3HFJA

Bacillus anthracis nicotinate mononucleotide adenylytransferase (nadd) in complex with inhibitor cid 3289443
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
189
structure length
189
Chain Sequence
MRKIGIIGGTFDPPHYGHLLIANEVYHALNLEEVWFLPNQIPPHKQGRNITSVESRLQMLELATEAEEHFSICLEELSRKGPSYTYDTMLQLTKKYPDVQFHFIIGGDMVEYLPKWYNIEALLDLVTFVGVARPGYKLRTPYPITTVEIPEFAVSSSLLRERYKEKKTCKYLLPEKVQVYIERNGLYES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nicotinate (Nicotinamide) nucleotide adenylyltransferase
publication title Targeting NAD biosynthesis in bacterial pathogens: Structure-based development of inhibitors of nicotinate mononucleotide adenylyltransferase NadD.
pubmed doi rcsb
source organism Bacillus anthracis
total genus 52
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3hfjA00
1ZUNA 1EE1A 1KKUA 2QJOA 3F3MA 3H97A 4G5YA 3P0IA 3KT6A 4X0EA 4ZCRA 1H1TA 2J08A 1QRUA 1H3NA 1M8JA 3CLTC 2CFOA 4OJMX 2QTMA 4MW1A 2D13A 1R6TA 3FOCA 3IVGA 5LFAA 5FO0A 1OWLA 3ZIUA 1GTRA 2QUHA 4EG3A 2A88A 2PFSA 1TYCA 1N2IA 4EGAA 1JHDA 4TS1A 4ZT2A 5EKDA 2GM3A 4MWEA 1J1ZA 3RBAA 3GMIA 5DK4A 3ELBA 2AZXA 2PZ8A 1BS2A 1IQRA 3MLAA 2X3FA 4KKVA 4Q16A 4MUHA 3DO8A 2J07A 1VLHA 1M8KA 2CUZA 1O0BA 3MLBA 4G5FA 1A8HA 1QU3A 3UC5A 3FDXA 3UOWA 4OUDB 3RK0A 1NSYA 4WSOA 3PNVA 2ZUEA 1GZUA 1N2OA 3SDBA 1OBHA 1U7DA 1QRTA 3UK2A 2HMAA 2XRYA 3UY4A 4DJAA 1N2BA 4HPWA 5AHWA 1VBNA 3SZGA 4MW5A 4H3SA 4ND6A 3ZJUA 3FY4A 1JEDA 1KH3A 1EUQA 2X0KA 2RE8A 1N2HA 4MVYA 1H3FA 2Z08A 3N8HA 3TQOA 1TYDE 3ZJVA 2XRZA 1N1DA 1Q15A 1YUMA 1M8GA 1O6BA 3AFHA 1V8FA 4NX2A 1TQ8A 1O97D 3IH5A 3G5AA 5K0SA 1ILEA 1J70A 1WJGA 1X8XA 2GKSA 3M5WA 4EG4A 2A84A 3NV7A 1NYLA 1G8HA 2DXIA 4QBTA 1O96A 4AQ7A 3D6VA 3IMCA 1T9GS 1EXDA 2EJCA 3ISJA 1I6KA 4JXZA 1J20A 1J09A 3X1KA 4GRIA 2DUMA 3MUEA 4NDAA 2H29A 2TS1A 3CA8A 1QTQA 2YWCA 3G59A 1JZQA 1KP2A 1MOPA 5J5AA 3KT0A 4YMIA 4AS1A 3TQIA 4CT0A 3RK1A 4EG5A 2Z3VA 4JXXA 4MAFA 3IOEA 4MWDA 4MW9A 3HV0A 2PZAA 3COVA 3QE4A 3S3TA 3AL0C 1WKBA 4PY2A 4MQ6A 1QRSA 2A86A 3RFFA 2QUKA 1MC1A 2DR2A 1GAXA 4KR9A 3NBKA 2OV4A 1T6XA 2PZBA 1YULA 3FH0A 3ND5A 1KP3A 3Q12A 5LLTA 1YIDA 5KWVA 4MVCA 4GU5A 4MUGA 1OWOA 1U0BB 4CDNA 4K0RA 3AG5A 5HUJA 2PG3A 1N77A 1PFYA 1N2JA 2G36A 2R5WA 4OUDA 2JAXA 1X6VA 1QNFA 1Y42X 3COZA 1O97C 1YUNA 4R0NA 1LI5A 1NI5A 1J1UA 1D2RA 1OBCA 3CVYA 2IJGX 1KAMA 2WQ6A 1VBKA 2A1TR 3L92A 1WXEA 2E89A 4HJXA 4R2LA 3CLUD 3IMGA 1Q11A 2DLCX 1JEEA 1O0CA 3IUEA 2AG6A 1MB9A 4BWVA 1FYDA 1EFPB 5TS2A 3JXEA 4J75A 2B7LA 1JIKA 2QJTA 3OTWA 1WZ2A 3A04A 1MAWA 5HUHA 1RQGA 3VRHA 2NZ2A 4ZT3A 2PIDA 3CR8A 3MMXA 1F7UA 1KQOA 1KQNA 1WXHA 5J59A 4ZCPA 3BL5A 4MULA 3ND6A 2CYCA 3SEQA 3SP1A 1EFVB 2OQ2A 4ZCTA 3ZGZA 2J09A 1NUPA 4MUFA 4MUKA 4JZYA 4DDKA 4J76A 3INNA 3KFLA 1U3DA 1JIJA 4L2IB 2E0IA 2CV0A 3HFJA 4U63A 2J4DA 4EF6A 3P52A 4S1OA 4EG8A 3RJZA 4RPIA 1S4MA 4ZCSA 4MVXA 4ZT6A 3AG6A 5JBNA 3COWA 1B6TA 2IP1A 3N2YA 3A05A 3CLRC 3TNJA 1O94D 4HJRA 1NUQA 3G6KA 4QREA 2NSYA 4PBRA 3A2KA 1OD6A 2YWBA 1WXFA 2WB2A 3KT8A 4NAUA 1K92A 1NUTA 2YXNA 3N9IA 3A4IA 4XFJA 2A4MA 1KH1A 3CVVA 3QTBA 1EUYA 1WOYA 4WNYA 1TEZA 4MVWA 1O5TA 3HGMA 3HZRA 1FFYA 1F7VA 1OWMA 1PG0A 1PFUA 1F9AA 3N05A 2VTBB 3ZUGA 3CVWA 1ZH6A 2YY5A 1M8PA 3CLTD 3CLUC 4XFDA 3U1VA 4MUNA 3DLAA 3H9BA 1O95D 1MAUA 4PBSA 1MBZA 3IVXA 1ZH0A 5H7XA 1R6XA 3VU8A 4FZJA 4MWCA 1IFXA 2JANA 1GTSA 2WSIA 1T6ZA 2AKEA 1MB2A 2CYAA 2QUJA 3X1MA 3IUBA 2ZP1A 1WXGA 1NZJA 3GUZA 5DB4A 1YI8A 1JIIA 3P0HA 4YP5A 4MW2A 5HG0A 4MUEA 4UZFA 1EFPA 4YP7A 1V47A 4I6JA 1ULHA 4CDMA 1R6UA 1I6MA 1EJ2A 1JECA 1IH8A 2Z09A 1MRZA 3AIIA 1CT9A 5KHAA 2E18A 5TEVA 3LCJA 4NAHA 1QQTA 2IELA 5FNZA 1I6LA 1OWPA 2WQ7A 3QTTA 3ILVA 5DASA 1GLNA 3SZ3A 1G8FA 1KH2A 2VXOA 1N2GA 1EFVA 3GLVA 1O94C 1IRXA 3CLSD 1G59A 3D6UA 3IOBA 4E1AA 5J58A 1JGTA 4EG1A 1U7XA 2QJFA 3UMVA 1WY5A 4NZPA 2A1TS 1YIAA 3IODA 4L2IA 1F4LA 3PNYA 1NUUA 3PNBA 3X1JA 1KORA 4DNXA 1SURA 2QUIA 3MXTA 1NP7A 2CT8A 4JFAA 1N2EA 4F3RA 4EG7A 1N78A 1WQ4A 4NATA 3HMQA 1LI7A 4ZT4A 3IOCA 4A91A 3TS1A 1HYBA 1N3LA 3FI0A 1XNHA 1OWNA 3ZXIA 1O95C 4KPUA 1I2DA 1H3EA 1J21A 1VL2A 3HL4A 4PBTA 4MW6A 3FNRA 3Q4GA 3NBAA 2HZ7A 1PFWA 4MUJA 2CYBA 1XNGA 2CV2A 1U3CA 5BNZA 1COZA 1VBMA 1NUSA 3LOQA 1ZJWA 2VTBA 2O8VA 4HK4A 4DDMA 3FWKA 5H16A 2EL7A 3IDFA 5K0TA 3K32A 1TYAE 4ZT5A 3ZJTA 1K4MA 5DEOA 5LM3A 1PG2A 5F23A 1JMVA 1M83A 3FETA 4MUIA 3FG9A 2JA2A 4K03A 2BTEA 3L93A 1N75A 4KPUB 2DEUA 5KCMA 1WQ3A 1IQ0A 3VGJA 1QU2A 4MW7A 4EFKA 3CLSC 1DNPA 2C5SA 1UFVA 4DLPA 2D5BA 4I6GA 1XJQA 2X1MA 1GPMA 4DE5A 2PXHA 4ZCQA 4JYZA 2H2AA 4KR6A 2A1UA 4U8HA 1JZSA 4DDHA 4I6EA 3ND7A 5TEWA 4ARIA 3SEZA 2HGZA 2CV1A 4ND7A 2QTRA 5IJXA 1KQPA 4ARCA 1LW7A 4Q93A 4YBRA 2QTNA 2DETA 2D54A 1T6YA 4RUKA 3C8ZA 5TGTA 3H05A 4R2MA 2J5BA 1IVSA 2CSXA 1QJCA 3CVUA 5IHXA 2ZUFA 2DERA 4F4HA 3Q10A 1M8FA 2E21A 3P0JA 3OP1A 1T9GR 2I1LA 2V0CA 4P2BA 3I05A 3FHJA 4XSVA 2V0GA 1K4KA 4U7JA 3SYTA 1KAQA 3E27A 3LE8A 3KT3A 1M1ZA 2A1UB 1G8GA 4MLPA 4YP6A 3CVXA 3COYA 1Q19A 2GOYA 2O5RA 2RD2A 3PRHA 3FIUA 3IMEA 4MW0A 1IQUA 3PXUA 5FO1A 2X1LA 3TZLA 1PFVA 3H99A 3DV2A 1P7PA 2A7XA 3DPIA 1NURA 1WXIA 4G6ZA 1Q77A 3RHSA 3AKZA 1TYBE 1K97A 1O96B 2BYTA 4MWBA 1GN8A 4ZT7A 4QRDA 4UZEA 1XNJA 1JILA 4KR7A 2DPLA 1IHOA 3CLRD 3ZXSA 4MW4A 1TFUA 3H9CA 3K9WA 4EG6A 1KR2A 3IVCA 4CQNA 3TZEA 1MJHA
chains in the Genus database with same CATH superfamily
4WERA 1Y6GA 4OFBA 1YB4A 3SJCA 2VOJA 1D6JA 3CV3A 4J0JA 4WW0A 2P1RA 1QYCA 4ZCRA 2ID9A 4KYIB 5T4FA 1Z6TA 4MS3B 4A92A 2AF4C 2CFOA 4UNQA 2I9KA 3LLUA 3WAJA 3DE3X 1JLKA 1PWXA 5F2EA 2YOHA 1VYVA 2G7MC 4LC0A 2ZUTA 3TCKA 4DRZA 2QUHA 2QSUA 2VI5A 9GPBA 2B83A 3ECAA 4OHVA 4UCXA 2MYPA 2R7AA 2QU8A 3EIFA 1SVOA 5H02A 3D31A 4URXR 3R5HA 4EGAA 1T9BA 1KYTA 5ECDA 2JLVA 3KR2A 1QUFA 3PTZA 4UQLA 3KZCA 4MQBA 4WHMA 5JVDB 1RMYA 3CEPB 3BB1A 3RTEA 1P17A 1CEXA 3DQQA 4L1KA 3UENA 4ESEA 2NADA 2PUBA 3PRYA 2R5NA 4MUXA 2VPQA 2XOEA 4UUOA 5AVJA 4NSNA 4BNDB 2BSQA 2O0JA 4M9XA 2P4HX 4OX9Y 3I9LA 5ADVA 3DVAA 4LDZA 4HUQB 3U7FB 3RRYA 1FJHA 4M6WA 3WS7A 5AVWA 3I30X 3VGPA 2FX3A 4UU8A 2IU6A 3HB9A 4NXMB 2HIGA 1X3LA 1JEJA 1SC6A 3P2KA 4MWTA 4WMLA 4AO8A 1NSYA 2GMWA 3IV6A 1JLLA 3GMTA 5HJEA 1Z22A 1TM1E 3WHLA 5JZBA 2OM6A 1AKNA 4FFRA 1DRKA 1JDSA 4HZUB 5J2UB 3EVBA 4G2NA 3K1AB 1E0DA 1NBEA 3PUVA 3ZHVA 1AHIA 2PUHA 3BL8A 3C87A 3KELA 5GQSA 3ONEA 1T5IA 2W58A 1U04A 3QIAA 4PQEA 2ZDGA 5LOVF 5ALKA 2WWWA 4J6FA 1VSQA 1Y8QB 3IHTA 4Q9IA 1ISJA 4YA6A 4DC9A 3DR5A 3OX1A 1H93A 2NSDA 1O7JA 4XJSA 4QTUB 4X84A 1B6SA 2J0UB 3WGJA 2JBAB 3TQOA 4KC0A 3FROA 4PFJA 5A9RA 1L4HA 4JOSA 5DTMA 3MZ0A 3AVVA 3M6UA 4J3NA 1P7ZA 4GMHA 1FA9A 3PS9A 5F1YA 4BCCA 1XC7A 1CRLA 3G5AA 1FOEB 3HBAA 4QQRA 2J85A 3R7AA 3WVNA 2YDYA 4Z3DA 1JHXA 4HQRA 2GM5A 2MINB 3WYDA 5TQ2B 1GSOA 2ZRQA 4WINA 5BRJA 2D7DA 2AEFA 4TUYB 5BSMA 1UBLS 2FA9A 3KM0A 2H1HA 4FKZA 3IEKA 2CLMB 3OKPA 4QBTA 4QWMA 3T6KA 3L79A 3A6ZA 4KUGA 3VPXA 5HKKD 1TZCA 3LV8A 3O2SB 4GPBA 2FUG1 3EODA 2AL7A 5L3RA 2HMYB 4B45A 1EXDA 2ODTX 3T34A 4BIMA 1CS0A 1GG5A 2VQEB 3KSBC 4RFSA 3OI7A 4L0DA 5HW0A 2VHWA 3X1KA 1CJBA 1KXZA 2YWRA 3W2IA 5L3QA 1LXCA 4B3CA 3GELA 3JWJA 3OEYA 2VT6A 3NP7A 4JBXA 4Q9DA 4GL2A 1HQKA 1P80A 2H29A 3GEEA 5E2IA 3IIEA 1KE1A 1SRRA 3ZX4A 3M0EA 2YZ7A 4LQDA 1UODA 3U3XA 3EVZA 1LKZA 1JZQA 1ZRNA 4KYUA 2OQIA 3SIRA 5T8KA 1Z0AA 1EMDA 1NX6A 4Y1RB 4HTFA 5AOVA 1A4RA 2D0OB 2H2WA 5FBWB 1LTKA 4EYKA 5IJ9A 2H8GA 4A36A 3PQ5A 4JT9A 2JRCA 4JVNA 3T0GA 3DDCA 4AMBA 4OHFA 4O59O 3LMKA 5GJCA 1WKBA 3WL6A 3QG5A 4BMNA 3QRWA 3MQFA 1UBEA 3EZYA 2QUKA 3D5QA 1NXQA 4EJMA 1GRQA 1E0AA 5JCOC 2BV3A 3KAKA 3GLUA 5B55A 3Q12A 2EJUA 4FGZA 3MMPA 2WWTA 5FAKA 2WMOB 5IAKA 1XJ5A 1DRVA 1Z8DA 3OM9A 4JHXA 3KHUA 4B2YA 2XBMA 3I09A 3RUIA 1GGNA 1E2EA 2RCNA 3T0FA 4X6XA 3UMCA 3KLPX 1DX6A 4HI0E 2C7VA 4RTSA 1M66A 3OUTA 2LRHA 3W1WA 3H86A 2FDXA 4UAVA 2BFAA 3B52X 3AOEC 1VSUA 2PZLA 3ME5A 1BVHA 1G3IA 1KVTA 3ZWDA 2XT6A 1ZGZA 3QHPA 7MDHA 2YFHA 5D87A 4D0NA 2FFAA 2PLAA 4P3YA 4DR6B 3L7DA 3OF2A 3TXYA 1R4NB 2BGIA 1VKJA 1CE8B 2J7KA 2O9JA 4LMBA 3O84A 4PHCA 3C3XA 3UO8B 2O50A 5KTTA 1F60A 1E5VA 1UC9A 4WOJA 2C2KA 1FC0A 3AZQA 1ZQ1A 4EH1A 1U2RA 5JDIA 3VH4A 4FYKA 2DULA 2YJ5A 3DHEA 4UVDA 3QEMA 5IBRA 3WWEA 5DTRA 1ABBA 3B1VA 4HJXA 4AKGA 3OMWA 4HNHA 4LGMA 2DLCX 2PGIA 4XGIA 3DEHA 2QTBA 1ULAA 4TMZA 2QGZA 2B1IA 1M1YB 2Y0PA 1UJCA 5EQFA 5E6SB 2WJ4A 1UMBA 5AK3A 3QVWA 1L4FA 3TRHA 2UYOA 2P67A 3H8JA 3ZGXA 5FH9A 1VCHA 2VFAA 1JIKA 3QPUA 5L4LA 2GBGA 3TM4A 1QB7A 1GWNA 1ZCJA 1ZK3A 3KJNA 5B5SA 2JZOA 1ACMA 4WN3A 2EX0A 1R2QA 4E33A 4YR9A 2PDAA 3BK2A 5CX1B 3AP1A 3I61A 2JGDA 1NVBA 1QHNA 4L7QA 3CN7A 5IH3A 1A7UA 3K0CC 2JHFA 4ITUA 3E2PA 2WICA 5DSTA 4TX1A 5A9SB 3IAXA 1YIOA 2ZR7A 3DE2X 3MD0A 1NFFA 1NRWA 1ZGBA 4J76A 4L9RA 2IKQA 3CF2A 4JSYA 3FGZA 3MTDA 4LYGA 4X95A 4YT5A 4GQAA 5JDCC 2I6GA 3HNRA 1YQXA 3M9XA 3IKJA 2IW1A 3HFJA 4UD2A 2IY8A 2YVQA 1U3FA 1E96A 3HVIA 3NEPX 4R8MA 3HKBB 3RJZA 3QEKA 3ROTA 3DNFA 2IX9A 1M33A 4WVFA 1SOAA 4F4UA 2G07A 5HFAA 1UOOA 2VPPA 3DVRX 4M8SA 3SE7A 2FJ0A 3SYKA 1KVSA 3TR5A 4V0MA 3V7NA 1BEEA 1JEOA 2RGXA 1NUQA 1W0KA 3AFIA 3EUAA 4RVCA 4WCDA 4XD7D 5LSAA 3NHBA 3H9EO 3E5RA 2E5WA 1A9XA 5TB5A 3M3PA 1NR5A 3WL4A 1WXFA 4BECA 3U17A 2LTAA 2XODA 3AINA 3RVSA 3UOGA 1PL0A 2FPMA 3B9RA 1UKCA 1H94A 1KAOA 2CVFA 2DCMA 3KWFA 2A4MA 2B4TO 3M1LA 5HFJA 5A5FA 1UADA 2GD0A 4FUQA 2PSHA 4KQ9A 3T5CA 3D8UA 3LPLA 5MFPA 1RZUA 2Y0DA 3L8HA 4MI3A 4QQNA 2FKAA 4G5OA 1SHTX 1FBNA 3FBTA 5D3MB 3U4QB 1JA0A 2I6SA 3HO6A 4IQ8A 3VO1A 3OIDA 1F9AA 3N6VA 4LRUA 2VTBB 2H06A 2OPBA 2RKOA 2VDLB 1WPXA 2YY5A 3CTMA 2D0DA 2HA6A 3LX8A 4B35A 4Y2XA 4CG2A 5KNDD 4KGXA 4F9TA 1PNTA 2K6GA 3DLAA 1PGPA 1T36A 4J9VA 1X3SA 3OQPA 2NUBA 1REQA 4YTEA 2SICE 3HDQA 5CLQA 3ELDA 1ZH0A 5LOVB 2RONA 1CW2B 1EHCA 1EWTA 2ZRJA 1YJ5A 1L4MA 3ZQKA 2VEDA 2KB0A 2KM1A 1IFXA 1QONA 1Z5WA 1NOJA 1T6ZA 1ML4A 2Q2VA 4KWTA 1EK1A 1LBTA 3WDMA 1GTSA 4D56A 3I92A 3N07A 1E79A 1PTJC 1GP2A 1OFHA 5T41A 4E5KA 1YMQA 3S7ZA 4HFJA 3RHTA 2IYLD 1I2BA 2I3GA 4D6YA 4KXXA 1YI8A 3EIHA 3WMEA 5JZVA 2ZYAA 2P2NA 3DFZA 4KQWA 5HG0A 4UZFA 3SVTA 2PS3A 4E32A 1QORA 7AT1A 4MVJG 2WYVA 2G70A 1RKQA 1Z2OX 4B83A 1AXEA 4Q7QA 2EGHA 4YV2A 2DSNA 3HYRA 1M3SA 2I9PA 4XPIB 1UM9B 5EE9A 4EX6A 1CQZA 3PLNA 1JZTA 1B6RA 1G1MA 2I4NA 3EEQA 5JR3A 3DV9A 3LCJA 1EKXA 1U28A 2CD9A 2IYVA 1BWPA 5DM70 1B0PA 4A15A 4ND8A 1YB5A 3FWYA 1DO8A 1TJPB 4AECA 1VFPA 4WY8A 4F6RB 3F7OA 5LQSA 1N3BA 1QZUA 3T61A 2V7WA 2ATEA 3ZCXA 2EWMA 1QFZA 1ZD4A 2Q0XA 1QHSA 4C7KA 1YL5A 1OR8A 4RFVA 3CLSD 2CF6A 4W9NC 1DPFA 2ZUSA 3U4CA 3GEIA 1QLWA 2CNDA 3HVHA 3OP4A 4NH0A 3IL2A 2F00A 3GFGA 4II7A 5CFZA 1U31A 1KY5A 1P6XA 3HXLA 4ZU1X 1F4LA 1ICIA 1J22A 1S01A 2INGX 4GQIA 1GXSA 3SS8A 5LDDC 2J3MA 4I55A 2VYVD 4NCXA 3IR5A 4QEZA 1EE2A 3R5KA 4ASUD 4J3JA 5HJ5A 3BBLA 1WQ4A 3PA8A 3QF4A 4J8PA 4NFYA 3T7SA 2KWIA 1JU4A 3O82A 4BFVA 3AVXA 5B3JA 3ASUA 2PGAA 3ODGA 2QDKA 3D81A 3P9NA 4YAJA 3B3FA 5E8RA 3SQNA 5ALMA 3WGLA 1CCWA 4C7BA 3ON5A 5KU1A 3DOEA 4KBYA 1X19A 1GPAA 3LUHA 5JD3A 4UNPA 4RTNA 2FPLA 2Q6VA 4UBOA 1H3EA 1OXUA 5DMXA 4PAOA 1TYEB 3AU8A 4K8OA 3A3OA 1FQKA 4ARAA 2QP9X 3KYIB 5HZGA 4ITRC 4MUJA 2B1JA 1WP9A 3AEXA 1XNGA 3M9WA 4HLUA 1U7OA 2CV2A 3QUSA 1RXIA 4LPKA 4WZBA 3PFBA 4KBFA 3AFMA 1NMSA 3K4PA 3ORSA 1F5SA 4N0DA 2ZVQX 3RK4A 2GAIA 3FTFA 1YRLA 1QO9A 1X14A 2OHHA 4XI9A 3SQMA 4L73A 1ZI9A 3Q7RA 5JEDA 1XRLA 3IMKA 2I87A 3KL2A 4XUCA 2GQ0A 4F84A 3OT5A 4UTRA 5LQRA 1TAQA 1N4AA 2CL0X 2VF5X 3MHPA 1GKIA 2PX4A 1TYAE 4N5HX 1OLXA 2H3EA 3P9IA 4GUDA 1P1FA 3ETJA 4R1QA 1HOXA 3GXBA 3S2GA 1U3VA 2X23A 5KQMA 1ZMOA 3AUKA 1ND6A 2ERYA 4KLRA 1KYIA 2QTCA 1P45A 3FETA 4UATA 1JIQA 4BGDA 4UDYX 1JSLA 3GAMA 4MIOA 3E9QA 4XYEA 5DIZA 3AR9A 4IZIA 2RBKA 1HNZB 4F2DA 1W44A 3DDZX 4M88A 1Y4UA 4IMPA 4LY3A 4RSHA 4LJ6A 5AJHA 2P4SA 4TLLB 1GT91 4GT1A 4ZV7A 3RC8A 4IVRA 4XDHA 1K98A 1P9LA 5AJTA 2BJVA 2GEVA 4PSUA 4QFBA 2R1VA 5BV2P 4JP1A 1NI3A 3N7TA 2IUEA 1WSAA 3PEVA 3K31A 5FBLB 5L4NA 2H1SA 1R0SA 2ZDQA 3N0XA 1UXKA 2ZAYA 3PHIA 1NOKA 5EJ7A 5JMPA 3TNDA 4IOLA 3ABQB 4X7RA 5LD2B 2PH5A 3F7NA 3Q3GE 1PP4A 1S2OA 1XHEA 4UJ3A 4M6WB 4NDZA 4KPFC 1CD5A 4ER7A 5IUNC 1QG6A 3ZDFA 2D54A 1JQDA 3UTCA 1QMPA 2GEDA 1U0LA 2QW0X 3B2QA 4QPNA 4KOEC 4M0DA 3G8YA 2XQGA 5AOAA 4IUCS 1R88A 3CVUA 2B7CA 5K99A 2ZUFA 1JLLB 1JDTA 2C9CA 2PU7A 3DHNA 4R8LA 2H85A 2I1VB 3P94A 1MHPA 2C77A 2GBLC 2Z5GA 3ETHA 5I7OA 1M6WA 1DIHA 4JN6B 2Q1YA 4ZVVA 3ADPA 2IUUA 4F85A 4XYLA 4AJ4A 1H9AA 1R9GA 2GCNA 5CVTA 5FOQA 3ZLTA 2ZXFA 1DOAA 3I2FA 5E6UA 2WR8A 1KQFA 4PAWA 2X4GA 3LQKA 4ZRNA 3ANNA 3NHZA 2V8BA 3L7BA 3KT3A 2GARA 3FRJA 2O2GA 2QX8A 1NXWA 2BH9A 4UHDA 2PT5A 1HE2A 3R8XA 1I33A 1C8BA 2RHTA 3E1SA 3K09C 4TTPA 3AUTA 1O54A 1HEYA 1BXKA 2ZVJA 3MOGA 4PW0A 3RS0A 3TX6A 1QO7A 1A5SB 2IOFK 3BZUA 2R2GA 5A5EA 3TLZA 4PXSA 2H59A 3O3CA 3IEUA 4AG6A 1CY4A 1V8OA 1ZIDA 2YNMD 1JG6A 4KYTA 2PAAA 4MYHA 5AKKA 5H4GA 3FCOA 1ZI6A 3NOOA 3CM0A 4OHZA 2GZMA 1UP6A 1M2HA 1MNAA 2BYTA 3G79A 2X7JA 2H5LA 2QN7A 4QUEA 1VCMA 4ALIA 1R6BX 4B4KA 3I42A 4IIVA 4CCWA 1CS0B 1F5NA 3MWEA 3P26A 4RFSB 1MAVA 3R7DA 3SGLA 3THRA 3RS7A 4F9EA 4DJFC 3LCMA 4QTTB 4ALNA 1X7WB 4YALA 3E7XA 1AXGA 1EEHA 1TEVA 1ZEMA 1E8DA 3B6EA 4NAVA 4NMXB 4YMWA 5DLQC 3LHIA 2QJOA 1IY2A 3NNSA 4IJVA 2NXNA 1D09A 3FDFA 3SSOA 5JSUA 3BAZA 3KKLA 2FHSA 2H1WA 1EYZA 3OZFA 3X2SA 2OB1A 4H1HA 1YFJA 1F4VA 2QQEA 5ENVA 1RPNA 8GPBA 1X80B 5AKZA 2ZUVA 2JFGA 3V3TA 3I01A 3TCNA 1W59A 3AVOA 4MW1A 1OAOA 3B1ZA 1KYZA 3RUAA 3Q8WA 1Y89A 4IJWA 1CUUA 4HTFB 4I50F 2ZUDA 4UUBA 5EJMA 1N9ZA 1QMGA 2CNKA 2VJDA 2WFZA 3MRXA 4KXNA 4MITA 4N54A 4Z99A 4YYZA 4BC0A 1X1QA 4D9EA 5IJ9B 1GAQA 4JSTA 4I55F 1KI8A 3IEMA 5HZKA 2VP2A 1DQYA 2VWPA 4NYIQ 2OPHA 1EGHA 4TQUS 1T9CA 2DY1A 4F0JA 3C5EA 2OHXA 1WLSA 3DF9A 1I4EB 4BNFA 4CM9D 2E1PA 2ABWA 2IPMA 3K8OE 4JJAA 4NY1A 4QC2A 4OATA 4ZV4A 2O7RA 1HTBA 3BDIA 3BWDD 4IFTA 4KFUA 2AS0A 4GXNA 4WKBA 5JYCA 2C2HA 2AIRA 1A2KC 1P1RA 2Z2KA 3VJLA 4MB6A 4KK3A 5AHOA 2J59A 3IVMA 5H5JA 2W2OA 3TH5A 1EVLA 4F2HA 5LD2C 2Y1LA 4XYGA 2X6QA 1ATIA 4B3GA 1E6LA 1D3AA 1RMQA 4D74A 3TQCA 2GXSA 3D43A 3SX0A 1UP4A 5JY1A 4TTVA 4GOND 3NOQA 1FB5A 2WVHA 3HFSA 4I8IA 4JCCA 4PFSA 4RZSA 3B51X 5E4TA 3RVJA 4AMGA 4DNPA 2QMZA 3GFPA 3QEMB 2VT7A 3NASA 3FYSA 4KTTE 1E8MA 3Q5EA 2PTHA 3WSWA 3DWEX 4HB4A 2I2WA 5HWSA 3IJ5A 3P71T 5EY5B 3WRVA 2ZBPA 5JRDS 3UXEA 1AQLA 1UMBB 3EQ8A 1TYDE 4HDQB 1RBYA 4DA7A 5CFNA 2XWSA 4LSGA 3BXPA 2GNOA 5CDUA 3HDVA 2X0FA 1F38A 5DLYA 1PS0A 2ODNA 4JBWA 5DI9A 4Z7QB 5BPHA 4P3OA 5HCNA 2IV3A 1NIPA 3I4CA 4LNUA 3A26A 4WJLA 5B1EA 4OFXA 1AKEA 4RIIA 3HLYA 4EG4A 5I4BA 5JD6A 1YSCA 4YEDA 2JGDB 2VYNA 3NJRA 4NG4A 3ZXYA 4D4HA 1GGMA 1N0UA 1Q3TA 3NANA 3QKSA 2R86A 4JROA 3GW8A 4ER5A 3V5NA 1FK8A 3O1IC 4AJKA 5JROA 1EDZA 3HXTA 3IPXA 4UHBA 4XB1A 1HE1C 3KE9A 2HY7A 1F14A 2WM3A 3B3AA 1T1SA 4GW3A 3VTZA 5BP7A 5A7GA 4LF8B 3WGMA 3WWCA 3M8KA 3H1AA 3JD1A 1JJBA 5CEFA 5B1HA 1ZAYA 3LPAA 2H16A 4QQFA 1KMIY 3LZDA 2SKCA 1HDRA 4RTJA 1JNXX 1RXVA 2TS1A 1J23A 2PX0A 4Z9YA 1TM2A 1IN5A 1OIXA 2GK7A 3PC4A 5DULA 2R6HA 3LKZA 4Q4CA 1XZLA 4L07A 4E5VA 2AZ4A 2Q6LA 3WWYA 1VJ5A 1GCUA 3RSQA 4C7MA 1LLQA 2FR8A 1FNMA 4OSOA 3SDZA 1E6WA 3M6AA 3OPNA 2DBRA 1Z62A 4X97A 5K4AA 5CXSA 4MW9A 3NPAA 4L22A 1NVFA 1A9XB 1U9ZA 2FZ4A 3NRCA 2M2IA 3AL0C 2C83A 2RJOA 2PQ0A 2PXAA 4LNHA 5T8KC 1F06A 5LMCA 5T7BA 5FUYA 5ES4B 4KTVE 4RPKA 3MCZA 1Z4PX 3TNLA 2Q28A 3RVOA 3W8EA 3ABZA 2Q5OA 2J7PD 3RVQA 4KVFA 2DECA 1YZNA 1YZVA 1D1SA 3R6WA 1JSXA 4QODA 1TOAA 5I8PA 1IN1A 1E2HA 1BWSA 1NNSA 2HU7A 1HG1A 1XD2A 1MXFA 1DAMA 2UDPA 2VWQA 4Q1DA 1D03A 4KX5A 1UC4B 2P9BA 3T38A 1QGUA 4PZYA 1GZ3A 4PXYA 4QLBA 3GR6A 4TKVA 4FGJA 2CFCA 2C2OA 3EDMA 2F9FA 1T36B 3KZKA 4NEHB 1DIBA 1REQB 1YQ9A 1Z3IX 3H17A 1JQ3A 1XZJA 5EIAA 1TF7A 1YU9A 2VHYA 5TDHA 3ZHUA 4LF9B 1W4RA 1MV8A 2G0AA 3ET4A 3WL8A 3H5OA 1COWD 3PGMA 4IF4A 2CVPA 3T3IA 2GLTA 1BQEA 3L77A 4JLPA 2V7BA 2XCOA 4HH1A 1ODIA 1GKYA 3QV2A 3T3PB 1JG4A 2OLKA 1K8YB 2K7FA 2QYTA 1JE0A 2Q29A 5K4GA 1B74A 2FB9A 2PXXA 2WF6A 4M0LA 121PA 1IOZA 3C14C 3L8GA 4KLCA 1W6RA 4NOMA 2OQRA 4LJAA 1MB9A 1PSWA 3RB8A 3TR6A 4KQEA 2QKYA 5CNJA 4B4OA 3A36A 1P74A 3D0RA 4RK5A 3JW8A 3TGLA 4D3ZA 4PYMA 5A5VA 5AUOB 1MPXA 3TEMA 1DBIA 1P0QA 1UK8A 3KVRA 3MMXA 1ZM7A 4KEAA 2O2ZA 4ZT3A 1Q95A 2G1KA 4G09A 1KJIA 2X9NA 4ND8B 3NLLA 1K3UB 1XK7A 1OH6A 6GPBA 5ELMA 1GGEA 2OC9A 3SP1A 4HH0A 1DC3A 3AFOA 3PK0A 5IMBA 4E22A 4Z4GA 4NEGA 3Q85A 1FQWA 5FI0B 1U0OC 1YACA 3GCDA 2G71A 2LZ0A 4RM3A 3F6CA 4INJA 1DWQA 1HQYE 1XEAA 4PCVA 1DXHA 1GLGA 4WPGA 4C6RA 4DDKA 5IF3A 4F97A 3KFLA 2FXVA 3B89A 3IMFA 4IHJA 1E62A 4Q5IA 3VR3A 4RIFA 4OUKX 4TSRA 4RAOA 3EEOA 4YMSA 4Z8YA 3T4XA 2J4DA 4XOUA 5EEGA 3GEMA 3HXQA 3UMYA 1GXSB 5D8DA 2VPWA 5ALHA 3JQGA 4N41A 1DJLA 1BYUA 2R6DA 4I55B 2R8ZA 1SUCA 2OL4A 2WP0A 5EP1A 4XX1A 2QG4A 5AI5A 2IP1A 3UJBA 3RF6A 3QF4B 3U4GA 2DGDA 2GHQA 3OJXA 1LPPA 1KY3A 1L4BA 4GQBA 4KXYA 3SSMA 3TNJA 1XZPA 1D4AA 2GHIA 5BN5A 4B5KA 4BV3A 3PGXA 3QXGA 4J0CA 2WWFA 4M9RA 3FOEC 1WSWA 2JLQA 3B1WA 1Z45A 4IIFA 2WB2A 3BE8A 3L0YA 2ZUCA 1PO7A 1K5HA 3C2QA 1QIDA 2IYNA 4DYVA 4YRNA 3F4KA 4LOLA 4LV5B 4PWYA 3WLRA 1WNFA 1BFDA 4WZBB 4Q7KA 1ZP6A 5F5NA 3C7DB 2JRLA 5D7BA 2PRKA 4QVIA 4O4LF 4RMHA 4E0BA 1N8SA 1EVKA 3WBKA 3DKVA 2ROQA 3STVA 7GPBA 3EXFA 3GRPA 1OWMA 1V5IA 2OO3A 5K8VA 3OFVA 1OV4A 3AJDA 4CTJA 1US8A 4CLRB 4DJ5X 5CYGA 1HZJA 3SPXA 2RH4A 2ZI9A 1P5JA 4KMRA 1PU2A 1ZVJA 1BQ4A 2BP7A 3BQ9A 3R3HA 3EXAA 2C97A 4KSBA 1IMOA 4GLBA 1GNTA 4LDQA 2ODAA 2AT1A 3WBJA 1OLXB 2PH7A 1S3GA 1R8XA 1P8AA 1LUAA 3ZPXA 1RWKA 2C00A 1GL7A 3D1JA 4K86A 4Q6BA 4A10A 4HNSA 4JMLA 1AU9A 1RAAA 2RHHA 2X4LA 4V0RA 4H0FA 4BV2A 1NZJA 1G55A 3IQWA 1ISMA 1UBHS 4GOMD 5CIQA 1JHOA 4H7HA 3RI3A 3GMDA 5CB8A 3DHYA 4E09A 2Y1DA 4EVSA 1Z63A 1U6JA 2JS7A 2VJKA 1V48A 4R8SA 5B3AA 4EA9A 4FC6A 4DEVA 2BM9A 1L4NA 3RCBA 1OZGA 2CB0A 1CFJA 1LPNA 2J41A 2VP0A 3ZU5A 1PGOA 4KUHA 5B6PA 4LTNA 3G2NA 2QN9A 2GCIA 3LPDA 3NHKA 4XWTA 1YRAA 1MC4A 5AXCA 3VZQA 4C0LA 5GWXA 1UT5A 2AW3A 3L1IA 4O0MA 4WGFA 4CMCA 1QQTA 2IELA 1XTKA 2ZI4A 3PXAA 2X22A 4Q4JA 3W6OA 4PZEA 5FHRA 2GF2A 4EY3A 3L8CA 3QPCA 4JYPA 4YAKA 3DVLA 2NU9A 4Y30A 1GLNA 3RRMA 1TKBA 1QCYA 3G1TA 2B1QA 1HO3A 4HMQA 4RJ2A 4N9WA 3FTNA 5CYFA 3L06A 2Y4NA 1JG1A 1J00A 1U28C 2ASEA 3QHAA 4RL4A 3O8LA 4ZAYA 2FZEA 1AKWA 4DJDC 3EOAI 1F0KA 4BRUA 4ISBA 3SF0A 4GMFA 3NTXA 4UW9A 2JJ1D 1I0ZA 1DEOA 5KSZA 4QA9A 5CIYA 1ATZA 2PXCA 1Q21A 2BJWA 2UZ4A 5DNWA 2Q0SA 4TYMA 4WH0A 1IATA 4LDNA 2J6HA 3C43A 3ACDA 2PWYA 4IQGA 4MV1A 1LY1A 2JAPA 3T3EA 1NWHA 3AR2A 4U9IS 1MQ8B 1BIFA 1M6HA 2VHCA 3H0KA 2PH1A 3AUAA 2AN3A 5E6UB 2ON6A 4J16C 4XCXA 1H6CA 1Q0LA 4JA0A 1Z5UA 4IHQA 4YHBA 1TPZA 2WC1A 3QW2A 4G5GA 3JATA 2POCA 1PSZA 2OVBA 2AMJA 5B3JC 1RQPA 3L02A 3JVEA 3HXOA 3QFCA 4M1QA 4EMUA 5DHFA 1HK7A 2XMZA 4LHYA 1ZGHA 2JIBA 4Q03A 3HGTA 4L6IA 3SR3A 5ITVA 2EBWA 1U0HC 1C8KA 4BVFA 3V80A 1E9FA 1G6OA 3KEQA 1ZJWA 2VXBA 3KAJA 3LBFA 4YRDA 2Z04A 4Y6LA 5ECGC 1RWNA 1U5CA 2R1TA 1E58A 1T8WA 4G24A 3E3OA 1JB1A 3BH0A 1KMMA 4K8RB 4YJ2F 3W7BA 3NGMA 3C98A 4X6UA 1G8SA 3VVMA 4MUAA 1ZEJA 2G67A 3PE4A 3WR5A 4EA8A 3O47A 2DMRA 4QFMA 2BGLA 4LN1A 4ZALA 3DXXA 4KRFA 4GE0A 4NU0A 5DSZA 3TZKA 3U7RA 3DFKA 3P0EA 1J5EB 3AVYA 2X9QA 1OYWA 5DEOA 4Y0VA 3T12A 5EZSA 4TWJA 1XTUA 2FW7A 4DJJA 3I0ZA 2FCRA 3OT4A 2AC4A 1J6UA 3IAUA 4Q0MA 2DOKA 5FOTA 3PYLA 3SD7A 1VXRA 3EXIB 2V9PA 4X20B 3IAFA 2OXIA 3PUYA 1KOGA 1OYVA 1WLYA 4OSEA 1J8QA 1K5GA 1L8LA 2CXNA 4P2GA 3TWOA 2OV3A 3W3AD 3FPCA 3C5HA 1E98A 3PHJA 2TMKA 4GBED 3TTVA 1LJLA 1QU2A 2ET6A 4TZKA 2UXCB 5H8WA 1X8LA 2ACKA 4YJ3F 2BGRA 2W6PA 1A5ZA 1TNDA 2BGTA 2D5BA 2EGGA 1NXXA 1JQAA 2JFHA 3L18A 3BRQA 4LWPA 4YCBA 4D9GA 1W7AA 1CQWA 4E13A 2XCTB 2ZRNA 2NG1A 2A1UA 3BHJA 4BMCA 4PN7A 1KFEB 1MC5A 3FDZA 5ARCA 4GOJA 1J8YF 5IANA 3ZVMA 2QG6A 4I6EA 3B38A 2FF7A 1TMKA 5MN5A 5TX7A 4BCBA 1JAHA 2ZETA 2PH3A 2NUTB 4DR3B 5HKAA 3O94A 2R96A 3KV3O 3K6RA 1XGKA 3VTAA 2JFVA 1MIOA 4RENA 5ABPA 1W36C 4Y2JA 5IPFA 4FSXA 2REBA 1PJ8A 2I0FA 3JYOA 3OICA 2DU8A 2C78A 2WKRA 1RADA 2B3TA 5DTEA 5L40A 3ZIAA 3BGVA 4M89A 2J5BA 3LT1A 3OJLA 4EJ2A 4GM0A 1M5UA 2QTVA 1ISIA 1KJWA 4MS4A 1Q0RA 5HZMA 3NWBA 3RJ5A 2XCIA 3P0JA 1IPFA 1T9GR 3D4NA 1X9IA 1U9CA 3IAM6 3LD9A 4V0KA 2HNBA 4WZBE 4EW1A 5BQ3A 1YS6A 2P0AA 2V0GA 2ONZA 3IIJA 3I2YX 2JW5A 1P61B 2MT9A 5FA5A 5KU7A 2JDIA 4HR7A 1E3DA 1C9MA 2IY9A 5JAMA 3OJOA 4UJ5A 3WNCA 1L7XA 3FLMA 4PCUA 2ZSHA 3E9YA 1U5AA 4HVTA 4OQFA 1VJGA 5F2NA 1JBEA 4JXJA 1NJGA 2DFVA 2FZGA 3CKMA 1K7EB 1SC4A 3DMPA 3OM1A 4JGIA 3OD1A 4MO9A 4P3KA 5J63A 1TUBB 5HZHA 2OLJA 4BQIA 3TOCA 2GZ3A 1XTBA 4CTOA 4M83A 2JNWA 2JLSA 4QD3A 2GA9A 2OHIA 6LDHA 1JDJA 2AFHA 3MD9A 4PC3A 2HJ9A 4LNUB 2PZKA 5IDQA 1GQOA 3OSUA 4JHLA 1YS4A 2BM8A 4PC7A 2YW2A 4DMHA 3A4MA 1QHIA 2JI9A 2Y05A 3PUJA 2QE7A 5E3JA 1ZH2A 5C7YA 5E3IA 5FP0A 1GN8A 2PUJA 4MRMA 1RYYA 4K05A 2QVBA 3DGFC 5LKAA 1A04A 4IOMA 3K9WA 3CH5A 1IY8A 5DJ5A 1OFVA 1C7JA 1O5OA 1R16A 3A3NA 2B5VA 1TIPA 3OY7A 3KETA 1Q12A 2JVJA 3IKLA 2Z9DA 3ND8A 1P81A 2IIQA 3ZDZB 4D3SA 1JHPA 2ADOA 2AD1A 2LD4A 4WK2B 3U13A 1HWYA 3A0UA 2C03A 2GZ2A 1IN6A 1MJFA 3GUHA 2ZBFA 4DREA 4RS3A 3GPLA 3D2AA 3OJWA 1YT5A 1FLAA 1ZUD1 5K3CA 1YNOA 3RRJA 4TKZA 3GRRA 4BX9A 4KV7A 2ZZKA 4WV3A 2AW5A 4N49A 4CMHA 5K0ZA 1HOTA 1RR6A 4RD3A 3I58A 5EERA 1ZM4A 1ESEA 2BTOA 4AI6A 1Q83A 2DH6A 4RADA 4R71A 3WKEA 4V3CA 1OAOC 2W2LD 3ZJ4A 1J1ZA 5T5QA 1UMCA 1OX4A 2H11A 5FPQA 1VHJA 4M1ZA 5DK4A 1DLJA 1WOMA 1PK7A 2CBGA 3S2UA 1IRIA 2FSSA 3INYA 2B7BA 2YVUA 4OMFG 5ETJA 4PHTA 4RV9A 3HEAA 3MLAA 1XD2B 3MT0A 2NACA 4P7BA 3TLBA 3WB0A 4A0GA 2AMYA 3IBCA 4G1EB 4S0ZA 4W5RA 2A67A 1G19A 1QUEA 2FEAA 3FJ1A 4J90A 5EWJA 2J5QA 3VM6A 1QGUB 2SCUA 4QJ4A 5JMWA 2P9JA 4XLLA 4TKVB 3JD0A 4HGOA 4OGGA 5K8IA 5BW5A 3MLBA 1F4PA 2A5FA 4P3PA 3T7KA 1X1RA 2L2QA 4X5OA 3UC5A 4EO4A 3R1IA 5CB6A 5K8LA 4B7UA 2NU7B 3A31A 3GA5A 2GFIA 1U7UA 4HC4A 3VR4A 3BL6A 4PICA 4P6VF 2YYYA 4YJFA 1QVZA 3FPHA 3H84A 3GCZA 4CMAA 3CR7A 2ZJ2A 5LYJA 5BV1A 4K9RA 5TRTA 3O8CA 1P5HA 2PO5A 3RR2A 1L5FA 1V3QE 1LEHA 3NJ4A 4D92A 2QMHA 4A0RA 4S1PA 1UJNA 3IO3A 4F1KA 5BYBA 4OXKA 4RHXA 4HADA 1GDDA 1I3CA 5KTRA 2YVKA 3GO4A 5SZKB 1VLLA 3PHCA 4QU8A 4XPZA 1E7SA 4ZKEA 4J3FA 1KEVA 4MVJP 2TMGA 2Z08A 4HBGA 5DBFA 1NHWA 1DIOB 4ABYA 2F3PA 1I2MA 1V8FA 1XVTA 1Y5IA 2XTMA 3RREA 1O97D 4R9NA 1HURA 4PNHA 1TM3E 5ALVA 4EPTA 4XR9A 5FPPA 2FZCA 2I22A 3OUZA 2AOWA 2WD8A 5AP9A 1GPKA 3KS9A 3GV0A 1CU1A 3NV7A 4PAGA 1HH4A 1UMKA 1Y3HA 2X5XA 1TKRA 2FWRA 5AVYA 5AKEA 1SIBE 3MPOA 3FDIA 2P9YA 3BEOA 1MO2A 2AX4A 4XVRA 1CEEA 4UUAA 4M1TA 5HK9A 1RMTA 3SDSA 4XASA 5EPEA 3WYGA 4CNQA 4X61A 1UOEA 2QX6A 1W52X 3BEDA 4ZHQA 3G6WA 4Y8VA 1YTUA 2H7YA 2W0MA 4IHJB 1T0HB 2WWXA 2YWHA 3F8TA 3NDRA 5EFZA 4YMHA 4RTPA 1OFUA 3X1DA 3O0TA 1DTEA 4FD3A 4G89A 4ZQHA 1WL8A 2A2ZA 2VDRB 3WO1A 4BN4A 1UBNA 1YI0A 3JQGB 2ZSEA 3TL3A 5HJ2A 4U7PB 4O2BF 1GDTA 2YWCA 1I9CA 2YHAA 1JDUA 5KWIA 2P30A 3Q41A 1CF9A 4EG5A 2V6IA 1POXA 1H8ED 5T3UA 3RC3A 4MTLA 2QAGA 1YQDA 4U2EA 2QAJA 3UAGA 4EAQA 5U4QA 2FRVA 4O3MA 4GP9A 5BN5B 3ZG6A 3WLHA 2H54A 4TQGA 3AUJB 2VK2A 2JH9A 3U7EB 3U49A 4MQ6A 2FR8C 4L8FA 2F3TA 2A86A 4IJ5A 2RIRA 4D7AA 2OZLA 3ZN2A 2VR1A 1SB9A 3DL2A 4PQGA 2YZNA 4ROTA 1F8UA 3OTGA 2ZM6B 4ZOLA 2WFLA 2UUBB 1U0NA 2EKQA 1QPZA 1SXPA 1SU6A 3AHGA 4KW7A 3ER8A 2OA0A 3PCRB 1DEXA 2HA3A 3BMQA 3VR5D 2O52A 1QJ4A 2FFBA 4HTAA 1Q0ZA 2N1BA 4CDNA 1US8B 2CLEB 2JJ2A 2GZHA 3K30A 4H1VA 4B7CA 3LLCA 3GHYA 4K6HA 4K6GA 4NULA 3MHTA 2BP7B 1PFYA 2JARA 3ET5A 4MWZA 4HBZA 3T99A 2NZJA 3QEAZ 4DYHA 3HTXA 5EPUA 1GLVA 1Z2DA 3PQ4A 3SKVA 3WK7A 5DGDA 4B47A 1YUNA 2HU8A 2VNAA 3OJCA 4XCQA 4ZZIA 5G53C 1PYDA 3FKQA 5KO2A 1YHNA 4BVHA 4I9FA 3ZHBA 4LK2A 1YE3A 1RI2A 1RSZA 2AG5A 3JQ9A 3K5IA 3VU0A 1BW9A 5H9VA 1JFVA 4DSTA 2ZB8A 1OI3A 4R2LA 1WXEA 5DGHA 5KYKA 3KJEA 4B31A 1YZKA 4ROSA 2N1MA 3Q8KA 3JSAA 2IYXA 4HT3B 2AZMA 2PVCA 3B13B 2D1RA 3LQQA 1TT5B 2Z56A 3W2FA 4OBWA 3WZLA 2B7LA 2YL2A 2H4ZA 3OTWA 1UEIA 4HNQA 4CMEA 2J1LA 2OC4A 5CFOA 2XNDA 2D59A 4P36A 5HUHA 4IXNA 2VDJA 3QZUA 1TU4A 2J3QA 1KSHA 5AJYA 1UT6A 2I6QA 1CUDA 2IYFA 2R44A 4Q4JB 1I4OA 4GKVA 3UKJA 4UM9B 3LXRA 1W4LA 3UPDA 1GZDA 2FN3A 4RVOA 5KTKA 1ZJZA 3NWJA 2NU9B 1UC5B 4LZNA 4EPRA 3RDPA 4K9LA 4KMMA 2WOJA 3BKXA 3JWGA 1NVXQ 3OAAA 2GJAA 4AWAA 1LJUA 3R3SA 2R4QA 3HB1A 1N2CE 4D0GA 4PZ0A 3VVCA 3I83A 2NO9A 3MCWA 3MVEA 1CYDA 3BFXA 1SUFA 3MJHA 5UKDA 1C9EA 5ES3A 5L3ZA 4J0QA 4BLOA 4BO3A 4OI2A 1OMOA 1R0KA 4GPAA 4S1OA 3FPEA 1T2UA 3RTAA 4AX8A 3LRTA 2RGGA 3JQQA 3UJ3X 2EQ5A 1S4MA 2V7UA 3LNTA 1EUZA 1BNCA 2GSDA 2I3BA 2APJA 4FFNA 1T3SA 4G8JA 4ID9A 4CFSA 2ZULA 3FN4A 3QVSA 1B6TA 1E5TA 5EJGA 4BKRA 2QBYA 4D3DA 2XEDA 4IDPA 1FXSA 1GU0A 3GNSA 2XRMA 1UPTA 1VB3A 3VYUB 3FZQA 2PUEA 1EM8A 3CBQA 4PX3A 5LYJF 3ORYA 4DDTA 4NAUA 1QP0A 1RLMA 1NUTA 2V3VA 1Z88A 1KYQA 3VOBA 2AVDA 2XF2A 1K88A 1K0UA 3BK1A 4H6VA 3V7YA 3PXBA 3B9QA 4WNYA 1NVEA 3ESXA 4DZZA 4MVWA 4RJJA 5GIPE 2IW3A 2ZXEA 2XE8A 1WHTA 3UQYS 3JAKA 1PT8A 4Z2YA 4X8HA 2HRBA 3HZRA 3VNUA 1FFYA 1PUJA 3ISTA 3SK0A 2CGEA 4PZPA 3TMKA 1PT9A 2R1TB 2YQ4A 2ZYTX 4IWXA 4KIFA 3L8FA 1HDXA 4IIJF 3ZQ6A 2GYVA 3CLTD 5TMBA 4YCNA 2HF8A 2C94A 4JBGA 4OYYA 1XQ1A 2B36A 1O95D 1A1VA 4IDGA 4ETNA 4F12A 2H52A 2FPPA 4UEWA 3SSNA 3QITA 2OMKA 5ILGA 1A69A 3T7IA 4CT5A 4DAOA 3H1BA 3K2EA 4F3TA 3VU8A 2PPVA 1Q1AA 3IUMA 2VSYA 3M1YA 4JYCA 4RY8A 4Z9FA 1RWBA 4Y2SA 4BMDA 3C3DA 3A1NA 3HS3A 3KPUA 4HDOB 1KZ4A 1MB2A 1QHEA 2YMLA 3DD5A 3OSZA 5CLLA 4BDTA 4HZGA 1E2DA 4DA8A 1BX1A 4ZHQF 3G7SA 5CD1A 1WXGA 3O2NA 5THQA 5JWOA 4RD2A 1DWOA 1II0A 1PW7A 1SD2A 3R3VA 5EVJA 3PNKA 3AV0B 5B2EA 1WB6A 4C7OA 3JVVA 3JY6A 4KWIA 4ED9A 5TQ0B 2Z83A 2HQ1A 1IJFA 1SCNE 2A30A 1S2IA 3BE6A 3EMKA 4J9UE 3ZW8A 1KI6A 4O63O 1DJPA 5CNMA 1YOVB 1QWSA 3STWA 5E1DA 2ODEA 2O54A 2CWDA 1A9QA 4BFLA 2AK2A 3LVQE 3WYEA 3ZBTA 1RP1A 4EM6A 1JECA 3JQCA 1PCXA 1TD1A 3FDZB 2GN1A 5L6MB 4TRJA 1RP7A 4LHWA 1Y7TA 3CB4A 3RIMA 2AJLI 4H7IA 2HOQA 1Y37A 2GKGA 5CP8A 4H0CA 4I4NA 3VZPA 3BRCA 4F92B 3V1UA 2O7SA 3GGGA 1MIOB 2YIMA 2HSZA 4JLMA 5CT9A 5CT6A 5IMSA 3L6CA 4BLSA 4GKAA 4M98A 5IUJC 3WRYC 2YW9A 2JAOA 4BVLA 5J1SB 3D4LA 2QJFA 4ZOLF 1ZMRA 1YGPA 4QDZA 4M0CA 1E1MA 4B9AA 2QTVB 3MWYW 2CXQA 2OHFA 2Z58A 2V97A 1GHTA 4MS4B 2EBUA 5F64A 4KQKA 2JLAA 2IC5A 1SBNE 1DAPA 3DZKA 3KTFA 4P54A 4ZGWA 4OKSA 4PLYA 1U4SA 4PNPA 4GM4A 1ZOSA 4G4IA 1FMJA 1UPBA 1PL8A 1YMUA 2ECFA 1TCUA 5HMLA 5F2KA 2PZMA 4YCJA 3NBXX 5B3LA 2BMJA 3LT2A 2JFXA 2QRJA 1WZIA 4NHOA 3PP8A 3KEFA 3QUQA 3KZOA 3HDTA 2QRMA 4KU4A 1FRZA 1DHTA 1O89A 5B7PA 2VRNA 1YZTA 3B2NA 4NU6A 1HI9A 3WY9A 2H0AA 4DCSA 3MTJA 3BB3A 4E2WA 2IYYA 1O6FA 3HL4A 4ES6A 2WYHA 3PQ7A 4LECA 3F5QA 1R50A 3AJEA 3F7MA 5B4UA 2AZTA 2EF1A 4E7PA 3GEGA 5BNZA 1J5PA 1IC6A 2IOQA 3IUJA 2AFHB 1PDVA 3HN6A 3RG8A 2Q3EA 1JQLB 1QIJA 5GZ3A 3COJA 1QLHA 1DJQA 3FJOA 4RPCA 3N70A 1JALA 1FQJA 2AYYA 1N0IA 2OR3A 4DMLA 2C99A 4ZQGA 2FX2A 2P7HA 4BY9E 4J7UA 2BSXA 4U7FA 1BDBA 4QVGA 4RYLA 4J2HA 3LECA 2B20A 4Q18A 5KTNA 3G8DA 1SVIA 3G8AA 3GRCA 3NOXA 1XU7A 4MRMB 4YUZA 3ENVA 1GPJA 5E38A 2GCGA 4E11A 2DWCA 1W5SA 1NW3A 4O4IB 3OPMA 5EQTA 3E9RA 3YASA 3QVJA 4ESOA 1E59A 3JARA 3RS2A 4B79A 4C6SA 3R0ZA 4YPVA 2DHRA 3WJAA 4OL0A 3CZQA 1TCCA 2NV6A 2C3MA 5LM3A 3AM4A 4FMCB 2RIPA 3AUUA 3L1KA 3RROA 3BIXA 2WIDA 5JWRA 1MQ9A 3WTCA 4MAMA 2X0DA 4NZNA 2HU5A 2JA2A 2WP8J 4G97A 4TTAA 3ZTWA 1XELA 2BTEA 1XO1A 1WNTA 5TARA 4GH5A 4XH9B 1WB9A 4I1UA 3V46A 3N58A 4XSHA 5LZ7A 4AY2A 1G5HA 1T8TA 1QGAA 3PWZA 1GCIA 2G09A 2R84A 3VV2A 5A06A 2VDVE 4Y1GA 1QS0A 4JGGA 2ONJA 4EG0A 5DBEX 3V97A 3Q3IA 2H2AA 3JR3A 2EFYA 3NKVA 4LJLA 4C0XA 1UCFA 4B6FA 4B3TB 2D2XA 1UMCB 3KUDA 3PA6A 4LRQA 2I67A 4NARA 4QL3A 3RUEA 5EG5A 3VPDA 1XALA 4DMMA 3JCZA 3NVKI 3ZHSA 3ND7A 4PZZA 5TEWA 4AY3A 2X0NA 4LXXA 4RD0A 3CNEA 3H2SA 1U0RA 4I1IA 1LBIA 2QTRA 4DA4A 3TTYA 4CHTA 3ROKA 3S27A 1H2EA 4KX3A 5JXHA 5IVKA 2JI4A 1INLA 3GGPA 3HABA 2IOHA 2PANA 1OC4A 2SCUB 3AF4A 2PKRA 3CPJB 3CZPA 3KDAA 4RZIA 5B1SA 2QTNA 3LHFA 2HL6A 5EIHA 1OQAA 4PTZA 3RGGA 3STUA 2W2KA 2DETA 2QYOA 4NI5A 1ODSA 2VHVA 2H1IA 5TGTA 1WPQA 3MIIA 2VSXA 3BWCA 5IHXA 1Y6ZA 2DBQA 5KDDA 2I2DA 3BMCB 4OU5A 1M8FA 4JJEA 2FPSA 5AJXA 3DLIA 1ES9A 5DIFA 2A0UA 3WNQA 1NTRA 4QOFA 1LSJA 2V0CA 4FC7A 5EWJB 4P2BA 1W4CA 2X5KO 3A3KA 4Z4HA 3SC3A 5LYJB 1QRTA 5IJAA 2N46A 4DQDA 3ZD6A 1P4RA 4RFLA 5EMLA 5L7WA 3AB7A 3QU4A 1U0SY 3KUKA 2GXUA 5EXTA 4DA0A 4M86A 1ZMXA 1JYSA 3A8TA 2OFXA 3CF0A 2NV0A 1FVXA 1GA1A 3B8EA 3F2VA 2KSQA 2DHEA 1BX0A 2K2WA 3NWPA 3PXGA 1MB0A 3UHJA 4H4CA 4U02A 3FZGA 4IIDA 1DG9A 3EQ7A 2GWHA 1RHRA 4QYIA 2OGUA 3G2IA 5IASA 2PUFA 2W2XA 3OEHD 3BDAA 1CZUA 3F96A 4MO2A 1G0OA 2DJIA 2ZOSA 4R81A 5IM4A 3EAQA 3O4VA 3ECCA 4C14A 3JS5A 5B7QA 4G07A 1PFVA 4JDUA 3A6GA 2YJ4A 3DV2A 2PO7A 5EE5B 3VH2A 4RZ2A 1EU1A 5JH7A 3GF4A 1CLEA 4G6ZA 2VJOA 2FSVC 5J4HA 4CM6A 1XZHA 3GROA 5K01A 5GP1A 1L6RA 5JYEA 1F1BA 1UPXA 2FFRA 3AO0B 1KZ9A 3HCCA 3CONA 4R31A 4TKUA 1YFKA 5AVKA 5HA5A 4FIDA 2Z8ZA 4KR7A 3QPWA 2XVMA 1M2FA 1ONPA 4RHCA 4ZHQB 2SKDA 4F04A 2YYSA 3H9CA 1KR2A 4HAYA 1RM3A 3PEUA 1K9SA 3K2IA 1V8DA 1HSOA 2HCJB 2EFGA 4RKFA 1Y5LA 3PGKA 4X1IA 4G0UA 3VGJA 3E0QA 2FMHA 3C6QA 4LGYA 3RSCA 2IY7A 2B8EA 2WJYA 4W1QA 3WDLA 3CUWA 3FMOB 1ULZA 3NHFA 2RG1A 3OZAA 3PE3A 4OJMX 2QTMA 4U7WA 2YR0A 4AXBA 5F35A 4BGVA 4YRMA 8ABPA 5IAOA 2PD3A 2DKOA 1JS1X 5PGMA 2QAGB 1FXWA 4L08A 1TK3A 2VHXA 2XA2A 3L6UA 4UE3S 3I6BA 4J2OA 3JQPA 2HC9A 1NF3A 1ABFA 1TPYA 3GRAA 1OZFA 3MW8A 3OCXA 3EF0A 4DLTA 1DJOA 5BRNA 2RH5A 3HG7A 2H1OA 1CR0A 2CD7A 4XEUA 1MOQA 2OZLB 5H4HA 2IXBA 1T26A 1I1QB 3AK4A 4IMRA 3WC4A 5IH7A 1N8TA 4C0SA 1BS2A 1IQRA 4P4LA 1T1RA 2WFLB 3DHVA 4H3VA 1T24A 2X3FA 4FX5A 5FKJA 3ROZA 1TA0A 4MUHA 1DEHA 3BMQB 3E3LA 2AMVA 1GPH1 2LR0A 1B2LA 2HWWA 2R7LA 5CFMA 4ZZ0A 2E6KA 1RWOA 4KREA 1PLKA 2PNJA 3CCBA 2QLTA 3RS3A 1N9GA 3I9OA 2F1KA 4HZIA 5GPBA 4CUJA 1GSHA 1JFFA 1UBKS 1V5WA 3U7QA 4LZOA 2H5IA 2QVZX 2OO5A 1S96A 3O7WA 1ZUHA 4WD3A 1UBGA 4KMOA 3DEKA 4FYIA 1Z07A 3D5EA 3MJEA 2Z1DA 4UC0A 5CDHA 2P75A 4DJAA 5MDHA 3Q2OA 5KQSA 4UARA 3ZJYA 5E7JA 1QIMA 1BW9B 3LY8A 5COQA 3QQPA 1W5TA 2BKXA 2QN3A 2VF4X 4FKMA 3TQRA 3V4SA 4N6GA 1RPAA 3BFJA 3FHTA 2IHKA 5CB0A 1QKIA 1SU4A 3M5PA 3PDWA 4R51A 1KNXA 4BZQA 4BNWA 1VZ3A 1TO6A 2WNHA 1IG3A 3D7KA 2IXAA 3MFQA 1YDFA 1YR1A 4OHXA 3KQPA 5B53A 4US2R 1JA9A 2JZNA 5CCEA 3DV0A 3GLTA 1NP3A 2ISSD 4OK6A 3C8HA 4QAQA 3LQFA 3SXUA 1ILEA 3EFOA 3ETNA 1O4VA 4IFEA 3F6RA 3O8QA 2Z95A 1EVJA 3BX1A 2CNLA 3ZZ1A 1XMQB 1PG5A 4L8YA 3AEQB 4P53A 1QHGA 2HREA 4OFWA 1B42A 4OLAA 2E6UX 5FJIA 3HE3A 1MCZA 3N8NA 4EDFA 2YOFA 2NUPB 4BZZA 1QQBA 3QENA 3N7UA 3ISJA 1RAGA 4FE3A 5E9WA 1C4WA 2QRKA 4K88A 5FRDA 2A0KA 1U0GA 2BT4A 2J9XB 2I76A 4GRIA 4QQKA 3CUYA 3V6MA 1XF1A 1KF0A 1ISHA 4A23A 1JI3A 4DV5B 1H2FA 1XQ9A 2ZRMA 3I45A 1KTIA 3NXKA 1RJWA 5SY4A 1MOPA 4HRXA 4MRSA 3KR9A 5C8YF 2QBYB 5BO5A 5K9ZA 2ZB3A 3RLFA 1R00A 2GLUA 2NVOA 3DE6X 5D3QA 1QE0A 2P9GA 3EEFA 2XXBA 2F6RA 3PYXA 5AM0A 4RGVA 4KDEA 1EM8B 2X1VA 4D2IA 3AEUA 4N5IX 1R74A 1D4ZA 2D1YA 4PR0A 1SU7A 2FZ5A 2V7QD 3BSYA 3M7IA 5EHIA 3RIHA 3OLVA 4P7GA 1QRSA 2ZSAA 3F9IA 1QO0A 1ULUA 2V45A 2QAGC 2XECA 4TMYA 3EN0A 3QPVA 4LVOA 1V7QA 2MHCA 3TR0A 5LLTA 5G3YA 3DZ8A 1P62B 1BXRA 1WHTB 3JAKB 1OI2A 3MOIA 5CLFA 1H2YA 1P4SA 1X92A 3K3PA 3HDHA 5HE9A 3HFRA 4C20A 4X1KA 3UW1A 4LE0A 1U0BB 4TWBA 4URHA 3KIPA 2R97A 1FU7A 4LX8A 4HMOA 4MK4A 1WF6A 1MD9A 2PG3A 5IM4F 5DNEA 1E9CA 1MO5A 1QGZA 3HCFA 4L51A 2CHVA 2CHUA 3BUSA 3GOQA 4I08A 2W37A 2FPPB 4B17A 5JH7F 4M49A 4ADSG 1G0NA 3NIBA 1MDFA 1QNFA 1RLOA 4Y0NA 2E4WA 1JDBB 4NJOA 1RHUA 3DE7X 2HRDA 2VP5A 3F90A 3HN2A 3PC3A 4G1FA 4B3HA 4EFDA 1MC8A 3OCCA 1DOZA 1J1UA 1JHZA 5IT0A 3TOSA 2WWGA 2QN8A 2I62A 2O3TA 1JDZA 3DTVD 5AI9A 5DP1A 4OHRA 3COSA 2PZEA 1V6SA 5JNLA 4C7OB 3ZDEA 1L5RA 3GLFB 3FBWA 3PNMA 3QW4B 1JEEA 1FFDA 3PT9A 3VNAA 5K8UA 2W6ID 1FYDA 4AL4A 3BKWA 3JQ9C 1V9SA 1OHHD 4XIIA 4FZVA 4ZGBA 4GYWA 1J9GA 2EATA 4J0FA 3WLJA 1EB8A 1G1AA 3C7KA 4XVUA 4N3NA 5CA0F 5EJEA 1RQGA 1AUXA 1HYEA 2FWMX 4INAA 3WLEA 4HAIA 4LXYA 4NBVA 1OVGA 4P3NA 1F7UA 1RYMA 2FGJA 4K2HA 5EIOA 1KQNA 1U8XX 3COPA 3FJYA 3SMQA 4TYWA 4BB5A 2N75A 3TSAA 4CMEC 5AH0A 1XTVA 4QATA 5FBVB 1Q3HA 3FX2A 4YLYA 2PS1A 3Q9UA 3GBVA 1U80A 2HSWA 2I55A 4HFNA 4MDHA 4MUFA 3SSAA 4LMRA 2HHAA 4EKIA 2V6JA 1NVAA 2LXNA 4C0KA 2FFHA 3RSFA 1T0PA 3O1HB 2O1EA 4EHHA 1EWRA 1EQ2A 1NVDA 1X1SA 4NVRA 2EEZA 4ZO7A 4CLHA 2UZ1A 1QYRA 3HVJA 3W7AA 1FLVA 3QVVA 2LCQA 2DUNA 1IUKA 1P2TA 2GAAA 3C8UA 1EFAA 5MGBA 1CJMA 4G9EA 1TXGA 4N01A 1EDOA 3R9IA 1MKYA 4B7ZA 3IEIA 4RD6A 1YBAA 2Y1CA 1Y4AE 5DNCA 1SBIA 3CO0S 3G6KA 4KYVA 5J47A 5KYXA 2I4OA 1ZSNA 2IEYA 2CXTA 2W71A 3ABRB 3M5DA 1Z5GA 1J0EA 2F43A 3GVPA 3QOFA 4HLNA 3IIMA 3KHSA 1YS1X 2XSZD 4GOXA 5JISA 1V41E 3BHNA 1ECLA 5EQJB 3C15C 5DKFA 2H9IA 3QTBA 4FEEA 1WOYA 3PQ6A 5SICE 1E2JA 5JADA 2QMOA 4LJKA 3INRA 1CVIA 5ED4A 1TEZA 1KRHA 4WE3A 1DG1G 3R8CA 4DBVO 4MDFA 2VYCA 4IRUB 1VP9A 3KE8A 2VF7A 4PN3A 5E9AA 2R9VA 5DT9A 4RHFA 3KYDB 5EKXA 3ZLVA 4NV1A 1VI6A 3A9SA 2HJVA 3ZLJA 5DNUA 3RNOA 5LBIA 2WK1A 5AJZA 1MBZA 3CR3C 4WOBA 5K6RA 1H9BA 2Q3LA 3FPAA 3U6BA 1A4UA 1N6NA 2YDXA 3IQHX 5H3HA 4E2ZA 1XMXA 2Q2OA 3G1WA 3I9NA 3JARB 4OJYA 3ROMA 1LDYA 4BYGA 3I23A 2J67A 3UUGA 2JANA 4XWAA 2JGRA 2XB8A 3DE4X 2NO4A 4BFTA 1Y4SA 3DKRA 4E30A 3DL4A 5LIPA 1R7RA 1UL1X 4KXWA 2FRDC 4ABTA 1Z12A 2XWPA 3B6KA 1JDBC 1VYUA 2WV9A 3CVJA 4KQ2A 4DGQA 5TT1A 3EK2A 4D80A 3E3NA 1SA0B 1L5VA 1V6AA 4BO2A 4CIWA 1D1PA 3DM9B 2JCGA 1WMEA 2W00A 1RJ9A 4QDXA 3OZ7A 5FFNA 1ULHA 1TQ6A 3VA7A 4G1MB 3KOOA 2JD2A 1QS0B 3EDYA 3TZQA 1YDWA 3HU2A 4I4TB 2REXB 3CMMA 3TTTA 3G13A 4ZQEA 2WMYA 1G20A 5H68A 3SFTA 5HQ3A 5K3EA 4QU0A 4EKGA 1NNI1 4BP9A 2R8EA 5DTQA 2VQ6A 3J80A 4F4JA 1NLYA 3DYBA 2P1DA 2ZJBA 1YJBA 4WIAA 1K3TA 1TCVA 5DASA 5F76A 5G1PA 1NX9A 1QANA 5CG1A 4KSCA 1E9EA 4J0GA 3FFAA 1BMFD 4QYMA 3R23A 4IGKA 1XVAA 3UWOA 4D5EA 1XVUA 2Y0EA 4Z7OB 2W2KB 4B3SB 2EP5A 5EUBA 4E1AA 3E9CA 1Z68A 2V1UA 2I6UA 4K3VA 3AYXB 1YIAA 2OZKA 1DKPA 2PRIA 4X71A 5I6DA 2VJMA 3QBTA 5BWMA 5ED0A 1LQ2A 2WKSA 2ZSKA 3X1JA 1P73A 3EARA 1RTKA 3K0AA 2ZTMA 3RUDA 4DNXA 3QVXA 5EWLA 2KLBA 2R4TA 2V03A 3ENZA 3AFGA 3AC0A 5LUBA 3ZGVA 3NIWA 4CKYA 4F4IA 3QKRA 4GMXA 2EG9A 1AB6A 1ICEA 4Q66C 2Z98A 3GQBA 3GH3A 1XZCA 3DWGA 3CEHA 4Q39A 3EA4A 4LCBA 2X8BA 2OGSA 2JGFA 3RHZA 4TZ0A 3NGXA 1J2YA 3DWIA 3C3PA 4GI2A 1VC2A 2AA3A 3CIFA 3Q7QA 5FQNA 3Q7IA 4QYIB 3C3AA 2VDKB 1WUIS 1XYGA 2YOGA 3L0BA 4NBWA 5FYDA 1UFOA 5LXTF 4DLWA 5ADUS 5JBIA 4R40A 3WHPA 2ZSDA 2BISA 2H17A 2O8DA 2CYBA 3LDHA 3PFNA 4PYNA 1OPRA 2R8PA 4QJ3A 1FFWA 1P7VA 1XLWA 1NYQA 3AJ9A 4RXUA 2YKGA 3LGAA 4HFRA 3UTDA 4WXHA 5MN4A 4O1IA 3LBYA 3HGQA 3RSHA 2YWEA 3NHRA 4BWGA 5FTLA 3ANXA 3QUTA 5HMMA 1AGPA 1UDWA 3K53A 5JMOA 1QAMA 3EIEA 1QTRA 1FTQA 2XVYA 3GLFE 4QO8A 2NP6A 1ORHA 4FLFA 3OQVA 4GXTA 4EPXA 4BLUA 2O4CA 3HWSA 3K32A 4JMPA 5CXXA 7ADHA 2C3UA 1Y1LA 1GNLA 4Z9XA 1EZ1A 3QPDA 2YCLA 4YV7A 5F7OA 4DR5B 3ZJTA 1X74A 2F7SA 3IP3A 4CEHA 3AKEA 2DQ4A 3ENWA 1OU4A 2QHXA 1U9IA 1S5PA 3GRUA 5KQGA 1D9XA 2ZCVA 4P4SA 2OZPA 4MUIA 3M33A 1HORA 3UM9A 2B4AA 4UHKA 5J2TB 1ZC4A 1T2NA 1U7ZA 2G9ZA 2IZ6A 4HXEB 5JI2E 1BHO1 3M82A 3QA3E 4LBWA 4LVUA 1G5TA 2X19A 4RWEA 1LI4A 1ZNYA 2QT9A 4ID3A 1FSSA 3GC6A 3TG2A 1VJDA 5LQAA 2ZCJA 2OBFA 4EIWA 1XJQA 3T3GA 1WMDA 4YCSA 1GTJ1 1XDUA 2E55A 2RJ3A 1DKUA 3BA6A 3L5KA 3M6LA 3W9SA 2QRHA 2E4XA 4GOOD 4CPDA 4DSAA 1I5OA 2VPZA 4DMCA 1M2KA 4LFBB 4EI2A 5ISMA 2J3JA 4BMZA 1CK4A 2G0TA 4DBLC 3JQ8A 1A1SA 4KE7A 4FBMA 3WFJA 4ND7A 2QLLA 3ZH2A 4D3XA 4CF4A 2JJQA 2ZIUB 2J87A 3KBOA 2YVLA 4JLOA 4POAA 2KQUA 2UZIR 4Q3OA 3SXJA 1OGYA 6CHYA 2O2DA 1TZ2A 4B48A 5D85A 5TR9A 4XLZA 1ZN2A 3C8ZA 4LZAA 4WECA 3U37A 2J9RA 1UP7A 1ZDMA 4F5DA 3ZBUA 5JAHA 1G60A 1LFDB 1JFFB 3A7EA 4EO9A 3U7QB 3TTWA 4UUPA 1PFKA 2BZSA 4MR9A 1IU9A 2V7PA 2EZUA 4XQ0A 2GPYA 4C89A 3Q7SA 1N5DA 1SBQA 5DNDA 2GJKA 4ZICA 1A4XA 3KOUA 3WBFA 3QBVA 4C01A 3NTUA 2Z6AA 2W2MA 4WZ6A 4B3BA 1BX3A 5TV2A 1F0NA 3C4QA 4Z6KA 2O6HA 2VT2A 3WWZA 4EHIA 3WISA 4I9UA 1SRQA 2GJ4A 2IQIA 2DAPA 2HBZA 3F73A 3ICPA 4H0NA 1X0XA 2CNWA 4MHSA 3COYA 4MQ5A 5LNK6 4D4LA 1KO7A 1U3WA 4OHKA 4YRRA 2F90A 1WUTA 3JZIA 3L7AA 3B6ZA 2EFEB 5AK0A 4B73A 4HNUA 3IXQA 1G64A 5AIAA 3DV0B 3RQSA 1E1QA 5FO1A 3PR1A 1NW8A 3FNBA 3SXUB 4EA6A 3EFOB 4AKTA 1AMNA 1W4AA 2OK8A 2B8TA 5E9QA 3O8QB 2FPUA 5EESA 1H0RA 2D74A 3O1LA 3H2BA 1MXHA 4TLCA 1KGSA 3IILA 3L0IB 3RHSA 3UCFA 2DFNA 3H5NA 4ZMBA 5BV8A 4UKDA 2IH4A 3KB8A 2OBMA 4MPTA 4AK9A 4ZT7A 3PZRA 4DZRA 1XNJA 4DLSA 4OQMA 2ZIFA 3KWMA 2HSDA 4YROA 4FB4A 1MU0A 2RAPA 2H4JA 1Q7RA 3K6SA 1KHTA 2EXXA 1THTA 3R6TA 2VDWA 1YQUA 4KRGA 4P84A 2C5FA 1GQYA 4R7TA 1KYVA 2IHBA 2Z9CA 4OOFA 4X0EA 3CWCA 1W88A 4DQXA 1U0JA 2NWQA 3N8GA 3U80A 3HJGA 1LX7A 5A3SA 3K8QA 1J7JA 2VCEA 2OKCA 3NG1A 1Y9ZA 3GVIA 4NZ9A 3WSTA 4AAYA 2EKBA 2F55A 2D2FA 5LC1A 3OZDA 3QJ5A 4YIKA 5KX5A 1M6EX 1OWLA 3I53A 1HV8A 2D0IA 3LS2A 2G06A 4YX9A 1GTRA 4JR2A 4LZLA 3LLMA 4KE8A 1SVKA 5JCJA 1AS3A 1UWLA 5C52B 2VZEA 5D3KA 5LWQA 5TQJA 4PO8A 1GG8A 1S4QA 4C2AA 1VPVA 4FFMA 4QYTA 5KC8A 1K3FA 5CVUA 1WMAA 3W1EA 3DJYA 4LYDA 3NGLA 3RVBA 2AZXA 2HN9A 1OC2A 5TMEA 2FG5A 1BXRB 3AF0A 2HU2A 4KXUA 3LTNC 2JH8A 1WUKS 3DAGA 3EDOA 3HKCA 3EMBA 4LOJA 2JCBA 2NVUA 2ONKA 4JC5A 4X1KB 3AR5A 5IHPA 2A5LA 2HMTA 4HVCA 4KXMA 2FW6A 1TKAA 2XE6A 5U9CA 2AOTA 3QX9A 3FMGA 2BDUA 3H4IA 4LX0A 4TXNA 4E5SA 1D6SA 4PQYA 4YI5A 2BEWA 4RCZA 3WGQA 1I14A 3WJ7A 1PLLA 1W9HA 5C1DA 2OCGA 3PNVA 3OZCA 5IVIA 4BZXA 2XMCA 1L4GA 1OBOA 1V3TA 2B30A 4GICA 4BB0A 4TMFA 3SBDA 3GD7A 1O9BA 1EWVA 1NSTA 3IBTA 3MA0A 3OF3A 2EV9A 2NNWB 3HDGA 5AHWA 1W9MA 1G21A 4OKIA 3T5TA 2QQGA 1CUWA 2OO5C 4MW5A 1UKVY 3E7DA 3PWTA 3W5HA 3GUCA 3ZV7A 1RPJA 5BR7A 1N2HA 1XR3A 2W2TA 4GBJA 3ZZTA 5SZIA 3ZZ0A 4K1LA 3T7CA 1R10A 4BFZA 1KDRA 4ZN6A 3VC1A 2ZS9A 2XRZA 1SG9A 5DDIP 3B2EA 1RJFA 1NBMA 2TRSB 4IXWA 1PS9A 2DX7A 2E4AA 5DO9A 4GS5A 4QXRA 3UXYA 4F3YA 1LVGA 1KVQA 3T7AA 1XCGB 3FCYA 3JQBA 3TLGA 3HSYA 1WVIA 3MXOA 4M1WA 4FK8A 1NC1A 3B3QA 2DR3A 3AEKA 2C4WA 4ARZA 3ESZA 4HV4A 5EIBC 3V3KA 4TV8A 3U44A 1O96A 2ACEA 2LBPA 4PV7A 2GZDA 5ALUA 4J4BA 2HLPA 3C3CA 5K1ZA 2G17A 4IIHA 3RHFA 1NF2A 1MO3A 10MHA 1X87A 2AOUA 3Q2KA 1ZGCA 4IDBA 4G5RA 3NH9A 3KLOA 4N18A 1K1EA 3B6IA 3ONFA 3BK7A 3GLIE 1KO4A 2J46A 2WF7A 4FDUA 4RH1A 1V6CA 2QL9A 1LA2A 2D06A 5FV7A 1ENPA 1C9JA 3RANA 3TLKA 5M04A 3W5BA 3AR6A 4WXEA 5F51A 1C9DB 4CF5A 5BN3B 2PUVA 3NYIA 2HCRA 3QLTA 3TFWA 2HF9A 2CLIB 4H16A 4JWTA 3V9PA 4HYEA 3V8MA 1Q1BA 3OQBA 2FN8A 2R68A 4R2XA 4D8YA 1PQPA 2YTZA 1JEQA 3VHRA 1GZHB 3TIFA 2JGJA 3F4LA 4XB2A 5KYXB 3BCUA 4BLWA 1UMDB 3ABIA 3C1TA 3DXFA 3OEWA 1PZFA 2F43B 4C4ZA 2CMGA 3GFFA 4JEIA 4J03A 3RFTA 4Q9NA 3AVUA 1K89A 3R3JA 2DR2A 1Y7LA 4C03A 4OV6B 1K86A 1UPUA 4Y1FA 1BD4A 3DFFA 3T7EA 4FU0A 2PQ2A 2BUBA 2NU6B 1SUIA 2YV2A 2F8SA 5IN4A 3WB9A 2WD9A 1A5BB 3H0EA 3IB3A 1GUFA 2NPIA 5KNLA 1YR9A 4D8XA 1GZ4A 4MUGA 2O20A 2DQYA 3T1QA 5BSWA 3VO2A 1FLNA 3AXSA 1H2BA 4JEUA 1IN4A 2IP2A 1AZWA 2PAFA 1HTTA 1YKSA 2CXXA 1ONOA 3H5WA 1LNQA 5TMPA 4XGQA 1Y1TA 1EK6A 2IP4A 4ARSA 2VZ9A 2OCAA 3PVSA 5IAEA 3HB0A 1N77A 1FFSA 1P77A 4L27A 5JXIA 2G36A 2W83A 4LZWA 4DR7B 4M9ZA 5EXXA 2VBIA 3BFKA 2YRWA 3FVVA 3O2JA 4ZTUB 3CXRA 1N8NA 3P9ZA 2EERA 4W5TA 4BVBA 3ESBA 4AZ3A 5JSFA 4NFSA 2NZXA 2PUAA 3VKHA 1PR0A 3GZJA 4PLGA 1KIAA 4V0SA 1UWKA 2O2SA 3MWDA 4Y2YA 4DIEA 5HOQA 3AMVA 3C8MA 1TAUA 5DTJA 2ATCA 4RNCA 1ZIPA 2DWOA 4AY5A 1G2QA 1IEWA 1YU6A 1NW7A 1CJKC 1YRQA 4AS3A 4AJOA 2W11A 2X6TA 3IIKA 3TSZA 1RJ9B 3O4IA 3P2JA 4GVPA 2AQHA 3ZWOA 1XNQB 1IBRA 4HDAA 3Q6NA 1RC0A 3S2EA 4DMKA 2I2BA 4WLVA 4TLMB 1SQSA 3WLAA 1WD7A 1YUBA 1MAWA 1ZOPA 3CF4A 4C7XA 5KX5F 5HQ3B 1MN6A 1MT0A 3QLEA 2IZ7A 1DBQA 3GLQA 3OT1B 1XT6A 4RVSA 3OCWA 4IKPA 3LPNA 4I4CA 5HBGA 4I9NA 4ZIRB 3FF1A 3UJAA 4OHYA 1W6UA 1S2DA 1W5BA 3GJ6A 2AUTA 1JTFA 3NYWA 4YRCA 1E79D 1ULBA 1YTLA 1FX1A 4QOIA 4M9UA 2ZJ6A 5JSHA 2QQ5A 2YRFA 5EHGA 3WA6A 1FDSA 4BO7A 2FJUA 3MJRA 3V1MA 2E0IA 2VJMB 4DAEA 4U63A 1ZU4A 4ZYWA 1QZXA 3I37X 3H6KA 3FWNA 3URKA 3KC2A 1FPQA 1NMQA 2XMDA 1LPSA 1XCJA 1E9VA 1ZESA 5EWLB 1I9GA 4DWWA 3UMMA 3DOJA 1L5KA 4JI7B 1YB6A 3QKRB 3DCYA 2W4QA 2EFCB 3GQBB 1W49A 3K9NA 3F5DA 4MYTA 5IZ4A 3K70B 4TWRA 4EGFA 1N5IA 3UJ6A 2GFQA 2Z9BA 3M49A 3P1JA 1UWVA 5EP4A 4GPD1 4MQ4A 4MRRA 3V1KA 4DV7B 3PLAE 1T3TA 1QVAA 5HTOA 1L7VC 1Q7EA 3DW3X 1NF9A 4W5JA 3LQ1A 4X1YA 1GFIA 1L3BA 3IAS1 3JZFA 4OI4A 5GVSA 2XF8A 3GGDA 1E2QA 4E5YA 3OQIA 2O8DB 5A4FS 5A4JA 3ZCTA 5FWXB 4P4TA 3ACCA 4UNIA 2AI3A 2FEMA 1KKLA 3OF5A 2XQKA 3EE6A 3KQOA 4OD0A 1X1BA 2HV8A 4PG5A 4QPJC 5HDBB 5REQB 1QV9A 3G89A 3TQQA 3UXMA 3BT7A 2RSLA 5HRUA 5WRFA 5L7TA 1GG9A 4Y2UA 2IPNA 2ZVDA 3EOZA 4XQGA 3LA6A 5AHXA 1OBVA 3BD8A 3ZUGA 1ZNZA 1G3UA 3PFFA 3VJMA 2C3PA 4D9MA 3D3KA 3E03A 3GZNB 3H9BA 4XE5A 2IDJA 1SHKA 2JL1A 2XAAA 2Z8YM 3RODA 3S5UA 1U8AA 5H0IA 4LF7B 2CVOA 5LZ2A 2BVNA 4IX9A 1KMNA 3ASZA 4P5PA 4M36A 4A7PA 2XLCA 4OQLA 2I4IA 1LBEA 2V5UA 3EF3A 4ZI7B 4C3ZA 1MLDA 2VH2A 5IZCA 4FFLA 3J81A 3QU9A 2YHBA 4XCVA 2FE1A 3TX2A 4P4SB 3S1SA 5JT1A 2BKAA 4FJ2A 4D8VA 2VNKA 3TVDA 3ZS8A 1U0EA 1ZY2A 1ADCA 3JQRA 2UXDB 1I4LD 4MJ3A 3DTYA 1IXRC 1EFPA 4X90A 3ZS9A 1HLGA 4I6JA 4Q12A 2XE4A 3UG7A 1R6UA 3PE6A 3BGDA 4MX8A 5B6IA 4Y6RA 3OPQA 4ICIA 2WKPA 1NY5A 4QX6A 1A9ZA 2HLHA 4RY9A 5I01A 4D46A 1T5OA 4DLBA 3D64A 2Z09A 2FEXA 4NENA 3MN1A 2XNSA 3FWZA 3JQAA 2B92A 4OKNA 4QFDA 1ORWA 2RKWA 4KH0A 4KQCA 2C0CA 4D9FA 2HPAA 1P0IA 3TAHA 2JLBA 1I6LA 1KJQA 2IUYA 2ZANA 3JQ8B 3R0VA 2AKYA 2FV8A 5L7YA 1E9SA 2ACVA 2W2VA 3OESA 1T5TA 3L1JA 2BDTA 2GKOA 3HUUA 4GC5A 3NDIA 5FLKA 3VU1A 4RK4A 1H6AA 4YAGA 1FYEA 1T1IA 3A6JA 3L9XA 1PTKA 2HI0A 3O2QB 2X7XA 1TD9A 4PF1A 4BVAA 3IPYA 2HADA 2MSWA 5F1KA 4G8BA 1L5HA 2CK3D 3D6TB 2IHTA 2NSHA 1YKGA 3UG6A 4RX1A 1FNDA 2O2JA 2QR2A 5DXFA 3UMVA 2WUFA 4PR3A 4WDRA 1VLJA 3K15A 1V8BA 3QWBA 4FP9A 4I0WB 4MR9B 4YUWA 3PNYA 5I47A 3TUZC 3KK0A 3SICE 2P62A 3D8TA 1SURA 2O4UX 1U2ZA 1X2BA 3KWJA 5KYVA 1SHLA