4CLEA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
267
structure length
252
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQKSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
total genus 93
structure length 252
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cleA00
5COAA 3VZQA 3ZWNA 4CLXA 1KC1A 4JGBA 2C5AA 2IXAA 4UUOA 1EUCA 3W6UA 2WTBA 3EHEA 3EY4A 1W73A 4BQPA 3O8QB 1R37A 2Q99A 2PV7A 2Y1EA 3PGJA 4R3NA 4AJOA 3PZBA 3F5SA 5JDCA 1PZGA 3OIGA 5AVOA 2J3JA 1A4IA 1QYCA 2WEKA 3AM3A 5IXYA 1MP0A 2P5UA 1VM6A 2D8AA 1A9ZA 4OOEA 5JCXA 1LDNA 5EPOA 4Y6PA 2F00A 3GNSA 1VSUA 2ZB4A 5T67A 3L4BC 3C7AA 3ZWYA 3DONA 4BB5A 2VOJA 1MXHA 3K2BA 3EGOA 5L4NA 4FCCA 4NU5A 1ISHA 1J6UA 1A5ZA 1TT5A 2Q46A 1HDGO 3ONDA 2NVBA 4DC1A 4Q39A 2PA3A 3F1LA 3P7MA 3T4EA 2VT3A 5JC1A 4CUJA 3DDNA 3WIEA 1CETA 4IINA 4RJTA 3I83A 4YYZA 4YT2A 4CLRA 2H6EA 4ITUA 3RC9A 2HJRA 2FSVA 4L75A 5BSEA 1LTHR 2XXJA 5KKAA 2FR1A 2O2SA 1K3TA 4DQXA 4E0BA 4W7IA 2G5CA 2H63A 3AM4A 1E0DA 1GPJA 3EC7A 4J0EA 4WCFB 4CM8B 1X1TA 3ZWBA 1PL8A 3WSWA 1NPYA 1U3UA 2VUTA 3M6IA 1SMKA 2ZJ0A 4FFNA 1N5DA 2BFAA 3A14A 4PLHA 4CLDA 1SZJG 2D3TA 5CDSA 1BWSA 3HUDA 2JCYA 2X0RA 4MVJG 2O4UX 1O95A 4U8GA 4GX2A 4BNTA 1NBOA 4ND2A 3SBOA 2O4CA 2NWQA 5JCJD 5CG2A 5TT1A 2HJSA 1LSJA 5DZSA 4ZQHA 4BO9A 4YJDA 1YOVB 3WQRA 1Y8QA 2BFOA 3HDJA 4BMNA 5KJ1A 1EEHA 2PH3A 3LLVA 2EKQA 4ID9A 1X7DA 3DFUA 2VWGA 1VL6A 3GZ4A 1U3TA 1F8GA 5U4QA 3PHIA 1EQ2A 2ZQZA 3FNFA 4K26A 4CV1A 1XHLA 4Q3DA 1IOLA 1GAEO 4OH1A 4CM5A 4L9RA 4PLTA 1U4SA 3ZNOA 1H9BA 3W8DA 1UXJA 1NYTA 4IDAA 3INGA 4WJZA 4A0SA 3H9JA 3FNEA 4J0FA 1C1DA 2BF7A 5KJ6A 1H6CA 1F14A 3D5TA 3P2OA 3ASUA 3UGKA 4FIZA 2PNFA 1ORRA 1WDKA 3O4RA 5MGBA 1JU9A 4QECA 5BSFA 1FK8A 2NVUB 4RPJA 3IKTA 1KERA 1I5RA 1V9LA 4PZCA 1U7HA 2P4QA 3E18A 1JKFA 3R3SA 1U2GA 4IIUA 1GU7A 3GMSA 3HNPA 3HWRA 2X58A 2J3KA 2J8ZA 1MXFA 2AEFA 1OC2A 3FN4A 4LSWA 1M66A 1LQUA 3I9KA 4CUKA 4DRYA 3G0OA 5CPBA 3F4LA 1EK5A 2B36A 3CPSA 3QE3A 1BGVA 3I9LA 3N74A 3KYCB 1UDCA 1DEHA 5FYDA 2VRCD 1E3EA 2VHYA 3SXPA 2HK7A 4J7CA 1LX6A 5JSFA 5IDWA 2EXXA 4U6SA 3GLQA 3EW7A 3ZHZA 5K6AA 2Q4BA 1GTMA 1Z45A 4WUVA 1SOVA 4IMRA 1GD1O 4IM7A 5JDCC 1UR5A 1P77A 1ISFA 1LLQA 3D4OA 4P4GA 2VT2A 1C1DB 2GGSA 3QLJA 4Q9NA 4RVFA 4F46A 3H8VA 5I9NA 1J5PA 1H9AA 3GDOA 3IJPA 3GZNB 4R16A 3ZH2A 1UJMA 1U28A 3JQFC 3QVOA 2OHXA 1H2HA 3GGPA 3BZUA 4FJ0A 1FDWA 1OC4A 3GVCA 5C7LO 1IPEA 3RU9A 2X8LA 3HJAA 2VHXA 3AY6A 3ICPA 1GQ2A 4Z9YA 4CM7A 3OF2A 3ZWXA 4WLFA 4JJIA 1DO8A 4MO2A 4NPCA 1C0KA 5G4KA 2PD4A 2RIRA 1O89A 5JBIA 4JROA 4OSPA 4FPXA 1PZEA 1GEEA 3MJTA 2H5LA 1GUZA 2FOIA 2GZ3A 3SC4A 3WGHA 3T4XA 1HDXA 5L7YA 3G1UA 1KS9A 3CMCO 2Z95A 1BW9B 4EUHA 3C7DB 2AG5A 1CDOA 3VKUA 2VWQA 3QHAA 4XQGA 1ZMTA 3DR3A 3PLNA 4BKRA 1LI4A 2VN8A 4NHEA 2DAPA 4MVJE 2AE1A 3QVSA 5KJCA 1NHWA 1XR3A 5KNLA 3NJ8A 2VHZA 3LSYA 4BO4A 4O5OA 3DMTC 1PJTA 1XIVA 5A9SB 1ZNQO 3D5QA 3VHRA 4EBFA 1U9JA 5DT9A 2WE7A 1I3KA 4DXHA 1UZMA 1PJ2A 2HMUA 4OM8A 3FTNA 1P33A 5CDGA 1DRVA 4YJGA 1SEPA 3AFMA 4AJJA 3OJFA 1DFIA 4OQYA 4BKPA 1DRUA 1E6EA 2JD1A 4CLOB 4EDFA 4UVGA 3TFQA 2Z5LA 4CMGA 4R5MA 3KRTA 4NFHA 3RWBA 2EF1A 3ZWVA 1ZSNA 4J1QA 4YDRA 1UXHA 5EMHA 4BO3A 1NR1A 2AMFA 2Y1DA 2J3HA 1YO6A 1WDMA 4Y98A 1SEVA 4TWRA 3KLPX 3QW2A 3RKUA 4J4HA 2I67A 1Y8RB 5THQA 3ABIA 4XJTA 1KC3A 1ZKMA 3NJ4A 2FPIA 2IRWA 3ANMA 4J3FA 3RUCA 1I8TA 4M89A 4YXFA 5KKCA 1HKUA 3ZDFA 1NXQA 4NBUA 3ST7A 4DPMA 3JQ6A 4TRRA 4I9UA 5EL0A 2NU8A 3GVHA 3IUPA 4D46A 4RV9A 4Z9XA 4BGVA 1YWGO 2C54A 4NBTA 3WIDA 3BIOA 1HE3A 5ADHA 4ZQEA 4TMFA 2BD0A 4CM1A 2I3GA 1Z7BA 5F1OA 5F5NA 3F6YA 4D3DA 4PG8A 3JQ7B 3VVCA 5KJFA 1LDYA 1VI2A 1NWCA 2JD0A 5ES3A 2DBVO 4RDHA 5BNTA 1N7HA 3ENKA 4JCOA 5ICMA 3CE6A 3VH3A 3H3JA 4BKQA 1YB1A 5FWNA 2HUNA 2JFFA 1WZEA 1IZ9A 2EIHA 3IC5A 3MJVA 4JQCA 4BNZA 4GMGA 1PGNA 2NM0A 4J16A 2NU7A 1LJ8A 5JAIA 2BRUA 2G82A 5K0ZA 1ZSYA 3HDQA 1VJ0A 4GSLA 4ONEA 8ADHA 1M67A 2YFQA 1ZEJA 2POQX 1LXCA 3JD3A 4WKGA 4WLOA 3JYPA 3RI3A 3DHNA 3FWNA 4B4UA 2GZ1A 4U7WA 4NJOA 1ZK3A 2W2LD 1VL8A 2BI7A 3BTUA 1IHXA 4GGPA 4XYEA 1V3TA 3GT0A 2AG8A 3GQVA 1P9LA 2R00C 4FQ8A 4HNGA 2DBZA 1IHYA 2QQ5A 5EIOA 1MB4A 4YAJA 1E3WA 3F5QA 2X0IA 2Y0CA 3KXDA 4AJLA 4CM9D 2AA3A 3I5MA 1VL0A 1PQWA 1A7AA 4HBGA 1OI7A 3IP1A 4M87A 3WGOA 3JD0A 3V1UA 5HBRA 3ZV5A 4ZU3A 1OBFO 1EZ4A 2IEDA 1YRLA 4CV0A 1P44A 1RJWA 4ZRNA 4QUKA 4MVJM 4KMSA 3CINA 3FTPA 4N5NA 1BXKA 3DBHB 1D7OA 5GMOA 3VZRA 3QWBA 3R0IA 1MV8A 4JP2A 4DLBA 4U0JA 4YJGB 4BV9A 3IDSA 2GDZA 3PWSA 2QHXA 4NI5A 4FW8A 4GX0A 4WPGA 4LMPA 3ZI0A 2W2KA 1K0UA 5EESA 4OYRA 1V3UA 4J9UE 4NZ9A 4U5QA 2HMSA 2JKVA 1NQ5A 3QVWA 3S1LA 3OJLA 2PD6A 3HG7A 4A27A 3PFFA 4ZHSA 3E82A 3GUYA 5H81A 1BVUA 5T8KC 5DBIA 2A4KA 2HK8A 3HFSA 3ZZNA 3WSVA 2FHSA 4RPGA 3IKVA 4XQCA 5CHEA 3ZNQA 3RUAA 3HHPA 5T64A 4UVDA 3QRWA 1ZH8A 1DB3A 2IYPA 3TL3A 4DLAA 4AJIA 4RQUA 1VKOA 4DC0A 4CL8A 4WEOA 4C7KA 4NBVA 3WGGA 4EUFA 4J91A 1VSVA 1IY8A 1MG0A 3LDHA 5A5FA 1YDWA 4FJ2A 1E3SA 4MKXA 5DULA 3U4HA 4QO8A 2WJPA 1PGOA 2O23A 4NFYA 3GA0A 4XEHA 4CLHA 4OXKA 3FI9A 4XGIA 2J5KA 3TJRA 1PJCA 5DP2A 2VRCA 4OJNA 1PR3A 4JJGA 1ZBQA 4AVYA 5L7TA 3TSCA 3KBOA 4B8ZA 2AXQA 3TZHA 1F06A 1K6JA 3AY3A 4ZD6A 1AN9A 2VUUA 1XSEA 4E2XA 3BTSA 1B8UA 1GR0A 4JN6B 4FC7A 4AJPA 1W6UA 2ZTMA 4XR4A 5EERA 2X9NA 3B6ZA 4EI2A 1NVGA 4BNMA 2R00A 2ZYAA 4KDFA 5IN5A 4CM4A 3JQ9A 2X0NA 2PZKA 4IIVA 1A9YA 3AY7A 4F45A 3FPCA 1M2WA 2EV9A 1Q0HA 3PLRA 1PGQA 3LT1A 3VTZA 4BGEA 3BHJA 3LLSA 3DTYA 1E1MA 1I3MA 4JBIA 3C85A 2RH8A 3ENNA 2X5OA 2PH5A 2V7PA 3VC7A 2O3TA 4F6CA 5L53A 1NX6A 3DQPA 1OMOA 1QXSA 3BMQB 4Y67A 5CEEA 3FCOA 1UDAA 3AUAA 2WYVA 3GNTA 3M2TA 4UVHA 4M86A 1ULSA 4IGFA 3PWZA 4DIOA 3A1NA 3K9QO 4XRGA 3G3EA 2YQ4A 3EDMA 2YZ7A 2ZCVA 1CIVA 4WGGA 4X54A 4BMSA 1YE3A 3FR7A 1PWXA 3TL2A 4PFJA 1B7GO 2Q4EA 4GSKA 4UEKA 2Q1TA 2ZKLA 3KYDA 3WGQA 4GI2A 1C0PA 3AM5A 4YJHA 1TT5B 4MP3A 3S2EA 1ISMA 4R68A 5CAEA 4WLNA 3DBVO 3VOSA 1MG5A 3K31A 3RUDA 5KVVA 1K5HA 2VYNA 2E48A 4JJFA 3WOHA 4BL5A 1NVMB 3DZHA 4XYMA 2EKPA 3WLFA 4YAKA 4Z6KA 2UYYA 4DBVO 1AXEA 1F17A 4XB2A 5A4DA 4Q3EA 1BXGA 1I3LA 5DF1A 2QRKA 2ZB7A 2QG4A 4JLWA 2Y1CA 4CQMA 2W8ZA 4J1SA 3PPIA 2C20A 5IDQA 3DOJA 2X23A 2CD9A 2Q1WA 3PEFA 4MVJD 1PU2A 1VLLA 2EWMA 3SVTA 3TZCA 3IP3A 2QIOA 4PLYA 1GUFA 2EHDA 3RROA 4PIVA 1DSSG 4Q3CA 3G17A 2HU2A 3IQDB 4XJSA 3ZN2A 3S2GA 2JFGA 2UV8A 3W4KA 3H2ZA 2OORA 3GVPA 4Y8VA 1X15A 4R5HA 3Q9UA 5CP8A 1RKXA 4IQ0A 3MCVA 1CJCA 3ZU4A 4RZHA 4PRKA 3VPFA 2CMDA 4J1NA 4YJFA 3WYBA 3D64A 3MOGA 2W90A 1IPFA 2CVQA 2A35A 3LF1A 1XU7A 4PLPA 1R12A 5JPIA 3D3WB 4XYLA 3R6DA 2VYVD 2PGDA 2RHRA 2V6GA 2OXIA 3VZPA 4D45A 2VHVA 5TSDA 4M55A 1DJQA 1P1HA 5BNFA 4KOAA 3KM0A 3U0BA 3WQSB 2OP0A 4M49A 3WXBA 1O5IA 2E4AA 4DA9A 5IN4A 1WAMA 3UXYA 3ZHXA 2NQTA 1I2BA 1XU9A 2GASA 4DIFA 4YPOA 3KZVA 4YR9A 2Y67A 3HQ4O 4FD3A 4JK3A 2ZTVA 4EW6A 2JCXA 3JV7A 1JVSA 2AQ8A 4TRNA 2GNAA 2ZTUA 3VPGA 2NVUA 1QP8A 1ZK2A 5IDYA 2Y1OA 3PQDA 5F5LA 3UW3A 4HY3A 4XR9A 5KWEA 3ETEA 2C82A 4YVFA 3U09A 3C8MA 1ZMOA 3ON5A 3RBVA 1PGJA 1GL3A 3KSUA 4BO2A 1V0JA 4J2OA 5DBGA 1NQTA 3JQDA 3U62A 1PJLA 1GPDG 3RU7A 3UKOA 1FMCA 1N7GA 2ZK7A 3ETDA 2I65A 1LLCA 5B4UA 2G17A 5I8WA 2DM6A 6LDHA 1AGNA 4PZDA 1IE3A 4CQMB 1P1FA 1R66A 1I01A 4DQUA 5KIAA 4FC6A 4WEQA 3ZWWA 3T7CA 5JAZA 3LT2A 4OGWA 2IXBA 4IJWA 5A3VA 3GMDA 3VPHA 5EN4A 3V2GA 1GZ4A 3DBLB 4CR6A 4CPDA 1EDZA 1R4NA 4D43A 1ADFA 2DU8A 3FD8A 1QKIA 5G0UA 3NV9A 2Q45A 2DPHA 1F0YA 4P38A 3RJ9A 1ADBA 1ISJA 4GLLA 3L6OO 5JNLA 1PL6A 1PQUA 1P1RA 4UUNA 5G0SA 4W82A 1M6HA 5I7FA 1PJQA 1YDEA 1BXZA 2OO5A 5DOVA 4IDFA 3AI2A 2ZATA 1E1LA 4BNWA 5L7WA 2FY8A 1K6IA 1YJQA 3PWKA 3WQQA 3MJEA 2IZZA 5JDIC 4D3FA 4IQ8A 4NDNE 4C7JA 4PG6A 2O50A 3KYBA 4XRRA 4HV4A 3INRA 2P91A 4LRTB 4PGFA 1DHRA 1KY5A 4DVJA 4WOKA 4TZTA 4NU6A 2OOSA 1WZIA 3WLEA 2FSSA 2VNAA 3DZIA 3CTMA 3PFWO 1KVUA 5FI3A 3C1OA 1VKNA 2H1SA 4R01A 1HWYA 4J49A 4L73A 1JAYA 2GLXA 3U4IA 3DEYX 2QRJA 4INAA 4BO5A 1B2LA 3FRJA 1HRDA 5AXCA 3IOYA 1PJBA 4FS3A 4O59O 1JKJA 4PVCA 5ITWA 4TVOA 2HSDA 2NLOA 4IDGA 2VWHA 2BFPA 5IAAA 1HEUA 3OHSX 4MVJP 4GKBA 2WD8A 1DLIA 3GEMA 1T1RA 2VOEA 1U7TA 4CJXA 4GBJA 3RUEA 3PYXA 1NFRA 4E30A 5DNAA 3C7CB 1I32A 4F6LA 4Z9FA 5LDHA 3NDIA 1DC6A 5T57A 3GFGA 2GF2A 3OBBA 5T8KA 1ARZA 3DTTA 2JAHA 2HCTA 2EERA 4AJEA 1EK6A 1UUFA 2JD2A 1C1XB 3F4BA 3OH8A 2AHRA 3HB5X 5ILOA 1TXGA 3C24A 4YJHB 4CQLA 1HT0A 1ZJYA 4EUEA 2VZ9A 1YB5A 5JS6A 3OSUA 4UULA 4OL9A 4EJ6A 3DMTA 3I4CA 2C5EA 1PS0A 4R1NA 1GUYA 1WPQA 1JAXA 3IUSA 3TF5A 2WWRA 1P3DA 2D4AA 2HKIA 2GZ2A 1OOEA 1X0VA 3GC6A 3G1TA 2P9GA 3QA9A 4RGBA 4M8SA 5IZ4A 2AQHA 2IZ1A 3LVFO 2NADA 2Q50A 3QV1A 2DUWA 3P2YA 3PP8A 4YEDA 4BNYA 4D79A 4FN4A 1O0SA 4EZBA 4CMEA 4R4JA 4ND4A 1KY4A 2O7QA 3ROMA 1U8XX 1DAPA 2TMDA 1P31A 3AK4A 3ZHBA 5H82A 1E7QA 5BSHA 1I10A 1JN0A 3CEAA 3HN7A 3PHLA 4I5GA 4QT0A 1PX0A 3K6JA 4FFPA 3A9WA 4IUYA 3SLGA 2P68A 4QO7A 4E21A 1ENPA 1NR7A 4DYDA 3UOGA 1T2FA 4QFDA 3W4JA 1WWKA 1LRLA 4I5EA 4A26A 1T4DA 4HX5A 4W99A 1KEWA 3AUSA 1D1TA 2TMGA 1GV0A 2LDXA 3FNHA 5TRTA 2GN6A 3WWYA 2X22A 3WDSA 5JAQA 2EW8A 4L74A 3KOUA 1GV1A 2NTJA 1HDCA 3LT0A 4R41A 4CMCA 1PJSA 1ZCJA 4GAEA 4PVDA 1P0FA 3V1YA 4R51A 3KTDA 1E1NA 3TZQA 3H6KA 4W4TA 4B79A 1JLLA 3OJEA 4PLZA 5BT9A 1B8VA 3VPSA 2GRAA 4XKJA 4A03A 1BXGB 4EGFA 4J4TA 3EUWA 1ZFNA 4GKVA 4IZHA 3GVIA 1I0ZA 3PZRA 4FFLA 1O94A 1VJ1A 3O38A 7ADHA 2W98A 5J23A 4TRMA 4RDIA 4B4OA 3I6QA 1Y9AA 3X2EA 3JTMA 4BNKA 1K89A 2X1HA 3K8ZA 4XWYA 3UCEA 4KZPA 4Y6SA 5CEFA 4YB8A 3ZV6A 3QWIA 1BG6A 3ZU5A 4OO3A 4XGKA 4YRBA 1UZLA 4DIBA 2X86A 1LDBA 3ASVA 3AI1A 3CSDA 1HE2A 3I1JA 4O0LA 2D1YA 2WD7A 1S7CA 2HRZA 3HE3A 4J7XA 3JQEA 2LDBA 3UH1A 3HN2A 1ZXLA 2C29D 3RVDA 1ZK4A 3ZNPA 2D59A 3G79A 1X7GA 4BNLA 3PQEA 4GL4A 3VZSA 3FBTA 3GOHA 5L3ZA 5A1TA 3AW9A 1BDBA 2BI8A 1CQIA 1HETA 1YL5A 4MP8A 4Q3NA 4DWVA 4MIEA 4IS3A 5CPFA 4MVJH 1B3RA 1R4MA 3H5RA 5JO9A 4OIMA 1HSOA 2OZPA 2PWZA 1LDEA 3QVTA 4L8VA 3S8MA 1C0IA 1CERA 1GCUA 4II3A 2DC1A 3IMFA 4EITA 1Y1PA 3COSA 1HTBA 1LRJA 4IGEA 1DOHA 1PS8A 3DXFA 3IL2A 2DVMA 3DOCA 2VYVA 4U0KA 5TC4A 3VKVA 3WGYA 4PLWA 1YBVA 3PJGA 6ADHA 3MTJA 4ND5A 2BFMA 3DAFA 4KUHA 3ADOA 4UVEA 3ZWAA 4ZVVA 3CIFA 3WX0A 4GPD1 4BIIA 4PLVA 5A02A 3KV3O 1G0NA 4MVJI 3BMQA 2NQ8A 3GG2A 1JDJA 3DZFA 3NAQA 4BO8A 4BO6A 1UXIA 4OQZA 5CFZA 2I99A 3KO8A 4J43A 4XYBA 1DXYA 5F3RA 1R6DA 1TB4A 3RFTA 2ZB8A 5IZCC 1E7WA 4P8RA 1D3AA 4PG4A 3CMMA 4QFCA 4BMVA 2I5PO 1EBFA 5L45A 2DTDA 1EFLA 1W8DA 4A73A 1E5QA 3L9XA 4IPTA 3V8BA 5EINA 1WXDA 3L6DA 2NNLD 3VDRA 1ONPA 4UEOA 4E5MA 3BMOA 9LDBA 5TX7A 4N54A 5B4TA 2NU9A 4J4BA 5EJ2A 1CEQA 3QSGA 4RF5A 3E6AA 4YA6A 4GH5A 2X5KO 3PJFA 4LCJA 3QJ5A 1BSVA 2Y0EA 1ENZA 5C3MA 5EQFA 3TOZA 3UN1A 3FSRA 1UP6A 4BO0A 3FHLA 1I36A 2OFPA 2WM3A 3JYOA 1O9BA 4O63O 1Q7GA 4RORA 3L4SO 3AFNA 4ZJUA 4CLRB 2O48X 1X0XA 5JLAA 3Q1LA 3CXRA 2I76A 3ZWMA 1RYEA 5DCYA 3PTZA 4I5DA 2OUIA 3JQFA 2YQ5A 3PJDA 1QORA 2HMVA 4W6ZA 4IZIA 4GVLA 1KOLA 3PHGA 3B70A 2Q1UA 1DJNA 3PHJA 3OEYA 5TS3A 4WK6A 5L9AA 5I7SA 1Z6ZA 2R2GA 4WOJA 1YL6A 3UFXA 5G0TA 1E92A 3B20A 1PR9A 2EJWA 3GHHA 4DTIA 1MFPA 4CV3A 1XWFA 2O3RA 3GHYA 4BO7A 3ZHYA 1YONA 1XA0A 2Y99A 3BTVA 5DBFA 4UREA 3BMNA 5DCWA 1NFFA 2Z1NA 3GRKA 3PIDA 3U49A 3KEOA 1H6BA 1I33A 4G5HA 4ND3A 3ZGYA 2P9EA 1TLTA 1NFQA 2D5AA 3ADPA 3NRCA 3PIIA 3KYDB 3AU8A 3NUGA 1GYPA 1UAGA 3KVOA 2R6JA 4J2HA 2Q2VA 2XAAA 2BGMA 3TZ6A 1W4ZA 2Y1FA 4NIMA 3VPXA 4R1TA 4BGIA 5AOVA 4C4OA 3KUXA 1TVEA 4W9NC 3Q11A 4D41A 4IDDA 1YOVA 1Z74A 3U5TA 1H94A 2C2YA 4IBOA 2VZ8A 3F1KA 1TEHA 2YDYA 3L0DA 4YQZA 2BGLA 1SOWA 3M1AA 3OETA 1C3VA 4XA8A 4Z3DA 3TOXA 5JE8A 3FPLA 1UAYA 4UVIA 3OECA 2PK3A 4ROSA 4ZQGA 3L07A 1S6YA 8LDHA 5CDYA 3ONFA 3GGGA 3JQGA 4TKMA 1QR6A 1LSUA 1QV7A 5A3JA 2FP4A 2YV2A 3NDRA 2BGKA 1NM5A 3E5MA 1NAHA 2E37A 3BMCA 3Q0EA 4Z0HO 3WNQA 2PD3A 2Q2QA 4BV8A 1NVTA 3WBFA 1ZZEA 2DFVA 5TJHA 1TI7A 1WW8A 3TQHA 1E3JA 3DBRB 1R0KA 5JO0A 4NBWA 1DIBA 1O6ZA 4YJFB 2FMUA 2W2LA 1SB9A 5HA5A 5A5EA 4CMBA 4PCVA 5FF9A 1BTOA 1LUAA 4XD2A 4E2WA 5F21A 1X7HA 4YCAA 4AG3A 3VH2A 5JXWA 1MFZA 4YT5A 1OFGA 3A06A 3EAGA 1ISGA 1D1SA 1ZO8A 3JQAA 1XYGA 2GD1O 3ZWCA 3DFZA 3FWZA 4XGNA 3JYNA 2OGUA 2G0TA 2YUTA 1AHIA 2RHCA 1R0LA 2YDXA 3ORFA 5COQA 5JFOA 4ND1A 4EEZA 2ZCUA 4CMJA 3AI3A 3ROQA 4MKZA 2GSDA 1VJTA 5L95A 4DQVA 2EP5A 1E3IA 1KBZA 2CY0A 3D0OA 3TPCA 4GWGA 1ZK0A 3ZU3A 3DL2A 2UUPA 4GMFA 1LDMA 1ZIDA 1Y6JA 5JY1A 2BLLA 4LK3A 1HYGA 3AOEC 4IDEA 4D42A 1QLHA 4DREA 4FBGA 3RQSA 4Z0PA 4CMKA 2YHIB 4FFMA 4RVDA 1Y8QB 4Y6RA 3LF2A 4YAGA 2EGGA 1A71A 4OOFA 2W2KB 2QX7A 5DDIP 2CDBA 3WYCA 3P5SA 1VE9A 1RPNA 4ALLA 1R15A 3RASA 4WNCA 4RZIA 4GVXA 3E1KA 4UUPA 3GVXA 2HAEA 4RVSA 1ENOA 2P4HX 4RLSA 3RD5A 1A4UA 1YQXA 2GPTA 2FWMX 3NTOA 5TJ9A 1C0LA 1IULA 4JP3A 5B4VA 2DTXA 2O3UA 2WYWA 3MTGA 1UXGA 5JCJA 2GR9A 5KVSA 2WSBA 1EVYA 1G6KA 1NPDA 4DBZA 5L4SA 1HDZA 3ROPA 1HZJA 3RBXA 4DLLA 4KUEA 1NHGA 4WCDA 1FF9A 3A4VA 3BMCB 1Q1NA 3TN7A 1K2WA 4N7RA 3C3XA 4FOSA 1T24A 1IUKA 5TLSA 2GERA 4M1QA 3GG9A 2WE8A 3KSDO 1A7KA 2CDCA 2W4QA 2AEJA 4BNVA 3STHA 4IJVA 3JQAD 4I8XA 4PLCA 4OKIA 5I9LA 4DL9A 1J49A 3FF4A 1GQQA 5F1PA 2FRDA 5AXAA 1AE1A 3V2UA 1ZSVA 3DAPA 4EJMA 2VYND 1HLPA 1HDRA 2PGJA 4GQAA 3CUKA 1GZ3A 4RL6A 1XG5A 5KVQA 3BMOB 3D4PA 3RCBA 2VQ3A 4HFMA 4H3VA 4B8WA 3GAFA 1KVSA 3RFVA 4QXMA 1LLDA 1I3NA 4DPKA 1WVGA 2DBQA 1T2CA 1IB6A 4L4XA 3ZCXA 2B0JA 1Z82A 3PJEA 2XPCA 1TT7A 1MA0A 4WCFC 3OJ0A 3WJAA 1H5QA 3HDYA 4ALMA 4A7PA 3PGXA 3RUIA 3KLMX 1ML3A 5ILGA 2OL4A 2A9FA 1T26A 3U3XA 4PZEA 3RC7A 1SPXA 2CUKA 3NT2A 3RC1A 1Q7CA 1DC4A 3GDFA 2IEBA 4WNIA 2UVDA 5CEJA 1I24A 2NTNA 5IG2A 1G0OA 2E82A 1NP3A 4Z0TA 3B1FA 4CMIB 2CVOA 2GYYA 4YWJA 3KSZO 3RUFA 4MIOA 2Y93A 4HFRA 1P1JA 1GFSA 4BNUA 2NTVA 2RH4A 3S2FA 3GF4A 3OQBA 3W1VA 1WDLA 4D44A 3AJRA 3JQCA 4CM9A 4L0QA 4XZ3A 4J6FA 4O1MA 1HL3A 3H9EO 3VDQA 1ADGA 1SNYA 2CNBA 4WLUA 2Y1GA 1N8KA 2NUAA 4JX8A 4CM3A 4UEJA 1I30A 5DN9A 1KETA 4NBRA 4CQLB 4GWKA 5C5IA 2PR2A 3JQBA 3EVTA 1UH5A 4B7XA 4FGSA 4R1UA 3N58A 4XDZA 1SO8A 3WTCA 4QTZA 5A03A 5L51A 3DHEA 5T5QA 1PZHA 1UP4A 4RPKA 5ITVA 4ALNA 4RCVA 2CFCA 3DO5A 3E9NA 3EYWA 4FGWA 4PG7A 4Z3KA 1KVRA 2CVZA 4CQMD 3BXXA 1P1KA 3KHUA 3O8QA 2EJVA 2HQ1A 2BH9A 3OIFA 3NTQA 3P19A 4LW8A 2Y05A 4Q3AA 3F47A 3ETGA 3GZNA 1D4FA 3KB6A 3LC2O 3DOOA 5G4LA 1I2ZA 2PZLA 2RCYA 4WECA 3GPDG 2PY6A 5IZCA 3ANNA 3GGOA 4QEDA 3KEQA 3RKRA 4QX6A 1EE2A 3AWDA 4XQEA 1LU9A 3JCZA 3U4CA 4XIYA 1YQDA 4B4WA 3LQFA 3NDJA 4FFOA 4LVCA 1PJ3A 1Y9EA 3OEWA 1MLDA 2B4TO 1MUUA 4MDHA 4ZRMA 1F8FA 1ZUD1 4J1TA 1Y81A 4CMHA 2UUOA 1U8FO 5JY6A 3QIVA 4P22A 2C0CA 1WP4A 4RQTA 3JQ9C 5KCZA 4JNKA 2J5RA 1DFGA 2VUSA 3ULKA 4TQGA 3GPIA 4NR0A 1CQJA 1NASA 1PWZA 4J9VA 1GZ6A 3X2FA 3LYLA 3HADA 4TSKA 4XDYA 2C7VA 4N5LA 3AU9A 1ID1A 4NK4A 2FPGA 2X6TA 1JWAB 4P4NA 2HDHA 2VCYA 3IS3A 1FDTA 4E6PA 5AXBA 2P5YA 4MOWA 5C7OO 3WWZA 3WR5A 1P45A 1Z7EA 1N9GB 3H9QA 3H4VA 3ZNNA 4XIJA 1YBMA 1E5LA 1LA2A 1B14A 2X9GA 1OAAA 4ALIA 3H5NA 4RF3A 2SCUA 2GO1A 4I08A 2G76A 1ONNA 1N1EA 1U1IA 1MX3A 1MGOA 1V3VA 4BKUA 4OXYA 1UP7A 2PKQO 3ITKA 3DZBA 5A9SA 4E4YA 2D0IA 1F12A 4E5YA 1GCOA 3BAZA 4BKOA 4I1IA 3W4IA 1WNTA 4XCVA 1R4NB 4ALJA 5I9MA 1X14A 3H9UA 3GN1A 1M76A 2ZQYA 3E03A 3UAGA 3EZYA 1XQ1A 1EVZA 2CF6A 3NEPX 4J7UA 5A05A 2J5QA 2A94A 4CMAA 3TFOA 3WGIA 4BUCA 4GLOA 4NFSA 5ENDA 3I23A 4GX1A 1L7EA 4NH4A 3SJUA 2YJZA 2PGLA 5JDIA 2DQ4A 1WLYA 3DWFA 3G49A 1N9GA 3OIDA 1T1SA 4AJ4A 4I9HA 1ZXBA 2QZ9A 1H6AA 2UAGA 4LCEA 4GGOA 4TRJA 3PK0A 3I4FA 1ZW1A 1XDWA 1ZK1A 3ANLA 4TKLA 5BNIA 1YH3A 4CLEA 1RYDA 3I9JA 2C07A 4FR5A 1KYQA 3DBHA 3I52A 4MKRA 4IY1A 2DTEA 2GN8A 3D4NA 2DFDA 4II2A 1RM0A 2EP7A 2EG9A 3GEDA 5LDGA 3E9MA 3C1AA 2NU6A 3K96A 3S55A 1AXGA 1E6UA 3JQ7A 3CZMA 2RAFA 2JAPA 1B15A 4D3SA 2V65A 4CR8A 5AXDA 4YRAA 4OMUA 1BDMA 3S2IA 3UCXA 2V6FA 5GZ1A 1B8PA 1JKIA 3R1IA 2VNSA 4PN3A 3WB9A 4L4RA 3D3WA 2JHGA 4CR7A 3GN2A 4CMEC 3WGZA 2X7HA 2IZ0A 3IAHA 1J4AA 4RVHA 3RJ5A 3L6EA 5GZ6A 3FNGA 1V6AA 2I9PA 1PIWA 2Y66A 2E49A 2VTDA 4BOYA 4WE3A 4KTVE 4KP7A 4E2ZA 4TVBA 1NPTO 3O9ZA 3H65A 3V2HA 4E13A 4LGVA 4OSOA 2C7GA 3E48A 1J0XO 3DZGA 4HNHA 2HO5A 1R16A 3Q2KA 1CRWG 4NJMA 1X1EA 4LMRA 3TZKA 1T2AA 3HB4X 4NG5A 1IYZA 4N5MA 5F1KA 2DBRA 4WCFA 1ONOA 4URFA 4XQ9A 4W9NA 1E3WB 5G4KB 4AL4A 2VZ0A 4KQXA 1E7MA 5LCXA 5IFLA 5BR7A 4IJKA 1E6WA 3LC1O 4BO1A 4A5OA 5FFFA 4D0SA 3H5AA 1Q7BA 5I7VA 4S3MA 5JAMA 1ULUA 4E31A 2O3JA 3RC2A 4E3ZA 2HMWA 1EE9A 1JTVA 1YGYA 4LN1A 4AFNA 4B7CA 1LSOA 1NNUA 4BVAA 2PKRA 1DPGA 1LRKA 1E1KA 1SB8A 3Q3CA 1BW9A 5TF4A 1FXSA 1HDOA 1CYDA 2X5JO 4RVUA 4BNXA 2QYTA 1Y5RA 3JQBC 3BHIA 3ITDA 7MDHA 2CF5A 2ZYDA 1DIGA 1LEHA 3RFXA 3RIHA 4O6VA 1Q0LA 3JD4A 1UXKA 2EGHA 4CV2A 1GDHA 1EMDA 1YVEI 4RVGA 1UDBA 2B37A 3DZJA 3H3FA 5KJEA 5HTOA 5H83A 1NTOA 4NK5A 3RUHA 1DC5A 3PYLA 4DGSA 1M6WA 3ZV3A 4YT8A 4CMIA 1ZVMA 5KOIA 3H9GA 3R3JA 3W6ZA 4DMMA 5FI5A 3ZWPA 1U3VA 3MEQA 1U4OA 4FDAA 1HE4A 1XELA 3K2EA 1B16A 3F3SA 1B3BA 3ZW9A 2ZTLA 3DBLA 4XX0A 4E5KA 4CODB 5HRUA 4B3IA 1OZAA 5DOZA 1T2EA 4FFRA 4QSMA 3AUTA 5TNXA 3BHMA 1Y7TA 2VWPA 3WMXA 1Q0QA 3NT5A 1UZNA 4BNGA 3V5NA 1MC4A 1BMDA 2O7SA 1BRMA 1V35A 1FDVA 2AEMA 2DT5A 2Z1MA 3KYCA 3QWFA 4KDEA 9LDTA 2HRBA 1PS9A 2B69A 3ZV4A 3GNQA 4BB6A 2AW5A 4ZICA 3U9LA 1H93A 1M75A 3CH6A 1E7RA 1ADCA 3I9NA 3DC2A 3UICA 2H9IA 3LZ6A 4GX5A 4ZQBA 3WYEA 1QYWA 4R9RA 1QV6A 2JL1A 4HUJA 4LSMA 3ICCA 2CSUA 2VHWA 3OA2A 1PTJA 4UUMA 2FZEA 1G1AA 4MVJF 4ZGWA 1WMAA 1YJ8A 3RBZA 3L9WA 1BVRA 3CZRA 4IMPA 5KVCA 2HMTA 3JYLA 3Q6IA 4OXNA 4DUPA 2Y68A 4R54A 3BA1A 2ZIZA 1KVTA 4BHTA 3F46A 3GRPA 1N92A 4IJUA 4JBHA 2XOXA 5I7EA 2YY7A 1E7YA 3NTRA 5DCUA 4YT4A 1XCBA 1HF3A 2GN4A 3PRJA 4PLGA 5T6BA 2PZMA 1XQ6A 5A9TA 2DLDA 1CF2O 4LVUA 3TNLA 1Z73A 3JSAA 1XLTA 3L4BA 1T2DA 3HFGA 4XYGA 1JW9B 2DKNA 2G1UA 3E8XA 3EK2A 2PKQP 4BNNA 2PZJA 4RF4A 1YS4A 2O3QA 3GDGA 4EYEA 5C7IO 3WFIA 3GUCA 4R3WA 5JMPA 1QMGA 3GFBA 4AJ1A 1LNQA 3OMLA 2PFGA 2JHFA 4G65A 2AQIA 2IYOA 5HWSA 3NGXA 1DAOA 1PSDA 3ONEA 4MVJA 4D0RA 4WASA 4M54A 4YAIA 3CKYA 5HM8A 3Q9NA 5TGDA 3B1JA 4B7UA 1YKFA 3W8EA 4J90A 2NVWA 1FJHA 3AOGA 2NACA 3VAZA 3UVEA 3D7LA 3SC6A 1NWHA 1E77A 2YHUA 4BS9A 2X9VA 3LC7O 2O2YA 5L4LA 4RO0A 2O3SA 1LBEA 5ER6A 1E3LA 2BELA 3A28A 2Q1SA 4P4LA 4MP6A 5A06A 4HADA 3SEFA 3QVXA 1GYQA 1PL7A 1ENYA 3F9IA 1JQBA 2ET6A 3TWOA 1EVJA 4XB1A 2GN9A 5CG1A 3DZKA 4WLVA 5CDTA 3VH1A 3AOEA 1SAYA 3I9MA 3I6IA 1KIFA 4WLEA 3VTFA 3K5PA 1C14A 1PGPA 1EFKA 2UDPA 3AUUA 1P1IA 1HYHA 1DRWA 1HE5A 1IZ0A 3PYMA 1QYXA 1VC2A 5U1PA 2CZCA 5IF3A 3UHAA 2B5VA 3B1KA 5IXSA 1ZJZA 1EVIA 1FDSA 2IDZA 2GUGA 4UAGA 2F1KA 5KTKA 3SJ7A 1H2BA 1CWUA 1PEDA 4DYVA 2FR0A 1YXMA 2OBNA 4JIGA 4YBZA 1QLJA 2P2SA 3IIEA 4TROA 5GZ3A 1L1FA 4CL3A 5JW6A 1YL7A 2C2XA 1B0AA 1Y5MA 1EUZA 4OHUA 2XXBA 1B26A 1I2CA 3O03A 4LISA 3NT4A 1O8CA 1U5CA 2ZB3A 1KEUA 2HLPA 4CUZA 3NKLA 5TIIA 4RPHA 2GCGA 2J3IA 1PJ4A 3OQ6A 1K6XA 2A92A 1DIRA 4F3YA 1MC5A 4G81A 5HS4A 4R9SA 3OA0A 3D3EA 4CM8A 4AJKA 3PQFA 2QRLA 2YFHA 3DHYA 4E33A 4DPLA 1DLJA 1EBUA 3INTA 3K73O 4CM6A 4HFJA 1SCUA 4IXWA 1HXHA 2Q2WA 3HSKA 2RBEA 4QQRA 1HYEA 5B37A 4S1VA 4BNJA 3JQGB 5K6AC 2B4RO 2B35A 3MJ4A 4R69A 1N1GA 4KTTE 2Y0DA 1QYVA 2ILTA 4RLHA 2V6MA 5ER9A 4E2YA 4K1LA 1GEGA 4IDBA 3PI7A 1BHSA 1U2DA 3I3OA 2WD7B 3E5RA 1L7DA 3SLKA 2YV1A 1QYDA 3UUWA 3BTOA 5ICSA 4Q3BA 1T25A 3LT4A 1LC3A 4CM4B 3V1TC 5L40A 2DPGA 4H16A 2OBYA 4K6FA 3I9OA 3QP9A 1P0CA 3WNVA 3PVZA 1H0KA 4AICA 1A27A 1AHHA 3JD2A 3RSHA 4B4VA 1LC0A 1H6DA 3H2SA 4ESOA 4IQGA 4ZQFA 5TT0A 5B1YA 2AQKA 1KEVA 3DB2A 3JQ8A 1EUDA 1R4MB 4PLFA 5COBA 1LSSA 4I9NA 2I66A 4NQZA 2QYSA 4NNJA 1RWBA 1KVQA 1SBYA 5A04A 1EQUA 1LLUA 3GEGA 2NSDA 3MWDB 3WBBA 3WFJA 1DC3A 3HZZA 2QZZA 4FOOA 4G2NA 4KWHA 1P74A 2FPPA 2VTEA 2DUUA 2VRBA 2OP1A 3U4DA 4H15A 3EMKA 2WDZA 3E9QA 5IDXA 3OJOA 4EJ0A 1YQGA 5B12A 4KQWA 2Q3EA 2YHIA 1HDYA 3DAGA 4K28A 1HSZA 4MJLA 1GADO 1GYRA 1R0SA 1U3WA 2EEZA 3K30A 1N2SA 4JXKA 4MPDA 3WICA 4JBGA 5CDUA 4R1SA 4N18A 1VRWA 5G0WA 5ENVA 3GH3A 1JVBA 3OQ1A 5DP1A 1AUPA 1NQAO 5JC8A 4BNFA 4HXYA 1DHTA 1Y8RA 3PXXA 3WS7A 4BQRA 1WMBA 5AYVA 1XEAA 4L76A 5I8ZA 4IXTA 2CDAA 2B5WA 3BYZA 4YAEA 2ZYGA 4PRLA 4I5FA 3NX4A 4YACA 1DIAA 2I6TA 1NAIA 4HKTA 2EW2A 2D5CA 4PG5A 3O26A 2QW8A 3QWAA 5HS6A 3W8FA 1DFHA 2E6UX 3PDUA 3RAJA 3LK7A 1LDGA 2JJYA 3JQAB 3ZW8A 5U9CA 3TRIA 3T7EA 2I3AA 3TDKA 2YYYA 4AJ2A 4LRSB 5BQFA 2ZJ1A 3WG9A 1DBVO 1XGKA 5GY7A 3SX2A 4Y9DA 3D1LA 2IE0A 3IJRA 3MJCA 3DMYA 1DDOA 3ZU2A 1SC6A 4HFNA 3OICA 5FEUA 5MDHA 4E5PA 4DMLA 3Q2IA 4OAQA 4BGUA 1GY8A 1Q2XA 3BMNB 1QRRA 2EKLA 3VH4A 4ALKA 4E12A 1C1XA 1D8AA 3M2PA 3QWHA 4FSHA 1TA4A 3WJ7A 1LQTA 1IL0A 4FJ1A 3MZ0A 4K6CA 4E32A 2J6IA 3MJSA 4YQYA 3QY9A 3C1TA 4IS2A 2FN7A 1V8BA 3KETA 3MOIA 5JYDA 2YW9A 4A10A 2P9CA 5IJZA 3PDJA 1XKQA 2JCVA 4U6QA 1RM5A 2JFHA 2XF8A 3FR8A 5A9RA 4YRDA 5G2OA 2X4GA 4IDCA 1E7SA 2YV3A 3VVBA 4EEXA 4W7HA 4NMHA 5C37A 2D2IA 4KWIA 5K9ZA 3EZLA 2PTGA 1PQPA 1JWBB 1QSGA 1YB4A 3N7UA 1EDOA 2BMAA 4AJHA 4TZKA 2B4QA 2WYUA 4K9DA 2FR8A 2OMEA 5JMWA 2C59A 2HK9A 4ZN6A 2BKAA 3OP4A 3FBGA 4YTEA 3WMWA 1T4BA 1RM3A 4MIYA 3UF0A 3JQ8B 2FZWA 4KUGA 2B83A 3EVNA 5G0VA 1HZZA 3LU1A 3DBRA 2IODA 1DIHA 1HLDA 4HWKA 3WGTA 1YBAA 2AE2A 4MINA 3GY0A 1ZEMA 4CLOA 5JYEA 1JA9A 4BNIA 5EQDA 5BSGA 3QQPA 4AJNA 1W0CA 3GAZA 5TQVA 2PLAA 5AQ1A 2BHLA 4E5NA 3GK3A 4BNHA 3MWEB 3ZWOA 3H7AA 3JD1A 1X13A 2X0JA 5LC1A 3WTBA 1ISIA 1FDUA 3PHHA 2V6BA 1VPDA 1Z75A 3GR6A 3K92A 3M1LA 3OFSA 5THKA 3OM9A 3UCFA 2WMDA 1NQOA 1QG6A 2NV6A 4RF2A 4ZA2A 4D7AA 3NGLA 4NJMB 3HDHA 4H7PA 4ILKA 1PZFA 3NYWA 1KEPA 4L4SA 1RM4A 3ROKA 4FB5A 4HP8A 2Q49A 3L77A 1GQYA 1U5AA 4A2CA 4B3HA 4OKNA 1A72A 3JYQA 4B3JA 4RPLA
chains in the Genus database with same CATH superfamily
1FXWF 3VZQA 4YO7A 4C2AA 3QIAA 3VSBA 3GUVA 4U2EA 1P8AA 2C5AA 2YWGA 3TO5A 3CEPB 4C88A 1XO1A 1WW2A 3Q6MA 3CXUA 1VJDA 4N03A 4M1YA 4EG6A 1VKJA 1R37A 1ODKA 2Q7OE 2PV7A 1M1YB 2YWEA 1T35A 1TQ6A 2ZBUA 3KXLA 4Y30A 5DNYB 2J3JA 1MJGA 1QYCA 3LCRA 4RADA 5GVSA 2SECE 5IXYA 4YJ2A 2DKOA 4TMZA 1ZA1A 2D8AA 3E81A 2WAYA 5CA1F 5JQGF 2VJMA 2F00A 2WU8A 1MB3A 4FHDA 4BMPB 3ZXSA 4TV9F 1IIRA 3C7AA 1SXJA 3ET5A 3RU2A 3R20A 2XW6A 1MXHA 2IIVA 3Q4GA 2LKDA 4FCCA 1ISHA 3P20A 1TT5A 3BCRA 3DT9A 5E9JA 3TW0A 2D0OB 4EI9A 1RI1A 3H4TA 4HQOA 2RFLA 3QX7A 5KNDD 3P7MA 3IKJA 4RQBA 4U9HS 3RTDA 1GITA 2VT3A 4Q66C 4RMJA 5JC1A 1V1RA 1X2BA 3X1MA 3UK2A 3GUHA 5CTAA 4IJ6A 4CLRA 3R8FA 1JDZA 3UGQA 3RC9A 3KU1A 2FSVA 4TKUA 4OHWA 3T9EA 1EUDB 1HA3A 3FF1A 1DWPA 5DV9A 2BOVA 1K3TA 4LDRA 5FNZA 4DQXA 4W7IA 2G5CA 2H63A 2UYHA 2AC7A 1GPJA 1BKSB 3EC7A 4J0EA 5J2UF 4ARCA 2B6HA 1YIOA 2GA8A 2FRXA 3NONA 4J0DA 4H3SA 4FOTA 1OCEA 5ELLA 2BDUA 2WNSA 1V4VA 1SG9A 3ZZ0A 4B6SA 3M6IA 5JNVA 1I6LA 1SMKA 5EVJA 3R7FA 3W90A 4DANA 4FFNA 2ZWVA 3E8MA 2BKEA 4IDQA 1JHMA 3DUFB 4HH4A 5AI0A 1L7BA 2EKBA 3RM3A 4CLDA 1TC1A 4D98A 1QUFA 3LA6A 3OWOA 1EGAA 3LKVA 1TQHA 4AS2A 4RMGA 3HUDA 2R7NA 2X0RA 4MVJG 2O4UX 1U1CA 3U44A 5JADA 2OR3A 2GZHA 3L01A 4YASA 3VR5A 3EXG1 4DQ0A 2DPXA 3KEGA 3AH8A 2ZWIA 2WU0A 1YSCA 4N7MA 1NNSA 1Q21A 1ULTA 5CVEA 1PBTA 2I9KA 4RABA 5CG2A 2JI8A 3KCQA 3LDGA 4HAUA 1O0CA 3BGOS 4NECA 1CY6A 4BO9A 1L4EA 4C29A 1M2OA 2QSUA 4FT2A 1T8PA 2JAOA 1YOVB 3NKVA 4ZK2A 1RD4A 1Y8QA 2BFOA 4Q4AB 5KJ1A 5M2QA 3OTIA 2RD2A 4O8ZA 3Q3EA 1WZ2A 1K98A 2CB0A 2VT7A 4CL0A 3GZ4A 4HZUB 1FDOA 1M5RA 3ECAA 1YVPA 3NPMA 3IKLA 4UQLA 1EFVB 1EGVB 4ZZ2A 1IHDA 1Z38A 4L7QA 4OH1A 1KKMA 3VU3A 2D0DA 4BE7B 2NSHA 5I6DA 3IOMA 5CLFA 4PHCA 3PD1A 4HX2A 5TQ0A 2QRZA 3AMVA 3RLIA 1MIHA 4EKYA 1TE2A 3INGA 4MCIA 4B32A 1NXWA 4A0SA 3EXHA 3ZD6A 4J0FA 3RODA 3AL2A 4YRQA 2J9ZB 3B6KA 5KJ6A 4IV5A 4S05A 1NX9A 3LBNA 3ASUA 4MI3A 2NAFA 4FIZA 3A6KA 2VBFA 2EAUA 2BMEA 3QVVA 3KNZA 1K8QA 3EIOA 1ZUNB 1E1RA 1KXZA 1TUIA 3HB9A 3O4RA 5MGBA 4QJ4A 4YV1A 3NGMA 4PAGA 4DCTA 1SVNA 3ND5A 5ITZB 16PKA 2DP4E 1FK8A 1RABA 3L0CA 5LQCA 4RPJA 1KERA 1J09A 1DADA 1I5RA 4IHJF 1PK9A 2BISA 4JC5A 5D6NA 1JAZA 3EIFA 5EJAA 3FZYA 4YS6A 2P4QA 3R3SA 5H7XA 3LHSA 1U2GA 2GYWA 3GMSA 3GLHB 3HWRA 2CVFA 2W6ID 4MV3A 2J3KA 2D8MA 2J8ZA 1MXFA 3BF7A 3MGGA 3FN4A 4R2WA 1TYCA 1GVHA 1M66A 1LQUA 4M7WA 4CUKA 5E1OA 4DRYA 4YV7A 1Y1QA 2IEGA 1XWWA 2C92A 2H17A 1USKA 3I9LA 1IG3A 3KYCB 4MUHA 4IIGA 4CETA 4JL8A 2QMHA 3LL7A 4AROA 1E3EA 2F64A 1MRNA 2HK7A 3J80A 1LX6A 5HZHA 1RRVA 2EXXA 2Y77A 2WQ7A 2JZOA 4ZREA 1RQLA 1GTMA 1MT3A 1Z45A 2XNDD 1SOVA 3R41A 4EHAA 3OQOA 1MGPA 4UHEA 4WAUA 3CW8X 1Z6TA 3GGCA 4GBED 4P4GA 4EHJA 1C1DB 5I9NA 3KFVA 4ZOBA 3S29A 2WR8A 1J5PA 1XB2A 3H18A 1Y42X 3GZNB 4R16A 3ZH2A 4YRZA 5CCBA 1UJMA 3JQFC 5LN1A 3QYFA 1R00A 1TM4E 5HFNA 5JH7A 3N2EA 2QM8A 4MW2A 4QQ8A 3HHEA 2XDWA 3M5PA 1BU5A 1FDWA 3HGTA 2PT6A 4MW7A 4QDKA 5C7LO 4TMVA 2X8LA 1OXXK 2VHXA 3AY6A 3ENZA 2DSTA 3ICPA 2PR7A 2HIHA 4PO1A 4QU8A 3UAYA 1ECJA 1UJ5A 1N33B 3LUFA 2H0RA 1IC6A 1DO8A 3FMGA 4N76A 4WZBE 2VRNA 2B9EA 2J9GA 4KHZA 1NUHA 2O8CA 4IHJB 3MB8A 2O2ZA 1ZRMA 3FDZB 1VG0B 2X4DA 5JWRA 1GPNA 1ISRA 2H5LA 2GBCA 1YZ3A 3I5UA 4P80A 2NUTA 5JD3A 2VDOB 1RIFA 4IGKA 4FI3C 5L7YA 2ICAA 3X1WA 1NULA 1AGYA 2ZIXA 3G1UA 1KS9A 1YIDA 2OGSA 4M1ZA 1KOJA 5FPKA 5D7NA 3E84A 3VKUA 3ZD9A 4MW4A 1XD9A 2Y92A 3ZHUA 4XQGA 1CRQA 2KLBA 3KOMA 1EWYA 1SD1A 3ASYA 3RTAA 1AUOA 4DQLA 1JIXA 1LI4A 2VN8A 1U8AA 4WD3A 2IWHA 1W2WB 2YIJA 4A1FA 2HRRA 5A9RA 2QTMA 3F9RA 5JNUA 1HYQA 1FW8A 4O4HF 2AE1A 4MIKA 2P0EA 1M2OB 1S2OA 3O93A 1PZMA 2VHZA 3LSYA 1MJGM 4FR2A 4TX1A 4F9FA 3L04A 4PR0A 3T1VA 4Z7OB 5BOSA 2GWRA 3CSSA 2D1SA 2YXEA 3FFBA 2CMHA 4JJ6A 5GJWC 1M7GA 2WE7A 3U4MA 4DXHA 5GIOE 5EYPB 4UUQA 1SXJC 3GEPA 1P33A 3OX2A 5HMMA 4U2GA 1GZVA 1QTQA 3AUSA 1XVIA 1WR8A 4RYDA 1BE0A 3DDOA 2FPPB 4A2PA 4U7DA 2VYCA 4TMXA 2EBWA 3IQHX 3R77A 1ZWLA 2ARKA 2O0MA 4H59A 2FUCA 5ERXA 4F7DA 1MB0A 2Z5LA 4RY8A 1YU9A 3RSGA 3W77A 3VYRB 1JYEA 3BQMB 4X93A 1GGFA 3I9FA 4KKVA 4N0QA 4Z9AA 4IUCS 1U3DA 3GLFA 4NS4A 1JKXA 5EMHA 2LR0A 1NR1A 3LBHA 2AMFA 4JVOA 3R7WB 4D9IA 2QG6A 3NHAA 4R83A 1AMOA 1WDMA 4D97A 1ECCA 2C4KA 2QN2A 2BWJA 4C0SA 3PE6A 4DB2A 1SN7A 4P4SB 4MICA 2GD2A 1KC3A 1ZKMA 2OGWA 4XJTA 4IO1A 3WB0A 1H2AS 2W2XA 4HDCA 4ZOLA 1FOEB 4B71A 3RUCA 1JG2A 1G42A 1MF7A 4K5QA 1I8TA 4M89A 5KKCA 2H51A 1IOWA 1ZUWA 3QI7A 5IJ0A 1NG1A 2BJHA 3OJWA 1NXQA 4N49A 2JVKA 3N2YA 1DKRA 1DVRA 1TRKA 1ZU4A 2IW1A 1Y6RA 2IU6A 1H42A 5TMPA 3GVHA 3EYAA 4PO3X 1J8MF 4KNWA 4Z9XA 1N3YA 3NYQA 4AS3A 1AO3A 2C54A 3WYGA 4KQMA 5CDFE 4UHBA 1Z56C 1CY0A 3LYUA 1KI2A 2XY4A 5CLIA 4ZQEA 1XD2B 1T4GA 5KNCD 2C5GA 1ZNYA 1E0SA 1SZCA 2OWDA 2HDOA 5F1OA 2I4MA 1HLGA 4KQ1A 5CFRA 4GM4A 5DTMA 5KJFA 3EEOA 1XCPA 1PWHA 1VI2A 2H3EA 3A2NA 5ES3A 2ZR8A 2DBVO 2LCIA 1ZD3A 5BNTA 2F43B 4MQLA 3N0WA 1O2DA 5EP2A 1RAGA 5IU6A 4Z4FA 4BKQA 2CFSA 2R6HA 2ANBA 5FWNA 3MJVA 2GPSA 1IZ9A 1G3UA 1PLLA 2EIHA 3IC5A 2ZIXB 1RBQA 3CX4A 1PGNA 4NENB 1Q0PA 4YMUA 2ERCA 3EXG2 1NLUA 4YQEA 3KKLA 4J16A 2JGEA 3KQWA 2FUEA 2R1TB 2G82A 3BBLA 4FZRA 4JUAA 2CLEB 3BDIA 4PNEA 5AVJA 1EWQA 3U7FB 8ADHA 1USVA 4HAWA 2ZBGA 2IU4A 1ZEJA 2QL6A 1LXCA 2YFQA 3D8NA 3HWWA 4WKGA 3VNSA 4WLOA 2WG2A 2VXCA 1S2LA 3HFJA 4V03A 3RI3A 1F4VA 5A0FA 3HJBA 4FBMA 4DV7B 1V4BA 1ZK3A 1UDXA 3EMDA 3T5TA 4COOA 4F71A 1B41A 3G9XA 1V3TA 3OTGA 5LYYA 1MIOB 3GXBA 2YMQA 3GQVA 3TCNA 1P9LA 3VNQA 5EE3A 2R97A 3NCTA 3PEEA 4ARZB 3QITA 4JSYA 4EECA 4QLBA 4C78A 2P6NA 2XCRB 2QD5A 1EE1A 4ZEWA 4EYKA 4YAJA 1E3WA 2YNMC 10MHA 2Y0CA 5I7RA 4UQPA 4AJLA 4BYMA 2PJUA 1SBQA 1I6MA 3MCZA 4WA7A 3HNOA 3STYA 4HBGA 3EGDB 3DFKA 2AMLA 4B3RB 1OI7A 2QIPA 3UW1A 3WIUA 3B2QA 1RRGA 5BV1A 1CK4A 3JD0A 3AKZA 5IM4A 4FR0A 4MS3A 4NESA 3IXLA 3G5TA 4IIEA 4V0LA 2IEDA 3M6AA 3ZV5A 1NJGA 2BFNA 3N6VA 5MN5A 5HTKA 1CE8B 2RARA 3E2MA 1G8AA 1RJWA 4JLDA 4JY7A 1L9KA 3I05A 4MVJM 4QUKA 4Y9UA 4ZRNA 3EZ7A 3A6PC 3TLGB 2I4IA 3DZCA 3LLMA 4ZVTA 3EQ9A 1D7OA 3FMIA 4OQMA 4PF1A 5GMOA 1A98A 3QWBA 1X1SA 1Z13A 3R0IA 4LC0A 4TV9B 3VZRA 1MAVA 4NH0A 3PX3A 1JMYA 4KQEA 4DDWA 4DLBA 4HEJA 4U0JA 5EIEA 2QPOA 4BV2A 4C5AA 3UWKA 3WK6A 1YULA 1ZRHA 4WN9A 2VKTA 1KQOA 4GX0A 2FOXA 1C2YA 3L1VA 4LMPA 4WPGA 2WSIA 4WXHA 3O3CA 1K0UA 1AVTA 2KBEA 3HKEB 1E2BA 3AB3A 3PDIB 2VTVA 1I4DD 1TJ4A 2HZ7A 2P5SA 2XCLA 4NZ9A 2M2IA 3DMRA 2GPYA 2HMSA 2JKVA 3S1LA 2A3RA 4R3UC 2O0LA 3HG7A 1NC3A 3PFFA 3WIVA 1RS0A 3FMPB 4ZHSA 1OB5A 4LF6B 1JILA 5H81A 3NS7A 3KFLA 1ZINA 1O5OA 3ZZNA 3PQCA 2Q4OA 4UU8A 4YP6A 2FHSA 4RPGA 4YN3A 3IKVA 4XQCA 3QZUA 2FX2A 3RUAA 1JEQB 3M4ZA 5T64A 3SF8A 2NXNA 4JFRA 3QU2A 4UVDA 2VLIA 2IYZA 4I9GA 4RCZA 4LE0A 5LUBA 1DB3A 3DXXA 2QRVA 4QODA 3MPOA 2H4FA 4CL8A 3T95A 3D8RA 4WEOA 5D85A 2YVQA 3I2KA 5I8PA 3GROA 3NIBA 4HNQA 5LBIA 3VDMA 4EUFA 1BA2A 2V9ZA 3HZHA 3SC2B 3WA6A 1LTQA 3LDHA 5A5FA 3U81A 2OM6A 2ZXEA 1ZOLA 4FJ2A 4O4LB 2XLCA 5K5EA 1G16A 5DULA 3U4HA 2QUKA 4QO8A 2WJPA 1I9GA 5DYNA 4MX8A 3GA0A 4D9MA 3BXZA 2XA1A 3P0RA 5KTSA 4URUR 1RLJA 4FYJA 1KR2A 2ANCA 3JZDA 3KCNA 2RHHA 4EUNA 1MMFB 1PR3A 4Z4HA 1ZBQA 4AVYA 2H1LA 1WXWA 1DKMA 2AR9A 2IPXA 1K6JA 1B73A 3ADKA 4E14A 4RUKA 1C3OA 2VUUA 1I2MA 4E2XA 1WXIA 3DMFA 1WQ3A 1L7RA 1TFRA 1M8JA 2H4YA 3RS7A 3UT0A 1TZMA 4FX2A 1NI5A 4AJPA 2V59A 5CB0A 3KSBC 3SG0A 1G66A 1FFGA 5EERA 3MGKA 2X9NA 2ILVA 1ZJ5A 3QF4A 2H1FA 4F7WA 4L15A 1MENA 2YCBA 4KO2S 5B36A 1L7VC 5IN5A 5BWMA 1QH8B 2G9VA 3HXLA 3MUEA 4TXHA 1QS0B 3JX9A 3JQ9A 3SQMA 2HEGA 5LL6P 2AYZA 3LVBA 4KRXA 3JVEA 1LBHA 1DKQA 2EKDA 2PZKA 1Z6QA 1A9YA 3D2LA 2BH2A 1Z2NX 3DF9A 2JAQA 1Q16A 2WUEA 4KKXB 3OZAA 1Q0HA 4PX9A 5C4GB 3VTZA 4BGEA 4RK5A 1S4QA 2YN4A 3RYHB 4FEYA 4IDOA 1I3MA 4JBIA 2Q5CA 1KK1A 3NBFA 3D7KA 3C85A 4EATA 2XMCA 1SQ5A 3ROEA 2UXDB 2PH5A 2JH3A 2O3TA 1NJFA 5L53A 1ZX1A 2PJRA 3WI7A 5K0TA 4Q1CA 4MYRA 4CEHB 1N5OX 3WWOA 4ZYZA 1CNEA 3W5CA 4GMXA 3ZZTA 1Q1ZA 4QHYA 4RMIA 5AP9A 2WYVA 1E98A 5JUWA 3BIFA 2FKNA 2C4VA 1IBRA 2VQEB 2PUTA 3BRWA 5FPSA 2QK4A 5BSKA 2BL4A 2CYBA 2NYVA 3KXPA 1HV8A 3NAGA 1FRQA 3B1XA 2YZ7A 4BMSA 5I5EA 1WY7A 5AIAA 2XBLA 2UZ1B 1PWXA 2QRUA 3A3YA 4PFJA 2C9MA 4LYJA 1Z7WA 1E99A 4O2BF 3GD7A 2Q4EA 3A31A 4GSKA 4JJ8A 4FUTA 3OT5A 4UEKA 5CNMA 5KYTA 2ZKLA 3OWXA 4Q4LA 3SF8B 5J2UA 2R9VA 3B6EA 3KYDA 1DRJA 4GI2A 2PHZA 4GOND 1YVUA 3AM5A 4RYLA 3K0BA 2H5JA 3QKRA 1FFHA 1ISMA 4B81A 2PV0A 3AF0A 4HAZA 4WLNA 1KK2A 1H0HA 3DBVO 2PBZA 3HKCA 4HGRA 4F5ZA 4DEYA 1T5IA 2E48A 4JJFA 3ZI4A 4OB8A 4BL5A 4F72A 4Q1FA 4XYMA 4EF4A 1MRZA 3OLQA 4BY9E 5SZHB 1JRLA 2E4XA 3FCSB 4UDOA 4B44A 3H2BA 1OXMA 3GBPA 1XEWX 2PWAA 2V0CA 2NXWA 3AFIA 2QG4A 2IEAA 2GCIA 3GJYA 2Y1CA 4CQMA 5ICGA 3RYTC 2W8ZA 2FEOA 1KDRA 5J2TB 2CNDA 3ZQ4A 3TPFA 4K88A 2Q1WA 3PEFA 1Z4PX 1VLLA 2EWMA 3OZVA 4RTLA 3SVTA 2QTCA 3E3AA 2QIOA 2EHDA 1TA9A 1KFJB 2PTHA 2R5WA 4TYPA 4PIVA 1BHQ1 3GLVA 3DUFA 4TN1A 1JDSA 1ETUA 4XJSA 3HBMA 5DM2A 3N59A 4YMSA 2DFTA 2GEBA 2UV8A 2QKYA 2ZW9A 4EB0A 1I4WA 1D6MA 4MQEA 2C0PA 5EMNA 4M0CA 1DRKA 4YRTA 2P9QA 4C43A 2Q3DA 3UAZA 3DYVA 1YBFA 3KOOA 4K6GA 2P6UA 4YDHB 2VXOA 3N75A 3VPFA 1TZKA 4LA4A 1G6Q1 2HOQA 1YS7A 4BTVA 3NJRA 1NVVQ 1M2GA 3D64A 4QNMA 2WWWA 2PUAA 2ECKA 4UCXA 2CVQA 3PGVA 3TDNA 4MITA 2HTFA 4AJ9A 2BZ1A 1CQPA 1XU7A 4PLPA 1TKCA 3LW8A 5JPIA 1VL5A 2ZBDA 4XYLA 3WRYA 2OXIA 2FN8A 2V98A 3THWA 4IWYA 2VHVA 2IIBA 4JUIA 3ZWQA 4F9EA 2A58A 3K9LA 3G2JA 3VV2A 1OYVA 4OK6A 1Z2PX 4BTLA 1P1HA 2OXTA 4POOA 1H22A 1WMDA 4LQCA 1EVQA 1VQ1A 2FPLA 4KXVA 2BYTA 3BH6A 4M49A 1A76A 5JPCA 3R9XA 2W71A 4HH0A 3F97A 5IN4A 4F3KA 2OCKA 4YJKA 3UXYA 1I2BA 1XK6A 1YE5A 3KDAA 3HQ4O 4F3RA 4PBTA 4JI6B 3WL4A 2OV6A 2QN1A 1JJIA 2A78A 4EW6A 1O6CA 2CHQA 3U3MA 1HOXA 3JV7A 2CYAA 3GPBA 1D9XA 1XVVA 1Y5LA 2BFFA 2I3BA 4QUGA 2ZTUA 4TRNA 2XUHA 4N47A 1T6XA 1ZK2A 1CUHA 1WXEA 4X9XA 3DDSA 5ALMA 2W6NA 4I4IA 1J2UA 1WD5A 4RJIA 3UW3A 1JYSA 2QRPA 1BYIA 1FDIA 4XR9A 5KWEA 2GLUA 3Q0TA 3ETEA 2C82A 4G5QA 4I55F 1J8FA 2HN9A 3HCWA 1PGJA 2EEPA 1GL3A 1YR7A 3ZJUA 4YCLA 4S1WA 1USWA 2NPIA 2P7IA 3REFA 3N05A 4IVNA 3OMWA 5TARA 2POCA 4S2UA 3PRYA 3WADA 1PJLA 4D9HA 5AKYA 2NZWA 2WLSA 3UKOA 3PCTA 1N7GA 1GO2A 2ZK7A 4F3CA 2YXDA 4ZYTA 3AEQB 2Z43A 1LLCA 3IB6A 3II6X 3NASA 3MILA 5B4UA 1OFUX 4ZT2A 2J85A 2PS1A 2X3UA 3OEHD 1KH3A 2Z1DA 4FBLA 1GGEA 4LJSA 4TS4A 4YYEA 5C53B 4KO1S 1TPZA 2ID4A 2WIAA 1X7ZA 5MF6A 1WHSA 4Z3OA 2X76A 4CQMB 1EIWA 2PZEA 4J0IA 3AQ4A 2HQBA 4FC6A 5C1IA 2C5HA 2YWDA 1ORDA 4OX9B 4UM9B 3KTFA 1QHYA 1UEXC 2WU1A 3PU6A 3CLUD 1Q14A 4NCBA 3LCCA 3EEBA 3GMDA 3VPHA 1JFVA 3DEFA 1B74A 4WFQA 4FNOA 3UENA 4N9QA 1Z62A 2BGNA 2VPPA 1NJ5A 2RI0A 3RVOA 1XCOA 4CPDA 2OO5C 1L3IA 2DH5A 3L7AA 4FDMA 4YAFA 1THGA 5G0UA 2AZXA 4HB0A 1S1MA 2Q45A 4KAJA 4HEQA 1F0YA 3RJ9A 2PPVA 2BBTA 3L6OO 4CGYA 5JNLA 1PL6A 1SQ6A 5FRDA 3D3JA 1P1RA 4QULA 2OORC 5CXXA 3B9QA 4DY4A 2V74B 2HLNA 4WXYB 2O1EA 4G6ZA 1LJLA 1EP9A 1P0IA 1W4CA 2DOKA 1A8PA 1E1LA 1KGDA 5L7WA 2FY8A 4FE4A 1I94B 2Z2ZA 4N3BA 4QYIB 3MJEA 5LMNB 4NMXB 4NAVA 5BY2A 4C7JA 4QRDA 4PG6A 1FSPA 2ACEA 2HCRA 2IPOA 4HV4A 1RC0A 2IS1A 1GSAA 5M04A 2WILA 3DP7A 2PGNA 4KQ9A 4PGFA 4WERA 3KWFA 1CU1A 3S1AB 1J24A 2O0JA 4ZYUA 1MX5A 1THZA 4GLJA 1KI1A 3WK4A 3WLEA 1WUTA 1ZD5A 4UEQA 3PFWO 1NJ1A 4I1VA 4TTIA 4FHZA 3I0ZA 5KHOC 3FOFC 4BFVA 3Q15C 2W83A 4TMYA 4WFIA 4BO5A 1B2LA 4Y2QA 5CT6A 3T5PA 2QUHA 3SMVA 4EGAA 4G63A 1S8AA 5HQJA 4RFVA 4YRJA 1R6XA 3BG5A 4C87A 3NHJA 2OVFA 5BMOA 2YS7A 4RZSA 5HOQA 1PZXA 4O59O 5EG5A 1E94E 2DPLA 4PVCA 5ITWA 2J0QA 2HSDA 1UKEA 3IPAA 4IDGA 3PGA1 2PT9A 4Q7MB 2RGGA 3UWPA 4EI7A 5IAAA 2RGBA 3B52X 2RHLA 3JRWA 1WLSA 3GOQA 3D81A 4IRMA 1EFRD 1TMGE 3V32A 1E9SA 3VJRA 1ZM3A 2ZRKA 1T1RA 3QVKA 4TTSA 5AI4A 5AKKA 3F7NA 4L8YA 5IBCA 2CJYA 3INNA 3K9HA 3RUEA 2ZG6A 4MV0A 1CVRA 1JDBB 2ZRFA 4OXXA 4E30A 4CKXA 4JJ4A 1J0DA 1I32A 3PF9A 3BX1A 3OLVA 1PRYA 1DC6A 1KSFX 3EZNA 4TLEA 4MQFB 5G1NA 3GFGA 2YVAA 5F35A 3PC7A 4K8RB 1QH8A 3S40A 2EERA 4BYGA 4UOEA 2MU1A 1SXJD 1KI3A 4O8CA 2RKBA 4Y3UA 2KX7A 1E4YA 3F4BA 3OH8A 4DKXA 2JJ1A 3PXCX 1AF4A 1DBWA 4JI1B 1HT2E 4XVRA 4YJHB 5AHKA 3TUIC 2OZEA 2PMCA 3OSUA 5JQGA 1IWBB 1KNQA 1M7HA 2GO7A 4OL9A 2YJNA 1XPOA 2JLUA 2AOTB 2QN9A 3DMTA 3LUPA 4H27A 4H7JA 5F3DA 3SKVA 4Z5XA 1PS0A 1WPQA 1O97C 1JSZA 1M3SA 4RJKA 2WWRA 2XZOA 1BXRB 3AX6A 5HIAA 2SBTA 3LRXA 3P0EA 4GZ6A 1X0VA 3GC6A 3HCCA 4X60A 3WLRA 2NIPA 4LYDA 4NLLA 1K7YA 3DKPA 3QA9A 1CY7A 3KYJB 2IZ1A 3NW9A 4C9BA 2NADA 5IZ4A 1CJTC 5LMZA 3W9BA 4BNYA 3BWDD 3KR2A 2VUHB 4D79A 1O0SA 4EZBA 3RR2A 3VTKA 3CC8A 1GTL1 3GFPA 1X2EA 3IAFA 4DV1B 2DHCA 3ROMA 4ND4A 1KY4A 1L8LA 3Q9LA 1Z18A 2G08A 5MHTA 1Z2OX 2X6RA 2P79A 1TO2E 2CXSA 2TMDA 3AK4A 2C3UA 4KU4A 4EPXA 1EX6A 1OYOA 2GXQA 5JOQA 4P1ZA 4FCWA 4I8IA 4U5XA 4MJXA 3EMBA 1EI9A 2W6QA 3OOEA 4X92A 2I7TA 3NORA 1NUSA 4UTXA 1XMXA 4QT0A 3E3NA 1THTA 2IUSA 4KVFA 3ZVKA 2WM9B 4IUYA 2P68A 3AUXA 5BN3B 1T6ZA 1Y3HA 1XWIA 2JGAA 3THXA 2UVPA 4FP9A 1NR7A 2JB9A 4DYDA 5JT1A 2BN4A 3IQIX 4QFDA 3IIJA 5IH3A 2FPRA 3NLLA 4YI5A 2BM9A 4DCOA 1LRLA 3MTIA 3WV5A 1BU8A 4M36A 5HW0A 1E62A 1KEWA 4GBGA 2NUBA 1D1TA 2WUDA 1EFRA 1GV0A 2LDXA 2NUPA 1VGQA 2GN6A 1UM9B 3FNHA 2Q0QA 2ZUUA 3HEBA 2EW8A 2HXGA 3BL8A 4YJ3B 4X1KB 2NTJA 1HDCA 3LT0A 4KR7A 2OO7A 4RHFA 3ZWKA 4C0KA 2DXIA 3OIVA 4OBXA 2NMVA 4R51A 2F48A 3QBEA 2ZROA 4RENA 5K3AA 3NIGB 1PV1A 1N6LA 4YHHB 4PC1A 3S99A 4W4TA 1JGTA 4L6CA 2Z8ZA 1N8SA 3NETA 5T4HA 4C89A 4D0GA 1CZOA 1T43A 1B8VA 1WZUA 1I9CA 2GRAA 2YWXA 1CB7A 1BXGB 4N7BA 3H1TA 4NG4A 4KC0A 4IZHA 4CTJA 3GVIA 1UFRA 4GRDA 3A58B 3EVFA 1Z3CA 2IYEA 2W98A 5KWIA 3HYSA 2H00A 5J58A 1ECBA 4ZOCA 5JCOA 3TK1A 4IKEA 1Y9AA 4B4OA 4QBHA 3JTMA 4FOLA 3LP8A 3OZEA 1K89A 1K66A 4XASA 3MHPA 3CUSA 1TKAA 4BNKA 5A71A 3EGIA 4XWGA 4Y1GA 5D6OA 2RG7A 5F7JA 1K8ZB 1QGYA 4LQDA 3VR5H 4YB8A 1OX5A 3PNOA 1BG6A 4C6HA 4EY3A 3C87A 4ZQIA 3FHJA 4F4HA 2WWYA 4ERNA 2FMXA 3OKCA 3JWPA 3G1WA 4FMCB 4NKRA 3T9AA 1ZOPA 4O0LA 4RK1A 4Y6OA 5DHRA 4DCUA 4EHHA 3RC3A 1NVXQ 3WBJA 4PX3A 1JIQA 1D7AA 4M0KA 3GLHA 3HN2A 4AD8A 3H5OA 3RVDA 5AM4A 1ZK4A 4RH1A 4WN9B 4DDHA 2G1PA 1CZUA 2D59A 4QOEA 4G9EA 4V3CA 1X7GA 4HDRB 4RACA 2JI9A 1DWUA 1R8QA 3PQEA 4GL4A 5D00A 5A1TA 2E18A 3F2VA 3UB3A 4WJLA 4NS1A 1VHTA 2A7QA 1U2RA 3GJQA 3SYLA 5SYMA 3H5WA 1YL5A 4Q3NA 2HMAA 4MIEA 4IS3A 4B3FX 2OZLA 1B3RA 3BD8A 3I0MA 1I7SB 3H5RA 3VNVA 1Z07A 2CFOA 1HSOA 2OZPA 2PWZA 1LDEA 3QVTA 4FYWA 1CERA 1GCUA 5E6RB 3ZLUA 5NLLA 1JV2B 4MV5A 1XTRA 1VFPA 1T0HB 2GEDA 4EITA 1NIPA 2C84A 1TDJA 2ZE7A 2XUDA 5KTPA 1O9GA 1UQRA 2VYVA 5DPMA 2VDKB 4JUBA 1YBVA 3VC2A 2ZM6B 1LCIA 1XPRA 4C6RA 3G85A 4UFNA 1QZTA 4QBGB 1AURA 2QTZA 4KUHA 4ARAA 4ZVVA 3CIFA 3QX3A 1Y7HA 3N0TA 5PNTA 4BIIA 1UKVY 3KB2A 3V80A 4MVJI 3M6XA 2ZUSA 4MRVA 5KOHA 4HS4A 3TIGA 4OJKA 2DY0A 2XQJA 1UXIA 3UPTA 5BMVA 3C98A 1NVUQ 5CFZA 4ZVMA 4TYNA 2HSGA 3O3NB 2IL1A 4RIFA 1VHDA 1UJBA 2NTEA 3A4IA 3M81A 4HNRA 4KH0A 3GLFE 3RFTA 1VCHA 4HJRA 4P7JA 4LMBA 3O94A 1E7WA 3EOAI 4P8RA 5K3FA 1MNAA 2BVNA 4L5YA 4MEAA 4Q93A 1EGHA 1EVKA 1X1AA 2RHWA 4UBLA 2I5PO 4BMVA 3GLIE 2WHXA 1EFLA 1UIRA 5DT2A 4PPGA 3VHXB 4K9RA 1SCJA 2Q0SA 4O2AF 1WXDA 5B64A 3S1AA 5M3BA 1JZQA 3VDRA 4AZ0A 1ESEA 3KDSE 1EFUA 1KI6B 3C4JA 5IYZF 1KJWA 3E05A 4N54A 1UKBA 5EJ2A 5AFSA 1NI4A 4BCBA 3GFSA 4DR5B 4Q9JA 3R3UA 4FSXA 1LH0A 3O90A 3O1HB 4GH5A 2H1IA 5J4KA 1AZLA 1BSVA 4ENVA 5PGMA 5EQFA 4BO0A 3ZDYB 1TMYA 3FSRA 1VPWA 4G0QA 7GPBA 1SK9A 2XMSA 1XXHE 2OFPA 3JYOA 3PSHA 1L5MA 3GDHA 4O63O 4DSZA 4GDFA 3O91A 4B5KA 5ABPA 1IM2A 4ZJUA 2QM3A 4CLRB 3PE3A 1ZWKA 2ONZA 3S81A 3G9ZA 3AR6A 3V8RA 1P9OA 1K9VF 3Q1LA 3CXRA 1E0JA 3UATA 3ZWMA 2YR0A 4F85A 3QBTA 4YR7A 1AMNA 4I5DA 4ZVOA 3QUTA 4P32A 1QORA 4W6ZA 1KIMA 4IZIA 3QX9A 1N9ZA 1W34A 2WZBA 4GVLA 3WKAA 2DEUA 3OEYA 5TS3A 1O95C 5AMXA 2GZAA 3OLZA 2IX3A 4AJOA 1Z6ZA 2FQWA 4JX9A 5AJYA 4MYCA 2GUWA 2E4UA 5I7HA 5G0TA 2Q3FA 2QPLA 5HCIA 2DUMA 3WLHA 1PR9A 4C05A 1C3JA 3TD2A 4DTIA 1MFPA 1K27A 2RONA 1W5AA 4UU7A 4BO7A 6AT1A 1EU1A 1SVUA 2XITA 2Y99A 4KR6A 2LUOA 4UREA 4RMNA 4MGHA 3V8VA 2Q3CA 5DCWA 2Z1NA 3BDAA 4Z1MD 4XWTA 2R62A 4LNUB 4RNCA 4UE3S 1XZDA 5B53A 4GP7A 3PR3A 2P9EA 1TLTA 2D5AA 4PBRA 4Y1FA 4QUJA 2UYQA 4YPFA 5FOSA 3M4NA 2YZMA 5AHWA 4CKCB 2TS1A 3OE4A 5IJ9A 2D2VA 3DVAB 4GEKA 1DP4A 3IT2A 4WWHA 3HGQA 4CTMA 3P0IA 2Q2VA 3TG8A 2JPDA 2JARA 1QNLA 4KI7A 4LXIA 5JJCA 3HLYA 2ODTX 3A0RB 2DWPA 2WTNA 4W9NC 4QTXA 2IHJA 3NHUA 4ARSA 4WXEA 3EZGA 3IVAA 4IBOA 2C8VA 4RTMA 5EHGA 2YDYA 1S8NA 2V8BA 2BGLA 2QNRA 3BE5A 3FSGA 4XA8A 3TOXA 2O52A 3AEXA 1FLAA 1UAYA 2G1KA 2VNJA 5CX1A 4DS3A 5KMGB 2IHVA 1Y4UA 3OF3A 4PSDA 1W36B 3UFXB 4ZQGA 3HXKA 4L9WA 5LQJA 2O1WA 1FU4A 3AQIA 1YTUA 2XTZA 2KBFA 4R2KA 1E89A 2XMZA 3TXYA 4ETIA 3C6ZA 2ZJYA 1RI3A 1P17A 1UBGA 4BDSA 3EH2A 1FX0A 3FCXA 3JQGA 1QV7A 1XROA 4HSEA 4PNZA 4LXQA 3ZHTA 4DM4A 4DJFC 1U1FA 3SU8A 3TCXB 4UFPA 2AKEA 4R1MA 5FWDA 1X87A 2BGKA 1NM5A 3CJQA 1E1QA 4Z0HO 1NU8A 1JLHA 5K4HA 2PD3A 2X42A 5FBWB 3ZTTA 2FN4A 4KHPB 1IXRC 4U9IS 3X3HA 2PLRA 5C1BA 2ODQA 1DTWB 1WCWA 2DFVA 3O9MA 3SFZA 4EJSB 1JUDA 1NXPA 2V8OA 3H17A 1R0KA 5JO0A 5AVKA 3QE2A 1CVLA 1JHDA 2JIQA 4DLSA 3WE7A 1O6ZA 1SR8A 5HA5A 5K3DA 4QJ5A 3SXUA 4HNAB 4PCVA 3DKKA 1BTOA 3KPVA 3B78A 5LB2A 4MUIA 1OBVA 2GBGA 3BK7A 1RAFA 3TR0A 5H16A 4II7A 1QDLB 3C8HA 1BCRB 3L5KA 1T1GA 4PPNA 4A6DA 4YRSA 2PL3A 1UBHS 2QRNA 1O77A 3VH2A 3VQTA 2JGFA 1C4OA 3IAM1 4Z4EA 3GW8A 2ZUWA 3DUWA 3PPXA 4I55A 2OPHA 3HO8A 3FWZA 4Q47A 2PFSA 4XM0A 4XGNA 5IAEA 3SYKA 1JHUA 1JDUA 3EXIA 1L5HA 1EXMA 5CVVA 4M22A 2O1SA 2OCGA 2RHCA 1EEXB 1NW4A 1TIPA 1MAHA 1A97A 2OXRA 1FE8A 2WKPA 2F67A 2HB6A 3LUGA 5IWAB 4UEWA 4M9SA 2YC4C 1V6CA 4UZFA 2F59A 2XNSA 3ROQA 5EJ5A 1OPXA 3HYTA 1MU0A 3ICEA 4GOOD 3AXSA 2EP5A 1KBZA 2COUA 2CY0A 2XYPA 4TSFD 1ZGJA 2XRMA 2FCAA 3ZU3A 3BIXA 3FGOA 2UUPA 1YA6A 4BMXA 4TWBA 2X41A 3P0HA 2XI4A 1J1UA 2VAXA 2BLLA 2YWHA 4LK3A 2CWDA 2BM1A 4ZARA 2DZDA 1Y3DE 4RHCA 2FFJA 4D42A 4NAUA 2CJPA 2R65A 2QJWA 4O4IB 4DREA 3X1JA 4AXXA 3KUDA 4CMKA 4A36A 1XAHA 1X1QA 4JSRA 5EMKA 3C3MA 1X9IA 5E1DA 2C9BA 4GXQA 1NOIA 3CHYA 3ADBA 2CMGA 4TV8A 1UK6A 2A14A 4I14A 1QRDA 4Y6RA 4YAGA 3WKEA 3T5DA 1K4YA 1RKVA 1L5OA 2QX7A 4BZQA 3NEAA 3PUJA 2YWRA 4R7GA 1Z4OA 1W35A 2D3WA 2WJJA 4KN8A 1VE9A 4A23A 4JT9A 4YJ2B 2ZP1A 4ALLA 4ZANA 3RASA 2OB2A 4ZJZA 5KKNB 1V5IA 5TEVA 3AEQA 2IV2X 5TE9A 5CD9A 4CDMA 1AS3A 2RC6A 4W9MC 3HU2A 4DKJA 3DDZX 1S01A 5DLPA 2P4HX 1QG2A 4JL6A 4UFOA 6CHYA 5LJLA 1Z26A 2VJDA 3Q9SA 3H1AA 2I2DA 3B36A 2GM4A 1H05A 1MO4A 2FWMX 2OA0A 1E6LA 2OHIA 4MW6A 4JP3A 5B4VA 3TXAA 4YP9A 3K1TA 3MTGA 3ZQJA 4IIFA 1GA1A 1KQNA 1SHTX 1UXGA 2GR9A 5KVSA 1DEAA 3OM1A 1P0QA 3L1IA 1UT5A 2HX1A 1ODSA 4RKEA 2XTJA 5E9QA 3ROPA 1HZJA 4BMCA 4KUEA 1NHGA 1E61A 3LH5A 1SCIA 1E8MA 3EWAA 3KD3A 3A4VA 2EJTA 4REOA 3GFFA 1F2UB 4TQ9A 3TN7A 5AW4A 4FOSA 3WHIA 1IUKA 2WAAA 5TVGA 5IT0A 1II0A 2WE8A 3A0UA 1YU6A 2HM7A 1A95A 2ZJFA 1S9HA 4BNVA 1BFKA 2QORA 4QVGA 4EMBA 4ZFNA 3WA7A 3AHHA 2QYHA 1N2CA 4RPIA 4HZGA 4GI5A 2CXXA 4RY2A 2G83A 2ATCA 1KYTA 1UFQA 2BW0A 2XJ4A 5AXAA 8AT1A 2GPWA 1XX6A 2XQGA 1G6HA 1T0UA 1VPLA 3KKEA 4DV2B 1PNVA 3N07A 1SUEA 4KQIA 2WF7A 2ZI4A 3EQ6A 4L16A 5JMTA 4XAQA 3WMFA 2YNMA 4JDUA 1Y1RA 3OE7D 3V8PA 4RL6A 4M76B 4A2QA 1E5VA 3G6WA 4ZGGA 2VQ3A 2QN7A 3UYKA 2FEAA 2LCQA 1RPTA 4B8WA 3GAFA 5KTTA 1OB2A 1LK5A 2JIDA 2OSBA 1UANA 3EDCA 3AEZA 3DCIA 5JH7F 4M8NE 4Q5IA 4DPKA 1M6NA 4R9VA 3IUMA 1C4KA 1KR5A 1W5BA 4OB6A 5K8CA 2IYQA 5B7NA 3EA5A 1E1DA 1SCDA 1H5QA 2CVPA 3HDYA 1R0BA 3RUIA 4HT3B 1JYFA 3KLMX 2KLHA 3THYB 1T26A 1JJBA 4PZEA 3RC7A 3NT2A 1WBJB 1Q7CA 1DC4A 2QN6A 3GDFA 4WNIA 3CBQA 1IJKA 3FPSA 1BVHA 2GK3A 2ESRA 4C6TA 2CK3D 3T0FA 4EB3A 1KFBB 3HYCA 1TQDA 2E82A 3QH4A 1SUCA 1GZUA 4Z0TA 4PN7A 2NZVG 1MO3A