPA 1IN5A 4RFSB 4LFBB 5LP1A 1DZ3A 1HL3A 2WVGA 4EMBA 1NN5A 1PT9A 1OTHA 1O03A 2OUKA 1I7DA 4TRMA 1RRKA 4WVLA 3A9UA 1FX0A 5HMLA 1SB9A 1T9KA 3G2OA 3MELA 3MJVA 3TGWA 3UPDA 4HEHA 3SBEA 3VU9B 3QLUA 4BWFB 2BGWA 1DTSA 3JYPA 5G4KA 4ZCIA 2R00A 1YULA 2A84A 4DN6A 4RQBA 4AG5A 1TD1A 2PUCA 1HE8B 4FFWA 4U0KA 3TVDA 2W6QA 1YZYA 5MN4A 5TS2A 3QKSB 1QWOA 4E46A 2JBAA 2O0MA 3UZUA 3HXPA 5IYZB 2FUKA 5FQOA 2EHJA 1C3LA 1NNSA 4WD3A 3T9AA 3A1TA 3WIEA 3LH5A 2FYTA 3DMGA 2AOWA 3E9YA 1KZ1A 1BYUA 3HM2A 5JAPA 4GG1A 2G4VA 1ZICA 5I9MA 1B7GO 1DLIA 3EN0A 3OJLA 4JD5A 1IY9A 2OAQ1 1D7AA 2XRMA 3FMGA 4RFSA 5I7AA 3WGLA 2XYQA 2X8LA 3CR7A 3OOJA 3Q11A 1RWNA 3NXKA 4QJBA 4HXEB 5K6TA 5DCLA 3H8JA 3IVMA 1F14A 2GCNA 3N8KA 3NT5A 1XTRA 4U2FA 5K0TA 4MKHA 5LPNA 3RVOA 2VUHB 1A5ZA 5KTOA 1MX9A 3A9TA 2GXAA 4Q4AA 3I83A 4IH9A 4WT7A 3OZVA 3W3AH 2LRHA 1QVAA 5AJXA 1CDEA 1I4OA 4C3ZA 4BTEA 2DR0A 4BATA 3PD0A 2FLVA 1FQWA 4KFUA 4RPIA 2G5GX 1W5FA 2GFQA 2FQWA 1T8SA 5IYZA 2H85A 1IN1A 1Z4IA 3QW4B 4YRMA 2HK6A 1PJ2A 2OBMA 3HCDA 1IQPA 3HV0A 1SBIA 1HZZA 1C41A 1ZH8A 3VZBA 1RPTA 3V7FA 1R6BX 4UOZA 2VBFA 2E18A 3HLKA 5CFLA 4TYQA 3ADDA 1H1LB 2SKCA 1AS0A 2XJ9A 4IIJB 3IS3A 1LQ2A 1E7MA 1W9HA 1ZMXA 3AM4A 1Z22A 4ZV4A 3N2EA 2YHUA 4UDXX 1Q3HA 1PFWA 4WNAB 4KK3A 2YZMA 3E8XA 1DUVG 2PX5A 3EZFA 4WXRA 3VDRA 1N8KA 2ZULA 1C0EA 4IDFA 4A3SA 3S81A 3UQYS 1XR3A 2VTEA 2FFJA 5L7TA 1QNLA 3PUJA 3NYIA 4IDDA 2IOYA 4U8HA 4WECA 3AZOA 4DIEA 4QVIA 2LCIA 4YP5A 3I32A 3LPMA 1KU6A 1M1NA 1E2NA 3P2KA 4TUYB 4ZK2A 4PN3A 1Y1TA 3F74A 3FDZA 1X7YA 3AUSA 4FGZA 2BFDB 3I2IA 1GPLA 1YNOA 4BBJA 5AW4A 3C6ZA 1NUAA 2GSWA 3F4BA 4HK4A 5F23A 1ATZA 1LK0A 3OAAA 2AOUB 2FEWB 2OBXA 4QXMA 4EHFA 2WU1A 3Q7IA 4GMKA 4CN9A 5FHRA 1K7EB 4OHXA 3UCFA 1H93A 2FEAA 2OD2A 1B6RA 2XE4A 3WQQA 3ZYCA 2XKJE 4I5GA 2HOQA 3GGGA 3OUUA 4M0DA 3LT5A 3I4LA 4N8SA 5EEHA 2WWWA 3GIDA 5JR3A 4RX1A 3GFFA 2G5TA 2P68A 3WDLA 4HP8A 5GADl 821PA 1CRPA 2VJPA 1IJEA 4H0CA 2WBLC 3TLEA 1GGFA 4Y6OA 2BE9A 3KKPA 3KYJB 4MVXA 4RSHA 3V32A 4RD3A 3DTVB 5CFQA 3QVTA 4UDOA 1BE0A 1NT4A 3THYB 3KFLA 4MA0A 4B6JA 2DRIA 4DADA 1RI3A 3A37A 5AWFC 5SYAA 3A9SA 1T0HB 3LBNA 3PGLA 2VDMB 1TQ4A 3R9XA 2DE0X 4YJ3A 1NN0A 1WLYA 2I2DA 3IHKA 3ZHYA 2CNWD 4MQEA 1W49A 2JIOA 3M2PA 4AL4A 4E5UA 1MH1A 1QGDA 3UT6A 1R0WA 4G0PA 1G7RA 3D3EA 2OA0A 4U39A 3T7CA 2ODAA 3U13A 3FYHA 3ZG6A 2WFZA 1M6VB 2Z8YA 3RGGA 2QR5A 2C7PA 3X1JA 3LFUA 3NLLA 1CUFA 2HU8A 4KAFA 5E6RA 1L1FA 3ZVKA 3DKRA 2HMUA 3CE6A 2K6GA 2CNDA 2PX3A 2FW0A 2IL1A 3LUAA 4QYWA 3SJUA 3F3YA 4KR0A 2R84A 3GEPA 5KCZA 2QAIA 2QLTA 4N7BA 1G5HA 3U7GA 2OORA 2J6IA 5BV0A 3HO8A 1YZ3A 3D4PA 4MCIA 1LF5A 1TTQB 1QF9A 1XZFA 3OX1A 1SB8A 2KBFA 2PVCA 3MLEA 4FW8A 4CKZA 4DHWA 3DTVA 5IBRA 2YWGA 4BU1A 1YBHA 3B51X 2WIKA 1QUEA 3TPFA 2OC9A 3I6IA 5IFLA 3ZDAA 5HQTA 2YBDA 4QATA 2J09A 4GXTA 1KEUA 5D5HA 4CQNA 4J6EA 3N0RA 4KIUA 3GJ8A 3MSCA 4NYJQ 1YQDA 2ID9A 2JGAA 3E5HA 5ECGC 2X0EA 2PGJA 2V59A 4FP9A 5EJ9A 3WL5A 4Y0NA 2HLPA 3F96A 4ZCSA 4YUVA 1RZVA 3PKZA 1G1AA 3RT1A 1U7TA 2RGDA 3RBVA 1PNRA 4ESHA 5JHHB 1QP8A 3A27A 2P9HA 2WLTA 3D5QA 3EUWA 3LBYA 1VSBA 2C2ZA 2GZMA 4OB6A 4PVCA 5CTJA 5DHSA 5AW9A 5ARCA 4A92A 3IHWA 4KXUA 4MGKR 4BO1A 2WHQA 2EQBA 5KWSA 2EP5A 3I2HA 1L5RA 3FPJA 2XUJA 2Q8QA 4CN8A 1EA5A 1L1QA 2AXEA 1T3TA 2ZIGA 2ZJAA 3V4ZA 4FC6A 1UEJA 2Y99A 3GAFA 4UM7A 2BBSA 3EZ9A 2A4KA 1TCAA 3I9OA 4BYMA 5KWEA 1FJGB 1WZIA 1ECCA 1L5WA 1KORA 1Z4QA 5CX4A 2A9VA 4L9SA 5JC8A 4FYKA 2A14A 3F4KA 2B2CA 3G9XA 3UK7A 3SR3A 3BM5A 3FF1A 2QN3A 5HM6A 3OKFA 4D5EA 4EYOA 3TOSA 5H3HA 1GVNB 5B4TA 1QWSA 3HEMA 3M3PA 1F0PA 4R83A 3E1GA 4OL9A 3GBVA 1CBUA 5G1PA 3CFYA 5T4EA 5CR9A 3TRIA 1QXSA 2ZYSA 3K9LA 1GPUA 4XWGA 5LWQA 1X2EA 3ZE1B 1OYWA 2R7NA 4RVGA 4FGWA 4Z4FA 5JZVA 3AV3A 1K7SN 4H1HA 3TUIC 4W99A 1T4DA 4KQCA 3TLMA 1KBOA 4J0FA 1EVLA 4E5VA 4MUMA 2AYXA 1I32A 4E21A 1QG4A 1U11A 4AROA 4TSKA 4RJKA 4KWHA 1DAFA 4GRIA 3T7KA 1LUAA 5FCDA 1BJKA 1W30A 1F0YA 2HRQA 2Z0MA 4KW7A 1RKUA 1WPXA 2C3YA 2V4MA 2ZETA 4REOA 1FRNA 1VG8A 4NBTA 3CT4A 4E31A 3KT3A 2Z04A 2I4MA 3RVLA 1ECJA 2QY9A 2EKQA 4S2UA 1AXRA 4P4SB 1O7JA 9ATCA 3UAWA 2REQA 4AJ2A 1QQTA 3GZ4A 3TLCA 2V7EA 5F9MA 1JG7A 1LRJA 3LTNC 2EHDA 4DCGA 5DLDA 1IPFA 3WK4A 4B9AA 2CDNA 1UAGA 3DLAA 1YJ5A 3QUAA 4O33A 5AHRA 5B1DA 3OHPA 1QLJA 5FTKA 4M9ZA 4CM9A 5BNWA 4Z4GA 4PX5A 2CY0A 1K75A 4DJFC 2Q2WA 3U9SA 4IINA 4EY3A 1Q83A 1XLTA 1TECE 3DDNA 3I3SR 1UOQA 4P7GA 1XL1A 4G25A 5LA6F 4ZOLA 3VPSA 4ZZIA 4HNGA 2JIZD 4M0EA 5IWCA 4F2GA 3I9LA 1Y3CE 1GPBA 2UAGA 2C07A 1SEVA 1LZLA 1EE2A 2H5EA 3E58A 3ESDA 3FRIA 3KJFA 3N9IA 3O2NA 2G9RA 3JRXA 1S6YA 3R24A 2Y68A 3IEMA 4MNTA 3G9TA 4J6FA 2FWIA 2IW3A 3MAAC 2Q0QA 3PITA 4W5JA 4PQEA 3EEBA 2VH2A 1SR8A 1GTVA 2IY8A 3BZUA 3T3GA 1RYEA 1CJKC 1TK3A 4HSEA 1SC1A 3TJRA 3MB5A 1L5GB 3KHSA 4X45A 1HRKA 2C8VA 2ONYA 3PNMA 1PJ3A 3MUEA 3T1HB 4GP7A 4EG5A 1JHVA 1VHQA 2AHRA 2NPIA 4ICIA 5DLPA 3V6MA 2GM4A 1EB8A 5KWJA 2OWDA 5J5AA 3GMSA 3WADA 4P9NA 2CEKA 3BICA 4BGVA 4LAFA 4R8LA 3S2SA 2Q45A 5IVKA 3FIUA 1G291 2PLFA 2O2JA 2TYSB 3LX8A 2J5RA 4US0R 5TXGA 4JROA 2BF7A 4AYWA 2ZJ0A 4FCWA 3K8YA 1YK1A 3L3BA 4B6EA 3FNEA 1B8VA 4XRRA 3DJYA 2B9EA 1HT1E 4ALNA 2PR2A 1RC1A 3HA7A 2QPOA 4F84A 1T43A 1YTLA 1EFLA 1JG3A 4RPGA 5F2OA 2X2PA 3P5BA 1E60A 1W94A 1N3IA 3Q8LA 3M4NA 4ENUA 3GCWA 3RUPA 4K0RA 4Y7CA 1E98A 4XLLA 4G3XA 3K0HA 2IE8A 2VH1A 5CCXA 1NA5A 1JEQA 2B99A 2RCYA 4K9OA 1V5WA 1EZZA 3ABZA 3C3BA 3DR5A 4OFZA 2IWHA 2R6JA 2Q0HA 2E1PA 3HGMA 2VT6A 5GWXA 4F6RB 2D2XA 3T3NA 4XAQA 3QX9A 2FB9A 4KGDA 1T4CB 2GCIA 4RGYA 5AOCA 3DLTA 3PXAA 1T24A 4YS6A 4CDGA 1KVQA 1E1KA 2I6UA 4WN3A 5TRTA 2CV1A 2V74B 3C3MA 4J1TC 4N65A 1ADBA 2MINA 3WLQA 1YTUA 4C4TA 3T52A 2UZAA 4CKXA 1ZM2A 2XT9A 1BVRA 1RXYA 2X0RA 3E05A 4PINA 4ZYXA 5KJCA 1HFKA 3ONEA 4RZ2A 1EZ1A 4J7XA 1WB5A 3NBMA 3CJTA 3D7RA 4ESOA 1YH3A 3EXIA 4D74A 5AVSA 3A9VA 2P41A 5ECWA 1EBBA 2ORIA 4Q4HB 3AONB 1IHUA 4EF5A 4TXLA 1G8HA 3LA8A 3UHJA 3HHEA 5TQ0A 1NBOA 4EHBA 1M74A 2CVFA 1XTBA 3RTDA 1KEZA 2AMFA 5BMVB 5JDCA 2HUPA 1WX1A 2XGSA 3EA4A 3FPGA 5EHGA 4ER5A 3TUZC 3WIDA 1H6AA 4DAEA 1L7VC 4ZC8A 4DUPA 1S2LA 1XTZA 1DTWB 1T6YA 3FYCA 4IOMA 3WDSA 3NWJA 2AI2A 1VKOA 5E8RA 4H7FA 4HYTA 3S6JA 1JMVA 5A06A 4US1R 4C5BA 4V3BA 3QPUA 1CY8A 1XVTA 2EZUA 4F72A 3ROTA 2AOVA 2NPFA 5FTJA 1YQGA 2GM9A 5FJIA 1Z68A 1K6IA 1U81A 1KZ6A 1QZ3A 2BBOA 2P62A 3DDCA 3DO5A 4LVNA 5DXJA 4R69A 4EY4A 3TH5A 1I7LA 3CU5A 3DM9B 1U0JA 6CHYA 2IZ7A 3W1EA 1ZSVA 4NX2A 5DYYA 4MV3A 1QTNA 1TFUA 1USGA 2HLDD 3FHOA 1T8UA 3U4DA 1M2WA 4YYEA 1MKYA 2A5GA 3HKDA 4DCTA 2HI0A 2OHIA 1C2YA 4MO2A 3S8MA 4AF6A 3FPEA 5P8WA 4A6DA 2BFEB 2ZSKA 1P29A 4KODA 2D13A 3C4JA 3KVRA 1UWKA 1AHHA 4R8SA 3ZEAA 1VCMA 2YQ5A 4Q6WA 4TLDA 4BWYA 3P9QA 4JP8A 4BNDB 1F6DA 3AHHA 5HR5A 2P6RA 2CK3A 3HJFA 1CIJA 1C3JA 2UZ3A 4R84A 1PIWA 4RM3A 1GRVA 1YB2A 5J59A 2PWYA 5IN5A 1RE0A 3G8DA 1EGQA 2CLCX 4B3TB 1W4LA 1QO9A 1ZL2A 1RYNA 4PSDA 1UMDA 4CT5A 4UC0A 4LDPA 4I6GA 1WDKA 1U65A 4PXAA 1NDUA 1XD2B 2W2NA 1Z75A 4G5SA 4PGFA 4QGHA 4TX1A 1SU7A 1TK2A 1SA0B 1J2UA 3O95A 4G5RA 4X3PA 3UWMA 4JR2A 2AJBA 3ORFA 4MMZB 3KOXA 4XTCS 1QIFA 3VVBA 3WZLA 3DE7X 2RB4A 1ZM7A 2H92A 3LLSA 1G5FA 1Z0FA 3ASVA 3K9HA 5IX8A 3J81A 3JVIA 4M9CA 1YQXA 1JDVA 3JQDA 2HQOA 2Q5OA 2YS7A 4RQTA 3S7TA 1WHTB 2HSZA 1T5LA 1PT8A 1Y42X 1CUJA 1KFBB 1T3HA 4RJ2A 5T67A 2DP4E 2VPXA 3OETA 3QOWA 3RHZA 1H6BA 3V7UA 4TKUA 3WJAA 2Z8XA 3L05A 3X0DA 1HORA 3EASA 3Q1LA 1XDSA 1DBIA 4F85A 2X9GA 3UJHA 3I23A 1N7JA 2CXTA 2FSGA 4V38A 5FO1A 5JCZA 2NVOA 5DTQA 1U2RA 1KQFA 4Q9AA 1HYHA 1W0JA 4P0QB 3ZN2A 5HZKA 1P6QA 2VA8A 3P2OA 3P96A 4WFQA 1PFQA 4FFBA 4NY1A 1MUUA 2CXHA 1U7ZA 2GRJA 1PDVA 1QB8A 4PBTA 3RODA 4BB5A 3CLSC 4JUAA 5C4IA 4L72A 3K32A 1N6LA 3ME5A 4MXDA 5CK4A 1I9CA 3UJPA 4TT8A 2OFWA 4RJLA 5J2UA 4AUEA 1SCQA 1X7ZA 3HZRA 4XB2A 4RPLA 5LB2A 3UGTA 5G0SA 5LL6P 1OPRA 5LIPA 2P4QA 1GZDA 4Z86A 2LKCA 4CM7A 4ZIRB 2G25A 3FM9A 4Y6RA 1XPUA 1EUCA 4ZMSA 3VNUA 2YIMA 1KJQA 4Q1FA 2P2LA 1JQEA 1XFDA 3KVYA 2NQ8A 5SY9A 3NX4A 1IG3A 4KMOA 2CZGA 4KGVA 3MMPA 5KMGB 3JZAA 1D6JA 1NQOA 3FDIA 1CETA 4UASA 4OK3A 4GI1A 4KE6A 4UPDA 1QYVA 2H29A 1QRAA 2I4IA 3D59A 1DQSA 3D2AA 3L1VA 2EQ5A 1FK8A 1N5OX 2Q5FA 2ZIVB 3GIWA 4HEA6 1NSYA 3RJ9A 4D99A 4RZQA 1A98A 3OSUA 3Q2OA 1NUSA 5JJBA 2SBTA 1ZEMA 3QVGB 4CV3A 2CXSA 4RVOA 5K0LA 3SOZA 5KOJB 3KG2A 2VDOB 4D79A 1TADA 5JLAA 3SEFA 4BLPA 2J9XB 3U1TA 2FX5A 1BRTA 3CGWA 4JEMA 1Z8DA 3EOZA 2QX9A 1CQIA 4TMVA 2N1BA 2H08A 1CRZA 4HADA 2ANBA 1M1ZA 3HKEA 3ESZA 5BXQC 4DJTA 3LM8A 4P2GA 4U2BA 1C8LA 4LY3A 1JHMA 1SHJA 4FLEA 3SE7A 1JU4A 4MUFA 1Y9EA 5F1PA 1V43A 2YJ5A 1MX5A 2Z57A 3ILSA 5DHRA 1AKEA 2A7XA 2Z30A 1GU7A 3AI2A 3AFOA 4IDPA 2FZLA 4AJ4A 4CQLA 1W5TA 4CTMA 4MCAA 3DUWA 3H1PA 2BFNA 3LAWA 3DJFA 2WNSA 2PX4A 2EFCB 2VFAA 1IK4A 3I2KA 4EGJA 2CMFA 1OJLA 3JSAA 2GK6A 1I1NA 2PZ8A 5DYNA 1V26A 1SUCA 1ABEA 3NNSA 1F8FA 1SCIA 4ZMRA 4KLCA 1QUFA 3D8SA 3QVGA 1IAVA 3IUYA 1UEIA 1QJCA 3MS4A 5FBWB 5EA2A 3WBJA 1MQ8B 3SZRA 3HLYA 2IH4A 4G8JA 2J67A 4G56A 3PKIA 3H5VA 4NCJA 4CCAA 3A3PA 3GH3A 3KUDA 3MJTA 4FZRA 4PAOA 3TD2A 6PFKA 1GYRA 3N5CA 1SKUA 2HPVA 4R51A 4NEGA 2IYZA 2IVFA 3MHTA 1CZKA 5BPHA 1K7YA 2A5FA 3ED5A 3KZOA 4Y1GA 1CF4A 2MDTA 1OC2A 1PVDA 3DDSA 3HKCA 3ABOB 2WWHA 3LC0A 5EMLA 4R1OA 1FYWA 5C7LO 5JYEA 3AVXA 2WJ4A 3I37X 3AM1A 3QFFA 4JXJA 3OCCA 3NHAA 4N0PA 1Z07A 1W5AA 1UMCB 3MQ2A 3LX5A 3HR4A 2ONJA 3ZDEA 5I3ZA 1I4TD 3MGCA 3IAHA 5FAKA 1W36D 2GM3A 5FTNA 3ZUGA 5DM70 4D8VA 5IKOA 4B31A 1QHSA 3AJ8A 4AXXA 1SXJE 3C24A 1NXXA 4F11A 1Z29A 1EX1A 3V1NA 1XNRB 3LUCA 4MDYA 3L8GA 2Z9DA 4AMZA 4MEAA 1NRWA 3AW9A 2Y2UA 1V8OA 4ES6A 1E0SA 1Z9BA 1J00A 4N03A 2BMAA 2D1FA 4O25A 3WDKA 4DZTA 4QIHA 1XZMA 2IFTA 2KPOA 2Q4OA 4UAVA 1Z45A 3FNFA 1KYYA 2ZE8A 1CNFA 1G2IA 2Q5QA 2NUAB 1LW7A 2C9YA 2B4QA 1UODA 2XMDA 4G01B 4UMEA 3GF4A 2IV3A 9LDTA 2XYHA 1R6UA 1L9XA 3AGQA 5SZJA 1PGPA 1YDGA 2XKBA 3M9LA 4NICA 1KZ9A 3HB0A 1MZPA 3IUJA 3MCUA 1KOFA 3AOGA 1LVUA 5AXBA 3OTGA 1JI0A 5CITA 2G36A 4EEXA 3LY7A 4LRWA 3V8RA 3WHPA 3E53A 4CQMD 4R1MA 3S2YA 5KNDD 1X15A 1R0RE 2QN2A 1LZKA 4ND5A 3R7AA 2DY0A 2VTBA 3ZHCA 4LX8A 4BNHA 1M0SA 4L3OA 1K7FB 4PVDA 2W2MA 3IKVA 4N3AA 3KPJA 5CUQA 1PX0A 4XEHA 1YRAA 2KSQA 3MS7A 4NEQA 3H6GA 4PTLA 5ALKA 1RFLA 1AVTA 1I24A 2WF9A 1EK5A 1WD7A 4KAJA 3O4FA 4OI2A 2YHSA 1SBTA 5I9IA 3JZDA 1VJ5A 1UXHA 2EGUA 2FMIA 2I9PA 2JIPA 3GRFA 3DHYA 4MYRA 4LGVA 1S02A 2VAXA 4R1LA 5DPMA 1NMEA 4A27A 4BLSA 4OFWA 3P2JA 3VR4H 3MTEA 4J8PA 2VXOA 1WNTA 2YICA 3EXFB 3PWSA 2AMJA 2HK9A 2WZCA 1JFVA 3L92A 2QNIA 4IYRA 4J0QA 3H7AA 2OLKA 2REXB 2DBQA 3ZQKA 3EW9A 1A72A 3HYNA 4QM7A 4TT3A 2YV5A 1T2UA 5JCOC 2ORVA 2WDPA 1PR9A 1JWAB 4UAGA 5PGMA 8ABPA 2BKEA 2G9ZA 3UPUA 4B6OA 2WU4A 3GLFB 3H5LA 1RBQA 3BKXA 5A5GA 4EECA 1XK6A 5J2TB 3ZLJA 3BL6A 3FY4A 4Q9IA 1J70A 3NONA 1KQNA 3CX6A 2DQKA 2ZIWB 4C0QC 3VGJA 4TTSA 5EOVA 3O8RA 2NTVA 5JD5A 1Z5OA 3UXEA 3RKSA 4YBZA 3TM5A 2I54A 4ZANA 1BS2A 1LBIA 4K9RA 1RU3A 2ZI9A 2V6MA 4YAKA 4ZICA 2QLFA 2H63A 2ONCA 3WB9A 1B3BA 5ESRA 1PR0A 5REQB 1Q0UA 2F1IA 4NSNA 4UREA 3RYHA 5AESA 5KNLA 4BP3A 1KO4A 3M6VA 3EXFA 2QRZA 1LNZA 2VJDA 3ASZA 1KH1A 1LBTA 5EP2A 4CMGA 1PAUA 4MQUA 5ESXA 1GPKA 4R1TA 1PGJA 3HNOA 3BRSA 1G5PA 1YR1A 2IXBA 3H5AA 3WRYA 2C3MA 2QJFA 1FY2A 1WHSB 3I5AA 4U2GA 5C8YF 3PNQA 1WF3A 2BSAA 4W7HA 2VUTA 5FADA 1W7AA 1EM8A 4IVRA 3ZWMA 2CXPA 2Q5IA 1ZI8A 4ZCTA 2NU8B 3I12A 1IMOA 1XCJA 3AHFA 3HYRA 4OB7A 4XGKA 1TJPB 2BEVB 2C94A 3VTAA 3IBGA 1W1IA 1FNMA 5KYXA 1T0IA 1VIDA 2CVZA 3HLTA 3LPCA 2XEXA 4GGMX 3X1XA 3PEVA 2YOHA 3KQMA 1U1GA 2NUBA 4KE9A 1QYCA 2P2YA 4J0IA 4OV6B 1L2TA 4GW3A 1ZISA 2F3TA 3IVRA 5JCJA 3HVIA 3T06B 3VOAA 3UH0A 4P5EA 2AB0A 1TEZA 5KQPA 1NMXA 3GP5A 3L9WA 3S70A 5IJ0A 2Z6AA 3BPSA 4QXAA 4YMUA 1XAJA 4LY9A 5GGXA 2AW3A 5E7JA 1H3EA 3ORSA 2RCNA 4WBNA 5AVQA 3LC2O 2BDEA 3LL4A 5I9NA 4IMPA 2IPAB 1KRWA 2MWMA 1YUNA 3OZWA 4M0PA 5DX8A 3EGDA 2OCGA 3OICA 2E87A 4A2WA 3ORHA 2DQ4A 4UDYX 2WJPA 5K4GA 3I5MA 4PQFA 1JTFA 2FXIA 3HSSA 1P5ZB 4RK4A 2AC2A 3P0HA 1W0KA 1L7RA 3AKEA 2C3OA 4B81A 2IPOA 3ZKAA 1BDHA 5HIIA 3RJTA 3SQXA 4WJKB 2DWPA 2WINI 4YI3A 5AHOA 1THGA 5EP1A 2WY2D 5KQMA 3NDIA 1DDGA 2UZIR 3NCTA 3VO2A 3ITEA 2GDJA 3U9TA 4OYRA 4R2WA 4G37A 3VDXA 1E92A 3CONA 1ZVJA 2IOFA 3L77A 5EE1A 1L1RA 2OAGA 5JPIA 3MWEB 3M1YA 1EXWA 3IX7A 2I78A 2W6CX 3NAQA 3OIYA 4L95C 2DTDA 2H17A 4HNTA 1XZLA 1E64A 4KI0A 5C52B 1C1DA 2X0JA 2OXTA 1KYWA 3LP5A 5EJIA 5KTSA 2NO6A 2Q49A 3UYLA 2EV9A 3JRWA 1ZK0A 1DEKA 4JLUA 5SZIA 5LOVB 3ZIAD 1T36B 1GTJ1 4HEJA 3UXYA 3CCBA 3AF0A 4AVYA 1V39A 2NVBA 3GOHA 3RM3A 4OQPA 1O96B 1ZOSA 4KQ2A 1G8JA 4MINA 3ADOA 3GFTA 1Q11A 5HTKA 1XD8A 5IH7A 3B2NA 3VFDA 2I8CA 5CAEA 3U31A 5KQGA 3J80A 5JQWA 1FUYB 3ICEA 2R4TA 1JMYA 3CH5A 4HD8A 3E48A 3QVJA 2WT8A 3GYBA 2QAGC 4BMSA 3ASUA 4PCUA 3VOSA 4K8RB 4WCFB 1FMCA 1NNUA 4CMCA 1JHOA 2C7QA 1UK8A 3CUTA 3KQPA 1N5KA 4JNCA 4Y2UA 4CF6A 1KOLA 4K03A 1RQLA 1LQTA 3GEDA 3O3CA 1X7GA 2XUOA 2CNLA 5E0OA 4A6XA 4AJ1A 3L1UA 1KA9H 4EH1A 1S7GA 1KFJB 3UOAB 2XTZA 4PX3A 4TSFD 4HN4B 1RBYA 1X80A 3P8ZA 5BR8B 3EFOA 1WIWA 1USUA 3SQMA 1A04A 2JFGA 3V2UA 2Z4RA 3IUBA 1N33B 2RJOA 3HA2A 3HS3A 3Q7PA 5COBA 1NBWB 2OGTA 3IJEB 3REQB 1G64A 3N8GA 1U9IC 2PLWA 2PO7A 2HC9A 3LY5A 4JYBA 2XCOA 3GRKA 4YPFA 2QVYX 3DZFA 4XVCA 5CK5A 1IDN1 3MJ4A 3OQJA 1E96A 5J5CA 5TE9A 4A0SA 1OZGA 1RM5A 3A1DA 3HXOA 4NBSA 2IS4A 1PCXA 2H31A 2BE7A 2ODEA 3CNNA 3M1LA 3MFQA 4QOGA 3KPYA 2O59A 2NZWA 3BSFA 3Q2KA 3EGOA 3ZDXB 1NXVA 2HW8A 2NAPA 2PVPA 1AK2A 1Z6XA 3V1YA 1NN1A 2C2HA 3HCCA 5JFTA 3EPRA 3EDCA 2EP7A 3PGMA 4QYTA 3RAPR 2FPLA 4EGFA 1AZLA 3PWTA 1K6JA 3EBOA 1U0BB 3BC1A 2CYBA 3UTCA 4BQEA 4BUCA 4ZJYA 3TQHA 4J9VA 1XZAA 4C21A 2AKYA 1SBHA 3D5TA 3M9XA 2X8AA 4NJOA 1G20E 4D3XA 1NVXQ 2W42A 2ZSDA 1KSGA 2WD7B 2YRXA 1GT6A 3I1FA 1JE1A 4OGWA 2C2KA 1KSHA 3AHGA 2XQJA 4H7PA 4H7HA 4YJKA 5FBQB 1Q1QA 4IXTA 3N1UA 3C3AA 4HL6A 3BWDD 4LZAA 2DQZA 4Y6PA 1ZC4A 1ZD9A 2F9MA 4JBHA 5TY0A 4BFYA 2ZRGA 4BMNA 1C3OB 1M2GA 2EW2A 4UZSA 5LYJA 1NBHA 3PL5A 3VHXB 1XQWA 1PO7A 1ZN2A 3OQVA 3HNPA 1ECFA 3U37A 4QODA 1YBVA 3DO6A 2PRYA 5GV7A 1P80A 5DF1A 1P17A 3DMDA 3GROA 2XTJA 3BCSA 1R3UA 4G1VA 5FBKA 5BUSA 4KQ1A 2QU7A 5E9AA 3V1UA 4AK9A 2JAOA 4HI0E 1WUHS 3QV2A 2QNBA 3GLIE 3SZOA 2W00A 3DM5A 2BHNA 4HZUB 2RC5A 2PFSA 1SU8A 1U1DA 2PRIA 2O05A 2WIJA 3FD8A 4RF2A 1DRJA 1NYTA 3E2MA 4LS3A 3KYDB 4DEVA 2I80A 3I8XA 4C7MA 3ENVA 1QR2A 4AN1A 3JTEA 5BYKA 2Q5HA 2JPDA 1UK7A 1P19A 2WD7A 2WKWA 1KJZA 2WUVA 3AUTA 3H2GA 4F06A 1C50A 1MDFA 4N6NA 3QEAZ 1ABFA 3QU9A 4EY7A 1G6HA 5J9FA 2F4VB 3OOEA 4BO5A 1WR8A 4Y9TA 5DM2A 4EI2A 3DEHA 3OIUA 3HN2A 1HZJA 1DT5A 3ADKA 2W98A 3P71T 5DHQA 1L7QA 4L07A 1ND5A 3UV6A 4B3CA 4GR4A 4U7TB 2CFIA 3EVNA 1Z5PA 3FUVA 3CTPA 3NH9A 3JQFA 7GPBA 2REBA 2QGFA 3I6QA 4RXUA 1PJSA 4INOA 1GP2A 3G2QA 1NVMB 2QTBA 2K5UA 4JVSB 4TTIA 1A0OA 1S9HA 1XZCA 1XP8A 3DAHA 1VLQA 2R1UA 5ICFA 4MIOA 2WPDA 3KAPA 1WOYA 4X1IA 3TM4A 3N2ZB 2H2AA 4JUCA 2VUUA 4P3NA 3A6EA 4CKCB 1CR2A 5T8KA 1XRMA 4BNXA 3GFSA 4D3SA 2XCRB 1AJEA 4WSOA 3ZV7A 3QZUA 1E5QA 4A1OA 4Y2HA 4JVOA 1NBIA 4A4DA 1Y4SA 2WB2A 4ESVA 4BLOA 2UUOA 4L3VA 1VA5A 4AYTA 4PAMA 1F5NA 3C5HA 3RRNA 3WNDA 4CT4B 3KCQA 2PK3A 1BGVA 2AKAB 2ZXEA 3OO1A 4TKZA 2A0XA 3VQTA 1V1RA 2DF8A 3DHEA 3ABIA 2BISA 1E1CA 2XOKD 4BZQA 2GWRA 4M3NA 3WB0A 1H0SA 4HAZA 1DO2A 1TEXA 4RKYA 4RYDA 3GNSA 3OEHD 4IQ8A 3HB7A 2JLUA 3ITNA 5F1KA 2C4KA 2PLNA 3G1WA 2NU6A 4OIFA 4TROA 3DYIA 3UJ6A 5K0ZA 2RHHA 5A3RA 3NUGA 4RVHA 4OJMX 1A71A 3RU9A 4DCPA 4TYNA 2W2PA 4P3XA 3R6LA 1K66A 4F8JA 1GAQA 4K3VA 2QTVB 1FFEA 3K94A 3NI2A 5FI0B 2VJOA 3K9WA 4DF3A 4AKTA 1QVVA 1ECLA 3KJGA 1OWLA 1E8MA 5EWLB 3GUVA 1DAIA 1QH0A 2VK4A 1V4BA 3KJEA 2BFBB 1LV8A 1XL0A 2V7PA 4OKSA 4WH0A 3WL3A 4R31A 5F1YA 5BV2P 4ILKA 3WKEA 2OO5C 1B6TA 4QOIA 3I1JA 1A69A 4HMPA 4GWLA 4TOIA 3ZJYA 1PJRA 1SQ6A 3KQKA 2A6PA 1BFKA 1F51E 4ND7A 3RANA 4WPGA 1Z5VA 1LBSA 3LKZA 3W5UA 1QVWA 4D25A 4PHCA 1X1SA 1DOAA 1HWYA 4BFWA 2V0GA 4J91A 3KVOA 5E1DA 3LV8A 3DFIA 1U3UA 1WXIA 2M32A 3OURA 3TW8B 1H9CA 5CIQA 1WZUA 1RM4A 4DQUA 5DH9A 1UXJA 2A0FA 3HC7A 2XXBA 4H2DA 5C8ZA 3MUOA 4KQJA 1P2BA 1Y33E 1OWPA 3H9BA 4RH0A 5CXSA 1KQPA 1E2BA 4QBKA 2X9NA 1Z34A 4ZAWA 3VYUB 2SKDA 3D4LA 1XMIA 3W5DA 2Q62A 2VRBA 2ZWPA 3A1CA 3E15A 3I45A 4O2BB 3AR6A 3R7WA 3ZKWA 4ZYWA 3MXOA 3AVTA 5FEMA 2AGVA 1QHXA 2NO4A 4XCQA 4DIUA 3PT9A 1WNFA 4O4HB 2C83A 1WABA 4XPIB 2AKEA 2CZCA 1NVWQ 4K9QA 2ZBVA 4TV9B 5ERGB 1DDOA 2GZ1A 2I76A 3DE3X 3GPCA 4ZJUA 5EL0A 3NETA 5KQSA 1QLHA 3B9BA 1Z6AA 4KQHA 1GRNA 1TXGA 1AMUA 1LC0A 3ZHSA 2QTAA 3VBCA 1AXEA 4AJNA 2HJHA 4M9XA 3G7NA 3PNOA 1Y8ZA 3GCDA 1O2DA 1TC2A 3O8OA 2EOAA 5ALGA 4Z9FA 3NRBA 3F9CA 1VP3A 3V34A 4HDKB 3WNCA 3INNA 5AIAA 1VCNA 2B1RA 2ZIAA 3LUGA 3IP7A 2A9FA 2FDXA 1N3YA 3UW1A 3M5CA 4EJMA 2BI4A 1UZAA 4BGDA 2VATA 1V7QA 2Z9CA 1PWEA 4OQMA 2Y1LA 1CEEA 2EKPA 2ZJBA 3LU1A 4O2BA 5C8XA 3DWGA 3CX8A 4ZVMA 3SC4A 4TKVB 2DX7A 5LP6C 4Q3CA 2RHTA 1AS2A 1G3IA 3FMFA 2YN4A 4B40A 1HDZA 2VP5A 2QHXA 4XVHA 1PTJC 4JLMA 3E2IA 3B6ZA 1XAIA 1DRVA 3ORRA 3AF6A 1DCMA 4KR2A 3IDQA 4AS1A 4DG8A 3CLSD 4L9AA 2Z2YA 2BMEA 4MUAA 1IL0A 2VJLA 4U7DA 3GH1A 5I3CA 1ORIA 1HQDA 3RSFA 1SQSA 1A1VA 3L41A 2VRCD 1NJ2A 4NV0A 2OYRA 1ONBA 3KYCA 3NVKI 4N9WA 1EX9A 4OUKX 5HA5A 5C31A 3S68A 5IF3A 1DDIA 3BZWA 4Z9XA 3OEED 4C5AA 2SECE 3EFBA 4O63O 3RS7A 2VWQA 2B8WA 1MXHA 5AW0A 1S2OA 2IDKA 5FR1A 2FZKA 1YMUA 4D7AA 1RLMA 1YI1A 4CCYB 3K09C 1Y9JA 1LV7A 4DTCA 5IYZF 3C2QA 1MEOA 1BWPA 3V55A 5FPSA 1ZH2A 2Q8PA 2ZUVA 4K7JA 1NYQA 2F9FA 3L5KA 1TVEA 2HD4A 1HYQA 2ZRAA 3KNZA 5AHKA 4B85A 3U6BA 1I4LD 1T1JA 1YB7A 4D5GA 1JLRA 2YIVX 2HY7A 1OLSA 2XT6A 1Z6GA 4UEJA 4XGRA 3IA2A 1Y8QA 1XMSA 2YWFA 3EVDA 4JP3A 4RA6B 1ICIA 5CYFA 1HOXA 3R74A 1JLLA 1WDLA 2J3JA 2O1SA 2VNAA 5L53A 2HSGA 4W9NA 3DXYA 2OYCA 1JG1A 1YCDA 3FCYA 2XBUA 4OX9Y 1MFZA 1EIWA 2HQ1A 1A2OA 1S8FA 4S24A 4AIRA 1PT7A 4WGFA 2TS1A 3ZJUA 3WB2A 3KTAB 1HLPA 3VPXA 4MAFA 4QT0A 3H65A 5HILA 3X2SA 4CLOB 1XMJA 1F2DA 3NFRA 4MQMA 2BT4A 4LIPD 1CR0A 4K6HA 3PC2A 1F5SA 3SHWA 1A9XB 2QE6A 3D31A 3K72B 2E4VA 4GE0A 3RIGA 3VZSA 4CMEC 4B4UA 4QYSA 3R3YA 3M7IA 2FCAA 5ERYA 3MWDA 2I6XA 4OXKA 1PD1A 1F06A 1GL7A 2W2VA 1WXWA 2ID4A 4Q05A 1Y6FA 1Y1RA 4DQLA 1C4OA 3AGPA 1R12A 4FONA 4UJ5A 2P6OA 2RGCA 2CSUA 1LI4A 4IIJF 5D5QA 3WSWA 1T0UA 1P44A 1UKCA 2CFTA 3AEXA 1UR5A 3UKJA 2C9OA 5CLQA 4DDWA 4DQKA 4R2IA 1OFGA 2C20A 2Z3VA 2A4MA 4OO3A 5D6OA 4IG9A 1HTTA 2AG6A 1JPJA 3VR3D 4K40A 3ILVA 4ASUD 3K0FB 4KQIA 1DWQA 5GP1A 4F3KA 1IJKA 2ONKA 4D6XA 2RH5A 3DBOB 3FE2A 1X7DA 1I6MA 1XJWA 4P82A 2WFAA 5EZYB 2ZYUX 4EMSA 2ANCA 3PLRA 4FBGA 2H1LA 1PQ4A 4X62B 5D85A 4TUYF 4D41A 2E21A 3NH6A 5DHTA 4WY2A 4EFLA 3CRW1 4ZT6A 2ZT8A 4BLVA 1REQB 4LWPA 1L9KA 4ZGGA 4E7OA 2EF1A 4O59O 2A94A 1UWVA 3QELB 1Q7GA 5E1OA 3TEFA 4ZHSA 1J56A 1JMKC 3N8DA 3NKLA 4FMBB 3GGPA 1Y9DA 4MR7B 4R16A 1ORHA 3DMRA 4CODB 2P7IA 1NXSA 1EHCA 2J8ZA 4CKWB 5ARBA 4P5PA 2GF9A 2ZU0C 1GADO 4EUEA 5AR1A 3Q2IA 2PGNA 2ODBA 3P7MA 2ZSAA 1K8ZB 2CUZA 4M1OA 4YLYA 3QBVA 4YMGA 4G85A 1RI1A 1AGXA 2GAAA 2QXTA 2QD3A 3B78A 3EWNA 3PWZA 3CZ4A 2GBCA 3K0FA 4OYLA 5DGTA 1D2NA 3RS0A 4AT1A 1Z2OX 3JU3A 3K2QA 4YV7A 5B55A 1Q14A 2DHRA 2GGSA 2FUCA 2QE7A 2FFRA 2VEDA 3OM1A 4KUGA 1S1MA 1E2QA 1T4BA 1PLJA 3C87A 4JMPA 3MCVA 2FMHA 4K05A 2ZGVA 2WAXA 5CA0A 4LJKA 5IKMA 4WN9B 1I4WA 4GOLD 3R5FA 1YR7A 1KZGB 4PNEA 1VMEA 1T10A 3LX4A 1JJ7A 1ES9A 4MDFA 1G60A 3P27A 4AG6A 5JQGA 1U28C 5EIHA 2G1PA 1BE1A 2WP8J 4K3UA 4J3NA 5HIAA 1QF7A 1X92A 3P9IA 4EYEA 2HSJA 2JI9A 4UHEA 1E1MA 1E3WB 1VB5A 1IN6A 5FL3A 4KXWA 2FPIB 4ZPJA 3K6SB 4GYJA 1OXTA 4CDRA 4FSXA 4PHHA 2W48A 1YZGA 1J07A 4C4AA 5KOYA 3SR4A 1C7EA 1BYIA 4M83A 1L3BA 2Q2QA 3OOHA 4TQ9A 2PMFA 1DMRA 1N0UA 4DT1A 4ALLA 4KSYA 2ET6A 5FUQA 4FIDA 3TRFA 5IMBA 3WWDA 5K09A 4HQ0A 3ZH2A 3H3JA 1VL8A 5CLHA 3RKUA 4QA9A 2I6TA 1KJNA 1VLZA 2GBIA 3OTIA 3QF7A 4F7WA 2GZDA 1P9LA 2NNLD 2PL1A 3TSWA 1RRCA 3DXXA 4YMVA 1A9QA 1AK1A 3UJ7A 4BFSA 4NI5A 2I8AA 4MS1B 3KFXA 3D6VA 4TXJA 1UZLA 2BEWA 2JAPA 3DL7A 4UUBA 4OQ4A 1W36B 5ECDA 1LEHA 1G3RA 2OESA 2ZYWX 3FBTA 1WW3A 3DPSA 3G3EA 3LK6A 4B09A 3CB4A 1FP7A 2H2HA 4XTRA 1VPEA 3AHDA 4DLYA 5IAGA 1USKA 1OJ7A 3JWPA 5KWIA 2EJVA 4KH0A 1ST3A 1X1AA 1Z3IX 2CFRA 5G0VA 3SEAA 1PHRA 3BSSA 3U2QA 3IMFA 5CBKA 3ZIUA 4UQOA 4PQYA 1JAYA 2O2DA 3WMRA 2UUBB 4E11A 2KW5A 2GTHA 3IYLW 1MB2A 2D8AA 3V4FA 4UTVA 1XE3A 4BL5A 4CNBA 1N9KA 5HUHA 2ZRQA 2ZM5A 4XJXA 4ZJZA 4S1WA 1KPHA 1THZA 4HX2A 4W6QA 4C0AC 3TXYA 4BRSA 1U8FO 4E3WA 1BU8A 3VTKA 2C8KA 221PA 2YINC 3QLTA 3ZVNA 3ANNA 4R41A 1M34A 3I9MA 1QP7A 1SVLA 2QOEA 2W2KA 3PC8C 4KKVA 2IHYA 2M98A 2BHSA 1T3SA 3L06A 3A28A 2O3RA 1JFFB 2D4AA 2ZK7A 2PQMA 2R8ZA 4LJAA 3WNQA 3JRNA 2QBYB 5B58T 4NDNE 2IZ6A 4CQMB 3FTEA 1JQJC 4Y2TA 5JYCA 4YN3A 5C1IA 1A7AA 1P1RA 1GG5A 4IVPA 1X94A 1NYLA 2ACWA 3WRWA 4R2JA 3LW7A 3PIRA 3KD3A 4HBZA 4L8YA 4PX2A 2QR2A 5HUQA 2OECA 1OB2A 2KQUA 5FPYA 4MI1A 3RKRA 2CL6X 4CMIB 4FBLA 4J1QA 1AUXA 1KI7A 2DHQA 1JHZA 3QEMA 2Q1UA 2XSZA 4JFRA 4BLQA 2I9KA 1P4HA 3R3HA 2JI6A 1DXQA 4YAEA 1NP6A 2XGOA 4YCAA 3SJAA 3Q3CA 4E1AA 1ADCA 2BMWA 2ZYHA 4V0QA 2RE8A 4W8OA 4F9FA 2EU8A 1RQNA 3FPBA 4HQKA 4F60A 2WLSA 4MP8A 4RH1A 4DGSA 2GOYA 4R2LA 3NHWA 1JIKA 3PWKA 1I51A 1AE1A 1KU0A 2OCXA 3DMYA 4R7ZA 1GDHA 4G1CA 2CL7X 1FP4A 2QM7A 2QW1A 4L8LA 3C3CA 3X2EA 4D3ZA 4C08A 2HRZA 4GBJA 4LC9A 1M54A 1YO6A 2IYVA 5DI3B 5E4FA 3WA7A 4CQMA 3GDHA 5JRZA 2EYQA 2DSTA 1YJCA 2JJYA 1EJBA 3QPCA 1Y3BE 2AJTA 1R8QA 4FX5A 5BWLA 2P9CA 1EVIA 3L6UA 4HR7A 4ID9A 4NCHA 3I4CA 1SQGA 5ALJA 4ZALA 3TWOA 2GPYA 2AJ8A 1DC8A 1H4TA 3P4YA 3VR5H 3TOCA 1U90A 3QA9A 1XMQB 1S0UA 1XEWY 5JNSA 2ZZNA 5DBOA 1PV4A 3WLPA 1AD2A 3W8RA 1L7AA 4R54A 1G9TA 4MZXA 2GQ0A 5JS7A 3RHSA 3SQLA 2D62A 3FPLA 4JOQA 1NG1A 4C0KA 3TIXB 2GJ9A 3IT0A 4RHTA 3NHUA 1XJ0A 2V7BA 5GQSA 5ALWA 1LBQA 1MN6A 1T0JB 1GR1A 4MVJD 2BTEA 1UPCA 2GBGA 4B4OA 4EA7A 4Q1BA 4NFYA 1BGXT 3O7MA 2G1KA 4M1ZA 4FFPA 2AFRA 3H6KA 2FEOA 3NHJA 3ZY4A 2I7DA 2HCTA 4HWOA 5EJ6A 3R0IA 3JTMA 4XW2A 5DGDA 4NE9A 4X7RA 3WAJA 1M66A 1J5EB 1A9ZA 3G23A 1J42A 3AIIA 1YVUA 4G41A 4KPGA 3IQWA 4IG4A 2AG8A 2YCLA 2Q3CA 1ISIA 4YP6A 1AN0A 4FFOA 1RQRA 3CN7A 1KDRA 4TM7A 4CM8B 2IS1A 4JDUA 4A8JA 3DKKA 4I50A 2YYZA 4HUQB 2QUKA 1I6KA 1X14A 3HJNA 4C0BA 2XNJA 3W4KA 4ZHQA 1PTKA 2VOEA 4MUJA 4RXTA 2AEMA 4BVHA 2YUTA 2AJDA 2V7VA 2ADOA 3WC4A 2VSQA 1KR2A 1GAJA 4Q9JA 5E7IA 4DOMA 4GKJB 1O8CA 3JPWA 4LXYA 2RB5A 2ZIXB 3VDNB 4EYQA 1NU8A 2O3JA 4JCCA 3WXMA 5IJ9A 2ZJFA 4WZAE 4JJ4A 3ZC3A 2IZZA 2CDBA 2GCGA 2QSUA 1H0KA 1SC4A 1FFCA 3COVA 2DFLA 3IDSA 4YEDA 4DRXA 3ETCA 4YCDA 2FFAA 5I4KA 2IXDA 2PXHA 1IM8A 4NMWA 4R7TA 1OWOA 4RD2A 3GCZA 4P7FA 4PO9A 9GPBA 3ZE2B 4B3GA 3AVQA 2FX2A 1U2SA 2PMCA 4LGYA 3ZHVA 3F5MA 5DI9A 2J31A 1GZ7A 1ZQ9A 2Q9AA 2IPNA 2O8CA 3O1HB 3GT0A 3H0KA 2O3TA 3LT4A 2JARA 3H87A 4OMUA 4LWZA 4TQUS 3OU7A 4B35A 1SHLA 1QG6A 3IBTA 1UADA 1UXOA 1QFZA 1GFZA 2FF7A 3M0EA 2WILA 3OE7D 3PQ8A 2O2XA 3FYSA 1COZA 2JAQA 4NL4H 4ABYA 2IKQA 2JH3A 2TECE 3K73O 1EYZA 1EFAA 5BW8A 4WQMA 5K3EA 4J7CA 2G63A 2Y0DA 4GRDA 4ARZB 5JJIA 1Z5NA 5FXMA 2EJCA 3KUXA 1KYVA 1VE3A 3SBDA 1BROA 2WD8A 5DULA 1I2ZA 2EBFX 3ZGOA 3N2KB 2XCUA 1SUFA 5H5JA 2ZJ7A 3Q7TA 2J0VA 5F51A 4M9QA 3VJLA 1ZVMA 3TW0A 2FR8A 2XZDA 3H2BA 1N5LA 3C8UA 3JD3A 1YZUA 1MOQA 2DULA 3UM9A 4F6LA 2XRZA 3MD9A 1XQ1A 2PBFA 4FYIA 3WDMA 2WSMA 3M6FA 2FDCA 1SWWA 2GX6A 4G8DA 4LV5B 5BMVF 2OHVA 2XAAA 4PIVA 1HF3A 4WXMA 2MT9A 3HCEA 5DTIA 1M5RA 1B3RA 7AT1A 2FN3A 5ALDA 1YUMA 2WTAA 1DPFA 4L0CA 3JYQA 3DB1A 3QVMA 1YBAA 2UYQA 2YX1A 3AP2A 4JC4A 4JENA 3IKMB 2AL7A 2YMQA 3SVTA 3CRZA 2OD7A 2Q4BA 1NBAA 1R4ZA 3NAZA 3UMJA 3IVAA 4BP9A 1PJLA 2IHKA 3LKBA 1WUJS 3IR7A 2PE5A 2JFQA 3KFVA 2WFLA 4LRQA 1T4GA 3KDPA 4ARZA 2PD3A 4EX7A 4RK5A 5E4JA 3S1LA 1UJ6A 1VFPA 3L0YA 4MV1A 3LUKA 1CUUA 2BHTA 4MGYR 3CVYA 1E7RA 2H1FA 3UT0A 3VNBA 3W5IA 3Q6MA 3DZCA 2Y67A 3G9UA 1NM5C 2Y9PB 3OFND 4CZ2A 1APBA 2ECKA 4RWEA 3MT0A 5FWYB 3ZCXA 4H31A 2OHXA 3DHWC 4IYJA 4KLRA 3WE7A 4UAUA 5AVUA 4U7PB 3DBIA 4DM3A 1W5EA 4OQQA 3IVXA 3THXB 3ZI4A 4D98A 3ZD7A 3ZCQA 1MIOB 1AZTA 1G8GA 2C2BA 4TTPA 3S8EA 3Q4GA 1L3CA 4L2IA 4LOAA 2AUTA 4WNIA 1D0SA 1UOOA 3WY9A 1Y3FE 2A58A 2R7MA 3PE3A 1O95C 2XI4A 3T3PB 4IJ5A 4BVBA 3GMTA 3GRZA 3C5CA 3C4VA 4FLFA 2H52A 2XT0A 3EF1A 1KDVA 3S4YA 1I0IA 1QFYA 3W7BA 4Y2XA 4AI6A 5FNVB 2VP9A 3IIJA 3ILHA 2R68A 1RKVA 2O4UX 1O9HA 4CEIA 1BVHA 1PUJA 3MG9A 2J0UB 3LQ1A 4Z2AA 2HH9A 5F7XA 3KDSE 4JL8A 1X13A 1PL6A 1T5BA 3IIKA 3KOUA 4NBNA 5TMEA 2QTHA 4NONA 5BN3A 1N2CB 3ET4A 4GOOD 3LDAA 2IXAA 1L7PA 2AIRA 2ZVJA 5CA1A 5B3LA 4V1CB 4RF5A 3GP8A 5AW5A 1BD3A 3B9PA 4N5MA 3UWDA 1WBDA 1LSSA 2J3MA 4OHFA 4MDEA 4RK0A 3VJKA 3DVLA 2B4RO 1GN9A 4YAFA 4BQFA 3IULA 4QPZA 1VGRA 1XU9A 3LLUA 5BSEA 4HDSB 2ZTMA 4RHEA 3CUEF 3PX3A 1DV1A 2VYCA 4Y3UA 1ID8A 1RMQA 5K3FB 5B2ZA 3TQTA 1VZ2A 2BGTA 4GPIB 5LXTA 3E22A 1LB1B 1QZTA 2RGYA 2BJWA 3OLYA 2BM1A 1LA2A 1R7RA 2F1KA 2IEAA 2P75A 4WADA 1XPOA 1YUBA 3KVNA 1K1EA 2P77A 4AX4A 3NEJA 4DB2A 1OAKA 3JARA 5K3SA 1ZUD1 2MU1A 1XAGA 1UKAA 4KIGA 2FPOA 5CFNA 5AT1A 2DT5A 3L8FA 5HRUA 3HA5A 2PTHA 3IH5A 1X8LA 4MW6A 1KGDA 5JAZA 4B2IA 2XVZA 1O89A 4OBEA 3HWRA 3WL4A 1G63A 4KIJA 1B0AA 4UVGA 2LR0A 2P6MA 1RKBA 5I7OA 2N42A 5LBIA 4GOXA 4IIVA 4ZDJA 1ORTA 3E82A 3DEAA 3OF2A 4RDXA 3NB0A 3MCZA 5MHTA 4F3RA 3F7MA 1CUIA 3DAFA 2O0KA 3L0PA 2R1VB 4XUEA 4EG3A 2R8RA 1M0EA 3QPAA 3FMIA 2AFIB 2IIQA 4BQSA 3CV3A 4XWWA 1QH8A 1GQSA 1O8BA 3DAOA 1S1CA 3BBPA 1FJ2A 3L7YA 1EAYA 1UBKS 4G5HA 4PWYA 1KYXA 1Y3AA 3LPNA 4JZYA 1HT3A 5JTUA 3L4JA 4Y9SA 4P0TA 1YOBA 1MV8A 1D5CA 2H18A 4MJ7A 3RTAA 4BJ6A 3WGQA 2C84A 1TYZA 1OXUA 2C5FA 3OESA 2JEOA 3NBFA 2JAHA 3QMVA 4TL8A 2WWFA 2Q3DA 5EI5A 5F2KA 3AG6A 5I9SA 3TVTA 3HP7A 2C4TA 1ZM4A 2B92A 1SXGA 3PC6A 2IU6A 3A4MA 3BGWA 2D54A 2R47A 3D43A 4OHUA 2Q7DA 3VM6A 3MERA 3ZK9A 4ZI7B 4TWIA 2KB0A 1DQNA 1R3DA 3SDSA 4Y2GA 4L6AA 3FZQA 1RJWA 3LF1A 3AEKB 3O1IC 4IZIA 4D9CA 4F4UA 1UT6A 3PTLA 3TPCA 3AFIA 3OJCA 1P81A 1N1MA 4KN6A 3N6VA 1XDBA 1W581 1WDWB 4G26A 4JP2A 3OPMA 4B4DA 2LNDA 3CR8A 3HRKA 2ZUUA