1N1DA

Glycerol-3-phosphate cytidylyltransferase complexed with cdp-glycerol
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
126
structure length
126
Chain Sequence
MKKVITYGTFDLLHWGHIKLLERAKQLGDYLVVAISTDEFNLQKQKKAYHSYEHRKLILETIRYVDEVIPEKNWEQKKQDIIDHNIDVFVMGDDWEGKFDFLKDQCEVVYLPRTEGISTTKIKEEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Glycerol-3-phosphate cytidylyltransferase. Structural changes induced by binding of CDP-glycerol and the role of lysine residues in catalysis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
molecule keywords glycerol-3-phosphate cytidylyltransferase
total genus 45
structure length 126
sequence length 126
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.39: Glycerol-3-phosphate cytidylyltransferase.
pdb deposition date 2002-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1n1dA00
2V0GA 4MWBA 1JZSA 4JFAA 3P0IA 4MWCA 1VBNA 1JEEA 2A7XA 2QJFA 3CR8A 4MUNA 4EG7A 2CV0A 2NSYA 2JA2A 2V0CA 1O0BA 4DJAA 1G8FA 2X3FA 1IVSA 1NSYA 3HV0A 3P0HA 3ISJA 3ND5A 4G5YA 4YMIA 1OBHA 5K0TA 1MC1A 1OWNA 1COZA 5KWVA 1N77A 2IP1A 3AIIA 4XFJA 4ZT3A 1KKUA 3ZJTA 1T6XA 3RBAA 1SURA 1ZH0A 2GOYA 3CLRD 3OTWA 2TS1A 2DEUA 2Z3VA 3DV2A 3RFFA 1NUQA 1JEDA 2X1LA 3IODA 2A86A 2HGZA 5FO1A 4EG6A 5FO0A 2WQ6A 3COZA 1O96B 1RQGA 4MWEA 1I2DA 1KP2A 4MWDA 2JAXA 4EG1A 3SDBA 3CLUC 3FG9A 1KQNA 3LOQA 4MW5A 5EKDA 5FNZA 1XNJA 3VU8A 3OP1A 2A4MA 2E0IA 4WSOA 3CLSC 4YBRA 4KR7A 1T6ZA 1MOPA 2E21A 1Q11A 1U3DA 3RHSA 1T6YA 2PG3A 3SP1A 3UOWA 1NYLA 1F7VA 1N3LA 1IHOA 1LI7A 4QREA 1WXGA 1QU2A 1PFYA 1R6TA 3TQOA 2DUMA 4NAUA 2CT8A 4XSVA 2E89A 4KR6A 1TYCA 4MVCA 1TQ8A 1J70A 3SYTA 5K0SA 3ZGZA 3S3TA 3C8ZA 4UZFA 3COVA 2BYTA 2BTEA 1OD6A 3IVCA 1KQOA 4NATA 4EG4A 1NUUA 5HG0A 1GPMA 3G59A 3CVWA 1KP3A 3HL4A 1N2IA 4CDMA 2NZ2A 1YULA 3IMCA 1IRXA 2X0KA 1QJCA 5IJXA 4CT0A 4CQNA 1WKBA 4ZCPA 1IFXA 1I6MA 1KH1A 1N1DA 3FIUA 3KT0A 1R6XA 2DR2A 1M83A 1TEZA 3ZXSA 1KAQA 1NI5A 2DXIA 1MB9A 3ILVA 1WXEA 4OJMX 5IHXA 2EL7A 2YWBA 4EG5A 1O97D 1QTQA 1N2JA 4F4HA 3DO8A 3KT6A 3QTBA 4Q16A 3CLRC 1JMVA 4QRDA 1O94C 1IQUA 3K9WA 1Q15A 2RE8A 3CVXA 3H9BA 4X0EA 4YP5A 1TYAE 3U1VA 3X1KA 1WY5A 3ZUGA 1H3FA 3QTTA 4JXZA 1MJHA 1N2EA 1IH8A 4ZCQA 1GN8A 4U8HA 3IVXA 1J20A 4PBRA 4MUIA 4YP6A 3A2KA 2AG6A 1H3NA 2CSXA 4FZJA 4L2IB 1O6BA 1UFVA 3FETA 1O96A 1XJQA 1U7XA 1T9GR 4EGAA 1EUYA 4I6GA 1N78A 4MW4A 4G5FA 5TEWA 1GLNA 1J09A 2J07A 4U63A 1NUTA 3AFHA 3D6VA 1FYDA 3IUBA 1VLHA 1YUNA 3H05A 3RK1A 1X8XA 2JANA 3PRHA 1WQ3A 4BWVA 4NDAA 1M1ZA 3Q4GA 3I05A 1X6VA 2PIDA 4HJRA 3RJZA 4MUGA 1N75A 3L93A 3Q10A 3IUEA 4R0NA 1U0BB 3FOCA 4J75A 3CLTC 3TZLA 2CUZA 1NUPA 4DLPA 1ZUNA 1PFUA 5KHAA 4R2LA 3N8HA 3IOBA 4HPWA 3UMVA 3BL5A 3A04A 1VBKA 4F3RA 4ZCSA 1EUQA 1V8FA 2DLCX 3LCJA 4ZT5A 4MVXA 1T9GS 2CYAA 1Y42X 1S4MA 1GTSA 1V47A 1EFVB 4MW0A 4Q93A 3FDXA 3RK0A 3IH5A 4ZCTA 4MUJA 2O5RA 1NP7A 3N9IA 1QRSA 1IQ0A 3H9CA 3NBAA 5LFAA 4ZT6A 3KT8A 1YIAA 2DPLA 3FH0A 4ND7A 4KR9A 2RD2A 3N05A 2OV4A 1BS2A 2CYBA 2HMAA 3X1JA 1MB2A 2DETA 1TYBE 3DLAA 5LLTA 2XRYA 2PZ8A 2YWCA 3LE8A 2A1UA 1F9AA 3COWA 2EJCA 4G6ZA 3M5WA 5DEOA 4EG3A 5JBNA 3FWKA 3ND6A 4EF6A 3MXTA 5AHWA 2QUHA 2IJGX 3CVYA 1JGTA 4NZPA 4TS1A 4ZT7A 1N2GA 2IELA 2Z08A 1O5TA 1B6TA 2A88A 2GKSA 3FI0A 2AZXA 2QTMA 4JYZA 2PZBA 2OQ2A 2YY5A 3IOEA 3IMGA 1YIDA 2QJTA 3SEQA 4MULA 4MW6A 2VTBA 4MQ6A 3FY4A 4GU5A 1J21A 2H2AA 4NX2A 2QJOA 3X1MA 3MMXA 4K03A 1M8PA 4E1AA 1JIKA 4MLPA 1JILA 4MW7A 4OUDB 4EFKA 1PG2A 3MUEA 5J59A 2PZAA 4AS1A 2DERA 1LI5A 5J58A 1DNPA 4J76A 3L92A 1J1UA 3HZRA 4OUDA 4MUEA 2PXHA 4PY2A 1KH3A 1M8KA 2J4DA 5TS2A 3CA8A 1WZ2A 2QTNA 3HFJA 3GMIA 1XNGA 3CLTD 4MW9A 3HMQA 4P2BA 4JXXA 4KPUB 1F7UA 1U3CA 4MUHA 4ZCRA 1N2HA 3KT3A 2X1MA 3UY4A 2ZUEA 5DB4A 5J5AA 3Q12A 2J09A 1WXIA 4XFDA 4S1OA 1ULHA 1EFPB 1MAUA 4MVWA 2QUJA 3GLVA 1G59A 3A05A 4HJXA 4ND6A 2WQ7A 4ARCA 3A4IA 3QE4A 3ZJUA 1K4KA 1GAXA 3AG6A 1M8GA 1K97A 1O95D 3F3MA 2QTRA 4DE5A 3TQIA 5LM3A 1K92A 3MLBA 3N2YA 3INNA 1FFYA 3COYA 1M8JA 4DDMA 1K4MA 2CV2A 1CT9A 3SZ3A 3CLUD 2D13A 4DNXA 2GM3A 3AKZA 1KR2A 5H16A 1N2BA 5DK4A 3SEZA 1H3EA 1ILEA 1VBMA 4A91A 4PBSA 3IVGA 1EFPA 4KPUA 1EJ2A 4RUKA 3CVVA 1QRTA 4JZYA 1JZQA 4EG8A 5DASA 2WB2A 3ND7A 3DPIA 1EFVA 1VL2A 1GTRA 1JIIA 1M8FA 2A1TS 3IMEA 3ZIUA 5HUJA 3H99A 1QNFA 4ZT4A 1YUMA 2A1UB 1Q19A 4U7JA 4PBTA 4QBTA 1J1ZA 4ARIA 1PFWA 1MRZA 3NBKA 3GUZA 2Z09A 5H7XA 2WSIA 3P0JA 3TS1A 3ZJVA 4MAFA 2D54A 3G5AA 1Q77A 1XNHA 1TYDE 1IQRA 3MLAA 2CFOA 4YP7A 1NURA 1NZJA 2VTBB 1A8HA 5BNZA 4DDKA 3P52A 3VGJA 4I6JA 2A84A 4MVYA 3TNJA 1JECA 3E27A 4MW1A 3ELBA 1KORA 2H29A 2A1TR 3K32A 4GRIA 1PFVA 4MUFA 1I6LA 1JHDA 2XRZA 4CDNA 4AQ7A 1WXHA 3CLSD 3H97A 4H3SA 1WOYA 1QRUA 2CYCA 3KFLA 1QQTA 1YI8A 4MW2A 4WNYA 3AL0C 2QUKA 2D5BA 1QU3A 1O97C 4NAHA 1G8HA 1OWLA 1JIJA 2ZP1A 1P7PA 4ZT2A 3AG5A 1OWPA 3NV7A 2HZ7A 1O94D 2J5BA 1N2OA 2C5SA 3IDFA 3IOCA 3FNRA 4R2MA 2CV1A 1KAMA 1OWOA 4MUKA 1H1TA 1LW7A 2YXNA 3UC5A 2J08A 5HUHA 2VXOA 5TEVA 1WQ4A 3PXUA 1KQPA 1TFUA 2B7LA 3HGMA 1EE1A 2G36A 1OBCA 3D6UA 1G8GA 2E18A 4L2IA 1OWMA 1MBZA 1O0CA 1HYBA 3UK2A 3FHJA 5KCMA 3G6KA 1D2RA 2R5WA 5TGTA 1U7DA 2I1LA 3PNBA 4HK4A 1WXFA 3PNYA 1WJGA 3PNVA 3SZGA 1I6KA 2O8VA 3TZEA 1EXDA 1O95C 2QUIA 4UZEA 3ZXIA 2PFSA 4DDHA 1ZH6A 1NUSA 4I6EA 3VRHA 1F4LA 4K0RA 1GZUA 5F23A 3JXEA 1MAWA 1ZJWA 1PG0A 4KKVA 3CVUA 2ZUFA 4RPIA 2AKEA 1KH2A 1R6UA
chains in the Genus database with same CATH superfamily
4YRBA 4RZXA 2BCGY 1F51E 2HPVA 1MZVA 1DRUA 1Q1EA 3OECA 3MF4A 3B7PA 3ON5A 4MWCA 2YHBA 4H6WA 4KW7A 4DIOA 1CUIA 3NRCA 1N2SA 5ED0A 4D41A 4TVSA 4YAFA 5DHUA 5K3FB 1E77A 2CHQA 3HS3A 1R9GA 4W8OA 3PZBA 5HKOA 2ZVDA 3S2IA 1PJ8A 1W46A 5BWNA 2SECE 1WCYA 3NXKA 1Z74A 1XTPA 2WUVA 3HV0A 1O3YA 2H63A 3IVAA 3M3HA 1JSXA 5J4KA 3K1AB 4GL4A 3RR2A 1ODTC 2BMAA 3I32A 2O0LA 2ZZNA 2PA3A 3LHSA 5CLGA 3QLEA 4INJA 5T4HA 4Z3DA 1L0BA 4LWQA 3AIIA 2HOQA 4YA6A 2IKQA 1GPJA 3VR6D 1I1HA 3A3KA 1A27A 1DG9A 4P58A 1THGA 3FDZA 4IQ0A 2DFLA 4ALNA 2RH9B 4W5JA 1W1WA 2C96A 4G23A 2GNAA 3A2NA 4ZEXA 4WXHA 2VDPB 3BFPA 3UATA 3FW1A 3OC0A 4B80A 4R1PA 3GX1A 2D0OB 4L4ZA 2C3PA 3BMOB 3KZXA 1P7CA 5KOHB 4RVHA 4FHZA 3N3BC 1IMOA 4W7IA 2WD7A 3QKRB 1C7IA 4RACA 2BDTA 3ER9A 1JHQA 2WSSA 3WNDA 1F1JA 3GCXA 3PSAA 4HYEA 2GBLA 5FTWA 1X1CA 2R7LA 4GR5A 4V38A 2HF2A 3VKGA 1OU4A 1KPIA 2R8BA 5IBRA 2YN2A 2D6FA 1Z29A 3ZQKA 1XA3A 4BNJA 1R74A 3G0BA 4E22A 4N0DA 3TEMA 2Z8ZA 2BVNA 1RCUA 2QTWB 4V0RA 2V7QA 2WAMA 3QY0A 4HCJA 3TLGB 3WKEA 4C1NA 4TRMA 5LMCA 5LMZA 2O20A 4KDFA 4O0MA 2AFVA 3T7JA 4BLQA 3RHSA 4GVLA 1A9SA 2P0AA 3KL4A 3OWHA 4MQ5A 5DRTA 1ZD4A 4Y9TA 2C0CA 4LQ4A 4XLZA 4Y67A 4E5PA 2OSBA 2VAMA 4ZI7F 1YCHA 3UJNA 3QKSA 4NARA 3TQOA 2FVXA 1BHO1 2QTZA 4XSVA 4EVQA 2X8LA 2XZDA 2E89A 4UASA 1MEEA 5FNVA 4MINA 5FPQA 3EIFA 1J70A 3NHLA 1AN9A 2PH3A 4L22A 5IKOA 3KO8A 4IOJA 3MTDA 1IK6A 1H0RA 3X44A 2ZTVA 1P2SA 4FDAA 2CK3A 2X23A 3WL7A 5HE9A 2AL7A 1INLA 5TDHA 1RCFA 2YZMA 2KHZA 5BN4B 1J5PA 1NR5A 3OF5A 3S1AB 3WGLA 1NM5C 4MQ4A 4NATA 1R8YA 2GCOB 2O0JA 1WNTA 3DBHA 5E95A 5LC1A 1KRHA 4FDUA 3TMYA 1SCNE 4N41A 4PLHA 2AB0A 3J7AC 3ET4A 1KIMA 3GNLA 2CSUA 2FG5A 2Z56A 1YULA 5HBRA 2EEPA 1SVNA 3GP5A 5LZ2A 4ZV7A 4DS3A 1EJ6A 2WKWA 3NVMB 4PSUA 4QUGA 1BRMA 1CUEA 4L9SA 5IJXA 3OPXA 2EATA 4OGKA 3IL2A 3R5SA 1FX0A 2DR3A 4QBKA 4UHKA 4XM2A 3W06A 3QVUA 2D2EA 4GZ5A 3AJRA 3IBFA 1M2NA 3TQHA 1HC7A 2CNBA 3WGJA 2FEPA 3SCZA 3EDCA 2HADA 3P2KA 4DF3A 1FXSA 4MVJD 1JSCA 4NH0A 3VYSB 1M67A 1TT5B 4N3CA 4HDSA 1VI2A 1NWCA 4PIMA 4EZEA 3ROPA 3N6VA 5IRCD 5CPFA 4NYIQ 2NMVA 5J5VA 4MV6A 3S29A 5IJ9B 1XYYA 3CPSA 5CT6A 2GM4A 3KQKA 3GGGA 4FEAA 1G66A 3DMTA 3DONA 1P5JA 4AYXA 3T3IA 4OH7A 1BXRB 4WKOA 3BL8A 5CH8A 1Y1RA 4X0EA 1SU4A 2IYXA 5EJ5A 4WBXC 3ETEA 3NTQA 1C2TA 4KP7A 1J23A 4K6HA 4ML3A 3V2GA 1JRLA 1TOAA 1WY5A 2O2XA 4R2HA 5LUAA 3BGVA 3QTTA 2O06A 1MCZA 3AP2A 1V2HE 3FGZA 4RIGA 1T0PA 3TMKA 3ESCA 3LYHA 3OLWA 4CUKA 4F6RB 4U8HA 3MGCA 5F7ZA 5K8IA 5CXQA 4BRSA 1NVAA 3PXXA 4CIVA 5HMMA 2J0VA 3G02A 1KY2A 2NZJA 3R6WA 3MQ4A 1NY6A 5E0KB 4IIUA 1DXOA 3MD9A 2GD6A 3SU8A 3WLHA 5AK5A 3LGAA 4GRDA 5EWLA 4R3UC 1BDJA 4DG9A 1X7ZB 3KKKA 4YFVA 2FX5A 1KK2A 2GBIA 3PD7A 4QEZA 1O96A 2J7PA 3LRTA 4PX9A 5GJVC 3V8QA 4CKWA 1T5HX 4J0CA 2G4VA 1AQLA 2ID9A 3NR2A 2REXB 1XF1A 1I5RA 4I6GA 3PFGA 4O29A 5IM4F 4DV2B 1H2XA 1E1MA 4J6EA 4G5FA 2EWMA 4QHYA 2H2WA 2FPRA 3AHCA 1ZN2A 3FOEC 3ER8A 4U63A 1KAGA 1L7BA 1ZNQO 3E84A 3H05A 1NDQA 2WD7B 3W5VA 4DR7B 4DLUA 1W25A 3PC6A 4Q47A 1R8SA 2OV3A 2AZTA 2P91A 1H23A 3BXOA 3C97A 1T5OA 3NB0A 2QLNA 2O4UX 3K72B 4NDAA 5F21A 3QVKA 3VOTA 1N5LA 2OHFA 3HL0A 4TVKA 4B6SA 5KYYA 5DDIP 4C5CA 4DBLC 1VFPA 3HYCA 2H7CA 1FY2A 2ZS8A 1OREA 2ATIA 4X20B 3CZAA 4BUJA 4FZ3A 2DBRA 3EDOA 4UW9A 3N2GA 5HX7A 1HE3A 1XJ0A 2VHCA 2OC9A 1NUPA 5MGBA 1UZNA 2X7HA 3LCMA 3NTXA 4JEHA 2Q3BA 5K0ZA 1F20A 2B4YA 4D9GA 1LJLA 1NW4A 3LJKA 3UOAB 2QW1A 4KMRA 3Q98A 4RETA 5BWMA 1EK0A 1W4AA 4Z7OB 1EHIA 1W8DA 4ENWA 2FCAA 1M7GA 2E49A 3VV2A 2DLDA 2J9GA 4RPGA 3BSSA 4HI0E 4TLAA 3S44A 3JAKB 4TMYA 5FBKA 5BN5B 4AZSA 3QBJA 1KE1A 1D3AA 5KJ1A 3LC1O 2WU4A 1DFIA 3B70A 4Q48A 4RCYA 2NUTA 2ZBEA 3JQ8B 4ZEMA 4A82A 2Y1EA 4D6PA 1PZHA 3ABIA 3O8CA 5GM2A 3DDZX 1X7YB 2MTBA 4B35A 4Q1BA 1Y33E 2ZLBA 2Z5VA 4XRGA 3FOZA 5D3MB 4ZOLB 1ZCBA 2AYXA 3WMRA 3QVGA 2FW6A 3AM4A 2FAXA 1NVGA 4EA9A 3CWZA 3K16A 4O4JF 3U40A 2VBCA 3VDRA 3IPAA 1OZHA 2WT8A 2J3IA 1Y3DE 1ZIYA 5G1NA 2JFXA 1ST3A 5I7AA 3V8PA 4G0XA 3JW8A 2HYDA 1QLJA 1SBNE 4NMMA 1P72A 2UUOA 1A97A 5G0TA 5KDLA 4GQIA 1YASA 3VYUB 3AIKA 4GOOD 4YQYA 3W1VA 3WP0A 3T1QA 4MQLA 3GCWA 4UOEA 4QYWA 3OPVA 5KJCA 5JBNA 4ARAA 4EMBA 4NJEA 2OYSA 5I47A 2ZSIA 4CN9A 1SXHA 4LXXA 4S1TA 3GMSA 1JGTA 1M1NA 2P3QA 4H1HA 2I65A 1SQSA 1UOOA 3O1JC 3NALA 1P74A 1QV9A 4PAQA 3DOIA 5LP6B 1NBHA 1I7SB 2V1XA 3PC8C 3R0XA 4MGKR 4IZ6A 4YJFA 2C54A 3LT0A 1JR3A 1WUYA 4EELA 5FR2A 2YY5A 2QJTA 3ZH9B 1CS4C 2C2KA 1DQNA 4A2CA 5C8VA 1X0VA 2VYND 3J81k 2VRWA 3OSUA 2YVQA 4NE9A 4ZJZA 2CGEA 3JPYA 1MJ5A 2PS3A 3DOCA 3EMKA 3QVSA 4YO8A 1ZSYA 3K4PA 4H60A 3BKWA 4HX2A 3E35A 4BQIA 1A76A 1PQYA 1UDCA 2BN4A 3GLQA 3HGTA 4UU7A 5F2EA 4DEXA 2COKA 3UUEA 2YOHA 3HB1A 4I5EA 1VL0A 3OE1A 4J76A 1TVKB 3L4SO 1B2RA 2A35A 1RJFA 1P0MA 4R1NA 3TZHA 2WJAA 3NW9A 4CMEA 5AUPB 2C9BA 4XD7A 3QEBZ 1WCXA 2YV5A 1AGNA 1A71A 4BXOB 2AQKA 3K0KA 4RJTA 4MW9A 2NNWB 2DTEA 4I9UA 3RS2A 1Z3IX 2AZDA 1SXPA 3G13A 2HSJA 1LPMA 1OMOA 3ELUA 3K0AA 2G9NA 3RU3A 3HBAA 1O87A 3P19A 4MKXA 5L3SA 2PS9A 2XA9A 3P9SA 1Q17A 3B8HA 4FDVA 1HE4A 1HOTA 1USUA 4Y2RA 2NZXA 4H6VA 3AI2A 4FT2A 4O4LA 4F8YA 5B7GA 4MA0A 3RJMA 3DJYA 4BAUA 2Y1LA 3VKHA 1EFPB 4YRFA 1X7WB 2Z2XA 3HA7A 2RBKA 4G5XA 4NSNA 2HWXA 1Z13A 2FGKA 3GLVA 1CR2A 2J8ZA 2OD2A 5JQWA 2P2ZA 3QX7A 3ML1A 4DLNA 4WESB 5JVDF 2R44A 1T2FA 1VKNA 3FYCA 3DXXA 4OG2A 4HWSA 3VAYA 1RRVA 1SXJC 3D4LA 2NWQA 3OG9A 4M1SA 3T9BA 5EJ6A 1YFLA 5J1SB 1PJ4A 2X4LA 5DOVA 2BFWA 1KFJB 1TCAA 1OX4B 1JP7A 4RX1A 1REQA 3Q0TA 3V4VB 1H5QA 4P54A 2GT1A 3FSGD 3N7TA 3P45A 4H9GA 5TJ9A 4WINA 5IYZA 1EFPA 1YCDA 3F4LA 3HZOA 1ZM7A 2X2OA 3EASA 5G0WA 4CKYA 5M7EA 1QRTA 5B58C 2XV1A 3NIDB 4BFYA 1P9NA 2EKBA 5EERA 3VA7A 3LXUX 1S7CA 1UBSB 1ZH2A 3A2MA 1TJ4A 4MPPA 4BWGA 1RPTA 1M73E 2XQJA 4DSZA 4GE0A 3IMEA 4GBED 2AOUA 2NU8A 4BEBA 3BMNB 1RWOA 1LPPA 1Z08A 3T7SA 3OZRA 1J2JA 4JLBA 5MF6A 1P2GA 5M2QA 1QLHA 2F3PA 3GLHB 1UJ4A 3CGWA 3DHYA 3HYTA 3QITA 4HQNA 4MUXA 4ZALA 3SF8B 4ENRA 3QU5A 3P0JA 3CFYA 3MMPA 2Z0MA 3WZMA 5GIPE 2WF9A 2CUKA 3GEIA 4RQBA 1CFZA 3IAFA 4YREA 5JSUA 2D54A 4BE9A 2I4MA 4CQLA 1AQUA 2P6UA 4JODA 3ZU4A 5BWCA 5BWBA 2VEOA 3MOGA 3ZWVA 4DC9A 3R9IA 5DRYA 3AQIA 1ZLXA 4RESA 1BFKA 5AI9A 4RZUA 5EIBC 4MR7B 1QQ6A 2R1TB 2HHAA 1UKAA 4RFVA 4YCDA 3WGUA 2HCRA 2MHCA 3F96A 3KD2A 2ETVA 2HWKA 1A8PA 1SCBA 2HIMA 3U19A 1C1YA 2GLXA 4H7KA 4UAVA 1GTJ1 1EFAA 4MUFA 4JR1A 2Q0XA 4RGVA 1JHDA 1C0EA 4NOLA 3PXBA 1V4NA 5KOJA 3RYHB 1DRJA 3HFSA 4R4JA 3SNKA 4XAQA 4N3GA 5I8ZA 3SGLA 4PTLA 1P5HA 1QQ5A 1LS6A 1QQTA 2X9VA 5DLEA 4F2GA 4MW2A 4WNYA 1CU1A 2NLOA 3U4MA 1NVKA 4MGZR 1XKLA 3NM5A 5JNUA 1QIDA 2DCUA 3V2UA 5CEJA 1OH6A 4KQHA 3BGIA 1JBQA 1JQKA 3BK7A 2D5AA 3OZBA 3ZC3A 1N25A 3DDHA 2HT1A 1SFRA 1Y3IA 2X14A 2ZVQX 1L5FA 4UFNA 1Q44A 4M8SA 1C1XA 2BEVA 3BTVA 3NIFB 2HM7A 2Z2YA 2C1EA 2ZUUA 5T67A 4WRRA 2H9YA 1J22A 4C4RA 3PEFA 1A5BB 4ESVA 5EG5A 2P9ZA 4ZV9A 5J4VA 1XDWA 2HEGA 4UUBA 3UMBA 1EFTA 3WP1B 1QC5B 2BFBB 1IZYA 1D1TA 4ITUA 3KPVA 4QEKA 4AJLA 2O8BA 2HNBA 1YKGA 3PFNA 1U5AA 2YXNA 4ZAGA 4RFSA 3C7TA 4U2BA 4YT5A 4OFWA 1NE7A 1K0FA 1R4MA 4D9BA 1ULUA 1WHSA 4TTPA 3PPWA 2ZIEA 5TMPA 4JR0A 3GGOA 4QWMA 5FL7D 3W4IA 1DCMA 3AL2A 3WYBA 1ZD1A 4HZUB 3WNCA 2TECE 1SVOA 5CAEA 1RQNA 5SV2A 4UMDA 1H22A 2OCGA 4F93B 3D2AA 1FTWA 4XZ3A 2ZSAA 1SHUX 2AFHE 1SQFA 5TMDA 5EVJA 4C89A 3CF4A 4I9GA 4F8JA 3IKVA 1KRWA 2FW8A 4ZQEA 5EFOA 5FR1A 3TXXA 2ZBPA 5EFZA 1CZOA 2X8WA 2BGJA 3FLBA 3M5DA 5KUTA 1DINA 3CW9A 3LIPA 1FBTA 1NQXA 3MYRA 3WNVA 1AO3A 3JTEA 2VTVA 3OHSX 5FTMA 4L9WA 2ATCA 2QVYX 5K3BA 4N9QA 3AUFA 3H3FA 1G7SA 2JVJA 4PZ9A 4QQNA 1PJQA 5HFAA 4W5OA 1U9IA 3PNOA 1VMDA 2VDVE 3FWZA 1DRKA 2RKWA 3FNQA 4TOIA 5KSYA 3A1EA 1TCBA 3U6BA 3RFUA 1WW8A 4O4HB 2DWUA 4MIOA 4RHXA 4A7PA 1XMQB 4DDWA 1US8B 5HM6A 2XECA 1VBNA 1IBSA 3WQRA 5I4KA 1MXHA 4S0ZA 3D4PA 4IWYA 1TO6A 3LBFA 3TR6A 1CUWA 3CKLA 1Q1QA 5HKKD 1M6YA 1Y3AA 4N5LA 3SLKA 3C6MA 5HRUA 1UZMA 3IVRA 1AHIA 1GQRA 3O7MA 2ODAA 4DMHA 1ONSA 2WP0A 3AGPA 4GP7A 4BAGA 4RVDA 1M2GA 2A9PA 4LZPA 1BNCA 2N75A 1PL6A 3L4BA 4Q15A 3C1AA 3FYUB 3QPBA 3RH0A 1JPNA 2JZNA 1SU6A 2ZJ1A 5I51A 3GUCA 4FDLA 5FBVB 3BBLA 3NLLA 5HQTA 3N5KA 4L3WA 3DV2A 3ZNQA 4DVGA 3NWBA 4TQGA 3VO2A 4UM9D 1GG8A 3BFVA 3MN1A 4KYTA 3MGGA 4XB2A 3I2GA 2C92A 3RRJA 4UMVA 4IV8A 4ZU6X 1ZUD1 1U8UA 4C4YA 1OLUA 2BKLA 2EF0A 1ESMA 16PKA 3KR0A 3QUAA 1WSWA 7MHTA 3OO0A 3R3ZA 1PV2A 2HDWA 5H4HA 1BC5A 1R27A 5B3JA 4MWDA 2CFTA 2X1HA 4PFJA 4OHCA 4RDHA 3WADA 3U56A 1D0VA 2HF7A 5LVAA 2R79A 3ENZA 2OO7A 3U3JA 1YZVA 5I9LA 3WTBA 1J56A 2HDHA 3IPYA 5KNBH 1AKMA 3I53A 3BE8A 3LK7A 4DA8A 3OP1A 3RUPA 4X64B 5BORA 1NG9A 2IVFA 2NXWA 4XRRA 2F9FA 1MOPA 1T6ZA 1XQVA 3CUTA 3UUFA 4LJRA 3IR7A 3B82A 1FCJA 2Q5OA 1RAFA 3WLPA 3PLAE 2VYVA 1U3DA 1GZ6A 4LJ9A 1T6YA 3T3DA 5AW3A 3NTUA 2ZYHA 5I7HA 1B7GO 3S81A 4TPKA 4RLHA 1A9OA 2OKGA 3H2GA 3N6RA 4KGDA 2QRNA 4UD2A 5ALLA 1LI7A 1XTSA 1U0NA 2J6BA 1B15A 1KNXA 4U0JA 2Q5JA 4HLNA 2GJ9A 4IZHA 3FMGA 1O1YA 3EZGA 1EXVA 1E7QA 2BFFA 2G5TA 2H57A 2K4MA 5E6RB 2BZSA 1PQUA 3SYTA 1T5BA 1G8YA 1TX4B 1ZS9A 4ANFA 1NPTO 3C8ZA 4RK6A 2C2OA 4DIFA 2H17A 3LY9A 1B6SA 3VSBA 3PEYA 2QL7A 3C7AA 3EQZA 1PKXA 5I4IA 2YR0A 2ZAYA 1K8QA 1RTTA 4UVEA 1XF9A 1NSFA 3M1YA 5JO0A 3ZCQA 1KL7A 3PQ4A 2VJBA 1TZMA 5LQKA 1SZDA 3E9DA 4OQNA 3JD1A 1RKBA 3KDPA 4C7BA 3IEPA 1JG2A 4H27A 4L4RA 2UZ1A 2NPFA 2IA5A 1GYRA 1Z5GA 2ZQ5A 3VH2A 4DB4A 4DIDA 3EVNA 4UU8A 1YK0A 1OAOC 5GVRA 3K9HA 2HU7A 4QUDA 2V97A 3HFRA 1JW9B 3MT7A 2QZPA 2ZRHA 3A6EA 4J0EA 1N1DA 4CKEB 4GSYA 4FX5A 2XADA 2EX0A 4WLNA 3T34A 4CR8A 2BGWA 1R6XA 3PLRA 4ZVPA 4M4SA 4MDEA 3HB5X 1Z2DA 1TEZA 2O05A 4GKVA 4N8SA 2QSUA 4UKDA 4BKMA 2WINI 4D43A 3VR0A 3ABQB 2PGXA 4RK1A 3LT4A 4OJQA 3U44B 3FUTA 3OD1A 1A95A 2YWBA 3VPCA 1FDOA 2D62A 1Q84A 1Z2PX 2Q3EA 3VZRA 4WZAB 2RHHA 3T8YA 2BFDA 3MTIA 1BH2A 1AOXA 2PQ2A 3CSSA 4XEHA 5D3QA 5J2UB 2J0EA 4CG3A 3KEQA 3GN2A 3A0UA 1CK4A 4K40A 4N01A 3EPHA 1RHRA 1YK1A 3AFMA 2IOYA 4OI2A 5BURA 2VCEA 2M1ZA 2YKGA 1U0SY 1DBWA 1R6AA 3D7KA 1GWNA 3GK3A 2OC4A 2BONA 5CFOA 1Z6PA 4OATA 1QHIA 3IJPA 4LHVA 4U4AA 3ZDRA 1LNZA 1FUUA 1KO5A 3MINA 1V39A 1FP4B 3ANLA 5IKXA 1SBTA 4HUJA 1DJLA 2B8WA 4JQSA 1AURA 4PBRA 4ZAWA 4M0MA 3GJ6A 3AF2A 2QYTA 2YXEA 4BB9A 2ZB7A 2II6A 2X7XA 4DUPA 2ZRBA 2Z6UA 3WR5A 3EVBA 5EXXA 5KREA 3AEUB 3GEMA 2XYRA 3W4JA 1U7XA 1AS0A 3C3JA 4ROSA 3K1TA 2WU8A 5FPHA 5SYMA 3PQ7A 5KQPA 1EGQA 3H7IA 1EK5A 3WSTA 5IAAA 4OTZA 4B71A 1GNSA 2CZQA 3WRVA 4E07A 4MCJA 5GTDA 1GGHA 2PUFA 4F97A 2Q46A 4LE1A 3IIIA 5INTA 1LLFA 1O58A 2IPAB 1CG6A 3OQ1A 4N03A 4N7BA 4Y6OA 5E3HA 1IHYA 1P18A 3OZXA 4TYYA 1J9ZA 4ZREA 3KK0A 2DGDA 5SY4A 2R8EA 3P32A 1FS5A 1TMOA 2GASA 1ISRA 1JQAA 2J3EA 2X8JB 3G1UA 1RWBA 3O94A 4OQMA 5BT8A 9MHTA 1AD2A 3N2NA 1LLDA 4Z8YA 2LCFA 5A4JA 2XB6A 1RRGA 5LXTB 1DMRA 4NFYA 4OU5A 2FWPA 1Z5OA 3STYA 4HSGA 5AKIA 4BRUA 3OM1A 3QQPA 4YAIA 4YACA 4BBPA 4OKNA 5AW6A 3SQMA 4L0MA 1JJIA 2R4UA 5EWJB 5AXBA 4GMDA 1CY7A 3PZRA 4ALMA 4AS2A 3FBTA 3KKPA 1ULSA 2GBGA 2ZIAA 4EHAA 3UMVA 2Q8QA 3BL5A 5GVSA 4KAXA 1ISSA 2JLRA 3UCXA 3W9UA 1V8FA 2XPCA 5JARA 1WBBA 4KR2A 4LF6B 4WZAA 3U61B 2FPUA 2P62A 2PL9A 4MCIA 1E1LA 1ZRNA 2F9MA 2XTMA 3GLTA 3H65A 3NHFA 3OPQA 4XSGA 3SPXA 1X1EA 4BO8A 1GTSA 4Y1FA 1HKHA 3TNYA 2QRUA 3QOFA 4LK3A 1H93A 1ORHA 1BX1A 5JS2A 1UKBA 1HF3A 3NOOA 3WMGA 4KAFA 1SXJA 3ACDA 1UC5B 1IQ0A 1XEXB 3VV3A 1Z2OX 4PC6A 1CUSA 4GZMA 3CMCO 1PDWA 2YNMD 3ZWAA 4ZC1A 2RD2A 3JQ9A 4MMYB 1BQ3A 1IWOA 3G23A 4DLSA 3B78A 4N7MA 3WHIA 1KI2A 2QM0A 1MB2A 5I9BA 4ZZIA 2DETA 2QGFA 3X1ZA 4LJ7A 1ZI6A 2PZ8A 1M2OB 1ZCFA 5K0LA 1H2BA 1WD7A 2GO1A 2NV6A 3AJDA 3FUUA 4MQUA 4PINA 2A1UA 2MSKA 2WFMA 2PJUA 3S2EA 5DEOA 1WPXA 2ORVA 3BTOA 1L7EA 3O1IC 3STUA 3DBRA 3BSWA 4I4IA 4MR8B 3RVJA 2G28A 1LBSA 4ARZB 3HE3A 4QG3A 1BU5A 1SZJG 1B43A 4Z0HO 3U09A 1J0CA 3K0SA 1JNYA 1NVEA 1MH1A 2Z1DA 2WKPA 1UC8A 2XXBA 4KX5A 4LC1A 4UOQA 4Q12A 1USIA 4DLPA 1F5NA 4TLMB 4IHAA 1CKEA 2WDPA 5HGXA 1TE2A 2HU5A 4BQPA 3GP8A 2WE7A 4MULA 4BFLA 2CNKA 4FGJA 1JG3A 3FGNA 1RABA 2YV1A 3IMKA 4X91A 5FBQB 3QVVA 3GUYA 2EBUA 1PK8A 3MHPA 2V96A 4J16C 1Z4KA 3GU3A 1Z73A 2QK4A 1T10A 2J59A 1PR9A 3ONNA 1DTWB 3ZTYA 5B6PA 3TDKA 2GEUA 3F2VA 1IXSB 4FI3C 4FPXA 1JIKA 1MO2A 1OLXB 2JL1A 1B0UA 3AO0B 3OJXA 5AJUA 4AKGA 5J59A 1P75A 1U31A 1C5KA 4OHWA 2OMEA 4MCHA 4FUTA 1H66A 1ZUNB 1XWWA 2GN8A 3FYUC 3FPEA 5J43A 3VR5A 5AKHA 3MB8A 4I1RA 2Q6LA 1NP3A 2GAFA 4E1BA 3Q8KA 4D4IA 2XGOA 4D92A 1GSAA 1L6IA 3MBKA 4OM8A 1LX7A 1VCHA 1QRDA 1Y4ZA 2HSEA 3C2QA 1T2NA 2AVNA 4EHKA 3MJRA 4IHJA 2JLUA 2C9DA 2QXTA 3WQBA 4RAOA 4UXJA 1PCXA 2PDAA 5CT5A 4KMMA 1G64A 2E4UA 2OOKA 2VPQA 5CLFA 1BIFA 3H5IA 2R2GA 2O14A 2MSLA 3LXXA 2H18A 5IMSA 2BDEA 3TUZC 4N6NA 3GLFE 4J1QA 3E3LA 2YQZA 3TQSA 3H8SA 1Z2AA 4LHYA 3FCYA 4KQ1A 2BTQA 4S1OA 1VP3A 2XHEA 1M5TA 1AQ6A 2G9VA 1E2FA 3VSAA 5GQSA 5I7EA 4L5IA 4MHTA 1RPJA 1XUOA 4BP1A 1Q16A 1Y82A 1HT3A 5ARBA 1GGNA 3P2OA 2XXAB 3R2JA 1PEKE 1GEGA 3HO1A 3E5RA 3JYQA 4BS9A 1U4OA 4OP3A 4A5SA 2NG1A 1Q0ZA 2XUDA 3CW8X 1K88A 3EWNA 4PZPA 2JJYA 4WERA 1SUSA 1YR2A 3V4LA 4OHPA 3ADPA 4NJOA 4F0JA 1KQFA 1GHTA 2IEZA 3IEKA 5SYNA 1K92A 1ZGJA 3KETA 1YR8A 2I22A 5EPEA 2CV2A 1YZUA 1E96A 3OQHA 3S55A 3AX6A 3SEAA 2YJTD 5LZ7A 4LMAA 5CYGA 4MHOA 2DWPA 1QF7A 3BFJA 3CONA 4LHSA 1SY7A 2XF2A 1P3DA 4BNFA 5FBWB 1Y89A 3IVGA 3VHLB 1EJ2A 3CEJA 2YMPA 3L8GA 4FS8A 2O5EA 2VSNA 3KPWA 3ZCXA 4B43A 1XT6A 3P9NA 1BXRA 3P9KA 3I42A 4YK7A 5TSDA 3TB6A 4Y2TA 4PAMA 2G5PA 3JVIA 1E2BA 4OHKA 1R15A 5IFKA 4C6TA 5HRAA 5JNTA 3OQMA 4MGYR 3QBVA 4K9OA 4CHGA 1Y8CA 2SICE 3L41A 1BS1A 4LGMA 1EVIA 5FF9A 2WTXA 5JI3E 1EDZA 3FLMA 1IAVA 2QBYA 1GILA 1Q1AA 3VYVA 1ZZEA 4TWIA 1JLLB 1KYZA 1Q19A 5J9FA 2BEKA 1E3IA 1I14A 3ORHA 2Z09A 1XEFA 3GEPA 3GNQA 2GO7A 4CM3A 1TUIA 2XMGA 4B33A 1QZ3A 5JNRA 3WNZA 1WF3A 2VKTA 3CX7A 3DS8A 3HKDA 3M6MD 4KXUA 4MP8A 4NTZA 1GPNA 4OJYA 5ESWA 4Q3CA 2NUPA 5CB4A 1Y8ZA 1EWQA 3NDJA 1ZM4A 1K2WA 1Y80A 4E51A 1SVIA 2OBXA 3NYRA 2VTBB 2PU5A 2CFSA 2XB9A 1QHNA 3N6XA 4GUDA 4I6JA 4RDCA 5F7JA 1X7HA 4EVSA 5KU7A 2LW7A 1PNQA 1ZJZA 2IK8A 5IZCA 3RKUA 1E3TA 2JC3A 4ZO8A 3IDAA 1T0JB 1Y7IA 3RU9A 3ZNOA 2P27A 1S4QA 4R3NA 3L8YA 3NUQA 3I09A 4MS1B 2CEAA 4WOJA 1E99A 1P9RA 5DXAA 5CIYA 1K6MA 2WUFA 2FN7A 1NNEA 4K8OA 2L0XA 5F3RA 1Y6ZA 1ZGAA 2QQ5A 1MB3A 3DW3X 2BFMA 1T1IA 1FLVA 1SM4A 2WR8A 3E7DA 1OJ7A 2EKPA 2RGNA 2X0RA 1B4DA 3DBLB 2YWJA 3A1CA 5L3QA 2R47A 4LI0A 5HTKA 1HZZC 2FKAA 1N2XA 2EJVA 1PJTA 1G8KA 4JUCA 4QTYA 3D0KA 2AJLI 4ZV4A 1MQSA 3UMSA 1GV1A 2QGZA 1DQZA 1GAWA 4OLFA 2RB5A 3JQBA 3AR4A 2J5BA 4RTOA 2BE7A 3IP5A 2CKDA 3DC2A 4HFRA 4DABA 3DKPA 3IDFA 1QKJA 2JGJA 5F5XA 4P84A 4E33A 4A1OA 3N2LA 2F8TA 2VPTA 2O6HA 2WWTA 2WV9A 3EK2A 3EBOA 3Q2OA 4FEEA 4ZAZA 2HK8A 3MQ2A 1S02A 2FDRA 2YIDA 5HS6A 3CY6A 5BW8A 1E32A 4WKPA 1FA9A 5REQA 4PPGA 3IALA 4IQFA 3KWFA 2C2MA 2RGYA 3ROTA 1SUBA 1TFUA 3EYWA 5C4MA 5CT8A 3K31A 2WTEA 3W7BA 2ATXA 4BKOA 4ZIRB 1G5PA 2IHYA 3JVDA 5ALKA 1IG3A 4WVLA 3VKUA 4F91B 2G04A 5KCMA 3A7EA 1N5IA 1YS6A 4Z51A 1V16A 5T41A 4C7OB 5GJBA 3DCNA 4D5GA 2P4SA 4H7IA 2SCUB 2XZTA 1SG9A 4IDCA 2FPMA 4MQEA 4Y6QA 1TF2A 1YOVA 1U4SA 2DWQA 3TTUA 3WGZA 3Q3VA 2KBEA 5DBGA 3U62A 1Y6RA 4QARA 1RBYA 4FCTA 1OVGA 1E6CA 3QKTA 4G0NA 1LRJA 1OV6A 3TZEA 1O95C 3VR5D 5C1IA 2GF0A 1K5GA 3ZCUA 3K70B 3T3OA 1O6ZA 4KBFA 3I6MA 2ZSEA 3OHPA 4Y6GB 3LUPA 1BJRE 1H4VB 1XDUA 3QG5A 5COBA 4F5EA 5LL6P 4YT4A 4KO1S 5AVOA 3WWEA 3DKKA 5I9NA 1PV4A 2B2XA 4J1TA 5DHQA 2NVUA 5IT4A 1BU8A 3CKMA 5K0FA 2HQRA 2AKEA 4JIMA 5ESXA 2I7TA 4P3NA 5C1BA 1RE0A 1PJSA 3WA7A 1UFOA 3U2QA 4KFCA 4X1YA 1DOAA 3R5FA 4HEA6 3C6KA 5TPZA 3T6KA 3GAFA 3HA2A 1SCKA 4LRQA 1EFRA 2AK3A 3PUVA 5F5NA 3ADBA 4DMKA 2QYSA 2P3OA 4S04A 3DMHA 3J80A 1JEYA 3G17A 4U9HS 3KR1A 3L9WA 2PH7A 4N54A 2NV0A 4N7RA 4Q6WA 1NQUA 4RXTA 3SOPA 3KWLA 1HDYA 1L7QA 1RT9A 2UZAA 1FJXA 1ZW6A 4I5GA 5GOTA 1IVSA 5LQDA 4BNZA 2ATEA 4P7BA 3REQA 1P62B 4DYVA 3RT9A 3DBRB 2BFOA 3EIEA 2ET6A 2CLFB 3JZFA 4WA7A 4MGEA 1U8YA 5E9AA 4B75A 5IWCA 5IVHA 4XUEA 1U6JA 1FFGA 2O23A 1IBKB 3ICQB 2VYVD 4Y18A 3O47A 5KSWB 4FMDF 1T6XA 1P3Y1 3AC0A 5TQ2A 3S70A 1M34E 2UVPB 4HH0A 5AM1A 5JEEA 5T4EA 1RTKA 1IHXA 2I87A 2DE0X 1BKSB 1V71A 4IV5A 4Y1GA 2TS1A 4AY4A 1QRAA 5B4UA 3BF8A 3LZCA 1NUQA 2DT8A 1VHJA 2PWZA 2QE7D 3H9QA 4QGFA 1ZA1A 4BLSA 1FDVA 1OFIA 2IU0A 3IODA 1RZUA 5CX1B 1T3LA 2HGZA 4AUKA 1NXXA 1J7KA 1Z45A 3SAJA 2WJPA 3GJ3A 3T5BA 4CGYA 1CF9A 3O21A 1OC2A 1KHTA 2R6GA 1J5EB 4JXKA 2P9BA 3CRVA 3DC7A 2O7QA 3U4GA 3HUEA 2JAXA 2DSNA 5D1HA 1H1LA 5ECGC 2IW3A 2OORA 2EZ9A 3CLUC 4J0KA 4KNVA 4MW5A 4QU8A 3ZDZB 4IDHA 2FV8A 3WOVA 3A37A 3QU7A 4Z2YA 2SKCA 4DSAA 4C78A 5K8CA 1ZJJA 3ZBQA 4K3UA 4EI7A 4L5JA 3I6ZA 1IM2A 1F5SA 2BJHA 1CVLA 3FPFA 3MWKA 5IUJC 4MAMA 3KALA 5H4GA 2ZE5A 2R1ZA 3SZRA 3VJLA 4CLDA 2Z4SA 4Y2PA 3D3EA 1KI8A 3HABA 2ZTHA 2AMFA 2VH2A 1VA4A 3JX9A 4P5EA 1VPDA 5AP9A 3BMCA 5CK4A 4CF4A 1ZN8A 4B3MB 5CP8A 4GKJB 4X5OA 1WXGA 4B74A 2UYOA 2PLFA 3EZFA 1VTKA 1OASA 1L4UA 2GK3A 1RDFA 1JWAB 1TA9A 2AXQA 2B34A 4U6QA 2ZATA 3DAFA 5DNEA 3RSFA 4AROA 1W36B 1U99A 2QZZA 3DZHA 4BO6A 2RDMA 1RQRA 1XRQA 2IHTA 5ADUS 2WSSD 2JFNA 1SC3A 3CCBA 3GOQA 5ELLA 4LIPD 1F8UA 1IBRA 3H2BA 4MUYA 2CF6A 2PUBA 1NN5A 1DAHA 2CNWD 2IXBA 4FQ7A 4QOEA 3URKA 5EMHA 1PG5A 3HU1A 1HT0A 2R11A 3MZ0A 4PTZA 1XXHE 2PGOA 1LVUA 5GZ3A 3O8NA 1OZAA 4H59A 2VPYA 4AUMA 4G84A 1W9MA 2HSGA 2LRHA 2NVWA 3ILYA 3KHKA 4XDYA 1GSOA 3REQB 4WUTA 5JCXA 2OD9A 2Y0PA 3IMCA 3QUBA 4MVJE 4B4DA 4EB8A 2W4IA 2I6TA 5A1JA 5BV0A 3AVYA 2OD7A 4H3KB 1FOEB 4KK4A 1QDEA 3VU9A 4H15A 1W8IA 4WOBA 1QFMA 1V3UA 4IF6A 3CQ9A 3QY9A 3ZOZA 1AMUA 1V5EA 1HYEA 4GGMX 2WWHA 4S35A 2JF0A 2JKZA 1GIAA 1BGXT 4FDTA 4DNPA 4S1VA 2QAGC 2R6FA 3DE0X 2QD4A 4KE8A 3SJBA 3TGLA 1L5OA 1XVUA 5K09A 1VLLA 4XVHA 4D46A 1KDRA 2CZGA 5E7MA 2WM3A 1ZFNA 3HHEA 4NONA 4RPHA 5HQJA 5I4BA 3P2IA 5BMVF 2PTHA 2QWXA 4K26A 2XIJA 1N2JA 1VMEA 2BEJA 3KYCA 1ORTA 2R7NA 1RRPA 3LX8A 4R1UA 1A9YA 2XGMA 2RI0A 4HDKA 2EWWA 2WVGA 3VHXB 1BH6A 1V3VA 1GLGA 3OWXA 4JJAA 3ZE7A 3U7FB 4YRDA 1YB6A 1VPLA 4GHWA 3U7GA 1U0TA 3NHWA 3ZLBA 2FU5C 3H9BA 5ITZB 1Z7BA 2DSTA 3V00A 1KGDA 1NW5A 4YRCA 1JZTA 1PL7A 5A62A 1DPFA 3QMWA 4FMPA 3EMVA 4EX6A 1L5KA 4L1KA 1AUOA 2X9NA 3PKIA 2ZB2A 1TTTA 1XMSA 1FSGA 1CQZA 2BT4A 4M0PA 1EQ2A 1CY6A 3PQCA 4BFSA 1FFDA 2Y05A 3AH8A 3ZCRA 3IEVA 3UHPA 2AFHA 1ZW1A 4F11A 1R6VA 5BVGA 1PYGA 2CKMA 4PLWA 5JO9A 4KPEC 2FMHA 3P26A 5E4FA 1OGIA 4FZJA 3L79A 4EO9A 4E2FA 5IJ0B 4RH3A 3X2EA 2RH5A 2WHPB 1HSZA 3QPVA 2PSDA 1FMCA 4L3VA 4LHZA 3BD9A 2VT2A 3VBCA 1VJ0A 4D0LB 5A1TA 2V6BA 4GMFA 4Q7MB 2BBOA 5FOUA 1VJCA 3STHA 1ULTA 2CJPA 2FMUA 5IW8A 1JNXX 1YVRA 4FMBB 2EBWA 1SZPA 1B14A 4I3HA 4IDGA 1ZD3A 3GLFA 2XKJE 2IH2A 1EP9A 1DB3A 1UODA 4QASA 3AKDA 1ZEMA 2AJBA 4ZOQI 3RREA 1C8KA 5LBIA 3N2EA 4BU0A 5BWLA 1LDEA 3A6GA 1DKLA 1PLKA 3GFOA 1EFRD 3MUOA 3QA9A 5JD6A 2ZXUA 4TVOA 3C14C 5BMVA 3D0RA 2BGGA 3F6BX 3IDSA 4L7VA 2PJRA 4OV6B 1X6VA 2HB6A 4DDTA 1VMIA 3IJEB 2ZIWB 1PS8A 2XTAA 1HFKA 5JY6A 5J23A 2OBMA 1W5SA 1ISGA 4QPCA 1E9EA 2OM2A 4EY3A 2W2XA 5BW4A 3SICE 2FWMX 4C43A 2GKGA 3O26A 1EVKA 2ZYWX 4F4FA 1I3CA 1T15A 2C2GA 2PWBA 1LWOA 2WNHA 4C3OB 3QNMA 3QNUA 1TU3A 3UJDA 4EECA 1WBDA 3CNNA 3MTEA 4O2LA 4ZT5A 4AMYA 4OGLA 4YT2A 3RQSA 3HWWA 3H2HA 4PSKA 5F78A 4DLKA 2C5FA 5F51A 3BIOA 2ZR8A 2XE8A 1JAHA 5ECWA 2N9UA 3EZ9A 3W1WA 1Z5VA 3AOEA 2BFCB 1UPFA 3R5HA 4Y3UA 3G3EA 1LDYA 2KQUA 4BATA 3QA3E 3Q8WA 3QKWA 3KQPA 4B48A 4K5QA 5HE8A 4YV2A 1AA6A 4YJ2A 4PIVA 2HIAA 3D1JA 4G36A 4R2XA 3ZDDA 3KQMA 5ER9A 1HFJA 3QW2A 4Y9SA 5DGXA 2J9ZB 1U2ZA 4QYIA 4HADA 4ITVA 1NOJA 3ZDYB 1WUIS 2IS6A 4UARA 4K9DA 3RS8A 2XR1A 2IXAA 1QE5A 3IELA 3REOA 4JUIA 2H31A 3X1JA 2AKYA 2DFPA 3QXCA 5JFTA 2GPNA 1GGEA 2GN6A 1JHYA 3R9KA 3NEPX 4E31A 4X7RA 4TKUB 1OF1A 1TGYA 2XVYA 3LVQE 2GILA 4QDXA 1QANA 1Z8NA 4PF1A 2YJGA 1F9AA 3UUWA 3M70A 4DEYA 5JH7B 1D7OA 1K9SA 1ZVQA 3HKBB 4PZLA 1XEWX 3L82B 2C94A 3EGEA 4KXQA 4UQOA 3T3EA 5KJFA 2GZDA 4JMPA 2FW1A 3AF4A 2L82A 3C3BA 2F8SA 1FLAA 1BN6A 2G0NA 2W70A 1M1YB 2P4EA 1W0KA 2FQWA 4F04A 5J2UF 3BGOS 3HLKA 4G41A 1KVUA 1YDFA 3F4BA 3VDNB 1ORVA 4E12A 4RD3A 4LXTA 821PA 2XW6A 1MOQA 1XN4A 1AKTA 1XU7A 3DFMA 3IMGA 5DN6D 3LA8A 3K0BA 4IFBA 3SEQA 4J8PA 1O08A 4DV5B 1YQXA 3KXLA 2CNWA 1U7HA 4GU5A 1QV7A 1KDPA 1OHHA 2D06A 3DVAA 3SVLA 1DXHA 1GNTA 3WIBA 3CJRA 3FFWA 4EFMA 1HZZA 2ZTUA 3QUQA 4H1UA 1B8PA 2QJOA 3UTCA 3R3YA 3L1HA 3WLFA 1GPWB 4XVQA 4FFWA 4PLGA 1KO8A 1ZRSA 4MJ3A 3B1FA 2IU3A 5I5GA 2X42A 4AP6A 2D2IA 4QQKA 2HFJA 5JSZA 3RGGA 1T5LA 1BWQA 4Y2HA 4AS1A 2WWWA 1L5YA 4MNTA 5KKAA 2Z95A 1BVUA 3R7BA 5IUKC 4F5ZA 4E46A 1GZDA 3ZIAD 2X8JA 3TCXB 3WXMA 4DM3A 4ZYVA 2YX1A 4ETNA 2HIGA 3KTFA 4HB2A 3UAVA 5JBIA 4UUAA 1KJ8A 1U1IA 3CA8A 2HA2A 4CM9D 1WZ2A 3E6AA 2QTNA 2BEWA 1XNGA 3F6YA 4DCJA 2RJNA 3HCBA 1L8XA 5FPSA 3NQ41 5LYJB 1JSZA 4S0XA 4W1QA 4LOAA 5FYQA 1EWKA 2ZUTA 4E70A 5BR4A 1OI7A 3AUYA 4CPDA 4OGGA 1EX1A 1TUEA 3AGQA 5JDIA 3CRMA 5LBUA 4D4GA 4BMYA 1PGPA 2C59A 4HQ6A 2PXAA 3FPGA 4H31A 4AJKA 1OXTA 5AO9A 4BAZA 3PNSA 5KMGA 2P6MA 1U5BB 5E1DA 4MIYA 3HR4A 2OM6A 1C7RA 1JAXA 1W581 3BHMA 3R6LA 4GUAA 1ACMA 4MRPA 3K2IA 4AG6A 3A05A 5FAKA 4OLAA 1QHSA 3V8EA 1U3WA 4DZTA 1WKVA 2QN8A 1E3WB 4AM8A 5BR8B 4RL6A 3SS7X 4TWRA 5JTUA 3F3MA 1QDLB 5I7WA 1PWZA 2QTRA 2IP4A 2ACVA 1VIDA 3ITNA 3JD4A 3TQIA 3VZCA 1A04A 2DPMA 3ESYA 1K4MA 1XMJA 4KUEA 2QAIA 2J87A 3PHGA 2EBHX 3CLUD 3CNEA 5KQRA 1ZG3A 1HT1E 2PT5A 3CISA 3IP3A 3LCUA 4G5SA 3TOVA 7REQA 4Y2XA 1VSTA 1EXNA 2ZRLA 1K7CA 2IGTA 2RBEA 3CNOA 3HGQA 2J32A 4B9AA 1U5BA 1T2VA 1D2NA 2BGUA 4G4GA 4KPUA 1C30B 3G9ZA 5G4LA 2O3RA 2VDRB 5LOVF 2ZXEA 3INGA 4Z9FA 3VR6H 5ELXA 1JAZA 4ZDIA 1P2FA 3KJHA 5IX8A 1VL2A 4QJBA 4G2TA 4ND8B 4Z5XA 1T8UA 5AUQA 4MUBA 1R0SA 4ZPXA 3A7DA 3GGSA 3ZG6A 2QNIA 2QXUA 2GUWA 4I50A 3TRJA 5LZ4A 5J2TF 4J07A 3KKOA 4EFDA 3I9V6 4K7JA 1E62A 3BEOA 2X0EA 2A30A 1CUXA 4ZVKA 2X3YA 4HQRA 1U8TA 1C3OB 2A0UA 2HV9A 2BDUA 1C3XA 4MB2A 3Q9NA 4MAFA 5DIFA 3ZI0A 1OXBB 1GTVA 3F49S 4AXBA 1XNHA 1TYDE 1X0XA 3D2BA 5JY1A 3AFGA 2TMDA 3KHTA 4D82A 4K2AA 1OT5A 1EVEA 4G8DA 3QYFA 2PGAA 4JU8A 1JUDA 1NWHA 4R2KA 2Z98A 4MOWA 4V0NA 1CE8A 5ECDA 5ICGA 1BW9B 1TGVA 4MW1A 4OK6A 4P82A 4ZANA 4ZGGA 1KORA 3RASA 2C8VA 3IEMA 3QP9A 5MDHA 5HOEA 1GRRA 5KSPA 3CYFA 3BZUA 4KDCA 1TQ4A 4CDNA 1T9DA 3HR8A 2ATVA 2NTJA 3H97A 4WECA 3ZD8A 4HDCA 5IVDA 2N3ZA 1EAYA 2AN1A 5JXIA 1M34A 1PBTA 2Y1CA 3R3WA 4ZHQB 1VLZA 2OBBA 1XELA 2XMDA 3QHAA 4OY3A 2YC4C 3ADKA 3NHRA 4M9XA 4RKEA 4L74A 4AWXA 3PVCA 1QDUA 3UMCA 2NTNA 4O2AB 3TD2A 1FF9A 1LC3A 4C06A 1M2EA 2Q6IA 4KH1A 4RCZA 5KTYA 5TPWB 2DUUA 1P7PA 1XLWA 4QBFA 1FLNA 3VUFA 4W99A 4QODA 3RIYA 2PANA 3SHFA 1K3UB 1JFLA 4U7TB 4WK0B 3FMFA 5EIOA 1QH1A 2YFKA 3GWZA 3T12A 2UYQA 3TFOA 2WJHA 2O5VA 3IQZA 1UH5A 1GU1A 3AESB 4YQZA 2VR1A 2GA9A 3IA7A 4NF2A 4HNVA 4XYMA 2PAFA 4F9FA 3BJIC 2J08A 4EEXA 5A3QA 1NVUQ 3I04M 3ND9A 4JL8A 4L0QA 1RIIA 3HUTA 4QZVA 5KYWB 4BJ3A 2FYTA 5LQSA 4L4UA 1FEZA 4RFLA 1SC9A 1HYBA 3FHJA 1DAGA 3L01A 4RQAA 3C6ZA 4J0DA 3PNBA 5TGTA 5K4GA 4HK4A 2C9ZA 2RHCA 4DPLA 5KNCA 3T7CA 1W7AA 2VDMB 4GFDA 1KFBB 3FOAA 3LQ2A 4IR7A 4NQZA 1P4RA 5E1OA 1XZCA 4KQ9A 3FHCB 1U28C 1EHYA 3EEYA 2OAEA 4MPJA 4G8CA 2O8VA 5A9RA 4BNDB 2C97A 2Y1XA 4H3VA 5FQOA 4Q1CA 1OOEA 3KJNA 1WDKA 5IVPA 3F74A 4RHCA 3UH1A 1CZRA 2GX6A 4YMHA 2GRUA 1AA9A 4MS4A 2IUFA 4EHNA 2AG8A 2AS0A 2ZDQA 4FYXA 4UUMA 4X1YB 1ZD8A 1FPQA 1GT91 1T8WA 3ZLTA 1KJZA 1A2BA 2AOVA 4JFRA 4OCZA 1AS3A 4YJGB 3T3NA 1CC1S 4JB3A 4QNRA 3MS7A 4K6CA 4K3VA 3SJCA 2W0SA 4IHQA 1ZY2A 5A5GA 2QR5A 2DG2A 4POAA 3AEUA 3PDUA 3B9RA 3W4KA 3HXQA 2HDNB 4L72A 2Y1DA 2Z8YA 1VL5A 3BXFA 3JD0A 5AVTA 1UKYA 3CG0A 4DJAA 3ZY3A 3GDFA 4HGQA 2I7CA 5JS7A 4Z4CA 2QVCA 1NSYA 4NBSA 4BNKA 2VQDA 2G1AA 5TPWA 4RU1A 1A9RA 4WESA 2XYVA 4YMIA 4FHCA 1BE1A 3GVPA 4LBVA 3H1PA 3LX6A 2Z5LA 3JTMA 4RQUA 3W2FA 4BJ1A 2ECQA 5KWVA 1N77A 4M0DA 4ZRNA 3OZTA 4YONB 2TMYA 4IRMA 1L4GA 1Y3BE 4HNAA 4HB0A 4XYGA 1RKVA 4BTLA 4BOYA 1V7ZA 2A59A 2FWJA 2GESA 3NHMA 3SVZA 2O4CA 4Y2VA 3CG4A 3OZWA 4HEHA 3VJMA 1NV8A 1VMKA 1U3UA 1XK6A 2WHRA 2WKSA 1E1QD 1T4DA 4C7KA 3U31A 4ZEOA 2B21A 3LBAA 2Q6KA 3E0QA 1VJRA 2FY8A 3AJ9A 1YBAA 1JDTA 4L5AA 4Q0MA 1ENPA 4A8JC 1OPXA 3V6MA 2ODEA 3E05A 4BX2A 1ID8A 1AF4A 3JYNA 3W5UA 1CUAA 1T1GA 1XEAA 1SVMA 1B1CA 3WRXC 2FK8A 3VZDA 1E1DA 2JZOA 3JWIA 4MPRA 2BFEA 1HKUA 2BP7B 4TTRA 2KLHA 5E6SA 4BFVA 4CM5A 2WWXA 1LF5A 2YYZA 1ZOSA 2ADOA 3DYIA 3B6IA 2C3MA 1JLKA 3AZOA 1F4PA 4KXVA 4DRXA 3N28A 4TSKA 3R8CA 3Q2KA 3VTKA 3WKAA 3AM1A 3WGMA 1GFSA 5KAPA 3C8DA 4YJKA 4HDMB 4U7GA 2WAXA 3ZE6A 1QGDA 2WTAA 2OCYC 3SYRA 1HNZB 4PTYA 1QQ7A 2WJJA 4AJNA 1R6TA 2W6ID 1QFXA 3DPSA 3P9QA 1YRHA 2X5NA 2CLLB 2ON6A 3ZNPA 3GELA 1C8LA 4G4JA 2XGGA 1P80A 1MFPA 3DULA 1DAEA 4MVCA 1NVWQ 1Z4NA 2OP0A 3I23A 3RTEA 4HQOA 4YV7A 3CX3A 1ZU5A 2AIRA 5JXHA 4K9LA 1AQYA 2IY7A 2HPZA 2XNCA 3HY3A 2O7NA 2AF3C 4KXLA 3OTOB 4FYYA 4DAOA 2Z4RA 2D3TA 3IVCA 1NBMD 1XMPA 4CEHB 5LN1A 3CVWA 4LJLA 1KP3A 3ONVA 1B93A 4D3DA 3G2NA 1QZTA 4Q4AB 3OHMA 2LWIA 1OYVA 1R6DA 3W8EA 1L5SA 5K3AA 4ZAYA 2CXXA 2FEAA 4CQNA 1Q7TA 3U1TA 3U7EB 1NI4B 4IY1A 3CUUA 2A0YA 2OXCA 3I5AA 5IBPA 3KG2A 5JUWA 1I7LA 1KH1A 1FB5A 1ELOA 3VDXA 1ZMBA 2KLBA 4XX0A 2A5FA 3C7DB 1KKLA 3R09A 4DJ5X 3ECSA 3P4UA 1RYZA 3DOUA 3DZFA 3K6SB 1FYEA 1KAQA 4C04A 4BP8A 1T9ZA 4MYTA 1CW2B 1V45E 3RBVA 4EYEA 3F7NA 4L6AA 5DULA 4UE6A 1JXQA 4TTJA 3W6UA 5AXCA 3L9XA 3VR3D 4EG5A 4KYIB 1TMGE 1MNAA 1YVEI 4ZAVA 4G1BA 4MQFB 4XFKA 4B3GA 2IYLD 1LK0A 3QOYA 4Q4JB 4ZEWA 3IYLW 4JCCA 4M8KA 3FN4A 4FZVA 1M9NA 7ABPA 1NPDA 2D1RA 1W19A 3ID6C 1XZPA 4PICA 2RE8A 2WIDA 1NKSA 5DX8A 2GBCA 3T3HA 4BGUA 2WJ3A 2A9KA 4XWTA 3CF2A 2Q5QA 1PBNA 3CRW1 1OR8A 1M1UA 1ZJ5A 3ZUGA 2AOXA 4S1WA 4HGOA 1BHSA 4FQ5A 1AKVA 1L5ZA 3CX8A 3DG9A 4GVPA 1AIPA 4R2WA 4YJ3F 4M1QA 4DNQA 2VF4X 5JI2E 4BLVA 4PS0A 1ACLA 1HYHA 2PGLA 2XJ4A 4CLHA 2WKQA 1XKTA 1AQIA 2B99A 2BM9A 1OFVA 5JLAA 3MRVA 5LQAA 2XBMA 1U3VA 5JCZA 4MV5A 2AVDA 1E2EA 3CXRA 1FBNA 4CQMD 3MWYW 2O2SA 5KHLB 1JHXA 2QM3A 5EXTA 3ORSA 1Z16A 2IP2A 3EXG1 4NENA 1YZTA 5TGZA 3D7LA 4YMUA 3V2HA 2XT0A 5FJIA 3QI2A 9LDTA 1CUUA 1JU3A 5EZSA 2B9EA 2GF2A 2IFTA 4IQGA 3URMA 4IVPA 3HPQA 2PBFA 3EJ6A 3IQWA 4HDKB 4NBNA 4UPEA 1P1KA 3QKUA 1XPOA 5EE3A 4HUQA 1QPZA 4HX9A 1MPTA 4OO3A 2VDLB 2NU7B 2CXNA 4ZQCB 1U3GA 3BD8A 3TAHA 3THWB 3I8SA 5CT4A 4ZVSA 1T24A 1NBME 1UWCA 1SD2A 1LBHA 1M1ZA 1YR7A 4PV7A 1R0RE 3T3PB 3UJCA 4EKYA 4WBNA 4L5BA 4Q4HB 2WG2A 3SDZA 3L93A 3UPUA 4K8RB 4R0NA 1BOOA 5EKXA 5AICA 4JOQA 1KVSA 3B1VA 4UBOA 5CFMA 1QR6A 3RANA 5CB0A 4LZZA 3LD9A 2FE4A 2YY7A 3CW2A 3CF6R 5JZMA 3DO6A 3OEED 1Z06A 3GY0A 3VR6A 1EIWA 1QTIA 2ZPTX 4PAGA 4G1VA 4GMHA 5JISA 4ARBA 3THXB 3RVOA 3LLCA 4LI3X 3IT1A 4ZCSA 1EM6A 4BV2A 3LCJA 5JDIC 3VTAA 4MVXA 1DFGA 4YRMA 5ALNA 2X9GA 3QSYA 3JSXA 4LY6A 5FPTA 3WDLA 3X1XA 3L1IA 1RFGE 1S4MA 5CJJA 5B30A 2C7GA 1V9SA 3O4GA 1KI4A 2M1XA 4MW0A 3DW1X 4GLBA 4IKOA 1E2PA 3NJRA 4QDZA 1YB7A 3N8NA 3EC1A 3CZQA 4KRGA 1ULAA 4M9RA 4UTXA 3TDMA 2NUPB 1QRSA 4DYHA 1NTOA 3WSVA 3NFRA 3UG7A 4A8TA 3K8OE 4Z4GA 2WBLC 2XAUA 1YF3A 3R3JA 4Q1FA 2AEFA 4O2BB 3KKLA 2Y1KA 1X94A 5AW5A 4PZCA 2OV2A 4K9SA 2V6FA 3GJRA 3KQWA 2ZROA 1RLUA 2FX2A 2SNIE 1MRSA 2HQOA 2YWCA 1RJ9A 1MB4A 1WXDA 3DDSA 3TW8A 3RG8A 3SXUB 2JJ2D 5LUBA 1T1JA 5LCXA 1JR6A 2VAXA 2O8FB 5DBIA 3HJUA 1GKKA 4LSWA 2N46A 2VS1A 3FKQA 1LNSA 4M8LA 3DZIA 1L4FA 2WJGA 4TT8A 3UV7A 5CFRA 1DAPA 1JKFA 1BHJA 1V7QA 2CFRA 2H4YA 3VC3A 4X6XA 2PT7A 3T1OA 3IUPA 4FHDA 3WIEA 5DEIA 1BVYF 4Z7QB 2HQ1A 3EVDA 2ZJFA 3AF5A 1T9HA 4TYPA 2D1YA 1MX3A 2B92A 1RI2A 1S3SA 5J40A 3FY4A 1M7HA 2Z30A 4WBNF 1YR3A 3JVUA 3R5XA 3UFXB 4UBNA 1GKIA 4HB4A 2QKYA 2JGIA 2NVBA 1AG9A 2QMOA 3OE5A 2HA4A 3QBEA 3CGGA 4GPTA 5FULA 1QJ4A 2BPOA 3ZW7A 3ZGVA 2P5TB 3S99A 4MW7A 1KPHA 2UXCB 1ZUWA 2MSCB 2I8LA 1IJKA 1COWD 3HLYA 3NIGB 1R4NA 4RPCA 3GLGB 2I4LA 3BTUA 1QGYA 5JALA 3A6DA 1IQPA 1LI5A 3CN7A 1GNVA 5B64A 4XR9A 1WTAA 2PX5A 3GMDA 4A2QA 2YHUA 2O59A 4L0CA 4OUDA 7YASA 2PXHA 2C00A 2VRNA 2HA5A 2QYHA 3K53A 2JLBA 3D0QA 1GAEO 2Z04A 3O8QB 1HETA 5FXMA 3TE6A 2PWYA 4EFNA 4KAJA 2C57A 4G56A 2WFLA 3TBHA 1MW8X 5E2IA 1A5ZA 5DU2A 5B6IA 4AF6A 3MBOA 5JYBA 1QO9A 2XQIA 3VR3A 3WK9A 1NRWA 1UJ6A 1XD2B 2B5VA 4O4IF 3ZD6A 3BMQA 1NU8A 1U3TA 4X1OA 4NV0A 3UY4A 5IJZA 2BAGA 2JBAA 1C1HA 3B89A 2NN3C 4BV9A 4DT1B 5J5AA 2V9CA 1G5FA 2IKSA 3EGVA 2J09A 5AUOB 1BS9A 1DJQA 5D01A 3I1JA 4ZMRA 2Q3CA 3Q8MA 2C98A 1X1SA 4H0FA 5ILGA 2R8OA 4OHZA 2JASA 4FM9A 2FJPA 2BR4A 2Z9BA 2BUCA 3F6CA 1T9CA 3WO1A 1Z25A 2VZ0A 2GCGA 2X19A 4GNRA 5BYAA 3ZJUA 5CNMA 1JEAA 4MWOA 5KC9A 5EHXA 5J4LA 5FDFA 3KS9A 3PK0A 3VKWA 4HVTA 4WCFB 3DO5A 2UXBB 4RHTA 4DLZA 4GOLD 1MHPA 4FJ1A 1ENOA 4NBVA 5JS1A 4QYIB 2AEJA 2O3SA 4WN9A 4EYKA 4EUNA 1XBTA 2PUVA 1T3HA 1AK2A 1CRQA 3Q15C 4ND4A 5BO5A 1IY2A 4BC1A 5DOZA 2W6CX 5HDQA 2BMEA 3JQGA 4U8GA 5CG1A 1H3EA 4LXIA 4G25A 3R74A 1I6WA 3AVPA 3B3JA 3QQ5A 4AY5A 4CM1A 4PO9A 3VPHA 1E64A 2QRJA 2JNWA 3DTYA 3A6ZA 3O2JA 3S68A 2SKEA 1C3VA 1L1RA 1RLMA 4LAFA 4R0MA 4P22A 2Y4NA 1IRIA 2GN2A 5HQ3B 5IEJA 3KAKA 1F2TA 1FSZA 2PH5A 2R6DA 2REQB 4II2A 5EP1A 2P2NA 3E9MA 1HDGO 1F1BA 1V8ZA 1IN8A 5JMPA 4CKWB 3ZHUA 4WL0A 1YRQA 3INTA 5A6SA 5AT1A 3EDQA 1ZNXA 2G83A 2VNSA 4ZT4A 1YUMA 2A1UB 3PQ3A 1IWPB 4NYJR 1AKNA 3L0IB 2WZQA 5EZ5A 5GONA 1FP7A 1NKTA 3CIFA 5H70A 3CJQA 3NWJA 2GN9A 4W5RA 1GADO 5C51B 3PNPA 3O75A 3OCXA 4P31A 1I7DA 2QBYB 4G24A 1P2TA 4MO9A 3LKDA 4YC7A 2VVTA 4QU9A 5F9FA 1N9KA 2VPWA 1HTBA 5EP3A 3BD7A 3AHHA 2OZPA 2PL3A 2CFOA 5CCBA 1VZ2A 1I9GA 4C4PA 4PGAA 4RC9A 1Q7RA 2OFFA 1EB8A 1V3TA 2AT1A 4FR0A 1C0IA 4TXHA 3L6DA 4DDKA 1PAUA 3D6JA 4RMNA 3U7QB 1VPWA 4PNZA 5A6SB 4POOA 2R7KA 4ZHQF 1WZUA 4E30A 4EQZA 2IQ5A 3K0FB 3ZWYA 1ORIA 1SJ9A 1WB5A 1NP6A 4ARUA 2I4RA 4L50A 2EQAA 2XSZA 2ZJBA 1DXQA 2H48A 2Z43A 1XJCA 2BM0A 3L7DA 5JE8A 5BNFA 3SKXA 2XRZA 3ERCA 2PQMA 1V25A 2QL6A 5B7NA 1P1RA 4YJ3B 2R9VA 2DJ5A 1AZWA 1QC5A 1FVHA 2OHVA 3KAQA 5JV5A 2XWBF 1M6HA 2UVPA 5FJJA 1U9YA 3QEJA 2XE4A 2QUKA 3R20A 3T9DA 2BMVA 4U5QA 4Y6RA 1MLDA 4M0CA 1E4VA 2FR8C 4RSGA 4CU5A 2O57A 4QG7A 1XXLA 1OBFO 2G40A 2G6BA 3QM1A 4KREA 2G5GX 2EQ5A 1SUIA 2ZSBA 1MENA 1OWPA 1J33A 1Z34A 1DKOA 4WNAA 4DWWA 4M1MA 5GJWC 2JRCA 1KI3A 1NX6A 3AV3A 4JJ8A 3S8YA 2DPGA 2DQYA 2FWNA 4P8RA 5DSZA 4NFHA 2PYDA 2O2YA 4R2MA 5A5DA 3OT1B 5ALIA 1L4HA 3Q3CA 1JU4A 5LA6A 3UV6A 2W6JD 3IDOA 1R5BA 3QSGA 4HG2A 4EH1A 4ND5A 3VDMA 2OCDA 3O9MA 2J30A 3KB8A 4Y2YA 2I1WA 1Z0AA 3N2IA 4L9AA 3PXUA 1A9XB 2AFRA 2QMHA 2GDZA 2DT5A 2V7VA 1I7QB 1P31A 1HL3A 3UK2A 2ZU6A 4M1YA 2J5KA 2PA0A 3ONEA 3AKCA 4BDTA 4FHFA 3AZQA 3OX2A 5SYAA 1EPUA 1RPNA 1SB8A 2ZT6A 4U0KA 4EHJA 3GVXA 5F76A 3PT9A 2OL4A 2PLNA 4HEJA 1IBLB 4WK6A 5EXPA 3W8RA 2VPIA 5DLPA 2G8LA 1LBQA 1CUVA 4RMHA 3I6QA 1DCKA 2YIVX 2DBYA 1RXWA 3FF4A 3MJTA 4A3SA 1Z15A 2LDXA 5EP4A 1Z6TA 1FUKA 3K2QA 4YFYA 4UZEA 4AY3A 2O7VA 4HFNA 4OYRA 4GQBA 4JT2A 4XD7D 3SSMA 3VNBA 2QT0A 1RWXA 5LWHA 1HE1C 2C7PA 3UJ8A 4OX9Y 2P41A 1XZIA 3O2SB 4ND3A 3GA5A 3IHKA 3ICCA 2HLDA 1BWPA 3N7AA 4O1MA 4G0ZA 2VJPA 1MC8A 4LFBB 4CTMA 1JDVA 2C1XA 2FPKA 5AVWA 4BNHA 5K2OA 3HJTA 4BNYA 2PRKA 2GWRA 1A1VA 3R3XA 4D3FA 4CIBA 3QYJA 1SUCA 1IM8A 2G17A 5CTJA 3A32A 4EGFA 5BYKA 4LHWA 2EW8A 5CBPA 2J9FB 4JYCA 1LPAB 4MWGA 5TMEA 3P0HA 4FFBA 5C3UA 4RXUA 3H17A 1N92A 3DXFA 3EZ2A 2CHUA 4NDNE 2IYPA 5BSUA 1TC1A 4I8XA 1B8VA 3MK31 3ROGA 4BMNA 3SLRA 5D5QA 4J2HA 5ENVA 3T41A 5KIAA 4XGKA 1D2EA 4BFTA 1YCFA 2VYCA 3L8MA 4G4SP 4LPSA 4D2IA 3GUUA 3FYDA 3I2HA 4PONA 4RWEA 3IBTA 3GGCA 2IEYA 4ZZ3A 4BJHB 1KWGA 3OTWA 1B8UA 3DE1X 2DJIA 3AW8A 3JARB 4O0LA 5TJHA 4AO7A 3DB2A 4HMQA 2QRGA 5AM2A 2GZRA 4EG6A 1KU6A 4A6DA 1A69A 4PRKA 1BEZA 1KGSA 3O2NA 5MHTA 1PEAA 1RYFA 1E3LA 5FHRA 2VHYA 3F6PA 2EX4A 5EUBA 3O95A 4XDZA 1Y7PA 4EG1A 3H11B 2PKEA 3RS4A 1VL1A 3RV4A 4NESA 3NYQA 1G6KA 2PN1A 1AXGA 4YVFA 3W8DA 1BXGA 1UBLS 1L4BA 3ZXXA 3PHLA 5CGQB 2HA6A 4AYTA 3OFKA 1FTSA 2A4MA 2FMIA 2EFEB 4YIKA 1KK1A 1G7TA 1ZQ1A 2A67A 3BB4A 3EQ9A 4OLHA 4CMJA 3O8RA 3KPJA 4RAQA 1N8KA 1EGMB 1OLOA 3E70C 4RYDA 4M54A 3MSCA 1HLFA 4LHEA 5C37A 1JDPA 4NBUA 2WJYA 4MYCA 5A7FA 4RSRA 3MS4A 4IEIA 3D4IA 2XE7A 3LV8A 3LLUA 1QG4A 1C0KA 1IXKA 1WPQA 4UBJA 4XWOA 3T94A 1FFXA 2WWVD 4Z0NA 3HBLA 5TQJA 1G2OA 5CH3A 1CP3A 4CM7A 5DGDA 3TIXB 4BCDA 3Q9SA 2FPIB 2CT8A 1C7FA 3DHWC 2ACKA 4CLEA 5HXAA 3FKSA 3O4VA 1FXWA 5IMBA 1VSQA 1RKQA 1HYQA 5D7BA 3KOMA 2RKBA 3H5TA 3PUZA 4UJ3A 5HCNA 5ADWA 3M1AA 1RVDA 3COVA 4F9EA 2BYTA 4G8JA 1V1MB 1TVEA 4I4CA 4CU2A 5EEGA 4CN8A 2CHEA 2P65A 4IIHA 4OYYA 2VUIB 4ME6A 4KH0A 4LNHA 3WQHA 4P7GA 4BVAA 2RI6A 3PA8A 1AUXA 5ILQA 4FN5A 4ZJPA 1X77A 1G4HA 2D7JA 5LB2A 4FFBB 1BCRB 1IRXA 5BSEA 3ENKA 3W78A 3ZW8A 4UTNA 1BE8A 3Q7QA 1GCUA 3ET5A 1BVHA 5AM5A 4FEYA 4ZOAA 5HZGA 2B4QA 4NHEA 5AHOA 4U5XA 1IFXA 1YZHA 4CF5A 1YTUA 4KNYA 1RXEA 4UDXX 3U39A 4BHTA 1XPRA 2XDAA 1MC4A 2IZ6A 2XNDA 2CL5A 2PZEA 2XQFA 4C05A 1J99A 4M7RA 5JNVA 4B09A 4I7EA 4JZKA 3H04A 3I9FA 5B12A 4CNQA 2R85A 1FMFA 3KWMA 2W71A 4MX8A 3A9TA 2BEUA 3U9LA 3I0NA 1Y4UA 3JATB 4GPIB 3CM0A 3U9TA 1JHVA 4K9KA 4KPGA 5LQMA 2R84A 1SOAA 2HK9A 4OI0A 3JRNA 1TYAE 1FYFA 4ZQGA 1J2EA 2QN6A 2IEAA 4OH1A 2ECOA 2KE5A 1FIUA 3CH6A 3HKBA 1HY3A 4KC0A 3MC1A 1QV6A 4RLSA 3HYLA 4YUAA 4MS3B 3ZZ1A 1QFZA 5CB6A 2O8EA 1BA2A 1G17A 4I4LA 4KL8S 5GGXA 4KQXA 5DCUA 4ZCQA 2QW8A 3UGTA 4Z3KA 4XASA 3K0CC 1K6IA 4YAEA 3QU9A 3PX3A 4B6QA 5H3CA 1MG5A 3KTDA 3A36A 3K92A 3T0FA 2BC9A 3GBVA 1S7GA 3LGXA 5CAEB 5D7NA 2QUAA 3NBFA 1TD1A 2GXUA 4P3XA 5BYBA 4F1WA 3I2KA 2A0XA 4GI1A 1R9NA 4YPOA 2VK4A 5A3RA 1RXYA 3WB2A 4OMCA 3HZHA 4OA8A 4KGZA 4A8JB 4GPEA 4MYRA 4Y2QA 3PIIA 1K75A 4HWRA 1QKIA 3E9CA 4R01A 2J5XA 3NBXX 1PX0A 4EL0A 4FLFA 3PRYA 1IB0A 3FUVA 5C9ZA 3SR4A 1F9EA 2ODBA 4XEUA 4LDPA 5FOVA 3TL3A 5IT0A 2KSQA 4JX9A 2X8BA 2CBZA 1NVTA 1T25A 4FR2A 3HYSA 5A04A 1D2MA 4BIIA 1S8OA 3QUTA 1GKYA 2EERA 4ENSA 3N59A 2OO5A 5JAPA 4CM8A 3C3CA 2C77A 3ELDA 1V48A 3H1AA 2XCTB 4BNUA 3WIVA 5IULC 5KYTA 1DEOA 1I4WA 1DAOA 3O83A 5H59A 4LMPA 2WKRA 1FUIA 3WNBA 3G0HA 1U2GC 2JGRA 2W2OA 4KE6A 3CO5A 4KODA 4LYEA 1JA0A 3BIJA 4LBWA 1ADJA 2P11A 4OAPA 3SFZA 3GZNB 1VM6A 1ZUNA 4KBGA 3SM9A 5AHRA 3H2YA 4TSFA 3N8HA 2Q2VA 1SKQA 2QMYA 2RARA 4N0MA 1P6XA 4BEJA 4NPCA 3A04A 1VBKA 4F3RA 2FRDC 1G9TA 2OVFA 3PTAA 5FPYA 2UV8A 4MJ7A 1QTRA 1E0DA 2NUTB 4AX8A 3TNDA 4U7FA 3L05A 4OHFA 2CYAA 2FI1A 2H65A 4RDIA 1R3UA 1UKCA 3M9LA 5E6SB 4Q9LA 3ENWA 4G2NA 3RB8A 2D0IA 4QT0A 3IAM1 4KZKA 4RF3A 5ENDA 1W85B 1O6GA 4HNGA 3X2SA 4CIAA 4PX2A 5KX5B 3G7UA 2QVBA 2X5KO 4EW6A 4HYQA 3RYTC 4JC4A 1JFFB 1FYWA 3H9CA 2I71A 3EG9A 1E61A 1B0ZA 2NNLD 3H84A 3O8QA 1LV7A 2ZJ6A 1TPYA 4JHXA 1V4BA 2HTEA 3P0FA 1R2QA 4I36A 1PWHA 4MVJI 3T9AA 5CFPA 4R31A 4PRYA 1G60A 4EKDA 4F1KA 1UK7A 1LFAA 3FPLA 5LD2C 4IF4A 2VNJA 3G88A 5KEIA 1DO0A 1J0XO 2YMQA 2C3OA 2X40A 3GRRA 4XUGB 1Y1QA 4KE9A 2Q62A 2I62A 3BTSA 3CXUA 3EA0A 2OCPA 4HRYA 2FQXA 3NM4A 4MVJG 5IEBA 4P0QB 3EXEA 1S1CA 3Q5DA 1N8TA 4G0PA 4HOYA 3AI1A 1PZXA 1NN0A 1CIJA 1J00A 3NT2A 2C2WA 4IIJA 4JBIA 3I5UA 2IQIA 1G9XA 3IQDB 3VZPA 5C53B 2R96A 5FUVA 5AKLA 4C9BA 2H5LA 1VSUA 2Y1GA 3H5LA 1YZKA 4A36A 3WFJA 4B4UA 1NW6A 2HSDA 1RCTE 4QTXA 3Q8LA 2F48A 4FFVA 4Z1MD 4E5VA 2NYRA 1KXJA 3KAJA 4PZDA 1DC3A 4X66B 4BVKA 4RMIA 4DR3B 4CL2A 4MQ6A 2FA9A 1SB9A 3CH4B 4ZI3A 2D1FA 3GBSA 5ALHA 2PQ0A 1MH9A 3F5FA 1XRSB 1ZI8A 5H81A 2M6RA 2G25A 1BSVA 4RS3A 3JQBC 4IW3B 4MLPA 5ALRA 4Z99A 1VG0B 4R8RA 4R83A 4EFKA 4F2WA 1O7JA 3B13B 4R16A 1AB5A 3TNLA 3QVLA 3UC9A 2ODTX 3GT4A 4GMKA 3SD7A 3SJ7A 3ZJ5A 4EI9A 2P4QA 4YRPA 3DFUA 1ZVVA 2I6GA 3DVSX 1SKYB 4QUEA 2OV8A 4MK4A 3AB3A 3H9UA 5L3ZA 1QGOA 1VIYA 1W4BA 2BCEA 1I1QB 1JR2A 3AERA 3CUWA 1C8VB 3QE2A 5JDCC 1Z26A 1I36A 2ZJ2A 4G9GA 4JBNA 2VA9A 2VPXA 3HMQA 3T7IA 1PJRA 1R3DA 4CLXA 4UUQA 4XI9A 3NANA 2C4TA 2RHLA 3FB4A 4J9VA 3I72A 4GSLA 3R44A 4URUR 2HJWA 2ZM6B 5DB4A 3AJ8A 4K81B 2NUBA 3KKMA 5CCDA 4DA4A 2RGXA 3W77A 1N1EA 5DE3A 4PG7A 2O8DB 3AVUA 3BRQA 1GG5A 3MWEA 1QVRA 4JB8A 1TLLA 2NU9A 1FDRA 2F8LA 2O0KA 3EDRA 3HP7A 1VJ5A 2Q1SA 2QAGB 3MMSA 5DI9A 2IEGA 1J0AA 2CLIB 2P8JA 1XLTC 1G59A 4Z2AA 3CU5A 3IXQA 3EC2A 2CE2X 4QICA 4RVCA 5L53A 1K4KA 1YA4A 4NU6A 3UT5B 4EMUA 3A25A 3DCJA 2C31A 3LFUA 1HFEL 1FQOA 4HH1A 3JWHA 3ZH2A 1WCWA 4HWPA 5K6RA 5L3QB 3G9TA 4V03A 3ZCTA 2YHSA 3IO5A 1XEWY 2C4NA 2ENUA 2PV7A 3ROKA 1KRXA 4HZGA 4RVFA 1D1SA 1FQKA 2ZPAA 1UBCA 1KR2A 4MRVA 2VSQA 4RS4A 4AWBA 2VT7A 4C6SA 2GN0A 3HN7A 1Y9AA 2NGRA 2QENA 1CUYA 2G80A 3IQIX 3M8KA 4L5CA 4PBSA 4BEWA 1QZUA 2IXTA 1VBFA 4F6CA 4W9MC 4BO7A 1EUCB 4W5TA 1ADBA 1J49A 2Y71A 2H8GA 1Y1SA 2JLSA