1GRQA

Chloramphenicol phosphotransferase in complex with p-amino-chloramphenicol from streptomyces venezuelae
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
178
structure length
178
Chain Sequence
MTTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMPLKMQSAEGGIEFDADGGVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVGDLDVLWVGVRCDGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYDVEVDTTHKESIECAWAIAAHVVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE
publication title Structural Basis for Chloramphenicol Tolerance in Streptomyces Venezuelae by Chloramphenicol Phosphotransferase Activity
pubmed doi rcsb
total genus 58
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2001-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07931 CPT Chloramphenicol phosphotransferase-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1grqA00
3PFIA 2NMVA 2ZANA 2FWRA 3FVQA 1NSTA 4F4IA 3SBEA 3H2YA 5EE0A 1XPOA 4JT4A 1R6BX 3GJXC 4WIAA 4TYQA 2EYQA 2XSZA 2O0HA 3KFXA 4AG6A 1EESA 1ZD9A 1NMXA 4E03A 1Q44A 5H8WA 1T5LA 3NBZC 3O47A 3B1WA 4M1WA 2JLRA 4NYIR 3MWKA 3L0PA 1D9XA 3B78A 1DAKA 4PSKA 2X8AA 2W58A 3CB4A 2V54A 3GFPA 3RSOA 1KAGA 2IYUA 5EQTA 3KKPA 3AP2A 1G4UR 3U4QA 4Z54A 4AURA 1ZU5A 3TLXA 4TZ0A 3OFND 1TQ4A 1AS0A 4KBGA 4A36A 2WKQA 1UAAA 4RZ3A 1KAOA 2ZI3A 1E2MA 1RVDA 4PZZA 1KGDA 1R0ZA 3D3QA 1XMIA 2PL3A 1OHHA 1H8HD 2OXRA 2PZGA 3LXXA 2R6FA 2A30A 1VDZA 1D5CA 4LGMA 5TB5A 1EX7A 2IHYA 2BCJQ 1ZC4A 4BFVA 2IYZA 4F4CA 2YWEA 5KUTA 4QHSA 1J2JA 2P3SA 3TAHA 3ETLA 5HE8A 4B35A 3R9IA 2DFKB 4NH0A 2YOGA 2ZUCA 3QY0A 1MO3A 2ZJYA 3W34A 1MABB 4XWOA 1G5TA 2OSBA 1NVUQ 2WPDD 1Z8FA 1ZRHA 1D2EA 4PPGA 2ZJ5A 2CVHA 3NEJA 3AVTA 3WHKA 1EFTA 5E7IA 1U2RA 1HY3A 4GZMA 1D8TA 4RFSA 2Z6VA 3B9PA 2LWIA 3QKUA 5AJVB 5FOWA 3QF4B 3NH9A 2QPTA 4UXIA 1KO5A 1VYVA 3B1ZA 1P3JA 1R8QA 3CR8A 2I1VB 3K0FA 3I1FA 3FMFA 5F98A 5AUQA 4PHTA 2V7QA 5DI9A 4Q9LA 2OAP1 1S1CA 3FMPB 4E07A 2GHIA 4PR0A 4DVGA 2N42A 2RMKA 1KK3A 2QE7A 3AUYA 2A7QA 4JVSB 4JVNA 2YYZA 1S1MA 4L16A 4PPFA 2ZR7A 2VSFA 4P4SA 2LKDA 3CF0A 1VTKA 3P4YA 3KXLA 4N1AA 5DE3A 1XPRA 4CGZA 1N6LA 1AIPA 1AKYA 4IOLA 4Q02A 2HCBA 4PZYA 4TL7A 1WP9A 4TMKA 1YU9A 4TMXA 3S1AB 4I4LA 3UG7A 3VU9B 1GKUB 1RC8A 4HAXA 4B44A 1U8YA 1A5TA 1E2QA 2ZI9A 1U0JA 1XTJA 3B8HA 3OIWA 4YMTA 5D3MA 4IRUB 2C96A 1OH6A 2ZYTX 3IDQA 2O52A 1UKYA 1DAFA 1JQLB 1SKYE 4DLXA 2IT1A 5GJCA 3UKDA 2ANCA 2JDID 3A36A 2ERXA 2WAXA 4P32A 1ZM2A 4QKQA 2ZRAA 2REOA 1E99A 4LC0A 1F5NA 2QSYA 5LPNA 4KU4A 3PJRA 3VR3A 1KK1A 2HDNB 1P61B 1W5TA 3K0EA 1JR3A 3VX3A 1FW6A 3OZXA 2ZSEA 3ECCA 4A82A 1XZQA 1NKSA 4POAA 2D7DA 4WA7A 5TY0A 1OJLA 4I1SA 1HTWA 1R0XA 1UDXA 4LJ9A 2J0SA 1NG9A 1KJZA 1XTQA 3B1YA 4ESHA 2ZXUA 2WWIA 4FCTA 1CJTC 2WJJA 4AYXA 2DBYA 2J5XA 1DARA 2BMDA 3SR0A 2QAGC 4G5GA 4K81B 1KI6A 1VG0B 1OXXK 1XWIA 2V55B 3W90A 4Q03A 4QGGA 2G0TA 2GJSA 1E94E 3CWZA 1B23P 4TYWA 1E2GA 3B7GA 3W5IA 2XJ9A 2WIBA 1A82A 1GNRA 2OFXA 1K6MA 4L4UA 5E7JA 3R7WB 4LBYA 2PMKA 1QG4A 1KDRA 1CULC 4S35A 4OK5A 4Q7JB 4ITRC 1EX6A 1N2CE 4UNRA 3NDPA 3U3JA 1L4UA 5CITA 3WMGA 1J7KA 3AKCA 1LTQA 1OXVA 3PUVA 4JT2A 1XD9A 5CB6A 3SQXA 2PH1A 4OL0A 5AR1A 1G8HA 4Q1EA 5AJYA 2C03A 1CF4A 3DZDA 3VX4A 3LY5A 3U5ZB 2P5SA 4Y0AA 2IC5A 5A4JA 1JEEA 2ZTSA 4O0MA 4RD0A 1GAJA 2BBOA 3FKSA 3JVUA 3VR4A 4KHZA 1E1QD 4QXAA 2HF9A 3ZZTA 4LDJA 4DSNA 5KDDA 4M0LA 1SVSA 1G16A 4M1KA 1T8UA 3PR1A 5JZVA 4A0GA 4QRHA 1XRJA 1OLOA 2EW1A 2RGNC 3ND9A 1G21E 3KB2A 3QKRB 1TADA 1CBUA 4TQ9A 4ILEA 2VP0A 3HJNA 5JS8A 1GNQA 3TH5A 3LX8A 1T3LA 4KV9A 1FNMA 3QKTA 3DKPA 3U3OA 1PV4A 4HZUB 4DSUA 2Q3HA 3WYFA 1VHLA 4L5BA 4UJ5A 3KQNA 1T9HA 1TUEA 4U02A 3RANA 1RRPA 4QG7A 3GPLA 1E2KA 1XD2A 3I5XA 3K70B 3AGPA 2Z43A 3P26A 1XEWX 3DHWC 4AD8A 3U3RA 1JPNA 3ASZA 5EE3A 3MWLA 2EU8A 3EZ2A 1Z06A 2VL7A 4UNSA 4O3MA 1EG7A 5FUXA 3MSXA 4N3NA 1W7AA 1VCOA 1VCMA 2CK3A 3AKDA 3MWJA 3PUYA 5EXPA 1F6BA 3BAFA 5AJWA 4C0AC 2FN4A 2WPDA 5F9FA 1E1RA 4HAUA 1YR9A 3BC1A 1UBFA 4C0KA 3BERA 4JYCA 3SFZA 4KLNA 3RNLA 5JWHA 2QTFA 2WKPA 3DKVA 5M04A 4D82A 1Q12A 1MH1A 2VYFA 1GKYA 3HR8A 3MCAA 521PA 3RS5A 1DEKA 4B6EA 4BZPA 1JXMA 3JZMA 4ZIRB 1ZAKA 4MKGA 4LHWA 1DAHA 2IYLD 2BKUA 3O8BA 3WYAA 3K0AB 1H8ED 1PLKA 2NOAA 1QHXA 2GWHA 3C8UA 4DLTA 5JLJA 1MT0A 1ZUNB 2FZ4A 1R5OA 1MV5A 3Q7PA 4MGIR 2J59A 2OO7A 2GAOA 3L82B 4II7A 3FPAA 1Q20A 4TMTA 1DE0A 4I1UA 1E2JA 2O5VA 4Q5IA 4D4MA 2WWXA 1IY0A 3LV8A 4CEHA 4EJSA 2GEUA 4LJ8A 4P0TA 4TMWA 3G0HA 2DYKA 2X1VA 4KI0A 3HU3A 1OFIA 3R9WA 1F2UA 2P2LA 1M74A 4M9QA 4HATA 4Z8YA 1LS6A 3RWMB 4B32A 3ZZ0A 2YWFA 5FOSA 4DRZA 1R4AA 3EG5A 1E9FA 4FINA 1L7VC 4KVGA 2GK7A 3IO5A 1EK0A 4UKDA 4Z1MD 5JFGA 3BFXA 4ACBA 2OBNA 3CKLA 2Y8EA 1VG9B 1CRPA 3JZAA 1TF2A 1EFRD 1LF5A 4CEJB 1N0UA 1DBSA 3K1JA 3Q7QA 1G8GA 4PSAA 1M34E 4F7WA 1SXJA 1E79A 1P2VA 2JLQA 3MGCA 2R62A 3C16C 5LB2A 3LWNA 1IN4A 5KNDA 4V0NA 1G41A 4F91B 2WWGA 3PUZA 2ZJ2A 2C2HA 1KOFA 1WA5A 4JLOA 4TMVA 2O8BB 1DAMA 4IDPA 4RD6A 2H17A 5EP4A 3RRNA 5K8UA 2G88A 1FX0B 5KDOA 2EVWX 2QP9X 3ZQJA 1SVOA 1KI9A 1B0UA 3AP3A 1ANKA 2QQ0A 1Z3IX 2D2EA 1M7HA 3PEWA 4JKYA 2V1UA 1Q1ZA 2YV5A 3IO3A 4BLTA 2B8WA 1Z5ZA 2IS6A 3B9QA 1RRCA 4G01B 2QM7A 4OQFA 4YDSA 3N2EA 4HAZA 2FPMA 5EE9A 3TK1A 4BWYA 2UKDA 4DIEA 4B2LA 1DO2A 1OH7A 3RS3A 3T12A 4XH9B 3BIFA 4EJSC 2JASA 2AL7A 3A1WA 3HU2A 2ZJBA 1NN3A 2YWGA 621PA 1AQYA 3TSWA 1RJ9A 1T5IA 4X8OA 5EZ5A 1GRRA 4OHZA 2WJIA 1AZTA 3BBPA 5KPDA 5IT5A 5FTNA 3W5JA 3PQCA 1E2LA 1E2FA 3KL4A 4QGHA 4ZI2A 2WJYA 2OT3B 4IDOA 3TAUA 5E4FA 3KB1A 4V0ME 5B30A 2ZRKA 1OB2A 4FXPA 2XITA 5IHPA 2YJTD 4YQFA 3IHLA 3EPJA 2QRNA 4ZCMA 1S2MA 4LBVA 3QKSB 4ZI3A 2OCYC 4Q1FA 2WWWA 1Z08A 2IXFA 3KTAB 1GRNA 4KJZA 4ASUD 2V8OA 2FGKA 4C9BA 5TDHA 1OT3A 1Z6XA 1ZU4A 3FMOB 4LJAA 4IOMA 4HLQB 4W7SA 5EE1A 5FI0B 2BC9A 4NYJR 4LHVA 4MRSA 4Q01A 3O8CA 2WMOB 4YXWD 2R6GA 5H1YA 2IYWA 4S2EA 1YZQA 2ODEA 3X1WA 1N6KA 2FNAA 2KWIA 1JXOA 2GEDA 2H18A 3IPXA 5CLQA 4B76A 2OFWA 4AI6A 3D6TB 3X1ZA 1RRFA 2J0VA 4JBWA 5KSZA 2LCFA 1XTSA 3PXGA 2WZQA 1K8RA 2F9MA 4QBIA 3K09A 2XZPA 4HLUA 2CDNA 3ADKA 3U44A 1EGAA 1NIPA 3LQRA 5JCPA 3QF7A 2BBTA 2C04A 1FQKA 1KI7A 2OESA 3KJIA 1JR3E 1K5DA 3D8BA 3U7GA 3KJHA 3RS2A 3GLFB 1II8B 1O87A 1P73A 3A8TA 2K5UA 4KFRA 1F3OA 1E2NA 1N6OA 1ZUIA 2XNDA 1Q1BA 1U99A 4GP7A 4TT3A 4Z8XA 2V6JA 5FPSA 3T15A 1W0JA 1W4CA 3X1YA 1QBKC 3ONWA 2QRZA 2OILA 1G3QA 1UEIA 2ZYUX 5SZIA 1R2QA 5TXGA 4BASA 1BO6A 1XMSA 4XTRA 4PZLA 2FV8A 4ABYA 3QXXA 3KUDA 1QDEA 1UF9A 3NBFA 4US0R 4NCIA 2D4HA 2CHGA 4QFMA 3ZS8A 4D26A 1OB5A 2IS2A 1RIFA 2P6UA 2QU8A 3GJ0A 1D2NA 2W0MA 2EWVA 4ZPXA 3GLIB 4IFEA 5BYKA 3TGPA 1YR6A 1NNEA 3TNFA 2XSZD 5JBQA 3DOEA 2KB0A 5CDFA 2I3BA 3MLEA 1AGRA 1UBCA 4OHWA 3LLUA 2DHRA 2VP4A 2C9CA 4XSHA 3WBKA 3PEYA 3E1SA 3T35A 1KO1A 4XVQA 1X8JA 1KSJA 2MMCA 3MFYA 1P9RA 2AKAB 1ZM3A 1XEWY 4GMDA 3ZS9A 5HR5A 4C7OB 4B3FX 1DS6A 1NL3A 5SZKB 3RWOA 1G7SA 2FF7A 1W46A 3K9LA 5HE9A 3QPVA 2OCBA 4MGZR 2HUPA 3K09C 4DLUA 1NLFA 2RH5A 3BE4A 5ELXA 4Q4AA 2ODNA 3GLGB 3JVVA 4MYTA 1Z6YA 2HEIA 3O8DA 4M1MA 1OHHD 4URZR 1E3MA 3NTUA 4C0HA 5G3ZA 3V4RA 1U94A 1XX6A 2B6HA 3FOZA 1FP7A 4Q7KA 221PA 2WVJA 1GM5A 4B47A 1EFHA 2PX3A 1Q0UA 2DFTA 3P20A 1HT2E 1TL7C 5SZHB 4CEIB 2VQSA 1ZW6A 5J4KA 4H9GA 2PEZA 3BFVA 3HPRA 4Q48A 4MUBA 4EPRA 4BEJA 2DPXA 1ZNWA 1ZNZA 4BZXA 5LBIA 5KO2A 3DMDA 1R7RA 2IUTA 3ND8A 2GESA 2JLSA 1E4VA 2W2TA 1BMFD 2W2XA 3WMEA 3THWA 1UBGA 3TW8B 2FSFA 2N46A 3I61A 1XU4A 3M4YA 3T1QA 4RCYA 3I92A 4QBHA 2E87A 4CVNA 1ZBDA 3AB3A 4TTPA 4A4DA 3A6PC 2H7VA 3CLVA 3FYHA 4NYIQ 5JECA 2CJWA 1CJKC 1T3HA 3GEEA 4JS0A 4EPXA 2RAPA 4Q4JB 1I4DD 1QF9A 5SZJA 2V7QD 2ZVQX 5LD2B 4Q1CA 2AWNA 4Q4HB 2H8KA 3OE7A 2VHTA 3KJGA 4A8JB 1ZNXA 2BEKA 3R9XA 4MRNA 3WBJA 3AF0A 4W5JA 3ADDA 4MYCA 2O8FA 2GRJA 1KNQA 2AD1A 5DI3A 2FE4A 1CKEA 2CL7X 2QE7D 3EWSA 5HKKA 3SOPA 5L3RA 3E70C 1KI3A 3M6AA 4TYYA 1S8FA 1DAGA 1KDOA 2G77B 1PJRA 4LPKA 4V0OA 4HUTA 4BZQA 1TX4B 2ZI6A 3AVXA 1CR0A 3UPUA 2DWQA 4PSVA 3CBQA 2P6RA 3ZGXA 3QNUA 2CL6X 5K8TA 3ZYCA 2NZJA 3SE0A 4OQLA 1NBMA 4EPTA 4B48A 3EPKA 2NG1A 3B2EA 5JHGB 1AS3A 2GCNA 1DAIA 4Q1AA 2F55A 4FIDA 4PHHA 3SFVA 1NJFA 2NO9A 2VEDA 4KBFA 2X19A 3C14C 1GP2A 3ZVNA 4FMDF 2LKCA 2AXPA 4XTCS 1IOZA 3EZ7A 4IVQA 4UXHA 2CNWA 3CIOA 2FOLA 4OI2A 2CLSA 1U98A 1JR3D 2F1HA 3Q3JB 4TLDA 2IL1A 1Q1QA 4D0LB 4BLRA 3W3AA 2RB4A 5JWOA 4TL6A 4JJKA 1Y3AA 3UG6A 1N6HA 2IWHA 2JLXA 2HYIC 1U0LA 4ZKDA 3BRWD 3VHLB 1IJFA 4QOSA 2ZE6A 3C5CA 2GZHA 3IILA 2G3YA 3I62A 5BN5A 1SXJE 121PA 3SNHA 4U5XA 3AF3A 2VF7A 2W2VA 2Z0MA 3MRSA 5J4LA 1XNJA 5C4MA 1M7BA 3FKQA 3D7MA 3Q5DA 4YMWA 1AA9A 3FHCB 3UMRA 4B2PA 1JAIA 2GNOA 2XOKA 1JALA 1KMQA 4P31A 4X8LA 3OEHA 1IBRA 1Z47A 2GETA 1F60A 3IQXA 3EARA 2A9KA 5JSZA 1S3GA 4K8OA 4P33A 2EFHB 2GZAA 5DYGA 4XVUA 1SGWA 4TN1A 3FKSD 2VP2A 4C0QC 2P0EA 4DCNA 2JCSA 1NRJB 1V5WA 1VKJA 2PZEA 4DT1B 3THXB 5FUWA 3THOA 1YZLA 1XB2A 2JJ2A 1M2OB 4A0RA 3FE2A 3F0TA 2G83A 5B64A 1P75A 1Y63A 4ACAA 4XIGS 4EFNA 2CHQA 5L8VA 4W9MC 3LRPA 3PENA 1KKMA 4FWTA 1A2BA 3Q85A 3T1TA 1TTTA 2O8CA 3BOSA 2ZRFA 3T1OA 3IEVA 4TLEA 1G7RA 1NF3A 4G5SA 4B3BA 1CJUC 4QGFA 1G3UA 2OG2A 1G4AE 2RGCA 1I2DA 1ZCAA 4IFBA 5K8IA 3QBVA 3R8CA 5ANRB 3K70C 1WRBA 3LAWA 4L15A 4ZDJA 3U3KA 3BH6A 5KTYA 4OI1A 1T0HB 3X2SA 3U6KA 4DB2A 2CK3D 2ZYVX 4TQUS 4G1UC 2P5TB 4MRRA 5L3QB 3RVBA 2KI5A 1FOEB 1BMFA 1E1RD 3LXRA 1XJ0A 2BHRA 3TUZC 3ZDQA 2ZUDA 2QQEA 1FTNA 1LB1B 3UWKA 3FGNA 2J41A 3AVWA 2DY1A 4B3DA 2XXAA 2O8BA 3FWYA 5FUYA 2B7CA 2ODWA 4YDHB 1CR2A 1DOAA 2N1BA 2QAGA 1C9KA 1NY6A 1NI3A 2VBCA 3UMSA 1W1WA 2TMKA 2GZDA 1M8PA 4JBXA 2R65A 2ZRBA 3LBNA 4M1OA 4V0MA 3TSOA 4ARZA 4Q1BA 1XTIA 3HDTA 1JEDA 2VHUA 2C77A 2IK8A 4A6PA 1N6PA 1GIAA 5UKDA 2JEOA 1MO6A 2QMEA 1XMJA 1SZPA 2ZSAA 1QHGA 3EIQA 4G0NA 4MH0R 1IONA 3DL0A 1MR3F 3CRQA 1G3MA 5H68A 3MMPA 5BN4A 1OF1A 3AP1A 4GP6A 5FPHA 1X86B 4FMCB 5L3SB 2ZJOA 2QP3A 3FB4A 5J4VA 4OHYA 1KTVA 3GJ4A 2F43A 2J0QA 1N3BA 2Q9AA 2W83A 1U81A 1E32A 3EZ9A 5JEEA 5JI3E 1TU4A 3P27A 4HAWA 3ZQ6A 5CDFE 1GZSA 3WMFA 5CK4A 2QORA 4DCSA 3THYA 3CM0A 3QG1A 1DPFA 2IS1A 2FU5C 1R10A 1XEXA 2WIAA 5FL7A 1S9DA 3GLHA 4OHVA 5FOTA 1OXUA 2C99A 4EIWA 2ONKA 4GT1A 2RGNA 1Z63A 1OE0A 5LDDC 2YHSA 3GMTA 1K5GA 1W2HA 1A2KC 1YR8A 2BCGY 5EUMA 3OAAA 1SVLA 1SXJD 1E79D 4CF7A 2CCJA 4U7DA 1US8B 1HV8A 1CXZA 1GNPA 1W5SA 4KAXA 3SQWA 4GOKA 1N5JA 2IYSA 2QP4A 2ZAMA 2ZE8A 2DFNA 3AF2A 4KFSA 1NKTA 1Q22A 4HSEA 4TTQA 3ICQB 3ASYA 1XMVA 5EJEA 3AVQA 4FCWA 5JJLA 3ADBA 4BEBA 3DO6A 1XCPA 3UIEA 2ZRJA 2QBYA 2UVQA 3DM9B 1LY1A 2F1RA 4JL6A 3KUCA 4M22A 5B2ZA 2G1JA 4URVR 1W36C 5DH9A 3X1DA 2OCAA 2KSQA 4BQSA 1I4LD 3GFTA 4WW0A 5JJIA 1NN0A 1G5PA 4Q7LA 4QC2A 3H1TA 1AS2A 4CT4B 2OHFA 2IEZA 4QBFA 1IXRC 1G1MA 3BS4A 3CO5A 3LBHA 3LD9A 3RS0A 5CB8A 3H4MA 3SU8A 1CR1A 1E2EA 4Q9JA 3C4JA 3QEJA 3FFBA 4C2UA 3CZPA 1DVRA 2F9LA 1U9IC 4RKFA 3LNCA 4A2WA 3W6PA 2W00A 1XPUA 2D74A 2GCOA 4J0QA 4L9WA 2X77A 1YKSA 3FMIA 4V0KA 4AC9A 1J70A 4B33A 4US2R 2IUUA 1Z29A 5DN6A 5FL3A 4NMMA 2H1LA 1T3SA 2VHCA 4LRWA 3TUJC 3AV0B 4QJ4A 4HLCA 2ZROA 2QEQA 5JHHB 1IN5A 3AKYA 5C4GB 2BMJA 5JMTA 4R98A 2CEAA 2WM9B 2YOFA 4MGKR 5LB4A 2XB2A 5DGXA 1QG2A 5FPTA 1QRAA 1UKZA 3PITA 4QNMA 3BXZA 1XXHA 2JATA 2BMFA 4OKSA 3EASA 2FX3A 1GSIA 2A5JA 1UPTA 4V03A 4M21A 1TF5A 4OQNA 3GEHA 2QN6A 1CP2A 1NBME 4TZ6A 4ZCIA 2W6JA 1ZUHA 3U7HB 1T0JB 1R8SA 2C9YA 3EWAA 1VHTA 4OK6A 3QXCA 1G6OA 4QL3A 3VR5A 4E09A 2ATVA 4LWZA 2YINC 3D31A 1XCGB 3HYRA 3LW8A 4M1SA 2PJZA 4LUCA 2GBLC 1FZQA 1QHHB 2L0XA 3T5DA 4DDWA 1TQDA 1NG1A 3IIMA 2AD5A 4HUQB 3HWSA 4I99A 4LV5B 3KKOA 4G5OA 2XGJA 2KBEA 4HI0E 4HLDA 1SVWA 5CIQA 4LYAA 4C4PA 1KMHB 2O8DB 5BXQC 4TT3D 1W49A 2XNDD 1UDWA 2ZEJA 3C7KA 3EC1A 1W0JD 3EIEA 3NHBA 4M1YA 1IXZA 4C30A 4JYBA 3TR0A 4IVRA 4MRPA 3U2QA 3KXIA 1KI4A 1TNDA 3FTQA 3L8YA 4DUGA 1W4BA 1XJCA 2PT5A 3RS7A 2AFHE 4I1OA 2OUKA 2IXGA 2J0UB 3L0OA 2IEYA 4LJ6A 2GXAA 3WP0A 3L0SA 1KY2A 1N0WA 4I1VA 1WXQA 1F48A 1QHYA 2HF8A 2ZR9A 4JL5A 4RD2A 4W5HA 3SHFA 2C8VA 4G5RA 3BH7A 4QM7A 1QHNA 4B34A 2I1QA 4NYJQ 2ZU0C 5IDVA 1RFLA 1NVVR 1Z2AA 3QUSA 3AVPA 2R9VA 4XD7A 4D4KA 2ZETA 4JLVA 4NU0A 3H84A 4TL9A 4Q4JA 3B13B 1NN1A 2WSSD 2RGXA 4X8MA 4DLRA 4LYFA 4A8JA 1KKLA 3R20A 4WAUA 2VRWA 4A0FA 4EQ6A 1TQ6A 2FZLA 4OJQA 3ADCA 3PUXA 3OEEA 2J7PA 4DEYA 3U4QB 2ZUBA 3B5JA 5TARA 2BDTA 1PZNA 4LHZA 4M9SA 1T91A 5F2EA 5F9HA 2AHOA 1AGPA 2ZRCA 4PQRA 1EWRA 3B85A 3SEAA 5EXXA 3U7FB 1DAEA 2HCJB 4C0BA 3NC1C 4OI4A 4C2TA 2FSGA 3LVQE 4M53A 2GEVA 2VSXA 1RW4A 3CF2A 5JJKA 2ZR0A 2FJUA 2AKYA 1GRQA 4ZKEA 1X8KA 4IDQA 3C41J 2D2FA 2PLFA 3VAAA 5FBWB 4LV8B 3REFA 3W8RA 1PLLA 2IF0A 4YLGA 1N5LA 1HA3A 2CHVA 1Z0KA 1II9A 1FUUA 2WWHA 1Z28A 2SHKA 3HYTA 2NPIA 2O8EA 4WZBE 4IJMA 4MUAA 4WXPA 1OFUX 1W4RA 1CTQA 2AX4A 3QI2A 4JSYA 4BLPA 1KYIA 2ANBA 1XTRA 1BKDR 1QHSA 1T8TA 3SYNA 4MITA 1AZSC 5FBLB 4MDEA 2J46A 4Y0VA 2VP6A 4HB4A 4RFSB 4NHOA 5CK5A 4BPBA 3WNCA 3LFUA 2VIIA 3J81k 2C98A 5GVSA 4A15A 4DCVA 4PO8A 5DYIA 3K0FB 1F2TA 3WNBA 5FR1A 4R7ZA 1WBDA 1S4QA 4OI0A 2ZIAA 3OE7D 5FPKA 2EQBA 4M2LA 4D81A 1G64A 5FBVB 1OW3B 5LD2C 1FQJA 5HPYB 3GCGA 4A8JC 1NVWQ 2ZS8A 4BRUA 3SJZA 5HKKD 1YZGA 3EC2A 2JLZA 3AGQA 2JLWA 2IA5A 5FTLA 5KHOC 1P2UA 3CF6R 2JLUA 3VKHA 4O25A 1NY5A 3QIAA 4P4SB 5AJXA 2FGJA 2ZSBA 3CRMA 3DOFA 4B3XA 4BFZA 2JJ1A 1JI0A 2NO1A 2NZ8A 1CEEA 2RCNA 5IK2A 3PEUA 2FA9A 1NBMD 1OPXA 3KKNA 5D3MB 2CE7A 3X1XA 3BJIC 4KFUA 1VCIA 1JJVA 2RGGA 2ZSFA 1J90A 3WNDA 3SC3A 5AK0A 4EFMA 4HZIA 2IXEA 4LC1A 1IJEA 2CBZA 2WSMA 5FOUA 3TRFA 5DNYB 4D4LA 2BBWA 3DPUA 1FMJA 3FDIA 3N5CA 4NL4H 3L2OB 3QOFA 1G3RA 3IEUA 2CNWD 5JWRA 4FW9A 2Q21A 1GILA 4PXAA 5GVRA 2OLKA 1TMKA 4I81A 3EIHA 1IY2A 2JAQA 4HYYA 4CDGA 1ZP6A 1XFAA 1EXMA 4FWIB 3GLHE 4LOAA 4NP6A 3W3ZB 3IBGA 1NSFA 3TW4A 3U60B 5C1BA 2Z4RA 3L43A 4E5UA 4HAVA 2F7SA 4IEIA 4B73A 3NEYA 3QG5A 1HURA 3QPUA 1CLUA 2AK2A 3ZVRA 1KO4A 1M6NA 2A5DA 1KI6B 1II0A 4NZYA 3K70D 1R5NA 4AYWA 3T61A 1JR6A 4NPHA 2Q6TA 1E0AA 3AUXA 4IXMA 4Q18A 3SDZA 3ICEA 1CRQA 4JSTA 2XOKD 4A0HA 2WHXA 4GMXA 4LBWA 5FUVA 2RKOA 1OIXA 3KXKA 3K8YA 2ZI5A 2HT1A 1DADA 2FSHA 3OEHD 5JRJA 3A1SA 4MRVA 4RZUA 1MABA 721PA 3KQLA 2ZAOA 4K46A 1FPMA 2HXYA 2Q0HA 3R8FA 3OIVA 3BK7A 3GJ6A 4RKEA 4M9ZA 1EFCA 2BOVA 2HJVA 2QROA 3N2IA 3P32A 5FTJA 4C3ZA 5JS7A 3OESA 4DKXA 2PLRA 1BH2A 1KY3A 3QF4A 3CNLA 1AQUA 4IHQA 2MMGA 1SQ5A 4M4SA 3RRYA 2IYQA 5CM8B 2J87A 2IYYA 2MSCB 2NIPA 4KSBA 5KSPA 4BECA 1NLZA 1ONBA 2JJ2D 2A5GA 2AR7A 4ERNA 3EPLA 5K8LA 1JECA 2WSSA 4IOJA 2OBLA 3DDCA 5H70A 3SZRA 1L8QA 2A78A 3M0EA 4ZDKA 1TAGA 4KODA 5CYPA 2P6NA 1G5RA 4UNQA 2ZITA 1TQ2A 1SVIA 3L0IB 5EP3A 2F1JA 2ZI4A 1PUIA 1VG8A 4MGYR 1ZNYA 3ZH9B 4D0NA 2PX0A 4R2HA 3TBKA 4PQFA 4HDCA 5FR2A 3S1AA 3VU9A 3ZD6A 1E0SA 5EUQB 4F93B 2ZSDA 1YJ5A 2OBMA 3AVUA 1XEFA 1N0VC 1XD2B 3W9YA 2CL0X 1G20E 2NTYC 2X2FA 3Q5EA 4GOJA 4D6PA 1XXHE 3KQKA 2PJRA 3F8TA 3K0CC 1S96A 5D3QA 1FFHA 2JGNA 2PEYA 4JJZA 2ONJA 5B57C 3LH5A 4URXR 1GKIA 4NE2A 1XF9A 3TE6A 4AYTA 1NMYA 1E9CA 3I4LA 3AVVA 4TQAA 3V00A 3TR5A 3HPQA 4GNKA 2FPKA 2ERYA 1P72A 4PAOA 5L3VA 4DBLC 2ZS7A 5FPYA 1G7TA 1KZGB 1UBEA 1YQTA 3LLMA 2ZQ5A 1KK2A 2GVDC 2W6IA 2QGNA 1D9ZA 1NJGA 3KFVA 3TQCA 3ZVLA 1WCV1 4YC7A 3VHXA 2QMUA 1N5KA 5GJVC 2FFBA 1W36D 1KSGA 1G291 2GVZC 1KO7A 3BB3A 1XBTA 2FMXA 4Q66C 4DLWA 2J7KA 1C4OA 4RY2A 4DXAA 3OF5A 1WF3A 3CRW1 3EA0A 4GI7A 1VMAA 4NKRA 1VIYA 1IXSB 2UZ3A 3UANA 4Q9KA 3R7WA 4CRWB 4YMSA 4QM6A 5E95A 2QTVB 1GDDA 4MKHA 1IQPA 1X8LA 2ORWA 5JEDA 2FFQA 4CEHB 4D25A 4IOKA 2ZRDA 3ZVMA 4EJSB 1AJEA 2IUSA 4A2PA 1GFIA 4TTRA 1Z6TA 2F3TA 2REXB 2R6CA 2ZRNA 1F2UB 1WQ1R 1ZC3A 5HTKA 3WRXC 3PCRB 2UZIR 3AF1A 3IQWA 4Q1DA 4OQMA 3W8NA 4N0EA 3F5FA 2AN9A 5FL7D 4DJTA 3A37A 5JCZA 3LQQA 4TLBA 3IIKA 4HDOB 2G1KA 2WMNB 3OIUA 2XEXA 4B3GA 3PVSA 1GG2A 2DWOA 1OIVA 4R2IA 3QKRA 1IY1A 1P2TA 1U90A 2A5YB 2YOHA 3OAAD 2NPFA 4F4JA 4DCTA 1PLJA 2QMHA 1SXJB 4URUR 5C46F 1P60A 4IDHA 4ON9A 3VNVA 3SJAA 2ZE5A 5KYKA 4HZUA 2HLDA 1BYIA 3TSZA 3NKVA 3A58B 4B75A 1PUJA 4RD1A 4HB3A 1QZXA 1CU1A 3I8XA 4Q4LA 2R2AA 3UWOA 1XJQA 5DLQC 2GILA 4DEXA 3I5YA 5KNCA 2QTHA 2WAYA 3PIRA 2EYUA 3AEZA 1RZ3A 1HH4A 4F38A 2F1IA 4ZO4A 1YE8A 2XTZA 1YRAA 4W5WA 2P67A 4FI3C 1Z2CA 1UJ2A 1RRGA 1FL9A 1N6IA 5JRZA 1W44A 4TLCA 2CLCX 3EAQA 4P4UA 1KJWA 1ETUA 4E22A 4GDFA 2IW3A 4NCNA 2GKSA 2QPAA 2J9RA 1RJ9B 1QHIA 3IKJA 4NCJA 2CE2X 4OBEA 3GD7A 2OV2A 5TMPA 4UNNA 2C5LA 4LSGA 3CNNA 3PUWA 3KKQA 3K9HA 4ZIRA 2BVNA 3CUEF 5DN6D 4JVLA 1IM2A 1VECA 3B82A 3I72A 4LPSA 5AUNB 1KI1A 3CPEA 3K0AA 1VCNA 1SVKA 4JKIA 4CW7A 1VYUA 2H57A 2XX3A 1FP6A 4L9SA 3CPJB 4EFLA 3MJHA 2FG5A 2WKRA 1V43A 4AKEA 2GCPA 1GTVA 4FMCF 4R9UC 4DHEA 1CS4C 1Z6GA 3NIBA 3EX7C 4H1VA 1TUIA 5P21A 2FEOA 8OHMA 4AG5A 4JLBA 3ZIAA 3A4NA 5CJ2A 2W6JD 2QA5A 1UEJA 4GRAA 1KDTA 4B71A 4FMDB 4PTLA 4B74A 2H16A 2QENA 2XZOA 1COWA 2GF9A 3PV0A 5DSZA 2KE5A 2EFDB 3GQBA 2NQ2C 4A6XA 3U44B 3GJ8A 4LCBA 1HQYE 4AWXA 1G8YA 4CEJA 1E6CA 2V3CC 2B8TA 4B43A 2QY9A 1YRBA 1GOTA 2VTKA 4PO1A 3MUFA 5A0FA 3VKGA 3CONA 4KVAA 3K0SA 2X2EA 2WJGA 4KO8A 1NIJA 2YNMA 5E7MA 5E3HA 5AUPB 2YZ2A 3LA6A 4JIMA 3BFKA 2IS4A 4YONB 3B1VA 1FX0A 4QBGB 2QSZA 4BFXA 4DUGD 2BBSA 1IN6A 2ORIA 4JVMA 1OXSC 4D4JA 4NCHA 3CRRA 2CCGA 1S9HA 2FH5B 4LBZA 4Q00A 2ZREA 1M1YE 3I73A 2HYDA 1LS1A 3NXSA 2CVFA 5EZ6B 4DDVA 4MDFA 4FCVA 4RCZA 2IF2A 1E0JA 2IYVA 4AKGA 4M8NE 5GADl 1U8ZA 1ZVQA 1A7JA 4ZDIA 1ZIPA 2GAAA 3LDAA 3BH0A 1T6NA 4JLDA 2YC4C 3UXMA 5G40A 4XD7D 3NBYC 2HV8A 2QG6A 1Q1EA 4PX9A 2IYXA 5CLLA 1SKYB 2W0SA 4Q9HA 2FPLA 1U9IA 4TMZA 2OLJA 3Q8XB 4M9XA 3RSLA 4LX0A 1JNYA 1E2IA 2RHDA 2ZU6A 3ZJYA 3EZFA 3OEED 1QVAA 2BM1A 2QMOA 3QBTA 2J7PD 4G5QA 5KSYA 1X6VA 4ZV4A 2C95A 4G3XA 4D80A 4KLZA 4MA4A 4DWJA 2QGZA 3KZ1E 4HAYA 3FFAA 4F92B 4Q4AB 421PA 2QL6A 4BGDA 1AN0A 3LX5A 1W47A 3QKSA 1I4TD 3A1VA 2DFLA 2WV9A 2GJAA 1G3IA 3KTAA 2F3RA 4PO9A 5BWMA 3U7EB 1SULA 1ZM4A 3P1JA 3T34A 3HU1A 3W6NA 4XOIA 4NBSA 4JLKA 3P4XA 2ZRGA 1FTSA 3B1XA 4HB2A 4JLNA 1G8FA 3K9GA 1DTSA 1R5BA 4PC3A 5GJWC 5FBRB 5GJBA 1GWNA 5TV2A 2GDJA 2FEMA 1MOZA 1E9EA 3NBXX 4NYMQ 4URWR 5KDLA 5J4YA 2GXQA 4BFUA 2D7CA 2GBLA 4WVFA 4TYNA 3KKMA 3THWB 3QXJA 2VO1A 1KI2A 4D2IA 1NVVQ 1O3YA 5AJZA 4DSOA 1GL6A 5KPJA 4V02A 1RPZA 3K53A 3DM5A 4O2LA 1OH8A 1N5IA 2ZRIA 4LYHA 2FFHA 5HCIA 1M7GA 1G17A 3GEIA 5A5GA 4B3CA 4Q19A 1VPLA 2ZRPA 2CJWB 1II8A 1W0KA 1KNXA 2QUZA 4TWZA 4B2IA 5BW8A 3GLFA 2BV3A 3WP1B 1YZKA 4UNPA 2G0NA 2JIZA 1HQCA 1TU3A 1XD8A 3CPHA 3H0KA 3AH8A 4ZDWA 2IYRA 2D3WA 3UK6A 4Q7MB 1UADA 4A2QA 3CH4B 2O8FB 1W4AA 5AWFC 5DI3B 3PEVA 1HT1E 3FHOA 3MD0A 2MSDB 3CX8A 2DR3A 1Q3TA 1G7CA 1TPZA 1KSHA 1Z6AA 4P4TA 1N6NA 2CXXA 1ZMXA 1AKEA 3QSYA 4AKHA 3TMKA 5DO9A 2JJ1D 1KIMA 5FBQB 2RHMA 1Z0FA 3RLFA 5IK2D 4DLSA 1WMSA 3QQ5A 2WOJA 3GLIA 3KJEA 3QPWA 1Z83A 1ZM7A 3DEFA 4AY2A 4PC2A 1Z07A 3BD9A 4EKDA 1JJ7A 1SHZA 4UJ3A 3C5HA 4DB4A 1DG3A 3WXMA 5G3YA 2J1LA 4LJ7A 1E98A 2NGRA 4C7OA 1IAQA 2VH5R 1ZM9A 2V1XA 4TL8A 3VR1A 1Q3HA 3NG1A 2Q9BA 4LHXA 4QGAA 1RYFA 1TEVA 1AM4D 4DCUA 5AUOB 4C0JA 4XWAA 3L8ZA 3OFNA 4YMVA 5FI1B 5J4HA 1HYQA 3GLGA 4MYHA 2ZE7A 2WTUA 1A1VA 3KQUA 2FSIA 2XB4A 1NVXQ 3BB1A 5HZKA 5DHAA 1GL7A 4JZKA 4PC6A 2JLVA 1H8HA 3CWQA 1VYTA 1ZD8A 1KO8A 1Z0DA 1GITA 1P2SA 4DDUA 4CEIA 1G18A 4GOXA 4IEEA 4CT5A 4LYJA 1LV7A 5BN3A 4ZCLA 4CYMA 2VPPA 1AK2A 2ODBA 4XWKA 5CIWA 3WRYC 1ESNA 3V4FA 2WWYA 1BS1A 4RFVA 1XDBA 4IDNA 5JSZB 4NYMR 4IXNA 5CM9C 2ZRHA 4QJ3A 2AXNA 1LFDB 1OXTA 5FTMA 5TVKA 4R71A 2OZEA 2YKGA 1NMZA 4TSFD 1KSFX 4KYIB 5J5CA 1IHUA 4XJXA 5BQ5A 2GJKA 1XP8A 1ODFA 3QVVA 1GUAA 2NO0A 3WY9A 2GXSA 2DWPA 3GFOA 3NVAA 5FFMA 3W6OA 4Q4HA 2O0KA 1IN8A 1P4SA 4DC9A 2B7BA 1E9DA 4A9AA 4O2RA 1SKQA 2PZFA 3Q9LA 4MKFA 1P9WA 4EAQA 3CH5A 3IIJA 2IYTA 1OH5A 1ZCBA 1KDPA 3GP8A 3TIFA 4AKIA 1DELA 5JI2E 4RD4A 2VHQA 2O8CB 5BYJA 4DIDA 1G9XA 3LVRE 2VA8A 2G6BA 2E9SA 4Q47A 3EA5A 4CIDA 1CR4A 5G53C 4A1FA 2AWOA 3M1IA 2CCKA 4LHYA 1E0KA 1DG1G 5DHFA 4PANA 4QJ5A 4DDTA 1D6JA 3K9NA 4RVCA 3NH6A 3G5UA 3VNUA 2PCJA 3RRMA 1GVNB 3T5GA 4EPYA 5EP1A 3EXAA 3CRVA 3TJZA 3E2IA 1L4YA 1XCMA 2JDIA 3NHAA 2XJ4A 4PHFA 1G6HA 1X3SA 5EP2A 3BORA 2XNSA 1HE1C 1ZD1A 4NDZA 3REGA 2JLYA 5FH9A 1NP6A 3WYGA 4GL2A 2D62A 1WB9A 1P5ZB 2ZVPX 1OKKD 3C15C 3AQ4A 3CZQA 4DSTA 2R8RA 4IVPA 1MO5A 4C0SA 2W6ID 3GJ5A 3KDSE 1UKVY 2ZI7A 2G9NA 1T4GA 2XXAB 4RZXA 3B60A 3CX6A 4BFSA 3U3MA 2QAGB 1ESMA 3CR7A 1W36B 2WWFA 4MQBA 4OQXA 3AKEA 4JLJA 1E2HA 2IWRA 1LVGA 3SJCA 1Q57A 4ARZB 4U00A 3CW2A 1OV4A 4DLVA 2ZJAA 3IPYA 1E9SA 3ZLJA 1P7CA 3E5HA 1UKEA 1Q21A 4MYUA 2J3EA 2V6IA 4BE7B 4OHXA 4WBSA 2Z4SA 3QENA 5FOXA 3I32A 1D2MA 4FMBB 4BLSA 4PAQA 2EWWA 3NC0C 2RGDA 2OCPA 1Z22A 1WE2A 3SBDA 4WOPA 1FMLA 2GA8A 3HR7A 4Q21A 2F43B 3QJYA 1E9AA 3A4MA 2J45A 4PPQA 1L2TA 2KBFA 4GZLA 2DCUA 4KXFB 3DZ8A 4JLMA 1RKBA 3THYB 3AM1A 4RZ2A 4BFTA 4CZ2A 1E1QA 1WBBA 1XEXB 2QZ4A 3EZ6A 3RRZA 4DT1A 2ASEA 3THXA 2DB3A 3RHFA 2QT0A 2XTMA 3GLHB 4N0DA 3MWYW 3RABA 4DZZA 5F3WB 4XSGA 3FHTA 1TF7A 2GF0A 3NDBB 4M1TA 4EUNA 1S3SA 4ESVA 3ZD7A 4WZAE 3CX7A 1HUQA 3DVLA 4LJ4A 1E9BA 3IHWA 3O8RA 3ZZUA 2PCLA 1SXJC 2B21A 4QHYA 2HLDD 4PAMA 4AIIA 2GK6A 3RDPA 2EFCB 4IW3B 3I3SR 2D06A 5B58C 4EPWA 4DLZA 2E1RA 2R6DA 1JPJA 4GSYA 1UFQA 2QBYB 2YWHA 3SJBA 3MJRA 3VTKA 3VR6A 5FOVA 3VFDA 4NCKA 3K0CA 5G41A 1CJMA 4AK9A 1J8YF 3SI7A 3GJ7A 4IKEA 1E2DA 1YHNA 2ZYWX 2BWJA 3VR2A 1Z0IA 3I8SA 4FD2A 1YZNA 1UM8A 3SYKA 1J99A 1ELOA 1BIFA 3WHLA 3EPHA 1RYHA 2P65A 5L3QA 1EFUA 2Z5FA 4HB0A 4JBYA 4DLYA 2ZJ8A 2BMEA 1DO0A 4LJYA 3TQFA 4H1UA 3CNOA 4PFSA 3BGWA 4TSFA 1LNZA 1J8MF 1I2MA 1R0YA 2HXSA 2GCOB 1ZJ6A 2ECKA 3SHWA 3GLFE 1U0HC 1KK0A 2MSEB 4NTZA 1MKYA 2IBMA 3SN6A 2OEPA 5CJPA 1JQJC 4BFWA 1OFTA 1H8EA 3UMFA 2CLDX 3UATA 3U61B 3QVUA 3GJ3A 4LZZA 4BLQA 5KOYA 1JBKA 4XVRA 2H5EA 3A1TA 2Q9CA 1BOFA 2BIFA 4JLAA 4MKIA 2ZRMA 1W48A 3SYLA 1U8AA 1FNNA 5HCNA 3IGFA 4RJLA 3QXHA 1XZPA 2ORVA 2VLIA 1XXHB 1LF0A 1N25A 2KJQA 3B6EA 3A4LA 4JL8A 2A3RA 5EE5B 5L3SA 2JA1A 4PPNA 4Z51A 3A1UA 1OIWA 3ZIAD 2XZLA 3RC3A 3BWDD 3GLIE 5HZHA 3QEOA 4HDQB 4HEJA 4UQOA 2PBRA 3RC8A 5C18A 2GTPA 4BRWA 4LJ5A 3T1VA 3RYTC 2GXUA 1COWD 1KHTA 4P3YA 4JLPA 4JMPA 3TUIC 4BUJA 4GBMA 3RAPR 1NLYA 2GJ9A 4Z1MA 1E9RA 4KSCA 2WJHA 3MG9A 4GPTA 2AK3A 4QNRA 3TVDA 4C0LA 4HLUC 2HT6A 1N6RA 2RGBA 1EFRA 2YC2C 3G82C 4KCGA 2IHBA 1SVMA 2OXCA 4KFTA 4PC7A 4QHTA 1OKKA 3TVTA 2V4ZA 2ZJZA 3SS8A 1US8A 4BLOA 1RE0A 1WDTA 1LW7A 2CMKA 4PQYA 5DIFA 6Q21A 2VP5A 5DISB 3GLGE 2EFEB 1G8PA 2R44A 2Z83A 1CIPA 2AFIE 3MAAC 1E96A 4OYHA 2VSOA 3NWJA 1E2PA 1HE8B 1VG1A 4RSGA 2BJWA 1NN5A 1P6XA 3AF4A 1P62B 4L8GA 1A4RA 1E4YA 1E69A 3QXSA 2ZPTX 2ZM5A 3KX2A 1KI8A 3LBIA 4OK3A 4B6FA 821PA 2RGAA 3PG5A 4V0LA 2NO7A 2OE2A 2YVUA 1XTKA 1HEIA 2XTNA 2XAUA 4LI0A 5KSOA 1MRSA 4X8HA 3H86A 1X1RA 2QPOA 2VHJA 1EWQA 5KU1A 4LY6A 2RGEA 4US1R 2HJGA 5EXTA 3VMFA 4EQ6B 1KJYA 1R0WA 2B92A 4WXRA 1JAHA 3LO5A 1SHKA 3N70A 4WZ6A 2O0JA 2R6AA 2BM0A 2I4IA 4URYR 1CJVC 5KNBA 1H65A 1MO4A 1X1SA 1P9NA 1YZUA 4GFDA 4UXJA 5IRCD 4PC1A 3RS4A 1BYUA 1ZINA 1KZ7B 2QI9C 2PMDA 2VF8A 5IF9A 2C78A 5EXSA 3BB4A 3V9PA 1OYWA 3VKWA 3VQTA 4ASUA 4RD3A 2ATXA 1OYYA 4EDHA 2VP9A 2OFOA 1VIAA 4EPVA 2BEJA 4OJKA 1IN7A 3DMNA 4YXWA 4KITB 4LV6A 2QNRA 4A92A 2JJ8A 4TYPA 2PT7A 2O8EB 1OFHA 3LW7A 1FUKA 1ZYUA 2ZRLA 4Q9IA 4PHGA 1YZTA 1QHHA 1TEXA 2NO6A 4YMUA 1Z0AA 2A2ZA 2FFAA 4HUQA 4BFYA 2IX3A 1MRNA 5C2JB 5J40A 2QAJA 1GL9B 1OSNA 3QE0A 2C9OA 3F3YA 4FN5A 1Z0JA 1S0UA 2Q3MA 3IBYA 2REBA 1W0KD 2BJVA 2F6RA 3OHMA 1KMHA 3U6BA 2O8DA 3EW9A 3Q72A 2QT1A 1F2TB 4KYUA 2JIZD 2WOOA 2EFGA 2A5FA 1YVDA 2QM8A 4LK2A 5FTKA 2Q3FA 5J47A 1W2GA 2ZS9A 1YR7A 3IUYA 4D0GA 4NONA 3HP1A 2OM2A 3KQHA 1PVOA 1C1YA 2OAQ1 2V9PA 2WICA 3TKLA 3OIYA 2WBLC 4TLAA 2FDCA 2WJVA 1G19A 2BKEA 1ZIOA 3AVYA 1QVRA 2J0UA 1JB1A 2H92A 3AVOA 5CYOA 2GJ8A 3T06B
chains in the Genus database with same CATH superfamily
1SBZA 3PFIA 4RK1A 2NMVA 2AJLI 4KWCA 3FVTA 1C3OB 2ZANA 3OHSX 2FWRA 3FVQA 4RSHA 4ZOLF 1CVLA 1NSTA 4IJVA 4D4HA 1XPOA 1CUXA 3H2YA 4W7IA 1R6BX 1MDBA 3GJXC 2Q3JA 2EYQA 2DTEA 1IEVA 3KFXA 5ICCA 1SEPA 5EERA 1EZZA 3DHYA 1L4HA 3ZBUA 1ZD9A 3A6FA 4E03A 2UVPB 1NQVA 1SH7A 5H8WA 2Q49A 5E2BA 3W77A 5LUAA 2PM8A 4YCDA 3B9BA 3MWKA 4FJ2A 1VMEA 3EXIA 4J3NA 3RQSA 1Z4LA 4LNUB 1K75A 3E81A 3OIFA 1VKZA 3C3YA 3ZNNA 2V54A 4WBXC 2KPOA 3KT6A 1SG9A 1EVQA 5EQTA 1RJGA 4MVCA 2EKPA 4B83A 1RWBA 1RWNA 4AURA 2IZ7A 1H2XA 3OZAA 4JI4B 4K28A 3RQIA 4F6CA 2NP7A 5HOQA 2WJ3A 4KBGA 3DF7A 4B79A 4A36A 3GYGA 2ID4A 4D44A 4QYXA 1RMTA 2I7CA 3ZCPA 3PXAA 4L5JA 1E2MA 3HFSA 1R0ZA 3PVZA 3ZDYB 1E1KA 2EQAA 2PL3A 3OQVA 4X5OA 1TFRA 2OXRA 4KKVA 1D5CA 1ZJWA 1CNMA 2CVOA 2FZKA 2HSJA 1EX7A 2RAFA 1W96A 3QFTA 4W5OA 1SXQA 1ZC4A 4W5QA 2IYZA 1PNOA 4QHSA 4X93A 1AKTA 1J2JA 4Z0NA 1I5OA 3RKUA 4BX0A 4CM8B 4JEUA 3SIWA 1JB9A 4WLFA 1FVXA 1A9RA 1VL0A 1J0BA 1M8GA 3GIWA 5CEEA 4GH5A 2YOGA 4R54A 4ZVOA 5AI9A 5G1OA 3ESXA 3UMCA 2I4TA 4N7RA 1RMYA 1NVUQ 2OSBA 4X63A 4CM9D 2Z6AA 5ED4A 1PS0A 4Z3OA 4RENA 2ZJ5A 1FMCA 1WTAA 4UASA 1ZK4A 4QPZA 3WHKA 2A9FA 3VU0A 3DXXA 4RFSA 4NECA 4UBLA 1GSOA 2LWIA 2OORA 3QKUA 1Y3BE 4H3SA 3HM9A 2QPTA 4FOSA 3L7YA 2X8JB 4ZWNA 3NBKA 1LEHA 3B1ZA 1R8QA 2NVUB 3CR8A 4NFSA 3VSEA 4M1ZA 1WQ3A 3I1FA 1NXVA 3GZNB 5JANA 2R2GA 1HK7A 1PIWA 2NYAA 3MTBA 1T8PA 3OKCA 3IDAA 2OAP1 1D5WA 1AVTA 1S1CA 4O2BB 4UDOA 2PBZA 4B6PA 4E07A 2CLOB 1T34A 5AHXA 5H16A 2WYUA 2GHIA 1KFBB 3RV4A 3UAGA 2YZGA 5LP1A 2QB5A 1KK3A 2SICE 3W7BA 4B3IA 4I1IA 3IAXA 3CLUC 3TX2A 1EM8A 4ZRNA 1ODJA 1WP4A 5CD1A 4IRMA 4QUDA 3KKLA 2CLFB 5EOVA 4QEZA 2VWHA 4EW1A 4FJ1A 4P6VF 4U6QA 4U0JA 3NPMA 1L4BA 2P35A 3KJQA 2HCBA 4Q02A 3LC7O 1WP9A 1MOPA 2R1UA 4PLYA 4TMXA 4RH0A 3S1AB 3VU9B 1GKUB 4D1YA 3OF3A 4B44A 1A5TA 4YMTA 1XTJA 3L06A 4IRUB 5AKKA 1RXYA 2ZLBA 1PJSA 3DZCA 3IP7A 1FSFA 2O52A 4V0SA 1DAFA 1Z12A 1ONPA 3H2KA 5E0KB 1DEOA 1L4GA 5GJCA 1KXJA 1TAQA 1XVIA 2ANCA 2P2GA 2P2YA 2WAXA 3HCNA 4KQWA 1JHOA 3HEAA 3LK7A 3PJDA 1IOLA 2Q7DA 5ICFA 1E99A 2QWXA 1OZHA 4ZYYA 4KU4A 3COPA 2JEZA 1P61B 1RHKA 4QYWA 2BHLA 1AQ6A 3FLAA 4LVUA 5FWYA 1JR3A 3OZXA 1E7MA 2ZSEA 3ECCA 3L7IA 4L07A 1XZQA 4P7JA 2GN0A 4GM0A 4POAA 2C57A 1UEXC 3BWEA 3BMQB 4L7QA 1BVUA 4NDAA 2EFJA 1NTRA 4WADA 1RHRA 5TY0A 5BSVA 2UYCA 1ZO8A 1CQPA 2XMDA 1SU6A 2X23A 5EKXA 4AFNA 1EFKA 4QODA 3CC8A 4M0CA 1YTLA 2EBUA 1E1CA 2J09A 4H6WA 4OD0A 2WE8A 4MA5A 5FO1A 4AYXA 3QUTA 2OFPA 2HCRA 3BDIA 3FFTA 2ETXA 3LY7A 3W90A 3MCTA 4QGGA 5TQ0A 4FLFA 3FNGA 3QU4A 5DLPA 2GJSA 4MWDA 3WQQA 4TYWA 4Y2YA 1LLFA 2WIBA 3AIOA 3NDIA 3LUGA 5ERXA 3EGOA 1KDRA 3B6JA 2DULA 3FPSA 4OK5A 1N2CE 5C34B 3E03A 3TZEA 5DDIP 3U3JA 1WZEA 3SQXA 2X15A 1XD9A 2OWEA 2FI1A 5KVAA 1P31A 1UP7A 1YV9A 3AJ8A 5AR1A 1PTJC 4Q1EA 5AJYA 4EY3A 3VSAA 3LA8A 2C03A 3VX4A 1X7ZB 3H7IA 3LY5A 4N40A 2XDWA 3U5ZB 1ZHOA 4DDVA 2QX9A 3AINA 1JEEA 3PGXA 4R6XA 1Y6RA 1YQUA 3G8BA 4RD0A 3V1LA 5C80A 1E1QD 2O6HA 5FCDA 2I6QA 2BFBA 5JAQA 1SVSA 1RPTA 1ZOLA 4Q7EA 5FWNA 3HBLA 3V97A 1X1QA 5HRAA 4A0GA 2QSUA 4FNGA 3HFRA 1Z26A 5KNBH 5LZ2A 2PGLA 3QKRB 1YD7A 4LTNA 3M9LA 1XRLA 1KWKA 3C7TA 8AT1A 3LUPA 2IY9A 3JZDA 2GPBA 2Q28A 5BT9A 3TH5A 3VPGA 1T3LA 4DA7A 2X41A 4KV9A 5L7TA 1EHYA 1YB5A 3EG9B 3QKTA 4K9PA 1NWHA 2R3SA 3WL4A 2JFPA 4BWGA 2A0YA 1B4DA 1S7CA 1HYHA 5ALKA 4DSUA 1VHLA 1QCDA 1R0BA 4I4TB 4UJ5A 3ZK7A 1FQWA 1Q0QA 2NTNA 4UTXA 4C03A 4KAAA 1RRPA 3VR6D 4WA8A 1Y6JA 3GPLA 1RJEA 3SVTA 3GLUA 3AGPA 2PGNA 2Z43A 1Q0SA 3KSRA 2NM0A 1XYGA 4GG1A 4AG3A 5AKIA 4LGCA 3OOWA 3MWLA 2EU8A 4MRMB 3VR2D 4CG1A 2VL7A 4UNSA 3IP8A 1SCUB 3G1WA 3KSBC 4XQ9A 1W7AA 5HRCA 3OC6A 4XRGA 1E4EA 2CK3A 3D6FA 1XYYA 4EGAA 1F6BA 5A4DA 3BD7A 3LUDA 2OV1A 5BSTA 1D4FA 2WT9A 3V4SA 1AQLA 3IP5A 2NADA 3SJUA 1QIJA 2ZSJA 3B1FA 4HAUA 5KYGA 5F9FA 3BC1A 4FBGA 3WLOA 1JU9A 1NV8A 3SFZA 4CI9A 1QO7A 1MOQA 2PH3A 2QTFA 1LPPA 5M04A 4MEJA 1G98A 2BF7A 4H59A 1BROA 4RXUA 2XMCA 521PA 2YXNA 1SUBA 1TK3A 1C0IA 4ZVSA 3E8MA 5DTMA 4PX5A 3T4PA 1B8NA 2NVBA 3N05A 3TX6A 2ISQA 3OZFA 2GK3A 1NE7A 5T4HA 2VZ0A 5TJHA 4X7RA 3VUEA 5JQGB 1H8ED 1PLKA 3K6JA 3RGGA 4WEQA 4DLTA 1OBVA 2FDRA 2PAFA 2X0NA 3C8UA 3JR7A 4PXSA 5D84A 4IYRA 1MT0A 4BP3A 3D3WA 3UN1A 4D9BA 1W75A 4ZD6A 4R41A 4TMTA 2OCDA 3EFHA 2PBLA 1E2JA 2O5VA 3DUFA 5H7XA 5A4KA 5BMOA 1IY0A 4MUGA 4CEHA 1UBSB 4P0TA 1K89A 3UH0A 5TIIA 4TMWA 1Y5LA 2PDAA 3DJFA 3V7YA 1HSOA 2DYKA 2X1VA 3FFXA 2I34A 1QH8B 3PUJA 3RC1A 1DTWB 2JIMA 4Z8YA 4DA4A 3RWMB 4PCVA 4EKIA 1BD4A 4EB0A 1GPMA 1R4AA 3D1LA 5DWQA 1SUFA 4LGVA 5T8KA 1EE2A 4GO1A 4CMEC 1U4NA 1L7VC 1J7JA 1WZCA 5E1BA 3IO5A 1EK0A 3TRIA 4EJ0A 3RAJA 4AJOA 5LLSA 2OBNA 3GQBB 2Y8EA 1VG9B 3S3TA 5BSUA 2O2ZA 4WFQA 5JDCC 3JZAA 3OKFA 2JFGA 1TF2A 4XFKA 1ZDMA 1ZGCA 3IMKA 3M5CA 1N5DA 3Q3CA 5ICMA 4CEJB 2IHJA 1DBSA 5EZSA 4MV3A 3SBXA 1OI4A 4M6WA 1CIVA 3PRJA 1XWWA 5T7BA 4PSAA 2CL5A 1ZMTA 4W1QA 1J6UA 3IDSA 1RKXA 3LWNA 3FCCA 5KNDA 1G41A 3FVWA 2WWGA 1QLHA 1P1FA 3KSZO 4GM4A 1WM1A 2C2HA 2VP3A 3TB4A 3N75A 2RHCA 3NNSA 4D0RA 5JO9A 4WK2B 2OBYA 3AHJA 4YRRA 1FX0B 2LCQA 2PL1A 4M7WA 1U7PA 4PU0A 4AVYA 5DBIA 3ZQJA 4DV2B 4BMYA 3N74A 5DGIA 2A1IA 1OAAA 4XB6B 4HTAA 2QQ0A 2WKWA 3CKYA 1SIWA 3OC0A 1Z5VA 4PX3A 4X9XA 4I3HA 3JTMA 5AVJA 4P0PB 2YV5A 3BA6A 4BLTA 2OO5A 4B82A 3RADC 1UK9A 1Y1RA 2IS6A 1CUZA 3L02A 4XUEA 4YEDA 4ER3A 7REQB 3FYUA 4G01B 4UUQA 1VFNA 3N2EA 2FPMA 4UTZA 1Y7LA 4DIEA 1NW4A 4B2LA 2I99A 4KZPA 3FPLA 3QVGA 3RS3A 1QZ3A 4HGRA 4V3BA 4JJ4A 4EJSC 1C9EA 2HPHA 2ZJBA 1E6WA 1V26A 3DVAA 4IDFA 1V16A 2FX5A 1AQYA 2I7VA 3L7MA 1RJ9A 2RC5A 4RV4A 2IXDA 1GRRA 4X8OA 3OFSA 5LP6C 1VSTA 2DQSA 5GONF 3ZWXA 3TG2A 1A9YA 2NLOA 4L5CA 2E5LB 2ICAA 3DP9A 3IBTA 3GCWA 3ISVA 3SX2A 1QYCA 1V95A 1USWA 1XA0A 3KYJB 4QGHA 1WHSA 1SUIA 2H0RA 2WJYA 3GH3A 4PBRA 3INGA 3TAUA 1DDGA 3S0JA 2DMRA 4WT7A 3KB1A 2JGKA 2ZRKA 2ZYHA 3LY8A 1XAIA 3GHYA 4GWKA 4ND1A 5FB3A 3EDQA 1MW9X 4PLPA 4ZCMA 4UFOA 4AMYA 1TYAE 4HMOA 2BM8A 2WWWA 4Q1FA 4CMHA 4D42A 4EUEA 8LDHA 3OQIA 4HNRA 1XDUA 1EVIA 2IP4A 1IZ7A 2OLEA 3TQTA 2CJXA 3HB4X 1BU5A 2XD9A 3FMOB 4ND6A 4EUHA 4HLQB 1I7NA 1WLSA 1TECE 4NYJR 4QQNA 1J23A 1FTYA 2HNKA 4Q01A 1HE2A 2ZPAA 1TVMA 4CKEB 3BAZA 1BEEA 3VGJA 2AQIA 2AE1A 4IXTA 2GZRA 1N6KA 5A3SA 1A8PA 4R01A 1YHYA 2KWIA 2H18A 2VZLA 4B76A 5F4ZA 4CNQA 5F1OA 1YNOA 1RRFA 3LT5A 1HDRA 3RFCA 5KSZA 3PXGA 2WZQA 1K8RA 1W5EA 4NV3A 2F9MA 3K09A 4BCBA 2XZPA 3SX0A 2Z3VA 3ADKA 4OMUA 4YCCA 3ANSA 2FW8A 3WJAA 2A1TR 5IARA 4QUJA 2C9ZA 1NXSA 2Z98A 2JAOA 4NQRA 3RSCA 1JR3E 2P3OA 2BY4A 3GI1A 2PV0A 3A8TA 2K5UA 2YCLA 1F3OA 4PAGA 1ZUIA 2XNDA 2XMRA 2XCTB 3VH4A 3F7OA 2V6JA 2ARKA 3PD1A 2Q62A 4M89A 3WL3A 3L7AA 3IDZA 1B8UA 3KP1A 3ONWA 2QL7A 2C31A 2AW5A 1H0KA 1CWUA 1PJ3A 1WBJB 3F3SA 3H83A 3K0HA 3KPJA 1DKUA 2PD4A 2RAVA 4MCJA 2GHQA 2BMWA 1O97D 2X0EA 4UHCA 1JQEA 5GAJA 3IUEA 4RS3A 1NI5A 4TM7A 1FBTA 5TXGA 1BO6A 4DLKA 1ZVKA 3Q98A 1XMSA 3PYXA 1ZJJA 4KP7A 5DM2A 1OU4A 4XR9A 4ND5A 3FHJA 1C7ZA 3QXXA 2D6FA 3DTTA 2OV6A 3NBFA 4DCPA 2D4HA 4QFMA 2B8NA 1OB5A 1NURA 5EY5B 1NRWA 1D2NA 3LG2A 3QE4A 4KGDA 1TYDE 3KQUA 4ZPXA 2WB2A 3KYDA 2IZ0A 4ZVQA 5KQRA 4S1PA 1BS2A 2D5BA 1Q1AA 3DOEA 4GPZA 4K6HA 2I3BA 1YACA 3C1OA 3CNEA 3A6DA 4MOWA 4RQUA 3ZDEA 5ADWA 1XN4A 4O1IA 3DGFC 2C9CA 4RORA 4XSHA 4L57A 3RFFA 1BQ4A 2DWUA 3LC1O 4XARA 4F7DA 5C3UA 3TXYA 3PEYA 3VR4H 1KO1A 4MJ7A 1PNRA 4HPWA 2VOJA 4XVQA 3R1IA 4L2IA 3MFYA 1LC0A 2AKAB 1ZM3A 5I7AA 5HF8A 4QUBA 4YJFB 5F78A 3TQSA 1DS6A 2PQ2A 1HWYA 4KPEC 2WMYA 1SN7A 3PJGA 1KS2A 3T4UA 1W46A 1X80A 4LXQA 4KRGA 3QPVA 4MQMA 1X38A 1Q95A 1TLLA 1EP1B 3ABZA 2CLMB 2R7AA 3P9PA 4DLUA 5DX1A 2ZTMA 3BE4A 1T5TA 1ZI6A 4ZJZA 3ZWAA 2ODNA 1EP2B 3HSSA 4YRTA 3SMVA 1QIDA 4FUTA 5IXYA 1KAQA 3DHEA 1J2RA 4YVFA 2JFVA 3O8DA 3R44A 3INYA 4GEKA 4XQGA 1E3MA 1EUDB 3NTUA 3W9UA 2AFIB 4PX2A 3DAHA 4C0HA 3QA9A 4C6SA 1XX6A 1LXCA 1TKRA 1I7DA 1GSHA 2J6CA 2CWDA 3B3GA 4KGZA 2CV2A 1GM5A 1VE9A 2V4UA 4JHLA 2HD4A 3EW7A 4OSPA 3R0ZA 3RIMA 5JW6A 3DQPA 4RGYA 1WS6A 4BDSA 4P81A 4DCCA 4OQEA 4Q48A 2X4IA 2VPYA 4EPRA 4TTVA 1ZNWA 1E3EA 1J49A 5HQ3A 2XQJA 2VTBA 3VU1A 4BZXA 3KQVA 5HXAA 1VOTA 1RBYA 4K9DA 1CY4A 3I28A 4BRSA 4YJ3A 1KAMA 3ZZNA 4CTMA 2W71A 2W2XA 2VDMB 3OOSA 1PR0A 1UBGA 1I4OA 3PYMA 2FSFA 5DYNA 3TLBA 2ZCVA 3I61A 1XU4A 4J0HA 2OENG 4CVNA 4OXYA 2AZMA 1ZBDA 3AB3A 4N0QA 4X60A 4N5NA 1GZHB 4BE4A 2C4VA 1G5FA 1WKVA 3R9KA 4A4DA 4BIMA 4P7BA 3MD9A 3ZHUA 5CLHA 2BGTA 3QFRA 4DLAA 2CJPA 2PTHA 1FK8A 4GRDA 3BXEA 4NBUA 4UMFA 1CJKC 1N1MA 3IMCA 3E3OA 5JECA 1FYFA 1XALA 4E5YA 3B7WA 2RAPA 5SZJA 2GI4A 4M99A 1DKQA 1Y9ZA 1Y5MA 4HJRA 4Q4HB 4RK4A 1PL8A 3OE7A 4A8JB 4L8YA 1ZNXA 1V5GA 4HG2A 4JYMA 3AF0A 4MYCA 1M1UA 4NOKA 5ITWA 1JVSA 1LDNA 5L53A 2GRJA 4ZZIA 5DI3A 5B1HA 3NM5A 2C9DA 1CKEA 2FE4A 2QE7D 1E3LA 2PZBA 3E70C 3M6AA 5JCPA 1JAZA 1NR5A 1VKOA 4V0OA 4AZ3B 4XPIB 3GVXA 2ZI6A 3AVXA 4PSVA 2LUOA 3ZGXA 4OHUA 1VHJA 1P4GA 1E6EA 2ZBRA 2JIPA 6AT1A 4JI2B 3SKXA 2B1JA 1O5TA 4AB1A 4E5PA 4EPTA 1BWQA 4K1XA 4CLEA 1E3QA 2XMGA 2NG1A 1A04A 1G55A 2DFDA 1AS3A 5ALSA 1DAIA 5D85A 1TMYA 2POQX 1DRUA 4HEQA 2FR8A 4GPEA 1FLDA 4CLOA 1W94A 1NJFA 2VF4X 1P0MA 5BR8B 4FFSA 2WKSA 1GP2A 1WB6A 1NXPA 2AXPA 3L7LA 4IVQA 3EZ7A 2XUQA 3TOXA 4C4PA 2IEDA 2XR1A 3H13A 2FOLA 3D8NA 1T25A 1XZFA 3OCYA 1U98A 3EVNA 4OGGA 4OI2A 4EECA 3UB2A 2FMHA 5C35A 3C3KA 5IAGA 1IN1A 2VZ9A 3R6WA 3VPCA 4D02A 1Z7YA 2XBLA 1MFPA 1EHIA 3JD0A 3F74A 2DTDA 4M38A 2AJ8A 2Q7OE 1ISIA 3BRWD 4L0DA 4U2GA 1AN9A 4MWEA 1W4LA 2OL4A 1FRFS 1CT9A 2VDJA 4MYDA 1SA0B 2VNSA 3I58A 5LU8A 1M6VB 2AEMA 3B51X 1CS0B 3TTUA 1KEVA 1VA4A 2GARA 2AFHA 1SBYA 1ONOA 1N2IA 3NBUA 1M7BA 4IUBS 3Q5DA 4EG5A 4F60A 1PT7A 1C4WA 1OV6A 2Z5GA 4QRIA 2H4ZA 4ZI7B 1R12A 4KNWA 4BUCA 4RVNA 1W6RA 4CIVA 4K9OA 4RK5A 2GTHA 1V9SA 2GERA 2RIRA 4HJXA 3GDGA 2R4UA 1KOGA 2AN4A 1JGTA 2GETA 1F60A 3Q11A 5BSGA 1XYVA 3CW8X 4Z7NB 3ZE7A 4TRJA 5AVKA 4YAIA 4NBRA 5K3OA 4FEYA 4YPVA 1S3GA 1P7WA 3HFJA 5TJ9A 3D8TA 4K8OA 2H9IA 3DTVB 3CUUA 4QX6A 4P33A 1BXGB 1TRHA 1UBNA 2GZAA 2O7NA 3PNPA 4P38A 2PNFA 4G9BA 4I9GA 4ENRA 2V97A 1N2GA 3ICWA 4XVUA 5JXWA 1PX2A 3FKSD 4JSRA 4WJKB 4C0QC 2P0EA 2CHFA 2JCSA 4F04A 4YCSA 1JFRA 1E20A 1V5WA 1SD2A 4L9RA 3THXB 5FUWA 4DIFA 3WAKA 4EH1A 1M2OB 5FRDA 2QLFA 1JKXA 4FGUA 3F0TA 2PPLA 3WGZA 4WXEA 4QU5A 1KP9A 2H4FA 2XLBA 3VXKA 1B0PA 1K7FB 2ZB4A 3IAAA 3LHFA 5DM1A 3QU2A 1WMFA 4ACAA 4EFNA 5L8VA 1I7QB 1B6GA 4V1CB 4JZYA 2VPQA 4OB7A 2A94A 5G02A 4FWTA 3EGCA 2A6PA 3Q85A 3DZGA 1Y1PA 2MJLA 3UKJA 4C2BA 2IXTA 4I5GA 4CCAA 3KALA 4IS2A 5TNXA 2PQ6A 3NUQA 1G7RA 1A8HA 1I7LA 5K3SA 2B8JA 4CV0A 1DNPA 1SIBE 3RHTA 1K0FA 2OG2A 3ZHYA 1GGJA 1U2GA 1X7YA 3K20A 4DANA 1YB4A 2L69A 3QBVA 1FFWA 4FNMA 4OJMX 4PS0A 4S1NA 4WY2A 4YJ2F 5EJ4A 2ENUA 3IFSA 1WRBA 1UXJA 4ZDJA 1FUIA 3K5IA 2BLNA 4Z9AA 1ISMA 1HE3A 4OI1A 4R4JA 5JXIA 3NEAA 3UJ9A 4RVDA 3X2SA 3GUZA 2V6GA 3GXOA 1WB4A 4A26A 4CQMD 1MQ9A 2AMLA 3KHKA 1TK9A 1QQBA 2ZYVX 4LGYA 3I09A 3LIPA 4G1UC 4MRRA 1YQEA 2XQVA 3TSCA 5JNLA 1YB7A 3DMTA 1I0IA 1NPTO 3QEAZ 1LBSA 1FOEB 1ABFA 1BMFA 3G2OA 1QJ4A 4JKOA 3TUZC 4WQMA 2EJUA 2PSFA 1OQAA 3A0RB 4ML3A 2QQEA 1LB1B 3UWKA 5KTNA 2J41A 3AVWA 3SIRA 1EE9A 2OQRA 3AEKB 3QMPA 4NAUA 4UULA 3ZKAA 1LI7A 1ID1A 3F9CA 4DDHA 3FWYA 3IIIA 3FWZA 1OFGA 1P7VA 4JP8A 1CR2A 1DOAA 2N1BA 1XEAA 2X5XA 1BD3A 1N2XA 1TA4A 4LDAA 1YU6A 2YICA 3AC0A 4D9KA 4JBXA 4QLBA 4ZCSA 3ENZA 3WLMA 4KQFA 3LBNA 5ALWA 5H59A 3H11A 4GL4A 4LXHA 3U0BA 1XZHA 1XTIA 2Q5CA 3HYLA 4BX8A 4CN9A 1VE3A 1QQ5A 1QH1B 2DTXA 2ZWVA 3ROEA 1LVUA 3D43A 2V03A 5AHKA 4D46A 3RPEA 1C9JA 5JCJD 2Y0PA 1MO6A 1XMJA 5I5GA 3EIQA 4G0NA 2ENWA 3VYWA 3DL0A 4GICA 4YAJA 1G3MA 4X00A 3MMPA 5BN4A 2Z1MA 1XTTA 5CCDA 1O96A 1CNFA 3OQJA 5JARA 2A1UB 2GJ4A 3QGMA 3PL1A 5FPHA 2ZJOA 2QP3A 1GQOA 3W79A 2G72A 3VYVA 2F43A 3FVVA 1N3BA 2PNJA 3VNSA 1U81A 1E32A 5JEEA 1MJGM 1NDHA 3FMGA 5GGYA 3KL2A 3P27A 4XRRA 4RQTA 5CFNA 2BFNA 2CXRA 2WSIA 4Y9UA 2QORA 2CNBA 1KGSA 2FU5C 1B00A 2VTDA 2WHPA 4O2AF 3PFHA 1XEXA 1X7HA 1PBNA 3OZVA 1CJSA 2WF9A 3EULA 4EEXA 3M3PA 4IIYA 1QO0D 5ITVA 2C99A 4NZNA 4WJLA 4KZKA 5H83A 4EIWA 4GT1A 1F7VA 1PQWA 1OE0A 3L0DA 5LDDC 1WUKS 3EEOA 3ZUGA 1R0CA 3GMTA 2EERA 4ZZ3A 4R3UC 4TT8A 3GEDA 5EUMA 1YR8A 2BCGY 3HWX1 3OTWA 5BW5A 3J80A 1CHNA 1SXJD 1USVA 4JI1B 4BMZA 2OK7A 2CCJA 2YVAA 3HA5A 1HV8A 1CXZA 1W5SA 2AYYA 2QP4A 2QJRA 4GOKA 2ZAMA 2WIGA 2DFNA 5AJUA 2YY5A 2PKWA 3CXRA 3FUCA 4HEHA 3RSSA 5EJEA 4W99A 4FCWA 1CDDA 4O4JF 3QUCA 4BEBA 2HH9A 1PYDA 2YNMC 4D8YA 2N47A 1IY9A 2GCEA 2G06A 4FE7A 1UT5A 2ZW9A 4U7HA 5GZ3A 1PSWA 1DAPA 4XEUA 2F1RA 4QTTB 4URVR 5DH9A 1RZRA 1FFCA 2OCAA 4G81A 4RF5A 2CJFA 3MBKA 3DHNA 4BQSA 4QDXA 5JJIA 1BGVA 5T64A 3IBSA 3JX9A 4KACA 3H1TA 4H0FA 4POOA 4WK6A 1Z15A 1AS2A 3ZI7A 4UU8A 4C4OA 2XYHA 3WDMA 1ADFA 1CUBA 4QLAA 1EPUA 2IEZA 4HY3A 1QUEA 3LBHA 3LD9A 3LDFA 4CM4A 1TVCA 1ZOSA 4PWZA 1DP4A 1QIIA 3L6CA 5C8YF 2ZM6B 1SU4A 3G6KA 1HXHA 4Q9JA 5FBHA 3HC7A 3B6IA 4N3CA 4DUZB 1Q91A 3FFBA 3K4QA 3MT0A 3WX0A 4R5HA 1U9IC 1VJTA 4RKFA 4UTRA 1GARA 4L5AA 4A2WA 3MGGA 4OFWA 4BMXA 3V8BA 4L28A 2GCOA 4L9WA 4EB8A 4V0KA 1V7ZA 2AOUA 1J70A 5DBGA 3DMGA 4ZC8A 3R7BA 4US2R 5DNAA 2HA3A 2JF0A 2IUUA 1Z29A 1NUPA 1NYRA 3I6QA 5DN6A 4C7MA 3D64A 4NMMA 2Q2NA 2XBUA 3C43A 1T3SA 1LGYA 2VHCA 1T9ZA 2TMGA 2Y05A 1E8NA 1FMTA 1K63A 4OYYA 5CUQA 3P52A 4HLCA 4C4XA 3MRTA 1M6HA 3AM3A 2QEQA 2PXHA 1IN5A 4Q3EA 5C4GB 1WXEA 4MGKR 3UW3A 5LB4A 4N01A 3SYRA 4D74A 2JI4A 3UB4A 1QG2A 4D57A 3VSBA 5GMOA 4ZMRA 2NSLA 5C37A 2O2SA 1SXPA 1LZLA 1UKZA 1DO8A 2BFAA 5I9LA 2JATA 4O5OA 1NKVA 1EBUA 1JXQA 2A5JA 2IZ5A 3CN7A 4ZQFA 4CMGA 3HKCA 4KE9A 4OQNA 4AS3A 1QSGA 3DP7A 2O6LA 4B0PA 4DZTA 4TZ6A 3KXDA 1JDTA 1GGHA 3CQ9A 3DW1X 4UBJA 2C9YA 3TTWA 1N9GA 3FPGA 3VR5A 2H2DA 3QXCA 1G6OA 2JFQA 2VRCA 2DFVA 3QEKA 4LWZA 5D00A 1SMKA 2D5CA 2YINC 4ZO9A 5ALGA 5I8PA 3JRWA 3G79A 1KJ9A 1QHHB 3E53A 5LKRA 3T5DA 1TCBA 1TQDA 1XE3A 2FPXA 4D9IA 2MTBA 4HUQB 1VBFA 2E1PA 4ZVLA 3MJEA 4KO2S 3KKOA 4ED9A 2DG2A 2HMAA 3M5PA 4EHFA 1QKIA 4HLDA 2YZKA 1SVWA 4Y6SA 3QWFA 4M8IA 4LYAA 4MX8A 1KMHB 2BFEA 3KWMA 3QYJA 1K4KA 2AOTB 1W49A 1SVUA 2M6KA 1UDWA 4MXDA 1SWVA 3AFIA 4M1YA 3U4MA 4OYLA 4G63A 4WCDA 5DB4A 2H0QA 2JGDA 2W93A 4B09A 4MRPA 4BB6A 3DZHA 4ZYUA 4G85A 2RHTA 4LA4A 3K05A 5ARBA 3U7RA 1TNDA 5LCXA 1A9TA 3B3QA 1K8YB 4FFPA 4FOOA 3FRHA 4H77A 2AFHE 1KYVA 2P4SA 2VJPA 4I1OA 2OUKA 1YXMA 3L0OA 1GPBA 2IEYA 4WMLA 3L0SA 3OZ7A 3QYPA 1X3LA 4RE6A 2HF8A 2J3MA 1Y48E 1XL1A 4W5HA 2AUTA 2ADFA 5KQPA 1TT7A 3L18A 3JQ8A 5CR9A 2CV1A 4FFOA 4ZALA 4LJSA 1YAJA 4CKXA 1I7SB 1C5KA 1Z2AA 4DYVA 3C6YA 1KTIA 2H4WA 3F8SA 1K8QA 3QRWA 2JKZA 5EWJA 1E6MA 2R9VA 2HIAA 5HQTA 1YZHA 4Y6RA 1YS2X 3JWHA 4S1OA 2H4YA 3VJKA 1BGWA 1KFJB 4Q4JA 2ACEA 3B13B 3PGJA 1RQPA 5GGXA 5CAEA 1KKLA 3T3HA 3WK8A 2ETVA 4A0FA 3S2IA 2XEDA 1MHTA 3W8FA 3OEEA 2O3SA 1LU9A 1K3TA 1O0BA 2RJ3A 4DEYA 1FNDA 2RSLA 2C2YA 3AR5A 4IDBA 4RA6A 2X9GA 5HA5A 3ZE8A 3T52A 1P0IA 1GDHA 3H5AA 4OO3A 4TXHA 4IFIA 1T91A 5EPUA 1LLQA 5F2EA 5F9HA 3N59A 3B85A 2PLWA 2UXBB 5EXXA 2OA0A 1XA4A 1Q1NA 1YFZA 4C0BA 1BWPA 1EFPB 1JSCA 3KJXA 3NC1C 5AYVA 2RAUA 2WFAA 1JIVA 4M53A 3SG0A 2GPAA 1MB0A 1P1BA 2FJUA 1PGOA 4ND8A 3WLJA 3DE2X 1X8KA 1BCSA 1NUUA 2VDUE 3C41J 2D2FA 4UVEA 1UIRA 4CI0B 5IHXA 4JP5A 4DG8A 2DKFA 1NU6A 5A4IS 4UUNA 4B6QA 5EUBA 3Q7EA 3EXG1 4RK0A 1M6WA 1Z45A 4BWFB 4ZQCB 4DXDA 1UZUA 1INLA 4IH4A 3BD6A 4R5MA 3TZHA 1PJCA 2WWHA 3TOSA 5CX4A 3EUAA 3M6LA 2H63A 1CQJA 4MUAA 4WXPA 1YRYE 3NOQA 1CTQA 3JQFC 4JSYA 5A7FA 1MAAA 4BLPA 5AD1A 4R8LA 1QLJA 4KQCA 4RABA 1QHSA 4LF8B 1GLNA 4MITA 5FBLB 4EFDA 2J46A 4N12A 1Y6FA 2VP6A 2J5KA 4YRDA 3G7SA 3LMKA 1HFKA 5CK5A 2FW0A 1D6MA 1EGMB 4OQDA 2C0CA 4OLJA 1KQOA 2VIIA 5ALJA 5F51A 1Z4QA 4A15A 1U3UA 4PO8A 2QRLA 3K0FB 3CHYA 3UGJA 1KVUA 3I4FA 1QDLB 5TT0A 1JEJA 4G0WA 2BH9A 1JZTA 2A92A 2RKBA 2G9RA 4MICA 2EQBA 2RI0A 1TEHA 3T9AA 1P5FA 4D81A 1LBTA 3R0JA 5FBZA 4A8JC 4IHAA 5JMWA 3AHEA 4G6ZA 1ZH0A 4LJRA 1YZGA 2Y1WA 3EC2A 3NKLA 5AHRA 1ZXXA 3ZCUA 2JLZA 4YRQA 3HM2A 4G2TA 4MS4A 2JLWA 2P62A 3LS2A 3D2CA 2GZ1A 1DQRA 3NS7A 4OHRA 3M6VA 5C5EA 1VLZA 5EIBC 4HEA1 3K71B 4BFZA 5EJ8A 2FP3A 2JJ1A 4F0JA 4MPJA 2NZ8A 1A96A 3WLIA 1L5KA 2FA9A 1JWBB 2PO7A 4MO2A 3TTTA 3CKKA 3F2IA 4BQPA 2AGVA 3HGTA 1HFJA 2R8OA 3BJIC 1H94A 1ZWLA 3R5TA 4EOGA 5CA0B 1AC5A 1JJVA 4Y6QA 3L07A 2ZTHA 3U1BA 2QUIA 1DOHA 2XE8A 3UH1A 4BBPA 3A25A 5HIAA 4ZOBA 3P7MA 2H65A 5AK0A 4RBNA 2BEWB 2WSMA 2CBZA 2CXTA 2XOXA 3PJFA 3H97A 1U5AA 3DPUA 4V0RA 1NP7A 3WL6A 3S7ZA 5JWRA 4FW9A 4YRFA 1URPA 4E46A 4C6TB 2VJMA 4QOFA 1L4EA 4IIEA 1E18A 1TMKA 2PUHA 4YECA 4OP1A 3M49A 2JAQA 1RKVA 2O9JA 4BFLA 4FWIB 3SC2A 3IBGA 4RVOA 3ITDA 1PJ4A 1JWLA 5K8JB 3P9IA 2A4KA 5AVZA 3DZJA 3RAFC 1Z82A 1TLTA 4I1YA 3ND5A 4BUZA 4IYJA 2XA1A 3EC7A 1V48A 1SZCA 3DT8A 3N0XA 3PHHA 4WY8A 4B73A 3TLMA 2HB6A 1KEEB 2AK2A 3LOUA 3OLXA 2WYHA 2FZWA 2RJNA 2ZWIA 3LT0A 3K70D 1PEYA 1V5EA 1L1EA 1X8XA 1NI4A 2FQ1A 2RG1A 2VKTA 4CDNA 2PKEA 4DABA 3T61A 1NRXA 2GKGA 2GA9A 2E37A 2Q6TA 4JQYA 4IXMA 4Q18A 4HFJA 2B4TO 3SDZA 4JSTA 4A0HA 5K8CA 3HCAA 1ESCA 3NV9A 1B15A 2B2XA 3NHRA 3LF1A 3LCCA 4RK6A 5DNWA 3A1SA 3KQLA 4QVKA 4RZUA 3A1EA 3UOGA 1U0TA 3H7AA 2B0CA 4HS9A 1VLLA 4W63A 2C1EA 2Q0HA 2RBKA 3UT5B 2Z2KA 1DQPA 3EYAA 2QROA 4OKIA 4YYEA 4RTMA 3MWEB 1QYDA 2IQ5A 2P90A 4MP8A 4AJ9A 3HTXA 5COAA 1TI7A 2C8JA 4OHBA 3UJ3X 2O1XA 2JFUA 1KY3A 2EKZA 1AQUA 2LE0A 4IHQA 2C84A 4Z3KA 5JSQA 1EFVA 4L0MA 4AM8A 3S8YA 3H2JA 4IMPA 2IYYA 4YK7A 5LP6F 2I4LA 4I36A 3ZKWB 4BECA 5A3JA 1VZ2A 2A5GA 2AR7A 2WSLA 5ALYA 1GZ6A 3K30A 3WLQA 5LXTA 1YA4A 5EHNA 2OBLA 2HXGA 3B2NA 3DCNA 4RQAA 3H1AA 4AF8A 1VLJA 3FLEA 1XNRB 1SQ0A 2J4DA 3M0EA 1TAGA 4UVIA 4KQEA 5LWQA 4EGCB 1NF8A 2ZITA 3CLUD 2GD2A 3DDUA 4O0LA 4C0XA 3B3JA 1IATA 1QIMA 3AI2A 4LZAA 1QBGA 3I9FA 2FP4A 3I6BA 3T41A 1PUIA 1V3QE 5C81A 1VG8A 1QV7A 4HX2A 1Q7CA 1VB3A 2FQXA 4LZPA 3I9LA 2OV4A 3CUVA 4EELA 5IUNC 4MGYR 2OQIA 3QUAA 3DKKA 5A04A 4OFZA 3ZH9B 5BOSA 1Z56C 5TS3A 4ROTA 3DE5X 5BVGA 4PQFA 4HDCA 2J85A 5JFTA 1E0SA 2CLHB 3NWOA 5F52A 2ZSDA 1YJ5A 3CNBA 1UBJS 4GAEA 3E18A 3EBOA 1XD2B 5LQUA 4DV4B 2PJRA 1B8VA 3LKDA 3H75A 4J8PA 3I39X 2Q6VA 4M36A 5KU7A 2NXCA 5B57C 3LH5A 5FI0B 2CD7A 3PKJA 5IYZA 1YKGA 4X65B 2ZB8A 4GVPA 4NE2A 4G8BA 3TE6A 3GFVA 4P3NA