1GRQA

Chloramphenicol phosphotransferase in complex with p-amino-chloramphenicol from streptomyces venezuelae
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
178
structure length
178
Chain Sequence
MTTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMPLKMQSAEGGIEFDADGGVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVGDLDVLWVGVRCDGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYDVEVDTTHKESIECAWAIAAHVVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Chloramphenicol Tolerance in Streptomyces Venezuelae by Chloramphenicol Phosphotransferase Activity
pubmed doi rcsb
molecule tags Transferase
molecule keywords CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE
total genus 58
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2001-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07931 CPT Chloramphenicol phosphotransferase-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1grqA00
5JWOA 3KFVA 3LA6A 5L3QB 3PFIA 5JCZA 1BMFA 4Q7MB 2YC2C 1KOFA 1E2GA 3DM9B 1CJVC 1GNQA 3KJHA 4IVQA 4PXAA 1NY5A 3TW8B 2JLWA 2GAOA 4ZCLA 3RC8A 4BFXA 5F2EA 1P61B 2BIFA 4OHZA 2Z43A 4ZIRB 3AF1A 2XOKD 3T06B 5CB6A 1XTRA 4HB0A 1G20E 2VP5A 5B30A 2IUSA 2XAUA 4ZO4A 4B34A 2IUUA 3ADKA 1CJTC 1GDDA 3ZZTA 3L8ZA 4DCTA 4MGKR 1E9FA 1LTQA 4KSBA 2OE2A 1N0VC 3EW9A 3NEYA 2GEDA 4DB2A 3WRYC 3B1WA 2X2EA 4HDOB 4KHZA 4RZXA 1ZD8A 4D25A 1RE0A 3SR0A 1NLFA 1SZPA 4W7SA 4BPBA 3RANA 4LJ4A 1E2KA 1E2IA 1FW6A 4NP6A 2W0SA 4G0NA 2RGXA 4TMKA 2CHQA 4F91B 1NF3A 4HYYA 4TL6A 1GILA 1HT2E 4NU0A 3LVQE 4B2LA 3R9XA 2ZRNA 1AK2A 4JLKA 4V0NA 5FH9A 1CULC 1ZP6A 2QAGC 2ZRFA 4JLNA 3AF2A 3QKSA 5CK5A 3R9IA 4NCNA 4NMMA 4PR0A 1OW3B 1JR3D 2ZRLA 1W2HA 2ZQ5A 2R44A 4A92A 4AYTA 1M7HA 1LFDB 1VECA 2ATXA 3PR1A 5HZHA 1KY3A 5LD2B 4IEEA 1MO4A 2B7BA 2JEOA 4GSYA 1JJ7A 2ZJ8A 5LD2C 1OJLA 1KO4A 2C8VA 1N0UA 1OIXA 1U81A 2H5EA 2ZTSA 1LS6A 2J7KA 3KL4A 4R9UC 1JJVA 3P32A 1ZINA 1G8HA 2ZAOA 4PANA 2O8FB 3THYA 1DO2A 4NBSA 2P5SA 2Z4RA 3K9LA 4JT4A 2DWOA 3O8CA 3WHKA 2JLUA 4QJ4A 1F60A 5FUYA 2IYXA 1ZU4A 3SFZA 3MG9A 4QNMA 1W36B 4LYFA 2C98A 3PXGA 2ZE6A 1E4YA 3U4QB 1XD9A 3OEHD 3A1SA 1EFRA 2XJ9A 3Q85A 3VR4A 4B43A 1A7JA 1QHHB 3B82A 2GCNA 3C15C 1MR3F 2VSXA 3MWJA 1E9EA 4B74A 1IN5A 4HAZA 1SGWA 4DUGD 5K8LA 4OK3A 1KHTA 4FMBB 5KOYA 1R5NA 5FOVA 3FE2A 1J70A 4RFVA 1OXVA 4WIAA 1OFTA 5FPHA 2GWHA 5KU1A 2ZVPX 1YZKA 2MSDB 3QBTA 4M1TA 4NCJA 2IW3A 3ZQ6A 2CL6X 1YRBA 1P2SA 4TLAA 1OV4A 4QRHA 1KMQA 2FWRA 3ZVLA 4PC7A 5JS8A 4WZBE 1E0SA 1QVRA 5AJVB 2B21A 5EQTA 5AWFC 4V0OA 4P4SA 3QXHA 3T1TA 2C77A 2EFGA 1X86B 1OXUA 1CR0A 1IN4A 4EPRA 5FL3A 1HQYE 4HLUC 4Z51A 1FFHA 5FTLA 1N6RA 1TF5A 2OG2A 3RS4A 1OHHA 4FMCF 4MYHA 1NN0A 1OFIA 2IF2A 2CLDX 2RH5A 1DAKA 4TMXA 1DOAA 1E32A 4C4PA 1T6NA 4MUBA 2O8CB 4L15A 3FKQA 3OZXA 1SXJE 5TARA 4HLUA 2IL1A 2UKDA 3KTAA 1M6NA 2QMOA 4LC0A 2JLYA 2R65A 4EJSC 1VG0B 1G5RA 1AS2A 1KNXA 3PEVA 5SZJA 4WW0A 3FMOB 1E6CA 1HY3A 4AKEA 4V02A 4RD6A 3TJZA 2GILA 2GHIA 3SDZA 4F7WA 2IX3A 2HLDD 1N0WA 3QXXA 2FE4A 3BIFA 4LX0A 4P4SB 1MO3A 3DOFA 4KLZA 5CM9C 5DN6A 3AVYA 3ND9A 3TW4A 5KHOC 4MKGA 4Q4LA 2NO9A 1A82A 1W0JA 3GJ8A 2ZPTX 3P1JA 3R8CA 1UFQA 2PBRA 1Z6TA 2PEYA 3H1TA 3K1JA 4LYJA 1VYTA 5FPYA 3VR2A 4K8OA 5JSZB 2JCSA 3U6KA 3K0FB 2IEZA 3SE0A 3VTKA 2ZSDA 1NN1A 3UMFA 3TR0A 3TKLA 3W8RA 2O8DA 3U3RA 2W2VA 4M0LA 1DE0A 4O2RA 3W3ZB 2XZLA 1KK0A 4A2QA 1CR4A 3LQRA 4TLBA 4Q21A 4EFNA 5K8TA 2JA1A 1XJCA 2VIIA 2FOLA 3GEHA 4BLSA 3ADBA 1LVGA 2ZI4A 1GKUB 3E2IA 1F2TA 2HJVA 4P33A 2PH1A 3FYHA 4Q1CA 5G3YA 3AVVA 1UKVY 2ZJOA 5GVRA 1QHYA 2ODBA 3FOZA 1G18A 3IGFA 3EIQA 1XU4A 5EXTA 5CDFA 2QBYA 3GJXC 2VYFA 5E7IA 1YR8A 4JLAA 5FPSA 1ZD9A 5CK4A 4N1AA 2AD5A 1G8GA 2D74A 2UZ3A 5DO9A 1M7GA 4RD1A 1AKEA 1IY2A 4Q4HB 1AGRA 4BQSA 4Q4AB 2DWPA 5JSZA 2FU5C 1OB5A 4BASA 4DT1B 1Z6GA 1Q21A 1Z47A 3B2EA 2XNDA 3B6EA 4Q1BA 4YXWD 3OF5A 4ZV4A 2J1LA 4G5OA 3UMRA 1OB2A 5IK2A 2PL3A 2RGCA 4PSKA 3ZIAD 4LJ7A 4AKGA 1FMLA 3CRVA 1U9IC 4NYJR 1F3OA 2RGNA 4B3GA 1UKYA 3VKWA 2RGBA 3NC0C 1KZ7B 5EE0A 2YKGA 3DL0A 4MH0R 1SVSA 5KNDA 2QORA 4RCYA 4HUQA 2Q21A 3QF7A 4US1R 5BW8A 1G5PA 1I4LD 5KNBA 2DFLA 2JLRA 1CIPA 1XMVA 3BH0A 1DELA 2IYSA 1HQCA 2ORVA 1OIWA 4A36A 4TQ9A 5CM8B 2CNWA 1E1QD 3RSOA 2Q9BA 2QTHA 2PLRA 4OK5A 5FUVA 1U9IA 5FBRB 1KI1A 5FR1A 2FPKA 1EXMA 1OH7A 2CL0X 2ZXUA 3ZGXA 2GETA 3X1YA 1XPOA 3QQ5A 1AM4D 5CJ2A 4B3FX 2IWRA 4JL6A 4YDSA 5KSYA 2CCKA 4DCVA 1R6BX 1Z5ZA 1ZUNB 1Z6XA 1E79D 2EFEB 3AKYA 3NDBB 2QU8A 2WWGA 1I2DA 5FOUA 3TUJC 2XTNA 4MQBA 5DLQC 1E0JA 1KAOA 3B1VA 1NN5A 4WXPA 4HB4A 3NBXX 2Q3HA 2BBOA 4KYIB 1XTIA 3B60A 4QBFA 3UK6A 4HSEA 3B5JA 4IDPA 3T34A 5FPTA 1AKYA 2I1VB 4QHYA 1D2MA 2AHOA 3CLVA 3CRW1 1TX4B 3THWA 1E2NA 1XEXB 4II7A 4R71A 2AX4A 2CLCX 4JVSB 5AJWA 1N6OA 3UG6A 1XCPA 1R5BA 2BDTA 4DCNA 1Z29A 4F92B 5JJKA 2FF7A 3T5GA 4B71A 1U0HC 2QAGB 3BB3A 3IHLA 3VR6A 3GLFE 1JNYA 1U94A 4TMWA 2NPFA 1M2OB 621PA 1JALA 2D62A 4QJ3A 3GJ4A 1EFCA 3B78A 3FHCB 3PUVA 2DCUA 4GZMA 2OFXA 3J81k 2R2AA 1KJZA 2O52A 1GKYA 4GFDA 2AR7A 1XX6A 2VHCA 221PA 3LX8A 3AVTA 1E9BA 1TF2A 3LD9A 3ZS9A 5G41A 4NTZA 5FOXA 2GCOA 2AWOA 3CPHA 1CRPA 4B3BA 4UJ3A 1Z8FA 4B48A 5B57C 4QGHA 2ZJ2A 4TL7A 2XB4A 1GP2A 2C78A 2QM8A 4PPFA 4DEYA 3CRRA 3CIOA 2ZRMA 1XPRA 1OXSC 4BE7B 3IDQA 1OSNA 2F43A 3NHBA 1JPNA 5KYKA 1H8HD 1Q1QA 2GCPA 5GADl 2G0NA 3I32A 2CNWD 3ADDA 4TQAA 1AN0A 1FL9A 1XDBA 2ZS7A 1LF0A 3CWZA 4OI1A 2ZETA 3SJAA 5EUMA 3PQCA 1Z6YA 2PCJA 1KDOA 4MGZR 4IDNA 1RW4A 3IPYA 2P6RA 1G4AE 4M1WA 2BMDA 3AUXA 2QRNA 1UM8A 1VMAA 2YC4C 2B8WA 4BFUA 5A4JA 4Q47A 1OKKD 4AKIA 1ANKA 3L0SA 3MJHA 2PCLA 1GWNA 2QT0A 2VEDA 1KI6A 1AJEA 1HYQA 5EE5B 1OIVA 1JR3E 4MDEA 5GJBA 3KQKA 4NPHA 3CBQA 3FVQA 4TN1A 4DDUA 2JASA 3JVVA 2X8AA 5HKKA 1NG9A 4E07A 5BN3A 1ZCBA 4KFUA 2FEOA 1QZXA 1KY2A 1X8JA 3IKJA 4AK9A 2BM0A 4ZDIA 1ZVQA 1E2LA 1Q57A 1F5NA 5DSZA 3UMSA 4MYUA 1T5LA 4IDHA 2C9OA 3A36A 4XSGA 2WV9A 1QBKC 1NRJB 2BJWA 1E2QA 1G3QA 1G6HA 3PENA 5FBWB 1DARA 5CB8A 2IUTA 3UIEA 2FFAA 3QOFA 2JIZD 4NYIQ 3CRQA 4XOIA 1BH2A 1VKJA 4HLCA 4EQ6B 3WBJA 3VR5A 3HR7A 3AKCA 5KO2A 1PLLA 4Q1EA 2YNMA 1FOEB 1NJFA 1NMYA 4LV8B 2J41A 3V4FA 1YZUA 3W5JA 2BEKA 2ZYTX 1RFLA 5FL7A 1R10A 5H68A 4DCUA 3U44A 3LH5A 4QGAA 4QBGB 1EG7A 1TPZA 4QHTA 1SVLA 1W0KA 1MO6A 1D2NA 4HLQB 3QSYA 1US8A 2J87A 4PC1A 2ZI7A 5IF9A 4R7ZA 1MO5A 5TDHA 1XTJA 2EFCB 3X1XA 4LY6A 2QAGA 2WM9B 2GTPA 1GFIA 2ZRPA 3KX2A 4UNPA 2IC5A 5DNYB 3THYB 2OCAA 5JI2E 1CXZA 2DFTA 4C3ZA 1GL6A 4BWYA 1M7BA 1D2EA 4ZKDA 2NZJA 3BERA 5HCNA 4Q9KA 5B2ZA 4GNKA 3SNHA 2BKUA 3D31A 2FZ4A 3AGQA 1JBKA 5CLQA 4AY2A 3IUYA 5CDFE 4RZ3A 4TL9A 4GPTA 2XXAB 1ZM2A 5TVKA 2DYKA 3TAHA 2F55A 4TYQA 3NDPA 3DMNA 2ZE7A 4LV6A 4V0KA 4KFTA 3VQTA 2ZR7A 4O0MA 1SVIA 3I8XA 1Z63A 2ZJ5A 5CYPA 2A5JA 1FX0A 3T35A 1SKYE 1R0YA 3OAAD 2AD1A 4AI6A 2VP4A 1YHNA 1TF7A 2C99A 4Q7LA 1DTSA 2VTKA 4C0BA 2P65A 4RKEA 4G1UC 5DI9A 3WYGA 2W2XA 3KJEA 4FMDB 3RS7A 4DSOA 821PA 1S9HA 1IJEA 4GBMA 1NMZA 2DWQA 3MAAC 3QI2A 2WWHA 1ZM3A 1W0KD 4C0JA 4EPYA 3VKGA 2CHGA 2J0UA 2J9RA 1AGPA 1KI9A 4WOPA 3ZVMA 1SQ5A 2G3YA 1CBUA 2WPDD 3QE0A 5D3MA 5KSOA 4WBSA 2XXAA 1IAQA 4B76A 2BWJA 5AJZA 5EJEA 2ZROA 3FFBA 3WNBA 4JZKA 4UNNA 4OI2A 2G77B 3GLIB 1G7SA 3TIFA 1F2UA 1N2CE 3KTAB 4D4LA 4D81A 3T15A 4M1MA 3I4LA 3NBFA 1YZTA 2JLVA 1AIPA 4E5UA 3RVBA 1UBGA 2QGNA 1IOZA 1W47A 5CJPA 2ONKA 1H8HA 1Z3IX 2ZITA 2WWIA 4N0DA 1SVOA 1ZM7A 2WJIA 3T1VA 4A8JA 4G5RA 4C0LA 4KJZA 1F2TB 3U5ZB 3W6PA 3TUZC 5AJYA 4BEJA 5DH9A 4AYXA 4CEJA 3U7EB 1RIFA 4B73A 1U99A 2WICA 1TAGA 2WSSD 3KKOA 2KBFA 3W9YA 3L0IB 1S96A 1RRFA 4ZCMA 4AKHA 2FGKA 2GXAA 2PMKA 2C03A 4URZR 5AUPB 3EARA 2IA5A 1M8PA 1YZQA 2P3SA 1P9RA 2REOA 3UKDA 3ASYA 3C4JA 1KI4A 4EFLA 2Y8EA 1IHUA 3FTQA 3CUEF 4B3XA 3SHWA 1Z08A 3T5DA 3WXMA 3U2QA 2CVHA 2OLKA 3TH5A 5AUQA 2V6JA 2PX0A 4PFSA 4FWTA 2O8EA 3GJ5A 1PLJA 4RD2A 1E9AA 1ZYUA 1T3SA 4URVR 2EW1A 2BOVA 3KXIA 1KSHA 3TMKA 4PQFA 3GLGA 1FPMA 2NO0A 4URWR 1ETUA 2ZRKA 1NVVR 1XPUA 5DISB 5FBVB 3U44B 3UWOA 2P67A 1CR1A 5KDLA 4HAUA 1P9WA 2C96A 5TY0A 521PA 4HAVA 4Q9HA 3H0KA 1W2GA 2G88A 1G3MA 1G8PA 3U4QA 2QGZA 1CS4C 3GLHE 4Q03A 1J90A 1YR6A 4LSGA 2IS4A 1NBMA 1KGDA 3TSWA 3NEJA 4DDTA 2G0TA 4IOLA 1UEIA 1E1RD 2QMUA 4PO1A 2ASEA 4ARZA 3K09C 4PO9A 3LRPA 2HJGA 1RRGA 2B92A 3WP0A 3REGA 3RRZA 4LK2A 3LX5A 4C2UA 4CGZA 2WOOA 3QKRB 4CEIB 3BC1A 3TUIC 1KJWA 1N6HA 1ZW6A 3TQCA 4PHHA 3AVQA 4EUNA 4XWOA 4JT2A 3KUDA 4M9XA 4LHYA 4BZQA 4IOMA 5B64A 8OHMA 1EFHA 5LBIA 2FA9A 4KSCA 1NP6A 4R2HA 4B44A 3SHFA 4GZLA 3GJ0A 4Q1DA 2WVJA 3EASA 1N6KA 2WJJA 3ONWA 3OEED 2FJUA 3KJGA 2I4IA 3L8YA 3MJRA 4LBYA 4AWXA 1E94E 4EPTA 4DEXA 2ZREA 4Q7KA 3WYFA 2QTVB 3P4XA 2E87A 1KAGA 2G1JA 1ZC3A 1U8YA 2VLIA 1EGAA 3RWOA 1XXHE 4ABYA 2C04A 3I72A 2G9NA 2W83A 2RHDA 5J47A 1Z0JA 2FPLA 4HZIA 3RRMA 3ZZ0A 2OBMA 2HDNB 4FCTA 5KTYA 4IKEA 1E0KA 5F9FA 1KDPA 4QOSA 1FNNA 3FPAA 1RVDA 4DIDA 1EWQA 2XOKA 2ZU0C 1NBMD 1T5IA 2P6UA 4A2WA 2F9LA 3SQWA 5J4VA 2J0QA 3ZZUA 5EP4A 2HF8A 4US2R 1KO5A 4Q4JA 2FSFA 4Y0VA 3I73A 1OH5A 1GNPA 1C4OA 2GVZC 2JJ1D 5BN4A 3TBKA 1ZD1A 3ZS8A 5AUOB 2R6AA 3H84A 3KQNA 4YLGA 4E22A 3QIAA 1XJQA 3SQXA 2ZE8A 4IVRA 1OHHD 3F5FA 2HYDA 3Q9LA 5EZ5A 2NGRA 3PUYA 2ODEA 1XEWX 1ZU5A 2HXSA 3AKEA 5J5CA 4LBZA 3QG5A 1WBBA 4CT5A 2PJZA 4OQFA 4XH9B 5KSPA 3T1QA 2F3RA 2CVFA 2GF0A 3EPKA 1AS0A 1OH8A 2LWIA 1N5KA 4ZDJA 4CDGA 1IJFA 3BOSA 4BFVA 2RGDA 4RCZA 2IYRA 3WBKA 1ESNA 3KKMA 4PC2A 3AP1A 2X77A 1VCIA 3BH7A 3ZJYA 1GRQA 3EZ7A 4IFBA 2ONJA 5SZKB 3OIWA 2QM7A 2NO6A 1G17A 1E1RA 4NCHA 2JLZA 2XSZA 1N6NA 1S1CA 3O8BA 4RSGA 3Q72A 4HB2A 4I1UA 4AYWA 2PJRA 1OXXK 2V55B 1CU1A 2D06A 4S35A 4BLTA 2QPAA 1W0JD 2ZSFA 4KBGA 1WMSA 5C46F 2OAP1 2XGJA 3B9QA 3X1WA 2D7CA 2HCBA 3A8TA 4AC9A 2B6HA 1I4TD 2H17A 2A5FA 3QPUA 1QHIA 4LUCA 3DVLA 3EWAA 1VYVA 2IYZA 4HI0E 3VFDA 3LLMA 4G5QA 3BXZA 4W5WA 2VL7A 1Q1EA 1SXJB 1VCMA 3LO5A 4MYCA 3AVWA 2ZI6A 5FUXA 1D6JA 2DY1A 4DSUA 4NYMR 3A37A 3EPLA 1LY1A 5JZVA 3AM1A 3A1VA 4BRWA 2WAXA 3U3KA 4ASUA 4GOKA 2NO1A 3I8SA 3IHWA 4JYBA 4HATA 3RS3A 2EWWA 3V9PA 1IQPA 1ZUHA 3BWDD 2F1HA 3W5IA 2A5YB 2XJ4A 1BKDR 3CM0A 5FOSA 3W34A 3U60B 2BCGY 1II0A 1UDXA 2F6RA 4CT4B 4RZUA 3FGNA 1YR7A 4QGGA 2PMDA 2D2FA 4V0ME 2C2HA 5JEDA 4MITA 4QGFA 4V0MA 1U2RA 2PZFA 4CZ2A 3K0AA 1KO8A 2MSEB 4MRRA 1WRBA 3H4MA 2JJ8A 5TB5A 5AJXA 1DAHA 1G7TA 3WMFA 4BFTA 4Z54A 4ZDKA 2XNDD 4ON9A 2IS6A 2D2EA 2BMEA 2OUKA 2HLDA 1CTQA 3T1OA 1B0UA 1S0UA 4MRVA 3LXXA 4NYJQ 3PITA 4I1OA 4ESVA 1G7RA 2H16A 1NG1A 1U90A 5KNCA 4EJSA 1QHGA 2A3RA 4K81B 2ECKA 4KFRA 4TMZA 2YZ2A 4AG6A 2P6NA 2ZS8A 4CIDA 5H8WA 3PUZA 3K0EA 2YWGA 2WMNB 4YDHB 2ORWA 2X1VA 2VSFA 3FMPB 1DVRA 2QPOA 3O8RA 5GVSA 3KXKA 4LGMA 1TMKA 3IBYA 4M21A 1S2MA 4MRSA 2WJHA 1TQ2A 2H92A 2X19A 1W4RA 2E1RA 2PLFA 4GOXA 2OHFA 4ACAA 3CZQA 1AZTA 2VQSA 2IYUA 3MCAA 4JLBA 1XMSA 2OAQ1 2AK3A 3PEYA 5SZHB 2G83A 2J5XA 4MGYR 4B3DA 2JJ2D 4I81A 1VIAA 4F4CA 2BMFA 3RS0A 3QXSA 4UNSA 1EFUA 3E5HA 5DN6D 2QQ0A 4XIGS 1UBFA 3CO5A 1L4YA 3EX7C 2QSYA 4OL0A 4A82A 4EPVA 1X6VA 2IHYA 2EYUA 1GL9B 1JQJC 4I1SA 1ZRHA 2VA8A 2NTYC 4B35A 1E99A 1GSIA 4DLTA 2WIAA 2ZSEA 4IDOA 1Y3AA 4C0AC 4QG7A 4S2EA 2ZSAA 1S3GA 2X2FA 3SFVA 2IS1A 2ORIA 3U6BA 4TTRA 4JLJA 4WZ6A 2PZEA 2ZS9A 3A4NA 4EFMA 4A9AA 3OAAA 1ONBA 3AH8A 3K0CC 1Z0AA 3ETLA 2IT1A 4KVGA 4BEBA 4RD0A 4TLDA 3VR1A 4DLZA 3EC2A 3UATA 4QXAA 3KQHA 5FTMA 5HE9A 2J7PA 5KSZA 2IS2A 4JJZA 1NLZA 4B3CA 2YOHA 3GMTA 5JECA 3O8DA 4PC3A 5E4FA 3B1XA 2QE7D 1E98A 5DI3B 3CH5A 4X8OA 1RC8A 4UKDA 5EXSA 5A5GA 1X8LA 4FMCB 4KI0A 2CJWA 2FSGA 3VAAA 4Q1FA 3VHXA 2KSQA 4PQYA 4FCVA 2BM1A 2NG1A 2JJ2A 3BS4A 1EWRA 3MD0A 4J0QA 2AFIE 1M34E 1R7RA 1V43A 1VTKA 2JDID 3M6AA 3EZ2A 4LYHA 4B75A 3L43A 2QPTA 1G6OA 4XWAA 3EA0A 3NC1C 2YVUA 1E79A 2Z6VA 2ZUCA 2V54A 4QHSA 4KCGA 5CITA 1NKTA 1U0JA 4DDVA 3U7HB 2RGGA 3SOPA 1G41A 5TMPA 3QENA 4W5JA 4DZZA 3ZVNA 4OK6A 4AURA 4L16A 2OBLA 1TEVA 3K0SA 1GRNA 2W6JD 4Q9LA 5FPKA 5KDDA 2UVQA 4JLDA 2JATA 5EUQB 4Z8XA 2QENA 3DOEA 1II8B 3AF4A 4AD8A 1RPZA 1E9CA 1W1WA 3CNOA 5EP1A 1Z07A 4CF7A 5LB4A 2NOAA 3MSXA 4FXPA 4KODA 4PO8A 5FTKA 3AVUA 1HE8B 3ZQJA 1DAGA 2LKCA 1E2HA 3IQXA 1D9ZA 1FQJA 4GMDA 4KAXA 4LJ5A 1F48A 1T9HA 4M53A 4RD3A 1NBME 1CRQA 1ODFA 2GZAA 3HU3A 3LDAA 4MUAA 1QDEA 4WXRA 1TU4A 1ZUIA 3LY5A 3GLIA 1NI3A 3D6TB 4M9QA 1FUUA 3P4YA 1UAAA 3Q3JB 3R20A 4HAYA 4KITB 1YZGA 5FOWA 3AGPA 721PA 4X8MA 4G01B 3ZD6A 3HYTA 1Q44A 3LLUA 2QRZA 3VHLB 5JFGA 2LKDA 3VU9A 2BHRA 2VP6A 2W6ID 1KI7A 1DG3A 3N70A 1GKIA 1P60A 3RLFA 3ND8A 1NSTA 1FUKA 3QKTA 4PHTA 2CK3A 4A8JC 2WOJA 3SYNA 6Q21A 5IHPA 2JIZA 4BFZA 3MRSA 1XZQA 2MSCB 5LDDC 2GA8A 3FWYA 4BRUA 4HDQB 5C4GB 4URUR 4CYMA 3L0OA 4PSAA 1GNRA 4Q5IA 1XRJA 2OBNA 4U02A 5TXGA 3G0HA 4U5XA 1E9SA 4XD7A 4TYPA 5JEEA 2V9PA 3K9HA 1RYFA 3GLHB 3ZD7A 3F8TA 4EAQA 2FFQA 2JLQA 4FN5A 2KWIA 3GLGE 2C9CA 2J7PD 4URYR 4BFWA 2REXB 1A2BA 2ZI5A 1P2UA 1ZIOA 3DKVA 3H86A 1G8FA 2WSMA 4D26A 1R0ZA 5K8UA 3T61A 1PJRA 3DMDA 4PPGA 3ZYCA 3NTUA 3TVTA 1GVNB 2IYTA 1P4SA 3W6OA 1IBRA 2JDIA 5JJIA 4PAQA 3R7WB 4TMVA 1BO6A 2ZRCA 3TVDA 1T0JB 4EKDA 1G21E 1T4GA 2FG5A 1KKLA 1XD2B 3W8NA 5F3WB 2O8EB 2IYQA 1MOZA 3RS2A 2H18A 3D8BA 4M9ZA 4GDFA 3HU1A 1Z2CA 3P20A 4B47A 1COWA 4JVLA 1XB2A 3ZVRA 3DDCA 1HE1C 3MLEA 3QVUA 3A58B 1BOFA 4LOAA 2W2TA 2IXFA 2WWXA 3C5CA 1GRRA 1QHNA 5E95A 3F0TA 1U8ZA 1PV4A 4IOJA 2O8CA 2EYQA 2FFHA 1OYYA 3HU2A 4FW9A 3F3YA 1CLUA 1P9NA 2YINC 3P26A 3S1AA 1ZBDA 4Q02A 2OM2A 4JLMA 1H8ED 1K5GA 3I61A 2WWFA 4P0TA 3CWQA 5IT5A 3NBZC 1N5IA 1KSJA 1Z06A 3KJIA 1CEEA 1CJKC 1OKKA 3LV8A 4CEHA 3RS5A 4F4IA 4U00A 2GJAA 3D3QA 1G8YA 2ZUDA 4QBHA 4O3MA 1WBDA 4LJ8A 1J7KA 1P6XA 3CZPA 3TK1A 1G19A 4ZIRA 3DM5A 4BLOA 2NPIA 5HKKD 4XWKA 2FX3A 3GLFA 1HV8A 4MGIR 3HPQA 3E70C 4JSYA 1N5JA 5IK2D 1YQTA 4NDZA 2HEIA 2ZI3A 1CJMA 2VHUA 5C18A 3CPJB 4NH0A 2YYZA 1HA3A 4P4UA 2FMXA 2ZVQX 1G7CA 3ZH9B 1RYHA 3N5CA 3Q5EA 1MT0A 1ZAKA 1BYIA 1BMFD 2OCYC 3VKHA 2W0MA 2MMGA 3QBVA 3SS8A 3TAUA 4B2IA 4BLPA 1XTQA 3QJYA 1IM2A 1WA5A 2ZRDA 2IHBA 2PEZA 4KU4A 4A0GA 5HPYB 2YJTD 4B6FA 2ERXA 4PAOA 4IXMA 1BIFA 4JSTA 5BXQC 1K8RA 1EK0A 4BZXA 4C0SA 4LHWA 3JVUA 3WY9A 2SHKA 1GAJA 1E2EA 3C16C 4XTCS 4I1VA 1VIYA 1Z22A 4LHXA 5KUTA 1E2PA 2ZEJA 3U3MA 4AG5A 1IXZA 2P5TB 1OLOA 4MKIA 4ITRC 2DFKB 1JB1A 5J4KA 1NVWQ 1CP2A 4BFYA 3IEVA 3K53A 1VHTA 2UZIR 1WB9A 4D4KA 4YQFA 1Q12A 5KPJA 4UJ5A 4KXFB 4YMVA 4US0R 5J4HA 4H9GA 1XCMA 3WMGA 1QG2A 2A2ZA 1NIPA 1NVVQ 2QROA 4BUJA 5C1BA 3EZ6A 4EQ6A 2WBLC 1KO7A 2KE5A 1VHLA 3MWLA 2H8KA 1A2KC 4YC7A 1N25A 2GVDC 1JXOA 4DJTA 2OXCA 1SXJC 3HPRA 4IVPA 5HCIA 3K70C 1DPFA 2B7CA 1RJ9B 3DPUA 3NXSA 1EX7A 1VYUA 5J4YA 4TYYA 3WHLA 2WZQA 5FTJA 1W5TA 1XMIA 3BD9A 4B2PA 1E2MA 3GPLA 4HDCA 3O47A 4BLRA 1AZSC 2RCNA 2OFOA 2FPMA 4RVCA 4OQMA 2A5DA 2VRWA 1Q0UA 4C7OA 5FBLB 3IPXA 3RAPR 3TRFA 4P32A 2RGAA 2QI9C 1HURA 4LJYA 2QAJA 4GP6A 3EC1A 4B32A 1VG1A 3PIRA 1SVKA 4HLDA 4BLQA 2QP9X 4TYWA 4NONA 2HXYA 2EVWX 1T8UA 4LC1A 4YMSA 4F93B 1IXSB 2VP2A 1P62B 4MDFA 2EU8A 3AVXA 2AN9A 3B1ZA 4RFSB 1K6MA 1KNQA 1KI2A 1T91A 1WDTA 1YU9A 4KLNA 2K5UA 3KZ1E 4DVGA 3PJRA 1DAFA 1OF1A 4RZ2A 1G1MA 4PZZA 1JEEA 1E9DA 4ZI2A 3N2IA 2OCBA 4NHOA 4X8LA 4QM6A 1JECA 4OHWA 1US8B 4HAWA 4FIDA 2XTMA 5JLJA 1KTVA 3W3AA 4N0EA 2AKYA 3SI7A 1COWD 5DI3A 3PVSA 2NZ8A 3LVRE 1G5TA 4OHXA 1G9XA 1BYUA 4PZYA 2WAYA 4Q9JA 1JR6A 3QEOA 5JI3E 2PX3A 4DLXA 2YWFA 4Z1MA 3I62A 1YZNA 4UNRA 2HYIC 2IYLD 2KB0A 1UPTA 2IF0A 1G4UR 3B7GA 4RD4A 1L7VC 1XTKA 2ZANA 5E7MA 1XEWY 3K9GA 3CX7A 4RFSA 1H8EA 1CKEA 5DE3A 2QP3A 3EPJA 4YMUA 3NIBA 5P21A 1R0WA 1N5LA 2JLSA 4JBWA 1XTSA 3DO6A 2CDNA 2A9KA 1W46A 3SYKA 1N6IA 5D3QA 2ODNA 3IQWA 4AIIA 2GZHA 4PHFA 5AK0A 2FSIA 4RKFA 4M4SA 4LCBA 2OV2A 1UBEA 4O2LA 1UJ2A 4F38A 2D3WA 1S4QA 4C2TA 3QPWA 5JRJA 2JGNA 2D4HA 4D0NA 4E03A 3OEEA 3K0FA 1KZGB 4UXIA 4Q18A 4DB4A 2G1KA 5E7JA 3ICEA 3BFKA 3X1DA 2O0KA 2BKEA 1QHSA 3GFOA 4C0KA 1ZNXA 3HWSA 4JL8A 4XJXA 4TL8A 2GBLA 1O87A 3R9WA 1I2MA 4JBYA 2ZM5A 1JEDA 5L8VA 1HEIA 4I99A 5D3MB 4A1FA 1JXMA 1YKSA 1Q3TA 3NKVA 2QSZA 4OHYA 2Q3MA 2CE2X 2OCPA 5FL7D 4PX9A 2CCGA 4PHGA 4ZDWA 2J46A 3U3JA 3A4MA 3Q7QA 4GI7A 4FINA 2GEUA 1BS1A 2QBYB 2XX3A 4G3XA 3LNCA 2FSHA 2A78A 2OXRA 2EQBA 1TQ4A 2YWEA 4NYMQ 2WJGA 2GK7A 1G64A 2ZJZA 1CJUC 4Q9IA 1UF9A 1N6PA 4B6EA 5DHAA 3GJ7A 1WE2A 3WYAA 2HV8A 4A0FA 2ZRGA 1P2VA 3QF4B 3KDSE 2VBCA 4QFMA 3PUWA 2AXPA 3QKSB 3OIYA 1JAIA 1W48A 3K09A 4JJKA 4PC6A 1XCGB 2HCJB 3CPEA 3JZMA 4WAUA 2BEJA 2OLJA 3QPVA 2ANCA 5JRZA 2EFHB 5EZ6B 3PV0A 1NVXQ 2QN6A 4IEIA 3DZ8A 2RGNC 1P75A 3VMFA 2J0SA 2GAAA 1XNJA 1HH4A 2OESA 1W4CA 4V03A 3SJBA 2AL7A 2IXGA 3BE4A 4LWZA 4CRWB 4Z1MD 1TEXA 4P31A 3MGCA 1JR3A 2V6IA 5A0FA 1Z28A 3CONA 2FN4A 3FDIA 3NVAA 3K8YA 5FI1B 4MRPA 4NKRA 4QJ5A 4UQOA 2O5VA 3RYTC 3U7FB 1Z0KA 2WKPA 1E3MA 3IIMA 1TNDA 4LRWA 4YXWA 3VU9B 1QVAA 4OQXA 1W4BA 4JYCA 1F6BA 1E2DA 4KV9A 4ERNA 3LFUA 3I5YA 2CBZA 3CKLA 1QHHA 4P4TA 2R9VA 4K46A 1WP9A 3Q7PA 3L82B 4DBLC 2HT6A 3E1SA 3CB4A 4DLWA 4Q4JB 4XTRA 1PUIA 1MABA 1NNEA 3QXJA 3MFYA 3UG7A 2E9SA 4LHZA 4CEJB 5BWMA 1EESA 1LV7A 3AQ4A 1KK2A 4LYAA 3WNDA 3BORA 3LW7A 4LJ6A 1D9XA 4QBIA 2H1LA 2PZGA 3IIKA 4PAMA 4JVNA 2WKQA 2IYWA 4ESHA 2W00A 5FFMA 1KKMA 1KSFX 3I5XA 1XMJA 3QNUA 4ASUD 4QC2A 1ELOA 2GF9A 1Q1ZA 5L3VA 3V4RA 3HJNA 1G3UA 3AVPA 1WQ1R 3A6PC 1Q3HA 1Q20A 2GJ8A 1MH1A 3CX6A 3GLGB 2D7DA 3SBDA 4XVUA 1H65A 2VF8A 4HZUB 1P5ZB 1WCV1 2WSSA 3SYLA 3THOA 4Q4HA 1Z2AA 2YV5A 5BYKA 1UEJA 3CF0A 1SKYB 2XITA 4DT1A 2CJWB 4GP7A 2ZU6A 2ATVA 2QTFA 4PZLA 1Z83A 2I3BA 3BB1A 2Q0HA 5CLLA 1WF3A 3EPHA 4TSFA 3SC3A 1A4RA 1DAEA 1MABB 2NO7A 2Z5FA 1HUQA 3L0PA 3M0EA 2DPXA 3A4LA 1IY1A 1F2UB 3QXCA 4UNQA 5CIWA 3RC3A 4CW7A 4OI0A 2NMVA 1EFRD 1QHXA 5EXXA 2QT1A 3MWYW 5F98A 1XXHB 4FD2A 3K70B 2VPPA 3BJIC 1MRNA 4FWIB 1YZLA 4DUGA 2N42A 5CIQA 1DADA 3P27A 4H1UA 4M1YA 3OIVA 2RHMA 1U0LA 1IXRC 3L2OB 3UANA 3LAWA 2V3CC 2V7QD 1GG2A 3ADCA 4W9MC 1P2TA 2EFDB 2OO7A 2VF7A 4UXJA 421PA 4EIWA 5LPNA 2J45A 4DLRA 1X1SA 5G53C 3G82C 2VP0A 4M22A 1R8SA 1M74A 3BRWD 4HZUA 5GJVC 2HUPA 2ZRAA 1Z0FA 1XXHA 3I92A 4OKSA 4JKYA 2GBLC 2R6GA 4YMWA 3SN6A 1XEXA 1FNMA 3EWSA 4LZZA 5AUNB 2OFWA 2V8OA 4CEHB 1GL7A 1S9DA 5H70A 5KDOA 2F1IA 1ZNZA 2ZJYA 1W7AA 3SEAA 3QG1A 1OH6A 3SJCA 1TU3A 1NVUQ 4N3NA 2AWNA 2WWWA 4OBEA 4A15A 3BH6A 2J59A 1XD2A 3EAQA 5EE3A 1AS3A 1TQ6A 2Q9CA 1UADA 4L9SA 1Y63A 121PA 3NG1A 1NN3A 1E2JA 1KI6B 4O25A 3AP2A 2Z4SA 1L4UA 2BBTA 4LV5B 3C8UA 3M4YA 1II9A 3UPUA 1UKEA 3M1IA 3I3SR 1E4VA 1D5CA 1P72A 2BBWA 3THWB 2GZDA 2WJYA 3I1FA 1DAMA 4PPQA 1YRAA 2DFNA 5JCPA 5M04A 5FI0B 1XBTA 1ZJ6A 1HT1E 3ICQB 4YONB 4QM7A 3GFPA 2C95A 4JKIA 4Q48A 1XD8A 2IXEA 5C4MA 3OEHA 4Q4AA 2V7QA 4Z8YA 3GLHA 2ZAMA 1ESMA 1KI3A 2P2LA 2FGJA 2KBEA 4C0HA 4JMPA 3LW8A 1YVDA 3B13B 1RZ3A 1OFHA 2AFHE 2J0VA 3Q5DA 4JLPA 1XEFA 2F1RA 3K9NA 3KB2A 1ZIPA 3KXLA 2GNOA 1VDZA 4BECA 2A7QA 1FTSA 2QA5A 3TSZA 3B8HA 3QKRA 4TSFD 1SULA 4TLCA 4TT3D 3DHWC 5DHFA 1LW7A 3EA5A 1OFUX 2JJ1A 2V1UA 1L8QA 1XF9A 3IBGA 4MYTA 3ZIAA 2ERYA 1JPJA 2QG6A 3IEUA 2B8TA 1J8MF 1NIJA 5JS7A 5BQ5A 4D0LB 4DCSA 2FDCA 4H1VA 1SVMA 1P3JA 2I1QA 4HEJA 3WP1B 4DKXA 1FMJA 4XVQA 2GKSA 3CF6R 3FB4A 4XVRA 2BV3A 1IN8A 3LBNA 4TQUS 4DLUA 1IONA 4DLYA 4Q00A 3THXA 5FUWA 5JHGB 1GOTA 3EZFA 4PTLA 4LI0A 2VH5R 3QUSA 3AKDA 3PEWA 4LPSA 3TSOA 3MUFA 1NKSA 5DYIA 3CW2A 4FMDF 2ZYVX 1CR2A 3NWJA 4DXAA 4OQNA 2R62A 3S1AB 2F43B 1ZC4A 2DBYA 5ANRB 2ODWA 5GJWC 3THXB 3RHFA 2ZUBA 2ZRJA 4NE2A 2HF9A 3CNNA 3OE7D 2R6CA 5FOTA 3QVVA 2RKOA 4IJMA 4OYHA 2GXUA 1MKYA 3TGPA 1XZPA 2C5LA 2L0XA 2FNAA 1U8AA 4TWZA 3GLIE 2O8BB 3GCGA 3AV0B 3RRNA 1U98A 3SZRA 1UBCA 2GCOB 2TMKA 1DS6A 2R8RA 3K0AB 2OT3B 3T12A 1EX6A 2CHVA 3OESA 3WMEA 3QEJA 3VX3A 3BB4A 4HB3A 2W6JA 4MKHA 2QQEA 1Z0IA 4LPKA 1R0XA 3DKPA 3FMIA 1G291 1O3YA 1N3BA 1YJ5A 4LJ9A 4KYUA 3CX8A 1UKZA 2DR3A 4A8JB 4DIEA 2RAPA 4ILEA 2DHRA 3B85A 4A6PA 1E0AA 1ZM4A 1I4DD 1W4AA 2QMHA 4F4JA 1GITA 3CNLA 4DLSA 4KVAA 4Q1AA 4D0GA 1E69A 3ZLJA 3WNCA 1AQUA 4V0LA 3V00A 3D7MA 1VPLA 1SXJD 2QL6A 1II8A 2PT7A 3GEEA 5TV2A 3VR3A 1FZQA 1LS1A 2GESA 1W49A 1KDRA 2IYVA 4QNRA 3C14C 2C9YA 5K8IA 3A1UA 2OEPA 1KO1A 3Q8XB 3GQBA 1NL3A 2O8BA 1NSFA 1G3IA 3PEUA 1J99A 4OI4A 4ZKEA 3RDPA 3OE7A 3TNFA 5G3ZA 3CH4B 2NQ2C 5L3RA 1T3HA 3AB3A 4HAXA 1FX0B 3IIJA 4M1OA 4Y0AA 3HYRA 1M1YE 1OE0A 3RRYA 3LQQA 2CK3D 4LDJA 5JJLA 4D4JA 1KMHA 5EP3A 2RMKA 2CLSA 2ZYWX 4EDHA 2V1XA 5EXPA 1R2QA 3VNVA 4M9SA 4UXHA 1JI0A 1OXTA 2ZSBA 4DHEA 4C30A 1T3LA 2GK6A 4L5BA 1DBSA 4XD7D 1CF4A 4WVFA 2IK8A 3AUYA 2CEAA 3N2EA 3C5HA 3KQUA 5L3SB 2F9MA 2OILA 3PUXA 1TTTA 1TQDA 2WTUA 4DSNA 1PLKA 1E1QA 3KKPA 2Q6TA 2CXXA 5GJCA 2FZLA 1S1MA 1FP6A 1ZMXA 4DDWA 1NLYA 3X2SA 2RB4A 3UXMA 2LCFA 2AXNA 3GD7A 2Q3FA 4KO8A 1QRAA 5FTNA 4A6XA 4BGDA 1DAIA 1Q1BA 2YOFA 1A5TA 2VHJA 4NL4H 1KIMA 4FI3C 3SBEA 1XFAA 2AK2A 4I4LA 2QNRA 4D6PA 5L3SA 4OHVA 1DG1G 2QZ4A 4Q66C 3TLXA 1FTNA 4TLEA 2GJ9A 4M8NE 4GOJA 5KPDA 2VP9A 1KK1A 2XTZA 4BZPA 1QG4A 2GEVA 3LBHA 2GXSA 2IEYA 2CE7A 3H2YA 1E2FA 4YMTA 3U61B 3ECCA 4M1SA 5E3HA 4CEIA 3EZ9A 1IN6A 2ZJBA 4A4DA 2BJVA 2ZYUX 2IYYA 3BAFA 1J8YF 3TQFA 1TUEA 2WJVA 3IILA 3IO3A 4DC9A 2MMCA 3SJZA 4FCWA 4X8HA 1PUJA 3BBPA 1SKQA 3NH9A 2KJQA 4L4UA 4WA7A 1SVWA 5BN5A 3BK7A 4OJKA 2YOGA 2J0UB 2GDJA 5J4LA 3FHTA 4XSHA 2DB3A 5HE8A 2FV8A 4U7DA 3U3OA 3B1YA 5IRCD 2XB2A 2KI5A 3QKUA 1GIAA 4JBXA 1OPXA 1WXQA 4OJQA 1OYWA 5EP2A 1B23P 4KBFA 4JS0A 1E9RA 3KUCA 5B58C 2VSOA 1KJYA 2QE7A 2GJKA 2WHXA 3AEZA 1RRCA 4DWJA 4JL5A 4CVNA 3B9PA 2JLXA 2GRJA 2N1BA 2VHQA 3RWMB 2ZI9A 2P0EA 5JWHA 4DSTA 3R8FA 2WMOB 3AF0A 3A1TA 3A1WA 4OQLA 2QY9A 4ACBA 5EE9A 1W36C 1DO0A 2XZPA 1KYIA 1PZNA 3K70D 2W58A 3FKSA 4LJAA 5AR1A 1LF5A 2F3TA 1FP7A 2WIBA 4IFEA 4IHQA 2O8DB 2XEXA 2EWVA 1DEKA 2XNSA 4IDQA 1EFTA 4PPNA 4D4MA 3KB1A 1NMXA 4IOKA 1N6LA 2A30A 1NY6A 2G6BA 3HP1A 4TMTA 3JZAA 2Q9AA 2R6FA 4M1KA 5DIFA 4DLVA 5EE1A 1AQYA 1C9KA 1FQKA 1R8QA 1YR9A 3EG5A 3MWKA 1YE8A 4JLOA 4NCIA 2ANBA 4MA4A 3CRMA 5CYOA 1GM5A 2CL7X 4POAA 2RGEA 5F9HA 1L2TA 5HR5A 3LXRA 5FR2A 3BFXA 2V4ZA 2ZRHA 1ZCAA 4IXNA 3NBYC 3C7KA 4TTPA 1GUAA 1X8KA 1KK3A 2Z0MA 3SU8A 2OZEA 2ZR0A 4E09A 4QL3A 4A0RA 4ARZB 4ZI3A 1A1VA 4DRZA 4Q19A 1KMHB 1C1YA 2FEMA 2J3EA 1MV5A 3X1ZA 4C9BA 2N46A 4HUQB 4D82A 1S8FA 4D80A 5JHHB 2ZRBA 1KSGA 3CR7A 4NCKA 2Z83A 5DGXA 2XZOA 4PSVA 1SXJA 4ZPXA 1VG8A 3RSLA 4TZ6A 3VX4A 4D2IA 2W6IA 1Q22A 4GMXA 4P3YA 3LBIA 3OIUA 3BGWA 3MMPA 4NZYA 1G16A 1K5DA 3ASZA 3OFNA 1JQLB 5HTKA 2F1JA 2GJSA 3FKSD 3GJ3A 1RRPA 5ELXA 4RY2A 4URXR 1QF9A 2YWHA 3PCRB 2AKAB 1X3SA 3GFTA 3OHMA 1W44A 3QF4A 2IBMA 2A5GA 5C2JB 2ZR9A 3KQLA 1HTWA 1UDWA 3NH6A 1TL7C 4LHVA 4A2PA 4RJLA 2NIPA 2GXQA 2FH5B 1D8TA 1IY0A 1VCOA 1MRSA 2O0JA 4NYIR 3TE6A 4JIMA 4MRNA 2XSZD 3RNLA 2WWYA 4R2IA 1ZNYA 5IDVA 4GRAA 2VHTA 1XJ0A 2REBA 4M2LA 4HUTA 4TTQA 1VCNA 3KKNA 3KKQA 3VNUA 5FBQB 1KDTA 1OT3A 1NJGA 3TR5A 3PG5A 4PQRA 5H1YA 4BFSA 3C41J 2JAQA 4GT1A 5G40A 2WPDA 1RKBA 2ZRIA 1ZM9A 3GLFB 1T8TA 3CF2A 4L9WA 3AVOA 2FFBA 3HDTA 4LBWA 4KFSA 5UKDA 4C7OB 2WKRA 3FHOA 3HR8A 4ZCIA 1S3SA 1SHZA 3EIEA 4EPWA 2YHSA 4G5GA 1GTVA 4G5SA 4JVMA 5DYGA 4W5HA 1R5OA 3GJ6A 1ZNWA 3DEFA 5HZKA 3FFAA 2ZIAA 4TYNA 3EIHA 3FMFA 1V5WA 4R98A 3W6NA 3OFND 4EJSB 1P73A 1PVOA 1LNZA 2BMJA 2BCJQ 5JBQA 1AA9A 3QY0A 5J40A 3G5UA 5JMTA 2CMKA 4Q01A 2VO1A 3UWKA 3WRXC 4GL2A 1KI8A 2O8FA 2F7SA 4QKQA 1JAHA 3K0CA 3R7WA 3AF3A 2QMEA 3RABA 2QUZA 2HT1A 3U7GA 1T0HB 2BC9A 2H7VA 4IRUB 1J2JA 4C0QC 3BFVA 1E96A 2R6DA 3ZDQA 1IN7A 5SZIA 2BBSA 2QP4A 4TT3A 1G3RA 5JWRA 3GP8A 1GZSA 2BVNA 2H57A 3NHAA 4L8GA 2ZE5A 4JLVA 2ZJAA 2PT5A 5L3QA 3DZDA 1W36D 5LB2A 2CCJA 1LB1B 4Q7JB 1P7CA 1XWIA 3REFA 1XP8A 4IW3B 4TZ0A 5BYJA 3KFXA 1VG9B 3CR8A 2QEQA 4WZAE 1SHKA 4B33A 4EPXA 3EXAA 1X1RA 3LWNA 4A0HA 3IO5A 4MKFA 3W90A 1TUIA 2OSBA 1Z6AA 1TADA 2O0HA 3AP3A 3GEIA 2IWHA 4LBVA 1W5SA 1R4AA 1RJ9A 1Z0DA
chains in the Genus database with same CATH superfamily
3LA6A 1GQYA 3RVDA 1J97A 3FLBA 2Q1WA 1VJDA 1HT0A 2XRMA 1KOFA 4Q7MB 3RGWS 2IDKA 1FBNA 3SHOA 5B6PA 3PUIA 1JFLA 4P80A 4PXAA 2VTBA 1NY5A 2PKWA 3KOWA 3TW8B 1FW8A 1UP6A 5LDHA 2GAOA 2I6FA 1VJGA 2AE2A 4HADA 3A10A 2GHQA 4IMPA 3VYUB 2DQ4A 3HFSA 3T06B 3L02A 3IVRA 4YJHA 2VP5A 1PSZA 3V48A 2J31A 2IY9A 1UFRA 2JI8A 1NMSA 1T43A 3HM2A 3VZRA 3IULA 3TN7A 2EC5A 3UAYA 5CA1B 4HH3C 1TYBE 3IB6A 1P7ZA 3WFZA 5EHGA 1OXKB 4WI1A 3L8ZA 3HBMA 3OCCA 2A59A 2H1IA 3PDUA 4RMGA 4G09A 2RB5A 1G21A 5F23A 2ZBUA 2MHCA 3WRYC 2B7LA 1X1AA 1NASA 3U0VA 4RTOA 4E1BA 5ILGA 2Q4DA 1Y6QA 4HWGA 3RU9A 3MNFA 1NLFA 5EIOA 4W7SA 5FHRA 3GLKA 1Z56C 1E2KA 3BIOA 1E2IA 1NYLA 2J6IA 3G6WA 3LU1A 4UDNA 1UAYA 4NP6A 3FYCA 1RHJA 4G0NA 1FSFA 3R7BA 1R37A 4YY3B 3PNSA 1P0CA 4F91B 1BG6A 1NF3A 4NG5A 4HYYA 1GAEO 4UVDA 1GILA 4NSNA 1LPPA 4QUJA 4J90A 4URHA 3F7OA 1AK2A 2G67A 2IZZA 1J8QA 1VMKA 2NVWA 3D54D 3H5AA 3VSCA 1WDLA 3DL7A 1IB0A 1CULC 1WUIS 1ZP6A 2B94A 2R4TA 3ACBA 5EFZA 4DABA 3QKSA 4U7TB 1HFWA 3L07A 4I4CA 4NCNA 1CUYA 1Y1LA 3NAGA 3P9SA 5LUAA 3T7SA 1ECPA 4P38A 1AY0A 1W2HA 2ZQ5A 1MF7A 5ESRA 4EH1A 1FNBA 4KIJA 1LFDB 3G9UA 3PR1A 2R8EA 1LBHA 1KY3A 2TMYA 3H8JA 4CV1A 4X6UA 3WGJA 3RIHA 3IT0A 4MV1A 2CUNA 1OFGA 1EJ0A 4IQ8A 5FWXA 5BRNA 5LYJF 1CUVA 2Q7DA 2VBIA 2H5EA 3KQOA 1H9AA 1VE5A 2ZTSA 2XLBA 2J7KA 3P32A 3FPEA 1ZINA 2AS0A 3HWRA 4PANA 2JCBA 1M1YB 2CV2A 2O7QA 3IOBA 4JP8A 2Z4RA 1M1UA 2L2QA 3GRZA 3K9LA 3OJOA 4JASB 4U6QA 3RVLA 3RHTA 1LFAA 3H2GA 4GPAA 4HQ6A 4MWSA 3NTXA 4MUFA 3CT4A 1R8XA 3KSBC 4M0KA 2A9FA 1S8OA 2FR1A 4RU1A 3TSAA 4LYFA 2C98A 2A1IA 4PVCA 3A70A 1O4VA 1RBMA 3A1SA 2C2XA 1PJ2A 1H2FA 2XJ9A 3Q85A 1QHHB 2FPSA 4B43A 2D54A 2ZT8A 3NJ4A 1ENPA 1NW8A 3OZEA 4FGUA 5C34B 3T9CA 1X42A 4HAZA 1SGWA 2IODA 2CD9A 1SCBA 2I80A 2P30A 4OK3A 4R8RA 3S2YA 4BVEA 3ZWYA 5I7VA 3TTSA 1XYVA 3AHJA 4HNQA 2C2WA 4IJUA 1P4JA 1OXVA 1OFTA 5FPHA 3FMVA 4JJFA 3DFIA 1QYCA 5THQA 4PNPA 1B3BA 2ZVPX 3GGGA 5KU1A 4M1TA 2Z1MA 1YRBA 3M7IA 3H99A 4CKWA 1D4FA 3SPXA 1EWKA 3PDWA 1OV4A 3ZY6A 1KPGA 4RQTA 5LBUA 1U0EA 2BZ1A 3LUCA 4TKUB 5HZMA 3DC7A 1W30A 1YHZA 1ZLYA 1XZJA 3AU8A 4RVHA 3ZWWA 4CL3A 1I36A 3RVSA 1A5AB 2IZOA 4P4SA 3QXHA 3ZU3A 1X7YB 1G55A 1M2KA 2VYVA 4IXTA 4JGIA 2VJDA 2REQB 1JYEA 1OXUA 1CR0A 1EZ4A 1WAMA 2PKYX 3GJYA 5FTLA 1BVUA 1N6RA 2X8LA 3DOUA 1IRIA 4M36A 4R1SA 4DYDA 4L9AA 1U0SY 4FMCF 4KPEC 4MYHA 1SUEA 1JLSA 2IF2A 2TYSB 3KFLA 2AXEA 4HGYA 4IXDA 1JFRA 1DAKA 4R7GA 4F1WA 1E32A 3C3BA 5E6UA 4OVKA 1NLMA 1YNOA 3AUFA 1IULA 3JQGA 3KZXA 2VUHB 2IU4A 2IL1A 2LV8A 1L8AA 2H51A 1AUXA 1DRKA 2W2LD 4R8MA 5DBFA 4U7HA 3ST7A 1XNGA 3S5UA 2X1HA 1AQ6A 3TRIA 3MCTA 5CMLA 4RE5A 1FX1A 4GU5A 3PEVA 1ODSA 4J7AA 1EVIA 3C2QA 4BJ6A 3K5PA 3TJZA 4CLXA 3B7PA 2X9NA 1XZKA 1EK5A 1WSWA 3ITKA 1AKMA 5GZ6A 3ZBQA 4ZK2A 3QXXA 3BIFA 4ES6A 4O5AA 1DXYA 1KZ9A 5E0KB 4LX0A 2W98A 3LDHA 1MO3A 4U7PB 3L0YA 1JKIA 4ZT7A 1WMFA 5DN6A 3F90A 3AVYA 2YBDA 3ND9A 3OA2A 1R6TA 4YS6A 1NBOA 1VSQA 3IP3A 4FGZA 1NMEA 1PR6A 5PNTA 2AN5A 4KQIA 1BROA 2KW5A 1HDIA 1LVHA 1Z5PA 1RAEA 4O4JA 2QVCA 3A04A 4KRYA 3R8CA 1Z6TA 5JSZB 4ND8B 5E9JA 1VLJA 3MF4A 3JWGA 3VZPA 5B12A 5KNDH 4G0UA 4GOLD 2P2YA 3TR0A 2QVZX 4IH9A 4WOCA 3U3RA 3W8RA 4E32A 1U7UA 3TECE 2O8DA 1QXSA 1QGZA 1QQ7A 1YQDA 2JK1A 1VE3A 2LCQA 3LK7A 4FEEA 4Y6LA 3VH3A 5JBNA 2FUEA 4R8SA 3ZCSA 1KK0A 4A2QA 2B0CA 2OHIA 1Y6FA 2KQUA 2WUDA 3E9YA 3QITA 2FOLA 1O08A 2UZ0A 2WJWA 4LF8B 1E3EA 2ZI4A 2K2QB 2OV1A 3AOGA 1F2TA 4EGAA 5C8YF 2BEVA 1M72A 1T6BY 4R3WA 4QRDA 4YPVA 4IIYA 3DR5A 2ODBA 3MWDB 1G20B 4HWPA 4ZJUA 1SB8A 1ZOOA 2WMDA 3BQ9A 4ZCPA 3GJXC 3BIJA 2VYFA 3O9VA 2AFIA 3SKVA 4JLAA 3JD4A 3RVQA 2D74A 1G8GA 3ABRB 5DO9A 4FSHA 5EJ6A 1M7GA 2OWDA 3EGDA 4XVHA 1IY2A 4Q4HB 5THXA 4X6XA 2FU5C 1Y6ZA 2FQQA 2Q99A 4QXOA 1FVHA 4N3GA 2EBUA 1MX3A 1JKJA 1AUOA 2BLNA 2QJFA 4N12A 3DQQA 1TO2E 3B6EA 3G13A 4LOKA 4O08A 4YXWD 5JMWA 5LL6P 1A9RA 1BMTA 1CB7A 1SJ9A 2J1LA 4Q24A 1CQZA 5EZQA 2F3QA 4MP8A 5JARA 2EJUA 3AFHA 3EIWA 3FYUA 5FV7A 3ZIAD 4WKPA 5AVQA 2FUNB 1FMLA 1S89A 2IQIA 3N2NA 2RGNA 4HX5A 3C3KA 4NYJR 1I01A 4PLWA 3MUOA 3VKWA 2RGBA 3E27A 3NVKI 3C7AA 2VAMA 3UAGA 1M2NA 3N39C 1YR3A 3FGZA 3ZK7A 4HUQA 3AIMA 3QF7A 3W5VA 3FVWA 2B98A 4M1EA 5BW8A 1PYDA 3FX2A 2ZBQA 2HNKA 5AK3A 4AS1A 1CIPA 4TUYB 1DELA 3E5RA 3FWHA 2Q1XA 2YWBA 3GBVA 1OIWA 3VU1A 2NSLA 2Q9BA 1Y4ZA 2YXEA 2XYGA 3CMCO 1FTYA 4OJYA 3VXKA 3IXQA 5EWMB 1UJ5A 1KI1A 3IALA 2CFRA 2GSDA 3NHSA 1WU8A 2CL0X 1UZMA 3SVTA 1JPUA 4RL4A 1POWA 3STTA 2ZXUA 4BXOA 3CTPA 3THRA 4AQDA 4TROA 4C6TB 3AM3A 1D1SA 1RI2A 4GO1A 4WY8A 3ZUPA 2FQYA 1EA5A 1N5RA 1NVTA 2XUQA 1RWWA 5F1KA 3ZDFA 4YCMA 4YCLA 3BGVA 4TUYA 3BXGA 1EVKA 2V6BA 3QLEA 2EFEB 2XD4A 3V2IA 2LZ0A 5CFPA 3HUTA 2Z5GA 3CZMA 2QU8A 4BEWA 4P0QB 3HSYA 5DLQC 1KP9A 1G8MA 3PTLA 4LISA 4R69A 5E2BA 3NBXX 3VZCA 2O5EA 1SBIA 2Q3HA 2BBOA 4WLFA 5BXYA 2W9XA 4QBFA 3B60A 1HZZC 1R1DA 4R7TA 1KEWA 4FYIA 1TXGA 3SJUA 3WKBA 2BI4A 3TOXA 5G4LA 3KELA 2UXBB 1AKYA 2P9BA 3D8NA 1LI4A 4QHYA 2J5BA 1D2MA 2UV8A 4R0NA 4UHHA 1WSBA 1YBHA 2ZKIA 3CLVA 1M2OA 3DZIA 3OUUA 4XRRA 1YOVB 1XQYA 4XPIA 4MV6A 2HV9A 1YZ3A 4II7A 4YCBA 2AX4A 3U16A 1BHJA 1QH8A 3TDKA 2YRXA 3TR6A 1R5BA 3UG6A 3DZFA 1UL1X 1CDOA 4UUQA 4ZAZA 3LHFA 4ZCQA 2R66A 1NHWA 5DNEA 4G81A 2Z6AA 1Z29A 4LMRA 4IDFA 2IV7A 5K8TA 3G89A 5AICA 3BB3A 3VR6A 2YRFA 3VNAA 1Q91A 3PQFA 4FT4A 1U94A 1UMDA 3L05A 4PAGA 4PGAA 4TMWA 3LUJA 4LZJA 2NPFA 4QJ3A 4L78A 1I94B 1PNQA 2Y3IA 3KZMA 4LNAA 3G02A 4I5IA 1GR1A 3PUVA 3VZBA 4GZMA 2OFXA 3FIUA 5KYVA 3SY8A 4EUSA 3LSTA 5JZOA 4BVBA 1SCQA 2O52A 1GKYA 4IDGA 3EEQA 3LX8A 5LZ2A 1JBEA 4PG6A 1E9BA 1CZLA 2VXCA 2BUAA 2PZAA 5G41A 4LFAB 5FOXA 1CRPA 1C3VA 2AWOA 3CPHA 3DE4X 1CV2A 3T7DA 5LBTA 4YCCA 4UMFA 4Q3AA 2FZKA 1DTEA 1SUSA 2VNSA 2ZJ2A 3EVTA 4QGHA 2AOTA 5AVUA 2IOFK 4ERXA 2C78A 1D6MA 1YE5A 4YUZA 1K0UA 2GN9A 3ZQ4A 3S70A 3F6SA 2PE5A 3HRHA 4RXTA 3GPIA 1V16A 3CRRA 4OHUA 5ALZA 2B4AA 1XPRA 3H1AA 2FP3A 3H4VA 1KYVA 4DWVA 1IJBA 1KMNA 2DCMA 4X71A 3KOOA 4UHKA 5GY7A 3SX4A 2PYIA 3WADA 1JPNA 3IP9A 3OFJA 1EFPA 2QW8A 1IYZA 2G0NA 5CDHA 2FUG6 3FH0A 3I32A 2AI3A 4B0OA 1CF2O 4FDAA 4MLCA 3ER6A 1L7MA 4BKMA 3H9QA 1TYZA 5CB0A 4D6YA 4CETA 2F67A 2XUOA 3FPHA 4UEJA 1MJGA 5JY6A 5KOHA 3U49A 4YN3A 1MFPA 1UC5B 4G56A 5CCEA 2EBHX 4RV4A 1Z6YA 1P44A 1YMQA 4IDNA 1I1QB 3T4EA 4ZO8A 3CXUA 3IPYA 5DEOA 1PX2A 4LXXA 1E61A 5FORA 3WR5A 1C30A 1ADCA 1UM8A 1VMAA 3BRSA 3R5HA 3U81A 1IOWA 3P0HA 3PHJA 2GUGA 2JFFA 4DXDA 1QP8A 3L0SA 2AMLA 2PCLA 1GWNA 1CVRA 2VATA 3KQWA 2GR9A 3PD0A 4J6FA 4K2HA 3JQ7B 3UHJA 4EB6B 3U1TA 4Q0MA 5F3DA 4TN1A 3JVVA 5IDYA 1R50A 4YK7A 1LSJA 3R1IA 6YASA 3RVMA 3EXIA 2Z6QA 1XZGA 3SIXA 4F1KA 4D4HA 2A33A 5A5EA 1MRZA 2LTAA 1F5NA 2P9JA 4MYUA 2C9OA 3A36A 2WV9A 5CNMA 4O8CA 1NRJB 4KRXA 3AM4A 1G6HA 3PENA 3DOHA 3IAUA 4MVJI 2ET6A 1SXIA 3ISTA 3C4QA 3M9LA 4EHFA 3H8SA 1N8SA 1B0ZA 4LS3A 2R8ZA 1QWSA 3CRQA 5DWQA 1JVBA 3M6MD 3P2OA 2RGRA 1J2UA 1LQTA 3WB1A 1DV1A 1L7XA 3ESQA 3AKCA 3HR7A 3RFTA 5LJLA 3D2LA 2B82A 5K6AC 2YNMA 3R0ZA 1V7CA 1U2PA 4J3FA 4JQCA 4J7CA 3MTGA 3T9EA 3OM8A 3O94A 2A67A 2PPVA 2DUMA 4E3WA 3H1PA 1IBLB 3LYHA 2W2NA 3IH5A 4HLNA 2X0EA 4D3SA 5JSUA 1RFLA 4WL0A 3L1UA 3INNA 1Y81A 2JGDB 4YJFA 1Z3CA 5H68A 1EPUA 2Z8YA 4K88A 1TPZA 1JLRA 2GT1A 1SVLA 1HMYA 1RMYA 1GQFA 1U02A 2J3QA 2YZGA 2Z2JA 1D2NA 3CW8X 1I10A 3GFBA 5L51A 3ZDAA 3PXCX 4PC1A 4YNBA 5IF9A 2ZI7A 5TDHA 5BOSB 1WMDA 1T1SA 4KMMA 5BR1A 3OQVA 1AV7A 2P3LA 5B4TA 2VWQA 3JRNA 3IAFA 2QAGA 2WM9B 3KX2A 2M6LA 4KR3A 5DNYB 1AB5A 2HK6A 2OCAA 4A10A 5JI2E 2HBQA 1ENOA 1OMOA 1M67A 2DFTA 1RTKA 2RGUA 3PQ4A 4ZOLA 4J2OA 4RK4A 3VV2A 4BWYA 4C3ZA 4EJFA 4LVOA 1HQDA 3JCZA 4JC4A 1QLHA 2NZJA 2WSBA 3DTTA 4R0VA 3D3KA 1MX5A 3ADOA 3BERA 1PX0A 3C1UA 1V8BA 1CZNA 4Q9KA 5B2ZA 4EHDA 2FZ4A 4IX1A 3DVAA 4XD2A 4P34A 1A71A 5CLQA 4G86A 3IUYA 2BFAA 3UCEA 5CDFE 1C1DB 4TL9A 1WF6A 4GX5A 1ZM2A 1XKLA 1GQRA 1KR2A 3UO8B 3HJRA 1OTHA 3IUPA 1XZMA 3WNQA 2FFRA 1P19A 3GUHA 3D81A 3E9RA 5LQNA 4CKCA 1UZAA 2ZJ5A 2A5JA 4M1ZA 3W7VA 1FX0A 2OCLA 3T35A 5EIWA 1R0YA 1V8OA 2RONA 3PHIA 1I7LA 1MP0A 2VZEA 1JTVA 2FSSA 2ZIZA 1C8BA 1AN9A 1DDOA 2C99A 4Q7LA 1YNSA 2EP5A 3FF4A 4ZC8A 4B40A 4BFCA 3ELUA 4RKEA 5BR7A 3TYXA 3WYGA 1KBOA 5HJ7A 5I8PA 5ILOA 1WZIA 2JIBA 4BNWA 1C7JA 4MHSA 4DSOA 3O5AA 1S9HA 4AX8A 4LZOA 1EX9A 1NMZA 3MAAC 2G40A 3NT5A 1Y37A 3A2LA 3KLNA 4PBSA 3REQA 3PC6A 3HKCA 2CHGA 2J0UA 1T2NA 3ELYA 3LUDA 2Z30A 1KI9A 4RELA 3AI2A 1YRQA 5G0UA 4GICA 3ZOZA 1CBUA 5ALIA 4W1RA 3WL6A 1BQEA 3OHSX 3QE0A 4WFIA 4UUOA 1WVGA 3TXAA 4JX8A 3TLEA 4AMUA 4HNTA 2IGTA 1ML3A 2NZXA 2ZROA 3LLSA 4F2DA 5EJEA 2QJTA 5KOIA 1N2GA 1O6GA 4OI2A 1KP3A 2G77B 3CISA 4L5CA 4QX6A 1TVEA 4BWVA 1WV0A 4DAEA 4EO9A 5CG2A 4D92A 5FAKA 1ECLA 3H0EA 1BJRE 1G7SA 1ZA2A 3AUJB 3KTAB 1YMVA 3J7AC 3I4LA 4UQLA 5EXDA 4LVUA 1I5EA 1Y5MA 5K01A 1M8FA 2HA3A 4Q3KA 4E46A 2QGNA 3ROMA 5FNVF 4CG1A 4DIFA 5JJCA 4M76B 2WWIA 4UASA 3ZTTA 1WCYA 5JDCC 4A8JA 1P4GA 4CBVA 4G5RA 5BSGA 5FLYA 4EYKA 3IAM6 4C0LA 3PDCA 1F2TB 4IQGA 1DB3A 1GNLA 3W6PA 1DBQA 1DX4A 2V0NA 4AX4A 3PHBE 3EN0A 3AY0A 4K1LA 4L74A 4KPFC 4BP9A 3ZU2A 4E94A 1U99A 2WICA 1TAGA 3OJWA 2OZPA 2KBFA 3PWKA 4ZI7F 5CIYA 1JEAA 1KVSA 1ONNA 2GLUA 1V95A 3P97A 1OT5A 4C4XA 4YHHB 4KNWA 2PR7A 2C03A 2IHKA 4OL9A 3A1DA 4IV5A 1U8XX 2CEKA 2DOKA 3ZNOA 2IA5A 4D3XA 1M8PA 1W29A 1PTJA 1ESDA 2IDZA 2P3SA 3GNTA 3C4JA 1ZR2A 4BYGA 1W88B 3CUKA 3FTQA 3HWWA 1HMPA 1XALA 2WHPA 1H6AA 3BE6A 2BMWA 4XJSA 3SHWA 2CVQA 3T5DA 1PFKA 1JQ5A 4FR5A 2GYVA 4J0FA 4K9LA 5AUQA 3TFOA 2PX0A 3DAOA 3QLVA 2O8EA 1H0HA 1L5MA 1HOXA 1T6ZA 1ZYUA 3B53X 3DMRA 2IHVA 4FEGA 3RTAA 2BOVA 4J4BA 1KSHA 4MW9A 5FFNA 4AF6A 2YJNA 2Z6UA 3KR2A 3HJFA 4IQFA 3GLGA 1D1TA 1XPUA 2H4FA 5GM1A 4KACA 3V8PA 3PLAE 3U44B 5AVVA 2FZGA 4HAUA 4M89A 1P9WA 3KVNA 4M1QA 1U4SA 5CJJA 5FNVA 5A5VA 4MPDA 4C7BA 3E4CA 5FQOA 2G88A 4UC0A 1G8PA 1WVIA 3EDOA 4Q03A 3QU5A 4TV9A 1LGYA 4UE6A 1G6Q1 4R40A 1KGDA 2BRUC 4G1MB 4LMBA 2DPYA 4DDTA 1VMEA 1BEEA 4N5NA 5ALSA 4ZV9A 1R18A 3T5BA 2QMUA 4P36A 2XCLA 4U5QA 4C2UA 3CZRA 3MEQA 3QKRB 2LNDA 1JXQA 2ORED 1KJWA 1N6HA 1ZW6A 2R8YA 4N9WA 3TQCA 2JGAA 3BXHA 3K2IA 4CFZA 1I4EB 4K03A 5LOVA 3KQSA 5K0BA 1N34B 5B6IA 5B64A 1RNLA 4XYMA 5IMSA 3D7SA 3GD5A 4X62B 2FA9A 3WDKA 4JI6B 2ID7A 4B44A 4GZLA 3GJ0A 3QFCA 4LVNA 4Q1DA 4TVBA 2GVNA 2WVJA 3EASA 3KQQA 2QTZA 2WJJA 5DLEA 5C35A 4JI0B 1SWVA 2XIJA 3HKDA 4I14A 2Q9UA 1PNTA 1I13A 1BGWA 2XMZA 2YQZA 3COJA 2EX1A 1E77A 1E94E 1VGQA 4EPTA 3CLRD 4MQ6A 4DEXA 2I62A 4WKBA 3NS7A 2AIRA 2IGBA 5DLYA 1FS6A 3TB6A 5JO0A 4R83A 2EIXA 4C1BA 5IJWA 2IZ6A 4ABYA 1ZC3A 2VLIA 3RWOA 2QVLA 3ZW9A 1L5KA 2R11A 2ZIEA 4RVFA 2AT1A 3HM9A 4DR4B 2ODQA 2FPLA 5KTYA 1RAHA 4MV3A 3CZ5A 2HDNB 3EGXA 4Y9TA 3ROFA 2WEKA 3U4QB 1E0KA 5G4KB 4AL4A 3V1UA 1W19A 1Q3KA 3FOCA 5FF9A 3FXAA 1KU0A 4V3BA 5E6SB 4QD3A 4JQYA 2OMEA 4X97A 3TXXA 2RH4A 5ALRA 1V5GA 1T5IA 2PIDA 5A0VA 4UZFA 3GUYA 2J0QA 3ABZA 4PICA 5IFLA 2O3JA 3ZZUA 3R3JA 2WTBA 4UFOA 4JR1A 1U8TA 1XPJA 2JB9A 4JQOA 1OH5A 2E2WA 1EEXB 2JIRA 3E22A 3KUUA 3QMWA 4ZAVA 4DM3A 1ZD1A 5AXBA 4D79A 2O06A 4YLGA 2HHJA 3I3OA 5LP6C 5IASA 2CZCA 1TJ5A 3CEAA 3AHFA 3LGSA 4Q3NA 1OHHD 1U7ZA 3JYHA 3K4PA 3LUAA 3Q9LA 1ZJJA 4U6NA 3IPLA 5H5JA 3I6MA 1B4DA 1RWVA 2ODEA 4MOWA 4NE9A 5EWJA 1XEWX 2PNJA 3NWOA 5KINB 3FWNA 2HXSA 1M5TA 5GONB 3R7NA 2UUAB 1WBBA 1TD9A 1WZCA 3AUUA 2BTEA 3TS1A 4XH9B 4ND5A 5AOAA 5KSPA 6AT1A 2F3RA 2GD0A 3OVMA 4P8RA 3IPRA 3CT6A 4QEZA 5JY1A 1WY5A 2LWIA 3N86A 4ZDJA 3LHDA 2I2CA 1N8KA 1AO3A 3H97A 4NOLA 1K4YA 4RCZA 3WBKA 2WPNA 3T41A 1WMEA 3Q2IA 4E2ZA 4UD6A 4AZSA 2X77A 4YECA 1M8GA 2EG5A 1YZYA 1DLIA 1VCIA 3C97A 4Y2SA 5FA5A 5JALA 5JUWA 1NW7A 2BE9A 1MQ8B 1DC4A 3WLEA 3DYVA 5GIPE 2JH8A 3KEMA 4FOSA 5B53A 2ODPA 4NCHA 3B6ZA 2AQHA 2XSZA 2QWXA 4CLHA 2QL9A 4BMCA 5ADHA 1Z12A 4RSGA 4HB2A 2RHLA 4TT8A 2PJRA 1JBQA 3CUVA 4QEDA 1J1UA 4HDRA 2F3SA 1CU1A 2FR8A 4PCAA 4BLTA 2CNNA 2P78A 1J25A 1Y5LA 4CDMA 5CFMA 3JAKB 4KBGA 2M6KA 5IEJA 5CDSA 2FMUA 2R1ZA 3FOWA 4KPUA 3NI2A 1BAPA 2AC4A 4RABA 2XGJA 4J9UE 1WD7A 3HDYA 1M54A 1R6DA 3A8TA 1VA5A 1XLTA 1Z6PA 2HRCA 2H17A 3HR4A 1PD1A 4NBLA 2FHSA 3EWAA 3QLUA 1MJNA 4Q3OA 4E12A 4FB5A 4YUWA 2BE7A 3SGLA 1ADBA 4G5YA 3VAYA 5JASA 4WCFA 4YP0A 1VCMA 3LO5A 1WP4A 1QCYA 1P1IA 4JB0A 2CF6A 3P5BA 3EXIB 1NM5A 4NYMR 5SV2A 5ADVA 1T8WA 1ZI9A 1YL6A 2E4XA 3M83A 2QN7A 3OCYA 4BMZA 5CBPB 4ZWNA 4JXXA 4HRAA 3P2IA 3R24A 1XT6A 4PSUA 2HZ7A 4N8DA 5CA1A 3GNSA 1EFLA 5LU9A 2MINB 4JYBA 3RS3A 2GASA 2QRJA 3V9PA 3BWDD 3BL8A 5FEMA 2NNLD 2XJ4A 4QARA 4D9JA 1K6XA 3CM0A 3W34A 1NP7A 5BV1A 4UHFA 3U60B 1J24A 1WZEA 4WCFB 4CIWA 3FGNA 4O5OA 5CA0B 2HA0A 1YR7A 4QXMA 5K0NA 2PMDA 3FAKA 4ZGGA 4IUBS 2C2HA 1KXZA 1CUCA 1JKMA 5DTQA 3BICA 3K0AA 1OXBB 1YDWA 4WXYB 4UTOA 4MRRA 3F6YA 5AESA 2JJ8A 5JDIA 1IDN1 1VMDA 5AJXA 4FYJA 2FRDA 5TE9A 3WMFA 3IOMA 2XNDD 4B3XA 4D4GA 1SNYA 4YAOA 3LSYA 3FOFC 3M5PA 3QSGA 2D2EA 1O96B 1N2SA 2F8LA 2HTFA 5KVQA 1BDIA 5MGNA 3JVIA 3AI3A 4I50A 3VPBA 4G5HA 3AR9A 4ARVA 2BM9A 4NYJQ 3LXXA 3G0BA 3PITA 3OU2A 4ZZ1A 5JOQA 4KH1A 4UTXA 4ZC1A 1G7RA 4QIHA 1NG1A 1U90A 3T7AA 4EJSA 2CKMA 1JDTA 5CDUA 1QHGA 1TM1E 2GPAA 2NUAA 4DCGA 2A3RA 3IE2A 1O0BA 4OHCA 1I3KA 4TMZA 1OWMA 3MAGA 4I9NA 4CI0B 4CIDA 1TUGA 4GLOA 1TVMA 4EFNA 1VLLA 3I8OA 4E5DA 1QAQA 5TSDA 2X0JA 2WD7A 2WMNB 1Y3DE 5CFRA 3RYHB 4DGSA 3AMVA 2DPMA 4GXRA 4Q3CA 2FWNA 2VR1A 1CUFA 1F8GA 1OD6A 2I1LA 1NQXA 1DVRA 1VM6A 1F9EA 3HCFA 3P0IA 4K1XA 4AP9A 4GF5A 4D9NA 3KEQA 1UMKA 4ZAFA 2IDMA 4AU1A 4N49A 1GNVA 1PW5A 4MRSA 2Z8ZA 3ZKAA 3KT6A 3FGPA 4UNIA 2X13A 3K15A 3PDIA 1EM8B 2WWVD 2E1RA 5I4CA 1YS2X 1Q95A 1QTRA 2ZDHA 1H2BA 1EZZA 2P11A 5TS2A 1RWOA 1AZTA 4NFHA 3SZMA 3GXBA 3WVNA 4CHGA 1KVTA 1EZ1A 2VWHA 1T36B 1C0EA 2BHSA 4RJIA 3C8HA 4TKVB 1QLWA 4NH4A 2NWQA 5AVKA 3WWEA 1Y3BE 4R05A 1HYEA 3O8OA 4EARA 1YQWA 3AG6A 3PFHA 1TMOA 1PDOA 3CVWA 3GL9A 3LOUA 3U40A 4BTVA 5K45A 4GHWA 3NO4A 4C08A 5FUQA 5DVZA 2QQ0A 1DKRA 4XIGS 2XE7A 4HWSA 2C1XA 5D51S 2JS7A 3UH1A 3STXA 4RLSA 3YASA 1L4YA 1FB5A 4A82A 1FJ2A 3VUFA 2PUWA 4JGBA 1X6VA 3KAKA 3G2QA 2WYUA 1JQJC 1ST3A 4I1SA 4WZZA 4Y1RB 1VL8A 2JGJA 2NTYC 4B35A 3OLYA 3HJGA 1BFUA 4MVJE 1Z8NA 3PFCA 1X9IA 1DC7A 2BPOA 5KWIA 3K6SA 4FFPA 4S2EA 4F9FA 2CN1A 5I45A 2ZSAA 3DS8A 3P9CA 4G5FA 5EOVA 3OZUA 4FS3A 4MCHA 3SFVA 4TQGA 1BQ3A 5HIIA 1RPNA 2PGNA 4RBNA 5BV0A 3U6BA 3HO1A 3IMFA 1XRMA 1TZ2A 5EPEA 4RK5A 4H3VA 2XXJA 2W6OA 1J33A 2M6RA 4A9AA 3C3JA 1YC2A 2YBEA 4NQRA 3WZLA 3SHVA 1Z0AA 2I66A 5CX4A 2ALJA 3ETLA 2VAWA 4KVGA 3VR1A 5IT0A 4DLZA 2OPHA 2R6ZA 3M3HA 3MGGA 3PI6A 4QXAA 2F64A 3MWEB 3JAWA 3KZVA 1YS7A 4NZOA 3HFRA 4PTZA 1ZSNA 1ULBA 1Y3CE 2YMMA 5BQXA 2YQ5A 5JECA 3O8DA 3TMYA 1FDTA 4FZ3A 2JHCA 2AVNA 2QE7D 1E98A 2OAEA 2CDRA 1KYWA 3F6EX 4FHZA 2IUEA 4UKDA 4X8OA 3T99A 2P9YA 3ZEIA 4CUJA 2YS6A 1MHTA 4BQNA 5JFTA 1C7FA 2FSGA 2PUJA 3AR8A 3VAAA 3VHXA 1UINA 4PN7A 4FCVA 3BS4A 1EWRA 3AR7A 3JALB 2AFIE 4R8KA 1V43A 3A9CA 4QM6A 4B75A 1GNTA 1YB7A 2Y0PA 1QYRA 1PJQA 3L43A 2QPTA 4NE7A 4DR5B 4YRBA 4MEAA 1NR7A 1YBFA 1OX6A 2JFBA 2W4QA 3QOYA 4KP7A 1DINA 4FLEA 4KCGA 4QHSA 4GXNA 3ROKA 3AJEA 4RPCA 3WMWA 3QPAA 1TMGE 2P5YA 4FZVA 4LJKA 1RWXA 2Z5LA 2XYQA 5ICSA 5TMPA 4DZZA 4HGPA 3MRTA 4OUDB 4BVHA 1NUTA 1V26A 2I3GA 5JQGF 2W4MA 3K0SA 2C07A 4X1YB 2W6JD 4CTOA 5HMMA 5D7BA 5FPKA 1UOPA 2UVQA 1U0FA 4U9IS 3B51X 2O7NA 3C6ZA 2DMRA 3FNGA 3P8ZA 1FIUA 3O4RA 3CNOA 3LWZA 4H31A 2JHPA 2J5QA 2C8KA 2NOAA 1NZFA 2WY2D 3AVUA 1MZPA 1CQIA 5COAA 4KBYA 2OMKA 3LO8A 1X9HA 3LP6A 3ZQJA 1DAGA 3M5CA 4KAXA 1FQJA 2V7UA 5D7NA 3THOA 4M53A 1T9HA 1BW9A 4EKGA 1A77A 1HT3A 1ODFA 2IP1A 2R47A 2V7GA 3LDAA 3TNJA 5HUHA 1YSCA 1V1RB 3LY5A 4G85A 4LGYA 1BX0A 4PZEA 1NI3A 4C76A 1YCGA 1U0RA 2ZT6A 4M7RA 4PZPA 1D8AA 3L4BC 5MHTA 3FPCA 3P4YA 3LBFA 3Q3JB 3ESBA 2ID9A 3R20A 2O4CA 3B3GA 3CSUA 5HILA 4KITB 4G07A 5FOWA 4F0JA 4X8MA 3BT7A 3HYTA 1Q44A 3LLUA 5JFGA 2LKDA 3VU9A 2HRDA 3IUMA 5TRTA 2JF0A 2KHZA 2GNAA 1E1KA 2W2MA 2PXHA 4IYJA 3FY4A 3W5UA 3MILA 3CB2A 4CV2A 3HZHA 1G20A 3OT4A 2GCGA 4LSMA 1FUKA 3N7AA 5AM4A 3RTCA 3UOWA 4BO0A 5IHPA 4FGKA 4BFZA 3MRSA 2GA8A 1BXGA 3FWYA 2I2BA 3P19A 4K3VA 3T95A 5HGXA 1CFJA 4HDQB 5C4GB 3BULA 3W1EA 4URUR 4GMHA 1KARA 4M98A 5A03A 2DJ5A 3N2ZB 4PSAA 1MIHA 5EESA 1XRJA 3WYEA 1RCFA 3UUEA 2I29A 4U5XA 5JEEA 4TYPA 3TFWA 2V9PA 1RYFA 4GPEA 3F8TA 3LQ4A 4EAQA 2JLQA 4X61A 3RASA 4H1TA 1L8LA 1TB4A 4ECEA 3L6EA 1NM5C 2C9CA 3NVDA 3FHJA 4TWJA 4WGGA 4M3NA 2ZIWB 4BFWA 4Q4CA 1UBUS 1A2BA 2WV7A 3LY9A 3LPMA 3VYSB 2BKXA 2ZI5A 3E2PA 2HAEA 1KZ1A 1P2UA 5SYNA 2VZ9A 1I2ZA 5F33A 4DJEC 3ZK8A 2WSMA 5MDHA 5CVDA 1K3FA 3HHEA 1GCOA 3T61A 2KLBA 1PJRA 1KORA 3IMEA 4CQJA 2I4RA 3PGXA 3ZYCA 4HDAA 2IYTA 2XA2A 1P4SA 4RO0A 3W6OA 1IBRA 4EHNA 3KHUA 5JJIA 1GU7A 1GCUA 1F8FA 4RMHA 3ZU5A 2OVBA 3ZE9A 4TMVA 3QEMA 3RR2A 1JQKA 2IP2A 2PJUA 3AG5A 5JXIA 5JS2A 3B48A 1NX6A 3HHPA 2J9ZB 3OM1A 4WH0A 2Y99A 3SKXA 3W9BA 1G21E 3PF8A 1ZCJA 2Y1LA 2IH5A 1W4LA 1XD2B 4RMJA 2CLEB 2QD2A 1J5XA 1GZ3A 2O8EB 2IYQA 3FCAA 4R31A 2IZ1A 1MOZA 1FFBA 3RS2A 3ZGNA 3D8BA 4M9ZA 1MB4A 1SOUA 3O92A 4DCMA 4EBBA 2QRMA 4B47A 5AHOA 5ELMA 4MB0A 1CP3A 4GM0A 2JFQA 4B4UA 3G2HA 4TXHA 5AH0A 3OQOA 3HADA 2AG8A 3ZVRA 4K8RB 2E0IA 4M8IA 3PE4A 3H7IA 3L41A 5E9WA 3IXMA 4L6CA 3EZNA 2W2TA 1ZXXA 2WWXA 4M7PA 3A4IA 2E49A 1FS5A 1GGHA 3CWCA 4F9GA 1Y80A 1JG2A 2JI9A 4GMKA 4EITA 1XROA 3RKSA 2X40A 3RVPA 2PDAA 4MLDA 4IIJA 4XB6B 4FW9A 2C9DA 3LUHA 3WFJA 2YINC 3T9BA 2LRHA 3QZUA 3I0NA 4MW4A 4I55A 1ZBDA 4RA9A 1CETA 4S1WA 4OBWA 1QE0A 4JLMA 5FADA 3U5TA 1PP4A 2WWFA 4LXQA 4AO8A 2PAFA 3ZHXA 1Z06A 1W85A 2JEYA 4BU1A 4CEHA 4B9AA 2R2GA 3I1JA 3IPAA 4A03A 2GJAA 2QT9A 3D3QA 4QBHA 3UMMA 1A8HA 4O3MA 1LLUA 1KOLA 4QPDA 4X3CA 4C43A 1WBDA 1RXIA 1J7KA 3JYOA 4WACA 1RXVA 3FSRA 4TV8F 3AEUA 3PC8C 4KUHA 2NPIA 5TT0A 1K6IA 4YJHB 2C2ZA 1RKXA 2WLSA 3OTHA 4LWQA 2FXVA 3GLFA 1QYIA 4JSYA 4RDHA 1N5JA 4GQAA 2BDUA 5K3BA 1XTBA 3CXRA 5IK2D 2I7XA 1H2ZA 4BLVA 4ZV7A 2FW0A 2Q5OA 3HKDB 2YZNA 5AI4A 4QWMA 3BSSA 2WUWE 4J0IA 4QDXA 1KP2A 1TCCA 4FEAA 2P62A 4P4UA 4TZTA 2XQJA 2GZMA 3DE2X 1RYHA 3Q6NA 3Q5EA 4D9GA 2CFOA 1ZAKA 1BYIA 3BN3A 2V65A 1A9ZA 5HF5A 4HMPA 2W0MA 2MMGA 4BV9A 3ODPA 3TAUA 4KO4S 3OOYA 4B2IA 4QA9A 5EZYB 3ZZMA 4BQFA 1ISPA 3V34A 1XTQA 2Q27A 3GEGA 4B8ZA 4F3TA 3L84A 1TW3A 1WA5A