1GRQA

Chloramphenicol phosphotransferase in complex with p-amino-chloramphenicol from streptomyces venezuelae
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
178
structure length
178
Chain Sequence
b'MTTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMPLKMQSAEGGIEFDADGGVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVGDLDVLWVGVRCDGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYDVEVDTTHKESIECAWAIAAHVVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE
publication title Structural Basis for Chloramphenicol Tolerance in Streptomyces Venezuelae by Chloramphenicol Phosphotransferase Activity
pubmed doi rcsb
molecule tags Transferase
total genus 58
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2001-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07931 CPT Chloramphenicol phosphotransferase-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1grqA00
1QHSA 1CU1A 1SVOA 2GWHA 2ORWA 1NN5A 3IGFA 1NLZA 3AKDA 2PZFA 4LYFA 4MDFA 2PLRA 4YMWA 3KX2A 3N70A 3EX7C 2V7QA 3BE4A 5H8WA 1CRQA 4PQRA 2OT3B 3DO6A 1XXHB 1GKYA 4PAQA 1NJFA 4QHYA 4RVCA 5AUPB 1Z29A 4BPBA 4X8HA 4HDOB 1YR7A 3AV0B 4OQNA 5IRCD 2LWIA 3PIRA 4L5BA 1T3HA 3AGPA 2FEOA 4JLAA 1XPOA 3CKLA 1TEVA 2GCOB 2B7CA 2OFXA 3MJRA 1TADA 4HSEA 4ZI2A 4Q48A 4QNMA 4HB0A 2ZR0A 1RZ3A 1DVRA 1OIVA 1W47A 2DHRA 3KUDA 2ANBA 3LW8A 1E79A 1QVRA 2O8BA 1JB1A 4M1SA 4LBVA 4OJQA 4KITB 3BB3A 2YYZA 1Q21A 2AL7A 4ESVA 2X1VA 1IN4A 1KZGB 2WICA 4CEJA 1R6BX 2ERYA 3V4RA 1ZUIA 2RGXA 3L82B 2GJSA 5F98A 4IDOA 4IXMA 4Q9KA 4RZ2A 5CK5A 1KIMA 4UNQA 4M9ZA 2ODBA 3W90A 1P2TA 3RS4A 5GVSA 1JNYA 1NSTA 1TX4B 5FTKA 3G5UA 3CPEA 4ZDJA 1PUIA 1GWNA 1YZGA 4EFLA 2P0EA 1ZBDA 4NYIQ 2IYRA 1KHTA 1E9RA 4OI0A 2CCJA 2XNDD 4HB2A 3QXJA 4J0QA 3QOFA 3NEYA 2V54A 1KMHA 4R71A 2CVFA 3QVUA 4C3ZA 4HI0E 3CPHA 1CJMA 5JLJA 4YDHB 1E2FA 3SDZA 1G64A 2FFQA 2QI9C 1VPLA 5IT5A 3CF2A 3THYA 1IQPA 1MO5A 3EA0A 3KKMA 3W6NA 1ONBA 4F38A 3THOA 4P31A 3T34A 4HLDA 1OXXK 1F2UB 4URUR 2ZI5A 2ZRDA 3LLMA 3B8HA 3R20A 2O8FB 4KVGA 2GZAA 4UXIA 1OH6A 4RSGA 3KXKA 3U7HB 1N6IA 4AURA 1XTJA 1MRNA 1Q12A 2A5JA 2XXAB 3CO5A 4QJ5A 2P5SA 2J7PD 4MRPA 4M1KA 4MRVA 5KUTA 1DPFA 4QFMA 4WVFA 4AK9A 2MMCA 2ZJZA 2FSFA 5L3QB 2ZYVX 4BFVA 4HZUB 2AWOA 2DWQA 3T5GA 1TPZA 5L3SB 2OAP1 2XB4A 2J45A 4LDJA 4TWZA 3GEEA 4ITRC 5EXXA 5LB4A 5CM9C 1ZMXA 1XF9A 1YZNA 1ZUNB 1Z0DA 4DCNA 4AIIA 4PZLA 4MGYR 3MWLA 3QG5A 3KFXA 3EASA 1AS3A 4BFXA 2GESA 1KDOA 2G0TA 2HCJB 1XCMA 4B73A 3CONA 5C2JB 5G53C 3RLFA 4GT1A 1QHXA 2ZJAA 1R5NA 1T8UA 1NLFA 1RYFA 4AKEA 4N1AA 1BIFA 2CHVA 2VP0A 2ZRJA 3A36A 1XPRA 3P4XA 1F60A 1N0WA 1G3MA 1GSIA 2YZ2A 3K0AB 3K1JA 4LHXA 4MGKR 2N1BA 1BKDR 1YZTA 2OXCA 5EXTA 2ZANA 1XMJA 5DYGA 2ONJA 5FPKA 4HATA 2OBNA 2WSSD 3KKQA 3TIFA 1XTSA 1Q20A 2Y8EA 4HLCA 1NN3A 2BMDA 3QI2A 4M21A 3IIMA 2GHIA 2R6DA 4A2WA 3QQ5A 4L16A 4XTRA 1Z6YA 2IS2A 3TNFA 4DCUA 3HPQA 4M4SA 4Q21A 2FNAA 2F55A 5JCZA 3LQQA 5C1BA 1UM8A 3CRVA 3AF3A 4F4IA 4A8JA 4FW9A 3SBEA 2Q3MA 4JVNA 1Z2CA 1LY1A 1KY2A 3GFOA 2GJ9A 2VHQA 3QIAA 4URYR 3K9HA 4PZZA 1D2NA 1UKZA 1E0SA 2W58A 1ZNWA 1UF9A 3IEUA 4ZDIA 3U4QB 3OE7A 1ZIOA 4Q4AA 3LW7A 3EIQA 4PANA 1DAGA 3PV0A 4PPNA 5JSZA 2F6RA 4DCSA 2QTVB 4Q4HB 3AVVA 2DR3A 1RFLA 1G41A 2RCNA 2I4IA 3EZFA 2WBLC 4QBFA 3FMFA 1ZM4A 1IM2A 1ZU4A 3W3AA 4DB2A 2ZJOA 3ZS8A 3LRPA 3GLFB 2AK3A 1LF5A 2UVQA 4QBHA 1E2IA 4OHZA 4FI3C 2ZS8A 2ZE6A 3HR8A 4GSYA 4O2RA 3GJ6A 4R9UC 1B23P 3O8BA 1EFTA 2FEMA 2GDJA 1L4YA 3VMFA 1KI2A 1Z6TA 2ZI7A 4LC1A 2D2FA 2ONKA 1OT3A 2OHFA 1HUQA 3K0FB 1QHNA 1GUAA 1XD8A 3M6AA 2GJKA 3JZAA 2HYIC 2P3SA 2QPOA 4B2PA 4PO1A 4BQSA 4TMWA 2NO6A 3KKOA 2ATVA 3KXLA 3WRYC 5EP1A 3H0KA 3DZ8A 4JVSB 1N6NA 4MYTA 2BM1A 2BBOA 2IYXA 2ZAMA 2BVNA 3F0TA 2GCNA 2JJ1D 1G7SA 3L0OA 5DN6A 1G3IA 4V0OA 4A8JC 3FHOA 4JZKA 1UPTA 1W5TA 3U7EB 3F5FA 4KSCA 1MO6A 5CK4A 2CL6X 2IYVA 1XJCA 2CK3A 2ZEJA 5TB5A 5HZHA 2GXQA 3KQUA 3T5DA 1KO1A 2CEAA 3GLHB 4KCGA 1G9XA 1UBFA 3RRNA 1KDPA 4B3CA 3CPJB 2ZRGA 4DDWA 3IEVA 4NL4H 2F3TA 2VEDA 3NHAA 1COWA 4LX0A 1QG4A 3BWDD 1OKKD 2F3RA 3GMTA 3ZQ6A 2RAPA 3AVOA 4HAYA 2W2TA 1VG1A 1X1SA 1E1RA 5JZVA 2EFDB 2I1QA 3VR6A 2F9MA 3P4YA 1NMYA 2JA1A 1W0KD 3MFYA 4C0LA 4CF7A 4EPRA 4MRSA 5F9FA 2L0XA 4ERNA 2YWEA 3UATA 4M1WA 2WOOA 6Q21A 1HE8B 1E2QA 4A0HA 4UXJA 5FR2A 3B5JA 5FUWA 3BFKA 1F48A 3NH9A 2WMOB 4B43A 4PHHA 4JVLA 2G1KA 2YOFA 4YXWD 4ZCLA 1LTQA 2WJYA 1G1MA 3O47A 1ETUA 3ZIAD 1XEXB 4KV9A 4NONA 4XD7D 2ORIA 421PA 3ONWA 2B6HA 1XZPA 1GVNB 3U3MA 5EP4A 4D0NA 1IBRA 2JASA 5CDFE 2R8RA 4NH0A 3KJEA 3CIOA 2J0QA 3T12A 3LLUA 3WP0A 1YKSA 3RABA 1P4SA 4DSTA 3AUYA 2FX3A 4C0KA 1NY6A 5K8UA 3REFA 4BFSA 1CKEA 3GJ8A 2HYDA 5CDFA 2IYZA 121PA 5JWRA 4WZBE 5GJWC 3ZJYA 4AG5A 2WWXA 2YC4C 3RYTC 1NVWQ 1ZNZA 4DSOA 2J41A 3KTAA 3SYNA 1E3MA 1G8GA 4PZYA 1F2TA 1XBTA 1ZD9A 1CR0A 4S2EA 4QHSA 3VHXA 5A0FA 3ZVLA 1P73A 1E32A 3B1ZA 2V4ZA 3CR7A 1DAKA 3C5CA 3OIYA 4CEIA 4D2IA 2A5YB 4Q03A 3NDBB 5CIWA 1ZYUA 4WZAE 5BN5A 4DLSA 4QJ3A 1KO5A 3QJYA 3QXSA 4TYQA 3L8ZA 1NVVR 1ESNA 2NZ8A 2WWWA 4P0TA 4IOJA 3E2IA 1M2OB 1FP7A 1K5GA 2OBMA 1UBGA 5DGXA 5ANRB 4LOAA 4TT3A 3L8YA 2O0HA 3MWKA 1H8ED 1P2SA 3QBTA 2PT7A 2C9YA 2NO7A 3KB1A 2VSFA 2ZS9A 1RKBA 2EFEB 1CR1A 2FV8A 2QL6A 3LX5A 3VU9A 3NDPA 3ECCA 1NI3A 4NZYA 4ZV4A 2YC2C 1EK0A 4NP6A 3TH5A 4CRWB 1CXZA 2IEZA 4KAXA 2V7QD 4TLEA 3N2EA 5J4YA 3H2YA 3N2IA 3ASYA 1S3SA 1IXRC 4QM7A 1JAHA 5KSOA 1R0XA 3T35A 4Q4JA 5FUVA 3X1XA 1Z6AA 3ZVRA 4UXHA 5JS8A 3QSYA 2O8BB 5DIFA 4HUTA 4TYWA 4I4LA 2W2XA 1WDTA 4TYYA 2OESA 2CCGA 5KOYA 3IUYA 3X1ZA 3IKJA 2F7SA 3VHLB 2QAGA 4GRAA 4PQYA 1P75A 2WM9B 3AUXA 3CLVA 1GAJA 4B32A 4CEJB 1KI8A 3BJIC 1N5LA 3TR0A 3BFXA 1HTWA 1E79D 3QKSA 2C98A 3HU2A 2WWFA 2ZRNA 4QBIA 3WNCA 2O5VA 2QMOA 3QEJA 1P62B 1OV4A 1KTVA 1E6CA 3HU1A 4XOIA 3A37A 1OHHA 3NBFA 1P9NA 4ILEA 4OI2A 3K8YA 3OIVA 5E4FA 1N2CE 4RZUA 5A5GA 3RRYA 1YR8A 2J46A 2W83A 3DOFA 5BN3A 1FQKA 2YWGA 4KO8A 2K5UA 1IN7A 3Q3JB 1Q1QA 4LUCA 2XGJA 2FWRA 4TL7A 4QC2A 2Q9CA 3MGCA 4YC7A 2F1JA 3PUXA 4ZO4A 3I61A 3ZD6A 1KMHB 4KFSA 2ZJ2A 3KL4A 2ZRMA 2IYYA 2W0SA 1VIAA 2QP9X 2C78A 2EVWX 3IPYA 3UIEA 3THYB 2PCJA 4LJ7A 3D8BA 3VKHA 4B33A 1P5ZB 3OEED 4GZLA 4P32A 5BWMA 1U8YA 1U0JA 3RWOA 4IXNA 1W2HA 1YU9A 3P26A 1IN5A 2EFHB 1NNEA 1HYQA 3WNDA 1AZSC 2QQ0A 1SGWA 3BC1A 1EX7A 3R7WA 2QAGC 1W7AA 1KSFX 2XZOA 3EIHA 2D7DA 1H8HD 4ZIRA 2DFTA 2ZVQX 2BKUA 5FI1B 3SBDA 4RKFA 1W0JA 3DL0A 4JYCA 4RCZA 3Q9LA 2QZ4A 3N5CA 3DDCA 3A8TA 1T5LA 3TVDA 5HR5A 2REBA 3ZZUA 3OEHA 4ZKDA 1VDZA 3AVXA 1U8ZA 2ZRFA 3AVYA 3PCRB 3PG5A 5IF9A 3RWMB 4OQXA 3GP8A 3KQHA 3EIEA 4BGDA 4Q66C 3FKQA 3MLEA 3L0IB 3TJZA 3CX6A 5SZKB 1MT0A 4OQMA 1RRGA 4OHVA 4C0QC 1Q1BA 3B1XA 3PEVA 5CYOA 3DEFA 4P3YA 3I4LA 1R5OA 4TSFA 4IDPA 1VG8A 4US2R 4KODA 2IS6A 1NN0A 1JJVA 2QU8A 1W2GA 1N0VC 2RKOA 4WA7A 5G41A 1TTTA 2OSBA 3GLHE 1NLYA 4PC6A 5JS7A 2GZHA 4QL3A 1S9HA 2GXSA 4IOMA 2R6FA 2ZTSA 1DOAA 5KDOA 4DZZA 3WXMA 5JEEA 4UJ3A 4D82A 2QENA 2Z43A 3FOZA 2XSZA 1W36D 2IBMA 2OUKA 2WKPA 1CBUA 1LS1A 4IEEA 2GEVA 3FTQA 1MKYA 4OHYA 2ZSEA 4A8JB 2QPTA 3H84A 1JQLB 1KK1A 2OM2A 2OV2A 4M9QA 4H1VA 4WOPA 1E2KA 5DLQC 3W3ZB 1AGPA 1Z28A 1YRBA 4A1FA 2C99A 3C5HA 4A0GA 3GFTA 1WBDA 4CVNA 4Q4AB 3ZZTA 2B92A 2GKSA 1E2DA 2ZI3A 1Q44A 2GJ8A 2QRZA 2HCBA 3FVQA 4Q9HA 1AA9A 4B34A 4B76A 1A4RA 1JPNA 3GD7A 1RC8A 1HA3A 4WXRA 5E7IA 4NKRA 3I1FA 1CLUA 2WHXA 5EZ6B 1VCNA 1GM5A 3K0SA 3SC3A 1XNJA 4BFUA 3DKVA 4Q18A 4JS0A 3U7GA 3FMOB 3D7MA 2C8VA 3OE7D 4EIWA 1DEKA 2ZE7A 3B9PA 4Q00A 5FOXA 1E9BA 2YWHA 4MUAA 2CL7X 5CM8B 2PZGA 1GFIA 3TW8B 4EPWA 2D3WA 2ZITA 2JLYA 3ND8A 2BMFA 5C4MA 2VO1A 3VR3A 4NE2A 3DMNA 5KU1A 1CJTC 2ZUDA 4O0MA 4F91B 2Q0HA 5FL7A 4LBZA 4ZCIA 1NP6A 3X1WA 3QE0A 1N6PA 3VX3A 3W9YA 4PO9A 3B7GA 2WVJA 2HEIA 5EE3A 521PA 5DH9A 4Q7LA 3QKRA 4G01B 1E9FA 1BMFA 1N5JA 4JIMA 2ZU6A 3MCAA 5FL3A 4ASUA 4E03A 1AKYA 5K8LA 2V55B 5ELXA 4JLOA 3GQBA 3EC2A 1TQ4A 1ZUHA 3Q8XB 2ZROA 1UKYA 1E4YA 4XJXA 1X8LA 5CLQA 1OH8A 2FPLA 1XTQA 2O0KA 1F3OA 1VCOA 2QRNA 2WZQA 3SJBA 4QGFA 4G1UC 1E1QA 3UXMA 2FPKA 3BAFA 4U5XA 1E4VA 1T4GA 5DN6D 1GL7A 1MV5A 3UKDA 4LPKA 5GADl 2Q3HA 4DDVA 3LVRE 4LJ6A 4Q7MB 2IHYA 4PPQA 2CK3D 4L4UA 4BLQA 4URXR 3WNBA 2QMHA 3NIBA 1E9EA 4PPGA 3BIFA 2OEPA 1OJLA 4JSTA 2IF0A 4LV8B 2A30A 1Z22A 2IT1A 4Q1AA 4URWR 3NBYC 3T15A 1NVUQ 4TLAA 4BFZA 1G6OA 1KYIA 2VBCA 4JLBA 4OYHA 4PXAA 3RNLA 2MSDB 2RHMA 3L2OB 5J47A 3K09A 2PJRA 4G0NA 1TMKA 3FWYA 4KYUA 4A2QA 2JIZA 2ODEA 2ZYWX 2G6BA 1NIJA 3TUJC 2JLVA 3AVTA 2C9CA 2G3YA 1E1RD 4PSAA 3O8RA 3WRXC 1R10A 3CRW1 5DYIA 2H18A 2QT0A 1MH1A 5FI0B 4B44A 2C96A 3NWJA 3I5YA 2V8OA 4KBFA 5DHFA 4US1R 2J3EA 1DG3A 1II8A 2QSZA 4NTZA 3CNOA 5KNCA 3K70C 1KK3A 4ZCMA 1TQ6A 3EG5A 1KNQA 2JLQA 4UQOA 1SVSA 4K8OA 3VX4A 3GCGA 3U60B 3K9LA 1QRAA 4WAUA 4GOJA 4ZDWA 3TK1A 4EPYA 1GP2A 4DB4A 2YOHA 1VIYA 2JATA 2GK6A 3TUZC 5EE1A 4W5JA 4I1UA 2F1IA 4QKQA 1S2MA 5AUNB 1QHYA 4TQ9A 3QPUA 4FN5A 4A92A 2PZEA 3NVAA 5LBIA 3L0SA 3SQXA 8OHMA 3C14C 3FGNA 1KJZA 3UG6A 2WJJA 4IDHA 2VRWA 1TNDA 4M1OA 3GLGE 3B1VA 3EPJA 2YJTD 3KTAB 2RGEA 4JT2A 4DLZA 1JXMA 1YHNA 2Q9BA 4PHGA 2EYUA 5CB6A 1F2TB 1JR3E 2O52A 3A4NA 4DVGA 4NPHA 2BCJQ 3QPVA 1XJQA 5FUYA 2ZJBA 5JRJA 3WYFA 3GLGA 3ADBA 3K09C 3A1VA 4PSKA 4GFDA 1U9IA 3CF0A 3U3JA 4B6EA 1Z6GA 1EFRA 5H70A 4CEIB 2D06A 4A82A 3I32A 4WXPA 1LV7A 1OB2A 2AR7A 2V1XA 1JR3A 4RD3A 3BORA 3RS7A 4C0BA 3EARA 3FDIA 3VR2A 4GI7A 2Z0MA 1FOEB 2R62A 2KSQA 1FFHA 2BMEA 1KAGA 3VFDA 3GJ0A 2JJ2A 1E2JA 3D31A 2C5LA 1YZLA 5KSPA 3B9QA 1QBKC 3F3YA 1Z8FA 3VU9B 4JVMA 2ZS7A 2CNWD 4RD2A 4EJSA 4EQ6A 2VHJA 4IHQA 4PC7A 4TT3D 1Q57A 4Q01A 4BLOA 1LS6A 5B64A 1DO0A 1PZNA 3L43A 4HLUA 2XNSA 4BLSA 4ZKEA 1GRQA 4TMVA 3UMFA 2RGAA 4C0JA 4C9BA 2FSGA 4Q4JB 3LD9A 2VHCA 2NQ2C 4MH0R 2BC9A 4AY2A 3QEOA 3UG7A 1D2MA 2ZSBA 4AKGA 2C03A 3Q72A 1GDDA 4V02A 1A1VA 1OXVA 3PUWA 4FMCF 5JI2E 2BEKA 3UMSA 5P21A 1SKQA 3SHFA 2V3CC 3C4JA 1IY0A 3O8CA 4FMDF 1EG7A 2WJHA 3NEJA 1L4UA 1UKVY 1M8PA 2XTMA 3QKSB 5A4JA 3EZ9A 1U9IC 2KE5A 4Q1BA 4TQAA 1M6NA 1KDRA 3I3SR 4URZR 1SHZA 4TTRA 5M04A 3QF7A 3O8DA 1N6RA 4UNRA 4IOKA 4FCWA 4JLMA 1SULA 4IJMA 1Z0IA 2FZ4A 1HH4A 1G8YA 5EUQB 3I5XA 5EP3A 1VHLA 1JEDA 3B1WA 2Q3FA 4A6PA 4D81A 3ZYCA 4HLQB 1NJGA 2CMKA 2OLJA 4LHYA 4DDTA 3EZ7A 3VKGA 1D6JA 1R4AA 3EAQA 1NBME 4F4CA 5KSZA 4KXFB 1OHHD 4QHTA 2QTFA 4B3XA 2IXGA 4XVUA 2Q9AA 2W6IA 1LB1B 4EJSC 2ECKA 1XRJA 4U02A 2IYUA 1I2MA 3AVUA 3IBYA 2PEYA 3E70C 4HLUC 5GJVC 1C9KA 1KMQA 1K6MA 1NBMA 1D5CA 3HDTA 2BBWA 3U44A 3HYRA 1AGRA 3FMPB 2GXUA 4BEBA 2DCUA 4PPFA 1FMJA 3AQ4A 2FFAA 2P5TB 1TUEA 4FXPA 4A4DA 2A2ZA 1BYIA 2JLUA 4CZ2A 1Z0JA 3CF6R 3IDQA 1ZC3A 3DZDA 4FWIB 2J0UB 1N6LA 1TEXA 4RKEA 4BECA 4DKXA 2OAQ1 1XEWX 4OQLA 1G8FA 3R7WB 4ON9A 4QG7A 1E0KA 1HY3A 4ZIRB 1G5RA 2VP6A 3C8UA 1M34E 3BRWD 3MRSA 4IFBA 4ACBA 1HT1E 4B48A 5JSZB 1Q1EA 2ODWA 4GPTA 4AKIA 3BOSA 2J0SA 4M1YA 4FCTA 1VYUA 1VHTA 1MOZA 1NN1A 4TMKA 5CB8A 2KB0A 5DNYB 4CT5A 2EQBA 4LJ8A 2F9LA 4PHTA 1W0JD 4G5SA 2BOVA 4BZQA 1E2GA 4YMTA 1FX0A 2ERXA 2FFBA 2YHSA 4XVRA 3SNHA 2EFGA 4F92B 1IONA 4KYIB 3VR4A 2ZI9A 2QMUA 1G7CA 4M22A 2HUPA 3AVPA 1CJKC 1NKSA 4Q19A 3MAAC 4OK5A 1OYWA 2RGCA 2E87A 4B3DA 3KUCA 3KDSE 3Q5DA 2BWJA 3G0HA 3NG1A 1II0A 1OFIA 1Z6XA 5JHHB 3SQWA 2D74A 2FG5A 3TRFA 2E9SA 2ZR9A 2DB3A 4JT4A 1YRAA 2ZRBA 1CR4A 1P6XA 4AYXA 5CYPA 3NBZC 4K46A 1OFUX 4LHVA 1G291 4TSFD 4PR0A 4C30A 2ZSFA 2J0VA 5KO2A 1AKEA 1XCPA 2YOGA 1VYVA 1ZP6A 2VF8A 1XU4A 3CH5A 1Q3HA 2AHOA 2IYWA 3D6TB 5FPSA 3AF0A 5DI9A 2O8EA 1GG2A 4DHEA 2A5FA 4MUBA 1KSGA 3H1TA 2AXNA 2QNRA 1AM4D 1MO3A 2QN6A 1GRNA 5DSZA 2CHGA 3U6BA 1YZQA 1R0WA 2HF8A 4AYTA 2HT6A 5DE3A 2QMEA 1XWIA 4LHWA 5HKKA 2AWNA 1YZUA 1YQTA 4TTPA 3TE6A 3T1VA 2VL7A 1ZJ6A 2ASEA 1T0JB 4D4MA 2VA8A 4JLKA 1IOZA 2JLZA 2Z83A 3JZMA 1KI7A 1N6KA 4CDGA 4Z8XA 1TL7C 3C15C 3CZQA 2G88A 1E0JA 2WAXA 3SJZA 2ZETA 5KNDA 1Z3IX 5L8VA 1Z5ZA 3VR1A 3TGPA 4D25A 1XD9A 4HZIA 1FNNA 4B47A 3UPUA 3DVLA 1NIPA 3RC8A 3U7FB 2J9RA 1OE0A 1SVMA 1X3SA 2ZAOA 3SR0A 3FMIA 1SHKA 5KTYA 5AUQA 4KSBA 1JI0A 4E07A 2JGNA 4LYHA 1NG9A 1KDTA 2QSYA 1OFTA 2ZRHA 4O25A 4YQFA 1G8PA 1IJFA 3QKRB 2GTPA 4P4TA 1YZKA 5J4KA 3K70B 3QXHA 1P2VA 4KFRA 4QGGA 4YMVA 3RS2A 5FL7D 1ZIPA 4CYMA 4LRWA 4DRZA 2ZI6A 2A3RA 2OCPA 4WW0A 2P6RA 4UKDA 4UNPA 1RIFA 1F6BA 4C4PA 3K70D 1BMFD 2AN9A 1CS4C 2LCFA 2QM7A 3PEUA 4JYBA 1G20E 2KBEA 2NIPA 1TU4A 2V6JA 4RCYA 5LD2C 1TUIA 5JCPA 1PVOA 1IJEA 2WPDA 3BERA 3REGA 1Z0KA 3EA5A 1CIPA 3MUFA 4Q4LA 3SN6A 5E7MA 3A1TA 1E1QD 2OO7A 3FB4A 1E98A 2AFIE 3CRRA 4RZXA 1CRPA 4YMUA 3V4FA 2LKDA 3A6PC 5JMTA 5FTMA 4CGZA 3CWQA 5KNBA 4DJTA 1RRCA 3DM9B 1DAFA 3IQWA 2WWGA 2ZSDA 1M7GA 1NSFA 2FMXA 3IQXA 1WXQA 5K8TA 1D9ZA 1OXTA 2C2HA 3ZDQA 2P65A 2IWHA 1ZM2A 4JLNA 3DOEA 5AJVB 5EE5B 4DEXA 4XH9B 4RFSA 3B78A 1W48A 2LKCA 1T5IA 4NCKA 4A0RA 1KZ7B 3HU3A 1AJEA 2JIZD 1TAGA 4HB3A 1II8B 3PEYA 1E69A 1UBCA 2A5DA 1U94A 3RS0A 1AQUA 1OPXA 2BIFA 2RHDA 5DISB 4TL8A 2IW3A 2QTHA 2RGBA 1R8QA 1SVKA 1GZSA 2J1LA 1E2NA 3R9IA 3WMGA 1GL9B 4B3FX 4M9XA 2MSCB 1P7CA 1SVLA 1R7RA 3LA6A 2A5GA 2ZJYA 1G8HA 2G77B 3PITA 5G40A 2CLSA 3LQRA 2BV3A 3HYTA 2XITA 4DLRA 2QBYA 5IHPA 4BZXA 5E3HA 1X86B 2J59A 3PUZA 2PMKA 2IYLD 3I72A 1A82A 1GL6A 3CB4A 2CJWA 3ICQB 2OLKA 2DWOA 1AN0A 1A2KC 1KNXA 1M7BA 2QE7A 4Q7JB 2FGKA 2WWIA 2RGGA 4M53A 4LY6A 5LB2A 4JKYA 1XMVA 4OI4A 5JWHA 3FFAA 2B8TA 4Q1DA 5FFMA 3UANA 3GLGB 2QROA 4XIGS 1GKUB 3MMPA 1AQYA 1N3BA 3BS4A 5AUOB 2GCPA 4K81B 3LWNA 3D3QA 3TLXA 4IOLA 1E9CA 4I1SA 1BYUA 2FJUA 4S35A 5FPTA 3OIWA 3WBKA 4V03A 4DBLC 1J8MF 5AWFC 3ZGXA 3V9PA 4GOXA 1KGDA 3K53A 1EFRD 2ZM5A 4HYYA 1JR3D 4QRHA 3HR7A 5BYJA 4E5UA 3K0CA 1L8QA 2VPPA 3QNUA 2MMGA 3EWAA 2SHKA 1G4UR 4BE7B 4M1TA 5L3RA 2BEJA 4EJSB 4EQ6B 1J8YF 2TMKA 1DE0A 1XD2A 3HPRA 4RJLA 5KDDA 2VH5R 1ZVQA 5TXGA 3OZXA 1CF4A 2AKAB 4BRWA 1OLOA 2JJ2D 5FBVB 2C95A 2GEDA 2J87A 1DG1G 1RE0A 4DLYA 4MKHA 3EC1A 3SJCA 1XP8A 3QXXA 2I1VB 2QPAA 1N6HA 2V6IA 3TAHA 3WBJA 2QUZA 2R6CA 3FHTA 2YV5A 4NYMQ 2XEXA 2XJ9A 1AIPA 2DYKA 1CTQA 4ESHA 4N0DA 1W1WA 4PC1A 2ZE8A 2C77A 2UZ3A 2YINC 4OQFA 4DIDA 1UEIA 1Q0UA 4RZ3A 2FDCA 3T06B 1MO4A 4JJKA 4KLNA 4B75A 4AI6A 2ZRAA 2NZJA 4U7DA 2YKGA 4E22A 1UDXA 3AKYA 2IS1A 1GILA 1G5TA 3ZLJA 1Z0FA 3TSOA 3TSZA 1W49A 1XB2A 5HCNA 1UEJA 2JLXA 2IC5A 2JAQA 2PLFA 4BRUA 4DLVA 5J5CA 3AVQA 2NPFA 2B8WA 3Q85A 2FF7A 2J5XA 2ZUCA 3ZVMA 3QY0A 3SJAA 1G3QA 1BOFA 2FN4A 4FIDA 1G18A 2OCAA 3I92A 3LY5A 1SZPA 2O8DA 4BLRA 1R0YA 4KBGA 2FSHA 5D3MA 3LDAA 3ADDA 1E0AA 4YDSA 1NMXA 2FPMA 2HV8A 3K0CC 3NXSA 3I73A 5JWOA 4V0KA 5IDVA 1WRBA 1M7HA 2H7VA 2RGNA 1DTSA 4TMXA 3T61A 1BO6A 4JBWA 1I4TD 4MKFA 4ZDKA 2JJ1A 5G3ZA 4V0MA 2G0NA 3ADKA 5TARA 3EPLA 4P4SA 2BDTA 1YE8A 4EFMA 4MITA 1T9HA 4QNRA 1P61B 3U44B 2GETA 3AP1A 1KO4A 1Z47A 2QP3A 5DHAA 2W6ID 4YLGA 2RB4A 4W5HA 3DPUA 3ZH9B 5DI3A 1HQCA 1P2UA 4Q47A 5HCIA 3THWA 1ZCAA 1KI6A 1NBMD 1KO8A 1FUKA 2AD5A 5JI3E 2CVHA 4TL9A 5EE0A 4PO8A 3VNUA 2AXPA 1M74A 5FUXA 4CEHA 4MYHA 1KK0A 4DDUA 4AD8A 5FBQB 1W46A 3CUEF 3RS5A 1OXUA 2NTYC 4OI1A 4C0SA 5EJEA 2BJWA 4LV6A 1MABA 4KJZA 4LJ5A 4TYPA 2ATXA 2XZLA 2OFWA 1Z07A 3RRZA 3KJIA 1TU3A 2ZJ5A 3E1SA 1UFQA 5FPYA 3EWSA 4WBSA 2X77A 4F7WA 1PLKA 1I4DD 2EYQA 1FX0B 2VP5A 4TLCA 4LJ9A 1U98A 3A4MA 2CBZA 5B30A 3FPAA 3T1TA 2X2EA 2WTUA 1NY5A 2FE4A 4DLTA 3BBPA 2RGNC 1T91A 3AKCA 3LXXA 2DPXA 1U8AA 3KJGA 3LXRA 3QVVA 4NBSA 2R2AA 1ELOA 4KFTA 4JBXA 1N5IA 1ZD1A 4F93B 2WJGA 1DS6A 1VKJA 2BBSA 4OK3A 1UBEA 1W4RA 2IYTA 4UNNA 1NKTA 4C2TA 2WIBA 4M8NE 2WMNB 2JLRA 2ZJ8A 4MQBA 1XZQA 3BFVA 3SEAA 1FPMA 4Q9IA 1OXSC 3UMRA 4TYNA 3CRMA 4CT4B 5JEDA 2HLDA 5KHOC 3IHWA 1ZCBA 5BW8A 2AK2A 2RGDA 3B2EA 3KB2A 2H5EA 2Z4SA 3OAAA 5JJLA 3LX8A 1Z83A 1HURA 3B85A 4BUJA 2I3BA 4E09A 4JL5A 4GMDA 4PC3A 4RD1A 3MG9A 4A2PA 2FA9A 4DUGA 2O8EB 1SVIA 1SKYE 1JQJC 2QY9A 3KQLA 2FH5B 2JLSA 4Q02A 4RD4A 1IHUA 3K9GA 3NC1C 2IUSA 2G9NA 3WMEA 1T8TA 2PMDA 1C4OA 3WYAA 4XVQA 4Q9JA 3B60A 2ZI4A 3ZQJA 3AF4A 3U3KA 3SHWA 4IVRA 1PLLA 5DO9A 1S0UA 5E95A 3WMFA 5GJCA 1ESMA 3U6KA 4A15A 1COWD 1S3GA 5AJYA 5LD2B 4N0EA 3LBNA 4C7OA 3ICEA 5CIQA 4RD0A 3RC3A 3I62A 2CDNA 2ZIAA 3IO3A 1RJ9A 4EUNA 1OH7A 5KYKA 4B71A 3RS3A 2HDNB 3RHFA 2IWRA 2F43A 2IXEA 1R2QA 4ARZA 4HDQB 4BLPA 5TV2A 4DIEA 3VR5A 1JAIA 1KSJA 2R6AA 2OXRA 4W7SA 3QKTA 3KQKA 5HKKD 1D2EA 2HJGA 4UJ5A 3SZRA 1FNMA 1TF2A 3UWKA 3AP2A 3GJ4A 3PJRA 2G1JA 3M0EA 2H16A 3EPKA 4NHOA 3RSLA 2XAUA 2J7KA 3WYGA 3CX7A 4PTLA 4LYJA 4D26A 3KKPA 1EESA 1XX6A 2A78A 1E99A 3H4MA 3OFNA 3Q5EA 3RRMA 4D4LA 2AX4A 3SFZA 1ZRHA 3JVUA 2VP4A 4M9SA 4DXAA 4QM6A 1K5DA 3TUIC 4HAXA 5J4LA 2VHUA 3RVBA 4C2UA 1OF1A 3GEHA 4Q1CA 2ZRIA 1G19A 1JXOA 5IK2A 3TMKA 3QKUA 1A5TA 1IXSB 1G7RA 3QF4A 1OSNA 1RW4A 2VHTA 4HUQA 3V00A 2D7CA 3PR1A 4A6XA 4H9GA 1XEFA 5EUMA 1M1YE 3GJXC 1SXJE 2OBLA 3I8SA 2ODNA 1P60A 2CLCX 1KKMA 3DHWC 4YONB 4HAZA 5JJIA 2VP2A 2NO9A 3GEIA 4FD2A 3W8RA 3BB4A 1D9XA 2WOJA 3K9NA 3P1JA 5FTNA 1T3SA 4I81A 3BD9A 4I99A 1ANKA 1SXJA 1G5PA 5HE9A 2GF9A 3IHLA 3LBIA 1LW7A 2WPDD 2IX3A 3S1AA 5G3YA 1NG1A 3CZPA 2F1RA 1G16A 1XTIA 4B3BA 2OFOA 2W6JA 1CULC 4P33A 4GMXA 5C46F 3OEEA 3W8NA 2DBYA 2EW1A 4RFSB 1S1CA 4LWZA 5TMPA 4M0LA 1VCIA 4EAQA 4R2IA 2PJZA 2CE7A 4Z1MA 4JKIA 4QOSA 5B58C 2D62A 2XZPA 2OG2A 2ZRPA 2QGZA 1QHIA 1P9RA 3IBGA 2VQSA 5AJXA 1FTSA 1JALA 5SZHB 3EW9A 2HT1A 4A36A 4IRUB 1H8HA 4NDZA 2R9VA 2CLDX 5JRZA 1DAEA 1OIWA 4LK2A 1J7KA 2YWFA 4JLVA 2QAGB 3MWYW 1KOFA 2WSMA 3PVSA 2QBYB 2CHQA 4W9MC 2R65A 2QM8A 1QF9A 3SE0A 2R6GA 1JECA 2H1LA 2IUUA 3CBQA 3R8CA 4DCTA 5EE9A 1KJYA 1KAOA 4XWAA 4DT1A 5AJWA 1LNZA 2GA8A 4Q1FA 2JDIA 1WBBA 1WCV1 2CJWB 1VECA 2VYFA 1TF5A 2PCLA 5FR1A 4A9AA 4CIDA 1XJ0A 1DELA 2NO1A 4KLZA 4TZ6A 1PJRA 1E94E 1SXJC 3BH6A 1QHHA 2GNOA 4KU4A 4XSGA 1HQYE 3LBHA 1W4BA 2REXB 3AVWA 1P9WA 2QT1A 4YMSA 4M2LA 4TLDA 3B1YA 4X8LA 4QGHA 4C0HA 2QE7D 1FUUA 5GVRA 4MGZR 4BZPA 3U61B 3WY9A 1EWQA 4PAMA 1GTVA 4DLXA 4UNSA 4U00A 3THXA 1UAAA 3KZ1E 4G5QA 3QENA 2C04A 4ACAA 3C41J 3CM0A 5BQ5A 1Z08A 4LGMA 2ZXUA 1DO2A 2V1UA 3NKVA 1JPJA 1XEWY 4NYJQ 1ZC4A 2ZSAA 2XB2A 221PA 1MR3F 3PUYA 5FBWB 3K0EA 4PX9A 4US0R 1G6HA 3ND9A 4LCBA 1XD2B 1AS0A 3AM1A 4LJ4A 4RY2A 5JJKA 5C4GB 2DFNA 2OCYC 3H86A 2P2LA 2XOKA 4LHZA 1SQ5A 3DMDA 1PLJA 4PSVA 3PXGA 4IDQA 1ZU5A 3M4YA 4PAOA 5EZ5A 3BGWA 3GLIE 2O8CA 1E2LA 1W4CA 3ZZ0A 3ADCA 3TBKA 3CH4B 3A1UA 2FU5C 2HXSA 2WIAA 4QBGB 2Z6VA 1S9DA 1E9AA 1RRFA 3SOPA 2OZEA 3LVQE 3GLIA 3WP1B 2EWVA 3KXIA 5JFGA 2JCSA 1W5SA 1PUJA 2HJVA 4FMCB 3FKSA 4LZZA 1X8JA 1Z06A 4D6PA 4NCIA 1DARA 3CWZA 1G3UA 1V5WA 2GJAA 1YR9A 1ZAKA 3E5HA 1R8SA 5FOWA 1ZNXA 3FYHA 5HPYB 4FMDB 1DAIA 1F5NA 1L2TA 1VG9B 1VTKA 2GRJA 1RRPA 1JR6A 2VSOA 1LF0A 3OEHD 1EFUA 4JLDA 4HAWA 3EXAA 2WWYA 4TLBA 4LC0A 4II7A 3EPHA 1V43A 1R0ZA 1XTRA 3QG1A 2X2FA 2IA5A 4DWJA 1C1YA 1G17A 5FOSA 2FFHA 2O8DB 3M1IA 3TW4A 2EWWA 5D3MB 5FBRB 4NYMR 1W36C 4AG6A 3UK6A 1CJUC 2ZYUX 3FHCB 2CE2X 1KSHA 1XPUA 4LSGA 4NMMA 1US8A 3DKPA 5HTKA 3CX8A 4I1VA 4TN1A 2KI5A 2NGRA 2XTNA 4P4SB 3SU8A 1BH2A 2REOA 3PFIA 1N5KA 2E1RA 4GP6A 1G21E 4WIAA 4O2LA 2NOAA 4ABYA 4JBYA 3AH8A 4FCVA 2XTZA 4EPXA 5DI3B 2JJ8A 2GF0A 5C18A 4MKIA 3THWB 3SFVA 1HT2E 1KI6B 2XSZD 1GNPA 1HV8A 2V9PA 5AR1A 2IS4A 1XMIA 2KBFA 3QXCA 1FW6A 3WHKA 3OIUA 2OCBA 4LBYA 4LBWA 2D2EA 3GJ3A 1G3RA 4L15A 2H57A 721PA 4MRRA 4CEHB 3SYLA 5KPDA 1P3JA 1GRRA 1Z2AA 2GEUA 3JVVA 3LV8A 3W34A 1MABB 1XXHE 1H65A 5BN4A 1JBKA 1Y63A 3B6EA 4OHWA 5FH9A 5D3QA 3U3OA 1KJWA 1U81A 2GK7A 1Y3AA 2AFHE 4JMPA 3TKLA 1KI9A 4H1UA 2ORVA 4MGIR 4AWXA 4EKDA 5GJBA 1FL9A 1XXHA 5TDHA 3TVTA 2GXAA 1KK2A 3TR5A 5F9HA 1J99A 2ZPTX 2P6NA 3QUSA 2GZDA 5KDLA 1LVGA 1WQ1R 4OK6A 1UADA 3KJHA 4IW3B 1I4LD 2KJQA 2GCOA 4PC2A 5CJ2A 4TZ0A 1DAHA 2NO0A 1RPZA 1A7JA 2UKDA 2YNMA 3NHBA 4NCJA 4BLTA 2IYSA 2ZVPX 2GVDC 4MYUA 1U90A 2OILA 3WHLA 1IXZA 2CCKA 2N42A 1WB9A 2WV9A 1E9SA 1G4AE 2ZREA 2FSIA 4M1MA 4ASUD 2VIIA 3BH0A 3HP1A 1U2RA 3RDPA 1ODFA 4C0AC 2QP4A 2B21A 1N25A 2IYQA 2HLDD 2W0MA 3OAAD 1GNQA 4LPSA 2VSXA 3C7KA 3IIJA 2H8KA 4KI0A 2XNDA 4B3GA 5H68A 1IY1A 1JJ7A 1SKYB 5H1YA 4DUGD 3BH7A 2GVZC 4JL8A 2IL1A 4C7OB 1A2BA 1T3LA 3KKNA 2O0JA 1NF3A 3L0PA 4Q1EA 3SI7A 4B74A 4JLJA 2RMKA 1RJ9B 1KY3A 2AKYA 3FFBA 4PHFA 2F43B 3UWOA 4ARZB 5FTJA 2A9KA 3IPXA 4HEJA 5UKDA 1UJ2A 3BB1A 3MWJA 4EPTA 3AF1A 3AEZA 1E96A 2CNWA 621PA 2HF9A 5KSYA 1J2JA 5CJPA 1RVDA 4DSNA 1OW3B 1L7VC 3W5JA 2QG6A 3B82A 3QBVA 4TMZA 4ZPXA 2WJVA 2XJ4A 1F2UA 2J7PA 1KKLA 2VF7A 3AKEA 1E9DA 3NBXX 1OB5A 3KFVA 3CRQA 4A0FA 4ZI3A 2D4HA 2O8FA 5JBQA 4Q7KA 5LDDC 1TQ2A 3A1WA 1GNRA 2VLIA 1QDEA 3CR8A 4V0LA 5AK0A 5JHGB 2Q21A 3AB3A 3ZD7A 3Q7PA 4R2HA 4IEIA 2XXAA 3EZ6A 1ZD8A 2BBTA 3OFND 4MA4A 4D4JA 1K8RA 2CXXA 2HXYA 2BHRA 1SVWA 2R44A 1W4AA 2IEYA 3OHMA 1ZNYA 2IF2A 3QF4B 1EWRA 2PL3A 4OL0A 1JEEA 2BCGY 2JEOA 4HUQB 4RD6A 4D0GA 5HZKA 3BK7A 5L3QA 1W44A 4HZUA 4MKGA 1S96A 5L3SA 3CNNA 4PQFA 4GOKA 1AS2A 1N0UA 2PH1A 4TTQA 4FINA 4IVQA 4BASA 5IK2D 2X19A 4IKEA 3SS8A 1ZM9A 1GITA 4QJ4A 2ZRLA 2PEZA 3EZ2A 5E7JA 1FZQA 4GNKA 2PX3A 3F8TA 1AZTA 4GBMA 2WSSA 1Z63A 1SXJB 2DY1A 1G7TA 1E2PA 3A58B 2YVUA 4BFTA 1VMAA 2X8AA 1B0UA 4GL2A 3S1AB 2BJVA 2QAJA 1Q1ZA 5B57C 4B35A 1IY2A 3K0AA 1HE1C 2QGNA 2IUTA 1YR6A 4DLUA 2GBLA 3KQNA 2VTKA 3NH6A 4IFEA 2BMJA 3CNLA 3A1SA 1SXJD 1TF7A 2ZUBA 3P20A 5B2ZA 5K8IA 3X1YA 1X8KA 1E2HA 3VTKA 4URVR 1QG2A 3R8FA 4Y0VA 5AJZA 1LFDB 2BM0A 3TQCA 1J70A 2OE2A 2ZU0C 5BYKA 2GAOA 3OF5A 4IVPA 2W6JD 4QXAA 4HAVA 4Q9LA 2IHBA 4BWYA 3W6PA 2KWIA 2WKRA 4NCHA 2UZIR 1U99A 1CEEA 4Z8YA 3PENA 2ZRCA 4Z1MD 1PV4A 1U0LA 4JSYA 1KI3A 4XWOA 1GIAA 1YJ5A 821PA 2J0UA 1XTKA 3P32A 5FTLA 3U4QA 5BXQC 4NYIR 1ZM3A 2MSEB 5TVKA 4Z51A 3U3RA 3GLFE 4O3MA 5SZJA 3NTUA 3W5IA 4DT1B 4F4JA 1KI1A 1NVXQ 1S1MA 4MDEA 4FMBB 1WE2A 4Q4HA 4D0LB 3U5ZB 5EXPA 3G82C 2A7QA 1FP6A 1Z0AA 1WMSA 1FTNA 3P27A 4LV5B 4N3NA 4B2LA 1T0HB 5LPNA 1T6NA 4JL6A 1QHHB 1GKIA 4BFYA 1BS1A 4R98A 2CL0X 5F2EA 4BEJA 3GLFA 4NU0A 3VKWA 1MRSA 4B6FA 2WWHA 4W5WA 4V0ME 1UDWA 2JDID 3I8XA 2NPIA 3PUVA 5FPHA 3HJNA 3OESA 2GBLC 2G83A 1X1RA 4LI0A 4RFVA 3THXB 3GJ5A 3ASZA 3K0FA 1O87A 1OFHA 2NG1A 4OBEA 2H17A 4DCVA 2ZRKA 2W2VA 3GPLA 1QVAA 1VYTA 1VCMA 4XTCS 2ANCA 2GAAA 3ETLA 2N46A 2BKEA 3ZS9A 2QORA 2AD1A 2Z4RA 1KI4A 3MJHA 2B7BA 1YVDA 3QPWA 4I1OA 1U0HC 1W36B 1ZM7A 1ZW6A 4PFSA 1EFCA 4G5RA 3U2QA 2DFKB 5J4HA 3Q7QA 4OJKA 5FOVA 1IN8A 2WKQA 4AYWA 1XDBA 2P6UA 1OKKA 3PQCA 3BXZA 1ZINA 2O8CB 4L8GA 4TL6A 4GDFA 4IDNA 4OHXA 4P4UA 1HEIA 1QZXA 2C9OA 3GLHA 5JECA 3IO5A 3LNCA 1FMLA 4MYCA 2ZYTX 2WJIA 1W0KA 2PT5A 1Q3TA 5EXSA 4QGAA 1E2EA 1WA5A 2QQEA 2XOKD 4EDHA 2ZQ5A 4Z54A 1WP9A 4HDCA 3GLIB 3IILA 2W00A 3X1DA 3J81k 3LAWA 4Y0AA 3FE2A 4BFWA 4X8OA 4L9SA 4NYJR 3MSXA 4TMTA 2PX0A 3RAPR 1EFHA 4AC9A 4JLPA 4JJZA 4D4KA 5EP2A 1S4QA 3VQTA 4XSHA 1TQDA 4KFUA 4YXWA 3LFUA 3VNVA 3GFPA 4L9WA 1OYYA 2JLWA 4LYAA 3PEWA 2QEQA 1XFAA 3LH5A 3LO5A 4XD7A 3ZIAA 5CITA 1CJVC 2P67A 1EXMA 1DBSA 2IXFA 2WAYA 3CW2A 3AGQA 4DSUA 1OH5A 1AK2A 1IN6A 3FKSD 3AP3A 3TSWA 5KPJA 4B2IA 2GILA 1S8FA 4AKHA 1RYHA 4X8MA 1QHGA 3MD0A 1NMZA 2DWPA 4OKSA 2XX3A 3IIKA 3C16C 1Q22A 3HWSA 1XEXA 2F1HA 4MRNA 3A4LA 1I2DA 5L3VA 1II9A 4NCNA 2EFCB 1KO7A 2IK8A 3DM5A 5CLLA 5HE8A 4G5OA 4Q5IA 2EU8A 3RANA 1US8B 2VP9A 1WF3A 3SYKA 4D80A 1CR2A 2FOLA 2PBRA 4R7ZA 4HB4A 3R9XA 1D8TA 3TQFA 1IAQA 4V0NA 3RSOA 1O3YA 5J40A 1X6VA 4CW7A 5EQTA 1XCGB 1J90A 1E2MA 2ZE5A 1NVVQ 2ZR7A 4KVAA 5TY0A 4DLWA 1OIXA 4EPVA 1DAMA 1EGAA 2FZLA 5FBLB 3ZVNA 1R5BA 1NRJB 3TAUA 4EFNA 4LJAA 1GOTA 1VG0B 4G3XA 2FGJA 3B13B 1EX6A 3W6OA 2QA5A 4GZMA 5J4VA 4FWTA 1CP2A 4G5GA 2DFLA 5FOUA 4WZ6A 2Z5FA 3AF2A 4KHZA 1P72A 3X2SA 1N6OA 4XWKA 2H92A 2Q6TA 3NC0C 1UKEA 4GP7A 1FQJA 5SZIA 4LJYA 1XMSA 4TQUS 3VAAA 3R9WA 3GJ7A 4DEYA 4DC9A 1NL3A 4HAUA 5F3WB 3T1QA 2NMVA 3T1OA 2RH5A 5FOTA 4POAA 1DADA 1H8EA
chains in the Genus database with same CATH superfamily
2IKSA 1PJAA 1QHSA 2J9XB 3E84A 5BWBA 5BV1A 3HB0A 3AIIA 2Y99A 3UMGA 3TFOA 1UMBA 2FI1A 2NTVA 3FPLA 4KO1S 4L74A 5TEWA 5IU6A 4LYFA 1Y8ZA 2PLRA 3VM6A 3Q4GA 4M9RA 4MICA 4X64B 3I28A 4UVIA 2V7QA 4YBZA 5AM5A 1KEZA 4UQLA 4DMCA 3PGXA 3BE4A 1RQRA 3YASA 2IH4A 5B1SA 4IIVA 3DO6A 1CNEA 3UTCA 3QQPA 3WFZA 2IOFK 4G5XA 1JIJA 1Z29A 4LRTB 1N2HA 2A1IA 1SG6A 2AC4A 3AV0B 3TLZA 4EATA 3V3KA 4ARVA 1MDBA 4GGOA 1YS2X 2UYQA 2AFHB 1ZD5A 1IEVA 4FOSA 5A9RA 1GUZA 4L8YA 3DVAB 5EG5A 3LM8A 4YCJA 3G2QA 3PSAA 1DIBA 2GCOB 1X9HA 4PEVA 2CBGA 4GBED 1L9KA 1P0FA 3TD6A 2WU4A 4QNMA 1LSUA 2B8NA 2GK4A 2VSYA 2WIGA 5F5NA 3R5TA 1DVRA 3KTDA 1YASA 4MIOA 2HADA 3WE7A 4AP9A 1YJ8A 2NZVG 3GU3A 3GRVA 4KO3S 2FW1A 4M1SA 2RI1A 3RV3A 3ID6C 3OPYI 3LX6A 2UYCA 1FFAA 4JI0B 3KSBC 1Q21A 1U1GA 2RH8A 4RLQA 4ESVA 3HVRA 1YB6A 4JA0A 1IN4A 4AL4A 2QMQA 1HBJA 2OV8A 4GEGA 1JLRA 1R6BX 2ERYA 2DBRA 4IJ5A 3RIHA 5AW2A 3VO9A 3E2PA 3L05A 1RLMA 4DKJA 5F98A 1WNFA 1WU7A 1M1NB 2FUEA 1QKKA 4IGAA 5CK5A 3JVIA 5DGCA 4OX9Y 1Q77A 4BIIA 5BUQA 1L7DA 1P2TA 3P96A 3RS4A 4KUGA 4OB6A 1P7ZA 2J09A 1YD7A 5A62A 3OPXA 4MS4A 2HRQA 2X3FA 1V8BA 2YHIA 5LBUA 4JBLA 5TR9A 2P0EA 4KJXA 1P31A 3ME5A 4FCCA 2FZ5A 2CCJA 4YMIA 1Z33A 3FUXA 3QXJA 3QOFA 3U13A 3NEYA 4R71A 2IOYA 2CVFA 1TVMA 3U80A 3THSA 3KZXA 5TJHA 3UCXA 1TYDE 3C8DA 2G5TA 1G64A 1RWBA 1S02A 4R6WA 1VPLA 1F3LA 3CF2A 3I6YA 4HH3C 4JLUA 4XWTA 5F5LA 2EF1A 5CHEA 1U9JA 2GQ0A 1P0MA 4J91A 3VVLA 4URUR 1IATA 3KWFA 1E4OA 4IUCS 5DWDA 2IDZA 2P4UA 2O8FB 2BLNA 1OPRA 1X70A 1ZZGA 2CJFA 4L6CA 4AO8A 3NHKA 3M3PA 4PCUA 1N6IA 2Q6VA 2WM2A 4YRRA 3U7HB 1KMMA 3TO5A 1MRNA 2VHWA 4GD3Q 4QTXA 4DPKA 3F6YA 3HFSA 1Q1AA 2VN8A 2VOJA 3IQFA 5LJIA 5AKEA 5AXDA 2XXAB 1P45A 2LNDA 3BJZA 3EIFA 2X8JA 2P5SA 5A5FA 2X4IA 3GIWA 1J56A 4CMKA 1B1CA 3I6BA 3MGKA 5J2UA 1RWQA 1LK7A 5EHIA 1VBNA 5KUTA 3OKFA 4FYYA 1SBZA 4QFMA 4WVFA 3EFOA 2MMCA 3FSGA 5C5DA 3ZWYA 4L0MA 5L3QB 1NTRA 3GFRA 4HZUB 2VDQB 1DOHA 2B94A 2OAP1 4LDJA 4EGFA 5I9LA 1HNNA 4ITRC 1TCVA 5CM9C 4R0MA 1ZMXA 4QD3A 4EZBA 2GT1A 4W5TA 4AY3A 1SELA 4RPKA 3FSEA 3MWLA 3NP9A 3QG5A 2R8EA 4NJMA 3DR5A 3AG6A 4KYTA 1IZ8A 4MUHA 3ONDA 4O4LA 1QORA 4B73A 4DIKA 1NI4B 3L18A 2FQ1A 2C4TA 2H0RA 3EEBA 5C1IA 3N05A 3IAFA 3OPMA 4CKWA 1T8UA 5G0UA 1K8YB 3ZK8A 1RYFA 3CXUA 4D96A 3A36A 1H85A 1T3ZA 2PSSA 1Z26A 4GMFA 2FPIB 3T5BA 4DM7A 2H52A 1N0WA 3K0AB 1GSIA 2YZ2A 3OJ0A 1Z4MA 1W52X 3OZFA 3AUSA 4N01A 4NLLA 4NNJA 1YZTA 2OXCA 1V2HE 3OOWA 2ZANA 1JHVA 1XMJA 4QU0A 4RKYA 2ONJA 3ZQKA 1XZDA 2OBNA 1M8KA 1XZCA 3PNMA 4K6GA 4UUQA 4KP7A 1GTRA 2FN8A 1RJDA 1ZWKA 2AVNA 5CA0A 4DNXA 4XJSA 1QG6A 1K6IA 4A2WA 3AXTA 3HU5A 3HZRA 4XDHA 4U6SA 2VPQA 1PWZA 1OLSB 4L08A 4EUKA 3FYSA 4O2BB 3GR6A 3TNFA 3C0KA 1A9TA 1BDMA 2YJ3A 2LW7A 3HCNA 4U2FA 4M4SA 5LDGA 4Q21A 4DCUA 4LOKA 2Q5JA 1UIMA 2V65A 2ZAYA 4PAWA 3KKZA 5EKDA 3DZJA 3RHTA 4AROA 4BP1A 5JCZA 4FC7A 1R0SA 3CRVA 4QWMA 4BO7A 4F4IA 4MVJF 1EDZA 4A8JA 3KLBA 2R5FA 2FK7A 2HO4A 4KKVA 2XMRA 4F8JA 1Z2CA 3GFOA 3RNOA 1CDOA 1JR4A 1E1NA 3D02A 3M5CA 3QIAA 4S1OA 5SY4A 3WR5A 1DWPA 1UKZA 3I5UA 2D5LA 4ENQA 3OJEA 2HK7A 4D6XA 3HVKA 3OE7A 1V7PC 5MFPA 3LW7A 3NASA 3G2IA 1I2ZA 4KVZA 3Q88A 1MVNA 2G5CA 3I6ZA 2IP1A 4PPNA 2R8XA 2RIPA 3A04A 4Z4CA 2DULA 2C31A 3QSGA 4AKSA 2DUMA 3AVVA 4JYAB 4M0EA 1N78A 3RG8A 2G07A 2DR3A 1RFLA 3NRJA 3D6FA 2RCNA 1TFUA 4RQTA 3N74A 2GBFA 1K0FA 5EPUA 1OX4B 1OGJA 1VSBA 5KYUB 1P18A 3ZS8A 4D8YA 2ROQA 1XQ9A 2HMSA 1FFXB 2QRQA 3AY7A 1PGJA 4PZCA 4NZPA 4PY2A 2ZS8A 3IVGA 3NUQA 2O3JA 2QTWB 2ZE6A 4R9UC 3V8BA 1XROA 1PT6A 2I2AA 3T1YB 3KQOA 1M34A 2PLNA 2GDJA 3U4AA 4ZZ3A 3N28A 2GPAA 1SCJA 1ZEMA 2NUBA 1RXIA 3K6RA 1Z6ZA 3PXCX 4ZP1A 4KTVE 1ZMBA 2JGLA 3PPWA 3PXXA 5C5IA 1NWHA 2PUVA 3AI2A 1OT3A 1DC5A 2OHFA 3OQ6A 2HMVA 4AJNA 2E4UA 1FXWF 3LT5A 4C7KA 3K1YA 4P3KA 4JJGA 3RVQA 3ZU4A 1GUAA 4DQDA 1SUFA 1Z13A 1ZO8A 2I8AA 2GJKA 2PX6A 3K2IA 4BB0A 2HYIC 4BO1A 1FJGB 3HKEB 2QPOA 2R8YA 2OWDA 3BFJA 1WDKA 1GGVA 4BQSA 2NO6A 2NXWA 1RAIA 2FXIA 2HJWA 5AW6A 3BSYA 4XW2A 3D6VA 4YB8A 1DAPA 3ZY4A 4JVSB 2H7YA 2PLAA 4FFDA 4MUJA 2BM1A 3M34A 4QTTB 3SYMA 3OT5A 1G7SA 4UHFA 3Q8LA 1G0OA 1G3IA 4J3FA 3HN6A 5EEGA 1FMCA 4A8JC 2VUTA 4JZKA 1U7OA 2FOIA 1TW3A 3U7EB 3JR7A 5B1EA 4AX4A 3NLLA 5NULA 3KQUA 1XQWA 1IL0A 5BUSA 4P83A 4E11A 3UJCA 1KO1A 4AWAA 5EESA 4KCGA 1UBFA 3RRNA 3GJQA 3B6KA 4F3CA 5IDXA 2B36A 2RBGA 2GRUA 4EW3A 4DDWA 3IEVA 3CUSA 1KOGA 5B3JA 1HSOA 2DH5A 3A9VA 4FFRA 3JQPA 4LX0A 2KYRA 5ALPA 1QG4A 3O2SB 3TNYA 2XUAA 3BWDD 2YV2A 2R47A 4QEZA 1I94B 3RRJA 3DEYX 3JR3A 2Q3CA 1E1RA 5JZVA 3QVLA 4Y6SA 3UV7A 3AERA 2F9MA 2C3PA 4L02A 4WFIA 4XXHA 5FLYA 5AJUA 3VR6A 1S5PA 3Q5GA 4XX0A 5JAMA 4K9KA 5AP9A 2JBAA 4MRSA 1DWUA 5HUQA 2PR2A 2Z3WA 2QZ9A 1ISPA 2OY0A 3UATA 4M1WA 4Z4FA 2NO5A 1Z4JA 2G08A 2WOOA 1X74A 4JBHA 3CLUC 3IIEA 4A5SA 2IU6A 4H7PA 4S3MA 4D99A 4PS1A 3B5JA 1Z8NA 5FUWA 3O5AA 1F48A 1OFGA 1R8YA 1VHJA 5KI6A 1XDZA 5CCEA 4PHHA 4JVLA 4O8CA 4MR7A 4G1BA 1L4MA 2HSJA 5F76A 4ZCLA 1LTQA 2D0PB 1JDTA 2C61A 3C3XA 2OC9A 1G1MA 1HDGO 5DX1A 1I3MA 3KYCA 2QNIA 3SHTA 3ZIAD 5BW4A 2YZ7A 2O3RA 4KXQA 1P8JA 2YXLA 3DH0A 4FX2A 3ZD6A 4WKPA 2C4HA 1BSVA 5EP4A 1U7PA 3ER6A 4D0NA 3V2IA 2R8RA 4QXMA 4W63A 2PWZA 2YICA 4QFCA 3ER9A 1T0UA 3LLUA 4LXYA 2M1ZA 3WP0A 4WA8A 1KDVA 1K92A 1P4SA 4YACA 1C3EA 2IZ6A 3H0CA 3GPBA 4ZT6A 4DSTA 3AUUA 1Y3BE 5K8UA 2B3TA 2Z08A 4PYIA 5G4LA 2WE7A 4LA4A 3UGJA 5CDFA 2V7BA 4RDCA 1USWA 4OX9B 4R2JA 5CFRA 5GJWC 4AG5A 1RYBA 1NXQA 3M82A 5B3JC 3LCMA 4PLGA 3L6BA 5ALOA 2WT8A 3M9XA 2A88A 2HIHA 1Y7PA 1ULTA 4LE1A 3RTAA 3SYNA 4XWWA 1E3MA 4D4HA 2PUFA 2ZUUA 1U3VA 3COPA 3LBAA 2R8OA 2Q4OA 1F2TA 2AOWA 2I7XA 2QW1A 3AHJA 4PZYA 2JVIA 2IDJA 5T4EA 3RVRA 3VNAA 1CR0A 4QHSA 3GFQA 5E4TA 3P9XA 1E32A 2OB1A 2HHHB 3ZBQA 4PM4A 4EJ6A 5A6SA 5BVGA 3VC1A 3RH0A 4D2IA 2A5YB 4Q03A 4Z0TA 5A4IS 3NDBB 4HV4A 2VTBA 3VH4A 4JH0A 4IIJA 3PGVA 1KO5A 1M1XB 2IIQA 2VR1A 1UMBB 1K27A 2XI4A 4QTZA 3ZIUA 2RH9B 5KMGA 1NVVR 1RTKA 2HU7A 3GDGA 3M81A 4MVJH 2C7GA 2WWWA 3B48A 2ZWAA 4HYEA 4LF7B 3E2IA 2BGNA 3AWDA 2V4MA 3EPPA 2QLFA 2O0HA 1J0CA 3H2HA 5I7VA 3MWKA 1H8ED 1D6SA 1W73A 2PT7A 3N39C 2NO7A 3KB1A 2W37A 3SR3A 3KAQA 1CR1A 2FV8A 4A6DA 3LX5A 4DFDA 4YX9A 3EMBA 3IJEB 4ZV4A 1BCSA 1AV7A 2H2DA 2NAPA 5F9MA 2VAVA 3WL6A 4CRWB 3U19A 1SBCA 3HTXA 3MUNA 2JFBA 3B5IA 4D3SA 5DCWA 1S3SA 1GGHA 1NBAA 3ZCSA 1JAHA 5FBWB 3DCNA 5ALHA 5KSOA 1ZITA 1E1YA 3KPWA 4Q4JA 4A8HA 3X1XA 5I4IA 2FEKA 5JS8A 1ZRMA 4HUTA 4TYWA 5IM4A 4DCMA 4GPEA 2QF7A 4O1IA 5KSWB 3SDBA 4FYJA 3IUYA 1XQ1A 1JEAA 3E5MA 4Q1VA 3VHLB 4F92B 3CLRC 3CLVA 3L6OO 1TCCA 3WQHA 1N5LA 2WG2A 2CF6A 1LLUA 2GBIA 3DQZA 1LTHR 1E79D 2AE2A 5LQDA 4IX9A 3IT1A 5M3BA 1PZEA 2EJTA 3E6AA 2FN7A 4EP1A 1XQ6A 2QMOA 5GWXA 1KYTA 4R69A 3E61A 3FZNA 2F8SA 5K01A 3C5VA 1OV4A 1N5RA 5H4GA 2BM9A 1SBHA 4IICA 1O6BA 1JFLA 2CUTA 4MR8A 3NBFA 4MS4B 1P9NA 4OO3A 5G1NA 4PGMA 5H3HA 2X0NA 2YHIB 4RSHA 3HVIA 2ZUFA 5E4FA 5DBHX 2Q1XA 3RRYA 2G17A 5E1DA 1FQKA 4PYQA 1VP3A 2R48A 2OOKA 2VK2A 4UDNA 3QMWA 3Q3JB 1Q1QA 4OV6B 4PCAA 2FWRA 5JU6A 2XGJA 2EHDA 1P77A 3M89A 3LWBA 1NU6A 5IJZA 2UUAB 4N8EA 1YHYA 4ZO6A 2QTNA 4UQPA 1D04A 3U5ZB 3SK0A 1EGHA 1BE8A 2W0SA 4RANA 2WF7A 1EP9A 2GZMA 3NO4A 2AS0A 2P91A 3A28A 3WLFA 1RHKA 4B33A 3FB1A 4WJKB 1P5ZB 3OEED 1M2KA 1IHOA 3M6LA 3ROQA 1L7EA 3DOOA 3U9TA 1ABEA 2ZYIA 2Q2OA 4X92A 3GHYA 2O50A 5HJ7A 4DLPA 4FR0A 3MPOA 1U8EA 2RGRA 1YU9A 3P26A 4QLOA 4XPZA 1C81A 5B5SA 1QZTA 3HUDA 3SYRA 1NNEA 2PGAA 4J2OA 1WXHA 2ASVA 1SGWA 2X8JB 5ITVA 3L4JA 3BBLA 4OFZA 2XZOA 3I9JA 3ZV4A 5J2UB 2D7DA 3CQ9A 5KNCH 4MMYB 4JUIA 5FV7A 2XF8A 3DL0A 3EFOB 3KEGA 1N9GA 2HFKA 3C39A 4MQEA 1KJJA 3ITDA 2W6ZA 4TS1A 4UNIA 4NOLA 2REBA 4ZKDA 3AVXA 1MG0A 3OY7A 1U8ZA 2ZRFA 1J8QA 3PCRB 1C2YA 4M83A 5IF9A 3RFTA 1T1RA 4KR9A 1RP1A 4JOSA 2PD6A 3CH6A 4B09A 1HFEL 3NHJA 2B8EA 3TQOA 4NJMB 1H22A 2CLHB 2DBVO 1UJ6A 3FI0A 2B2XA 3L0IB 3PHIA 4DM4A 3G17A 5SZKB 4O4LB 4RK6A 3HP7A 1KP9A 1JHZA 1QIKA 1O6ZA 1RRGA 4OHVA 4PS0A 4CKWB 3HXPA 4FB4A 4NZMA 4N03A 4RY9A 2Q41A 3F67A 3H99A 3PEVA 4QATA 4P3YA 1EUDA 3BHIA 5CG1A 5THKA 5HM8A 3FPSA 2BRUA 1VLQA 1JQKA 1JJVA 2Q5CA 1QYDA 2P2YA 2YHAA 1LDBA 1NBOA 5FEUA 3CJTA 3L1VA 4PC6A 3LE8A 3ZJ5A 5CA0B 5JS7A 1S9HA 1X3LA 4ENVA 3MTAA 1EK5A 4IHJA 3FTEA 1Q14A 3O9ZA 1Y6FA 1I1HA 1ZRNA 2QENA 2YQ5A 4MA5A 3D2LA 4YAWA 3NYIA 4ESEA 4DDHA 3DBRA 4MVJE 2XSZA 4FPXA 2ZWVA 1SOVA 2IBMA 3K9QO 3P2MA 4L4ZA 5AVKA 1DRVA 1LS1A 4UFNA 4KAFA 4IEEA 4YAKA 1H5QA 2V5AA 5CH8A 1MKYA 1NFFA 3DZGA 4A8JB 5EY5B 4MSUA 4BFLA 1KK1A 2OV2A 4MV4A 4H1VA 1H23A 2QJOA 1FY2A 2AYZA 2HXGA 1Z28A 4L0QA 5DLQC 4F45A 5CD9A 5JAHA 4BVKA 1J06A 4G4SP 1DKQA 2LR0A 3C5HA 2J33A 4CVNA 4OJTA 4RGYA 3ZZTA 2GKSA 1I80A 5TRTA 2YYSA 2B34A 3LPLA 4E2WA 4DRYA 5JQGA 1JLMA 1MU0A 1UPUA 1EXDA 2IH2A 1H2XA 4QUJA 5E7IA 2VKQA 3MJDA 4NKRA 3WWPA 1KKUA 2IYEA 2MYUA 3MNFA 3NHZA 3ZI7A 1PEAA 3DKVA 3FMOB 1NA5A 3D7MA 3ZHXA 3ONFA 4H3HB 3WGYA 1F14A 3QNWA 4NECA 3B9PA 1T36A 2JI6A 4P4LA 5CDSA 5FDFA 5E9WA 3IVXA 2J3MA 4MUAA 1AQJA 2CL7X 1I1OA 3Q10A 2XRMA 1GFIA 3AY3A 4GXQA 4EPWA 2D3WA 5COQA 2BRUC 2J5QA 3CSUA 3N6VA 3P5BA 1MW9X 1LI5A 5EIEA 4R7GA 1IJKA 4R3UC 5AKJA 5AM4A 2NQTA 4OF4A 1CY7A 3CGGA 1CJTC 2WNHA 1J22A 4LISA 4O0MA 3SZLA 4BE4A 4LBZA 4ZCIA 5CEJA 5AM3A 4RHYA 1CP3A 1IQRA 1H2FA 4Z1OA 3W9YA 1S2IA 3R7LA 3STVA 4PIPA 5L9AA 2DPMA 2ZYRA 1ZGCA 2QL9A 2D0IA 1BMFA 1CF9A 3A6FA 2LIVA 3MCAA 1R16A 3KJZA 5FL3A 4DPMA 1AKYA 5FB3A 4ZXPA 5DM60 5K8LA 2VOEA 4ZJYA 5HOEA 4REOA 3G1UA 5LP6A 2UVDA 2EP8A 1AKTA 1BE0A 2Z8YM 4GPIB 2JH8A 3B3AA 4L8VA 2XW6A 4RH1A 1L5NA 3V8EA 1HNZB 3OO1A 1UFOA 2PQ6A 3MMXA 3CHYA 1F3OA 4NFYA 2QRNA 1WG8A 2YRFA 4O2AA 5FBHA 4DY6A 3QUBA 1D0IA 3LRTA 3H04A 3FROA 3SEZA 1J42A 2A0XA 3BILA 3PUKA 4CTMA 1JZSA 3G0OA 4PLZA 4YJ3A 1MV5A 4LTMA 4K9QA 2RHTA 1DV2A 2WIFA 3NTOA 3T3DA 3GBPA 4OA8A 2MJLA 2Z5LA 4PYLA 4PPQA 2CK3D 1XZIA 2AFRA 1E7MA 3IJ5A 4Z49A 1J2RA 4G8BA 1HDXA 1JKFA 1JHPA 4NENA 1NVUQ 4MINA 4TLAA 1I01A 1K98A 3CLSC 4PXAA 4XX0B 3R74A 4KWEA 3ZWMA 4BFZA 1QAQA 2C83A 2I2BA 2JBAB 2MSDB 4ZQEA 1VYHA 3F5QA 3K09A 4GWKA 3KS9A 2D5BA 4RCZA 2PJRA 3FWYA 4A2QA 4JJ6A 1ZONA 4JC4A 4WLEA 1FVXA 4XIYA 4CI9A 2IBSA 1DQSA 2ODEA 1NIJA 4MAAA 3TJRA 4CJXA 4M46A 4MWEA 1C2TA 3HABA 1L5HA 1CETA 5CCXA 4MR7B 1SCAA 4B9EA 1V6AA 1MH1A 4WKCA 2YN2A 4K0KB 1U3GA 5DNDA 5EZYF 3KYCB 2H9AA 3BWYA 2V8OA 5JATA 1DEAA 3DAFA 4US1R 2J3EA 1DG3A 3MW8A 3CNOA 4EW2A 4G24A 4KLCA 4ZCMA 5A7FA 3EG5A 3GROA 5EEHA 4HWTA 4LECA 4UQOA 2CYAA 3FYDA 3K9LA 3ORFA 4MW1A 4WAUA 5AI4A 5LP6C 1FA9A 2CVPA 2Y68A 4UUMA 2PZ8A 3F6EX 4ROSA 3QU5A 4ZVVA 2F8MA 4RKWA 4UHEA 3TUZC 5KYXA 2W8ZA 5JIBA 4C7MA 3P4UA 4I1UA 4CIXA 5HQTA 1S2MA 3DDSA 2OV3A 3H9UA 1F17A 4RJJA 3WZLA 5KQGA 2FWPA 4FN5A 4MV7A 3A32A 2D0DA 5LBIA 3L0SA 8OHMA 3C14C 4PZUA 4IDHA 1TNDA 1YVEI 3FPJA 4M1OA 4JI4B 1SY7A 2YJTD 2PX2A 4CQMD 4DLZA 4RHCA 1YHNA 3ROGA 2FETA 1TZKA 4PHGA 4U9HS 4R40A 1F2TB 1E7WA 5CB6A 2I6FA 3I5AA 3LIPA 3ON5A 1I3OA 4MWTA 2FW8A 2G36A 4MTCA 2O2IA 1G8KA 3QPVA 3N1UA 4FGWA 2B4AA 3WYFA 3GLGA 3T7RA 3BRQA 4X7BA 1TYBE 3D4IA 2Q1TA 3K09C 1STOA 2WYVA 1FFEA 3CF0A 1JG6A 4RZSA 5A6SB 1Z6GA 2L82A 1E59A 5H70A 3TB6A 4A82A 1OB2A 2H4ZA 2C8KA 5LXTF 4ZI2A 3B1JA 5F1PA 4IIJB 4C0BA 4BCDA 3HNRA 3FDIA 5IVDA 2Z6UA 1HG1A 3R3XA 1FOEB 2R62A 1PKXA 2GAIA 2GKOA 1FFHA 4BKMA 1TRKA 1JHQA 3AW8A 3J7TA 3OZUA 3ICCA 4L72A 1I7NA 4C05A 3F90A 1W581 2C5LA 2XKJE 5KYUA 1QLHA 1Z8FA 4WASA 4TXJA 4F06A 2CNWD 1S3FA 4R9NA 1BCSB 1DEXA 1TXGA 4UAVA 4BO2A 5HKLA 3QEMA 3C24A 5DF1A 3L4BA 4HJXA 4BP9A 7AT1A 2DPYA 3Q7TA 4TT3D 4BLOA 2C88A 1Y6ZA 1KAMA 5B64A 4FSHA 3ZV6A 1U6KA 4TMVA 3C3EA 1XVIA 2XUHA 5ESXA 4ZKEA 2O6LA 4C0JA 2VEOA 4C9BA 4Q4JB 1BGXT 3QMPA 1LDMA 5TQ0A 2WD7A 1TK3A 2JGIA 3KYDA 5KJ6A 4C6RA 1BJTA 3UCFA 4AY2A 3QEOA 1K8XB 5JAUA 1UZUA 1A69A 4AKGA 2C03A 3R3WA 4Y98A 3T5CA 1A1VA 3JAMA 3RC1A 3LHKA 3T1OA 4EGJA 1VBMA 3IXMA 1A5ZA 1RHQA 3UMSA 5P21A 3H7IA 4NV1A 2ZB2A 3M33A 2AOUA 3C4JA 3MCVA 5F3RA 3O8CA 1LXCA 1S7GA 1EG7A 3FDJA 3PTLA 1UKVY 2RHOA 3GIDA 4KIFA 3UB2A 5A4JA 2D1QA 4FN4A 2QMZA 4M0KA 2BSAA 4D3ZA 4URZR 3EDCA 3E81A 2NUAA 1BE6A 1I5OA 1MX5A 1PD0A 1N6RA 3E7DA 5DW3A 4IOKA 4DHWA 5CDYA 3SJ7A 1NT2A 4GE3A 2O5CA 4MR8B 2N47A 4MI3A 3KBOA 3ZOZA 4V1CA 5EUQB 1V8OA 2DPLA 3VVMA 1R4NA 1D2CA 1JEDA 1SB8A 1ZX1A 2PRSA 5BV8A 5TGZA 1MA0A 4DDTA 4FHDA 1LLDA 4IIUA 1D6JA 1TAHA 1NM5A 2GPYA 1RE1A 1OHHD 4NQRA 2QTFA 3SX4A 4G23A 4NAHA 2W6CX 2EGHA 4XVUA 1MT3A 1USGA 1K8ZB 1Z4IA 5EC8A 3QEKA 2ECKA 1SQGA 1ZJ5A 3EBLA 1PR1A 3EVCA 3L4BC 3ZWDA 4B7UA 3EAGA 4BYMA 4IZ6A 4KQMA 4UMFA 1I2MA 1G2QA 3UT6A 2QJRA 1E6EA 3E70C 4PG8A 2XVXA 1SKAA 1VPDA 3HDTA 2QUIA 1FS5A 5KNBH 5LKAA 1AGRA 1JDBC 4MARA 3WWEA 4ZYYA 1LPPA 4RV4A 4MIEA 5J59A 1FRNA 5DHTA 1TUEA 2B5VA 3IQEA 4I5FA 3TD9A 3EXG1 3AETA 2DBZA 3VNBA 3VSCA 3OFKA 4YO8A 3L7JA 4FZVA 3AFOA 4WVLA 8ADHA 4RKEA 1H0KA 3HB9A 3RVSA 1QZUA 2Z1DA 1G8FA 5EJ2A 2C00A 2NXNA 2WB4A 2PVCA 3OQJA 4MAMA 1HY3A 3MD9A 5EHQA 4UPEA 4OMCA 5C5CA 3HWRA 5K0JA 1NP7A 1R9MA 1GA6A 3BD6A 3KLNA 2C8LA 3PKJA 5J43A 2HIMA 4DCOA 2XLCA 2EGUA 4MW9A 3BRWD 2PL5A 3MRSA 4IFBA 1CUAA 1N9GB 3DXZA 4MQEB 4QOFA 3ZIDA 4AF7A 4C0WA 1UPAA 2ODWA 2DQYA 2QD1A 3L7LA 4TOIA 1U7WA 3JYHA 2EX4A 1ZW1A 2Q8QA 3UTDA 4WNAA 1QB7A 3AR7A 4WK0B 1KBOA 4TMKA 1XNHA 4HK4A 1Y5IA 5CB8A 1VE6A 1Y8RA 2EQBA 1BMTA 4LJ8A 4BCBA 5ENVA 1NJ5A 3L77A 2X7JA 4G5SA 3PYLA 2X5JO 3CIFA 2VCYA 5LQMA 4PXSA 3Q6IA 3TAXA 5LNK6 1NM5C 2VJOA 3VR4A 1KQGA 4RXMA 5G0SA 1GV0A 4J0CA 4EY5A 1F8XA 2YVQA 3E23A 5LA6F 4I19A 3IAS1 4CFZA 2HUPA 3HFRA 4NNPA 3N53A 4EB8A 2A5LA 1NFQA 4J0IA 1EUDB 3OHPA 3PXUA 1OYWA 2E87A 4YRJA 4B3DA 1DQPA 4MVCA 4U7HA 1CFZA 4MVYA 1JHUA 4G0OA 3G0HA 3NG1A 3DDWA 4TT8A 5TX7A 3FN4A 4OREX 2DB3A 3ISTA 4PRYA 3FLEA 3BTSA 2EIXA 4PW0A 4WNYA 1YRAA 2ZRBA 3JRNA 1BD3A 4IHJB 2YJNA 3B89A 3CRZA 2XH8A 5AW1A 2VHVA 4JJ8A 1L5WA 5CYPA 4LHVA 4TSFD 1G291 5KWVA 2ZSFA 3DBRB 3BSFA 4Q3EA 3H17A 3PGJA 2VF8A 4W1RA 5CXSA 3T95A 1XU4A 4P9NA 2HWUA 2J8ZA 4EKEA 1K75A 1U31A 3D6TB 2DR2A 1E9VA 1IYZA 2BI7A 2DAPA 1COZA 3AJ9A 3FTNA 5E2IA 1NAHA 3ZKWA 1GG2A 2A5FA 4EHDA 1ZGZA 1AVTA 1MB3A 3FLBA 4NJEA 3U4CA 2P7HA 1USUA 2RHRA 2JGRA 4MB2A 2FF5A 4PYMA 3O8NA 3H1TA 4BO8A 3G9UA 1P4AA 2FK8A 2WM3A 3RUEA 3ML1A 1L5FA 3FMVA 3UUEA 3V8PA 4OXRA 2QNRA 4XUCA 1L7PA 4V0QA 4D42A 5JD6A 2HMWA 5DSZA 5I4CA 1ZGHA 2CHGA 1YZQA 1R0WA 3VHQA 1HWYA 8AT1A 5JQGB 2PMWB 2HSWA 2QMEA 4WADA 3QWHA 3L8GA 3VMMA 1TJYA 4OHMA 3A05A 3D8TA 4ZPJA 2EKZA 2O7RA 2VL7A 2UXCB 3ABZA 3DHNA 1N5MA 4QAJA 3I64A 4CF5A 4DQVA 5LUAA 3HM9A 2LD4A 3URKA 5I4BA 1L4NA 1T36B 1N6KA 2GCEA 3R44A 4Z8XA 2PMBA 2J85A 2ZETA 3H8WA 3UMMA 3DWGA 3VDNB 4B82A 3HO8A 1PDWA 1Z5ZA 2FXVA 2QJWA 3AONB 3PI7A 4CQLA 1KJ8A 3ZHRA 4HZIA 2AC7A 3ZH2A 3TGPA 2H4YA 4JUDX 1J25A 1EVEA 3DVLA 4KQ6A 2M6LA 1UDAA 2DQZA 1TEHA 2JI8A 2ZQYA 2ZB4A 4KXMA 4M1QA 1B8OA 5EVJA 5K9ZA 2HK8A 3FMIA 1PFKA 2YTZA 4KSBA 4DDKA 3G2OA 4M8KA 4FYIA 4BKUA 3MJSA 3H1GA 2ZRHA 4YQFA 3ZWVA 4W1PA 2JRLA 1G8PA 2GTPA 1YZKA 3AUTA 4U8GA 4CTNA 1N3IA 2CSXA 4JBGA 3DT8A 2JHFA 3M5WA 3D1LA 2GKGA 3VJRA 4Y9DA 2ZG6A 5GM1A 4YMVA 3IDFA 4IZHA 4DMKA 3RS2A 3OOJA 4LRWA 3NWPA 2G9ZA 2ZI6A 3WK5A 1ONNA 2OCPA 4DRZA 2R2GA 1KAHA 4F85A 2ZQZA 4BNFA 1U04A 3OX4A 2UV8A 3QM1A 4UNPA 4O2AB 3BQ9A 3K70D 2YV4A 1NW3A 3I83A 1CQXA 3IJPA 1T1JA 4JYBA 4JIGA 3TGLA 4NWIA 3K2BA 2X2PA 2KBEA 3JYNA 4B3TB 3L4SO 3HG7A 1CSEE 4YJ3B 1C29B 2FUKA 1PW5A 3ZD8A 4DR4B 4RCYA 3TPFA 3A4TA 4BMPB 4EUEA 1TUIA 4N47A 1NVDA 3KELA 5JCPA 1PVOA 3VHRA 3QA9A 4DUPA 3UJ3X 5EMNA 3VJKA 1S2DA 1Z0KA 2C5BA 1R4ZA 2F64A 1CIPA 3MUFA 3VJMA 2X0JA 4Q4LA 4NENB 2OO7A 2Q9UA 1MAWA 1PJ3A 1E98A 2Y05A 4IO1A 4RZXA 5JDCA 4ER3A 2Z8ZA 2AG5A 1FQOA 3T9FA 4YMUA 3UBTA 3LP6A 4Y2VA 4D46A 3KZVA 3A6PC 4IJQA 1ULZA 3CWQA 3PDIA 1W93A 5JDIA 3V2GA 4IH4A 1RRCA 3Q3VA 1W8DA 1DAFA 3DM9B 1U0OC 3A6DA 3IQWA 4HC4A 3WSWA 2G70A 3P19A 2FMXA 2G25A 3IQXA 3MSCA 2P9QA 3SYTA 2P65A 1L5HB 2ILVA 1G1AA 1ODLA 1ZM2A 4GGPA 4JLNA 5EA2A 1PR4A 4DEXA 4GLJA 4RFSA 5CLFA 1T5IA 3SF0A 3G23A 3MTIA 3D0KA 4A0RA 3HU3A 2NTNA 3QFFA 1A5SB 1O4WA 2P9JA 4HB3A 1QYWA 5F2OA 3PEYA 3ZWAA 2BI8A 3SJAA 1UBCA 1R15A 5ICFA 3J80A 4Z2YA 2O7NA 4KWHA 2MSWA 4YJDA 2V0NA 2IW3A 3GBSA 3H11A 4OHBA 3UK1A 3TBFA 4BQOA 1R8QA 1C7JA 1SVKA 1GZSA 2QJTA 3FAKA 4RABA 5AKZA 1NXVA 4BLUA 2PUDA 5ECGC 2P9YA 5AVVA 2KMLA 2YMMA 3LA6A 4YROA 4ZHQA 5KYXB 2G77B 2FPUA 3WGOA 5BPFA 1P0CA 2BV3A 3I45A 5KCMA 2CSUA 4LVOA 5LVAA 1HPLA 3A6EA 3PUZA 2AH5A 4M38A 4B3HA 4BVBA 4LX8A 2CJYA 2HO5A 2V3WA 1UPBA 2I5PO 3HCCA 1A82A 2DTDA 1T8PA 1C3XA 1XLVA 1CUWA 4CL3A 5C5EA 1X7GA 4NMXB 2Q28A 2YRXA 3H42B 3MT9A 2BHLA 5DOVA 5L53A 3ICQB 2JFHA 4U2DA 1M7BA 1WPGA 3D3JA 2JF0A 4Q7JB 4M53A 4KI7A 4MMXB 2EP5A 5J63A 5JDCC 4C0XA 3IODA 4JB0A 1XMVA 2ID4A 2PKXA 2JFFA 4XB2A 3FFAA 1T5SA 1B73A 4LFAB 5FFMA 3VBEA 2P0AA 2QROA 3GLGB 5I47A 3UMYA 3MMPA 1Q7BA 1N3BA 5JDIC 3ZY2A 1VJDA 7GPBA 2GCPA 5CCBA 2GN4A 3LWNA 3D3QA 4GR4A 2GEFA 2B4QA 3CB2A 4GKKB 1BYUA 1SB9A 2FJUA 3G3EA 1WBJB 4S35A 5FPTA 1DJPA 4LSWA 1U0FA 1FYEA 2N3ZA 3G2PA 4V03A 1DT5A 3DE7X 3UWMA 1KGDA 1RQGA 5WRFA 3C48A 2O9JA 3V9AA 2E7ZA 4P8RA 1DX4A 1F9AA 1EFRD 3IBFA 3ZY3A 1LW6E 1C80A 4OYYA 3NKFA 3D8RA 4HYYA 4JCOA 1JR3D 2OR3A 3HR7A 1N36B 2M6KA 1XP5A 1YACA 1RIIA 1WY5A 2VPPA 2MMGA 2W98A 3EWAA 3BIWA 1VJ5A 2SHKA 4CLEA 4BE7B 3VR2D 4IHKA 3NAZA 4M88A 3ANSA 3FAZA 1DE0A 3QEMB 2CT8A 2VH5R 5AW4A 2TYSB 1ZVQA 4IIDA 1ECJA 4ENWA 1OWPA 5CYGA 2AKAB 1H2AS 2JJ2D 4Z6KA 3ICOA 2C95A 1SUBA 2HWYA 2J87A 3LUGA 4JUAA 4MVJG 3A4IA 4QNNA 1JDBB 5CEEA 1B6RA 1MJGA 3DDZX 5KKNB 4LE0A 4NIMA 2WD7B 1AMNA 3QXXA 2I1VB 2M2IA 3KYDB 4BJ3A 2N1MA 3FHTA 2YV5A 4H1TA 4NYMQ 5BSVA 4F3KA 3S29A 3MZ0A 2EG5A 1Z88A 1EBUA 3I2IA 1PZXA 1IOWA 1XE3A 4MJ3A 2AOUB 2PZBA 4IR7A 1HE3A 1L5ZA 1RAFA 3EVBA 4LG1A 4A5OA 4AI6A 2NZJA 2GN2A 4R8LA 3LLCA 3AR6A 5DGIA 1JIIA 3AIKA 4KQKA 3UAWA 3FH0A 4OSOA 3HLTA 4AMGA 2IS1A 1GILA 2FQQA 4QYXA 1RXYA 1G5TA 2VATA 3PVZA 4OBXA 3SQWA 4IS3A 3TSOA 3FTCA 1QOPB 4P7FA 2NUAB 3D6MA 3UK2A 2XE6A 3UXHA 4M3NA 4BRUA 5J5CA 5T7BA 2NPFA 3Q85A 3PQ5A 3WBFA 3W5VA 4ZZ0A 2P5UA 4FQ5A 3TDKA 4MGEA 4DGQA 4V1CB 5JCJD 1NQWA 2FN4A 4FIDA 3KWLA 4JI2B 1ORIA 1X1CA 1GTJ1 3AJ8A 1TVEA 1M76A 5AOVA 3I9LA 1T9AA 4BLRA 5D3MA 4DDMA 1E0AA 4A73A 2N75A 2WP0A 2XYGA <