1GRQA

Chloramphenicol phosphotransferase in complex with p-amino-chloramphenicol from streptomyces venezuelae
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
178
structure length
178
Chain Sequence
MTTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMPLKMQSAEGGIEFDADGGVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVGDLDVLWVGVRCDGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYDVEVDTTHKESIECAWAIAAHVVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE
publication title Structural Basis for Chloramphenicol Tolerance in Streptomyces Venezuelae by Chloramphenicol Phosphotransferase Activity
pubmed doi rcsb
molecule tags Transferase
total genus 58
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2001-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07931 CPT Chloramphenicol phosphotransferase-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1grqA00
1E4VA 3FMOB 2W6IA 2OAQ1 1TQ6A 1Z83A 2WVJA 3ICEA 3SNHA 4JS0A 4JL5A 3C7KA 4Q02A 4TYQA 3NC1C 3S1AB 5E4FA 2J41A 2O8DB 3GP8A 5L3SA 1TAGA 6Q21A 3FPAA 4XVUA 2ODNA 2PL3A 4QGGA 2XNDA 4WA7A 5TVKA 2ANCA 1OIWA 1CRPA 2FFHA 3LBNA 4TTRA 2GTPA 1VECA 1F48A 1X8KA 2ZSDA 5JHHB 2QAGC 2BEJA 3ZZTA 1GL7A 2C99A 4HLUC 1IXZA 1NLYA 4KV9A 5JZVA 2O8CB 3T1VA 3HDTA 5A0FA 1SULA 2XOKD 4HEJA 3ASZA 2V9PA 2IA5A 4OQMA 4PQRA 3WNCA 3WRYC 3BERA 2QGNA 1XZPA 2JA1A 3K0FA 1N5LA 5FI1B 2WJJA 4LC1A 2ZRGA 4G5SA 1W36B 1M1YE 3QOFA 5J5CA 4H1UA 2YKGA 1IM2A 2P6NA 2PEZA 1IJEA 2JIZD 2ZYVX 2C78A 4M53A 4PX9A 4JLPA 4R71A 5JEDA 4AURA 4YMUA 1LV7A 3RC8A 3DMNA 4C0KA 3PEVA 1HTWA 3KTAA 1OIXA 1ZBDA 1QDEA 3AF3A 5BYJA 3KB2A 2JLWA 2FZ4A 5C1BA 4RD6A 4HAZA 1D2EA 5JWOA 2FFAA 1ZIPA 2QNRA 2VHQA 4TLEA 2FPLA 2GBLC 3K0CA 1KDTA 3C41J 1W1WA 2PH1A 1BKDR 2QTFA 3FTQA 4HZUA 3H86A 4HB3A 1P5ZB 3I5XA 1TQ4A 1V43A 2ZXUA 3LY5A 1RJ9B 1UAAA 3KFXA 1JR3D 1VG1A 1G3RA 4Q5IA 4ABYA 2DPXA 3CWZA 3CRRA 1Z6AA 4MYHA 5TV2A 1Y63A 1CKEA 3EZ6A 2RGGA 4CRWB 2PT5A 4NHOA 2XSZD 1ANKA 1II0A 3DMDA 4F4JA 2CK3A 4BPBA 2IHYA 2J45A 4UNPA 1P62B 1ZC4A 3LBHA 4BFYA 4UNRA 5FFMA 1P61B 3TNFA 5BYKA 1XU4A 2ZYUX 4DB4A 3M4YA 4HUQA 2HJVA 3X1ZA 2YOGA 4A8JB 1OT3A 1X1RA 5SZHB 3TE6A 1E1RA 5KOYA 4II7A 4C0AC 2IYQA 3GLHA 1W36D 5KNDA 3VR6A 3PIRA 3CPJB 5JRZA 4B3DA 3QEJA 5JEEA 1SXJE 3M1IA 4A0RA 2XZOA 4GPTA 1XTRA 2A5YB 3B8HA 4HSEA 2I1QA 4LJAA 3LAWA 4EAQA 1Z0JA 1C9KA 2R8RA 3A4LA 3OEHA 5LPNA 1PUJA 2FSIA 3RWMB 1UBFA 1H8HA 3SYKA 3GLIE 2KI5A 4PANA 3L8YA 2J0UB 4I1SA 4AYTA 3NIBA 1XNJA 3HU1A 2IC5A 1N6HA 1XEXB 3WBJA 4MKGA 3CO5A 3W6PA 4BLPA 2A5JA 1XRJA 1ZAKA 3BE4A 4FCWA 1T3LA 4JSYA 4U00A 2H8KA 3RSOA 3SDZA 2JATA 3Q72A 4NYMR 1D5CA 2QP3A 3LRPA 4KVGA 2OBNA 2V54A 4XTRA 1G5PA 2DCUA 1TF7A 1VPLA 4OK3A 1XDBA 3SC3A 5HKKA 3B9PA 4HATA 4LBVA 3TJZA 1JEEA 4LCBA 4M1MA 4P33A 1HY3A 1YZQA 1Z0IA 3LBIA 5CM8B 4DVGA 2RGXA 2BHRA 2XZPA 4DSTA 3U4QB 1ZVQA 1G9XA 2ZEJA 1EX6A 1WMSA 5FBLB 5SZJA 1BOFA 2QAGA 5E3HA 3TW4A 1NI3A 4TMTA 4HLUA 4PZLA 3IEUA 3IBYA 3NKVA 2ZPTX 3ZYCA 1IN5A 5L3VA 4CF7A 3O47A 4PC2A 1W7AA 1AIPA 4Q9IA 2PT7A 3T34A 1U8AA 1RE0A 1YZTA 3QEOA 1KK1A 4OKSA 4XWKA 1CS4C 2WJIA 4URXR 4H1VA 1YRBA 4WW0A 3PV0A 5L3QA 4CEHB 3L8ZA 4UXJA 3IUYA 1G7CA 2F43B 4NU0A 5TDHA 2A2ZA 1AZTA 2MSEB 1N0VC 3PITA 1LF0A 4DSOA 4EFMA 2OT3B 4JT4A 3K70B 1E32A 1BMFA 3DKPA 3E70C 1C4OA 3TQFA 2ZRAA 3TUJC 1WP9A 1GFIA 1E9DA 2V7QA 4QG7A 1OH7A 3THOA 5EXXA 1NVVR 4EIWA 4EDHA 4ILEA 3Q85A 2AHOA 2GF0A 3EG5A 1NY5A 1Z0KA 3NBFA 4LBZA 2NZ8A 1P73A 1Z22A 3AF0A 3BB1A 5B30A 3VX3A 2CLDX 3UKDA 4E03A 4FINA 5CK4A 1QHXA 2EW1A 3AKCA 1W2HA 2R65A 2VPPA 4KXFB 1SVLA 3FKSD 4ZDKA 4TL7A 2IWHA 1Q1QA 1ZM9A 4MDEA 1PLJA 3ZZUA 3T12A 5L3SB 3DM5A 4JLKA 1NMYA 2Y8EA 2N42A 4UNNA 1OH6A 3NXSA 2XTMA 5CYOA 4GNKA 2VA8A 3U3MA 5JECA 1P4SA 1Z3IX 3ZDQA 5AJZA 2FH5B 3C8UA 5FPTA 3BORA 1US8A 4KFSA 5C4MA 2ZJYA 1P2UA 3K0SA 1R8SA 5FTNA 2VSXA 2ZRCA 4AG6A 1KI6A 3EIEA 3MJRA 3SHWA 1G3IA 3W34A 4IHQA 1U2RA 1KSGA 3ZQJA 5F98A 3B1VA 4Q1FA 4BECA 1ODFA 1XXHE 3B1YA 2CHQA 3CH5A 3K0FB 2CCKA 3UWOA 4D4MA 1P6XA 3NHAA 4XWOA 2JCSA 4EJSC 1JB1A 1M34E 3TW8B 4LV5B 2CL6X 4IKEA 3K70D 3W6NA 1F2UA 2OFOA 3PFIA 3GEIA 2GXSA 1AS0A 1PUIA 1NBME 2J7KA 3NBYC 1KMHB 3AF4A 1G41A 4OJQA 1DAGA 1Z28A 3KTAB 4Q01A 2IXEA 4BLOA 1XTKA 3M0EA 4BGDA 4AYWA 2REBA 4XH9B 4QKQA 1T0JB 4Q03A 1XZQA 2C96A 2V4ZA 4D82A 4P4UA 5C46F 4HLCA 4A2WA 3H0KA 2ZS8A 621PA 5J4KA 3AP1A 1ZUHA 2VRWA 4HZUB 4RZUA 1Z2CA 1GWNA 3SZRA 5JBQA 1G8FA 1T8TA 3B13B 1DG1G 3E2IA 2ZSFA 4KU4A 4KAXA 2OILA 1E2JA 5KDOA 2A78A 1IY0A 2YZ2A 2ZR7A 1GOTA 4B43A 2XNDD 5CDFE 1IY2A 1HV8A 4EPWA 3IBGA 1N6PA 2CL7X 5K8TA 4D80A 4R2IA 2ZYTX 5G3ZA 4AKHA 4U02A 1CJUC 3ZVLA 3MWLA 4R7ZA 1TF2A 3GJ8A 4OK5A 3KQHA 1JECA 4X8LA 4C9BA 3NEYA 1S8FA 1WQ1R 3DDCA 3MJHA 3O8BA 2UVQA 1ZP6A 2ZJZA 4W5JA 4HLDA 3LD9A 1R2QA 2GILA 5JFGA 3GLHB 2A5FA 4TLCA 4NZYA 1S9HA 1U81A 3K9NA 2I1VB 2DFTA 2IF0A 4M0LA 4V0NA 1G291 3SYNA 3K8YA 3WMFA 2WPDA 4A0GA 4IRUB 1ZM7A 2VLIA 2GRJA 3L2OB 2VP5A 2ZIAA 2JJ8A 4JJKA 3VHLB 1EK0A 1SVKA 4ARZB 1NSFA 2DYKA 2KSQA 2JGNA 2REXB 3VR3A 4TMWA 5JI2E 1DAEA 5EE5B 1TNDA 1AQUA 2NO6A 3PUXA 4FMBB 3VKHA 1DE0A 1G1MA 2RGDA 1JQLB 5IT5A 1RFLA 3SR0A 3FKQA 4L8GA 1Z0FA 1E9AA 4M9XA 2JLUA 1AK2A 1FX0A 3TR5A 3MWKA 3KUCA 3HYRA 3TAHA 4C2UA 1U9IC 1KO5A 3LW8A 2DFKB 3E1SA 2DWPA 4KLNA 2ANBA 4XSGA 3RS5A 1UDWA 2ZSEA 1DS6A 3BIFA 2IS2A 4R2HA 3GJ6A 2QROA 1FP7A 1FNNA 5FUWA 3KUDA 4DCTA 4XD7A 4A8JC 5CLLA 2WZQA 2CK3D 2HUPA 4OI2A 2DWQA 3SJAA 3DEFA 4CT5A 2EYQA 2XITA 1A5TA 1QHSA 1KY3A 2Z6VA 1G8HA 4QL3A 4EPVA 1PV4A 3GD7A 5LDDC 1KOFA 4JLNA 2LKCA 3K53A 4IXNA 1E1RD 3PR1A 4PZYA 3VNVA 1E2QA 2PMKA 2QAGB 3AB3A 1ETUA 1GILA 4LHWA 4BLQA 2BJWA 5IK2A 1UDXA 3CNLA 2ZRFA 3NWJA 3PJRA 4JLMA 4M1TA 2VH5R 1T8UA 1W2GA 1D2MA 2AKAB 2NPFA 3MLEA 4Q4LA 3B1WA 2ZITA 2A7QA 4IFEA 1EXMA 3IHLA 3TMKA 1OXVA 4DDVA 3B5JA 3TQCA 3AVPA 5L3QB 1X3SA 4NYIR 2ZETA 2VHJA 3OEHD 4YMVA 4AKIA 4PHHA 4EJSA 3HU2A 1XD9A 1EFCA 1H8HD 3JZMA 5EE1A 2P6UA 3R9IA 3I62A 4TT3D 2P0EA 3QKRA 2GXAA 2GKSA 3H1TA 4D4JA 1VMAA 1XBTA 3EZFA 4IDQA 3VU9A 4LYHA 4B47A 1RW4A 4L9WA 1DELA 3H84A 4QJ3A 1WF3A 1E2DA 1KJWA 1UKEA 2GZAA 3EARA 3U7HB 1VHTA 5G3YA 4Q1EA 2N1BA 3REGA 1HT2E 3W3ZB 2QBYB 2ZVPX 3BK7A 4FIDA 1JR3E 1ZNXA 4GRAA 1GAJA 2OZEA 2H16A 2W2XA 3VR5A 4JYCA 1OFIA 4LJ8A 5CM9C 1JJVA 3I1FA 5HKKD 1AS3A 4EPTA 4HB4A 1U90A 2NOAA 4CYMA 1W0KA 5C4GB 3LVQE 3FB4A 2BOVA 1MRNA 3I92A 1KDOA 3KJIA 2C04A 2CL0X 4RD1A 4ESVA 3CPHA 1E0KA 4UXHA 1B0UA 3BBPA 1AJEA 1TQ2A 1S1CA 4B32A 4JBYA 5GVRA 1US8B 2P5TB 5AK0A 4BFWA 4NMMA 4BEJA 3DOEA 4IDOA 2RCNA 1P3JA 1ZCBA 1G16A 2QP9X 2EFGA 2P5SA 1KI6B 2QORA 4LPKA 4TLAA 5FBVB 1Z07A 1VYUA 3RHFA 3ZVRA 5LBIA 1NSTA 3GCGA 1CBUA 1MT0A 3IO5A 5F9HA 4L15A 3SBDA 3PENA 2G88A 2QU8A 2QEQA 3GLGA 1YJ5A 4RZ3A 2GJSA 4BRWA 4TTPA 1JXOA 3ZZ0A 1F2UB 3HU3A 4N0DA 2YC4C 3ADKA 4WAUA 4B44A 2V7QD 4B6FA 2R44A 4B3XA 4B71A 5IF9A 2RMKA 2C9YA 1HA3A 3I5YA 3IQWA 1OB2A 1EFHA 3TR0A 2GAOA 3B60A 3T1QA 1ZM3A 1Q44A 1SVIA 3LVRE 4CZ2A 4CIDA 3H2YA 4B2LA 2IXFA 2QMOA 1DADA 2P2LA 2ZR9A 4Q4AB 5KSZA 3I3SR 4DSNA 5A4JA 1W4RA 1XMJA 4NP6A 2HYIC 2WKQA 2FMXA 4JVSB 2GEVA 4KLZA 1W4BA 2H57A 4XVQA 5EP4A 1EX7A 3F8TA 4UXIA 5FPHA 1KSFX 1U9IA 5J4HA 1WXQA 1E0SA 1G6HA 2GETA 2ZJOA 5EZ6B 3AUYA 4I4LA 5AJYA 4EQ6A 2IW3A 3AEZA 3MGCA 2ZRPA 4TYPA 4A8JA 2P67A 1KK0A 4A2PA 2NO1A 2QENA 4Q7KA 4NCNA 3NHBA 4FWIB 1QHHA 1E2HA 2QG6A 3K9LA 1UKZA 1Z63A 2GCNA 5JCPA 2VP0A 2WSSA 1KI9A 2BIFA 1TL7C 2ZJAA 4YXWA 3GPLA 3TKLA 4WOPA 1E79D 1TF5A 1NMZA 4Q7MB 3QNUA 2QN6A 4O2LA 2LKDA 3MUFA 1COWA 3SFVA 4CGZA 2JLRA 2KBFA 1Q20A 4HB0A 3IILA 1J90A 4G5OA 3AH8A 2G6BA 2NG1A 2PX3A 1ZC3A 4NH0A 3UMRA 1HT1E 2ORVA 5H1YA 1JQJC 2ECKA 2KB0A 4YDSA 2RAPA 3GLFA 1XEXA 2ORIA 4OQFA 3QG1A 1LS1A 2AK3A 1Q57A 1Q21A 3HPQA 2H7VA 2IYTA 5IDVA 3U3OA 4AWXA 1RPZA 4UKDA 1Z06A 3IO3A 2IS6A 3CZQA 4JYBA 1E9FA 4MGIR 2VEDA 2H1LA 4OQXA 1OFTA 3GEHA 4DIDA 3THYA 4GDFA 2FJUA 1FX0B 2XB4A 1P72A 1ZD1A 3E5HA 5EE0A 1JNYA 4KITB 1N6KA 5LD2B 1U0HC 4XJXA 1A1VA 3BH6A 2GZHA 1N6IA 3GFPA 4X8HA 2OESA 3AP2A 3U4QA 5CJ2A 1ZYUA 4QHTA 1D8TA 4KBFA 2ZAMA 5D3QA 3EZ7A 4HAYA 4YQFA 1KI1A 4DT1B 721PA 2EFEB 2YWGA 4HDCA 5DYGA 1S9DA 1W47A 1XCMA 2GF9A 2GWHA 1HE8B 4NONA 5JJLA 1WCV1 4P31A 3RLFA 2H92A 3B7GA 2OAP1 1JAHA 3A1VA 3IKJA 3A1TA 4NTZA 4DUGD 3MSXA 2IUUA 1ZRHA 3EA0A 3RSLA 3BFKA 2WJYA 1XTQA 4C0HA 1U98A 3ZQ6A 4B34A 3CNOA 4O0MA 5FTMA 2C95A 1CJTC 3NEJA 1JR6A 1M7HA 2R9VA 3H4MA 3LXXA 5EE3A 5BWMA 4LRWA 3LLMA 4MKIA 1KTVA 2AWOA 4EJSB 3SQWA 3J81k 1EESA 2I3BA 4K8OA 1D9XA 3QKRB 2RGBA 3VKWA 1Z5ZA 3U3RA 1ESMA 3VU9B 1NMXA 1RKBA 3MCAA 4IVQA 1U0JA 3DM9B 4O2RA 4CEJA 1F3OA 1G19A 2A5GA 4I1OA 4JLDA 4GP7A 2FFBA 1VCMA 1S2MA 2ZI6A 3EXAA 1F5NA 2BMJA 2ZI7A 4D25A 3KQUA 3QUSA 3B2EA 2G83A 4TTQA 3N70A 4XD7D 4RD2A 3G82C 1IN8A 2VF7A 1DO2A 3EWAA 3PEYA 2HT6A 3GFOA 2MMCA 1RRPA 3RRZA 1CEEA 1GNQA 5HZKA 2GAAA 3KQNA 2WJVA 4GMXA 4M4SA 1JEDA 2FOLA 3QXHA 4MYUA 5IRCD 1UF9A 4Q18A 3WP0A 1KIMA 2FSHA 1NVWQ 5IK2D 2X77A 2O0HA 4TQAA 3X1YA 1IBRA 4DSUA 3SJCA 4Y0VA 1U8ZA 1BYUA 1WA5A 4M21A 1OYYA 4M1YA 1OW3B 2JJ1D 4NKRA 2CBZA 2F1HA 3AVQA 2WMOB 3KJGA 4W5WA 1JAIA 5DGXA 4U7DA 1Z6TA 1CXZA 1WBDA 2CMKA 3GLGB 1KMHA 2BM1A 5CITA 5JCZA 4Q66C 5KSOA 4TZ0A 1NLFA 4ZDJA 3CH4B 2WKRA 3C15C 2IS4A 2NPIA 1KI8A 5H68A 4S35A 3ZD7A 2JJ2A 2V55B 1KO4A 2GCPA 1FMJA 2WJGA 3GFTA 2GHIA 3JZAA 4L16A 4M1KA 4TWZA 3TUIC 3VHXA 821PA 3FE2A 3B1ZA 4ZO4A 2PLRA 1LVGA 4V0OA 3THWA 1IONA 5J4LA 4GFDA 1NNEA 3SQXA 2ZE8A 1KO7A 4LBWA 1E2GA 2G0NA 5JSZA 1VKJA 3PUWA 2B7BA 2O8EA 1L2TA 1IN7A 3LH5A 1OFUX 4ZKDA 2V3CC 3MWJA 1R4AA 2FPMA 3TIFA 1DAIA 2J7PA 2GDJA 2DWOA 4LHZA 4HUTA 2KJQA 3CRMA 3MAAC 4NYJQ 1W0KD 4JL8A 4EQ6B 3AVYA 5FPKA 1MKYA 2AWNA 3L0PA 1KI4A 2ZREA 4KFRA 2A3RA 1E2NA 3P1JA 4FXPA 4JLJA 4LZZA 3KKMA 3SJZA 1E0JA 4OHWA 3KJHA 3BOSA 5EXPA 1AKYA 4G5GA 1QHHB 2HLDA 5EJEA 2AFIE 3BFXA 3LW7A 4IEIA 2CNWD 4JJZA 5CLQA 4DZZA 1Z08A 2CDNA 4DLWA 1CR1A 1G21E 3CPEA 2V1XA 1FL9A 2G1KA 2FV8A 3QKSB 5C2JB 1VYVA 5K8IA 1P2TA 4PSVA 3PG5A 4ON9A 1J2JA 2BBSA 2V8OA 2ATVA 3QBVA 1KSJA 4LYJA 5EP3A 3VR1A 2IYVA 4QBHA 4FMDF 5AWFC 2B92A 4ARZA 4RD0A 5TY0A 1PLKA 4PPNA 4RD4A 1U8YA 1NP6A 4TT3A 2Q3MA 2D62A 4QM7A 4DDUA 3AGQA 1QHNA 3HP1A 3WYAA 3T5DA 2QQEA 2HF9A 2IT1A 3GLFB 5FI0B 3UATA 1TU4A 2BKUA 1E2LA 1TEXA 2GCOA 4US1R 4ACBA 5DE3A 1N6LA 4BFXA 2ZU0C 2R6DA 2JDIA 3B85A 3CF0A 4PPQA 4FD2A 2ZVQX 3U3JA 1D9ZA 1FQJA 3LA6A 1ZD9A 3EASA 3Q9LA 4HAVA 4Q19A 2O8FA 2BBTA 1SKYB 3A37A 1PZNA 2YWEA 5AUQA 2AN9A 2IF2A 3NVAA 4M1WA 5DISB 3B6EA 3QI2A 3THYB 1AN0A 1XPUA 1GNPA 4MKFA 2W58A 4IVPA 3G5UA 2EWWA 1WDTA 3OIYA 2X1VA 1IQPA 3B78A 5E7MA 1HUQA 2OXRA 4MGZR 3KL4A 2QUZA 1OB5A 2G1JA 4MGYR 5AUNB 4GP6A 3THXA 2J0SA 4F4IA 3QPWA 2AD1A 1S96A 4JLVA 1DBSA 3SS8A 4BFUA 4PSAA 5E7JA 2F3RA 4I1UA 1YKSA 4GT1A 3EAQA 1GSIA 1MO3A 3AVWA 4BEBA 2WSSD 1NKSA 4ZI3A 4QHSA 1R10A 4Q9HA 1H65A 4KJZA 1XJ0A 4YXWD 2QY9A 5C18A 4URVR 5FOUA 2RGEA 2BM0A 3DO6A 1WB9A 1KJZA 5P21A 1COWD 1E2FA 2ODWA 2X2FA 4PHTA 3RYTC 3TBKA 3MFYA 4WVFA 3BRWD 4XTCS 2I4IA 4GSYA 1YZUA 5M04A 2Q3FA 2CE7A 4GMDA 3QKUA 4QC2A 4BZQA 3ZS8A 1I2MA 1OSNA 4EKDA 3EPJA 1LF5A 3T5GA 1DAMA 2F6RA 1EFUA 2E9SA 2Q9BA 3SHFA 4B48A 4DDTA 4QXAA 421PA 1L8QA 2QMEA 1KO8A 4PQFA 1CJVC 3U6BA 4QGFA 1P2SA 4P0TA 4TMVA 3HJNA 4LJ5A 3L0SA 2IUSA 2QBYA 3FMPB 1E9RA 5LD2C 1FW6A 1EWRA 1XCPA 4UJ5A 4CEJB 4UQOA 1KAGA 4DCNA 4LHXA 1XEWX 3BFVA 3ZH9B 2HF8A 1GUAA 1KK2A 1RYFA 3GJ3A 1N5IA 3HR8A 4RFSA 2FSFA 2XTNA 3O8RA 2XJ4A 2UKDA 2WWHA 3CX6A 2X8AA 3SE0A 4P32A 5EP1A 1YZLA 3CRW1 4URZR 5EUMA 1M7GA 3ADCA 1S1MA 4L5BA 2L0XA 4YLGA 2AFHE 4OI1A 2J1LA 1HURA 2R6CA 3I72A 5DO9A 2QQ0A 4BFVA 5FH9A 3DZDA 1M74A 1HQYE 2Q9CA 2QPOA 2VL7A 5G40A 4F38A 1MV5A 4DLVA 2EU8A 1E79A 3NH6A 3PXGA 1Q3HA 3GEEA 2J0VA 2PCLA 1T3SA 1LTQA 4LV8B 5JMTA 2ZRKA 2QTVB 3NBXX 4MRVA 4D4LA 5BN4A 4OK6A 1UKVY 5A5GA 4LV6A 4JSTA 4YONB 2VTKA 1XX6A 1R7RA 3KX2A 2ZRBA 4U5XA 3GJ4A 4QHYA 4DCSA 3ZD6A 4XWAA 5FR2A 1R5NA 1CP2A 1OFHA 3HR7A 4ITRC 1UADA 3TSZA 2CHVA 1E9BA 3OESA 1KMQA 3DKVA 2XXAA 3A8TA 4B33A 3AF2A 5JHGB 1XTSA 1YR6A 5DHAA 2ONJA 1K6MA 4Q4AA 4RD3A 1I4TD 1E2KA 1Z0DA 3UPUA 1TTTA 2B7CA 4P3YA 3THWB 1XMVA 3RS0A 3U7GA 2VHTA 2YWHA 3LX5A 3X1XA 5CIWA 5JSZB 3NDBB 1G7RA 3EWSA 2O8EB 2CLSA 3UANA 4NCKA 5CJPA 4YMWA 5HPYB 2RGNA 4HAUA 4JVNA 4D26A 2E87A 5FR1A 3EZ2A 3T15A 3D6TB 3KXKA 3DVLA 4MYTA 3R7WA 3TRFA 5AUOB 4I1VA 1T9HA 3OIWA 3CKLA 2ZANA 1I4LD 4PFSA 4JKYA 3AVTA 3SN6A 2DFNA 4DEYA 5DN6A 4AY2A 1VCOA 4GZMA 5KSYA 3T61A 1IAQA 2G0TA 1OYWA 3KKNA 4OHZA 1GDDA 1X86B 1LY1A 1TUEA 4LOAA 4DUGA 1G3QA 3QPUA 1CU1A 4TYNA 1W5SA 2GVDC 2QTHA 1OHHD 3A1SA 3FFAA 4YMSA 1RRFA 5FTJA 5DI9A 3LQQA 2YV5A 1R6BX 1I2DA 2GJAA 4C3ZA 3BH0A 3SI7A 4AC9A 4QNRA 4AKGA 3RS2A 4V02A 1L4YA 2KWIA 5F2EA 4C30A 4G5QA 4XVRA 1E96A 2W2VA 2CJWA 2VP9A 2JJ2D 1S3SA 1SVSA 3CUEF 3V4RA 1X6VA 3EW9A 2VHCA 2ZJ5A 1F2TA 1R0WA 2BC9A 4BASA 3WY9A 2GCOB 1SXJB 3QBTA 1G7TA 1CIPA 1FUKA 1R8QA 2WMNB 5HCIA 2ATXA 121PA 4POAA 1C1YA 3CF6R 5AJVB 1KNXA 2VHUA 1K5DA 4B6EA 4MQBA 3TSOA 2O8FB 4HB2A 2ZUDA 1BIFA 2PMDA 2C9CA 2J7PD 1XF9A 3U3KA 2WAXA 4TQ9A 4ASUD 1RYHA 1XD2A 4PC1A 2GEDA 4PXAA 1G5RA 2Z5FA 4LJ9A 2GXQA 4BFTA 5DH9A 3QQ5A 1X8JA 3OHMA 3QY0A 4WZBE 4E5UA 4DT1A 1LW7A 1AKEA 4URWR 3AGPA 1I4DD 4DLTA 3THXB 2EFHB 3B82A 3ADBA 2YJTD 2EFDB 3W5JA 2HEIA 3A1UA 4MDFA 4F7WA 2HLDD 2REOA 1D6JA 3JVVA 2F9LA 5J4VA 4RCYA 1DTSA 2ZI5A 2XGJA 4ZCLA 3KZ1E 4TYYA 4A6PA 4URYR 4G5RA 4A2QA 3TVTA 4B76A 3TUZC 2VBCA 2IYWA 4CDGA 1DAHA 1XFAA 3ZVMA 4PO9A 3LXRA 2EQBA 2ZRJA 1E94E 3AF1A 1NL3A 5GJBA 1FMLA 2JJ1A 1JBKA 2D3WA 4K46A 1FNMA 1CLUA 4TYWA 4G1UC 1CTQA 2Z43A 2Z83A 2D74A 1S4QA 2XNSA 4KVAA 4OQLA 5EP2A 3WXMA 5KHOC 2Q6TA 3C4JA 2IBMA 4QRHA 4Q47A 2WOJA 4LYAA 1AA9A 5JWRA 1GVNB 1OKKA 1VG0B 2DFLA 3WHLA 3F3YA 2VSFA 3EPKA 1SXJD 1FZQA 1QRAA 1JXMA 1XD8A 3MD0A 4D4KA 3T06B 2GA8A 4IVRA 1GIAA 2JDID 3ND8A 2VO1A 3LWNA 1ZM2A 2UZ3A 4FCTA 3CZPA 2K5UA 4Q7LA 3LLUA 4PAOA 1OF1A 4FMCB 2WSMA 1SGWA 3F5FA 4F92B 2X19A 2QPTA 3GQBA 3ICQB 2XEXA 5E7IA 2J87A 4RFVA 1II9A 1QBKC 2ZTSA 3VAAA 1KDPA 4CW7A 2DB3A 4IJMA 1E6CA 4RFSB 2FPKA 2RKOA 2ERXA 3CWQA 1L4UA 4XIGS 3EIQA 4HDQB 1OLOA 2V1UA 2WBLC 2XAUA 4AD8A 4Z1MA 5LB4A 1X8LA 1P60A 3OAAD 1T4GA 3LNCA 1Q3TA 3R20A 3UG6A 2CNWA 5CIQA 3VMFA 2ZI4A 2W0MA 3CRVA 1UEIA 3LQRA 2ZSBA 1ESNA 2JLSA 2RGAA 4XOIA 1Q1ZA 4OBEA 3TH5A 2QT0A 4MRSA 3PUYA 2O0KA 4RY2A 3KFVA 1KZ7B 3EC1A 4KI0A 3GLGE 1II8B 3EIHA 2B8TA 1R5OA 3F0TA 1R5BA 2ZS7A 4ZDWA 4MITA 3QSYA 1DVRA 4HI0E 5CK5A 3I73A 3X1WA 2O52A 5J47A 4A15A 2DR3A 3L0IB 4NE2A 3VR2A 2B8WA 1DOAA 4B3GA 1W46A 1W5TA 3K09C 4JZKA 1Y3AA 3A4NA 5GJWC 4ZKEA 2ZI3A 3SU8A 2A30A 2YOHA 1XJCA 1B23P 2XXAB 4MH0R 4BWYA 1J7KA 1M2OB 1SVOA 4H9GA 2NZJA 1CULC 1ZJ6A 3T35A 3P27A 3CR7A 4G01B 4OQNA 2YINC 1N6OA 1NLZA 4EPYA 1YE8A 3RWOA 3KDSE 4NBSA 3X2SA 3V4FA 5FTLA 2OXCA 2N46A 1TEVA 1UJ2A 1XMIA 1T3HA 3R7WB 4JT2A 3WMGA 4ZCIA 1P9RA 1TQDA 4JIMA 4QGHA 4NYMQ 2JLXA 3RABA 3LFUA 1OH5A 2E1RA 2WWXA 1T5IA 4ZPXA 1KYIA 2BMEA 5ANRB 3QKSA 2NMVA 3VQTA 1PLLA 2PZEA 1Z6GA 1TU3A 3QE0A 1W49A 5FL7A 4ZIRA 1N25A 2NO7A 4FW9A 3OE7A 1VCIA 5KO2A 2IYLD 1N2CE 2VQSA 2QRNA 2W2TA 1EG7A 4MUAA 2W6JA 2Z4SA 3FGNA 4GL2A 2ERYA 2FEOA 2BMFA 2HCJB 2ZROA 4IDNA 3C14C 5JJKA 2J9RA 4JLAA 1WBBA 3GLFE 2C03A 3IIJA 3UG7A 4AG5A 3QVVA 1WE2A 2CJWB 3HYTA 2VP4A 2G3YA 3P20A 1F2TB 3CX7A 1SKYE 1KJYA 2OFWA 3NBZC 2PJZA 4PPFA 4V0ME 1F60A 5E95A 1EFTA 4DLYA 1NBMD 3OF5A 1FPMA 3TSWA 1CR2A 4RJLA 1NVVQ 3TVDA 4ESHA 2FX3A 3QJYA 1S0UA 3IDQA 2CE2X 3FMIA 4MYCA 2ZRIA 3NH9A 5HR5A 1XD2B 5BXQC 1YHNA 2IUTA 4Q1AA 4Q21A 1NJFA 1OV4A 1SVMA 4FWTA 3EC2A 1SHKA 1XMSA 1IXSB 5DN6D 2QM8A 1UFQA 4KSBA 2WM9B 5DNYB 3QF7A 4B74A 1QZXA 4QGAA 2KBEA 1E99A 2YVUA 4LJ6A 4HAXA 4C4PA 3CRQA 3W5IA 2GZDA 2RHDA 1NN3A 4O25A 1E2MA 2SHKA 4C7OA 3LO5A 3K0EA 2NGRA 2F55A 3ASYA 4PHFA 2CEAA 1Z47A 5HE9A 1MH1A 2W0SA 4MUBA 3A36A 1XPOA 4Z8YA 1E9CA 1E69A 1ZNWA 1GRQA 3PVSA 2VP6A 4PAQA 1R0ZA 3ZIAD 3U2QA 1E0AA 3Q7PA 1SXJC 1KO1A 4P4TA 2IHBA 2D2FA 3UK6A 4PQYA 3FYHA 3K09A 3Q5DA 2W83A 4LY6A 1DPFA 2CCJA 3AKYA 2YYZA 1G4AE 1N5KA 2OG2A 4B73A 5KPJA 4JLBA 2F7SA 1KY2A 3MMPA 1GZSA 1J8YF 5FOXA 1GNRA 1P9NA 3K0AA 5FOSA 4A1FA 1QHIA 4D0GA 1W0JD 1SZPA 2ZSAA 3PQCA 2FDCA 2YC2C 1HQCA 3A4MA 3R9XA 2PLFA 4LSGA 4US2R 1NVUQ 5HCNA 4IOMA 1Q1EA 3AV0B 2D7CA 1FTSA 3LX8A 4KBGA 2H17A 2OM2A 5AUPB 4DLXA 1CF4A 3BD9A 5FPSA 2IEYA 2ZAOA 3W8RA 4A0FA 4DEXA 4RCZA 5LB2A 5EUQB 2H5EA 4TLBA 4LBYA 1K8RA 3BB3A 3WNDA 2A9KA 2AL7A 4MGKR 2EYUA 3N2IA 1GL6A 2J3EA 4IOKA 2Q21A 4MRPA 5J40A 3D31A 1VIAA 1MO5A 1Q22A 4B3BA 2BBWA 2PEYA 1OHHA 2ZU6A 3M6AA 4I99A 3U7FB 1QG2A 4BZXA 1BO6A 1XTJA 2QI9C 1KHTA 2JLYA 4B2IA 3AQ4A 1P75A 3AVUA 1NF3A 2QMUA 1NG9A 2O8BB 2AR7A 4DXAA 3VTKA 3Q5EA 5D3MA 4W5HA 4IFBA 3DHWC 1ZU4A 1GRNA 3VR4A 4IW3B 2EFCB 1OKKD 2FG5A 5CB8A 1A2BA 2WHXA 3ECCA 2BJVA 3QF4A 4OHYA 1BH2A 4LGMA 1Z8FA 4BUJA 4F4CA 5BN5A 2NQ2C 2BCJQ 3O8CA 2BEKA 1N3BA 1N0UA 2ODEA 2NO0A 4RKFA 5KTYA 4TZ6A 5JS7A 1AZSC 3PEUA 2ZRNA 4QBIA 4BLSA 4NCIA 1JPJA 2FZLA 4B3FX 1UEJA 2BMDA 1PJRA 2FN4A 1RRGA 2ZE5A 4ASUA 4AIIA 2IK8A 5KNBA 3RS3A 1GKUB 3N5CA 5HE8A 3WP1B 2HV8A 1LS6A 5GJCA 3IGFA 4UJ3A 4W9MC 2ODBA 4Z1MD 1MO4A 1YRAA 1LFDB 4M1SA 4CVNA 3OFNA 4DBLC 4ERNA 3CX8A 1G17A 3AKDA 5FBRB 3GLHE 1OXSC 1BS1A 1XPRA 2ZR0A 2ZRHA 4LC0A 1UM8A 4PSKA 4UNQA 3GJ5A 1YR7A 1W4CA 1GP2A 1XTIA 3O8DA 4ZIRB 3C5HA 4LWZA 3BJIC 3K9GA 4DIEA 3IEVA 3RS7A 1Z29A 1EFRA 4TLDA 5BW8A 2ZUBA 4Q7JB 4Q4HA 3UWKA 4P4SB 3UXMA 4AK9A 4TMXA 3FOZA 2QP4A 3MWYW 1J70A 1FQKA 2AD5A 1AGPA 4NCHA 4D0NA 1YQTA 2VIIA 2HCBA 2GK7A 4FMCF 1SHZA 1NN5A 1KNQA 3T1TA 1YZKA 1U94A 3RAPR 3CLVA 1IXRC 1W44A 1SXJA 4GOXA 4FN5A 4YDHB 4TN1A 5KYKA 5FOWA 5BN3A 5EE9A 1OH8A 4QM6A 5GJVC 2J0QA 2WTUA 2BVNA 4NYIQ 5FPYA 2QAJA 4LYFA 1KSHA 2J59A 4BRUA 1T6NA 1ONBA 2VYFA 2F3TA 3QENA 2ORWA 3P4YA 2AX4A 1G7SA 1O87A 1OXUA 2RGNC 4GOKA 2A5DA 1NN1A 3I61A 4TQUS 1O3YA 3CNNA 3DZ8A 1BYIA 4D6PA 2JASA 2C98A 1P7CA 3GLIA 1J99A 3BH7A 1ELOA 5JWHA 4KFUA 3U60B 2FGJA 1OIVA 3AP3A 2BKEA 4IDHA 3GJ0A 3ZS9A 1DEKA 4FI3C 4JBXA 3D7MA 4RZ2A 1R0YA 4B3CA 5HZHA 3FDIA 2QA5A 3JVUA 4LDJA 1RVDA 4PHGA 4PO1A 4PO8A 1KI3A 1OXTA 5TARA 3OAAA 1IN4A 4AYXA 221PA 3NC0C 5EZ5A 2GESA 4ZCMA 3TLXA 4LJYA 4Q1BA 2CXXA 3B1XA 1Z6XA 1HE1C 5SZKB 2IYRA 2PZGA 5FL7D 2RH5A 3OE7D 4IOLA 4LHVA 4DC9A 4QJ5A 4C7OB 2FWRA 3SFZA 3QXJA 3QXXA 4HLQB 1XP8A 2W6JD 3OEEA 1SKQA 1E4YA 4BFZA 3CW2A 2ZRMA 4E22A 2QRZA 2RHMA 5AJWA 3V9PA 4XSHA 4IDPA 3ZVNA 2WICA 4JLOA 1RRCA 1GM5A 1M6NA 2P3SA 3W6OA 2QM7A 1ZUIA 2OBLA 1AS2A 1NIJA 2QE7A 3KKPA 4QBFA 4AI6A 2R2AA 3LDAA 2D2EA 1N5JA 5B2ZA 5CB6A 1KGDA 4EFLA 4YMTA 2X2EA 1FP6A 2FU5C 1E2IA 1G4UR 2YHSA 3RS4A 1OE0A 1A4RA 2GXUA 3U5ZB 4US0R 3K0AB 4A92A 5H70A 3RRYA 4E09A 1KKLA 3RVBA 2EWVA 3BAFA 4PPGA 5JS8A 1XEFA 2PX0A 1AQYA 1GKIA 2FFQA 2GBLA 2CVFA 1YU9A 3FHOA 2DBYA 4N0EA 1F6BA 1Z0AA 2OCAA 1E9SA 3DPUA 3TK1A 2NIPA 1DO0A 5CYPA 3PEWA 5SZIA 3W90A 1FFHA 3LV8A 1KKMA 1ZNYA 5JLJA 1X1SA 2IYZA 3ZJYA 4Z54A 3VNUA 1II8A 1A82A 5H8WA 2BDTA 1HYQA 4C0QC 2GEUA 3VFDA 4Q00A 1T5LA 1XJQA 2ZRLA 3FWYA 4TMKA 2XB2A 3HPRA 2IYUA 3Q3JB 3UIEA 3P4XA 4BQSA 5D3MB 1NRJB 1W48A 3I8XA 1GRRA 4LUCA 1LNZA 4LX0A 4OI0A 2IYYA 3C16C 1YR9A 1XCGB 2PCJA 2NO9A 1XXHA 2EVWX 2OFXA 3QF4B 4OI4A 4V03A 2J46A 5AJXA 2D7DA 4Q9JA 3N2EA 4W7SA 1NJGA 1UBGA 3VX4A 1QHYA 3P26A 5L3RA 2IYSA 3C5CA 2JEOA 4WZAE 4A9AA 2ZM5A 1NN0A 1QVAA 4PC6A 4E07A 3PUVA 3EZ9A 1HEIA 4DDWA 4ZI2A 5FBWB 1H8EA 4Q48A 1NBMA 4Q9KA 4Z8XA 1TADA 3GJ7A 3RDPA 1P9WA 5GVSA 4I81A 4DRZA 3AVOA 2C8VA 1SQ5A 2AXNA 2PZFA 2JLQA 4BLTA 4C0BA 4V0KA 2IS1A 1YZNA 3R9WA 4TSFD 1DG3A 2BWJA 1VYTA 3I4LA 1ZIOA 1KI7A 4MA4A 1CJMA 2W6ID 1G64A 3WYGA 2QSZA 1M7BA 3MG9A 3EX7C 3SOPA 2VF8A 4G3XA 4HDOB 3RRNA 3CBQA 3NDPA 5KSPA 4A36A 2PBRA 1DAFA 4R98A 1E1QA 4KYUA 5CDFA 3IPXA 5KU1A 3RRMA 2OLJA 3IIKA 2B6HA 2QT1A 2OEPA 2MMGA 1VG8A 1ZD8A 4CEIA 2C2HA 1S3GA 1N6NA 1P2VA 1CRQA 4QOSA 1UPTA 2QSYA 4Q4HB 2AK2A 4PR0A 3REFA 4EPXA 4HUQB 3ZIAA 4BFSA 2LWIA 4D2IA 3WRXC 4WBSA 1W36C 4UNSA 1TMKA 3U7EB 4F91B 4DJTA 3BXZA 4GBMA 5GADl 5L8VA 2D06A 2QGZA 1MABA 1NY6A 2OE2A 3FHCB 4Y0AA 1GKYA 1U0LA 4EPRA 4A6XA 4KFTA 4Q9LA 4DHEA 3I8SA 4M8NE 2F9MA 2AXPA 2HXYA 3QXSA 2P6RA 3KXLA 1UKYA 5FUXA 2WJHA 2WWYA 2WIAA 3OZXA 3QG5A 2ZJ8A 4S2EA 1W0JA 2W00A 2CVHA 2HYDA 3GLIB 5DSZA 1MOZA 2G77B 4IOJA 4NYJR 4PTLA 1YZGA 4BZPA 2XTZA 1CJKC 4Q1DA 1Q1BA 3IIMA 4L9SA 1G8GA 2QL6A 5FUVA 4BLRA 4L4UA 3OFND 4LJ7A 1G18A 1CR0A 3I32A 3IPYA 4HAWA 5B57C 2Q0HA 1E2EA 3GJXC 1ZUNB 1VIYA 3QIAA 4Q4JA 1G8PA 1OJLA 5ELXA 1RC8A 5DI3A 1VHLA 3U44A 1KAOA 1ZM4A 3AKEA 4IXMA 4MRNA 4C0SA 1EWQA 3SJBA 2ZE6A 1VDZA 3SEAA 1OXXK 2ZS9A 3UMSA 1EFRD 3P32A 2GK6A 4M9QA 3KQKA 3RANA 4RVCA 5AR1A 3W8NA 1KK3A 5K8UA 2F1JA 4HZIA 2ONKA 3L82B 1E98A 4ZV4A 5B64A 1MRSA 5DHFA 1VG9B 1WRBA 4C2TA 2XOKA 4A82A 4LI0A 2QPAA 2QZ4A 2C77A 3BB4A 3HWSA 3RC3A 4KCGA 3PUZA 4KHZA 1IY1A 1IOZA 1IN6A 1AM4D 3ONWA 3FFBA 5K8LA 2IWRA 2V6JA 2FE4A 4KODA 2Z0MA 2H18A 2HDNB 2GNOA 2JIZA 1IHUA 5DLQC 1G6OA 4WXPA 1G3MA 2WV9A 1JI0A 5KDDA 2GJ8A 3UMFA 1V5WA 4TL9A 2OHFA 4KSCA 4DLSA 5KUTA 4NDZA 4OHVA 3W3AA 4F93B 3NTUA 1Z6YA 2OCPA 3K9HA 4FMDB 3RNLA 4IEEA 1DAKA 4A4DA 2ZQ5A 1N0WA 2LCFA 4HYYA 1VTKA 4Z51A 2QMHA 2C9OA 4M9SA 3TGPA 4QNMA 3S1AA 2XX3A 2O8DA 1JR3A 2VSOA 5FTKA 1RIFA 3X1DA 1PVOA 1Q0UA 2B21A 1T0HB 2J5XA 5FUYA 3U61B 5FBQB 2OLKA 1QF9A 2F1IA 2IL1A 5G53C 4QJ4A 2XSZA 4DLRA 3OEED 2O8CA 2O8BA 5DYIA 2XJ9A 3BS4A 2JLVA 4C0JA 2O5VA 1N6RA 1ZNZA 1ZINA 3BWDD 1GITA 2OCBA 4TL8A 4N3NA 4CT4B 3MRSA 2GVZC 1JALA 3ND9A 5DIFA 4PAMA 3WBKA 3EA5A 3CIOA 1R0XA 3KKOA 5EXSA 1UBCA 2ZUCA 2OV2A 3AVXA 2R6FA 4DB2A 521PA 2QE7D 4ACAA 2CCGA 4GZLA 4NPHA 2RGCA 3K70C 1XXHB 2D4HA 2WAYA 4JBWA 2TMKA 4RKEA 4MRRA 4FCVA 2HT1A 3PCRB 1XEWY 1BMFD 4DWJA 3R8CA 1CR4A 1G3UA 2ZE7A 1JJ7A 1ZU5A 4OJKA 3U6KA 3ADDA 1UBEA 1M8PA 3WMEA 3OIVA 3FMFA 3SBEA 1KZGB 2JLZA 5EQTA 2YOFA 2ZI9A 4NCJA 1E2PA 4X8MA 4URUR 4AKEA 2WWFA 1RJ9A 3CF2A 1U99A 4RSGA 5KPDA 3L43A 4EFNA 2VP2A 3A58B 3D8BA 3Q7QA 4TL6A 4BE7B 5BQ5A 1GL9B 4JKIA 1VCNA 3CR8A 5JRJA 2F1RA 5TMPA 1G5TA 3FVQA 5EXTA 2MSDB 4B2PA 1FOEB 1QVRA 5F9FA 2C5LA 4JVLA 1MR3F 4JL6A 4TMZA 3BC1A 4X8OA 3CB4A 4DLUA 4D0LB 8OHMA 4DLZA 2CHGA 2AKYA 4P4SA 2WWGA 4ZDIA 1DARA 4EUNA 5IHPA 4R9UC 1SVWA 3AVVA 3VKGA 1JPNA 4GI7A 4CEIB 3AM1A 4V0LA 2BBOA 2FF7A 3ZGXA 2IEZA 2OBMA 3NG1A 2HXSA 5TB5A 5UKDA 1A2KC 1Q12A 4WXRA 2G9NA 2FA9A 1YVDA 3D3QA 2ZYWX 3KKQA 1TPZA 4OHXA 2FNAA 1MABB 2WWIA 1GTVA 4NL4H 4M9ZA 3W9YA 4C0LA 4O3MA 2ZJBA 4JVMA 4KYIB 1W4AA 4JMPA 4PZZA 2R6GA 3QVUA 4WIAA 2R6AA 2DY1A 1XWIA 1H8ED 4GOJA 3EPLA 2J0UA 3ZLJA 2UZIR 1A7JA 5KDLA 5F3WB 3IHWA 4K81B 4M22A 4DCVA 1KI2A 1IJFA 3KQLA 4B75A 1EGAA 2RB4A 3CONA 2KE5A 1NVXQ 2P65A 3K0CC 5FOVA 5JJIA 1L7VC 2HJGA 3WHKA 2BV3A 4J0QA 4D81A 4OYHA 2WWWA 2CLCX 1J8MF 1D2NA 3FHTA 2GJ9A 3QKTA 3GMTA 2IYXA 3DOFA 4OL0A 1NG1A 2GJKA 4PC7A 3WNBA 1E3MA 4Q1CA 4V0MA 4N1AA 3L0OA 3QXCA 2BCGY 3FKSA 1E1QD 2O0JA 3BGWA 5FL3A 5TXGA 3V00A 1T91A 2FSGA 4A0HA 3QPVA 1HH4A 3CM0A 4Q4JB 2WOOA 4DCUA 5DI3B 3U44B 2OSBA 2JAQA 2FGKA 5KNCA 5HTKA 1YR8A 1FUUA 5B58C 4YC7A 4M2LA 2OUKA 3ETLA 2OO7A 2Q9AA 2YNMA 4LHYA 1ZMXA 1AGRA 1E9EA 3KXIA 4DKXA 4KO8A 2XZLA 3Q8XB 2FEMA 3T1OA 2IX3A 2Z4RA 5FOTA 3IQXA 3TAUA 4CEHA 2ZRDA 3AUXA 1FTNA 4PC3A 2PJRA 4M1OA 3R8FA 3SYLA 3A1WA 1LB1B 2IXGA 2F43A 4MKHA 4QFMA 2OCYC 3B9QA 3G0HA 4G0NA 1Z2AA 1NKTA 2MSCB 2V6IA 2WPDD 2ZJ2A 1ZW6A 4LPSA 1RZ3A 4LJ4A 5JI3E 2R62A 1OPXA 3KB1A 5G41A 1XB2A 1MO6A 2YWFA 3K1JA 1K5GA 2WKPA 2ASEA 3WYFA 4LK2A 3A6PC 1QHGA 3KJEA 1TX4B 3DL0A 1TUIA 4RZXA 1G20E 1KDRA 1GG2A 2Q3HA 2DHRA 1ZCAA 1QG4A 3OIUA 1G8YA 5J4YA 3EPHA 4B35A 4WZ6A 1NIPA 4TSFA 4QBGB 2NTYC 2WIBA
chains in the Genus database with same CATH superfamily
3UY4A 3V8MA 3I62A 2OAQ1 5J2UA 1TQ6A 1ICIA 2BI7A 4FB4A 3FLEA 5CMLA 3PHGA 3AESB 4F6RB 4TYQA 1CE8B 1XKLA 3DKKA 4AJOA 4ECAA 4Z1OA 2HPAA 3GP8A 2WG1A 1ZHOA 1QH1A 4BGEA 1K3TA 1CZNA 3FPAA 3LGXA 2ODNA 2PFGA 2PL3A 2XNDA 1X1AA 4MIOA 4WA7A 5TVKA 3SOZA 3V2UA 5CA0F 1B00A 1CRPA 4D44A 4D9GA 4M89A 5JASA 2QAGC 4QVGA 1BNCA 1IBMB 4P80A 3TLKA 1NPYA 3I9FA 3ZW8A 2Q4EA 1IXZA 4HLUC 5JZVA 1L5WA 1VXOA 4LAFA 5MFPA 1RZRA 4CI0B 4KXUA 5JNSA 1SULA 3O38A 2ATIA 5ENVA 2ENWA 2IA5A 3CEJA 4OQMA 4EGAA 4MS4B 4PQRA 5CNIA 4DAEA 3WNCA 4DG9A 1WUIS 2GBCA 1V4VA 5CFQA 5FI1B 5AVWA 1ADFA 3KLPX 2VWPA 1W36B 3OM8A 3WWDA 5AQEA 1QQ6A 3LIIA 3TW8A 4JEIA 4H1UA 3SD7A 4RO0A 3I6YA 1IM2A 2P6NA 2PEZA 2QRHA 2ZYVX 1QONA 3BXEA 1WU7A 4RIIA 4J9UE 2A6PA 2H0AA 4BNNA 2C59A 2FW7A 4M53A 4EW1A 4PX9A 2I2AA 4JLPA 4REQB 1TK2A 3D2LA 4RHYA 4ZOEA 4YMUA 5A3QA 5K3OA 1Z74A 3PEVA 4KQWA 2O1EA 3AJDA 4LVUA 1OIXA 5DHTA 1QDEA 1KZ6A 1WW3A 3AF3A 3KB2A 2FZ4A 5BYJA 5KB3A 5C1BA 2FX2A 4WKPA 2R86A 4HRYA 4FYMA 1W9HA 1D2EA 1J0EA 1O4VA 1WSDA 1UBLS 4HAZA 4BC1A 2FFAA 1MRZA 2G82A 2X22A 4JCOA 1ZIPA 2OZLA 3DBOB 4ABTA 4TLEA 1RWOA 2GBLC 1KDTA 2LD4A 2PH1A 1BKDR 1HDIA 2QTFA 1PWZA 4NZNA 3H86A 4HB3A 5KSZA 4OGLA 1V2HE 1TQ4A 1V43A 4H7JA 2ZXUA 3LY5A 3ZI7A 3KFXA 1JR3D 1VG1A 4W5OA 3L8DA 4OA5A 4Q5IA 1AF7A 2P2ZA 5EIWA 3CWZA 1N9ZA 1AD2A 3LOUA 3MJTA 2BT4A 1T9GS 4GPEA 2ODAA 5C3UA 1CKEA 4PG5A 1JHAA 1SA0A 2QI9F 2FZKA 4K0RA 3GMDA 3HQ4O 5CH8A 4ZMRA 4MA5A 3MC1A 4NHOA 4JD5A 3DH0A 4HBGA 1R4NA 1ANKA 3PQ5A 3DMDA 5JJLA 4L75A 3GA0A 4UNPA 5BYKA 3F7TA 3U0VA 1ESDA 1CUXA 2ZYUX 1GT6A 4MRMB 5G1PA 3J80A 5BN4A 2YOGA 3ER9A 2NW6A 4UE6A 1X1RA 1DG9A 4YO8A 2QW1A 5ENZA 2R11A 3Q7SA 4II7A 3H4IA 2B35A 4X3CA 1QYCA 3CPJB 3PIRA 4B3DA 1X7HA 3QSGA 4CTOA 1PDOA 1SXJE 3DYIA 4NXMB 3M1AA 4AL4A 4QXAA 4GPTA 2VCEA 1BZYA 4J3JA 1DZ3A 2A5YB 3B8HA 3IURA 4HSEA 3HY4A 1DIAA 2C61A 3LAWA 3BL6A 4HGOA 3MWGA 1GTJ1 2XF8A 1OCEA 4HMPA 3RQSA 1QHEA 4BY9E 2E4XA 4H3SA 1BDHA 4D5EA 1UBFA 1OREA 1QQ5A 1H8HA 2P9JA 1JHPA 1KAEA 1UXKA 3SYKA 1EAYA 2KI5A 3GFFA 3TG2A 2VWQA 1JT9A 2XQIA 3A6KA 1Y9JA 2R7AA 2WSLA 3G8CA 3GDGA 3NIBA 1M1NB 1F8UA 1XNJA 3NB0A 4WNCA 3V2IA 4AYTA 1XRSB 1N6HA 4LSZA 3L7AA 3CO5A 4FCCA 4PQGA 1X7YA 1GNLA 1XRJA 2DJ5A 3BE4A 3GAFA 1T3LA 2VF2A 3HB0A 4FCWA 4UMDA 2C7RA 3V4OA 1OVGA 2GM9A 2VPWA 2GD1O 4F2DA 1FSPA 3SDZA 3WYBA 4NAVA 3F3SA 2I2FA 2E5FA 3LK6A 2Q62A 4KVGA 3QLTA 1H6CA 1RI3A 4KVZA 1E3IA 2V54A 3LHDA 1DC4A 1G5PA 1VPLA 2YWCA 4XGQA 3OZFA 1KU6A 2VH1A 3SZOA 2BF7A 2WU8A 3Q10A 4B87A 4LCBA 2WA1A 4R6XA 1RXEA 1YZQA 4GR5A 3WK4A 3FGOA 4M9RA 2FK7A 3ORHA 3VVLA 4HNSA 4I55A 4DSTA 3B36A 3RAFC 1G9XA 1CSEE 3ZHSA 3TECE 2AUTA 1WMSA 1O58A 2UVPA 2XYVA 5FD8A 4ZV7A 3H1AA 5BUZA 1FU4A 2QAGA 3PC8C 5F3DA 1FJXA 1NI3A 4HLUA 4RX1A 4U7HA 4C2BA 4PZLA 1KMMA 2ZAGA 3IEUA 3UAZA 1YBMA 2V03A 1U2GC 4IDGA 5EZYF 4PC2A 1U2TA 5JXWA 1GPDG 4YRJA 1GPH1 2PT7A 2X3YA 2FZ5A 3IQGX 3W5HA 4CGZA 5I7UA 1YZTA 1KK1A 3BKXA 3OURA 4TN5A 2EX0A 4E88A 4WW0A 3PV0A 2Q6LA 4ZK2A 1TPYA 3KVYA 2WTMA 3IUYA 4WJKB 4P84A 4DQDA 3HA7A 4MX8A 3I9MA 3ZLBA 4C06A 2UUCB 2H4XA 2ZTUA 4RMJA 1I51A 1N2GA 4GM0A 4NESA 4BN4A 2ZW9A 3IOYA 1WMAA 1RWXA 4JT4A 4EKIA 3DKPA 1C4OA 1U7WA 4TTAA 3TUJC 5B4UA 5JPDA 3NWEA 9MHTA 2V7QA 4C5CA 1OH7A 2Q5FA 3THOA 1HZZC 1VLLA 4I6GA 5IW8A 1IQRA 1NVVR 3DR5A 5BSMA 4EDHA 4EIWA 3FDXA 4X3OA 3WGJA 2X0IA 2H00A 2GF0A 3EG5A 4H35A 1X19A 2CVOA 3M6UA 4LBZA 1NJ5A 2A86A 3BB1A 3KALA 5CAEB 4D1YA 2YASA 5B30A 3JQAA 3UKDA 2NTJA 4MZXA 3B2QA 2AFRA 3A7DA 5CK4A 4YY3B 1WY5A 5KYXA 1ZMBA 2H8GA 2P30A 2ZJ7A 4HXGA 2OUIA 1PL7A 4PO3X 4BEVA 4TL7A 2WDZA 1BMQA 1ZM9A 3IQIX 3CISA 3UT6A 1WHSB 3ENQA 4ZAFA 3RVPA 4UNNA 4V2IA 2EQAA 2QN9A 3BA1A 1OT5A 1ZN8A 3C8UA 4M0FA 1UFVA 2I4LA 4BQOA 3QYFA 4M8IA 4C3OB 3D3WB 2ZJYA 3QFTA 1R8SA 2WT8A 2C20A 4IHKA 3EEYA 3K8ZA 1Z0SA 2IUYA 4KUGA 3HZRA 4YN3A 2GZ1A 1KEPA 3MYYA 4I5DA 4H17A 4MUHA 5EXDA 1BX1A 4MSUA 1G3IA 3W34A 3PZBA 1PZMA 3T7SA 1L9XA 4IHQA 5JPIA 5D3KA 4JJGA 4E5MA 4CQLB 2OV3A 3FCYA 5AKEA 3UWOA 5I7FA 1XQXA 2PU5A 1A8QA 1Z82A 4DNPA 2BF4A 2GLUA 3PFHA 4G0YA 1U2PA 3M5DA 2A57A 4Z99A 5EJ8A 4LV5B 5C31A 3WGKA 3K70D 3RSGA 1SFRA 3O31A 1KEKA 4YUVA 3OT1B 5DBIA 2G9ZA 2WUWE 1PUIA 5JVDB 3SR3A 1FBTA 2CW5A 5KYUA 2J7KA 4J7AA 2H3EA 3KKZA 2O1WA 1IIBA 1PSDA 1OD6A 3CHYA 1E4OA 4OJQA 4OY3A 3WX0A 4EKEA 1UDCA 2FPOA 1XALA 3UMMA 4FOPA 3TD9A 5L51A 1NUTA 4NSNA 4BGDA 5BURA 1T0JB 2V4ZA 3DMRA 4P4UA 4EJ2A 4XX0A 4J43A 621PA 1Y1RA 3HCAA 3HEBA 1RRMA 2FPUA 1PK8A 5REQA 2N3ZA 2WJAA 3QW2A 5E2IA 3G5TA 4U2KA 3ULKA 1GWNA 1E5VA 1JQ5A 1KETA 1MTOA 4HG2A 1DG1G 3TR6A 4BUZA 3B12A 3PD0A 5K0BA 3NNDA 5DTMA 5JZOA 2FYTA 4PONA 4YCCA 4MQEA 1EJBA 2QUJA 1PS0A 2ZR7A 4HH0A 4B43A 3WYDA 4BNZA 1HV8A 1UBHS 1WAMA 1KS2A 4X63A 4MK4A 4ATNA 4BX8A 5K8TA 1G8MA 1FTYA 4M0PA 4Q3BA 4WK6A 5BSRA 4MWSA 1OR8A 4L2IB 3NHYA 5HZMA 4XJSA 1QIGA 1TF2A 3AF5A 3OLZA 4W1SA 3SJUA 5JXJA 1JECA 5IUKC 1I8TA 5C52B 5P8WA 2RKBA 3NEYA 4JLWA 5DNWA 1GGFA 1S8FA 3O8BA 4YRTA 3C3AA 2UVQA 5K0SA 1IHYA 1SOAA 5IEBA 1XCOA 4FYIA 2V5AA 2FMKA 3OKFA 3PC8A 4W5JA 4BO2A 3UC5A 1D0IA 3B3AA 1U2GA 3WGUA 4TLCA 1PK9A 4NZYA 1G21B 1SURA 2B0CA 2WUVA 3K9NA 1MQSA 4LNUA 4FSDA 4Y2QA 4XVHA 3SYNA 4AW9A 1PFUA 3RBVA 1PR6A 4MMYB 1JFTA 3SMQA 4A0GA 4BQPA 1JXQA 2VLIA 5HTOA 5TQ0B 3ZD9A 3VHLB 1SXHA 1GT91 1RWBA 1WDWB 2JGNA 2CLIB 4IXWA 4PSCA 4QPZA 2NUAB 4NWIA 4B7CA 4QAQA 2CYCA 1AQUA 2YJZA 2Q2WA 3NIGB 4BJ5A 1YJQA 1HZZA 4FMBB 1ZK3A 1G1MA 1GAXA 3P9ZA 4KH1A 4NECA 5T8KC 2OHIA 2BE7A 2J67A 2YDXA 3EQ6A 1Z0FA 3HWRA 3FVVA 3QLJA 2M6SA 3HYRA 1A9PA 1WZ2A 2IYFA 3TTTA 4ZGBA 1C7ZA 3QZUA 4TT8A 4B81A 3L1HA 1VKNA 3RU3A 1SBIA 3AG6A 5ITSA 4MWDA 3WO0A 5CVCA 3H2IA 1J42A 1UC8A 3NZEA 4ND3A 1DS6A 1V9SA 5A4MS 1XVAA 4R2HA 1Z7YA 3FG9A 3DAPA 4RMHA 4RADA 4GX5A 2D5CA 3ORQA 2HUPA 3SJAA 1PR2A 1R4MA 3DEFA 3ZDCA 1QHSA 2QF7A 4RHTA 3H2SA 4WZBA 3MOIA 2W90A 1M5UA 2OYCA 5LLTA 1JWBB 1ISHA 1T4MA 1TOAA 1LVUA 3DO5A 1GJRA 4V3BA 2JEYA 1G42A 3ASUA 1P74A 4JLNA 4YJ3F 3LC7O 3EXIB 3QJ5A 2EKBA 2WZCA 3R3XA 4D5GA 1ETUA 3G17A 3I6QA 2BUAA 4FJ0A 2Q1XA 4NJEA 5ALOA 4QO7A 5ITZA 3CNLA 3M9WA 3NWJA 4D9FA 5KNDD 2XE6A 3QEMA 3R5HA 1VBMA 4Q4DA 2VH5R 4BP9A 5KYYB 3E8XA 5CFRA 4YPFA 1U3WA 1X1TA 5ICFA 1E3DA 3B1WA 1GUBA 2M32A 3LF1A 4IFEA 3VJMA 4UQPA 1ZFNA 2XUGA 4C07A 3HADA 1NHGA 2BFWA 3OPYI 4PGFA 3LL7A 3K6SA 5LA6A 3KT0A 3DDWA 4PHHA 4B3RB 2Y1FA 1BEEA 2FVXA 1XD9A 3ZDDA 1MC4A 4UULA 3JZMA 1QFYA 1CEQA 2N0SA 1V8DA 5EE1A 5ARDA 4EY3A 1TA9A 1H4VB 5CLHA 7GPBA 4D4GA 2GKSA 1VMAA 1XBTA 4FFMA 4JUFA 4HY3A 3U3DA 4EL0A 4Y2UA 3KYJB 1SC1A 4JJFA 3H84A 4PQEA 4QJ3A 5IJXA 1QH8B 3HCCA 3EARA 3CVYA 4HVAA 4CCSA 5JSHA 1PWXA 2NUPB 5EWLB 4WBNB 4JITA 5H81A 2PH3A 4FIDA 2KW5A 2GARA 2W43A 3CFYA 3F6PA 1L4BA 4G5FA 2FMFA 1KY4A 4J07A 2W2XA 3FR8A 4RV4A 2YIVX 2LR0A 3OF2A 3R5SA 3UPTA 1WF6A 5CM9C 2ZPUA 4R9VA 2BL4A 1RQGA 4MQFB 4EJ0A 1F4PA 1FXWA 2BOVA 1CFJA 3MW8A 3KVVA 1AMUA 3I92A 2CNBA 4W7HA 4CV1A 2YXPX 4JR0A 2YNMC 4JC5A 2HMWA 3LY9A 1AJEA 5CXXA 1NMEA 1NXSA 1V5IA 4JBYA 5F35A 2HJWA 5GVRA 4CIWA 4DWWA 4MS4A 1US8B 2P5TB 3IEPA 3K2QA 2AJCA 3T4UA 4BFWA 2AFHB 3EW7A 2PK3A 4M8KA 5KREA 2CSUA 5JFTA 2CVZA 4RTNA 3CVXA 3IJEB 3K4QA 1G16A 3IH5A 2AUNA 2QORA 3WMXA 2O59A 1WNFA 4DMGA 2R1TB 2R7NA 4BFCA 4WXEA 4HGYA 4UBKA 1U4NA 4QT4A 2BFFB 4QYWA 3M2TA 4L15A 3SBDA 1Q1NA 5BQ3A 3WYNA 3GEPA 1NUAA 2QTNA 2QEQA 3OTGA 4M0EA 3PTAA 2GEJA 3IDZA 4WEOA 2WMDA 1XZBA 2A94A 2FN9A 2YRWA 2YYYA 5A7FA 4MVJH 5LOVA 3AR9A 1JXOA 2GS9A 3RS9A 5HQTA 5AIAA 1F2UB 4E7PA 1N5DA 3GJYA 3WWPA 2CKMA 4LZAA 1J1ZA 4ZVTA 4B71A 3OQVA 4ZOAA 4IIVA 3PNKA 3L0ZA 4KWCA 1NR1A 3B60A 3FPBA 4PZAA 1ZM3A 1Q44A 1SVIA 2OK8A 1UWLA 2BY4A 3LVRE 4OLFA 4CF4A 4LDNA 2VJLA 2GSWA 1K8QA 1UC5B 4EX6A 1C9DB 4P98A 4B2LA 2QMOA 2AJLI 2G40A 1R6DA 2FEKA 2P2LA 1DWOA 2ERCA 2Q07A 3I3SR 5T8KA 2Q1WA 3UK2A 4DSNA 4IUCS 1YA6A 1P5FA 2C88A 3KQSA 3NM4A 2ACVA 1QGZA 2FMXA 2GEVA 5FADA 3VR3A 5EP4A 1EX7A 2I54A 5AYVA 1KSFX 4OREX 2ISQA 5TEVA 5EZ6B 2XNCA 1FY2A 1KVRA 1RLTA 2BYTA 2JAWA 5A05A 2NVUB 1GRVA 4RA6B 2CYBA 3PA6A 2ZRPA 5LQSA 1CY0A 2FW1A 3T4EA 1D2CA 5TJHA 1ZK4A 3TZLA 2DFVA 5JD4A 4FWIB 4WZZA 1E2HA 4G0PA 2XE4A 1K7SN 1P29A 4DDMA 2BP7B 4FVTA 1N1GA 3MRVA 1T0UA 1GYPA 2ID8A 3KKEA 3ZGZA 4Y2RA 2NTEA 2JD2A 1J0XO 3GPLA 4CPDA 2QVCA 4QIHA 1VMIA 2IXDA 5HS6A 1E79D 1NMZA 4Q7MB 2IDMA 4B3JA 2PL9A 3MUFA 4MW4A 3OU2A 3FI9A 4ER3A 2KBFA 4H27A 3WGIA 1HOXA 4JAVC 4D57A 5BORA 5JYDA 3IMCA 3L8EA 4B6QA 3QK7A 5CTJA 2IHUA 1FBNA 1JQJC 1OBVA 1ZI8A 2KB0A 3TI7A 3GWZA 1FDIA 2YFYA 4UFNA 2NU8B 2IV2X 1R0KA 1KP9A 4R0NA 4RWEA 1Q21A 1PFKA 3U3OA 4O4LF 4AWXA 4NMXB 4UKDA 3DSRA 3UK0A 3DA8A 3DEKA 5EHZA 3IP8A 2PBFA 5LQAA 4R81A 5E1DA 1RI5A 1RZUA 3PLRA 5K1ZA 2Y1CA 1IEQA 3LX6A 5G4KA 5K3DA 1OFTA 3UJ6A 3A6JA 4Q3OA 5JDCC 1RHQA 3HRKA 3DBVO 3WJAA 4KHPB 4NG4A 2ZWMA 4AJ9A 3ABIA 4RMGA 1P4GA 5LD2B 3IB6A 1JMVA 4WN9A 3HWWA 1PYDA 1U0HC 4XJXA 3EH1A 4ND6A 2CMGA 4YRGA 1VBNA 3BH6A 3I01A 3N39C 1N6IA 1XVIA 4PYNA 3A3PA 4X8HA 4ZAVA 5FO1A 1U2DC 2OESA 1U6KA 4AP9A 3S7ZA 1GAEO 1XTTA 4CQMD 1ZYUA 4QHTA 1D8TA 3ETDA 4JYPA 1T2FA 1H2RS 4CFYA 2CLLB 1HE2A 2F2TA 1EBBA 1ULUA 3KLNA 4IIJB 3R0JA 1UBMS 4YQFA 3WAGA 1KI1A 2RH4A 2I3ZA 1CUEA 5KJEA 4ETMA 4HDCA 5KJ1A 1VP3A 2WEKA 1S9DA 1W47A 1GUYA 2OGZA 3MERA 4NONA 1FJHA 2J5RA 3GZNA 3I5UA 4DMFA 3ZU5A 4GBJA 2VSYA 3B7GA 2OAP1 1JAHA 3KR2A 3H8VA 3NAZA 4L3WA 4NTZA 2AB0A 2YIDA 3MSXA 2NU7B 1JDNA 1OFVA 4UTVA 2BGIA 1X77A 1PT6A 3UTDA 1J56A 1JG1A 2CXNA 2D2XA 2QJOA 2WJYA 4G5XA 5LMCA 3OQNA 1IZ8A 4PBSA 4D92A 1KJ9A 2PT9A 1IB6A 3Q6MA 1NPTO 1UMDA 1PG0A 2XMPA 2F1OA 2ZPAA 1F20A 2JI6A 3CNOA 4LRXA 4CMKA 4WK0B 1N9GB 3FPSA 1FF9A 2WE8A 3H4MA 3WLAA 3NHFA 1JHUA 1IBCA 3LXXA 3WQRA 5BWMA 4CIYA 3PUIA 4K2HA 1SUBA 3LLMA 3O9MA 3CLUD 4MKIA 2CUZA 2IDJA 2FXIA 3T5TA 2AWOA 5DBOA 3VDRA 4EJSB 5BSGA 4BE9A 3JARA 5DBEX 4MMZB 6GPBA 4ZQIA 5FLEX 3S2GA 3BGSA 3O0TA 4KR9A 2RGBA 4MQMA 1FSSA 1T36B 3VKWA 5H82A 3WLSA 4R5HA 3IMEA 3VU9B 3R7SA 4F96A 4EI8A 4QQNA 5KS2A 1Q15A 1TKRA 2I0FA 4ZT7A 4I6JA 4X90A 1U0JA 4O2RA 1OI7A 2WKWA 1G19A 2CXRA 4U7FA 3OOEA 2A1IA 3PF9A 4I1OA 3VR0A 5I4BA 3RR2A 1M5RA 4JH0A 1P18A 5BUQA 1YAHA 1UCFA 1XLVA 4GP7A 4NE9A 3KUXA 1QIMA 2ZI6A 1VM6A 3T3GA 4ZEWA 3DXYA 4QFMA 4Z9YA 3B6IA 1J33A 5ALZA 1F5NA 2BMJA 3K92A 3NTLA 4FEYA 3SXJA 1KEUA 5LYYA 4OQQA 4W1PA 4D25A 1XZDA 2IOFA 3QUSA 1DEOA 1L4LA 1YK1A 3GN2A 4ARSA 1JA9A 3TQTA 1U8UA 4J3FA 3P2EA 5YASA 5CP8A 2EG9A 3G82C 1IN8A 4XLTA 1QTRA 1W5EA 4PLPA 4A8TA 3DZKA 1HRKA 16PKA 2MMCA 4MPTA 5IVKA 3OZTA 1D1TA 1RRPA 2QTGA 4OU4A 4JOSA 2AOVA 1VHWA 2HN9A 5CFPA 1E92A 2C9DA 1Y4ZA 2FOLA 4G4SP 4M4SA 4PVDA 2WKSA 4WBXC 2EZ9A 2QMZA 3ZY2A 2P9GA 4Q18A 3KEGA 3X2EA 5H80A 3DDUA 2FSHA 2WINI 3SHTA 4A73A 1NVWQ 1PFVA 4PLWA 5IK2D 4MO2A 2X77A 2O0HA 3WIBA 1K66A 5CB4F 1IBRA 1ITZA 2EZUA 4DM4A 3L4JA 3BDIA 3FNEA 1KTIA 1U8ZA 3IQDB 3DZBA 1QRTA 5DRTA 2PRZA 3ZWQA 1BVYF 3NJ4A 2IU6A 4R41A 4O02B 4F84A 2YJGA 4OHMA 5DGXA 1Q84A 3SIRA 1GPMA 3JD2A 1WBDA 3GLGB 1QJCA 1PYGA 3QVLA 5ENDA 3ISJA 5IT9A 1CWUA 1W30A 1FYWA 4QPCA 5JCZA 4ZDJA 3NDRA 3CH4B 3A04A 5KSOA 2V9ZA 1KI8A 4FJ1A 2H51A 4AO8A 2XHZA 5BR7A 4MPRA 4PNHA 4XM1A 2JJ2A 2WJGA 3JZAA 3GFTA 4L16A 4TWZA 1FEZA 3FWHA 2GUWA 821PA 1YZYA 4B84A 5E2AA 1F9AA 4ZO4A 2X4DA 3T4XA 4MEJA 3VVCA 4M87A 1V4BA 1QX3A 2RDMA 2J3QA 2JZCA 3SQXA 2BFDB 1KO7A 3ZV7A 1C3XA 1LK5A 3H04A 4JR1A 5LC1A 4E7OA 4KN9S 3PUWA 1ECCA 4IGFA 2B7BA 4NU5A 1H69A 4X1KA 4CN9A 1IN7A 4W9RA 2WQ6A 4ZKDA 4MCAA 1IBKB 4QUHA 1GSHA 1R4AA 4YRSA 2J0EA 1DAIA 2O2CA 2DBVO 4U6NA 3EDRA 3RU9A 2UUBB 3MS4A 4LHZA 2KJQA 3CRMA 2D3TA 5DIZA 1PJ4A 5U4XA 1UQRA 3DXZA 4BN0A 4NCBA 3AL3A 4EQ6B 4L2IA 3QVXA 3AVYA 1C9JA 4DCOA 1T6YA 2JD0A 2YRFA 4DRYA 5FWYA 1U2DA 3M6XA 1KI4A 4BC0A 2WIFA 4K9PA 3FDZB 3E9EA 4FXPA 2Z2IA 3RGWS 4CF6A 4IIBA 4DJJA 4LZZA 4JXZA 4X7BA 3TS1A 1E0JA 2H7YA 1KDYA 4O4IA 5EXPA 2HLDA 1VHJA 1A95A 4DZZA 5EJEA 2O07A 3HDHA 1SPXA 3A9RA 4M0CA 1OWMA 4IUBS 4ZT6A 5FRDA 1G21E 3EVAA 3T7JA 1FU8A 4E1BA 3WLMA 1VYVA 4LZNA 5K8IA 1UM9B 1PG2A 2O7SA 4MWTA 2BBSA 5E9QA 1PO7A 2V8OA 2ATVA 2DTEA 4RBNA 1KSJA 4X1IB 4ZGWA 4V3CA 4CU2A 5I3CA 4QBHA 4RHUA 2ZKIA 1KF0A 5AHOA 3TTYA 4DM7A 3ZGOA 4RD0A 1TC2A 2DTXA 3SG0A 1ODLA 3E3NA 1Y4AE 1L1RA 1YL7A 1U8YA 2NUAA 3RHFA 4TT3A 3W6ZA 2QMQA 1F8FA 4I8DA 1XF1A 4ETWA 3C3YA 2H2DA 2JCBA 3AGQA 3BM5A 3HP1A 4YTEA 2JFWA 5GIOE 2B4YA 3MJ4A 4Y0NA 3T5DA 4CKYA 4C87A 3UATA 5B55A 3Q41A 1E2LA 1H6DA 1TEXA 5JQWA 4DMMA 2QLTA 4US1R 4ACBA 3S7TA 3KXPA 3VNBA 4DPLA 1PVDA 4FGZA 2JRLA 4DS3A 1EFVB 2RAFA 1DLJA 1UWVA 2ZU0C 3B85A 4JA2A 3H9JA 4PPQA 2DHDA 4UHDA 4UM9D 3T8YA 1V39A 4QATA 3I0NA 2O8FA 1E4EA 2BBTA 1B0AA 1SKYB 3A37A 4PE5B 2AN9A 1M2JA 3PXUA 5DISB 1SKBA 3BMOB 3COPA 4B31A 4KPYA 1G2QA 1RMYA 4KDEA 1AN0A 1CY6A 2FSVA 3AHJA 4M0DA 1GNPA 4G65A 4MLPA 5CH3A 2C57A 1JQAA 4OMUA 1NR7A 3RTDA 5B2FA 3OZEA 1DC7A 5E7MA 1QUFA 2P9QA 4MGZR 1HXHA 4DE5A 2J32A 3IQEA 4GP6A 1J8DA 2H29A 1P7WA 3BMXA 3FUVA 3ZE7A 1OPRA 4X54A 4AECA 4CG2A 1JIXA 1A50B 2BFNA 3EXIA 1YJCA 3JSXA 2WHPB 4HADA 1HYEA 1RTTA 3EIUA 4PSAA 3I2YX 4LGCA 1X42A 3EAQA 1MO3A 2I2XB 2PYZA 1QZZA 4PZDA 2J33A 1SM4A 1NVMB 4Q9HA 3KD2A 2R7LA 4KJZA 4YXWD 1IRXA 1DV1A 2HSJA 2Z8ZA 4HQ6A 1M1XB 4IFTA 4IV0A 2X40A 1XDGA 3STWA 4AJHA 1P39A 5JCOC 3DQPA 2JGDA 4EH1A 4WADA 5KYTA 4L07A 1KJZA 4DR5B 4DYDA 2X0JA 2G04A 1YI0A 2B2NA 4QEKA 3IRUA 4EHFA 3QX9A 4DANA 3MFYA 1YFKA 4GP9A 1FDRA 3HJBA 4KQFA 1XWFA 4WVFA 5HOQA 4FFDA 3D6AA 3G2PA 1YZUA 3QU9A 2OK7A 4G67A 1W2WB 5M04A 2H9YA 3EF1A 3QKUA 3SLRA 4K9NA 3CUYA 4KWTA 4H18A 3LQFA 1Q7CA 1RWWA 2W7TA 3URKA 4D8YA 4RACA 1MDFA 2HWYA 1GCGA 2HNAA 3G2JA 2CJPA 1QG0A 3DEAA 4G1CA 2AQIA 4H3HB 1L8QA 2PKCA 3PDWA 421PA 4QX6A 1CJVC 1DFIA 1N2EA 2TYSB 2Z5GA 3DB2A 3DOHA 4R2XA 5DDIP 4ALIA 2GYVA 4LE1A 2IUSA 2FZEA 5DYTA 4EO7A 1UK7A 5EWLA 3MWEB 3OUUA 1XRQA 1ZN2A 2XOEA 3A6DA 3WTBA 1BH6A 2GWRA 3AFMA 4MEBA 4AQDA 5JAQA 1LX6A 1NI5A 1T6ZA 1U2ZA 3G8DA 3HWX1 4KXQA 1USUA 4II2A 4M7WA 1FMTA 3BFVA 3KOWA 2HF8A 1C41A 3T7EA 3ZH9B 3O4VA 1ZUD1 4NU6A 5IULC 5KQGA 3USZA 3IR6A 1MC5A 2PD3A 2FSFA 2ZIWB 2XTNA 3A6LA 5I9SA 3O8RA 1C9EA 2JFXA 2JRCA 3M82A 3I83A 3CINA 3CCCA 4IUDS 2LZ0A 1BMDA 3UMCA 4L5IA 4GPBA 1IQUA 2V8BA 5EUMA 4CODB 3D4BA 2RH8A 5HX7A 4KE8A 1LLFA 3HUFA 2AFHE 2HQBA 4OI1A 4CM7A 5C8YA 1P0PA 1CB7A 2ESRA 4B5KA 2HSWA 5D6OA 5DO9A 3CF4A 4FGLA 5HIMA 1J1IA 1EUDA 2WY2D 1WY7A 5G40A 2BUCA 2YS7A 4F38A 2IQ5A 2G07A 5LYJA 2BFFA 3AIOA 4DGSA 4ZFNA 4M7PA 4LC9A 1K5HA 1WPGA 3CX3A 2EU8A 2C92A 2F67A 1NHWA 2EIHA 1Q3HA 3G6WA 3PT9A 3BE5A 4FFRA 2J0VA 1MX5A 2PCLA 4FOSA 4KQJA 1CX9B 2VOJA 3GY0A 4LV8B 5JMTA 4D4LA 3TMYA 2P1DA 1W9MA 4A0SA 4TKUB 2DAPA 3GBSA 4LV6A 1XX6A 1R7RA 1XHLA 3OWXA 4AX8A 1RVV1 1MPXA 3F7MA 3MJVA 3GJ4A 5HMLA 5C37A 3ZD6A 4XWAA 1G5FA 1CQJB 1MQ9A 1R5NA 1QE3A 1LWNA 1NVDA 2VHWA 3AHCA 4ID9A 4ITRC 1L8XA 5FXMA 5IH3A 1X2BA 2CHVA 3OESA 3BGDA 4HWOA 3ZEAA 1XN4A 4QO8A 4B33A 1YRQA 3A28A 5JHGB 3OE5A 1XTSA 4JQSA 1V96A 3KLBA 4I50B 5DHAA 3ZWAA 1E2KA 1H3NA 3DNFA 4L0DA 1U3UA 1X1CA 4P3YA 1N2OA 1QPBA 3D4OA 3G89A 2OL4A 4WZAA 2ZCUA 3AM3A 4H7EA 5JH7F 4EMUA 3IHTA 4DN6A 2IEIA 4E3ZA 3NDBB 2IYPA 1G7RA 3V97A 1LTKA 1P80A 2O2XA 1DTWA 1D5WA 2FPSA 1H0SA 3VZBA 4ADSG 4BQEA 3E9NA 1G38A 1YHZA 3UKOA 4I3GA 1PT7A 5FR1A 3I2GA 2R68A 3D6TB 4RA6A 1HNZB 3OTQA 1D1QA 3DLHA 4AICA 4KLRA 1J2EA 4R68A 4B3TB 3M6WA 4G8DA 1B0PA 2E0IA 1BE1A 1JIQA 4E2FA 4J16C 1EDOA 4IV8A 4MIKA 5KWSA 1R6XA 2EHJA 4DLBA 3SN6A 4DEYA 1V11B 4EFDA 3R23A 4M1ZA 1Q14A 2QUKA 1ENZA 4E08A 5KSYA 1LQ2A 2A9VA 1T8YA 2C5EA 3E8SA 4QBKA 5GOTA 1IAQA 3N2LA 1KY5A 2VUSA 3CLRD 3KKNA 4PRLA 4N47A 4BVJA 3OFJA 3ZUGA 2H7XA 5AVTA 1GNTA 1WXWA 1YTLA 2NZWA 3K30A 3QPUA 3QWHA 3TLAA 1W5SA 3A1SA 3B7PA 1OHHD 4X6UA 4YMSA 5JCOA 1QIJA 3WSTA 4NJOA 5BSHA 1HK7A 4YBZA 2DT5A 4RGYA 3RFTA 2YV5A 4PLVA 1GKLA 1IWBB 1R6BX 2HWKA 3H6GA 4V38A 2FJPA 4TGLA 2AR0A 3UFBA 3HCFA 1FIUA 3QX3A 1NDQA 4GX0A 3SMVA 4B3IA 2W4MA 1YRWA 4G1MB 4QOJA 4XXHA 5F2EA 4G5QA 4XVRA 4OXRA 3BXPA 4YASA 3KEOA 4P7JA 3VR4D 4MV0A 5LBUA 3OQOA 3P71T 1ZO8A 1EX1A 2W2OA 5EMLA 3O3CA 1XYYA 5F76A 4LHSA 5IJAA 3TBFA 1NW6A 1F2TA 4UM5A 1JAXA 3IELA 5FWAA 6AT1A 4NFHA 2BC9A 4CQNA 1IH8A 3PFGA 1TCAA 2Q0SA 4QQKA 4I7EA 3EC7A 3E3LA 1CIPA 4KPUA 1R8QA 3HFSA 1CEXA 1S8NA 2C4VA 1K8YB 2ATXA 3R3SA 4FKMA 2QR5A 3WWOA 3TLYA 3IVCA 5AJVB 5KHAA 4HJXA 1E3QA 4HNTA 4FMPA 3D8HA 4G1BA 1WS6A 1K5DA 4MQUA 1WKCA 1ECLA 4P83A 4MWGA 3TSOA 3MBKA 3W2IA 2ZUDA 2PMDA 2C9CA 3FYSA 1Z5UA 1ZZGA 1XF9A 1M6VA 3I04A 3MRXA 3U3KA 8ABPA 4V24A 1XD2A 2QRLA 1CETA 3DVRX 2GXQA 4BFTA 3EGDB 2HFJA 3QQ5A 1X8JA 3HXLA 1LW7A 4R1MA 1AKEA 4DMHA 5KNDH 1K8ZB 2BFBB 3THXB 7MHTA 3QE2A 1R8XA 4X5OA 4ZT4A 3UHOA 4FEGA 4EGFA 2O3UA 4JGGA 5ALXA 4F7WA 3LTEA 4PFKA 3ZDYB 1V25A 1QDLB 1D6JA 3JVVA 1FTWA 4U0KA 4Z0TA 4CL8A 3KKKA 4ZCLA 2XGJA 2CNNA 1NI4A 3KCNA 3DL2A 3FPGA 1TK9A 1UJMA 4ZVOA 4NV3A 3TUZC 2VBCA 1H2YA 2HO5A 2IYWA 1XPJA 3AERB 3ZZMA 4BNVA 2HRZA 4XB2A 3WNZA 3TBHA 3LXRA 4XKJA 1E94E 3UT0A 4Q9DA 2HSGA 1N9GA 1FMLA 4MPDA 4XQ0A 1JBKA 2PL5A 2P6MA 2D3WA 4H15A 1MOQA 1FNMA 1Q3KA 3ME5A 4ILKA 4K46A 3TGWA 4Z3KA 5K8JB 3I9OA 3TKAA 4TYWA 3UFXB 1S4QA 2XNSA 1WUTA 4LKOA 2DR2A 3GGSA 5FNVA 3IQFA 4QRHA 2I8CA 4CI9A 1QJ4A 3LT1A 4Q47A 2GPYA 4WT7A 3VVMA 1AA9A 3HXKA 1LD3A 3QP9A 1NR5A 1WB5A 2HU5A 4FGSA 5E6RA 4CG1A 5B4VA 3GT0A 2NN3C 4XWGA 3F3YA 3WHLA 1SXJD 3DMGA 1GR1A 3T06B 3U1BA 3V8BA 3QYJA 2VDPB 3NUZA 3C43A 2VO1A 4MWEA 3RJZA 1JEYB 2UZ0A 1M1ZA 4GI3A 4NOJA 4MYRA 4PAOA 4EB0A 4FMCB 3F5FA 1SGWA 3KHTA 3C1AA 4JK3A 4QDKA 2XUJA 3OICA 4QVKA 3R09A 4OMDA 5AVXA 5E7IA 1ZMOA 2F00A 2WJ3A 1Q11A 1WHTB 1II9A 4UQLA 4ZCTA 2DB3A 1EP9A 1N77A 4YRPA 1YS2X 2P77A 2HXGA 4S0ZA 3P0HA 1HZJA 5DYYA 1E7WA 1OA0A 2CXSA 3D5TA 1OLOA 3WRVA 3PXXA 4YO7A 5JSUA 2XAUA 4AD8A 4G2NA 4Q3DA 2ETVA 5LB4A 5C80A 4J16A 4Y2HA 1IZ9A 1FRZA 2Y0BA 3OAAD 5BMVF 2HH9A 2SECE 2G63A 2XRMA 1TYAE 1ISFA 1Q3TA 4DV1B 3D6FA 3R20A 4DV5B 3KSDO 5CIQA 2ZI4A 1V0JA 1VSQA 3CRVA 3CVOA 4ZV9A 4IMJB 4L5YA 2ZSBA 1ESNA 3GUVA 4K6OA 2DPHA 4CM9D 1D03A 2PWBA 4COKA 4LWOA 5K7SA 3KFVA 4L08A 3M33A 4JX8A 3FMGA 1H05A 1L4GA 2BMVA 4Q05A 2JI7A 4KI0A 3SS9X 4FB5A 1A9XA 1PNRA 3U3ZA 3GLGE 1R1DA 3COJA 4B7ZA 1RM5A 3O1HB 3PZRA 3VGJA 2OAEA 2UYYA 1JHOA 2ZBRA 3F3MA 4OAOA