1GRQA

Chloramphenicol phosphotransferase in complex with p-amino-chloramphenicol from streptomyces venezuelae
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
178
structure length
178
Chain Sequence
MTTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMPLKMQSAEGGIEFDADGGVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVGDLDVLWVGVRCDGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYDVEVDTTHKESIECAWAIAAHVVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Chloramphenicol Tolerance in Streptomyces Venezuelae by Chloramphenicol Phosphotransferase Activity
pubmed doi rcsb
molecule tags Transferase
molecule keywords CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE
total genus 58
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2001-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07931 CPT Chloramphenicol phosphotransferase-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1grqA00
4X8MA 2J0QA 4MUAA 1Q3HA 2JGNA 3GEIA 2OFOA 2QUZA 4OK5A 5FPKA 3QUSA 2RGCA 3B7GA 2J7PA 1QVRA 4M2LA 1XD2B 3F0TA 3QXHA 3H86A 2FZ4A 4A8JA 1UBCA 5E3HA 2AKYA 1NI3A 4BZXA 4QHTA 1LB1B 1OFHA 2UZ3A 3MRSA 3NVAA 4URUR 3D3QA 1XU4A 4L9WA 1GRNA 1G16A 2C9OA 4C7OB 2ORWA 2ZS7A 1UF9A 4KFTA 3AVOA 1Q0UA 2QY9A 2JIZD 1RJ9A 2R8RA 3NG1A 4BGDA 4XVQA 2A30A 2O8FB 3U3KA 1NN0A 4A1FA 5JCPA 4DDWA 2QP3A 3O8RA 3KJHA 2DWPA 2KSQA 1N3BA 3KQNA 2V7QA 2JEOA 5EP1A 3TVDA 1ZU4A 1NN3A 4Q4LA 1KNQA 3VR1A 1BO6A 2WHXA 4RD3A 1OLOA 4V0ME 1VCIA 3C14C 3L0PA 3U5ZB 2O8DB 2ZETA 3O8DA 1FP6A 2IHBA 3BFVA 4II7A 1DBSA 3GCGA 4S2EA 1N0VC 1R2QA 4M4SA 1FL9A 1E9AA 2K5UA 1M2OB 1E2GA 2ZVPX 3EX7C 4ESVA 4CDGA 4LHYA 2CE2X 4BZPA 1UFQA 2GF0A 5CLLA 5K8UA 4XSHA 4TMXA 5KSZA 3NH6A 2ZR0A 2V54A 2V3CC 2FPMA 1E1QA 5K8TA 1Q1EA 1T91A 4DB2A 1KI7A 2Y8EA 3EG5A 2IYLD 2AD5A 3AKEA 4JLDA 2HJGA 1TQ6A 2ZRKA 1SXJA 1CU1A 4TL9A 5LB4A 2P65A 1YZLA 1GNQA 2ZSBA 3SJBA 3MFYA 3WNBA 1Z83A 3NWJA 4TLAA 2XGJA 1U94A 1TEXA 1HEIA 4ERNA 4G1UC 3BAFA 4LOAA 2KBFA 4FWTA 4BLRA 2DWQA 2W0MA 4TWZA 1ZCBA 1E2MA 2CNWD 3F5FA 3GLHB 3Q7PA 2JA1A 5G41A 2FMXA 1W48A 3U3MA 5KNDA 1SVKA 3ZVLA 3FDIA 4DLTA 5K8IA 1RKBA 1Q3TA 2VH5R 4OI1A 4FXPA 721PA 5F9HA 5DI3B 4G5OA 4RCYA 5JRZA 1OYYA 2OAQ1 1ZINA 2RKOA 1N0WA 1G64A 2IA5A 4QJ5A 4ZIRA 4YMUA 4C9BA 4KO8A 2X1VA 1JB1A 4DLYA 2ZSFA 1E69A 3LLMA 4EPRA 3R9XA 4OKSA 4XTRA 5JSZA 3RYTC 4DEYA 1W5TA 2WWIA 1MT0A 2YV5A 3QI2A 4I81A 2A9KA 1FX0A 3FHOA 4FCWA 3PJRA 4Q9HA 4PR0A 2DY1A 1Z08A 3ZZUA 2JDID 4AG5A 3RWOA 4Q4HB 2YWHA 1G3UA 2FG5A 3PENA 4WBSA 5DI9A 5A5GA 1IAQA 4QFMA 2PEZA 3WHKA 2WIAA 2CJWA 1Z07A 2WKPA 5FUVA 2DFKB 2ZYTX 2XEXA 2VQSA 2P6RA 4NYIQ 5DGXA 4YMVA 3AVWA 3NKVA 1MO3A 4F7WA 1G291 2CDNA 1Z0JA 4HZUB 4PXAA 4M8NE 3H2YA 4NCJA 4ACAA 2J0SA 3Q3JB 2W6JA 3T5GA 1B0UA 3THYB 2C04A 4LPKA 4V02A 3VFDA 1XPOA 5GJCA 2G3YA 3FMIA 3UMFA 1P2VA 4EPWA 1Z6AA 3R7WB 4US2R 1U0LA 2R6GA 3IIMA 3RRYA 1AQUA 3AVVA 1TTTA 4M1KA 1N6KA 5JECA 3IIJA 3BRWD 3CX6A 4DUGD 1W0KA 1E1RD 1SKQA 4A8JC 4ZCLA 2XAUA 3NC0C 4XSGA 3K70B 2B21A 3VNUA 2GEUA 4KITB 3PEUA 2XITA 2BVNA 1S1CA 3RS2A 4IRUB 4HUTA 3KJIA 4JZKA 1NN5A 1F2UB 3MWJA 4LGMA 2GXUA 1ZNZA 3UK6A 3T15A 2XZOA 1JQJC 1UKZA 4F4JA 1V43A 4V0NA 2XSZA 1ZC4A 1OIWA 1ZJ6A 3GQBA 2KE5A 2CVFA 3NEJA 1T4GA 2PBRA 1Z5ZA 2SHKA 3CZQA 4QHSA 3U3RA 1E9BA 3ZQ6A 1XWIA 2QMUA 2R2AA 4M1YA 3CWZA 3DHWC 4P4UA 2P5SA 4LV8B 821PA 1HY3A 2L0XA 3GD7A 3HJNA 3WHLA 2CHVA 4D4JA 3SQWA 1K6MA 1T3SA 2PLRA 4FMBB 4JMPA 3TW4A 4IFEA 4GSYA 5F3WB 1G8PA 4FW9A 2CE7A 4HB2A 1GITA 4ON9A 3KQHA 4MKHA 3ND8A 4LK2A 2GCOB 4RVCA 1BIFA 4QM6A 2ZXUA 5LBIA 2GJKA 4B34A 1XP8A 2JLQA 3H4MA 4LHVA 3L43A 1TQ2A 1ANKA 2WMNB 1SGWA 3QVVA 4FMDF 2BEKA 1OIXA 3OFND 1KK2A 2JJ1D 4KFSA 2FEMA 4QHYA 1XB2A 2J3EA 4KBFA 1LVGA 2CVHA 2QPAA 2WSSD 1VCNA 2A3RA 1T3LA 3SU8A 1NY5A 3ETLA 1DE0A 1UADA 4L15A 1ZAKA 5FBWB 4PPNA 1OIVA 2H57A 3QPVA 4PZLA 4C2TA 2OM2A 2YYZA 4QBIA 4DVGA 2IYYA 3RSLA 4TYYA 2CL7X 1GM5A 3AUYA 4Z1MD 3EPHA 1JEEA 3KDSE 4LBYA 3EPJA 3I61A 2ZE8A 1QHGA 1T8UA 4EUNA 4JBXA 3AKCA 4IDPA 4AI6A 1CRQA 2IYQA 3WP1B 4DEXA 1OH7A 2OUKA 1YHNA 4CVNA 4WA7A 5AUPB 4IDNA 2HDNB 3CNOA 3U2QA 2W0SA 1FPMA 4EDHA 2ANCA 3VX4A 3ZS9A 1E79A 3GFPA 1XTQA 2H17A 2H7VA 3SFZA 3KKNA 1E96A 2OCYC 4W9MC 1U99A 1DAFA 2FGJA 3AQ4A 2B8WA 1Q20A 2N42A 4R98A 4U7DA 1JAHA 2P6UA 2PEYA 4Q5IA 1KMHB 3ZDQA 4B6EA 5BN3A 1OXSC 2F43B 3E70C 1RYFA 2GJ8A 3RS3A 4B3XA 5FBRB 3QBVA 3DOEA 5UKDA 5L3QA 4MGIR 2C98A 2GDJA 4NCHA 1EFUA 5J47A 1HYQA 5FPHA 2RGNC 1KJWA 1KO1A 1E9FA 3FMFA 2VTKA 3SS8A 1M1YE 2CNWA 2JLVA 4FINA 4IHQA 1SXJB 4OHZA 2WICA 2WJVA 5TB5A 3W3AA 3RANA 1G4UR 1XCMA 1N5IA 1Z22A 3BH7A 2QRZA 3A1VA 2CMKA 3OEEA 4HUQA 2EYUA 3T1OA 1KSFX 1NMZA 4BE7B 1S3SA 5B64A 3D6TB 1WCV1 2WPDD 3HPRA 4I1VA 5C4MA 1P72A 4IVPA 1AJEA 1I4TD 1IN5A 1KI8A 1Z2CA 2NO1A 4U02A 4IOMA 3LNCA 5FR2A 1QHSA 1OFIA 1US8B 4F91B 4KYIB 1XJCA 5LD2C 1FMLA 3HR7A 3LW7A 2WJJA 1QHYA 3IGFA 2Z0MA 4V0OA 2A5JA 2GXQA 4RKFA 2V1XA 1K5GA 3IHLA 2A7QA 4NYJR 1EK0A 4GBMA 1AIPA 4W5HA 1N6LA 2BKEA 4KV9A 4LJ7A 4MH0R 3CNNA 3CR7A 4CYMA 4UNNA 1JBKA 3QIAA 2Z83A 2D4HA 1J8MF 1PLLA 3AP3A 2YOGA 4Q1BA 1FQKA 3CZPA 2IYWA 4LWZA 5F98A 4B48A 1U9IA 1G3RA 1MRNA 4M1MA 2WAXA 1T8TA 2PT7A 2F6RA 1Q21A 2WV9A 4LY6A 2IXEA 4LZZA 2NO7A 4N0EA 3CW2A 2X2EA 2QP4A 3W3ZB 4B6FA 3ZD7A 3LXRA 4A0GA 4EFLA 1R5BA 2CJWB 2NTYC 2O5VA 1YRBA 1UBGA 2PMDA 1JALA 4ILEA 4C0KA 4ZPXA 1SVSA 4B2IA 4BFTA 4B44A 1VCOA 2GILA 2GZHA 4D82A 2FPLA 4HZUA 3B8HA 2Q21A 4GFDA 4OL0A 3M1IA 3NH9A 3FGNA 4AKEA 1XNJA 3C8UA 4P4SB 4B3FX 1CJVC 4IVQA 4IXNA 2OFXA 3EIQA 1QHXA 3MSXA 4KVGA 2XJ9A 4M1WA 2CEAA 3EWSA 2O8CB 4LYFA 1UDWA 2YVUA 1E2QA 3CIOA 1U0HC 1NVWQ 1LNZA 1S9HA 4KSBA 5FFMA 3CX8A 3K0FB 1KDTA 4B3GA 2ZRFA 4X8HA 4C0AC 4K46A 5LD2B 5CLQA 2Q6TA 4Q1CA 3W6PA 4K81B 1OKKD 3KXIA 5H68A 1P7CA 4CIDA 1CF4A 2ZI4A 3K9LA 3FPAA 2FPKA 1HE1C 3CLVA 3PXGA 1OSNA 4RD1A 4NYIR 3AF1A 3I4LA 2F1IA 3NDPA 2QP9X 4JJKA 3TSOA 4JYBA 4PAQA 1ZD9A 4YXWD 4C4PA 5DI3A 5JLJA 3TVTA 5KDLA 1EFTA 2BBWA 1L8QA 2QE7D 2VP0A 4TTQA 3UANA 4DSNA 3PEWA 3TGPA 3W5JA 1XX6A 3GEEA 5KU1A 2OSBA 1G5PA 2GAOA 2B7CA 1PLJA 1XFAA 3LBHA 1E79D 2QMEA 2ZQ5A 3L0SA 4HAYA 2CCJA 4JVMA 4XOIA 5AK0A 4KFUA 1F60A 5DISB 3SHFA 3R8CA 1J7KA 1R0WA 1G8GA 2BDTA 4D4KA 1XJ0A 2AFIE 3BGWA 2VP4A 4LV5B 3W6OA 1XRJA 3WY9A 2CK3A 5F9FA 4DCNA 5BN5A 2VP2A 2AL7A 2HLDD 2GCOA 2CL0X 5BQ5A 1ZMXA 1W4AA 1ZYUA 4OBEA 1E2HA 4TQUS 1W0JD 2C77A 4P32A 1XTKA 3A1SA 5FL3A 2AWNA 5KHOC 1G3IA 4D0NA 2WMOB 1ZNWA 2F55A 5AUQA 2O8EA 3NHBA 3C5CA 1YKSA 3CB4A 1LFDB 3M4YA 1QG4A 5JHHB 4US0R 4Y0AA 5KOYA 2GHIA 2JJ1A 2VF8A 3N70A 1Z6YA 3WYAA 4DSOA 2IHYA 2P6NA 3NBXX 3A58B 3BK7A 1NG9A 2ZJ5A 1NBME 4OHVA 1XTJA 1YZKA 1LY1A 4IDHA 3CX7A 4U5XA 3KQKA 5FTJA 1XEWX 4FWIB 2A5YB 5LDDC 4NTZA 3CRQA 4HB4A 3THXA 2ZJ8A 3TUIC 5DIFA 1NIPA 1QHHA 3KFVA 2IUSA 4Z54A 3A4MA 3K0CC 1SVIA 1W49A 5K8LA 4MRVA 2VF7A 4CRWB 3RSOA 1U90A 3GJ0A 2G9NA 4OI4A 5JMTA 1Y3AA 4XJXA 2GK6A 4IOLA 3B13B 3UG7A 3UG6A 1PVOA 4S35A 3KXLA 3G0HA 3PIRA 1U8YA 1COWA 4AKIA 3KKOA 1S2MA 2EYQA 2ZR9A 2HF8A 4GZLA 4HATA 4OI2A 1YE8A 2WSMA 4QRHA 2QQEA 5IK2D 1LV7A 2OCBA 1DAEA 3P4YA 3SNHA 4LPSA 5J4YA 2J45A 1DAIA 2REBA 4CZ2A 4A92A 2RMKA 2ZRBA 1Q12A 4P4TA 2FJUA 2QTHA 2H18A 3WXMA 1KTVA 4KHZA 4GL2A 1X1RA 2GBLC 4CEHA 4KLNA 1E2FA 1MRSA 2PJZA 5G3YA 1OB2A 2D2FA 2V8OA 3KKMA 3VTKA 1PUJA 2BIFA 4JT4A 5FI1B 1US8A 4CEJB 3DM9B 4P0TA 3N2EA 3KKPA 2IF0A 5JEEA 2OESA 3HU1A 2V55B 4R2HA 2DYKA 2JLYA 3DL0A 3VR4A 2AFHE 1YZGA 2KI5A 4NH0A 5EXXA 3OZXA 3GLFA 1GL6A 1NBMA 3SYNA 3NHAA 5HPYB 1A4RA 5EP2A 2WJYA 2BMFA 5F2EA 4IXMA 3X1ZA 3LQRA 3X1DA 4D4MA 1SVOA 2H92A 1IOZA 1FOEB 1L4YA 3BFXA 5GVRA 2FX3A 3T1TA 1CEEA 2P67A 2WOOA 3B1YA 1Y63A 4BLPA 4HAVA 4D80A 1CR2A 2ZI9A 3ASYA 1DELA 2PX3A 2QI9C 1OPXA 2BJVA 2C95A 3DKPA 2NO6A 5AWFC 5IHPA 3LX8A 1AK2A 1OW3B 1E94E 3G5UA 5CITA 5HTKA 4YXWA 1T9HA 3P20A 5EJEA 2R6DA 1MO6A 2F1RA 4OI0A 2XNDD 1W4BA 1SVLA 4AY2A 2GVZC 1Q57A 4MA4A 6Q21A 4BEJA 2N46A 5SZKB 2DB3A 2E1RA 1KK1A 4BUJA 4M9SA 2DR3A 5FBQB 1E9CA 4WIAA 1WRBA 3QEOA 5EXTA 1RYHA 4L5BA 2QGZA 5KPJA 3BE4A 1CR0A 2YWFA 2ZRNA 3B6EA 3BH0A 4OJQA 4Q9LA 3QG1A 4WAUA 1CS4C 3PEYA 3LH5A 1P9RA 1X86B 1GP2A 3OAAA 4A0FA 4B35A 4KFRA 3TSWA 4CEJA 1BYIA 1OJLA 4IW3B 2VA8A 1II0A 1E3MA 2AR7A 1XXHE 4HUQB 4QXAA 3ICEA 3X1YA 1ONBA 3GJ7A 3VNVA 2NPIA 2QNRA 4E22A 2KJQA 2VP9A 1MABA 4Z8YA 4KJZA 1DG3A 3MWKA 4Q00A 2A5GA 4DXAA 1XTRA 1OFUX 5L8VA 1HH4A 4Q9KA 3L0OA 3O8BA 1W0KD 1KK3A 3AF3A 1Z3IX 4NCKA 4JVSB 2X77A 3U60B 3KJEA 2G1JA 2ZU0C 3OEHD 1BOFA 1ZUIA 2D06A 2CBZA 3O8CA 1OXXK 5AJZA 2A5FA 4HSEA 1LS1A 1P2TA 2A78A 2ZJOA 3CBQA 1N0UA 4KCGA 3UPUA 5J40A 1VHTA 1IXZA 2FFBA 1YZTA 3AP1A 4H9GA 4L16A 5CB8A 4RD2A 1X6VA 4MRPA 4M1OA 5AJXA 3FHTA 1E2EA 1OXUA 3C15C 5AR1A 1S9DA 3CO5A 3IQWA 3AVPA 1G19A 2J87A 1NMYA 3LO5A 3NIBA 1FTNA 4QGAA 3BH6A 2W2XA 1XBTA 2H16A 3TQCA 3TBKA 2YWGA 4A2PA 1IN7A 4I99A 1SKYB 4URVR 1JI0A 4TZ0A 1SHKA 2O52A 3LA6A 3IKJA 2O8EB 4B75A 5SZHB 5EZ5A 4AYXA 4DCSA 2RGNA 1YQTA 5IT5A 2HXYA 3BERA 4KYUA 3K8YA 4HB0A 2JASA 2GCPA 4PTLA 4TMWA 3SYKA 4O3MA 4L8GA 1KI6B 5AJVB 1N6NA 1ESMA 1W1WA 4L4UA 3HP1A 2AX4A 3U61B 1BS1A 1IXSB 1BKDR 4JLOA 5JS8A 4BFWA 2AXPA 3UMSA 2LWIA 3UWKA 1ZM3A 4CEIA 1RJ9B 1G8YA 5CIQA 4A9AA 4ZDIA 4JKYA 1SQ5A 4DKXA 2W2VA 2F7SA 3B1XA 4DUGA 1DAMA 1KI4A 3AH8A 2FN4A 3QKUA 4Q4AB 2ZRLA 2WVJA 3DPUA 3DMNA 1NSFA 3SC3A 1O87A 4LRWA 1G7SA 4AD8A 2D7DA 1RE0A 2BV3A 4ESHA 1G6HA 3GJ5A 1DADA 4I1OA 1W0JA 4LHZA 3ZLJA 4EQ6A 2HLDA 4W5WA 1AM4D 2IYRA 3QKTA 1QZXA 3GLHE 4PC1A 2ZRIA 3KJGA 1XD8A 2J9RA 1XEXB 1C1YA 5CM9C 2OHFA 2R44A 4LC1A 1CBUA 2R6FA 5JFGA 1G7CA 4AIIA 5BWMA 5KTYA 4OQNA 2ODEA 2IX3A 3A4NA 4C0LA 4QJ3A 4DLVA 5CIWA 3UKDA 5ELXA 1RRFA 3FB4A 4MRSA 2XOKD 3C41J 1E1RA 5DH9A 3KQUA 2P0EA 1KI3A 2DFLA 2GTPA 1VPLA 2BM1A 1EFRA 1E2IA 2I1VB 3Q8XB 3KUCA 4B74A 5JJLA 4B3BA 1QRAA 4YONB 4LX0A 1S4QA 2J5XA 3PR1A 4LC0A 2OT3B 5CYPA 2WKQA 1CKEA 2GJSA 2B92A 2P2LA 1MO4A 4RSGA 5AJYA 4JLAA 2ZRPA 3TKLA 4PQRA 5E95A 2QEQA 2I1QA 2HYIC 1KKLA 2J7KA 3AVXA 1ZNYA 2ZPTX 3WP0A 5BW8A 1YR9A 1IQPA 2I3BA 4Q4AA 3IEVA 4PSVA 4A4DA 4HYYA 3CF0A 4F4IA 2XOKA 3QPWA 3EZ7A 3JVUA 4OQMA 4A36A 1GKIA 2DHRA 1AGPA 1EWRA 3EXAA 4FMDB 2Q3FA 5KDDA 2HCBA 2OV2A 1M6NA 2GAAA 2YC2C 3MAAC 2XTZA 1U98A 3ADKA 4LI0A 2GNOA 4DCUA 1H8HD 4WXRA 5DNYB 1RPZA 4RCZA 5DN6A 1FZQA 1G21E 4O25A 2V6IA 4V0MA 4MRNA 2JLSA 3BC1A 3X1WA 2KB0A 1KZGB 3CPJB 1Z47A 3OAAD 2QSYA 1KSHA 4OQFA 3QVUA 4B43A 1NY6A 1R0ZA 1CULC 2D7CA 1ZM4A 5CK5A 1WXQA 3T5DA 4KU4A 2MSCB 2NPFA 3ZQJA 2ZU6A 4MYHA 2GXSA 4NHOA 1X8JA 3B60A 1A2BA 1U81A 2IYSA 2VPPA 1W2GA 4FI3C 4NE2A 1II8B 3IILA 1YU9A 2ZRGA 3PVSA 4F38A 4HLCA 3U7GA 3KTAB 1DOAA 1IY0A 2JAQA 1GVNB 1P6XA 3GFTA 1E0KA 3RS0A 4N0DA 1PZNA 2REOA 3QKRA 4OJKA 4Z8XA 5KDOA 2XNDA 3AKDA 3CWQA 2VP6A 2WWGA 2EQBA 5D3QA 5AUNB 4CEHB 5E7MA 1H8HA 3EZ2A 1ELOA 2Z6VA 3W9YA 2ZIAA 1N6HA 1VYUA 1KK0A 2G0NA 4FN5A 4DLWA 1W44A 1GZSA 3AF4A 3BJIC 1GUAA 3KB2A 4E07A 3L8ZA 5DYGA 5FBVB 3TAHA 3GLHA 3I5YA 1JJVA 1AS3A 3B2EA 1E98A 3ND9A 2JATA 1T3HA 4OYHA 1GNPA 4M21A 1KGDA 4Q66C 4YMWA 3TR0A 4R2IA 4DDUA 4BPBA 2ZRHA 1OFTA 1E0AA 4LJAA 1JAIA 1DPFA 2ONJA 4DC9A 1IHUA 4KI0A 1HT2E 5A4JA 2BMJA 1CR4A 3BBPA 3FYHA 3WYFA 2RH5A 1UKVY 3LRPA 2Z4SA 4DLZA 2JCSA 1GRQA 5BYJA 2A2ZA 3VX3A 3DOFA 2ZROA 4BRWA 1FTSA 4ZI2A 2XTNA 2GJAA 4MITA 2GRJA 4W7SA 2ZR7A 3IDQA 1UKYA 1VDZA 3P26A 4AKGA 2OFWA 3I8XA 3B1ZA 3REGA 3CR8A 1KJYA 2ODNA 4XD7D 1NN1A 2J0UB 3HPQA 3BOSA 4ZDKA 1TPZA 2G88A 3AF0A 3ICQB 1KI6A 3LXXA 1JXOA 1COWD 4DLXA 1VHLA 2Z4RA 4MYUA 2GESA 3CRVA 3EA5A 1F3OA 2QA5A 4G01B 3OF5A 3U7EB 5FOSA 1HT1E 3LV8A 2W6IA 2FSIA 1EFHA 5HE8A 1ODFA 1S3GA 1VG8A 1ZM9A 4NZYA 1NVUQ 3I92A 1ZBDA 2X8AA 3PUVA 2ANBA 2UKDA 4C0BA 1YR6A 1Q22A 4MGZR 1H8ED 4E09A 3CONA 2IC5A 3GLGE 4D25A 2N1BA 221PA 2QGNA 4JVLA 3TR5A 3F8TA 2GCNA 4K8OA 2PH1A 4NYMR 4DWJA 1N5KA 2TMKA 1ZC3A 4G0NA 3P32A 4L9SA 3V4FA 2IS6A 1OH8A 2LCFA 2GETA 1P3JA 2ZE5A 3P27A 1TMKA 4UQOA 4IEEA 2J0VA 4EIWA 3SZRA 4EQ6B 2IUTA 3HYTA 2Q9CA 3RC3A 3I8SA 2IS4A 4A0RA 4IOKA 2JJ2A 2NOAA 3M0EA 4F4CA 4RFSA 2YZ2A 3KZ1E 3LBIA 3ZVRA 4BASA 4BLSA 3U6BA 2ZJZA 2W6ID 1R5OA 3TMKA 3VKWA 1ZCAA 2IL1A 4G5GA 5J4VA 3RRNA 2VP5A 4QBGB 4TMKA 5DSZA 5B58C 2VYFA 5TXGA 1Q1QA 1D8TA 1TF2A 1DO2A 2F9LA 2QG6A 3H0KA 2E87A 3IO3A 4DT1A 3K0CA 1BH2A 2NGRA 2GEDA 1LW7A 4IKEA 4JL6A 2CK3D 2PZEA 2BC9A 5TY0A 1XMJA 1ETUA 3QF4A 3CH4B 4Z1MA 4F93B 1Z6XA 4YDSA 1AS0A 2J7PD 3VHLB 1EG7A 3LFUA 4C30A 4QBFA 4PQFA 4B47A 3A1WA 1QHIA 1W4CA 2ZE7A 3AGQA 3ECCA 4RZXA 3GLIB 1F48A 1FMJA 1JR3D 2EFDB 3KTAA 1N2CE 2ERYA 4LJ8A 1E4VA 5L3SB 3B82A 1JEDA 2OILA 4GOKA 2EU8A 4HAZA 4B76A 1YR8A 4AURA 4TSFD 1KO7A 2VRWA 1YJ5A 3ADCA 4Q02A 2QM8A 3Q9LA 1LF0A 1WMSA 2FGKA 3IHWA 4MDEA 5JS7A 2IXGA 3Q72A 4NDZA 3SJZA 3VKGA 1GKYA 2D74A 3LAWA 1NLYA 1Q1BA 2IEYA 5DHFA 1Z8FA 4YMSA 4OHWA 5TDHA 3RDPA 3ADBA 3WBJA 3QSYA 1OT3A 2VSFA 4TTRA 4UNQA 3OESA 3WRYC 4XTCS 4TL6A 2QBYA 1XDBA 3FHCB 3K0AA 3SR0A 2R9VA 1XZQA 5TV2A 1W5SA 1S96A 1M74A 3UMRA 4BECA 2XXAB 2OO7A 4TMVA 1G5TA 3PITA 2EFHB 4Q1DA 5D3MA 2EVWX 3RS5A 4UJ5A 3CF2A 1NRJB 1R8QA 2BBTA 2FOLA 4M9QA 4RD0A 3SYLA 1W46A 3AVQA 3FOZA 3GJ3A 3SDZA 3EC1A 2O0HA 3EARA 4AC9A 1E32A 4UXHA 3G82C 4Y0VA 2OEPA 4TN1A 1KMHA 4YMTA 1D5CA 4HDCA 3AUXA 3DZ8A 1CR1A 3LX5A 1KOFA 1NJFA 4TZ6A 4YDHB 1QG2A 2KBEA 3CPEA 1N6IA 4LYAA 3GLIA 2PZGA 5EXPA 1SHZA 4YC7A 1NLFA 4M22A 1FQJA 3OE7A 3QXXA 3U3OA 5C2JB 3K0EA 4V03A 2PZFA 1R7RA 2ZSEA 4TLBA 4PPQA 3EIEA 1Z6TA 3VMFA 1G3QA 3SQXA 3SHWA 1NLZA 121PA 1G20E 2WM9B 4MKIA 1TL7C 1EWQA 2OBMA 2VSXA 3F3YA 5HZHA 1X8LA 4NBSA 2H5EA 2ZUCA 3RABA 2AHOA 1JR3A 4LBZA 5G40A 1JECA 3W8RA 2CLCX 2V4ZA 1KY3A 3S1AB 4BLTA 1U8AA 2IYZA 2XZLA 1Z28A 1GTVA 4J0QA 2EFEB 2WWHA 2ORVA 1E2PA 1C4OA 2PCLA 4A2WA 2QT0A 1GL9B 4NYJQ 5C4GB 3NBFA 3BFKA 1AQYA 1P4SA 2RHDA 5EXSA 2FWRA 1IJEA 4AKHA 4H1VA 5EE9A 2DCUA 4IDQA 3AV0B 4KBGA 3TRFA 5HKKA 2O8DA 5DLQC 4PANA 3ASZA 4WVFA 4Q7MB 2HXSA 1TX4B 1VG1A 1J2JA 2W00A 4XD7A 1UKEA 4KSCA 3ZVNA 2JJ2D 4WXPA 5FOXA 2XX3A 2PJRA 3W8NA 1VG0B 1DG1G 2YINC 5HCIA 2J59A 5AJWA 2ZRAA 3AVYA 4MQBA 2EFCB 4AYTA 4TL8A 4Q1FA 5FPYA 3LVRE 1W7AA 1YRAA 2O0KA 3ZH9B 2REXB 5E4FA 2AWOA 4LHXA 4XIGS 3SJCA 4F92B 4BFXA 1IJFA 3N2IA 4EKDA 1KI1A 4DT1B 2QMHA 2NZJA 4IVRA 3IIKA 2ZEJA 2X19A 3U4QA 1GKUB 1KNXA 1SXJC 2AKAB 2ZRMA 4PAOA 1II8A 2MMGA 2V9PA 2OG2A 2D3WA 3JVVA 3P4XA 3QE0A 4PHFA 5KSYA 1XCPA 3AVTA 4MKFA 2OE2A 3IBYA 1E0JA 1I2DA 1LS6A 2OLKA 3QEJA 1TAGA 1IY1A 3T12A 1JR6A 4GZMA 3Q7QA 4URYR 4Q7LA 2GJ9A 3S1AA 2W83A 4QOSA 3K9NA 2KWIA 3AF2A 3EW9A 1AKEA 3LY5A 3VHXA 4I4LA 4KAXA 4LJ9A 3IPYA 1UJ2A 4LJYA 3PV0A 1DAHA 4MGKR 2CXXA 4Q9JA 2IS1A 1DO0A 4AWXA 5CB6A 4DLUA 4PSKA 3TW8B 2HT6A 4NU0A 4DBLC 4B2PA 1P2UA 1P61B 3W5IA 1XXHA 2G6BA 4WZAE 2AK2A 4PO8A 4TLEA 2BOVA 4A15A 4Q9IA 4V0LA 1PJRA 2OCAA 2EWWA 4JS0A 1OV4A 5C18A 1KO8A 5JWHA 3TLXA 5HE9A 2QM7A 1A7JA 3OFNA 3WNDA 5BXQC 3FWYA 3BXZA 1SULA 1KZ7B 5FOWA 5JWRA 2CHQA 2IEZA 4JSTA 3EPKA 4WZBE 4DCTA 4URZR 1E2KA 3GPLA 3GJ8A 1J99A 5FPTA 5D3MB 3VR2A 2VEDA 4RY2A 3TIFA 5GJVC 4HB3A 3V4RA 4P4SA 3ZZTA 5L3QB 3HR8A 4JLNA 3KB1A 5B57C 4A2QA 1E9DA 1RC8A 1CJMA 3VR5A 1RRGA 4N3NA 1NG1A 2H1LA 4GRAA 2ZYUX 4PC7A 2R6CA 4YLGA 1CJTC 3PEVA 4JLMA 3I1FA 3BORA 3WRXC 3K0FA 3QENA 4LJ4A 1X1SA 4JIMA 4TMZA 3R7WA 1M34E 4Q03A 5C1BA 1SXJD 1Z0KA 3B1WA 3JZMA 5FUXA 4XVRA 4GPTA 4C7OA 1F2TB 1I4LD 2FH5B 3THWA 3WYGA 5BYKA 3I62A 2PMKA 4OQXA 5DYIA 3B85A 3C4JA 1GFIA 3CRW1 1TF7A 4G5SA 4UNPA 3J81k 2Q9BA 1E2JA 1IBRA 3GLFE 4QGFA 1CJKC 2ZJYA 4O0MA 2C9YA 3EA0A 1F2UA 1ZNXA 4OHXA 2PX0A 3I73A 1CP2A 1G5RA 1W4RA 3UATA 2JLXA 1IM2A 3IPXA 4ZCIA 2IW3A 3PUWA 1A5TA 4BZQA 3U6KA 1Z0IA 1P9NA 2JLRA 1PLKA 1L4UA 1P62B 3HU2A 4RD6A 3EPLA 4JYCA 3LWNA 5JWOA 4C0JA 1GOTA 2JLWA 1YR7A 3QPUA 5FUWA 1H8EA 1P5ZB 1G7RA 4LHWA 4D0LB 1OB5A 3A36A 3QXSA 4DDVA 4Q21A 5BN4A 2GXAA 1GSIA 2ZRCA 2JIZA 1XEWY 4PSAA 3ONWA 1AA9A 1NBMD 2ZSDA 3REFA 4KLZA 4C2UA 4PC2A 3A6PC 1FP7A 3HYRA 4RD4A 1VYVA 4B71A 4BWYA 2RHMA 4LJ5A 2WBLC 1P60A 1U8ZA 5LB2A 2GVDC 3E1SA 4PFSA 1IN6A 1D2EA 1G1MA 2WKRA 3W90A 4POAA 2PL3A 3D8BA 1Z0AA 3TQFA 5FUYA 2IT1A 2B8TA 3SEAA 1OYWA 2IYTA 2OXRA 2ZANA 1J8YF 1EFCA 3T61A 1F2TA 3Q85A 4N1AA 3RS7A 1EXMA 4DJTA 2RGXA 3W6NA 2W6JD 4PHGA 4HAUA 1TUEA 2O8CA 3T34A 2QRNA 4KODA 1WE2A 4TYNA 3THXB 4JT2A 1NP6A 2GZDA 4GP6A 1XD2A 3TE6A 3FMOB 5FPSA 1HURA 3QOFA 1KSGA 4JL5A 1RVDA 1FFHA 4QNRA 2GBLA 4Q4JB 1WP9A 2OBLA 5GVSA 4ZIRB 2HV8A 3EZFA 1ZUNB 1XPRA 5EZ6B 4NYMQ 3MCAA 1E0SA 1T0JB 2F1HA 2ZREA 3FVQA 4EPYA 1KDOA 3TH5A 1P9WA 1KIMA 521PA 1NL3A 4BFVA 4PQYA 1G9XA 1XXHB 2O8BB 2FF7A 4CF7A 2YNMA 4B3DA 1OXTA 5FR1A 2BWJA 1C9KA 4YQFA 4UXJA 3FE2A 2UZIR 3K0AB 5KSPA 3TNFA 1ZM7A 1UM8A 4A6XA 1G8HA 2HT1A 4Q4HA 3ZD6A 4Z51A 4HDQB 5ANRB 1R8SA 3R8FA 1FNMA 1RW4A 4UXIA 4ZO4A 4BFSA 1E2DA 1BMFD 1KDPA 2RGBA 2IS2A 2IWRA 1S1MA 4B73A 3B78A 4XVUA 4B33A 4GT1A 5JZVA 2ZYWX 2DFTA 4B3CA 2A5DA 2YC4C 3GEHA 2EFGA 4US1R 5FOUA 4DSUA 1HUQA 1MO5A 1T6NA 3A1TA 5H70A 1Q44A 4JKIA 4EAQA 4ZKDA 3R20A 5FTLA 3OHMA 3GJXC 4M1SA 3TUZC 5L3RA 3THYA 1M8PA 1MOZA 2C2HA 2V1UA 5G53C 2IXFA 3B9QA 5GJWC 1UEJA 1TUIA 2YWEA 2HF9A 1XMVA 2XNSA 4URXR 3K1JA 1E2NA 1DTSA 1HE8B 5IDVA 1TEVA 1OH6A 2QMOA 2QT1A 1UBEA 2JJ8A 2ZS8A 4DSTA 3TK1A 2WWXA 4TLCA 4PZZA 4Q1AA 2CLDX 3U3JA 4CW7A 2ZRDA 3NBZC 3THWB 3VU9A 1E6CA 5EUQB 1GIAA 3A8TA 4HAWA 4HDOB 1BYUA 5IRCD 2R6AA 2P5TB 1H65A 1P2SA 3A37A 4M9XA 5HCNA 3RC8A 621PA 1EESA 2R62A 4E5UA 2O8BA 4O2LA 1GILA 4TQAA 4AK9A 4KXFB 4HLUA 2PLFA 3K0SA 5FTMA 2GEVA 4MYTA 2XB2A 2IYXA 1XMIA 3LVQE 5JI2E 1DVRA 3EC2A 3ZIAD 4PPGA 2BMDA 3ZJYA 4KVAA 2ATVA 5KUTA 2F1JA 5EE3A 2GZAA 2VBCA 4IJMA 3VR6A 1KSJA 1N6RA 3OEHA 4EPVA 4Q19A 5EP3A 1DAKA 3EZ6A 2B6HA 1FX0B 4FD2A 1WBBA 5JI3E 2F43A 2C96A 3L8YA 1YZUA 4A82A 3EIHA 4MUBA 2IYUA 3ZVMA 3GP8A 1QF9A 1WQ1R 4Q7KA 4PX9A 1G6OA 1GAJA 3DZDA 3KL4A 4NL4H 1N5JA 1G41A 3T1VA 4JJZA 2ZI5A 5SZIA 3CRMA 2VHCA 1G7TA 3UXMA 4UNRA 1KDRA 1VG9B 1XPUA 4M1TA 1T5LA 1R5NA 3EAQA 4LUCA 3LQQA 1KJZA 1NKTA 1OXVA 4C0HA 4M0LA 2NQ2C 1E2LA 1MR3F 3BWDD 3PUXA 4P33A 4Q01A 3OIWA 2NO0A 2JDIA 3C16C 4PO9A 1AN0A 3KFXA 4D4LA 4D6PA 1RZ3A 5CJ2A 4UJ3A 3SBDA 1UBFA 2ZM5A 3VU9B 3SBEA 3RLFA 3MMPA 1W2HA 1ZD8A 4EJSA 1RRPA 3EZ9A 4U00A 3MWLA 2FEOA 3Q5DA 2RCNA 4V0KA 5EE5B 3CH5A 4HEJA 2QAGB 1G8FA 3MJHA 2VHJA 4PHTA 4QG7A 2F9MA 3DM5A 5CK4A 3EASA 3AM1A 3AP2A 4LYJA 8OHMA 1EGAA 4BEBA 2YOHA 2V7QD 3K9GA 2NIPA 4HLUC 2CHGA 5HR5A 2BEJA 3FFBA 3HDTA 1I4DD 4A0HA 4EPXA 3WBKA 3PQCA 1OHHA 5EQTA 3WNCA 4JLVA 1J90A 1EFRD 5TVKA 2BKUA 3VQTA 1F5NA 2NG1A 4DRZA 3JZAA 4TT3A 3PCRB 1SZPA 3H1TA 4R9UC 1JPNA 1TADA 3EWAA 3CKLA 3K70C 4MGYR 1W47A 2ASEA 4Q47A 4RKEA 4TMTA 3SN6A 4ZDJA 1PUIA 2PT5A 3U44A 5CJPA 3PUZA 3B1VA 1VTKA 3I32A 1UAAA 1SXJE 4R71A 1R10A 2B7BA 2WSSA 4E03A 2FZLA 3Q5EA 3IO5A 1GNRA 2FNAA 3OEED 3GFOA 4QJ4A 1II9A 4GMDA 3OIVA 2QROA 4DB4A 3QJYA 1TQDA 3I5XA 3V9PA 5G3ZA 2BHRA 4PC6A 4EJSB 3QBTA 1JXMA 2WJHA 4JSYA 4QBHA 4PZYA 3K9HA 2XZPA 2CCGA 2ZTSA 2J41A 3NTUA 1O3YA 4QM7A 1ZW6A 4GDFA 2FFAA 1QBKC 3VR3A 1GRRA 5FTKA 2BBSA 3UWOA 1W36D 3NDBB 2FU5C 3SI7A 1MABB 3C7KA 3R9IA 4HLQB 3BB3A 2ZSAA 3ADDA 2RB4A 4NCNA 3QQ5A 3WMEA 2PCJA 2VHUA 1BMFA 3O47A 4AYWA 5DN6D 5JJIA 2WOJA 2FFQA 2QSZA 3WMGA 2MMCA 1XEXA 1WB9A 3OIUA 3DMDA 3D7MA 2QE7A 1G4AE 4ACBA 5HKKD 4Q7JB 3MJRA 1ZP6A 2Z5FA 3CM0A 3H84A 3MLEA 5B30A 2IK8A 2OCPA 2QAJA 2QORA 3CRRA 4TYQA 1ZVQA 2ECKA 5L3VA 3OIYA 1TQ4A 4ZDWA 5TARA 2QTFA 1A2KC 3QKSA 4PPFA 1CLUA 2XSZD 1XCGB 4I1SA 1E9RA 4BFZA 2ORIA 1AKYA 4LJ6A 1KO4A 1Z63A 4BFYA 1KYIA 3KX2A 2IUUA 2FFHA 3CF6R 2F3TA 3KUDA 4M53A 4BQSA 1HQYE 1VIAA 1Z06A 3QNUA 4TQ9A 3DO6A 1IXRC 3T35A 1JJ7A 2HEIA 3QKRB 2QN6A 4G3XA 2W2TA 1NNEA 2VSOA 4GOXA 2IWHA 2RGEA 4EJSC 1NF3A 5FH9A 1NVVR 1E99A 1NSTA 1U2RA 2QENA 2BBOA 3WMFA 1AZSC 1JNYA 3BB1A 1B23P 2FSGA 2G83A 3L2OB 5CDFA 2MSEB 5A0FA 1FUUA 4PAMA 2G77B 4OK6A 3CPHA 1N6OA 2WWYA 4QC2A 5E7JA 5FOVA 4IOJA 4JL8A 4QKQA 5FTNA 3K09A 5C46F 3RWMB 1RIFA 2FSFA 4Q4JA 5KO2A 1VIYA 5AUOB 4JLBA 1SVWA 2ZAOA 4LYHA 1FNNA 3SFVA 3B5JA 3X1XA 1OH5A 2H8KA 2XTMA 4H1UA 4RFVA 4IEIA 1R6BX 4G5QA 3LDAA 3QY0A 1NJGA 4TYPA 4LBWA 2OAP1 1G17A 4TT3D 4QGHA 2DPXA 1Z0FA 5IK2A 1P73A 3RVBA 3SE0A 4O2RA 2BMEA 4XWAA 2OZEA 3MG9A 4ZV4A 2WTUA 1VYTA 5KNCA 2LKDA 3NBYC 3VKHA 1JPJA 2J46A 4ZI3A 2DFNA 2NO9A 2RGDA 4QGGA 3MGCA 5JBQA 3LW8A 2O0JA 1A82A 1QHNA 2JLZA 1CIPA 1KY2A 2FDCA 2YJTD 2J1LA 2IF2A 4I1UA 3TSZA 1DARA 4GI7A 1ZM2A 4EPTA 2UVQA 3THOA 2YKGA 2YHSA 5IF9A 4G5RA 1D9ZA 1VMAA 3LLUA 5FOTA 1XJQA 1TNDA 1Q1ZA 2JLUA 4PC3A 1WF3A 2QAGA 2FSHA 2ODWA 2CLSA 4BLOA 1CJUC 4WOPA 1W36C 2WWFA 1SVMA 5FL7A 3GLFB 1XF9A 4DLSA 4FCTA 1CRPA 3E2IA 4M9ZA 2Q0HA 1NKSA 4C0SA 2QAGC 4C3ZA 2VL7A 1XEFA 2XXAA 1R0XA 2QPOA 2ZITA 2ATXA 3HU3A 3ZIAA 1KI2A 3RNLA 4FCVA 3KQLA 4XWKA 1F6BA 2GKSA 5KNBA 1E9SA 5KYKA 3AVUA 2EWVA 1IN8A 4DHEA 5TMPA 3W34A 4RZ3A 2C78A 1ZU5A 4DIEA 4GMXA 4RZ2A 1D2MA 1NIJA 4ARZA 5FI0B 4RFSB 2OLJA 4QNMA 4Q1EA 2J0UA 5DO9A 4TYWA 4NKRA 2P3SA 1N25A 2ZI6A 1L2TA 3V00A 2C03A 4DDTA 5EE0A 4D81A 1YZNA 2YOFA 2VHTA 2BCGY 1YZQA 2CCKA 4PHHA 1JQLB 3K70D 1LF5A 2ZI7A 1TU4A 5FL7D 1FW6A 4HI0E 5HZKA 3BIFA 4GOJA 2MSDB 1SKYE 1HV8A 3RS4A 4JVNA 2ZE6A 1JR3E 2OXCA 1TF5A 2DWOA 2QPTA 3IQXA 3QXJA 1LTQA 3NC1C 4LBVA 4URWR 1NVXQ 2Q3MA 2XJ4A 5E7IA 3FKQA 3GMTA 3FKSA 2WPDA 2QZ4A 1X8KA 2V6JA 4GP7A 4JBYA 1E9EA 5DE3A 2D62A 2XB4A 3A1UA 1IONA 3E5HA 1E1QD 2IYVA 1D9XA 2VIIA 3AKYA 1OF1A 4DCVA 4R7ZA 1WA5A 4CT5A 5J4HA 1ZD1A 2F3RA 1S0UA 4QL3A 3T06B 3MD0A 5GJBA 4JLKA 3DDCA 4DZZA 1CXZA 1T0HB 1T5IA 5JJKA 3BB4A 4TL7A 1M7HA 2Q9AA 3K53A 2QU8A 1UDXA 2C8VA 4B32A 2NMVA 2FV8A 1G3MA 1GDDA 1QHHB 1GL7A 4TSFA 1MV5A 2AK3A 4MYCA 3HWSA 5EE1A 4EFNA 3CUEF 4NPHA 2BM0A 4BRUA 2QBYB 4MDFA 3NXSA 2WIBA 1XMSA 2VLIA 3VAAA 2OBNA 5JHGB 1VECA 4DIDA 1OKKA 2CL6X 2ZUDA 2WWWA 2GA8A 1J70A 1NMXA 3NEYA 3RAPR 3ZS8A 3MUFA 1EX7A 2R65A 3SOPA 1K8RA 1RRCA 1KHTA 1ZIOA 4MRRA 1YVDA 2HCJB 5JCZA 4ZCMA 4IDOA 4AG6A 3IUYA 4OK3A 2ODBA 1Z6GA 2AD1A 1N6PA 1UEIA 3GJ4A 3U44B 5L3SA 3FTQA 2AXNA 1R4AA 5DHAA 4WZ6A 1OHHD 3MWYW 2WZQA 1ZUHA 1ESNA 2RGAA 1HQCA 1P75A 4LSGA 4XH9B 2VO1A 4D0GA 1Z0DA 1XD9A 4JLJA 4LCBA 1AZTA 4ZKEA 2WAYA 4IFBA 3L0IB 2NZ8A 2HUPA 4ABYA 2AN9A 2ZRJA 4X8OA 1ZRHA 1NVVQ 4CT4B 3M6AA 4NMMA 2RGGA 2ZS9A 2HYDA 1VKJA 2O8FA 1E4YA 3IEUA 1KAOA 4UKDA 2EW1A 3D31A 2BCJQ 3BD9A 5EP4A 3TAUA 2Q3HA 4CEIB 5M04A 1M7BA 1WDTA 4TTPA 1AS2A 2FE4A 2G0TA 2GK7A 4DLRA 1Z2AA 2ZJAA 1CTQA 4MKGA 3AGPA 1MH1A 1IY2A 3TUJC 4NP6A 1QVAA 4HLDA 2IBMA 4OQLA 3U7FB 2DBYA 1VCMA 2QL6A 2I4IA 3IBGA 3LD9A 3DVLA 1DS6A 2LKCA 4RZUA 2GF9A 4EFMA 3KXKA 2X2FA 2ZYVX 3T1QA 2ERXA 1KI9A 4OHYA 5FBLB 5J5CA 3A4LA 3PUYA 2ZAMA 1XTIA 3FFAA 1KO5A 2QQ0A 1GWNA 4Q18A 1XZPA 1TU3A 4WW0A 4C0QC 1R0YA 4ARZB 5LPNA 5EUMA 4FMCF 4GNKA 2W58A 1FUKA 1XTSA 2C9CA 4D26A 3DEFA 3K09C 5KSOA 5KPDA 3R9WA 3GLGA 3X2SA 4RJLA 3QKSB 2BJWA 4LDJA 1X3SA 2ZI3A 3QF4B 4NCIA 3QF7A 1D2NA 4ITRC 3C5HA 3QXCA 3U4QB 2ZVQX 1RFLA 3ZYCA 3PG5A 3B9PA 3SJAA 1G18A 3P1JA 4NONA 2ONKA 1UPTA 1K5DA 2VHQA 4FMCB 5B2ZA 3LBNA 3RHFA 4X8LA 1KKMA 2C5LA 3BS4A 5CYOA 4TLDA 4BFUA 1L7VC 1MKYA 4FIDA 4A8JB 4BLQA 1WBDA 3QG5A 1IN4A 4B2LA 2E9SA 1HTWA 4ASUD 5SZJA 1I2MA 3UIEA 1PV4A 1KMQA 3ZGXA 1V5WA 1GG2A 2RAPA 2WJIA 1AGRA 3I3SR 4PO1A 5JEDA 5JSZB 1HA3A 3AEZA 2FA9A 1A1VA 4ASUA 1U9IC 3N5CA 4HAXA 3CNLA 4LV6A 3GLIE 2G1KA 3ZZ0A 4A6PA 3FMPB 1QDEA 2ZJBA 3DKVA 1ZIPA 4P31A 5CM8B 4JLPA 2QTVB 2HJVA 2ZJ2A 4P3YA 3RRMA 5CDFE 2GWHA 1OE0A 5GADl 4CGZA 2C99A 5P21A 5H8WA 3I72A 1M7GA 2D2EA 1W36B 421PA 1DEKA 3OE7D 3L82B 4Q48A 1D6JA 4W5JA 3GLGB 1EX6A 1U0JA 3PFIA 4UNSA 1KAGA 3RRZA 5J4LA 3U7HB 2Z43A 3GJ6A 1N5LA 4HZIA 1S8FA 4JBWA 1DAGA 5H1YA 2ZUBA 5J4KA 4D2IA 5JRJA 1Z29A 3FKSD 3TJZA 3KKQA 3AB3A 4XWOA 2WJGA
chains in the Genus database with same CATH superfamily
1Z82A 2VXOA 4X8MA 5EUCA 3EGCA 1DC7A 2GCGA 2P6MA 3NVDA 3TTTA 1Q3HA 3G23A 5KTNA 2HFJA 1NV8A 2B78A 3Q4GA 1D1QA 3HXMA 1NI4B 1QVRA 2HO5A 3F0TA 3LQFA 3LSTA 4I4CA 1OV6A 2C7VA 1XAGA 4HCJA 1NI3A 1Q7BA 5F2NA 3JXEA 4K6OA 4FGWA 1XZ8A 3KK0A 2VQ6A 2Q8QA 1JHXA 1XU4A 2QX9A 4YLEA 1XZNA 1ISMA 1GRNA 2C9OA 3RFVA 3E53A 4CIBA 3UXHA 2VJPA 1H93A 4U6QA 5M29A 4QUGA 1BU5A 1QYDA 2ZBUA 3NXKA 4GVPA 2QY9A 5E6RA 2JIZD 1RJ9A 5K7SA 3IEXA 3PJEA 4ENRA 5BRJA 3GNLA 1KEEA 1IBKB 2QRUA 4F2GA 2D13A 4HVCA 5M3BA 1J1ZA 3EA4A 2BEVA 3GR6A 3G68A 4RVNA 4DDWA 3IMEA 5AKYA 2NZYA 2V59A 2R47A 1HOTA 1N3BA 1V11A 1EVQA 1YOBA 1XKXA 3H1PA 4EVSA 3TO5A 5LKAA 2A9VA 1ZAYA 1ICIA 1RSZA 1RLTA 1DZ3A 3UMBA 4BKMA 2WF8A 2UYHA 3OKAA 1LTHR 1O97D 4A1OA 1OLOA 1XGKA 4KRGA 3FY4A 1N2SA 1LLFA 3KSMA 3KZXA 1H2FA 3TS1A 2O8DB 1L4KA 1E58A 1FP6A 1NLMA 1SHTX 3ORHA 3GCGA 2R68A 4S2EA 5CEJA 1QFZA 1N0VC 3L4JA 1I1HA 2PXXA 1WPGA 2EZ8A 5TLSA 4LHYA 4C4ZA 2CE2X 1RLUA 2W8BA 3HR4A 4IQFA 3UMCA 4BZPA 5KSZA 1YL7A 5ED4A 1O95D 1K68A 3LVBA 1O54A 2NLOA 1V8FA 1YRYE 4ZO7A 1Q1EA 1T91A 4YAEA 5GV7A 2H3EA 2IYLD 5JNSA 3AKEA 2ZRKA 5DGHA 1M5UA 1CU1A 3KUUA 5EG5A 4QRIA 4G1VA 3CUSA 3HADA 2QG4A 4RFLA 4FDTA 2QTCA 2ZSBA 3LK7A 1Z83A 4TLAA 1U94A 1TEXA 1X7GA 3G8AA 3MPUA 2OCKA 3OWHA 4BLRA 4X45A 2DWQA 3FB1A 5E0KB 4BV2A 1E2MA 3IV6A 3F5FA 2VH2A 2JA1A 1I10A 5KNDA 3HNPA 1SVKA 1GN9A 2HNAA 3J7TA 3L7IA 3WQBA 3FDIA 3UPDA 1GTL1 3N58A 3NTOA 5ICMA 2JVIA 4QULA 4I1YA 3GMSA 1OI4A 4TGLA 1RKBA 4UCWA 1XVTA 3WSTA 2VH5R 1TDJA 1ENOA 3EYWA 3G89A 3ILXA 4JI3B 1DHTA 2MJLA 4ZO8A 3VPCA 4E5DA 721PA 5DI3B 4GKVA 3GF4A 5K0NA 3EIFA 1V6CA 1TYZA 2VJNA 1QGED 3KQUA 1OYYA 3H5RA 2OAQ1 3QPBA 4TVOA 1N0WA 2WQZA 1ENYA 4HOYA 4QELA 4RAOA 4QJ5A 2F8LA 1AMNA 4YMUA 5CVTA 3ZGZA 2G4VA 3UF0A 1E69A 1Z45A 3FIJA 4ER5A 3RYTC 2ZIUB 4BLWA 1CQPA 4CMEA 3B5EA 1VPEA 1QHFA 3EIWA 3QI2A 4I81A 4K9PA 3IQZA 1Z5UA 3E0QA 3G88A 1J0XO 1FX0A 4PYNA 3Q8MA 4F6CA 3PJRA 3N8KA 4LSMA 4Q9HA 2FRXA 3FJ1A 1USGA 5I9LA 4Z4EA 3A2KA 1T2EA 5LXTF 4V2IA 5B4VA 4BNDB 4AG5A 4LMPA 5BMOA 5A5GA 3PENA 5HILA 1IAQA 4QFMA 3U7QB 2K4MA 1Y3CE 4KWIA 5FUVA 1L5ZA 4TVSA 2PUDA 1RTKA 4TWIA 1L7BA 2PMWB 1TTPB 3IESA 5FA8A 4RKRA 3I76A 2BT4A 4U0KA 4F7WA 2IPXA 5C8YB 3N59A 4QIHA 4CKXA 4KNWA 4KEAA 2VWPA 4C3OB 4M8NE 1O5OA 3V1NA 3G6WA 3IUSA 1L5SA 2V7GA 4NMXB 4R40A 3UJ3X 3NV7A 4LMRA 4ACAA 2HR1A 2J0SA 1S2OA 5JROA 4MI1A 4G0ZA 3T5GA 5KYGA 3DTNA 3KQYA 4KHPB 2I99A 2G3YA 4I4TA 4MQEB 1P2VA 4EFKA 1Z6AA 4F85A 2PRYA 4MI6A 1MW8X 4FHDA 1AQUA 2C2MA 4ZT5A 2R00A 5ALSA 3IIJA 4RHEA 5ESXA 2D5BA 2W6CX 3ADOA 1RT9A 4AT1A 3WV4A 2LXNA 1NOJA 1SKQA 2XNJA 2Y77A 3SKYA 3UAYA 4XSGA 2Q4OA 3RB8A 2J9YB 4LOIA 3QLUA 2WE8A 1A8HA 1UIRA 1HYBA 1VJ5A 1F51E 3CLRC 3OWOA 4HYTA 2BVNA 1S1CA 3RS2A 3PA6A 1JHQA 4MHOA 4ZAYA 4EECA 4JZKA 1KQNA 3UK6A 3T15A 2XZOA 1PYDA 3CVVA 2DLDA 1JQ5A 4Q3KA 2D1RA 2IEIA 4FMPA 4H18A 3Q3HA 1WXGA 3OH8A 1XP5A 1REQB 2QRLA 1OIWA 4BQRA 2KX7A 5EIBC 5LXTA 3ZWNA 1WCXA 2HMAA 1S2LA 4MR7A 3ZXIA 4WN3A 2PBRA 1Z5ZA 3QX3A 7ADHA 1F4LA 2ZTLA 1J23A 4BMXA 3U3RA 1E9BA 5A4FS 4CIXA 1XWIA 4OTZA 3TMAA 3BQ9A 4M8IA 5FI3A 4HN4B 4M1YA 3DHWC 4P4UA 4PW0A 4EW3A 3HI4A 4P0PB 821PA 1CUUA 1GPUA 4JUCA 5KQSA 3PHLA 1HX7A 1FSPA 3HJNA 3W1VA 2MYTA 3F5DA 1VFPA 3ZDBA 4D4JA 3SQWA 1EHIA 3NHYA 1LK7A 1LBSA 3FZNA 4GSYA 4IFEA 1LJUA 4ZK6A 5BR8B 1F2VA 1N92A 2Q99A 1G8PA 4FW9A 2CE7A 1BEUB 2QVZX 5KVCA 4GYKA 4MKHA 1P7WA 4RPLA 1PFUA 1XN4A 4Z0HO 3NIFB 3LCVB 4INAA 5JJ5A 3VR6D 1SXGA 5A0TA 4KMOA 4B34A 2HTFA 4GICA 3KYBA 1J0AA 3HN7A 2NYUA 1IAVA 1ND5A 1SGWA 2VJLA 1ZOPA 3MMNA 1TVKB 3OFND 1OIXA 3QVWA 4U9HS 1KK2A 3M4JA 5IN5A 3SSOA 3DAGA 4KFSA 3STYA 1A1SA 5F7JA 4CFSA 1TAHA 2GO7A 4M0EA 1XB2A 5BUSA 4KBFA 1LVGA 2QLFA 5T64A 3RSSA 1VJDA 1BW9A 4HN9A 2IE0A 4IDEA 3WFIA 4G0MA 2WAOA 1NY5A 1GYRA 5AVYA 1DE0A 4L15A 5FF9A 2H7YA 1MG5A 2TRSB 2VCEA 4PPNA 4PXYA 2H57A 1UAYA 2Y1XA 4FEYA 4J29A 2OM2A 3P9XA 4TYYA 3RSLA 1GM5A 4WN9A 3AUYA 2FSSA 5AW5A 1Y9JA 5FUMA 4LECA 1UP6A 1TEZA 1JEEA 3KDSE 5A2GA 2F67A 3R3UA 1CY7A 2ZE8A 4WUVA 1MU0A 1ZDMA 3AKCA 4FVTA 4AKSA 1AHPA 4KSYA 4U9UA 4X41A 1HNNA 4YPVA 3WP1B 4P0QB 3HZHA 2WNIA 1G8SA 3QU9A 2BSXA 4WA7A 1MOSA 2FPPB 1SK8A 3R7DA 2W43A 2PV7A 4IDNA 1UZAA 3CNOA 3GLTA 3RO7A 2FW1A 3H3JA 5ELLA 1NVKA 3U3ZA 3UJ7A 5CDGA 1NNI1 2B4YA 3G2HA 1E79A 3GFPA 1I2AA 4GHWA 2WIJA 3CZCA 3OZVA 4JZYA 4PNHA 3YASA 3T0GA 1MAHA 1XA0A 1F4PA 1G55A 2BFPA 2FGJA 4GLOA 3HI6A 2B8WA 4R98A 2VTVA 1JAHA 1DFIA 3D3JA 4HNRA 4PFJA 1PFGA 2C0PA 3QVGB 3ZHSA 4B6EA 1EUYA 4UATA 5ALMA 5C5EA 5AW9A 1EFKA 4LKRA 3PIIA 4PG8A 2B2CA 3QBVA 3DOEA 3L1HA 2QNIA 2J5BA 3OEYA 4LGCA 2FW6A 1FJGB 3IDOA 3LA8A 1YRQA 3VC7A 5E6UB 1SU4A 2YRWA 1MB9A 2P9EA 4ZVVA 2WA2A 2Q4RA 4XWTA 5CVDA 2VTKA 3C3AA 3T95A 1E1DA 1ZH6A 3W4JA 4FINA 4IHQA 1IWPB 2WJVA 3RANA 2DMRA 1G4UR 1XCMA 1HKHA 2I54A 4FHEA 3SZOA 1M0EA 3DBRA 1NNLA 2C88A 3PRKE 3KAPA 5AQ1A 1C9YA 2CW5A 4FZVA 3VI4B 1B1CA 1ECCA 4UEKA 2BD0A 1ISGA 1WCV1 3HPRA 1TU0A 4EHBA 3M6WA 1TYCA 2HC9A 4IVPA 2HU5A 5FHRA 4DY4A 5KEIA 2MOKA 1ZGAA 2BHLA 4F91B 3PC3A 4IIEA 2VTEA 1FMLA 2EJCA 1V47A 4S0ZA 1DJQA 3D0OA 1QHYA 2B6NA 5LD2C 2AZXA 1P4HA 4G1FA 5AKLA 2PQ2A 2YDYA 4KGDA 3T1NA 2RHTA 1ZK3A 5DSTA 1L5HA 1SU7A 2GXQA 4QOJA 1C0LA 2V1XA 4MEJA 3HB4X 4NYJR 1H6CA 3HZZA 2JGLA 2H4ZA 4GBMA 5JR3A 1RWKA 1NQ5A 4KV9A 4MH0R 3IODA 4YROA 3CNNA 2P2NA 3CR7A 3FBTA 1DBQA 1E8MA 1Y81A 2D0PB 3H18A 3EAFA 3FTPA 3PDJA 3HKBA 1DUSA 2B8JA 4Y6SA 1V3VA 5DP2A 1OXKB 4DANA 3RREA 4LWZA 2ZBGA 2O2HA 3KKLA 1C3OA 4DVJA 1U9IA 4TS3A 5SYAA 3WZMA 2ZOSA 4PTYA 5H3HA 4IGKA 4QPCA 1Q21A 1QYRA 5IASA 2WV9A 2I4MA 1WKCA 3M3HA 2VBFA 3G0CA 4J2OA 4M1ZA 4RVHA 1NRIA 1UOOA 2A0XA 3LXRA 2Z09A 4EFLA 4EMUA 1Y1SA 4JN6B 4NMHA 3L77A 1JALA 5C8ZA 2WF6A 3Q3IA 4QBTA 3RU7A 4B6SA 4C0KA 1UZUA 1I6KA 3DA8A 2X4DA 1VCOA 1PK9A 2GZHA 4D82A 1JQ3A 1PTKA 2WQ6A 2J3MA 4M0UA 4CTOA 4GFDA 4EG4A 4PLYA 3K6SB 1XNJA 5TJ9A 4HC4A 1C29B 2O6HA 3FCCA 2HMTA 4GAEA 5AVJA 2OFXA 2XKAA 3MSXA 2GPYA 4G8JA 3Q41A 9LDTA 5JBNA 1SCAA 4M1WA 1V1JA 3EWSA 3UGJA 3HCDA 2O8CB 1UDWA 3VTZA 4YCLA 3CIOA 3HEAA 2Q62A 4O2AF 5JE8A 2BH2A 1HDEA 3GROA 2R4TA 1S9HA 4DV1B 3EEBA 5FFMA 3CX8A 1QKJA 2X86A 3HJBA 2XQGA 4GR9A 1X7WA 4NARA 3ZGLA 3W6PA 2CJFA 1QTNA 5JSZB 1ZGCA 2VTDA 1FYXA 3HABA 3MCWA 1OKKD 3RLIA 4S1TA 5LQAA 1MVNA 4DJJA 2C1XA 2HRCA 5A9TA 2Q29A 1R6DA 5CD9A 1EVEA 1SRRA 4KQCA 1MC1A 3PNLA 4JELA 4MCIA 2IHNA 2O59A 3PXGA 1Z5NA 1OSNA 2VPQA 3Q40A 4RD1A 4DS3A 1BG6A 2VI5A 3AF1A 1L7NA 3I4LA 3L6DA 2QP9X 3P9KA 2GEBA 4FEEA 2IGTA 5KWJA 1KMNA 4JYBA 1K27A 4N6GA 4PAQA 4C4PA 5DI3A 3HK2A 4XOUA 1L8QA 3G85A 2Q5CA 4ROSA 3AL0C 1Y4ZA 1G2OA 1IHXA 1XX6A 2B37A 3GEEA 4HDMB 2OSBA 4IV5A 3JQAB 1PLJA 3IVMA 3LBHA 4DAEA 3L0SA 1SXPA 5BV1A 2ZAYA 3R9XB 4KFUA 5DISB 3TL3A 1J7KA 3L02A 1GZDA 1KL7A 5CJJA 1L6IA 5F21A 4DCOA 4C43A 4I50B 2DAPA 4UBNA 2V65A 2AFIE 3FVRA 3JD2A 3BGWA 2VP4A 3RJZA 1WU8A 1JGTA 4U1RA 2RGWA 4RSHA 4IG9A 3QLUC 2CL0X 3HJHA 3SBXA 4EGAA 5BURA 1W4AA 1R0SA 4M49A 5KC8A 4QYIB 4UCQA 4TQUS 1UC8A 5EUBA 1QPZA 1Z74A 3A1SA 9MHTA 3PNPA 4NEGA 3AY7A 3PD0A 2WMOB 1ZNWA 5B1EA 2UUCB 1DKPA 1TCAA 2CD9A 3C3JA 3EXG1 3STWA 2F55A 3SF0A 3NHBA 1D0IA 1CDZA 2R48A 5HMLA 4BQNA 3O1HB 1NUSA 1QP0A 2IQ5A 4US0R 4IMIB 2GHIA 5FPQA 4KRFA 1UC9A 4FGLA 3N70A 3FRHA 4DSOA 4KMMA 3VSDA 4C05A 1DCMA 4E1VA 2P6NA 4UEOA 4UFPA 1TT5A 3G13A 3BK7A 5CXUA 4RMGA 4AO6A 2X3FA 3U80A 4QZVA 1LY1A 3CX7A 3ZN2A 2X15A 4FWIB 5JVDF 5JXGA 3UJ9A 3HHEA 5L4LA 1RQPA 4TKUA 3W2TA 4KWEA 2HRBA 1EWYA 4IILA 4URHA 4ZCQA 5SYMA 4BNWA 3HL4A 4KE7A 1SD1A 4Z54A 5ALWA 3HMKA 1HDGO 2DPYA 3DOIA 1SVIA 3AUJB 4K0RA 5DXFA 3AXTA 1GV1A 2NT4A 2VF7A 5G1OA 4CRWB 1U90A 2G9NA 3HVRA 4OI4A 1Z12A 1Y3AA 2VHVA 4XJXA 5JMTA 4YCJA 2JH9A 2BI8A 2EWMA 3S2UA 1Q0PA 5LL6P 4CQLB 4POOA 1M0WA 1NBEA 3K73O 4KR3A 3C8MA 3HKBB 4G36A 5DBOA 1N8SA 2ZR9A 2H1SA 2J07A 4LF6B 1ZX1A 4UVEA 4YRNA 5MFPA 2QQEA 2CNKA 3QYJA 4YJHA 4ETNA 5IK2D 2Z8ZA 3PVCA 4AY4A 1J8FA 2RG7A 4DRXA 1LV7A 1DAEA 1K1EA 5AJUA 5B1IA 4UDXX 3ZHCA 5J4YA 1C3EA 2J45A 1JSZA 3BMCB 1WXEA 2H11A 4LQDA 1ZXBA 4TPKA 1RPJA 3C8ZA 4MV3A 2HBRA 2RMKA 4IXWA 8ADHA 1XRMA 4P4TA 4HS9A 1OMOA 4WK0B 2VZ8A 3AR4A 4PIVA 5HF6A 2I78A 1XHEA 1VC2A 2VVTA 3EXEB 3OKPA 4KLNA 5F12A 3O95A 5G3YA 1BVRA 3TLJA 3W6ZA 3ICVA 4NIMA 1CS0B 3IURA 4EBBA 2P69A 1LXCA 4OYLA 2V8OA 4PEVA 3VTKA 2BIFA 2W5UA 3DMTC 3R0XA 4MS1A 5FI1B 3N75A 3N2EA 2IF0A 3FTCA 2R97A 4R2HA 1AB6A 1TIKA 2IIBA 3B53X 3DL0A 4W4TA 3WAKA 5JD5A 3LFHA 4NH0A 5HUQA 1N77A 3OZXA 2F1KA 3SYNA 1DKNA 4MRAA 3VTFA 2BTEA 3Q3CA 4X92A 3NASA 4H31A 2P7HA 3V32A 1O94A 5HBRA 2EBHX 3LQRA 1QF6A 1UK6A 1SVOA 3BFXA 1IOZA 3L01A 4IS3A 4KRYA 4UVHA 5JD4A 3T1TA 4QUJA 1TFRA 4BLPA 3FKJA 1SY7A 4PAGA 1EIWA 1IMJA 3OCXA 5E3JA 4D80A 1QB7A 2JFUA 2ZI9A 6REQA 5JARA 2A4MA 3P9RA 1T8YA 4KPYA 2QI9C 3PDIB 3OU6A 2HI0A 5AWFC 2C95A 4QATA 2I1LA 2NO6A 3ZWQA 3HFGA 5EIAA 5F33A 4PN3A 1PGQA 3ESQA 5CITA 4YXWA 4FDMA 2WU1A 2GI4A 2K87A 2PIAA 3TQQA 1TM5E 2R6DA 1MO6A 4OI0A 3QOYA 1W4BA 3DXXA 2Q5FA 5IZCA 2GVZC 1JI3A 4MA4A 3HB1A 5A5DA 1C1XB 6Q21A 4QUIA 4ZEOA 2FWPA 1QSGA 3D4NA 5ALYA 3OTOB 3PVZA 2OORC 5JY1A 3M33A 3P2OA 5LM3A 4DEVA 2DR3A 2G04A 1BHJA 2IP2A 2VJMB 1E9CA 2VXYA 4M7PA 3D3EA 1WRBA 3K15A 4P3PA 2ZBFA 2FDXA 3H99A 4IUDS 1VJ0A 4X61A 1SCQA 4FIZA 1HPLA 4WE3A 5KPJA 2AHRA 2OQ2A 1SQ0A 3B6EA 1TRKA 3T6KA 1KQ3A 5E9JA 3LUHA 4MW7A 4WAUA 4TYWA 4N6OA 1P9RA 1T5HX 2PWPA 3EXIA 2YCBA 3LECA 5GMOA 1O5TA 2ATEA 3TSWA 2GBFA 3K6JA 2FFJA 1OJLA 1JKXA 1O6CA 1II0A 2VA8A 1U8TA 2XQIA 3TRHA 1EK6A 2AR7A 1S7GA 1NBWB 1XXHE 3ANYB 4PSCA 4HUQB 4ZVQA 1W5AA 3IE0A 4NH4A 4LF4B 3SICE 2Z57A 5M5BA 5CTJA 2ADFA 4L2IA 2QNRA 5B4UA 4XIFA 2BF4A 2J6HA 4F8JA 4HEA6 4W8HA 3CKYA 1N4AA 4Z8YA 1JHAA 1DG3A 3ZCXA 1WPQA 2PSDA 3R3WA 1GEEA 2WIFA 3CN7A 3PYLA 4OLHA 4IIXA 3AU8A 4LW8A 4HXEB 1X7XA 2ZSJA 1ND6A 1ZCJA 3SEQA 5KJCA 2JZCA 2H54A 1KK3A 3IA2A 1AD2A 1UBKS 4NCKA 2I3DA 2X77A 3U4DA 3KJEA 3U60B 4NBRA 5JAQA 3OEHD 3RK1A 2Z2XA 4FOLA 1ZS9A 3SD7A 2QS9A 2D06A 1ZUIA 1D3AA 1L1QA 3N3AC 1H0KA 4WOBA 4P54A 3O8CA 3GC6A 4HSEA 3V8BA 5LMUB 2UAGA 2LIVA 2X2PA 2A78A 5LDGA 1GUYA 2ZJOA 3N6RA 5BRAA 4IZOA 1V95A 4O4IA 1IXZA 2FFBA 4H9GA 4GWKA 3TX2A 1Z0SA 3N0TA 1Y6QA 4WJZA 3VAZA 2EKLA 1KMMA 2VNJA 4ZI7A 2CVPA 3FHTA 1HMPA 4WQMA 1EFVB 1U2PA 4JI6B 4I3HA 4ARAA 4GEKA 2AFRA 3PXEA 3NPAA 4F3RA 4MKXA 3SMVA 3HA7A 2QW8A 4YAKA 4H1WA 3CO5A 4QU8A 3T3OA 2ZYDA 3FDXA 1L5FA 1F6DA 2OP0A 1DCKA 1FTNA 5E9AA 4CMEC 3I5MA 1DQRA 2JBWA 2FR0A 3GVPA 3X0DA 3GA5A 2O06A 2F00A 4I99A 4R7GA 1GPMA 1LSOA 3ROPA 3DXYA 2ZYHA 2W22A 1I7PA 1S2NA 1IBLB 2O8EB 4RTRA 4YP6A 5FFNA 1CDOA 4DGSA 3KWJA 2WFMA 3P96A 3LGXA 4YEDA 2A94A 2HXYA 2PSJA 4HL6A 5L6MB 1Y6GA 4PTLA 1KYYA 4G4IA 2CMDA 4L8GA 1KI6B 3PKJA 5AJVB 5EIBD 4DSZA 4YV7A 3FLEA 5AKHA 3WWZA 1W1WA 1JHVA 1WUYA 1L1RA 2E5WA 3DWFA 1NHWA 3MRTA 3DE7X 5IAKA 3U61B 1EGHA 4OXIA 4JYAB 2I2AA 4EVRA 2AXPA 3U40A 3KUKA 5CIQA 1A8SA 2AX3A 2HJRA 4D9EA 2W6NA 3OMXA 4UHEA 1P3DA 5KTKA 1NHGA 4MS4A 2P3LA 3S2YA 1M2WA 4CF5A 2CN1A 2J48A 4KR2A 5H0IA 4NBLA 4E12A 4BX8A 5ECGC 1U4SA 3AH8A 4B5LA 1RJGA 3DBHB 3M5WA 4O4LF 2JD0A 4DNQA 2NUPA 5BPHA 1GGKA 2R8OA 2WVJA 4HWGA 3KRTA 2O1SA 2YHIA 1NSFA 1O87A 2B2XA 1G7SA 5HW0A 3LT4A 2V6MA 3BE6A 1SRQA 3IT2A 2OZVA 2FDRA 3V2HA 3KJNA 3FW1A 1S8OA 3PNKA 2EBFX 1G59A 1XWWA 4DYVA 4RDHA 2DHQA 2VA9A 3DXFA 1QZXA 1YOVB 4AXBA 1OUMA 2ZRIA 3W8FA 5ITVA 1C1YA 2D0IA 1FSSA 1NOIA 2XMQA 3W79A 4LC1A 5IS2A 3DFKA 2IX9A 2W2LD 3HXKA 2Y92A 5JFGA 3M6LA 2NVOA 1V3QE 3HZRA 4D9HA 4HWSA 4V2UA 3MJTA 2ODEA 3F78A 2BMAA 2PXAA 4QJ3A 1DEAA 3VA7A 3UNXA 1EVYA 1QK5A 1DJPA 3OLCX 4RAQA 5CIWA 4NMLA 5AXCA 4WCFC 3UKDA 4OIFA 4RY0A 4EEKA 5CPBA 3HA5A 3UA4A 4LVNA 4RULA 4YX9A 4YRAA 2ZW9A 1IRXA 1KYXA 1E1RA 1ZL2A 2AC2A 4JP8A 2HMUA 2PH5A 4KPUB 3O5AA 1KI3A 2DFLA 4HD8A 5DH9A 5JD3A 3TTXA 4AROA 4R0MA 2EJTA 2GTPA 1EFRA 1E2IA 5KNLA 1H1LB 1U7OA 3B3FA 1CUIA 3R3XA 5F78A 3RAJA 3ZHQA 4RQBA 4TKLA 4X20B 1GRCA 1FUYB 1PL6A 1FF9A 5I8ZA 4N01A 3BXEA 4C20A 4UTVA 4LC0A 2MSKA 2Q4EA 3PGMA 1GU1A 2ZBDA 5AOVA 3RYFB 3T1YB 1UJ4A 3CLTD 2IXTA 2WKQA 1CKEA 2WUFA 2P2LA 3BTUA 1MO4A 3E7FA 4RSGA 4IJVA 3T3EA 2Y0PA 2JFQA 4DJAA 1B0ZA 3FOAA 3ZVKA 2N47A 1KKLA 2FJPA 1ZNYA 1XZDA 5DLPA 4E51A 5C51B 3FJOA 3MERA 1Z7EA 1EK5A 2JI9A 3DTVD 3MIIA 2H4FA 2P5YA 2I3BA 2QR2A 1YQDA 1L3IA 4Q4AA 5IVDA 1YR3A 2ZYAA 4PSVA 1KGSA 3SZLA 3GAZA 1U0EA 3HM2A 3UW1A 1P0IA 1HK7A 4OQMA 5D85A 1M76A 4B8ZA 2GRUA 3O7MA 2DHRA 1EWRA 5KDDA 4KGXA 2Q3FA 1P29A 2Q27A 4WY8A 1CY6A 2HA5A 3PFNA 4KVZA 2O2EA 5HJ5A 4B17A 1U65A 2XTZA 3L4SO 4TTAA 1S8AA 2O3TA 4LI0A 4PX5A 3AESA 5DNYB 1QBGA 2Y76A 1KPIA 1FZQA 2J3HA 4PLVA 4V0MA 1HLGA 5K99A 3SIPA 1LBHA 1PG2A 1EKXA 3BREA 4N0MA 1G4HA 1T4MA 2A0UA 1KZGB 4I50F 3CFYA 4RYLA 3UH0A 4EOGA 1T5TA 3TLAA 3ESYA 4EJ0A 4DJEC 4MCJA 1WXQA 3ZX5A 1TVEA 2NPFA 4RPGA 3LYHA 2Z8YM 5MHTA 2GXSA 3OX2A 3HXQA 1J0BA 1HDYA 1A8IA 1E3QA 1X8JA 2PUWA 3I6QA 3JASB 1MAAA 1V7PC 2XHZA 3IXQA 1W2GA 1KXZA 4FI3C 5JANA 3EGVA 2V9CA 3VR0A 4NE2A 2X3YA 3WB1A 1GA4A 4EG1A 4F38A 4HLCA 5JCXA 4NENB 1GVNB 1QLJA 3ZWPA 2HIHA 3LCRA 4N0DA 3GGGA 2I4RA 1MQ9A 4UAJA 4BGVA 2REOA 3GBVA 5I6DA 5KDOA 4Z8XA 2NYRA 5AJHA 2Q6OA 1IEVA 1G0OA 3O8NA 1ECLA 4B3IA 2WWGA 2QPLA 2EQBA 3TTSA 3MBOA 2B1RA 2DSTA 5AUNB 3G3EA 3MQ4A 3WGTA 5E8JA 4EMTA 2DUNA 2ZJ1A 1ELOA 1E5VA 1GPKA 3EZ2A 2Z6VA 5A6VA 4V1CI 3FOEC 2G0NA 1N0HA 3L8MA 5JATA 3KHSA 4Z99A 1W44A 2R1TA 4IHJF 3AETA 3RTEA 1I14A 4E07A 3GJQA 2HIGA 4M3NA 5JNTA 3GLHA 1H6BA 1JJVA 1AS3A 3HE3A 2D00A 5HS6A 4A0QA 1EXVA 1OBVA 1SCDA 1SCIA 2YS6A 3CEAA 1SOUA 5DHTA 3M70A 2ZT5A 1T3HA 2RGRA 1GNPA 1P2FA 1EQUA 4YMWA 3SLRA 2C2ZA 2ZRHA 1V41E 1LPBB 2M1ZA 3N2KA 3MWGA 4DLBA 1CR4A 4NXMB 3VZRA 3JAWB 1NJ5A 2XVMA 2OHXA 4I9UA 2BFDA 3WB9A 1OAOA 1MB2A 2JS7A 3LRPA 4C89A 2WVGA 3CX4A 5B3AA 2I4NA 1X94A 2CSUA 4NBNA 1RXYA 2OC4A 1YASA 1ZW1A 5D00A 3N28A 2ZR7A 3GDGA 1UKYA 1O77A 4LA4A 5LP1A 1QU2A 4AKGA 2OFWA 3PTAA 4QARA 5SY6A 1GO2A 5EWLA 3O73A 1LEHA 2IIPA 3M2PA 5CH8A 5EJ2A 3RFCA 3ESBA 3G2PA 1V9LA 3H5VA 4ZREA 1LZKA 2G88A 1IM8A 2OGTA 3FNFA 3LQ4A 4J07A 3LXXA 4J91A 1EHCA 5ALLA 4ZZ3A 4MYUA 2C4HA 3FUVA 3QA9A 3A9RA 1PHPA 2XGMA 4V3BA 5HK9A 4EG5A 1SU8A 4NF2A 3LV8A 2FW8A 5CBPA 2W6IA 1QOZA 3P97A 4QBKA 2I2DA 2QTLA 4PZCA 3VX3A 4NZYA 4W5NA 4R05A 4ML3A 1JIIA 3ZHVA 4B81A 4CQJA 4E1AA 1GPH1 2FMUA 2X8AA 4C88A 1O4VA 3IUPA 4JUIA 4IEFB 2HK7A 1UK8A 3F47A 3BIXA 1CY8A 2O5EA 1BD4A 2A0FA 1B14A 2O57A 2C1EA 2X14A 3SEFA 2DQZA 1DRWA 4F06A 3G0GA 4DA6A 3GLGE 221PA 4D25A 1NR1A 5LFAA 1XLTC 2IDJA 1T4BA 4K8OA 4QQFA 4DWJA 1N5KA 1T9CA 3GFVA 1X1CA 3GP3A 5G0SA 4YMGA 5FIUA 2P8SA 2GETA 3VKUA 1X7XB 1BE8A 2C0QA 1TMKA 2IOYA 4IEEA 4O08A 4UQOA 4ZVUA 2MCFA 1J09A 1GADO 4MVJM 1R0KA 3DOJA 1KS2A 3U0VA 4AJ9A 4CV0A 4EQ6B 3RTAA 3HYTA 4FS3A 3R3YA 4TROA 2D2IA 4BY9E 2IS4A 1R18A 2GDZA 4F4CA 2YZ2A 3C6QA 3KZ1E 3IP3A 2C3PA 3LQ2A 3W8EA 2C84A 4BASA 3LC1O 4UM8B 3U6BA 3QFSA 1L4FA 1OLUB 2FVXA 2X9GA 4DXHA 2QTRA 3GCXA 4I36A 5J4VA 2VP5A 4TMKA 4MQLA 1RC1A 1MA0A 3MS2A 3NHKA 4X1IB 1Q1QA 2JGDA 1ES9A 1P7YA 1WMDA 1EK1A 3QIVA 4LHSA 4EHKA 1FDTA 3UICA 5LQMA 5A03A 3IO3A 1ORHA 3GRKA 3O92A 4RS4A 1BH2A 2GEDA 3O0TA 4IKEA 2CK3D 2WU4A 3IDZA 4BX2A 2UVDA 4DN6A 1XMJA 1ETUA 3NUQA 3CH4B 3T5BA 2W2OA 3CINA 4L4YA 4AJHA 4F93B 1MRZA 2H1IA 2DERA 2BFBB 4B3HA 1G21A 2NU6A 2DQ4A 2WNSA 3QWFA 4GF5A 4J2HA 4JY7A 5E4TA 5KYVA 3TLEA 4WLVA 4XI9A 2AOUB 4B47A 3C7CB 3LL7A 3MW8A 4Q39A 3ECCA 4P4NA 1FP4B 1F48A 1YU6A 1Y5LA 1GAWA 1FMJA 2VF2A 2EFDB 3JWPA 1KQGA 4FC7A 3FLMA 3M6UA 2P40A 4LJ8A 3H1EA 4XDHA 3RUEA 1NE7A 3D7LA 2C5EA 1OY1A 5EGSA 3GGJA 3VPXA 2EKZA 1O03A 3WRYA 4B76A 1NTRA 2OV3A 3AFNA 1UMKA 2CGEA 3RG2A 1U31A 3U7RA 1EGMB 1WMSA 1VBNA 1VLJA 2FGKA 2PGOA 3EMDA 3HH8A 1XK6A 3DUWA 4YWHA 1CHDA 4KWCA 2NUTB 5F4BA 5AKZA 2IEYA 3ADBA 2C9ZA 4OHWA 2WY2D 1Y98A 3HB9A 3NWEA 2EJWA 3SX2A 5SICE 2BHTA 3PQFA 4G5XA 2F4NA 3AOEC 5A3QA 5EKDA 3KZKA 2QZSA 3LZDA 4ZT3A 2DXIA 2R9VA 1SWWA 2FUG1 3CCFA 3JQ9C 2ZJ6A 4BECA 4EB6B 5IJ9B 3EGIA 2EBWA 1RIIA 2OO7A 4E32A 5REQA 1D4FA 3LSYA 2DTXA 3FHJA 1SUSA 1DX4A 5D3MA 1PS9A 4FHCA 4Y1GA 4RACA 4AICA 1R8QA 4QG3A 5CAEA 2P0YA 3G0IA 5FWXB 3FOZA 3QZUA 4TRMA 1GXSB 1JSCA 5DX8A 5U4QA 5JH7F 4HY3A 2EZ9A 5JNLA 2Z8YA 1OXMA 2OEPA 4TN1A 1A3CA 5DTRA 4ZN6A 1I7DA 1D5CA 4P7BA 3AUXA 2AG0A 2B61A 1FFGA 4JX9A 3PT9A 1VSVA 4JXJA 3EEOA 4TZ6A 4YDHB 3BRSA 1QG2A 2KBEA 4E88A 5CH5A 5K2MA 3ILVA 4J6FA 2WILA 1MBZA 4B87A 2MSNA 2PZGA 1CEQA 3KWFA 1GNVA 1WU7A 2YIDA 3OE5A 3PL5A 4YC7A 1V5IA 4MO2A 1TW2A 3VR3D 5C8XA 1C30B 3GEGA 1R7RA 1GGJA 2R4QA 2ZSEA 4PPQA 5EMNA 1BKSB 2MHCA 3O8OA 3VMFA 5C3MA 4YS6A 5ALUA 1BZYA 4QXQA 3DT8A 5THQA 4BBZA 121PA 4MKIA 2WM9B 3EG9A 4JFRA 5EKXA 5IKXA 1NXTA 3FSJX 5T7BA 3MTJA 4R0NA 5HZHA 3RC9A 5D5QA 4C6RA 3C4VA 4K9LA 4NBSA 4WN9B 2AJLI 2H5EA 1KKUA 1WZEA 3CA8A 3D2LA 1WVGA 3B5IA 3EVDA 3GFQA 3K30A 4FDAA 4LBZA 5CT4A 3OQ1A 5KX5F 1NW6A 4W5RA 2CLCX 2NYVA 1PEAA 1YFLA 5LQDA 1ONPA 2IIQA 1BGXT 1TJNA 4CODB 3LP6A 3BWYA 3NM5A 4BLTA 2VJCA 5AKEA 3JS5A 2XZLA 1JIVA 3L7AA 1GTVA 3GHYA 4J0QA 3IPAA 5PNTA 1AKRA 2AYXA 2TECE 3SNKA 1C4OA 2QT0A 2QD4A 2OCXA 3QOWA 1YK1A 5HM6A 1P4SA 2RHDA 4R2KA 5ICCA 1VHWA 2FWRA 5EXSA 4BAUA 2J85A 5DNCA 3C1AA 1SC3A 3IJPA 5B3KA 3VVCA 1JTEA 2ACEA 3AV0B 5A6SB 3TRFA 4ENSA 3WA6A 5BN3B 4PANA 3CVYA 3PS9A 1VKOA 4HNGA 1N34B 2O8DA 3H9QA 3W5HA 3F97A 1TX4B 2W00A 1CEYA 3L6UA 3WRXA 4XD7A 1YTUA 2AI3A 1LDBA 2JJ2D 4WXPA 1TO6A 1NP3A 5FOXA 5SY9A 2VSNA 2QLMA 3OSUA 5DNAA 2YINC 2J59A 5FNVA 1RLOA 2E85A 2QRQA 4MQBA 3V4OA 3GH1A 4TL8A 2FRVA 4Q1FA 1EAYA 1GQQA 1I5OA 2H48A 3FD8A 4D4HA 4OJYA 2O0KA 1DRUA 5HFJA 3ZH9B 1VSTA 3N2ZB 5HDBB 3DAOA 4MV0A 1CJBA 1T4DA 4LOJA 4PG7A 2GK4A 4MP6A 4YR7A 2CXRA 3IIKA 4HRXA 2ZEJA 1ORDA 1RCTE 3QITA 4ER0A 2H1RA 3C97A 4QJ4A 5LWQA 4RTMA 2QGFA 1XL1A 4Y67A 3WC4A 5B6IA 2YV3A 1ZEJA 1D2CA 3IEIA 3OU7A 1U7WA 1TA9A 3ANTA 4NU5A 3AVTA 2LZ0A 2MYUA 1JDSA 3UQYS 1KJ9A 2XQKA 4HV4A 2WJZB 1LS6A 3AR3A 3VU8A 1CSEE 4L8FA 2ZCUA 3CNHA 4ND2A 4PYIA 1CV2A 3ZGNA 3C3YA 3FI0A 4I19A 1GTMA 2WLSA 2X5XA 4YRQA 1YD7A 2A67A 5I51A 4HDRB 4B7ZA 4GNRA 3GEPA 8MHTA 2KWIA 5IT9A 2VHXA 4HMPA 2FRDA 3KPVA 2UUAB 3AF2A 4OHCA 3ZHRA 3EW9A 2DHDA 3WDSA 5KVAA 4I4LA 4KAXA 2OXEA 3PV0A 4Q9JA 3E22B 2BH9A 2CXXA 1H9CA 1MAVA