1GRQA

Chloramphenicol phosphotransferase in complex with p-amino-chloramphenicol from streptomyces venezuelae
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
178
structure length
178
Chain Sequence
MTTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMPLKMQSAEGGIEFDADGGVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVGDLDVLWVGVRCDGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYDVEVDTTHKESIECAWAIAAHVVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE
publication title Structural Basis for Chloramphenicol Tolerance in Streptomyces Venezuelae by Chloramphenicol Phosphotransferase Activity
pubmed doi rcsb
molecule tags Transferase
total genus 58
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2001-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07931 CPT Chloramphenicol phosphotransferase-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1grqA00
4PC6A 1JAHA 4Q7JB 5KSPA 1XMVA 4PTLA 2OBLA 2H5EA 2XNSA 2CEAA 4EPVA 4KVAA 2YVUA 3AVOA 4TLCA 4B71A 1HURA 2C9CA 4PZZA 3SEAA 1Z28A 4K81B 5BYKA 4DLVA 3E5HA 1D2MA 3KFVA 4FN5A 4IW3B 1MO4A 4TLEA 4CRWB 4QC2A 4W5WA 1XEXA 2ZJYA 5DNYB 1SXJD 1ZNXA 3AB3A 1AS3A 4QKQA 5EXSA 1O3YA 4WZAE 2LWIA 1K5DA 3TUIC 4Q1AA 3UWOA 4MKGA 4LWZA 3THOA 1Z6GA 1OB2A 1KK0A 1KOFA 2O5VA 4OHWA 2XZPA 4RD0A 1IY2A 3UG6A 1MO5A 4C0LA 1SGWA 1XNJA 1SXJB 3ICEA 4B76A 2ZRDA 4C0QC 1X8KA 2GXSA 1U98A 2B7BA 2IWHA 1NN1A 1NKSA 1FQJA 5TY0A 4TL9A 4IOLA 3ADKA 1P2SA 4B75A 5F9HA 3AM1A 3K0FA 3VR6A 4UXIA 3ZGXA 5FTKA 2ZEJA 2MMCA 5DI3A 2JJ2D 1AJEA 4B74A 1YE8A 1TU4A 2VP2A 4CEJB 2Q6TA 3SBEA 1CLUA 3RS5A 2F9LA 4M8NE 2ZRAA 4FCWA 4Q4AA 4HAXA 4ZI3A 2R65A 3CRVA 1OE0A 3R7WA 1C4OA 2F1RA 2ZSEA 3OZXA 1Z0KA 1OFIA 1OJLA 2V7QA 3QENA 4LV8B 1KO1A 5EP4A 2C99A 2YYZA 1XDBA 4Q66C 2H8KA 4M1WA 4QJ3A 1DAIA 3MD0A 3C8UA 2C96A 4JLVA 4PSVA 1NVWQ 2WICA 1LY1A 1YZQA 5FI0B 1IY0A 4D0NA 1E4VA 2OM2A 4DUGD 2QT0A 4GOXA 2G0TA 5DGXA 4QBFA 3WP0A 2ATXA 4ZDWA 3V4RA 4D82A 4NDZA 3BH0A 5B64A 3ZZTA 2G88A 1E2MA 1RRPA 1E98A 1F2TB 4BFXA 4D0LB 3ZLJA 1HE1C 2J0SA 1S96A 4DB2A 1YVDA 1QHHA 3IQWA 3PEWA 3IKJA 4XVQA 3RYTC 2A2ZA 4D25A 1ZIPA 4Q4HB 4XVUA 3WXMA 1R10A 2OBMA 2QEQA 4V02A 1KJWA 1OXXK 2ZJZA 2YKGA 1HY3A 2XNDA 4P0TA 2J5XA 4D26A 1CR1A 2J0UA 2UZ3A 4B6FA 3WNBA 1YKSA 2H16A 3H4MA 1XPOA 1F6BA 2OZEA 4TLDA 1UEIA 2DBYA 4DB4A 1P2TA 1N0VC 3I3SR 2FE4A 3AP3A 3RSLA 2P6RA 1W36C 3CR8A 3L0PA 2QG6A 3RNLA 2X2EA 4BFUA 3THXA 2QM8A 2E87A 2WWFA 4MH0R 4TSFD 3ZZ0A 4B3FX 3BFVA 3MWJA 3LW8A 5JS8A 1D5CA 4WXRA 2G0NA 1DADA 1WBDA 3R9IA 3ZIAA 1ZIOA 3EZFA 3BFKA 2B92A 4HB3A 2CL6X 4IDPA 4TMTA 1T0HB 2QRZA 2BJVA 1KAOA 1TEVA 1K5GA 5C18A 1T3SA 4PANA 4JVSB 3H0KA 4PPFA 1J90A 1IN5A 3DKPA 3DL0A 5FOTA 3LO5A 4EQ6B 2F7SA 3BH7A 2H92A 2A3RA 1IJEA 5J40A 3NHAA 4DCTA 1KSGA 1GZSA 2ZAMA 3GLHB 4I99A 2XZOA 1E9RA 2ZREA 4DLYA 1U94A 821PA 3UMFA 2CLCX 4FCTA 4B3CA 3NWJA 3U6KA 1BYUA 3NEYA 4TZ0A 4M1YA 1CJMA 2JLUA 4NH0A 3GJXC 1QBKC 1RRGA 4PHFA 2Z0MA 3EWAA 1TQ4A 2IXEA 1N6HA 3NBZC 4LYFA 1LW7A 4OI1A 3EZ7A 1XBTA 4TYYA 1MABB 5JRJA 2WTUA 3VQTA 3U6BA 4EFLA 4M9ZA 3BB4A 4F93B 3GFTA 4BUJA 1C1YA 3LLMA 3TH5A 2F43A 1G9XA 1S3SA 1ZUHA 2I1QA 4RZXA 3RWMB 3TRFA 2GF0A 4LUCA 4BLTA 3VMFA 1W1WA 3KB2A 1NVUQ 1XX6A 3ADCA 3ZD7A 4GPTA 3W6NA 2CXXA 2WIAA 4M4SA 4NYJR 3G82C 2J7PA 2ZRMA 3AKEA 2WKPA 3C4JA 1GL7A 2NGRA 2V1UA 3MMPA 2C98A 2FFBA 3I61A 2CE7A 2DWQA 3QEJA 2J41A 5FH9A 5GVRA 1XPUA 1QG2A 1RJ9A 1Z08A 1E1QD 1G291 3QIAA 3QI2A 2ZM5A 3CZPA 4JKIA 2NPFA 3AVUA 4B48A 1XZPA 3F0TA 1KO8A 1VCOA 2VF8A 4WOPA 2EFGA 4XWOA 4BLOA 4PXAA 4HB2A 3Q5DA 4MYUA 4IOKA 5FUXA 4FCVA 5GJVC 2IYQA 2J87A 2BJWA 4MKIA 1S1MA 3AKCA 5HCIA 1KDTA 2Q3FA 3K70C 2W0MA 2O8BA 4HAWA 2QAGB 1UADA 2B21A 1KO5A 2IYLD 3SYKA 1RRFA 2C78A 1XPRA 4IOJA 5JLJA 3M0EA 3OHMA 2RB4A 5C2JB 1UAAA 2J46A 4AD8A 4TYWA 2D7DA 4RSGA 3GEIA 2JCSA 1WA5A 1W4AA 1COWD 1G3QA 3HU2A 2OEPA 4PO9A 3VFDA 5IRCD 4PO8A 1WF3A 2ZE5A 4Q1DA 1GL9B 2FMXA 3IIJA 4R9UC 1JR3D 4JLAA 1VDZA 3B9QA 3IBYA 3TVTA 2GXAA 3MWYW 4LHWA 4P4SA 3PCRB 2EW1A 1MOZA 4OQLA 2O8CB 2Z83A 4ASUA 3NKVA 3AVXA 3NDPA 4PQFA 1N5JA 2XOKD 3QOFA 3LRPA 1W4CA 2PH1A 4PHGA 2DR3A 4UKDA 3PENA 5CIQA 1G5TA 2C9YA 4PR0A 4P4TA 2F6RA 2NTYC 2YV5A 2MMGA 5B30A 4S35A 1M74A 1UPTA 1ONBA 1IBRA 3D7MA 2JLZA 2GVDC 3U3KA 1W7AA 2PX0A 1LVGA 3NTUA 3TSWA 4YXWD 3Q8XB 1BMFD 4MRNA 4FMBB 5FTNA 4PAOA 5FI1B 1VTKA 1ZJ6A 1NMZA 3BAFA 2YJTD 3AGPA 1OFHA 2Z5FA 4KHZA 4TL8A 2JLRA 4MDFA 2QZ4A 2DHRA 3QKRA 2DFTA 3X1YA 3KL4A 5F3WB 1XF9A 3SC3A 3VTKA 1NJGA 4Z8YA 2PJRA 3U44A 1H8ED 1XWIA 3HPQA 1XEWX 1YZGA 2Q9AA 4PQYA 1KI6B 1W47A 2R6FA 3F5FA 3QPUA 1NVVQ 4KFUA 3RS2A 2JLVA 2W6JD 4D80A 4DLRA 4F92B 1YRAA 1RE0A 2GBLA 3F8TA 2BIFA 3OIUA 4EPTA 1DAMA 1NLFA 3EXAA 1Z6XA 2V4ZA 5JCPA 2L0XA 3CX8A 4O0MA 1MRNA 4NONA 1W4BA 2IXFA 5L3QA 4KYIB 1OIWA 3CRMA 3FKSA 3T5DA 3MG9A 5FL3A 1G4AE 3EPHA 4MQBA 3CKLA 2C77A 4TT3D 4E5UA 2N1BA 3KDSE 1G3MA 1NIPA 2HF8A 1AKYA 1E79D 4AKEA 3SQXA 1VG9B 2W2VA 3G0HA 2P5SA 2ZITA 4LSGA 1F2UA 4BEBA 5H70A 1KMHB 1Y63A 2BMJA 3W3ZB 3ZDQA 1G8FA 4FXPA 2PZEA 2WVJA 3BOSA 4PPNA 2GJ9A 3CW2A 4OK5A 4LHYA 4KODA 1Q44A 2VRWA 4HUQA 1OYYA 2D74A 1P72A 5P21A 3SYLA 3TUJC 4C0JA 2WJVA 4XJXA 4DT1B 2FFQA 4XOIA 1L4YA 1II8A 1OKKA 3AF3A 1Z29A 4MUBA 2UVQA 5CYPA 3KUDA 4GSYA 1KSFX 5DO9A 3RABA 3O8BA 2P65A 4A0HA 1TUEA 4B44A 3GFPA 1BH2A 4MRSA 4US2R 4DUGA 1J99A 1R5OA 1I4TD 1XXHE 5HZKA 5KHOC 2EYUA 3SYNA 4KU4A 3L8ZA 3DHWC 3UG7A 2GXQA 4JT2A 4X8OA 2IEZA 3KFXA 3R20A 4OL0A 1EX7A 2R9VA 2YZ2A 2G9NA 1XJQA 3HYRA 1TADA 4DLZA 3ICQB 4OQMA 4B33A 5CITA 5IHPA 1ANKA 1XEXB 5DIFA 3L0IB 4S2EA 4Q5IA 4Q47A 1R5NA 2GK6A 3J81k 3M4YA 1ESMA 1G17A 4ARZA 1E3MA 2XZLA 1WXQA 4FW9A 1GRNA 2ZIAA 5H8WA 5FPSA 1JR3E 2P6NA 3WMGA 3ZVRA 3KXIA 2ZYUX 5ELXA 5DSZA 2E1RA 1HH4A 1XD2A 1KKMA 2N42A 1U9IC 2WKRA 3I5XA 2QL6A 1GKUB 4TSFA 2ZUCA 3OE7D 2YWFA 4IKEA 5L3RA 4AIIA 1FZQA 1GILA 1LNZA 1KO7A 2QN6A 3B78A 1A5TA 4L5BA 4Q1FA 2W83A 2V55B 3NH9A 2OESA 3W34A 4DWJA 1KK2A 5DI3B 4U7DA 2F55A 3R9WA 2JIZD 2ZRFA 2GHIA 2ORIA 4RFSA 2BBSA 5JHGB 1G16A 1W44A 4Q4AB 5FBQB 2FFAA 3DZ8A 4NCJA 4NYMQ 4PO1A 5L3VA 3R7WB 4NBSA 1E2FA 1EWRA 3SHWA 3EG5A 4A2PA 4ZDKA 2P0EA 5AJWA 5JJKA 3SFZA 2IHBA 4BFSA 1KI1A 1GM5A 4JYBA 1GVNB 1YR8A 4PPGA 3CIOA 4OQFA 5KU1A 2TMKA 3LX8A 5JS7A 5FOUA 3ECCA 2OCAA 5JWRA 3X1XA 1U90A 1OH7A 1B0UA 2ZI3A 4A2WA 4PPQA 3GEHA 4M1OA 4L9SA 1CJUC 3PR1A 2AR7A 5LD2C 1QHHB 4GZLA 3LX5A 1T4GA 3B6EA 1E2IA 1CXZA 1M2OB 1T0JB 3K9HA 2ODEA 5AJXA 2JASA 5KPDA 3MRSA 1G7TA 4IEIA 3B1WA 2OLKA 4LJ8A 2Q3MA 3HU3A 4FD2A 4P32A 2QGZA 5D3MA 3TUZC 3SI7A 3CRW1 3U3MA 2J0UB 1E9AA 1BIFA 2HJGA 5AWFC 4BLQA 4EJSA 2C9OA 3M1IA 2NO7A 1EK0A 1QHSA 2VP6A 4X8MA 3H86A 2PCLA 3KKOA 1E69A 4EFMA 4WIAA 2ONJA 2ZI6A 3NBYC 3CPJB 5EP2A 1ZC3A 3ZIAD 4DEXA 1VCNA 2WSMA 4B47A 3N2EA 4BASA 4F4IA 3IO5A 4HUTA 2PEZA 3AF4A 3THXB 3W8NA 4LBZA 4HAVA 2REXB 4KFSA 3ZQJA 1OIVA 5L3SA 4M1TA 5LB4A 4ZCMA 4Q7LA 1M6NA 3X1DA 1AN0A 1E1QA 2XB4A 4ZKDA 1U8AA 1M7HA 2WAYA 4NYIQ 4LJ4A 4LJ7A 1ODFA 4UXHA 3U7FB 4D4KA 1IAQA 2HYIC 4QG7A 1UKVY 3LNCA 1FUUA 5KSYA 2GCOA 1XXHA 2QENA 3U7HB 3CRQA 4Q19A 1FMJA 2EYQA 2D62A 4YONB 4IXMA 4C0BA 1UKYA 3I1FA 1MT0A 1DTSA 5FBVB 2HJVA 3AVVA 2UKDA 3CWQA 2YOFA 3WP1B 1SXJC 1W5TA 2CHVA 2RGDA 2VEDA 2ZVQX 2XJ9A 3BRWD 3H1TA 1YZKA 2ZS8A 4MRVA 4PZYA 5K8LA 5DN6A 4A15A 1N0WA 1HQCA 3V4FA 4BLPA 4Q1CA 4IEEA 2YINC 1JJVA 3I4LA 1COWA 4JIMA 1M8PA 2IW3A 2ZRIA 3RC8A 2F1JA 1XCGB 1G5PA 5FUVA 1XFAA 1JR3A 2YC4C 2ZI5A 1VYUA 1KY2A 5JBQA 2VYFA 4RCYA 1E0SA 1U99A 4I81A 5DHAA 4D0GA 4BLSA 2V54A 3A36A 1XJ0A 1GOTA 1QZXA 4TTRA 1E9SA 3V9PA 4HDCA 2F43B 1P2UA 2QA5A 4M9SA 4A8JA 3WYAA 1R0WA 2JEOA 1LS6A 2XX3A 4M1KA 1VYTA 1N6IA 2P5TB 5FBRB 5CM9C 2C8VA 2IYXA 2WM9B 3U7GA 4G5QA 4NTZA 3ASYA 2BEKA 3ZVNA 1A1VA 5KOYA 3EAQA 5KNDA 1QHGA 1H65A 3BIFA 3WBKA 1BMFA 2XEXA 2HUPA 3BS4A 2QMUA 1RJ9B 1UFQA 2J9RA 2XTMA 3KQUA 2ZRLA 3GLFE 2JJ1D 1AQYA 2WWGA 3KXLA 3N70A 3BWDD 2BWJA 1KMQA 4JZKA 4ON9A 3BB3A 1PVOA 1GP2A 4PHHA 2CHQA 5CLLA 1EFTA 4G5RA 4FMDB 5J4LA 2N46A 3PJRA 2R2AA 3C14C 2WHXA 3IIKA 4A92A 4KSCA 4URWR 1M7BA 3I62A 1GSIA 3AVWA 2FSHA 4KO8A 5CLQA 3AV0B 2O8BB 2W6JA 2WKQA 4JBXA 2BHRA 4QJ5A 4WZBE 4TMXA 1Z0IA 2OFWA 2X1VA 3HYTA 4IRUB 5CM8B 1ZYUA 1G3UA 2IS6A 2R44A 3HPRA 1OH6A 4TLAA 1ZVQA 1E9CA 1R5BA 4JYCA 1G7SA 3L82B 4LY6A 5FTJA 4TT3A 5TDHA 4MGYR 4A2QA 1GFIA 1WCV1 4LYJA 2YHSA 1Q22A 4FMDF 1E79A 4OHZA 2RGNC 2C5LA 4I1VA 1S9DA 4C9BA 4P4SB 1XTKA 4DCVA 4P3YA 2CK3A 2FJUA 2VSXA 1P7CA 3IPYA 3AH8A 3CM0A 1A2KC 4JLPA 4U02A 4US1R 4ABYA 3Q7QA 3GEEA 3OEHD 1NY6A 5JFGA 3TAHA 5KDOA 4W5HA 3U3OA 1CBUA 3I8XA 5CJ2A 3TK1A 3SBDA 3PUWA 3A1UA 2FV8A 1JBKA 4HAZA 2WMOB 1SVSA 1DAFA 4TTQA 2NIPA 5EE0A 1R7RA 1VIAA 3K9GA 3NHBA 2HV8A 3B5JA 4JL8A 1S9HA 1Z6YA 4YMSA 1J8YF 5GJBA 1Q21A 1QG4A 2P2LA 4JLDA 2QQEA 3GMTA 3P32A 5E7JA 2A5GA 1ZUIA 3JVVA 3L2OB 4IVRA 4JLJA 2ZYWX 4NCKA 2ZYTX 3QKRB 2JDIA 4DLWA 1OF1A 4NCIA 3BH6A 1T9HA 3QG5A 5GADl 4QGFA 2FPLA 4LZZA 521PA 2C04A 1N0UA 1OXTA 1S1CA 1AGPA 1DS6A 2FZ4A 2OO7A 2H57A 3K8YA 1HE8B 3VR3A 2JATA 5EE3A 4F4JA 2PCJA 1E2KA 4DDVA 4F4CA 2O8FA 1AKEA 3VKGA 4C4PA 4MGKR 3FKSD 1GIAA 2OCYC 4RD1A 4Q7MB 3THWA 4LBVA 2MSEB 4TMWA 4LRWA 1VPLA 2AXNA 2Z6VA 2AK2A 3LQQA 2LCFA 4BRWA 2WWYA 1KZ7B 2F1IA 1G6OA 1PLJA 5EUMA 1DO2A 4NPHA 1ZU5A 5AUNB 2CL0X 1S0UA 1AZSC 5EP3A 5L3QB 2VF7A 2ORWA 3ZJYA 3K53A 1Z2CA 1RW4A 3OE7A 3VR5A 5DYIA 3SDZA 5KUTA 1DO0A 1S8FA 3ZS8A 1X1SA 5JI3E 2D2FA 3Q85A 2P67A 5K8UA 2JLYA 3FMIA 4B3GA 3SS8A 1KIMA 4MKFA 4QFMA 1F2UB 4XD7D 5JMTA 2ZPTX 3K9LA 1OKKD 2JIZA 4HLDA 5E4FA 3LDAA 4UXJA 3OIVA 3PXGA 3A1TA 3FFAA 2MSDB 2NG1A 3P4XA 5BXQC 4TL7A 2HT6A 3KJHA 2QAGC 4HUQB 4PC1A 4XH9B 4D4MA 3GLFA 2ZUBA 1G1MA 3SZRA 4NHOA 1G3IA 3NC0C 3FVQA 1G6HA 3U61B 4KBGA 3AVYA 2QORA 3LWNA 3WHLA 3MJRA 1II8B 2GKSA 2WBLC 5FTMA 2CE2X 4TL6A 3IPXA 3CONA 1QF9A 5EP1A 1X1RA 4C0AC 3R9XA 2H1LA 2KSQA 5E3HA 4M53A 4ZO4A 4DSOA 2HDNB 4R71A 3NVAA 2QU8A 1K6MA 2G83A 1JXMA 5EE9A 2F9MA 3CR7A 1DPFA 2FEMA 1G8YA 4TMVA 2ZI4A 1OXVA 1P2VA 4R2IA 4RD2A 1MRSA 1PLKA 3AEZA 1CU1A 1KKLA 3EWSA 2NZ8A 2QPAA 4GI7A 1IXZA 1CR2A 1T3HA 3HR7A 2PLRA 4ARZB 2CL7X 3FMPB 1MR3F 5J4YA 2ZE6A 1GUAA 3LVRE 1RYFA 4JLBA 3WYFA 6Q21A 1N5IA 2VA8A 4AKIA 1CULC 2G6BA 1OB5A 4DEYA 2VPPA 4PZLA 3DKVA 1OXSC 2QE7D 3CB4A 5HE8A 1OLOA 2IS4A 1TAGA 2GF9A 4MRRA 4HAUA 3SOPA 4Q9JA 2JA1A 4G5OA 3S1AB 4B3DA 2QP9X 3G5UA 4CEIA 3WRYC 2OAQ1 1CKEA 2BBOA 5FOWA 2GK7A 3NC1C 3SU8A 4B2LA 2A30A 2LKDA 1T5LA 2X8AA 2W58A 4MDEA 4BQSA 4EIWA 4RFSB 2VSFA 1XMJA 3KKNA 3TAUA 4DBLC 1NN3A 2ZETA 1PUIA 4A0RA 4C30A 4WW0A 3CH5A 5HTKA 1I4DD 3FOZA 4N3NA 2Y8EA 4LHZA 1OFTA 3SFVA 3EZ6A 4DXAA 3VHXA 2ERYA 1DAGA 5JECA 1RPZA 4HB0A 3DEFA 3LBHA 1R2QA 4BECA 5F2EA 3JZAA 4A9AA 4C3ZA 4E07A 3C5HA 1IN4A 5FR1A 2D7CA 2IXGA 1E2EA 1KYIA 2FWRA 2YWHA 4B2IA 3NG1A 3T1QA 2ZVPX 1OIXA 3CNLA 3IBGA 3VU9A 4AWXA 4B43A 3NDBB 4N0EA 4G5GA 3A4NA 3REGA 3V00A 4HI0E 1DE0A 4CT4B 3MLEA 1NSFA 2GJ8A 4O2LA 4C2TA 5JJLA 2FSFA 3ADBA 4KV9A 3NEJA 4KITB 4YDHB 1HTWA 4LJYA 1NVVR 1RYHA 5D3MB 1QHNA 5CDFE 3WY9A 2WJHA 3A58B 4EJSB 2WOJA 1UBEA 1DG1G 1WMSA 2XTNA 1T6NA 3O8DA 4QRHA 5AR1A 4BZPA 5B2ZA 2I3BA 1NBME 3KZ1E 1CRQA 4RCZA 1SVWA 2ZXUA 1D9XA 3EARA 4CVNA 2HT1A 1SQ5A 5B58C 5J4VA 1U9IA 3WNCA 4V03A 3LXRA 4Q9LA 2OV2A 2CCGA 2ORVA 1N5LA 4YMVA 3UPUA 5L3SB 4OHXA 5IK2D 2VLIA 3GJ8A 2ERXA 2BVNA 2JJ1A 5CB8A 5BN3A 5FBLB 1E99A 4M1MA 5G53C 1Q1BA 1QRAA 3U7EB 3RS3A 3AVTA 2R6CA 1G19A 1ZNZA 4BZQA 1HQYE 2GCOB 1XXHB 5DN6D 4W5JA 4Q1EA 1GITA 3GLGB 1ZU4A 2BOVA 1FL9A 1IXRC 1Z3IX 4RD3A 3FGNA 1E0JA 2V6IA 1W2GA 4E22A 4MYTA 4HLUA 4C0SA 3TSOA 3KJEA 3RRMA 1DG3A 2VSOA 1LF0A 3T34A 3UATA 3BXZA 5FUWA 1KI8A 3C5CA 2F3TA 3A6PC 1DAEA 5FPKA 1Y3AA 4XWAA 3QF4A 4KFRA 1WDTA 2EFHB 3A4LA 2ECKA 2ZI7A 3FMOB 1LB1B 3KKPA 1CIPA 1GTVA 3K0CC 4KXFB 5FL7A 2FA9A 2OBNA 3O8CA 5J4KA 1FTNA 3BERA 3PQCA 4BWYA 2W6IA 4GMXA 1I2MA 1R0YA 4LPSA 1YQTA 3KTAA 4PC3A 3PV0A 3T1TA 5G40A 3OEHA 1W36D 5LDDC 3U60B 2RAPA 2XAUA 1Z07A 2WSSD 2YC2C 5TVKA 5EJEA 1XCMA 4Q9KA 1P4SA 3W5IA 3BJIC 4A8JB 1JI0A 2AFIE 2VHQA 1N25A 2NO6A 4GZMA 1W0KA 1J7KA 1YR7A 2P3SA 1KSJA 3CX7A 3E70C 3C15C 3CNOA 4EDHA 2QAJA 1AK2A 1Z22A 1TF7A 2CNWD 4HLCA 4E03A 3IGFA 1IONA 2CJWA 3QXCA 3IO3A 4GOKA 4MYHA 5E95A 4YLGA 1CTQA 2KBFA 2IYYA 2YOHA 3FWYA 3OFND 5EQTA 1OSNA 2BCJQ 2ODBA 3I92A 4JBWA 4QM7A 1GRRA 1ZINA 2XJ4A 3GLHE 1KI2A 1JECA 3GJ4A 3HWSA 2QMHA 4ZDIA 1Z6AA 3W9YA 3AP1A 3TSZA 3ONWA 3UMRA 4HYYA 4NYMR 1UKEA 3RVBA 2O8DA 1XEWY 1YZLA 2SHKA 3KKQA 1TF2A 1YJ5A 1WRBA 4LBWA 3T1OA 3TW4A 1SVLA 3DO6A 2IT1A 4DKXA 1YRBA 5JEDA 3VR4A 2PZGA 3PEYA 4LCBA 4EPWA 1OXUA 2ANCA 5KTYA 2MSCB 2AWNA 2QM7A 4V0KA 1OH5A 2GWHA 2ZRJA 2NO1A 1EG7A 2WMNB 1XMSA 1AQUA 1RVDA 2CK3D 1SULA 5CDFA 4JLMA 5FBWB 3IILA 1U0HC 4DIDA 4EPRA 4TMKA 3AP2A 1A7JA 1DAKA 2EQBA 2OILA 1G8PA 2ZU6A 4QNRA 3PUXA 2BM0A 3SJAA 1XCPA 5K8IA 4NE2A 1NBMA 3BC1A 1JQJC 1S4QA 2GCNA 3NH6A 2RMKA 2GTPA 4XD7A 5BN5A 4BFYA 4B2PA 1HEIA 1II9A 4NKRA 3H2YA 4URVR 3EZ2A 1KDRA 4H1UA 4JJKA 4Q02A 4OQNA 4JT4A 1CJKC 1SKYE 1TL7C 2FG5A 4MUAA 2FZLA 3DOEA 2ZJAA 1L4UA 1IN6A 5IDVA 1LV7A 3X1ZA 4LJ9A 2IUSA 2HF9A 4L9WA 1KJZA 4Q18A 2JDID 1SKQA 1M1YE 1UDWA 1NG9A 1KDPA 1KNXA 1NG1A 5KDLA 4BLRA 4KLNA 4NYIR 1CS4C 4R2HA 5FOSA 1RC8A 2WJJA 4IDHA 2AHOA 2FGJA 5M04A 2BMDA 3W3AA 2FPKA 3BGWA 5AJZA 3MAAC 3LQRA 1KAGA 4U00A 2ZRGA 3NBXX 4A1FA 5C46F 4URYR 4F38A 1E6CA 1OYWA 3ZH9B 4QBHA 1CR4A 4LGMA 2O8FB 1JJ7A 4M0LA 1WE2A 2QMEA 4ILEA 3ETLA 1YZNA 2WWXA 2R8RA 1KTVA 3KJGA 5C4MA 3THWB 3GLIE 1NN5A 1E2NA 3K0FB 4B35A 2QE7A 2QNRA 2W00A 2ZE8A 4JL6A 2A9KA 1T8UA 3FMFA 4JJZA 2O0JA 4M21A 2DYKA 4YC7A 4RD4A 3TR5A 1I4LD 2B6HA 2AD5A 421PA 3TKLA 1AZTA 2OFOA 2ZSFA 1JR6A 4C0HA 2F3RA 4LBYA 3VAAA 2PX3A 1MO3A 2RGNA 2CCKA 3ADDA 1JNYA 3Q9LA 4KVGA 1P61B 4EQ6A 1QVAA 3CPHA 4G1UC 2REOA 3PUVA 1SHZA 3OEEA 4DLTA 4DSNA 2BBTA 4EUNA 5B57C 1F3OA 3GLHA 1DEKA 4Y0AA 4A6PA 3GLFB 1PJRA 3C16C 3GJ3A 1N3BA 3TGPA 1ELOA 1GDDA 4QBGB 2WWWA 3LD9A 5JJIA 3K09C 4POAA 2AXPA 4IVQA 4JVMA 4DIEA 1RZ3A 1S3GA 5H68A 3JZMA 2ZRNA 3TJZA 2NO0A 2AKYA 1GL6A 1TEXA 3KXKA 4BFWA 1HA3A 1OV4A 1VG0B 3QE0A 1Q1QA 4RY2A 3R8CA 2O0KA 4ESHA 4GP6A 1MABA 1XD8A 3K0SA 1LF5A 2J45A 1MO6A 2PL3A 1E2DA 5J4HA 2BCGY 1KI7A 2QTHA 2QI9C 3B1YA 3CWZA 4YDSA 3TE6A 1VHTA 2ZJOA 5BW8A 4AURA 1NRJB 3QXSA 3BFXA 5GVSA 1ETUA 2VP5A 3PUYA 4DHEA 3AGQA 2J7KA 4GMDA 4O2RA 4NL4H 4O3MA 4Q00A 4L16A 4HEJA 2BV3A 4OJKA 1F60A 3EIHA 4D4LA 4RKFA 4HZIA 1DELA 3T06B 4XTRA 1HV8A 4CF7A 3VR1A 3U2QA 4GL2A 3FKQA 1U0LA 5EXPA 2O8EA 1MV5A 5DISB 3GJ5A 4ZPXA 3CBQA 1E9BA 2IYRA 3FFBA 3L8YA 4JLKA 5IK2A 2D3WA 2IEYA 4TWZA 3C41J 2V3CC 3ZD6A 1ZD9A 1ZD8A 1ZBDA 3C7KA 3QKUA 1JALA 1VG1A 2QPTA 4UJ3A 3SR0A 1P62B 1KI9A 5KNBA 1NMYA 5FPHA 1CJVC 2X19A 4ZKEA 1EXMA 3A1VA 1DOAA 1Q57A 5ANRB 2AKAB 2XSZA 1EFRA 5AJYA 3AUXA 5TXGA 5EXTA 3MSXA 3SN6A 1G7RA 2D4HA 2GZHA 3K0AA 2GBLC 1KSHA 1Z6TA 2OFXA 3A8TA 1IQPA 1PLLA 1KGDA 1T8TA 1VECA 2OG2A 1N6NA 4NMMA 3UKDA 1CF4A 2X77A 2BMFA 3BB1A 2J0VA 4Z54A 4N1AA 4LYAA 2HLDA 5AUQA 1J70A 4E09A 4HAYA 1P3JA 3JVUA 3QSYA 3DMNA 4TYQA 4LC0A 3VU9B 2V8OA 2FH5B 3W6OA 2JLSA 1US8A 1QHXA 3GLIA 3TBKA 1XTSA 3B13B 3KJIA 4IDOA 3CF0A 3LH5A 4Y0VA 3ZVLA 4MITA 4CDGA 1NI3A 2RGGA 2O8CA 1JEEA 1JQLB 1NNEA 5FTLA 2YOGA 3DMDA 2Q9BA 1VHLA 4HATA 1XP8A 2C95A 5KSZA 3RS4A 4ACAA 2ODWA 4CT5A 4TN1A 3LBIA 3AVPA 5DLQC 1HT1E 2VP4A 2IYWA 1QHIA 4RZ2A 3K9NA 1RIFA 2WSSA 2R62A 2O52A 2QTVB 1XD9A 4DZZA 3BORA 2BBWA 1N5KA 3CF6R 4XWKA 2HEIA 4KJZA 2RCNA 2CNWA 4RZUA 4Q4LA 3W6PA 4W7SA 5DYGA 2GEVA 2REBA 3ASZA 4JL5A 4QNMA 3Q5EA 3OFNA 1E2PA 2VP0A 1U8YA 1UF9A 3U3RA 2IF2A 4U5XA 1X8JA 3IHLA 2H17A 3FTQA 1U8ZA 1Q3TA 1NLZA 3SJBA 121PA 2AD1A 2XTZA 2DWOA 2UZIR 5J5CA 4UNQA 1R0XA 2Q3HA 4II7A 3TNFA 1ZD1A 3W90A 1ZW6A 4AY2A 2AFHE 3GJ6A 4KLZA 4F91B 1P9NA 2VHJA 3QVVA 4G3XA 4PAMA 3AKDA 1YU9A 5G41A 1BS1A 1DBSA 2QP4A 4ERNA 3FE2A 5FFMA 5FL7D 4GNKA 1IM2A 4LPKA 1NLYA 3QXJA 3BK7A 2GVZC 1IN7A 2ZRPA 3FYHA 3QF4B 2KE5A 2W6ID 3QPVA 2WIBA 1QVRA 3AKYA 4BFTA 3OESA 2DY1A 4XTCS 3RRZA 4RJLA 1BO6A 3LFUA 3QEOA 3Q3JB 1V5WA 3RRYA 4TMZA 3LA6A 1W0KD 3W5JA 1E94E 1EGAA 3VKHA 2ZROA 2WPDD 4WXPA 4DSTA 3KTAB 4WAUA 2ZUDA 1GAJA 3VKWA 2RGCA 3QKTA 2XB2A 2PMKA 1E2LA 3UANA 3UMSA 4DCNA 1CP2A 2IYTA 3VNVA 1E9EA 4IVPA 3ZYCA 4XVRA 4ACBA 2WOOA 3AF1A 4OJQA 4P31A 2WJYA 1NSTA 4TZ6A 1AIPA 1ZNYA 4ZI2A 2OSBA 3SNHA 3GPLA 2ZSAA 4WBSA 2CJWB 2ZS7A 4L15A 2WWHA 4B6EA 4ZIRA 5GJCA 1Z0FA 3U44B 1E2JA 4IFBA 1HYQA 4TQ9A 3FHTA 5EUQB 1ZCBA 1RKBA 1N2CE 2D2EA 4QXAA 1E2GA 1LTQA 4I1SA 4Q4JA 1O87A 4Z1MD 3EPKA 4QGHA 2DFKB 2IBMA 4H9GA 4I1UA 5KSOA 1NIJA 3EA0A 1IXSB 3EZ9A 2O8DB 3EC1A 1Z83A 1H8HA 4IFEA 4LI0A 3RS0A 2EFEB 2W0SA 2GAAA 4MGZR 3CRRA 3X1WA 4EJSC 2Q0HA 3KX2A 2R6DA 2G3YA 2OCBA 4URZR 2IWRA 2VO1A 1Z63A 1NVXQ 1UBFA 1XZQA 3REFA 5HZHA 2A78A 5HKKD 2J1LA 3LY5A 2FOLA 3OAAD 3RLFA 5FPTA 1XTIA 4L8GA 2G1KA 4PSKA 3TQFA 3QJYA 2PT7A 5DHFA 2JAQA 1P73A 2PLFA 1NBMD 1TMKA 1EFUA 2ZJ8A 4MRPA 1UBCA 1WQ1R 2GZDA 4P33A 4A82A 4DDTA 5AUOB 2OCPA 4QHTA 3KQLA 3CZQA 4LOAA 1B23P 4DVGA 4R98A 4X8HA 1E32A 3PITA 3TLXA 3BBPA 3K0CA 1IY1A 4OK3A 3T1VA 4BE7B 4AYWA 4D81A 1AA9A 4YMTA 2VIIA 1R0ZA 3B8HA 3B7GA 1CR0A 4M9XA 2GRJA 2EU8A 3ND8A 2FNAA 4LJ6A 1EX6A 1P6XA 3B1ZA 4K8OA 2JLXA 3W8RA 1KI4A 1L2TA 3GJ0A 1ZM4A 2GXUA 2A5JA 2KB0A 3QPWA 2GESA 4J0QA 3DPUA 2ZU0C 4FWTA 3QQ5A 4DCUA 2QBYA 4AC9A 2ZQ5A 3MGCA 3SHFA 4KAXA 3BE4A 4ZDJA 1XU4A 2ZAOA 2GJSA 2VP9A 2ZSBA 3PIRA 4C0KA 1NP6A 4PAQA 5JSZA 4JLOA 1U0JA 5H1YA 2GEDA 5JHHB 3N5CA 2Z4SA 2ASEA 1KJYA 3CUEF 5CK5A 2FPMA 5SZHB 4B32A 4UNPA 1E96A 4PC2A 5CK4A 5L8VA 2RGEA 1RFLA 3NIBA 4FIDA 1FPMA 4QHSA 4ITRC 2F1HA 4I4LA 1DARA 4Q03A 1AGRA 2IYVA 4TYPA 2FGKA 4A8JC 1KDOA 3AUYA 2RHMA 1FNMA 2X2FA 3QF7A 1T3LA 1PV4A 3EA5A 1XD2B 4BFVA 3HJNA 3NBFA 1N6OA 3RWOA 5HE9A 2PBRA 3L43A 4HDOB 1PUJA 2ZSDA 4IHQA 1XTJA 2ODNA 2ZE7A 3PEVA 2QSYA 3MWKA 1G4UR 4F7WA 2GJKA 2KI5A 3IDQA 1G18A 1N6PA 2QUZA 2YWEA 5HPYB 1G21E 4FINA 2XGJA 2QQ0A 1DAHA 2HYDA 4WA7A 2FX3A 1D9ZA 1T5IA 2W2TA 1GWNA 3RHFA 3VHLB 2GJAA 2VHUA 3OEED 5UKDA 3KQKA 4Q01A 5EE5B 4HZUA 1D2EA 4C7OA 1E9FA 4LC1A 3HP1A 1E1RA 2EFDB 2WZQA 1W0JA 3CX6A 2OXCA 1BOFA 5JCZA 3L0SA 1F48A 2IUTA 1TPZA 2CLSA 3UXMA 4DLXA 3AVQA 1KNQA 1J2JA 3VX3A 2G77B 1YZTA 1E0AA 3HR8A 1W5SA 1M34E 3CF2A 4Q48A 4GDFA 1W2HA 3ZQ6A 1A4RA 3X2SA 4A0GA 2VTKA 4JLNA 1G41A 1Q12A 2FF7A 1OHHD 1MKYA 2G1JA 3QVUA 1SXJE 1FP7A 4LV6A 1FUKA 4M9QA 2BC9A 5KDDA 2OE2A 2ZR0A 1YZUA 2VQSA 4AKHA 5CIWA 1F5NA 1HUQA 4X8LA 3A4MA 3O47A 4JBYA 1W46A 2D06A 5KO2A 3LLUA 2QPOA 2IUUA 4HLQB 2CBZA 3WHKA 4EKDA 3U4QA 4NCHA 2VL7A 4PQRA 1OW3B 4QJ4A 3GP8A 1NL3A 4AYTA 4O25A 1NJFA 3EW9A 3QKSA 2V9PA 3T15A 1YR6A 4JS0A 4UNRA 3MJHA 3QY0A 4BPBA 2QGNA 2DFNA 2QRNA 3B85A 5EE1A 4TTPA 2XITA 1GNRA 4RKEA 4TLBA 1FQKA 3AF0A 5F9FA 4CEHA 3IQXA 1N6KA 4CZ2A 5G3YA 2ZRCA 4BRUA 2O8EB 3DM5A 2PZFA 2WJGA 3NXSA 4UNSA 2AK3A 1TQ2A 5HR5A 1KO4A 2WJIA 1SKYB 2RGAA 4RVCA 2XSZD 3WYGA 1EFRD 3U3JA 4DRZA 2VHTA 3P1JA 1OFUX 1XTQA 5CB6A 4P4UA 4TQUS 3RSOA 3P26A 1G64A 3FPAA 3IEUA 4G5SA 4QOSA 1LS1A 1Z0DA 3RAPR 4XSGA 4IOMA 4LJ5A 3THYA 2HCJB 2HLDD 2K5UA 4IDQA 4OI4A 2ZI9A 4URXR 3Q7PA 3K0AB 4V0ME 4DDUA 4QHYA 2IYUA 5DE3A 1R4AA 4V0LA 3K09A 3Q72A 3SJCA 5KNCA 3MWLA 3TIFA 1SHKA 2BKUA 2OAP1 4WVFA 3LV8A 3QNUA 4KFTA 4YMUA 5LPNA 2W2XA 3MUFA 2ZRKA 1GNQA 2A5YB 4Q7KA 3RANA 4Q21A 1J8MF 2JGNA 3LBNA 2J0QA 1US8B 3GLIB 4URUR 4OYHA 4YQFA 2XXAA 4BEJA 3LXXA 1FX0A 1NF3A 4US0R 3WMFA 1UBGA 2O0HA 5HCNA 4A6XA 1QHYA 4JKYA 2BKEA 1JEDA 2VH5R 3H84A 2WPDA 3KQHA 4JVNA 4Z8XA 3I5YA 4B34A 1W36B 3I72A 3B2EA 2RKOA 4PX9A 4CW7A 3VR2A 2DFLA 1ZP6A 1LFDB 621PA 2NQ2C 5CJPA 4Q1BA 3GFOA 3O8RA 3HU1A 5SZIA 2C03A 4BFZA 3WNDA 1EFHA 5EXXA 1G20E 1T91A 3RRNA 4OKSA 3A1WA 2AX4A 1E9DA 2EVWX 4DDWA 3M6AA 4DSUA 3KKMA 1M7GA 1R8SA 3QXHA 4MGIR 3KUCA 4QGAA 3GCGA 4Z1MA 2NMVA 2FEOA 2J3EA 2PT5A 1G8GA 1FMLA 1FOEB 1SXJA 1NY5A 4PC7A 2GILA 1CJTC 2EWVA 3P27A 4NYJQ 1W4RA 4AG6A 1SVKA 2H7VA 2AN9A 1AM4D 1D2NA 2OT3B 1MH1A 2LKCA 2PJZA 3IIMA 4AI6A 1OH8A 1ZM9A 2QT1A 5AK0A 3LVQE 5SZKB 4QGGA 5HKKA 3OAAA 1Z0JA 3ZS9A 4BZXA 1BKDR 1IOZA 1UDXA 3RDPA 2A5DA 3D31A 4CEJA 1WBBA 3OIWA 2GNOA 3T5GA 2ZANA 3F3YA 4RFVA 1JPNA 2Q21A 1D6JA 3BD9A 2C2HA 4PHTA 3UIEA 5JWHA 3TMKA 3OF5A 2VHCA 5J47A 1ZAKA 1V43A 4UQOA 1Z2AA 4LYHA 4AG5A 3SQWA 1GKYA 4ZCIA 2JJ2A 4GFDA 2QP3A 2ZRBA 2GEUA 4HSEA 3CNNA 1KI3A 1ZC4A 2ANBA 2GCPA 3LAWA 4L4UA 3TQCA 2CCJA 3MCAA 2NO9A 2NPIA 4XIGS 3PEUA 2PEYA 2BDTA 4OHYA 1G5RA 2BMEA 3AF2A 5FPYA 2ONKA 3K0EA 4LHVA 3SJZA 5IT5A 1F2TA 5G3ZA 1JXOA 1KZGB 1G3RA 4D4JA 3ND9A 1ZM2A 4RD6A 3ZVMA 3DOFA 5LBIA 2V6JA 4I1OA 4TYNA 3FB4A 4AYXA 2B8TA 1UKZA 3EIQA 4FMCB 3IUYA 4Q4HA 3K70D 2QROA 2IHYA 1WP9A 2FSGA 2OLJA 4N0DA 2WV9A 3GLGE 2ZJ2A 5K8TA 3PVSA 1H8HD 4ZIRB 2R6AA 3AQ4A 3N2IA 1GNPA 4RZ3A 1L7VC 5C4GB 1TQ6A 2CVHA 4V0MA 3CLVA 3K70B 4Q4JB 4BGDA 2EWWA 2B8WA 2ZTSA 3EC2A 3T12A 5C1BA 4M22A 1UM8A 3U5ZB 1FP6A 3QG1A 4DLSA 4QM6A 1ESNA 1UEJA 1FNNA 1SZPA 5SZJA 4A36A 2DCUA 4GRAA 4FMCF 4LHXA 1ZRHA 4B73A 1K8RA 1ZMXA 3A37A 4M2LA 5DI9A 2WAXA 4WZ6A 2FDCA 1TU3A 4B3BA 4KSBA 1VYVA 2CDNA 1HT2E 4MA4A 2GZAA 4OK6A 3S1AA 4QL3A 1W48A 5JI2E 5A4JA 1JPJA 1SVMA 2WWIA 3P4YA 2JJ8A 4XSHA 2V7QD 1Q20A 1I2DA 4LV5B 4V0NA 4MYCA 4OI2A 1NMXA 3EIEA 5F98A 1OPXA 1JB1A 8OHMA 3P20A 5TMPA 1NN0A 2IYZA 4PFSA 2J59A 1TUIA 3CO5A 3QBTA 4KYUA 3PFIA 2NOAA 1KK1A 4HDQB 1IN8A 4DCSA 5BWMA 1ZM7A 5EZ6B 3FHCB 3RC3A 3CPEA 4Z51A 3IEVA 2NZJA 1VKJA 1R8QA 2GDJA 4HLUC 4EPYA 1IJFA 2ZJBA 3EPLA 1P9RA 3E1SA 4Q9IA 721PA 1Q1EA 4NP6A 3T35A 2DB3A 1II0A 5FUYA 2IC5A 1A82A 2CVFA 4A4DA 3K1JA 2CMKA 1TTTA 1Z8FA 2A7QA 5DH9A 3E2IA 2FSIA 4IDNA 4HB4A 2QBYB 1OHHA 2ZR7A 1E0KA 2GETA 1FFHA 2EFCB 2IF0A 1P9WA 2XNDD 4OHVA 5JSZB 4GBMA 4EPXA 4GT1A 4C2UA 1PZNA 4G0NA 2KBEA 3I73A 2GAOA 3FDIA 1Z06A 4UNNA 2AL7A 2QMOA 3DDCA 4LJAA 5KYKA 2B7CA 2FN4A 4ESVA 3WMEA 1ZCAA 2KWIA 3DVLA 5A5GA 3ZZUA 2VBCA 1NKTA 1ZM3A 1CRPA 4W9MC 4DC9A 221PA 2PMDA 3FHOA 4AK9A 2FU5C 1VG8A 2R6GA 3B1VA 3D8BA 5BYJA 2IK8A 1YHNA 1EWQA 2HXSA 2JLWA 1N6RA 4CEIB 2DPXA 2P6UA 4D6PA 4QBIA 2RH5A 2I4IA 3TVDA 3GQBA 2OUKA 5TV2A 1Z5ZA 1KK3A 1E1RD 3KB1A 3RS7A 1W0JD 3IHWA 4M1SA 3GJ7A 4DLUA 4JVLA 3WRXC 1Z47A 1ZNWA 3B1XA 4OI0A 1EFCA 1E2HA 3R8FA 4CIDA 1KHTA 2QAGA 1TF5A 4HZUB 2I1VB 4C7OB 2ZR9A 1JAIA 4GP7A 5EZ5A 5JZVA 4OQXA 1VMAA 1YR9A 2ZJ5A 2H18A 5LB2A 3D6TB 2HXYA 2RGBA 3GLGA 3B60A 5FR2A 1FW6A 2ZYVX 4JSYA 4UJ5A 1QDEA 2ATVA 2IS1A 1VCMA 1DVRA 3PG5A 1AS2A 2JLQA 2QSZA 3TW8B 2QTFA 1E2QA 4G01B 3SE0A 3CH4B 3EX7C 2GA8A 5GJWC 1Z0AA 2OXRA 1UJ2A 2ZS9A 4YMWA 2DWPA 5AUPB 4IXNA 3EPJA 1XB2A 1GKIA 3PUZA 1W49A 2Q9CA 1CEEA 1G8HA 3I32A 4EFNA 2Z43A 1WB9A 1TX4B 1U2RA 1P75A 2HCBA 3I8SA 4CYMA 5IF9A 1G7CA 2E9SA 1BYIA 4ZCLA 2QY9A 3VNUA 4V0OA 3UWKA 4JMPA 1A2BA 3OIYA 3MFYA 4LDJA 5JEEA 1P5ZB 3DM9B 4H1VA 3U4QB 2J7PD 5TARA 4K46A 1S2MA 1P60A 1X86B 2XOKA 2IYSA 3UK6A 3QKSB 2CHGA 2AWOA 1XJCA 4FWIB 4KBFA 3VX4A 4A0FA 3L0OA 1TNDA 3DZDA 5KPJA 4Q9HA 2BM1A 1VIYA 4IJMA 2RHDA 3A1SA 1X6VA 3LW7A 4GOJA 1N6LA 3B9PA 5D3QA 5TB5A 3KQNA 2IA5A 2FFHA 3D3QA 4DJTA 1FTSA 4LX0A 4CEHB 4D2IA 4YXWA 1EESA 4AKGA 1X3SA 3QBVA 1GRQA 1IHUA 1Q3HA 5BQ5A 3TR0A 4KCGA 1RRCA 5BN4A 1KI6A 2KJQA 3GD7A 1R6BX 4TQAA 2ZRHA 2IX3A 2IS2A 1XTRA 4NU0A 1VCIA 1ZUNB 3B82A 1D8TA 3EASA 4EAQA 1AS0A 2V1XA 4FI3C 4OBEA 4NZYA 2A5FA 1U81A 1XEFA 3HDTA 5E7IA 1H8EA 2Z4RA 1XRJA 3QXXA 3QUSA 5E7MA 1KY3A 1E4YA 2CLDX 1Q0UA 5A0FA 3THYB 5JWOA 5JRZA 2RGXA 2BEJA 4PSAA 5CYOA 4B3XA 1XMIA 5FOXA 1X8LA 1TQDA 1C9KA 4NCNA 5LD2B 1GG2A 1KMHA 5FOVA 1L8QA 3T61A 4ASUD 4MKHA 4ZV4A 2YWGA 5AJVB 4CGZA 1SVOA 1SVIA 4LK2A 4KI0A 3WBJA 1OT3A 2XXAB 1FX0B 4R7ZA 4DT1A 2YNMA 4JSTA 2OHFA 2IL1A 1Q1ZA
chains in the Genus database with same CATH superfamily
1JAHA 1NURA 3KOYA 1XMVA 4Z99A 1RM5A 4KRGA 4KWHA 4R8SA 1G21B 5B6PA 4MS1A 3E1KA 1M75A 1J07A 1ZJZA 3AVOA 4B71A 1FJHA 3OJEA 1PQWA 3SQLA 1QONA 1KORA 1Q2XA 3DOJA 1PWXA 3BK1A 1N8TA 2VH2A 2CZQA 3UV7A 1SC3A 4I46A 1KRWA 1RBQA 5JOQA 4RYLA 3E5HA 5LP6F 4FN5A 5IZ4A 2P2ZA 4UD2A 2EARA 3UMBA 3PCXA 4OAOA 1O6CA 4YMLA 4LX8A 1P2BA 2ZJYA 3UJNA 1SXJD 2C7GA 2QTAA 4WZAE 3D8UA 2LWIA 3TUIC 1N4DA 2WUGA 4Q1AA 2W6NA 3DAFA 4JNCA 4KWTA 4EB6A 2IP2A 3TGLA 1KOFA 1TOAA 2O5VA 4BP8A 4MPTA 4UZEA 5ALMA 2WILA 5BR8B 2VHVA 3G9XA 4MV1A 2Q1TA 1GAWA 1SXJB 3ICEA 4B76A 2X9QA 3OCJA 4RH3A 1X8KA 1BQ3A 2VXCA 4BTEA 3LP6A 4C0QC 5MFZA 1Y80A 4HY3A 1NN1A 1ILWA 1NKSA 3HZRA 3DOOA 5TY0A 5IH7A 4MTLA 4ETMA 1MB4A 1P2SA 5F9HA 5K3OA 2C5BA 2OQIA 2H2WA 4U8GA 1Q91A 3N87A 4UTPA 4U0KA 4FGUA 5AKYA 4ALIA 4NICA 4JVOA 5FTKA 4YMHA 2MMCA 2ISCA 2BY4A 2RI1A 4J2OA 4RH1A 1QPBA 1YE8A 3OJWA 4B74A 5LOVF 1AJEA 4A91A 4G1FA 2WB4A 1DX4A 3BGDA 4J75A 2H3EA 2N9UA 1CLUA 5K1ZA 2AOTA 3CRVA 4OBWA 1P0FA 1B43A 5EGSA 3R7WA 3GA7A 1OFIA 1F8FA 1YQUA 1OJLA 2AQHA 3EQ8A 1KE1A 2V7QA 3W5HA 4DV6B 2VJQA 4YREA 4OX9Y 1XDBA 5I3ZA 2A0YA 5I9IA 3ZIDA 1L5SA 5ALSA 4AX8A 2BF7A 3ROTA 3AR9A 2HO4A 3PDHA 3MD0A 4F86A 3ZY3A 3CSSA 4JLVA 4PSVA 4BMXA 3ANXA 5JSZB 2C2WA 5FI5A 2HDOA 4O2AA 5IKPA 4GC9A 1E4VA 2BE9A 2QT0A 3GFSA 4GOXA 1WR8A 1ZEJA 1K4YA 2IDZA 3M2TA 4QBFA 3WP0A 5JD4A 2ATXA 2WM8A 4E5DA 4D82A 4NDZA 1PP4A 1PJLA 3H8SA 5FYDA 3BGIA 3ZLJA 3NTOA 1NT4A 1A72A 3MJEA 2JAWA 3FMGA 4FJ2A 5IAEA 4N0MA 3ZCQA 2G40A 4XVQA 4Y8VA 1JA9A 2ZGVA 3NTQA 2G9UA 1PI3A 3HUFA 3TKYA 5FYQA 4FHCA 4V1CA 4LRSB 3WXMA 1T1IA 2OBMA 3HYNA 2NTJA 3P2MA 4I1PA 4CM5A 1UZMA 4V02A 1KJWA 3T9BA 2NSDA 4HEA1 3G2QA 3L77A 4GX1A 1AO3A 2YY5A 5ALEA 3R9KA 3QOXA 2YN2A 3VBCA 2FW7A 4TS4A 1E8DA 4QG3A 4N9WA 2A59A 5JO0A 1C5KA 5LXTA 4RVFA 4PR3A 3G79A 4FFOA 3C1OA 3U4GA 3JASB 4DQXA 2VYCA 1YKSA 2R47A 3H4MA 5CVDA 3QYPA 4CTNA 4HNAB 1L4BA 5EIBC 1TJ3A 1BS2A 1K6IA 3NOQA 3CSUA 4FFNA 1N0VC 3LQ1A 2RKWA 2BFCA 4M6WA 2P6RA 1EFPB 2P27A 3LGXA 4EI9A 2X2EA 3THXA 1UK7A 2E87A 1H2FA 1YACA 3RW9A 1Y1KE 2YIMA 3LW8A 1QTQA 1D3AA 4KC0A 2R6JA 1TD9A 5BUQA 4AU1A 1DADA 1JLRA 1X94A 3KLPX 1ZIOA 3QYFA 4ML3A 3ZUGA 1MHTA 4EGJA 5EMNA 4YMIA 4N5IX 2QUKA 3WWDA 4WFJA 3VOAA 3TMYA 4PPFA 4MHTA 1J90A 1CDZA 2WYIA 4YJHA 1O58A 3RVKA 4EY3A 1ZN7A 1R9JA 2H92A 1OA1A 3UMGA 1THGA 3MMZA 4BQPA 3EQ9A 1NBEA 2OOKA 1PU2A 4QBTA 3RIYA 3VNRA 1ISGA 3W7BA 1E9RA 3NO4A 2ZWAA 3G2KA 3U4DA 3UMFA 4ZEVA 3N3AC 3PGKA 2CLCX 4XQ9A 3LF2A 4B3CA 1XCJA 1RHRA 2MSNA 2P9GA 4TVOA 1CC1S 3NEYA 3A2MA 4PXYA 4KACA 2WIJA 4UUMA 5K9ZA 2JLUA 2GA9A 1BJRE 3RVNA 5LQJA 3DT8A 1UZAA 1YGPA 1EVYA 1GPWB 3AZPA 4NMXB 1YIDA 4CFZA 3EWAA 5JQWA 4N49A 3NBZC 3VSEA 1YJBA 3RGWS 4EP1A 1LW7A 4FGWA 2NVUA 5GV7A 2V9ZA 3VH1A 5FADA 1XBTA 3SYMA 2HJWA 3RUPA 5HDQA 3NHMA 3NORA 2CVPA 3VKFA 2HQBA 3TM5A 2ZSHA 2PS0A 4M9ZA 3BB4A 2PGLA 1NOJA 1R0LA 3IAM6 2BKAA 2G72A 2GLTA 3LLMA 3H2GA 3ZNOA 1C0KA 1G42A 3E2MA 4RZXA 5K99A 3T1HB 3GGPA 2CB9A 2SKEA 3CC8A 4LUCA 3F46A 1KQPA 1NVUQ 3DL7A 3RYCA 3ADCA 1ADGA 4FJ1A 3R2JA 5H81A 4UOEA 2QUIA 3TLEA 1UXJA 4PGMA 1ODCA 2CXXA 3GCDA 1CUBA 4JGBA 2H1FA 4NYJR 4JB8A 5KQPA 4LOIA 3GY0A 3P0JA 2J7PA 1IBSA 2QIOA 2WKPA 4M8KA 1GL7A 4RMNA 3BJMA 1GPH1 2IIQA 3MMPA 2BR3A 2CWDA 2CE7A 2CWWA 1NW6A 3K5WA 2ACVA 4XWTA 4DG5A 2J41A 1XWWA 2FR8C 2G5PA 5KKAA 1XPUA 5AVYA 1Z08A 2XA9A 2XUHA 1E1QD 1G291 3N2YA 3QI2A 1WB5A 1RLIA 1YASA 4X93A 3IE2A 1J5PA 3ME5A 3MNFA 3NGXA 1LLUA 3NI2A 2FJPA 4IDEA 4UUNA 1XZPA 3F0TA 1VCOA 1WMDA 2PRYA 4BLOA 3F9CA 5JXIA 3EGXA 3EE6A 4P2GA 2I1WA 4J94A 5LMCA 3EA4A 3INYA 3V1NA 2J87A 3IKVA 1ICIA 5C32A 4NOMA 3WG9A 4WCFA 1TYAE 3BMCB 5HCIA 3K6SB 5JAUA 1Q74A 1HSOA 3I2HA 3K70C 1JR4A 2GPNA 2W0MA 4W99A 1YZ3A 3CLRC 1GFZA 1R3UA 2QAGB 2B21A 3S8MA 1M2NA 4ZVSA 4MR9A 4J3JA 4C6RA 5JXGA 3UQZA 1J8FA 4ZYYA 5HDBB 5JLJA 4HDRA 5HS6A 1T5DX 4MO2A 5C2JB 4YRZA 2XE7A 3IV9A 1Y7PA 4BE9A 2F90A 1POXA 1T5HX 2PGIA 1ORRA 2D5BA 3I6BA 2DHCA 1COWD 1CRLA 4JX9A 1MJGM 1RNLA 1U7DA 3W4JA 4NOJA 1YB5A 3VFDA 1AK1A 5IRCD 5K20A 2XYQA 5TMEA 2WPNA 1V11B 3R0JA 1GL9B 1DP4A 2FMXA 3BGOS 3IIJA 4Q1DA 2OZLB 4O5OA 3LNTA 4CM4B 1YJ8A 3R76A 4DR4B 5E1DA 3B9QA 4MS4B 3IBYA 4NBKA 5C5CA 2GXAA 1JJAA 2W37A 3T7JA 4AG3A 2HLPA 2QG9A 2VTBB 1Y8RB 3QE9Y 4XR9A 3LTNC 1WPXA 3AI1A 4EJFA 5B36A 2IODA 2QL5A 3IXLA 3AZQA 4WASA 2Z83A 6LDHA 2O8CB 3WIUA 5E8RA 1R12A 2QX9A 2YV1A 2C8LA 3EF3A 5JJ5A 4JP3A 2PQ2A 3LRPA 1W4CA 3D7SA 3DE4X 4ALMA 3ODPA 4TTIA 1YKGA 3WWZA 5DGHA 2RH4A 4H7HA 1POWA 1FRNA 1TYEB 2X4DA 2NTYC 2C4UA 2I0FA 4LZLA 1M74A 1XA4A 1IBRA 3VAZA 3D7MA 4KGVA 2GVDC 3DPIA 4OQPA 1UFRA 4IHJA 4H3HB 4X61A 1TZKA 1ESDA 1LVGA 2C2ZA 3TSWA 1H5QA 1LLDA 3M89A 2E4AA 4MRNA 1T9DA 4NDNE 4PAOA 1ODIA 4Q3LA 1QC5B 1NWHA 4HNHA 4CXMA 1VTKA 1NMZA 4KHZA 1OFHA 1TO2E 2J6IA 2DUWA 2JLRA 2VDWB 2QZ4A 2Z5FA 2DHRA 3HACA 4Q6BA 2CFCA 1N33B 1ZZEA 2FSPA 4M89A 4UTOA 3SC3A 4CQJA 2D0IA 3VTKA 4XFKA 4Z8YA 1RQPA 3BXPA 3U44A 2GCIA 1L0BA 3L3BA 1RHKA 1XEWX 3O5AA 2X1LA 2GAJA 2NTVA 4UHBA 3UJCA 4QO8A 4WK4B 5BUZA 3LJKA 2PRSA 4JP2A 4MWOA 4Q9DA 5JIBA 3SWWA 1H3EA 3ZI0A 2R751 4N54A 3TGWA 5K05A 1YRAA 2GLXA 3MGAA 4IS2A 2GBLA 2M6KA 3OPYB 4G25A 4KXYA 1J4AA 4YGYA 1HNWB 1Z6XA 2V4ZA 4DNXA 5LSAA 1QGZA 3B9RA 5IG2A 1K6XA 4NU5A 2B9EA 1OIWA 2VG8A 4ZMRA 5FL3A 2JFHA 5BT8A 2FPPA 2Q50A 1HDRA 3MVEA 1V2GA 5GOTA 4BCDA 4ZYXA 3P2IA 2JIPA 3DC2A 1OXKB 4AKEA 1PR4A 2AC4A 1VG9B 2BTQB 2O2XA 1ORWA 1U7TA 2DKNA 2V7GA 3PQFA 4RORA 4YUYA 2P5SA 5C7IO 1ZW1A 2EZTA 1DIHA 4BEBA 4V0RA 1KMHB 2BMJA 3V7NA 5B1EA 3DC7A 3DWIA 4FXPA 4XARA 1JFVA 1X70A 2PZEA 2WVJA 3EUWA 3GR6A 3MS4A 3FCEA 4KWCA 2GJ9A 3JZFA 4OFZA 4RL6A 5LNK6 3GVIA 3STUA 1Q44A 3GEMA 1X7ZA 5KQRA 5HKLA 1R00A 4FNOA 3RT9A 3ZCPA 3TFQA 2HKIA 1RI2A 1UXIA 3TUJC 4C0JA 4XJXA 3VM6A 2BW0A 4ND8B 5FWXA 5FJIA 1II8A 3AF3A 1Z29A 4PZEA 5CYPA 4ZVQA 4GSYA 3O8NA 4BO1A 3O8BA 1SWVA 4JLSA 2FXIA 1J99A 4B46A 3ZHCA 1XXHE 1OAKA 1S02A 5LZ8A 4B4UA 1FXUA 3F1LA 4DXHA 5IKMA 2RE8A 1YL5A 4YCDA 1IQ0A 3FPSA 2GXQA 1OVMA 1AE1A 3DMTA 1BCSB 3MJDA 4RETA 4X8OA 4OL0A 4PLCA 1N2XA 1TADA 4Z4IA 2JGAA 2O54A 2IPOA 4X7RA 1K6JA 5LM3A 3OM0A 4OO3A 1XMXA 2A84A 1JAZA 3RU7A 4BNZA 5DNCA 4DA8A 3F7OA 3H75A 3WL3A 4O4IA 4BQQA 3J81k 3S29A 1G17A 2ZBPA 3LDHA 1KJIA 1T8WA 2PSHA 4CIWA 5IVIA 2G80A 1TM2A 1IK6A 2OCGA 3O92A 4G0XA 5E4YA 2IIVA 5FPSA 3RROA 2HLHA 3PNQA 1VA5A 2O06A 5CFQA 2JLWA 4P9NA 3KXIA 1GO2A 1W93A 3CKMA 1NX6A 3P0RA 4KQEA 3JAMA 2AI3A 4RDXA 3TPCA 4L6AA 1ZJ4A 3G5TA 4LKOA 3G0IA 4M0FA 5CM2Z 1H5NA 2PH3A 5DP1A 1U9IC 2P1DA 1CETA 4HLNA 5L3RA 3IT1A 3STHA 1GILA 1G2PA 1MAUA 4DV7B 1UQUA 3HKBB 1C7QA 2V55B 1I4EB 5G0WA 4KFCA 2PV0A 1UBNA 2G17A 2H9YA 3GUVA 2BFEA 4DWJA 5BWOA 4LXHA 3NETA 1JFSA 1WDMA 1MP0A 2HRBA 3BYZA 1JMKC 3R9WA 2JIZD 2ORIA 4DM3A 3CUSA 5FBQB 4Q4AB 2CB0A 5FRDA 4D8TA 1Z5UA 2JKYA 5L3VA 3FTPA 1J2TA 3AJDA 1EWRA 1E2FA 1FU8A 1KH2A 3D7LA 3P94A 3S2FA 3SD7A 3WHIA 4BFLA 4ZDKA 5AJWA 3ZEIA 4QDZA 5CXSA 4ZAXA 4RULA 1NYLA 2IHBA 1AKRA 4Y18A 1GM5A 4JYBA 3TEMA 4NIMA 2I4NA 3U48A 4D41A 2HBRA 4DMCA 2A5LA 2H4WA 1JU3A 2Z2KA 2Z04A 3HKEA 1YOVA 2HU2A 5DK6A 2GASA 2HNBA 3E4CA 2PV7A 3ECCA 4TWAA 3X1XA 5L53A 1APBA 1FYVA 1DBWA 1OH7A 4L9RA 1TC2A 4YR7A 2HBQA 3DDZX 3H3XA 3KB6A 5TE9A 3FDZA 2I2WA 1YDEA 3MPOA 4LA4A 4Y2RA 5IAKA 3TOSA 2B1RA 2R7LA 1CB7A 4L27A 1XMQB 3QP9A 1Y9ZA 4QUHA 4MQFA 1P17A 1VHDA 2BKLA 3B6EA 1E2IA 3CO0S 1OI4A 2IHZA 5AJXA 5DPMA 4D92A 4L8FA 2GAIA 4HRAA 4EYOA 4K9NA 3BGSA 3OU2A 1ZOOA 8ADHA 2OLKA 5KYTA 3AILA 4FD2A 2C3OA 3L05A 5EKUA 5D3MA 3OJFA 5JH7A 1NXVA 3VJKA 3WLJA 3G6KA 3S1LA 4EJSA 2J0UB 3AI3A 3OIFA 3DP7A 3FUTA 5AWFC 1DIRA 1DTWA 2C9OA 3F5MA 3M1IA 1QRDA 5A5DA 5JJCA 4MR8A 1ID8A 3H86A 2PCLA 2G9ZA 4BP9A 1IH8A 3QHQA 4EFMA 3GC6A 4J1SA 3AB8A 4WIAA 2ONJA 2VDKB 5EP2A 3ED5A 2QL9A 4J7XA 4BNFA 4B47A 2NU6B 2VJPA 3KIPA 2PFGA 4F4IA 3U4MA 1CSEE 5B6JA 4DIBA 4QXPA 5C8DA 4ZVVA 5I6DA 4LBZA 3O2JA 4HAVA 4YRRA 3CA8A 3C2QA 3AG5A 5LB4A 5COQA 4ED9A 1E1QA 2DAPA 3T3MB 5CA1A 3WFJA 4I55B 1MJNA 1L5QA 2P4HX 4Z0HO 1VHWA 2O57A 3JSAA 1C7RA 3G5LA 1M1ZA 3OQVA 3OTIA 3UXYA 2ZWIA 2QG4A 2B1IA 3AHEA 1BQ4A 1VL2A 3D3WB 3GRRA 2VAXA 4C3UA 1DBRA 4Q19A 2PTGA 1FMJA 2QXTA 4HO1X 2H1HA 2UUBB 3SICE 2IYNA 1YQGA 5JASA 3D7KA 3NDRA 3L6EA 5FBVB 2VLBA 2W6QA 2EP5A 2XJ9A 5L4SA 3AWIA 2GM9A 3G5AA 4D5EA 1G38A 5DN6A 3ZBQA 2FMFA 4EYGA 1Z4PX 2DMRA 2EZUA 4BLPA 4NZZA 2Q9UA 2A94A 3HVJA 4IEEA 4D4HA 4EG4A 3KUUA 4WUVA 1JT2A 4J4BA 2MR6A 1COWA 1R9NA 2FPOA 2IYFA 2XXBA 1F6WA 2ZRIA 3PGJA 4OIFA 3RC8A 3D6VA 1RTKA 1XCGB 1JPUA 2PMBA 1QE3A 2DPHA 2XHEA 4RMHA 4PTYA 3VR5H 1Q0QA 5D84A 1KY2A 4H17A 4F8EA 2CJPA 4RPLA 4YP6A 4DYVA 2HCFA 3ZLBA 2VYFA 2LPMA 1DC4A 1VRWA 1BXZA 1D0IA 3KQWA 5H16A 2HPZA 3NIDB 2OKGA 3DTVA 3JD4A 5KX5F 5IBQA 2O5RA 1QZXA 4DVJA 2AG6A 4A03A 3A1DA 3ZQKA 3LIPA 2CNOA 4X54A 1P2UA 1ZH2A 5TGDA 4DGQA 1F0KA 5LDHA 2ACEA 3M9LA 1NOKA 1RAEA 1XLVA 3KHSA 1R0WA 2ZWPA 2JEOA 1LS6A 3OU7A 3PC8C 4G67A 2CSUA 4WOKA 3TD6A 1PG2A 1KBOA 1XNQB 1KJJA 4QOIA 1C2TA 1XK7A 2EXXA 3O91A 5HGJA 1QIJA 3AIIA 2VF5X 4JC0A 4EA8A 1W94A 1DRWA 1UMCB 3PUJA 4JYAB 1SQ0A 1IIRA 1PBNA 4G5QA 4BQFA 4V39A 4FC6A 3ZVNA 1RKXA 1V8FA 3BZUA 1VBNA 4YRDA 3UH0A 1TAHA 3BIFA 2AI1A 1TVCA 3WBKA 1W8DA 1JHYA 1LA2A 2LR0A 2QMUA 1DQYA 3BS4A 5CFRA 1J0AA 2OZPA 3IR6A 2UZ1A 1BA2A 4M49A 3WOHA 3WNQA 1AQYA 3KQUA 1H69A 1ECGA 3QMVA 3F5SA 4IIYA 3PSAA 3HRKA 3JX9A 5BV7A 3C8MA 3N1UA 3BILA 3LWDA 2CHQA 3HLKA 3WRVA 4G5RA 1D5WA 3WV5A 1V6SA 2N46A 1BGWA 2R2AA 1N2IA 2GS9A 2WHXA 3PGA1 4B7CA 2IZ6A 4B6QA 2VAWA 3GT0A 3IIKA 3I62A 2NZYA 3BWVA 1ZIDA 3W8FA 4MAAA 2WJWA 3T38A 2EJTA 3AVWA 2FSHA 3AV0B 2WKQA 2A9RA 3PSHA 5SY6A 4DLBA 4F2DA 2WWVD 4QQ8A 4I4IA 4QJ5A 1JH8A 1Y1QA 4RQUA 1Z0IA 2WHPB 4LDZA 3A2LA 2X2OA 1A8UA 1VXRA 2XNHA 4IMRA 3ML1A 1J20A 4K8RB 2IS6A 1AT1A 2R44A 3H2KA 4L50A 1OH6A 2O3UA 1YB6A 3C3EA 4X64B 4N7MA 1ZVQA 4XQCA 1E9CA 2OB2A 5FTJA 1K0FA 1EB8A 3MYYA 4WNAA 3WK8A 2C31A 4FMDF 4WCDA 2NACA 3SZGA 4OGFA 5A6SA 1VRCA 2BGMA 4JDPA 3DB2A 4I1VA 4C9BA 4DCVA 4P4SB 1XTKA 2GBCA 1JHAA 4P3YA 1DOZA 2FJUA 4RIEA 3AH8A 3CM0A 4U02A 1N9GA 1NVDA 3Q7QA 1LC3A 2XOXA 3OEHD 5J58A 2ZYRA 2R7KA 3DDUA 4IEFB 3TAHA 5K0TA 3CW9A 4W5HA 3U3OA 1CBUA 3GDGA 3I8XA 2A86A 3JAKB 4GKVA 5CJ2A 3RJ5A 3EDQA 1Z37A 3MILA 4GZ3A 3IH5A 2NYVA 2FV8A 1LBQA 5SYNA 1XV5A 1TECE 3EGVA 1XZGA 1AHIA 3KZXA 3LT4A 1AKUA 3HUUA 1HWYA 4KQGA 1TCVA 5K2MA 1DAFA 5EE0A 4TXNA 4JMLA 1YAJA 2VUTA 2X5XA 3WGIA 5LLDA 2OVBA 1R5JA 3KETA 1RABA 1Q21A 1U7WA 4DR3B 4BX3A 5P8WA 3CXUA 4J16A 3GMTA 2AZ4A 3EIXA 3OFKA 2A5GA 3NLLA 4MVJI 1H6BA 1ZUIA 3IDFA 3JVVA 3LY7A 4YT8A 4YRJA 5L3ZA 5JPDA 1D4FA 4DLWA 2F59A 4HJXA 4PLVA 2R8ZA 4CCYB 3QG5A 4EG7A 2FPLA 3A9CA 3NJ8A 2X8JB 4KDFA 4LZZA 3I64A 4FM9A 4ZO7A 1DS6A 2YS7A 1HE8B 1U0OC 3NHPA 4H0NA 1VIMA 3DDWA 5TQ2B 1E2KA 1XKTA 1AKEA 3VR4D 4C4PA 3FUXA 4KQJA 4YRGA 1GIAA 2Q6IA 2DPMA 2Y1KA 4G5FA 1FSZA 4RD1A 5FNVF 4Q7MB 5IAJA 4DUYB 1B76A 4EO9A 2Q4DA 3LQQA 4OFBA 2HQ1A 1Z2DA 3JQ7A 3ZZ1A 3UXHA 1ZH6A 2LCIA 4R0MA 4LYEA 3EEYA 4BP3A 3NBKA 3WNZA 3GGJA 1A27A 1AZSC 5K45A 2Z8YM 4X20A 2VF7A 2YRFA 3HJBA 4NVRA 5ADHA 2L18A 1FUEA 3K53A 1QYCA 4FDLA 4JA0A 3BE8A 3D6JA 3QLUC 3TR6A 2L69A 3LA8A 3VR5A 4ALLA 4JJ7A 5DYIA 5KUTA 3I4FA 1DO0A 4PM4A 3VOTA 3VO9A 1H2YA 1S8FA 1WULS 3ER8A 1X1SA 5SY4A 3KHKA 5K8UA 2P67A 2WNSA 3AUTA 1JEYA 3DTTA 1KIMA 3WGGA 1JPVA 2YWJA 2MCFA 1ZCJA 2E2WA 3P97A 1LLCA 1ZEMA 4BXOA 2JIZA 2ZR8A 1YNSA 3LDAA 3RYFA 3OIVA 4N4AA 4KB5A 3WA6A 1UK8A 3FFAA 2CUNA 5CEFA 4Q82A 3JWHA 1E20A 1TZ2A 1H2ZA 2FDRA 3T7KA 5A03A 5BXQC 4HUQB 3A11A 4D4MA 3GLFA 4XH9B 4R9NA 2NV6A 2ZUBA 4C0WA 4B3TB 3NHRA 3FHJA 1RWWA 1IUKA 3FVQA 3U61B 2E5LB 4KBGA 4TUYA 5IC4A 1SBZA 2WU1A 2QORA 3LWNA 1W6UA 4EGQA 4GI2A 4XUEA 3ZG6A 2ODTX 2D1SA 4XA8A 1CDEA 5T57A 3ANYB 1QF9A 1MQ9A 5EP1A 4K2AA 1X1DA 4M53A 1MFPA 3CX4A 4L3VA 4AS3A 2CJXA 4BMPB 4BX8A 3HKCA 2EATA 3BWEA 3PF9A 4J1QA 4TKVB 4XGQA 2QU8A 4BVJA 2H2HA 2RK4A 2PDAA 3A04A 1K6MA 2Y2UA 1K9VF 4YJ2F 1JWBB 1MJGA 2B25A 4YCJA 4CQNA 1NUHA 3JQFA 2FEMA 3DD1A 1G8YA 3OCWA 2ZI4A 1OXVA 1TFUA 1V48A 3AEZA 2P4QA 3LVFO 1SHLA 3DHVA 2IU3A 1Z0SA 3IRUA 3IEPA 4FYJA 4FILA 2JF0A 2QPAA 1CR2A 4KPGA 2WU0A 1S2DA 1T3HA 3EEFA 1Z2NX 2QD4A 1KF0A 4QFDA 4ARZB 2CL7X 4JJFA 3DVAB 1JQ3A 3OPMA 4BC0A 3LVRE 1GUAA 3S2SA 1RYFA 4ZOBA 3NALA 1N5IA 3NNNA 3OSUA 5LA6A 3RVJA 4DEYA 1PTKA 2NVBA 2ZBDA 2C0PA 1UM9B 2ECFA 1Q84A 3PDIA 4Z7QB 1G55A 1OLOA 1HTBA 5JADA 1CX9B 3OZIA 2D2VA 5F1PA 3H4IA 5CDTA 5JY1A 5FAXA 3ZU3A 1Y0BA 3ENNA 2JA1A 1Y33E 4FOTA 3KEMA 1DWQA 3G5UA 4MWCA 4E4YA 1KP2A 1CZOA 3G9TA 4GEKA 3F49S 3W05A 5MF6A 3DUWA 4ABTA 3WLEA 4CQLB 3G3EA 4B2LA 2P1ZA 1F2VA 1T5LA 5EHIA 4EL0A 1NPYA 2F4NA 5B4UA 1MGPA 2FQXA 2PSDA 1RT9A 2P2DA 3AM5A 2XMCA 3ONNA 4G0OA 4RFSB 2F8TA 2VSFA 4QQNA 4Z3OA 5DN9A 4BAGA 3UYKA 1PUIA 5NULA 2B83A 2WMYA 5A4IS 3D3KA 3VH4A 5HTKA 1I4DD 4GM1A 2HHJA 4N3NA 1JDJA 3FOZA 1DQZA 2DQKA 1GA6A 3B1FA 3L1UA 4RK7A 5AVJA 3VR4H 3VHXA 2ERYA 5KHLB 4HB0A 3DEFA 2UXCB 1H1LA 3RC9A 3TTUA 4M37A 4K9QA 2JD2A 1UK6A 4JLWA 1ZVMA 1IL0A 1T10A 4XB6B 3C5HA 4K3VA 1IN4A 2JCVA 4QU8A 4A9AA 4C3ZA 3FWPA 1DZ3A 3FMVA 4H1HA 5A1JA 3U31A 1IBCA 2FWRA 2YWHA 3RFFA 4B2IA 2G9VA 4ENUA 3KYCB 1YF3A 3H2IA 2GPBA 3T1QA 3KLNA 4AWXA 3BXXA 3EK2A 5EJ6A 1QRUA 2HRRA 3A3OA 3ICCA 4UQPA 1QK3A 2E18A 3REGA 1O94A 1U2GA 2D00A 1YL6A 2OORA 1DE0A 3LS2A 2EKDA 3WOVA 2IZ7A 4BIMA 2FQYA 2GJ8A 3NEAA 4ZVOA 1QLWA 4ZAVA 2WQ7A 2C82A 3AJ8A 4O5AA 2MIIA 3FCOA 3WMXA 1A50B 4R2LA 1R0KA 4GGOA 2EW2A 3ELDA 4DRXB 1J8VA 1QHNA 3SVZA 5LXTB 3WY9A 4YUZA 2CXUA 1U3WA 2CLOB 2WJHA 4KUGA 3WWCA 1WMSA 1T6NA 2JZNA 3PRHA 1PEDA 1A4UA 4R9RA 3RVDA 3RU9A 3IA7A 4I50F 3ZE8A 5GPBA 1WXEA 1SVWA 2Q5EA 4FK8A 2PX4A 1D9XA 3EARA 2GK3A 2H4JA 4YACA 1RMTA 2RHGB 4WHMA 5DYTA 1SQ5A 5B58C 3QUAA 4RXUA 5IXSA 5J4VA 2Q0QA 2ZTLA 4OM8A 2XD4A 3LXRA 2CCGA 4W1SA 1N5LA 2GYVA 1RRKA 1WSBA 3HWX1 4PYLA 1TVMA 3C3DA 1CYDA 4LGVA 4E5KA 2BT4A 3WWYA 3LBYA 1VBKA 5EWJA 1Q1BA 2P30A 3RS3A 5KTOA 2COKA 1YJQA 2R6CA 5EJ9A 1B6RA 2XDQA 1HQYE 2F3PA 2FCRA 1Z4IA 4Q1EA 4R9SA 1VKRA 3GLGB 1ZU4A 4LRTB 1FL9A 1IXRC 4F56A 4FOSA 3IEKA 1E0JA 2E82A 2BTEA 1AB5A 1SN7A 2HL6A 5I5EA 3N8GA 1Z34A 4HGPA 3M6FA 2WVGA 1DFGA 5FAKA 1CQJB 3Q12A 1DG3A 3UATA 5ES3A 2ZJ6A 3BXZA 3I3OA 1KI8A 4HG2A 5BY2A 2F3TA 3V7FA 2V6FA 3C3CA 4BZWA 5IM4A 3FSRA 3MBIA 4CNQA 2VPIA 4K9LA 1PWEA 1RC0A 3LHKA 4L9AA 4ZAFA 4QULA 2A33A 4MV7A 1X7DA 2YJGA 1A9YA 2NV2B 3FMOB 1W9MA 2C57A 5HM8A 2FF5A 3K0CC 3KVYA 4LN1A 1I3MA 1KETA 1ZESA 2GZSA 1KMMA 2FA9A 3GVHA 3R0VA 1IZ8A 3USZA 5J4KA 3O8CA 4J0HA 2A3NA 5IPFA 3E7WA 3C70A 4BNDA 2W6IA 3DBHA 4EMUA 4ZHQF 4MSUA 1XI2A 4TVSA 2CV1A 3PV0A 1BSVA 1MEJA 3OEHA 5G40A 3WL6A 3V46A 1W36D 2XAUA 1Z07A 4TWJA 3HA5A 4L4RA 1H4VB 4MROA 2WD7A 3NKLA 4HGYA 1XCMA 3GPDG 4N65A 4S1PA 5ALDA 3SLGA 3W5IA 3FDJA 5KNDD 3KELA 1YR7A 1J7KA 2P3SA 4ME6A 4Q3DA 4EH1A 2XA1A 3C15C 1BZYA 2QAJA 4NNPA 1RYYA 3PQ8A 4IDCA 4M7OA 1TF7A 1NZFA 4XX0A 2XUIA 1VCHA 2TS1A 3UJHA 1QOZA 4B7UA 1IONA 4P81A 3IO3A 3PWSA 1TGVA 3PQ2A 1CTQA 2FPWA 1UXHA 2DBZA 2I62A 2KBFA 1O6ZA 2YOHA 1OSNA 2D59A 3FWYA 4JBWA 4NFHA 4RA9A 1QF6A 1WMEA 1Z16A 4HDKA 2WDZA 5DNVA 3CG4A 3TN7A 1FNSA 4FX2A 2XJ4A 4OOEA 1JECA 3C48A 1R64A 4Y9UA 1SOWA 2JI8A 1P3Y1 3WRXA 10MHA 4LHSA 2GSWA 3ZHQA 4U9IS 3V42A 3R09A 4EENA 5EVCA 3ONWA 1QKKA 5AVOA 4ZVPA 2Y93A 4HYYA 4NYMR 2O8DA 1XEWY 4AJOA 3GNLA 3BIOA 3WS7A 2KLHA 2Y0PA 3B89A 2KW5A 4D5GA 3O84A 1TF2A 1JEQB 4LBWA 1B16A 3PB3A 2BGLA 4M0DA 3P9ZA 3NHJA 4JXKA 2GPJA 5KSWB 2I7DA 1SOVA 1YRBA 1K8YB 1KY4A 1XGKA 2YR0A 1T5TA 1EUZA 3EVTA 3PR2B 4WX2B 3S27A 3VR4A 5C7LO 5JD6A 3PEYA 4RBNA 4TWIA 5HUHA 2NO5A 1SUCA 3V1UA 1IZYA 5KTYA 3EIUA 1O0BA 1IEXA 1RMQA 3O0DA 4BVEA 4DJAA 2CVZA 1YDWA 2IOFK 2ZRJA 1L8XA 1X7WB 1A76A 1EG7A 3N8NA 4JI3B 1QO0D 4CLOB 4CU2A 4ENQA 2DTDA 3IOEA 1AQUA 1RHJA 1RVDA 1SULA 2CK3D 5IEJA 3P9QA 2CXOA 4CPDA 5DT9A 5BSWA 1U04A 4EPRA 3AP2A 2OL4A 3R7NA 3L1VA 4R5MA 5CCEA 3OCYA 3VU8A 4F1JA 4O1HA 5EWLA 3H99A 4OHBA 1FYEA 3TIGA 3R6LA 2BM0A 4I4TB 3SJAA 1SG0A 5JD5A 5K8IA 3BWMA 3BKWA 2BEUB 4QYTA 1S4QA 2GCNA 2CFTA 3DBLB 2RMKA 3CY6A 3QMPA 5A05A 2OBFA 3H11B 2TECE 1HEIA 4R8LA 2H00A 3ZI7A 4EKNB 4IJKA 1NJ2A 4URVR 1QQ7A 1I3OA 3EZ2A 4NK5A 4FP9A 4MICA 3ACCA 3FPHA 4OQNA 3VI4B 4JT4A 1CJKC 1TL7C 2CNBA 2JAXA 4KX5A 1R4MA 1MQSA 4MR7B 3UC9A 3F73A 3U1VA 4AKTA 2X14A 2CMGA 4P4GA 1V1MA 2P9JA 3L0ZA 4GVPA 4NLLA 4QYIA 3LE8A 3X1ZA 4U2GA 3X1JA 5IAAA 5LIPA 1JAXA 1PVVA 2EX4A 2JDID 3KYBA 2BZ0A 4MUJA 2IEAA 1PS8A 1A9QA 1EGMB 5B4TA 1NG9A 2CY0A 1BVUA 1M6WA 2AE1A 2NT4A 2WJZB 4K6CA 1M33A 5IKXA 1T0UA 1ODJA 3KVRA 1HRDA 1OASA 3WK6A 4X92A 3D2BA 3T9FA 1S7CA 4AY5A 1RC8A 5U4XA 2WJJA 4YV1A 4KIFA 2FN3A 3ZDZB 1IAVA 1Y7HA 4B3MB 3F6PA 1Z3CA 3KQPA 5EXDA 3WZLA 2GPYA 4EZBA 3M9WA 4F6LA 1ZK4A 2FPKA 5AJZA 1D7OA 1BKYA 4FSHA 3F97A 3P96A 2H08A 3H1FA 4U00A 4A1FA 4O4JA 2K2WA 1E6CA 1EVEA 1LGYA 4FX5A 4R3WA 3N3BC 4QBHA 1IDOA 4FDMA 3VDQA 3ZH9B 2OZKA 1D07A 3OQIA 1JJ7A 1KA9H 4CKEB 3A05A 1H1DA 3IAXA 4H15A 2XT9A 3DL2A 3THWB 5BR4A 1EJ2A 3RYHA 1OBVA 4X45A 1SD5A 1DT5A 2VJNA 4R1LA 3MHTA 1EH5A 2A9KA 3FMFA 1W29A 3QUTA 1Y9EA 2O0JA 4JJZA 2DYKA 4MXDA 4WK6A 2B3DA 4RIHA 5JNWA 1XQWA 4FKBA 4KN8A 1HSZA 2YWRA 2GKGA 1T9BA 4UHJA 1BJKA 1OZAA 4JJGA 3ZGYA 1OLUB 4BGEA 1CZKA 1XLTC 1V26A 2AN1A 5CYGA 5B1IA 3VAAA 2PX3A 1MO3A 1TD1A 4UTZA 2NSYA 4EG8A 3ZCSA 2CCKA 1DKRA 4EUSA 1N0HA 1BX0A 1S4MA 4RADA 3ZDFA 1KC3A 4KVGA 4RJJA 1EDZA 1P61B 2JAUA 2JC3A 2X42A 4YASA 3W2TA 5L4LA 2XQIA 4ZO9A 1WMFA 1XZAA 4FFPA 4WCFC 4KZPA 5EJMA 2HXGA 3HFRA 4QOGA 4X1IA 1A4IA 1NBWB 2F3QA 2JH9A 4DSNA 4EUNA 2LDBA 5B37A 3WISA 1DEKA 4Y0AA 3V4LA 1ZRMA 1PJRA 3GJ3A 4DPKA 2PT6A 1P31A 4UM9D 3AOEA 3DHYA 3FR8A 1GU1A 2XZDA 3GDWA 1EX9A 3K09C 2YVKA 4JELA 4POAA 5BRNA 1AKVA 2JGDB 1RZ3A 1TU0A 2P41A 4MW1A 5H68A 3JZMA 3TJZA 1GUBA 5H5JA 3W0LB 3R9XB 1RLTA 4UULA 4EGSA 2AKYA 1GL6A 1TEXA 3EPRA 1H3NA 4GMGA 3U3DA 1ONOA 1NW4A 1HA3A 1OV4A 1WTCA 1XRQA 1Q1QA 4RY2A 2O0KA 3HLTA 1C3LA 1H66A 4Y7DA 3WIBA 2FP4B 1MABA 3RBXA 2J45A 3WGLA 3OQ6A 5M3BA 3FPCA 2PL3A 1SUWA 4GOND 2OECA 3B1YA 3G5MA 4WZBB 3NYWA 4YDSA 2WD8A 5BW8A 1RHMA 2Q49A 3B38A 1V71A 1XVTA 4G0VA 3QXSA 4M99A 1MUUA 1O0SA 3ZH2A 3V4OA 4EY7A 2HLNA 1AKMA 4MP3A 1XQ6A 4D8XA 3KKLA