4CLEA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
267
structure length
252
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQKSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
total genus 93
structure length 252
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cleA00
2V6GA 4GWKA 3IMFA 5BSFA 4CM9A 2C20A 4BNIA 4AG3A 4K6FA 3HSKA 3V8BA 1LDBA 1ENOA 2E48A 2IYOA 3RROA 3I4CA 5IZCC 4BS9A 1JVBA 4AJHA 5K0ZA 1LTHR 3E9NA 3DB2A 2QRJA 3L07A 2QYTA 2P5UA 4WJZA 5DBIA 3ZDFA 4AJ4A 5JDIA 4ALJA 5C7OO 4QO7A 1GV0A 5I9NA 3W4IA 1WWKA 3ZWOA 3CZMA 1QYCA 1DIHA 4J3FA 4GBJA 5ICSA 2BGMA 4AJNA 4YJDA 4R5HA 3JQBC 4MVJD 2NWQA 3RUHA 1I32A 1DIRA 1RM3A 5A06A 3AK4A 4B3IA 4KUEA 2BI7A 1EDOA 1HL3A 3I5MA 3EY4A 3SJ7A 1Z6ZA 4E2ZA 4PIVA 5TF4A 1ZJZA 3G49A 5DBFA 4E6PA 1ZEJA 4LCEA 4BGEA 1C14A 3H65A 3PEFA 3PYXA 5FYDA 2WDZA 5JDCA 1ISHA 1BHSA 3RUAA 4MO2A 1H9BA 1JTVA 4D45A 4B8ZA 2PR2A 1P1IA 2I67A 2GDZA 3KB6A 3KM0A 4HFJA 5EIOA 3RUFA 1NVTA 3H4VA 5AVOA 3JQDA 2I99A 3MEQA 4Y9DA 2NM0A 3X2FA 5T67A 5IJZA 2BFOA 3DZHA 1T24A 4OHUA 2CDBA 1LNQA 3K9QO 1SZJG 3CXRA 3H2SA 5B4VA 3I83A 4QFDA 3QWFA 5MGBA 1H9AA 3CMMA 4MVJE 2YW9A 1I2BA 3KYCA 4YT2A 4R68A 3WIEA 4EEZA 1JWAB 2W8ZA 1DLIA 3AFNA 3ONEA 8ADHA 2WJPA 4OMUA 3JQ7A 1JKJA 1YGYA 3WJ7A 4M54A 5ENDA 3WYBA 3OIDA 2O4UX 4WE3A 3CEAA 1V9LA 4ID9A 4E31A 4L4SA 2PKRA 1HE4A 2Q1SA 4J9UE 3WMWA 1ONOA 2ZB4A 5I9MA 5FI5A 3RKUA 3S2FA 5KTKA 2C0CA 3TZQA 1AUPA 3EMKA 3TFQA 4Z0TA 2B4QA 1E1LA 4KTVE 4YT5A 1EMDA 4MPDA 5C37A 1QRRA 3DONA 2GERA 4J49A 5COAA 3AOEC 3UGKA 2NU6A 2X0JA 4GMGA 1UDAA 1HDYA 3WBBA 4BNNA 3T7EA 2XXBA 4EEXA 3Q0EA 3SVTA 2OO5A 3ZH2A 2JAHA 4JBGA 4IJVA 4YYZA 5JCXA 2ILTA 3G1UA 3QVSA 4ESOA 3RU7A 1FMCA 3PJEA 3ZWAA 1OMOA 3IKVA 5TT0A 4E5YA 4EZBA 4WEOA 3W4KA 2E6UX 4I08A 4Z6KA 3M2PA 3GC6A 1EK6A 2JFGA 4F6LA 4E5MA 1GCUA 3GFBA 3U4HA 3H3FA 2X9GA 4EI2A 3AOEA 5KJEA 1YBMA 2I3AA 2XXJA 4XKJA 4L75A 4I5DA 5EQDA 1IB6A 5JPIA 1AGNA 4PZDA 3NRCA 1ZK1A 2VZ8A 4OXYA 3ZNOA 3GMDA 2YYYA 5IDXA 1DIAA 4XYEA 3Q9UA 4BKRA 4K9DA 2CVZA 2FMUA 3KV3O 3H8VA 3O4RA 3TZHA 4DWVA 4J16A 1XYGA 2Y0CA 2GUGA 4XYMA 1P31A 5COQA 4LISA 2GN4A 1E7QA 1EVYA 2DPGA 2GGSA 3DZIA 1K0UA 2O7QA 3AY7A 4DREA 2DFDA 3GDOA 4E32A 3HHPA 4EJMA 3K2EA 3GN1A 4CMEC 1O95A 2C7VA 3DL2A 3JQGA 3SBOA 1DHRA 2VNAA 1D4FA 3ZNPA 5DCUA 1NR7A 2X22A 4NBVA 1GPJA 3OECA 1T2FA 3OM9A 4W4TA 5A03A 3KBOA 1SOWA 5KVSA 4OH1A 4C4OA 1DJQA 3DMTA 2VWPA 5ER9A 4N5NA 1YKFA 2EKLA 3E82A 2QYSA 2G0TA 4BVAA 5GY7A 3PYMA 3KZVA 2DC1A 4CV1A 4L73A 1JW9B 3ZNNA 4CM9D 1PQUA 5EQFA 4WK6A 3HG7A 4U8GA 1GYRA 4KUHA 5H82A 4BGUA 2Q3EA 3AU9A 1EZ4A 1D1SA 4C7JA 5BNIA 4K28A 3OF2A 1PJQA 4MIEA 2HO5A 3TRIA 3WDSA 1PS0A 2FOIA 2O3RA 2JCVA 1ZK0A 4IDGA 3KYCB 3LC7O 1O9BA 4OJNA 3G17A 1PJ3A 3SEFA 2NV6A 4G65A 3RSHA 3AI2A 4KP7A 3GZ4A 4HXYA 4OIMA 1WP4A 3GG9A 5JC1A 3ZCXA 1PEDA 1R15A 2X0IA 3AUTA 3DWFA 1BDMA 1H2HA 5G0VA 4GL4A 4ZN6A 1H93A 2PH3A 2Q1TA 3TN7A 4FJ1A 4MIOA 3NGXA 4TKMA 2X9VA 3K30A 1GUYA 3NTRA 4M89A 3H7AA 4GVLA 1P1FA 4PVDA 1GCOA 2NLOA 1EVZA 4JJGA 1VL6A 4BO8A 4R1SA 3KSUA 4R51A 2VQ3A 2PNFA 3WNVA 4Q3BA 1K6IA 3PFWO 5EL0A 1H6DA 2P2SA 4R16A 3TL2A 1PZHA 5K6AC 3F3SA 2I3GA 2X5KO 3GDFA 4YDRA 2B69A 1GEEA 1T25A 4ZGWA 4J1NA 2HMVA 1F14A 3WSWA 4YXFA 4UEOA 1KVUA 1UJMA 3FSRA 4QEDA 1R0LA 2XAAA 2YDYA 4IMPA 1BMDA 1M75A 4I9UA 4PFJA 2NVBA 2RHCA 4NPCA 3WNQA 5ES3A 5TC4A 4CM5A 1GEGA 2EP5A 1MGOA 4Q3DA 1SAYA 3D4PA 4M8SA 2YV1A 3S8MA 2GN6A 3JD3A 5L40A 1LDYA 2QX7A 1ULSA 3GFGA 3ORFA 2HAEA 5L7WA 1ML3A 5U1PA 4CLRA 3MJEA 3RJ9A 1TT5A 2O2YA 3WGQA 1HKUA 3ZWVA 4B4VA 5IF3A 3QSGA 4BO5A 3KRTA 4LVCA 4CM8B 1D3AA 1B26A 4A5OA 5AXBA 1O89A 4BKOA 1IZ0A 2A92A 1WDKA 3OFSA 4Z9YA 3DAGA 1XG5A 5IDWA 3GEDA 5AOVA 1X7HA 1I0ZA 1ZSVA 3F9IA 1OFGA 4IDEA 1KEVA 5AQ1A 4XEHA 4YAGA 3RKRA 1VRWA 2B5VA 2JFHA 3SX2A 4DPKA 2EXXA 2Y67A 3PLRA 3V2HA 1J5PA 3LYLA 4ZRMA 4YT8A 2VHZA 4YCAA 3OBBA 1CQIA 4BMNA 3UICA 1LLUA 2XF8A 5G0TA 1H5QA 3VKVA 3CH6A 4WLVA 4YB8A 4XR9A 3WYEA 4RVGA 3GUCA 3HJAA 5G0SA 4E13A 1TI7A 4URFA 3TQHA 1KVTA 4ZHSA 4MVJI 4NU5A 5IDQA 4W82A 1DPGA 1LX6A 4U7WA 5MDHA 1OC4A 2VYVA 1OC2A 3JQGB 1Z7BA 2IYPA 4JX8A 4Z9FA 3AI1A 3QJ5A 4XIYA 1NPYA 2OUIA 2IZZA 1AXGA 1A4IA 2YUTA 3OIGA 5FF9A 2QIOA 4J90A 4XB2A 4CLHA 2GSDA 3ZHYA 1K3TA 2PLAA 1E6EA 4D43A 4E3ZA 1PSDA 3FN4A 2B36A 5LDHA 3KSZO 2NVWA 4YEDA 5DNAA 2V6MA 4BO1A 2C07A 5A9TA 1P1JA 4A73A 2OGUA 4CMCA 4D46A 1H0KA 3KSDO 4R01A 1X7GA 4CM1A 2JFFA 5COBA 1P1RA 1XA0A 3NX4A 1ISGA 5TX7A 4DIOA 1U5AA 3KXDA 3EAGA 3AU8A 3ZGYA 4W9NC 1QKIA 1JKIA 1LU9A 3JYLA 5CEFA 1J4AA 3Q2IA 1EUCA 1GUFA 3GRPA 5JE8A 1LI4A 1ZW1A 1NPDA 1ZBQA 5DN9A 1VSVA 3MTJA 3QWAA 3VPXA 3CUKA 5KVVA 4UEJA 1ADGA 5CDSA 4DQXA 2PV7A 5DOZA 1E1MA 3DZKA 4OM8A 4RDHA 3KYBA 4LGVA 4IXTA 1RM5A 1W73A 4J1SA 3RIHA 3MJCA 5AYVA 4CMGA 4XYLA 2Y1DA 2PGDA 1EVIA 1VM6A 3LF2A 4IUYA 2O23A 4PLWA 2A94A 4PLTA 2HMSA 3TZKA 3QVWA 1NR1A 1V3UA 4I1IA 3EK2A 4HKTA 3QWIA 2F1KA 2HU2A 4CM6A 1N1EA 2UAGA 4NK5A 2CVQA 4ZQBA 3ENNA 1NAIA 3HADA 4A7PA 1SBYA 3SC4A 4R5MA 3BZUA 4MVJG 3ZV6A 1XQ6A 2YFHA 3UF0A 4NZ9A 4A2CA 2Y1CA 1A27A 1T4BA 2FR8A 3DOJA 4WLOA 3T4EA 3ANMA 2D4AA 5THKA 3KO8A 3WQRA 4BO2A 2V6FA 2HMWA 4E2XA 4JN6B 4CM4A 1TT5B 2DBVO 2R2GA 2IDZA 1IY8A 4MVJP 2I76A 3OH8A 1BVRA 2LDBA 3HB4X 1D1TA 4KZPA 4YACA 3GHYA 4P22A 4YTEA 4CV3A 1Y8RB 4J43A 4OXNA 1PJCA 5JCJA 4HFMA 3ROKA 1U3WA 3ETDA 4ALMA 3QWHA 1CRWG 2PGLA 1P0CA 1R4NA 4RVDA 4WOJA 3ZHBA 1IHXA 3H9QA 2HDHA 3I6QA 3UCXA 4R3WA 1UZNA 4OAQA 3L6DA 1E5QA 1K2WA 4R69A 3I9OA 1QORA 2CUKA 4GVXA 4MVJA 4CLXA 1ZFNA 1DJNA 1DIGA 1R0KA 4FFMA 4X54A 4BO7A 1BWSA 2RIRA 4DXHA 3GNTA 2P9GA 1DC4A 4JLWA 2GN9A 4IQ8A 1TLTA 3WICA 1F8FA 3ZWCA 3GG2A 4KTTE 5ENVA 3D1LA 1DO8A 3OA2A 4HWKA 4IZIA 2EW2A 4BNUA 2BI8A 2GYYA 3PVZA 3BTSA 3DDNA 2YHIB 1KVQA 5L53A 4BO9A 3GN2A 4FCCA 1KC3A 1O94A 1QLHA 4PLFA 1X13A 4RCVA 2ZQZA 5TJ9A 3QV1A 4ROSA 4EJ6A 2AG5A 4Z3DA 3PLNA 3NGLA 4L74A 3GNQA 1Y9AA 4IDAA 4NQZA 2JL1A 4NK4A 3H3JA 3QQPA 5DCWA 4E2YA 4TRMA 4R54A 5L4LA 3GAZA 2NUAA 3DBVO 4E12A 4Z0HO 4EUFA 1KY5A 4FOOA 1G1AA 5B4UA 7ADHA 3FR7A 4DTIA 1NWCA 3QRWA 1ENZA 3PWZA 1KETA 2X23A 1E3LA 5C5IA 3VZRA 3GZNA 3ZHXA 4DC1A 2A35A 1Y7TA 4HFRA 4BKPA 5ITVA 2J6IA 1I36A 2GR9A 2QHXA 2VWGA 5I7FA 1P45A 5T57A 2H5LA 3P2YA 3AUSA 2BFMA 3NKLA 2XOXA 4PLZA 1L7DA 1XU9A 3QP9A 4D3FA 4Q9NA 1QP8A 1C0PA 4OKNA 1Z75A 2EF1A 4BNJA 1LDNA 2X1HA 5JSFA 2JHGA 4WCDA 4RF3A 2VNSA 2VYVD 3S55A 6LDHA 3L9XA 4RVFA 3OJ0A 3RFXA 3BHIA 4UUOA 3WBFA 4RF5A 2YY7A 3FNEA 4QXMA 5EN4A 3WGGA 5IZ4A 2Q1UA 4WCFA 3TDKA 5T64A 5L95A 2CSUA 1T1RA 4Z0PA 3LQFA 3PDJA 4IPTA 3X2EA 5FWNA 2Y93A 1WPQA 3ZHZA 1F0YA 1LLCA 1XDWA 2BMAA 1AHIA 1ENPA 4HX5A 3PK0A 3PRJA 4J4HA 4KDFA 3H2ZA 4CM4B 1PU2A 1I2ZA 1X1EA 2O3SA 2YHUA 4DLLA 4HADA 3V1YA 3AY6A 1ENYA 2BGKA 2UYYA 1Y6JA 4BB5A 3LU1A 2WD7A 4OQYA 1GYQA 4NBWA 2ZJ0A 5DBGA 1T2CA 2Q50A 3E03A 3D7LA 1GY8A 4AJ1A 3NJ4A 1JAXA 3B1KA 1HYGA 4JK3A 5DZSA 1DFGA 1HSOA 1R4NB 2JCXA 4A10A 1PZFA 3C8MA 4LMPA 4PLPA 3WGZA 1GU7A 2A4KA 2X5OA 2WSBA 5AXCA 4A26A 1P0FA 1YOVA 5L51A 1JQBA 4I5GA 2Q2VA 2Z1MA 5HWSA 4RPJA 4ZRNA 4AVYA 3U4DA 4PLHA 1NASA 2FZEA 3ROQA 1SPXA 4TVOA 5K9ZA 4K1LA 5A3JA 1ZSYA 1X0XA 3IUSA 2HKIA 3JD0A 1FF9A 5JAIA 3F4BA 1YE3A 4CM3A 4LN1A 1U3TA 1TVEA 3RUDA 1N92A 3AW9A 4M1QA 2ZQYA 1O5IA 1YDWA 4E5NA 4TROA 4WASA 4M87A 1ORRA 4DLBA 3BHJA 2B5WA 2HQ1A 1I30A 2LDXA 1L1FA 2NQ8A 3RBZA 5JDIC 1GR0A 2B0JA 1A7KA 4A03A 5JNLA 1Y81A 2WTBA 2WM3A 5JS6A 3MTGA 5A02A 3ASVA 3F6YA 4BL5A 5IXSA 4YAIA 1U4SA 2HJRA 3IIEA 2JCYA 2BKAA 2POQX 4BB6A 2YQ4A 1ISMA 1KY4A 2AA3A 2CY0A 2G76A 2O2SA 1T1SA 3FPCA 2J5RA 1IE3A 3UH1A 1ZUD1 3VDQA 5IN4A 1HF3A 3DFUA 1JDJA 2VWQA 1DHTA 4D42A 4CQMA 2DUWA 4DIFA 1R0SA 1DEHA 4XGIA 4CR6A 5JCJD 4PGFA 3GZNB 3C3XA 3LZ6A 4Y6PA 2Y0EA 5JMPA 4YVFA 2E49A 2FSVA 4R4JA 3VDRA 4E21A 5JDCC 2NTVA 1M2WA 4CPDA 4D3SA 2RBEA 3GGPA 4J7XA 5L4SA 3SC6A 1SCUA 2WE7A 1MA0A 3VPSA 2V65A 1EBUA 1MFZA 3ITDA 3GF4A 1CWUA 1I3KA 4CUJA 3JQEA 4RVSA 3ZI0A 1EE9A 3G3EA 3OA0A 3G0OA 1IYZA 5EERA 3WG9A 3GR6A 1QYXA 4AJEA 4I8XA 5EPOA 5F5LA 4DQUA 1I3NA 2DUUA 2HJSA 3UAGA 1NTOA 3OMLA 3BMQB 3ICPA 4BGVA 1W4ZA 2D1YA 1U8FO 1GFSA 1Q0QA 4WCFB 1JLLA 3RVDA 1BXGA 1FXSA 2E82A 1LXCA 2X86A 1E0DA 3NV9A 3MWDB 3KLMX 4Y67A 2D3TA 1HZZA 3U4CA 5JXWA 3BHMA 1MG0A 2WMDA 1ID1A 3JQ9C 4YT4A 1X15A 1Z82A 5DDIP 1KEUA 5HBRA 1LSSA 3GEMA 4TQGA 2VOEA 1XLTA 1U9JA 4OO3A 1OOEA 1RWBA 3PYLA 5BQFA 2PWZA 4LMRA 1DFHA 3LC1O 4EJ0A 1MUUA 2WD7B 5CG2A 2AXQA 5DP2A 1M6HA 3E5MA 3VVBA 4BNHA 3HFGA 4RF4A 3BTOA 2IEBA 2X4GA 2FY8A 2IEDA 2ZB7A 4I5FA 1V0JA 3K5PA 2DLDA 3V2GA 3BXXA 3S2IA 3JQ9A 5CEJA 2PD4A 1YOVB 4TRRA 4E0BA 1EUDA 3CMCO 4BQRA 5FI3A 1G6KA 3G79A 3GK3A 3LK7A 2AQIA 4CQLA 3ONFA 1TB4A 3RASA 4RPLA 4B7CA 3DZGA 3LLVA 4BKQA 1YL5A 2FR1A 2DVMA 3ADPA 4IBOA 2RH4A 3WGOA 4OOEA 4UREA 3MJVA 5DF1A 5T6BA 2IE0A 1VL0A 3CIFA 1HSZA 4Z9XA 8LDHA 2HRZA 4Q39A 4DL9A 4AJKA 5CP8A 2VZ0A 4TRJA 4Z3KA 1AXEA 1B2LA 2Q2QA 3IP1A 4O6VA 1F12A 4TRNA 5TNXA 4FFNA 1LC3A 3FPLA 1YRLA 3LT0A 3Q11A 1ADFA 4UVDA 1XWFA 4E2WA 4WECA 1V3VA 4PG5A 2PFGA 2W2LA 3K2BA 1UP7A 4FR5A 1HDGO 4BNKA 4DBZA 2DTEA 5CDGA 2BF7A 3GT0A 1G0NA 4FQ8A 4RJTA 1RJWA 3L4SO 4CMJA 4CQMB 4GAEA 4E30A 4JBIA 1N7HA 1Y1PA 1KERA 4ZVVA 1TEHA 3C85A 3IOYA 4CL3A 2VUSA 3HFSA 4CM8A 4D0SA 4P4LA 2AQ8A 4NFYA 3WFJA 1B8VA 1GUZA 1P9LA 3AY3A 3DHYA 3JYQA 1IUKA 3KHUA 4OYRA 4BV8A 1QMGA 1PX0A 1PJLA 3ICCA 4BNGA 5JLAA 1HYHA 3DMTC 3UKOA 2WYVA 4IMRA 4D79A 3DR3A 4UVGA 2B4TO 4W7HA 3FHLA 4IGEA 2UDPA 1UXKA 4R1NA 1PJTA 3S1LA 3I23A 1NQTA 3CTMA 2DAPA 3GGGA 4J1QA 5BNFA 2X7HA 3GDGA 1ZSNA 2FWMX 1OI7A 3JQCA 3I6IA 3AM5A 3I9LA 3ULKA 1R6DA 4FFOA 3S2GA 1LEHA 1DB3A 1LSUA 2P91A 1BXGB 2CFCA 3RC2A 2DQ4A 4JCOA 4IQ0A 5TRTA 3BA1A 1SO8A 2B37A 3WB9A 5TLSA 2Q1WA 2VRCA 3PDUA 1PS8A 5DULA 1QXSA 4DA9A 4AJIA 1PR3A 2DPHA 2BLLA 3ZWYA 2NVUB 4WOKA 3OICA 4JJIA 4KQWA 4R1TA 4M86A 4RPGA 1C0LA 4ONEA 4CLOA 2QZZA 1DC3A 1ZJYA 3B6ZA 4DUPA 4XQGA 4GKVA 2EERA 4DC0A 3RBXA 4WNIA 2X8LA 4CV0A 3PJFA 5T8KC 5TGDA 4CLDA 2P5YA 4PRKA 4CQMD 5A5EA 4HY3A 1ONNA 4IINA 5BSEA 7MDHA 1ZCJA 2Z5LA 1C0IA 2W2KA 4OQZA 9LDTA 1ZMOA 1HDZA 4NI5A 1DC5A 3AWDA 3OSUA 1UZLA 2AE1A 2FP4A 1E1KA 4YJHB 5A9SB 1N7GA 1YXMA 5DCYA 4W6ZA 1H2BA 1V8BA 1W6UA 1QSGA 2DKNA 3EZYA 3H6KA 4LRTB 4DGSA 2OBYA 5G4LA 1HE2A 4AJ2A 4CQLB 4FFRA 2NU7A 4KDEA 3ZV5A 3GUYA 3NT5A 3RAJA 5A1TA 3VPGA 4MVJF 4DPLA 5T8KA 1NHWA 3P7MA 3NTQA 3RUCA 1V6AA 1UDCA 5KOIA 4BKUA 4EGFA 4IY1A 4GX0A 3DO5A 1BXZA 4WNCA 1HLPA 1UAYA 4JROA 3DFZA 3EDMA 3WYCA 2D5CA 1UR5A 2ZIZA 4QUKA 4UVIA 3VTFA 4WLEA 2WD8A 1NYTA 4MP3A 4RF2A 3ZN2A 5KWEA 1YB5A 3JD1A 2W4QA 5TS3A 3K6JA 1N8KA 2VRBA 4RVUA 4IDDA 5F1PA 5ILOA 5HRUA 1C1XA 3PGXA 1HZJA 2FPPA 2VHVA 5ICMA 3O8QA 4HNHA 3MZ0A 5A4DA 5KJ1A 2ZTUA 1XU7A 2ZK7A 1Y5MA 1T2EA 3WFIA 1J49A 1Z73A 3DBLA 3ZU5A 2OP1A 3ZWMA 5GZ1A 5IDYA 1WAMA 4J0FA 4NMHA 1E3IA 5KCZA 2WEKA 3ABIA 3NYWA 1Y8RA 1H6AA 1SC6A 1GPDG 1VC2A 3U49A 4QO8A 1HE3A 1NQAO 1IHYA 4ALNA 2ZCUA 3HN2A 4BUCA 2C7GA 2JD2A 3NUGA 4RLHA 3PFFA 3C7DB 1GV1A 3E1KA 3QIVA 4PCVA 4CMIB 1HT0A 3WGTA 1O0SA 3VPFA 2I66A 3Q2KA 2DBQA 4J7UA 2Q4BA 1F17A 4NJMA 4ZD6A 4BNMA 1ZK3A 1DC6A 1PGPA 1QV7A 2UV8A 2ZJ1A 1YB4A 3WGIA 2P68A 2TMGA 2O50A 1VKOA 3F4LA 4WGGA 3JYPA 4JXKA 1GDHA 5JAZA 4BO6A 2ZTVA 4BNTA 1YL6A 4BNWA 4CODB 1RPNA 2W90A 1UDBA 3OIFA 1UAGA 2Y99A 4KUGA 1F06A 3IL2A 2YHIA 1Y8QB 3V1TC 4CLOB 1Z45A 4RGBA 1OAAA 2W2LD 3I9JA 4PG4A 3WWZA 4NH4A 2BFPA 1NNUA 3JYNA 5THQA 1IOLA 3UCFA 2SCUA 2NU9A 2O3JA 1LRKA 2Y1FA 2Z1NA 3DZBA 3QVOA 3SLKA 3TWOA 2W2KB 2P4HX 3ZV4A 4CR8A 2VUTA 4XA8A 3ZU2A 4PG8A 1KIFA 3I1JA 2BH9A 2AQKA 1LDEA 4PRLA 4D41A 2HK7A 4WKGA 1YONA 1R12A 1AHHA 2C54A 5CPFA 4LCJA 5EMHA 3VVCA 5DOVA 1MC5A 4M49A 3HDJA 2VHYA 3OJLA 4KMSA 5JC8A 3H5AA 3SXPA 1YBAA 1DIBA 2AHRA 3WLEA 2YDXA 4N18A 3ZWBA 3DAPA 3U5TA 3HDQA 4UUNA 1Q7GA 3FD8A 4YAJA 3WTBA 1HE5A 4TSKA 3ADOA 3RD5A 1U2DA 2OHXA 3NT4A 4LRSB 5JO0A 3JD4A 1FJHA 2VRCD 3HN7A 3KOUA 1A71A 3FNHA 1AN9A 2EIHA 1A5ZA 1TA4A 5EINA 1C1XB 4DYVA 3UXYA 2J3KA 5HA5A 1HTBA 1H6CA 3O8QB 3VAZA 1NAHA 2GRAA 1WXDA 2PH5A 4CMAA 1I2CA 3JQFA 2JD0A 1J0XO 2V6BA 1EFKA 3EYWA 5JO9A 4NHEA 1U7TA 2CF5A 2DT5A 2X58A 3R6DA 3DBLB 3GGOA 3PP8A 5FFFA 1I24A 3EUWA 3JD2A 4KWHA 2CDAA 2YV2A 4PG7A 3WQQA 1XGKA 3RC1A 3C1TA 1A72A 3QHAA 2ZTLA 5CHEA 3WSVA 2Q49A 1VJ0A 3D3WB 4ND3A 2PGJA 4LSMA 4DMLA 5BT9A 4MP8A 4YJFA 2FZWA 4YJGA 3E18A 2IZ0A 4XJSA 2C2XA 3WIDA 3RWBA 4UUMA 1YL7A 6ADHA 1DAOA 2BELA 4GSKA 2O3UA 3TF5A 5JY6A 2TMDA 4UVEA 2G82A 4GX5A 2BRUA 1MV8A 5L3ZA 4NJMB 4BNXA 3L0DA 4YQYA 1UH5A 1RYEA 4MKXA 2ZYAA 2C2YA 2HUNA 1ZNQO 4JJFA 3TZCA 2DBRA 1WZEA 1YVEI 3A28A 3EZLA 4CJXA 4CL8A 1PQWA 3VH4A 3NDJA 1QYWA 1SB9A 4ITUA 2I6TA 1WMBA 1HDCA 4RZIA 3COSA 4UUPA 4DRYA 1NPTO 1NFRA 4ND5A 4O63O 3K73O 3N7UA 1V3TA 5IAAA 4PVCA 3C1AA 1NM5A 4C7KA 3DTTA 3DC2A 1Y5RA 3WWYA 1BGVA 3H9UA 5I7SA 2JAPA 3B1JA 1B14A 1E7MA 4NBRA 3AM4A 3AOGA 5ITWA 3LT2A 3F5QA 1BTOA 3FTPA 5GMOA 1LA2A 3A1NA 4YA6A 1D7OA 5G2OA 4XDZA 4BIIA 3C7AA 3P5SA 1E3JA 3MJSA 2ZKLA 4WCFC 4A27A 4XD2A 4U6QA 2J8ZA 1W0CA 1GAEO 1U8XX 3FNFA 3UFXA 3JQAA 4BNZA 1LQUA 2I65A 4G2NA 4BMVA 1C3VA 2OMEA 3H5RA 3AM3A 1EFLA 3KYDB 1ZIDA 3IJPA 3NAQA 4HFNA 4MINA 4R9SA 5KJ6A 3I9MA 2UUOA 4D7AA 1EVJA 2VOJA 1VJTA 3RC9A 2IXAA 2B4RO 2O7SA 1BG6A 3FWNA 1C1DA 4QECA 3KLPX 4FS3A 4RORA 3KUXA 1CETA 3KTDA 3ZU4A 3K96A 5L7TA 3FI9A 4GMFA 1KS9A 5F3RA 1QR6A 2AE2A 3R0IA 2QQ5A 1E6UA 3BMQA 5C3MA 3BMCB 2PY6A 5JMWA 5A3VA 3U0BA 1HWYA 5A04A 3KETA 1E5LA 5CEEA 1MG5A 4QSMA 2VT3A 1AE1A 3PQFA 4AICA 2YZ7A 3AUUA 2C5AA 1NXQA 4B3HA 2VHXA 5IXYA 3W8DA 3U09A 4IIUA 1K6JA 1TXGA 3ZW8A 2WWRA 3SLGA 2J5QA 2EJWA 4WPGA 1QG6A 1EQ2A 3W6UA 3ZU3A 1XIVA 1B16A 3ZNQA 4XRRA 1WW8A 5IFLA 5A9RA 3T4XA 4GI2A 3U3XA 4NR0A 1ZVMA 2EGHA 2Y0DA 1BRMA 2O3QA 2HRBA 3UCEA 4YJFB 2NSDA 4BO0A 2RCYA 2PZKA 4YJGB 3DZJA 3D5QA 4OKIA 1JU9A 1U5CA 3W8FA 1VKNA 4N5MA 2EP7A 2Y66A 4YRDA 2IRWA 2AQHA 3CZRA 4O1MA 4U5QA 4XYBA 2GN8A 2J3HA 4O5OA 1HEUA 3IJRA 2RH8A 2C82A 4IM7A 4NJOA 1YWGO 1A9ZA 2RHRA 4PN3A 2HMTA 1UXHA 5IG2A 4B4UA 1U2GA 3Q3CA 2VTEA 4JP3A 2EGGA 2ET6A 2PZJA 3VPHA 1N2SA 2IXBA 2VYND 1E3SA 4TWRA 1QYDA 1MC4A 1FDTA 3E9MA 1MP0A 2GLXA 3JTMA 4KQXA 1U3UA 4CLEA 4PLYA 4J0EA 4RL6A 4FFLA 4E33A 1YJQA 1ZMTA 4UULA 3V1UA 4L4RA 3ANLA 1PTJA 1LJ8A 4MP6A 4FFPA 4Q3AA 4O0LA 3QE3A 4WUVA 4ZU3A 5CDYA 3ZWPA 3PZBA 3QWBA 4YAKA 4GH5A 3OJEA 3DXFA 1UXJA 4L76A 3M6IA 4TMFA 1DSSG 1IZ9A 1E3WA 2H9IA 2HK9A 3C7CB 5KVQA 4CUZA 5FEUA 4IXWA 4L8VA 2CF6A 2EWMA 1V35A 1F8GA 2Y1GA 3E5RA 1YO6A 4B4WA 3PJDA 1X14A 1GZ4A 1E7RA 3EVTA 2FN7A 3HB5X 5KNLA 2X5JO 2P9EA 1VPDA 3GVCA 3JQAB 4O59O 3VH1A 1Q0HA 1D8AA 1PWXA 3GNSA 3NT2A 1EQUA 4GKBA 1LBEA 2OXIA 4F46A 5CAEA 4RO0A 3WGYA 3IAHA 3VZSA 2G17A 3N74A 2AG8A 1BXKA 3H5NA 2P9CA 2JHFA 4E4YA 3BIOA 3A9WA 5L4NA 3RFVA 1C1DB 1DDOA 1PJ2A 3F46A 3LLSA 3TJRA 1B3BA 1PGQA 2PZMA 1T26A 3DHNA 4XWYA 5JYEA 3D4OA 1E3EA 3PTZA 3V2UA 4JGBA 4H15A 4FD3A 5AXDA 1XCBA 2R00A 3GRKA 4OSPA 3OQ1A 4RPKA 2Q46A 1YBVA 4D3DA 2JD1A 4XQEA 2H1SA 2NVUA 5CDTA 4ILKA 3DTYA 3DOOA 4CM7A 3CPSA 3R1IA 4GGOA 5IZCA 5H83A 2J3IA 1BVUA 3LT4A 3PHIA 2Y05A 4IIVA 1K89A 3MJ4A 4S3MA 5BSHA 5KVCA 2QRKA 2EKPA 1NX6A 1KBZA 1GD1O 4UAGA 5EESA 3VZQA 1VLLA 1ZKMA 2OBNA 1T2DA 1ISFA 4LSWA 1DLJA 3G1TA 4A0SA 1SNYA 1LDGA 3OETA 1C0KA 1HYEA 2QG4A 1PIWA 4XJTA 5DT9A 4FB5A 3PZRA 3Q6IA 2EJVA 3K31A 1JN0A 1E6WA 3U62A 3JQ8A 2CD9A 3WGHA 3JQBA 4NBTA 2DTXA 4GX2A 3JQAD 3TL3A 2ZCVA 4YWJA 2XPCA 4ZQFA 5CFZA 1XSEA 1ULUA 4YJHA 5A9SA 1P77A 3ST7A 1X1TA 1UXIA 4P4GA 2OFPA 3PIDA 2WYWA 1U4OA 3PXXA 1NQ5A 2D59A 4INAA 4Q3CA 4GPD1 2PKQO 4NFHA 3FBGA 3JYOA 3GLQA 1I33A 3HUDA 1E7YA 1I8TA 1R4MB 3BTUA 5HS6A 1YDEA 3ZZNA 1U1IA 5JY1A 3PGJA 3VHRA 3BMNA 1NHGA 3NDIA 1CQJA 1YQGA 2VCYA 4I9NA 2VHWA 2GZ2A 3A06A 4B7XA 4NDNE 4BO4A 2GZ3A 5KJFA 3RI3A 3GVXA 1DRUA 2CVOA 1P74A 4U0JA 1X7DA 1JA9A 2NU8A 1U7HA 2GF2A 1NQOA 2JJYA 3TZ6A 3ONDA 1ARZA 1N9GA 2GO1A 1ZO8A 3E6AA 1R16A 1E7WA 2WYUA 2VTDA 3LDHA 1E3WB 4G81A 4FOSA 1HDRA 2NTJA 3O03A 1DOHA 2YFQA 1I5RA 2B83A 3VTZA 1ZK4A 1IL0A 5JW6A 2PD6A 1A9YA 4B79A 3AFMA 4F3YA 2YV3A 1ZEMA 3BTVA 5H81A 1DBVO 4AJLA 2FSSA 1OBFO 3PHJA 4QX6A 4L4XA 2ZTMA 4FIZA 3WX0A 1I3LA 2NADA 4WLFA 3I52A 5C7IO 3JV7A 4Q3EA 4DVJA 1KC1A 2PK3A 4MVJM 5I7EA 4CMIA 5LC1A 3FNGA 4E5PA 1W8DA 1SEVA 4S1VA 3DZFA 3OJOA 1UUFA 2ZB3A 4BMSA 1PGOA 1OZAA 3D5TA 1SEPA 1WZIA 2E37A 2OL4A 2YJZA 3PHGA 4AJJA 4WEQA 4NNJA 1MB4A 3RFTA 4FGSA 2GD1O 4GX1A 4P8RA 3DBRA 4HP8A 4U6SA 4I5EA 3RUEA 2C29D 4IS3A 3W4JA 4Q3NA 3GH3A 3ZWWA 4TZKA 1Z7EA 3RJ5A 1B15A 4ZICA 4F6CA 4ALIA 1Y8QA 1Q7BA 4II2A 3MWEB 4FBGA 3WTCA 2FPIA 2EKQA 4UEKA 5F1OA 3GEGA 5JFOA 1P1HA 3C24A 3U9LA 1KVSA 2NACA 3ANNA 3LSYA 1RM4A 3M2TA 4E5KA 4U0KA 3WXBA 3IDSA 1XQ1A 1VE9A 3WJAA 3WR5A 2EG9A 2QW8A 4XRGA 3JQ8B 1PQPA 3D3EA 3SJUA 4H16A 1NWHA 4XX0A 1DRWA 3EW7A 3NEPX 3LVFO 2A9FA 3D64A 3BYZA 5TQVA 1BDBA 1QYVA 1ZZEA 1ONPA 3I3OA 5TIIA 2VT2A 1GZ3A 2IODA 1CYDA 4QQRA 5KJCA 1LSOA 2O4CA 4YAEA 4EITA 4RPHA 5CPBA 3INGA 2P4QA 3AJRA 3GMSA 1RKXA 4XR4A 1B0AA 3QVXA 5HS4A 1GZ6A 2WE8A 4CMEA 3JSAA 1PJ4A 2ZATA 1N5DA 1CJCA 3W1VA 5CG1A 3N58A 4JQCA 2PZLA 3CE6A 3GAFA 4YQZA 3L77A 5IN5A 3QVTA 3IC5A 2OOSA 3BMNB 3INTA 4ZQGA 3RC7A 3WS7A 1ISJA 3JQ7B 1H94A 3F1KA 1JWBB 1G0OA 3K92A 1LRJA 1GQQA 1I3MA 4XGKA 2X9NA 4EW6A 5JAMA 1UP6A 4TVBA 2I5PO 1GQ2A 4JBHA 5F1KA 5B4TA 1LQTA 2O3TA 1RYDA 2Z95A 3DOCA 4IJWA 3W8EA 3I4FA 2AEFA 5B37A 2Q99A 4PG6A 2G1UA 1XKQA 4MIYA 5C7LO 2FHSA 4RQUA 1N9GB 4EYEA 4OXKA 1PGJA 3UOGA 4DLAA 3PWSA 3NTOA 3HDYA 5JAQA 5DP1A 3E9QA 3QLJA 1IULA 1P1KA 4BV9A 4ZQHA 2VUUA 1DXYA 1CF2O 3F1LA 4DPMA 2HSDA 4FW8A 3FCOA 1FDWA 3D3WA 3NJ8A 4AL4A 4LVUA 5U9CA 1BW9A 1WMAA 2OZPA 2YQ5A 2VZ9A 1O8CA 2VWHA 5BR7A 4MKRA 1HXHA 1FDUA 1UP4A 4I9HA 4R9RA 3RU9A 2PA3A 2VN8A 3PWKA 4QT0A 4FJ2A 4QTZA 5K6AA 3GVPA 4QFCA 1B8UA 1KEWA 1NFQA 3HDHA 4IGFA 2NQTA 5JBIA 4XYGA 3ZW9A 4MKZA 5CDUA 2C59A 3U4IA 3TNLA 3A4VA 3INRA 3BMOA 4R1UA 3QW2A 1EE2A 1HDXA 5L45A 4JNKA 4YBZA 3DBRB 1R66A 3RQSA 4F45A 2F00A 3L4BC 3LF1A 3MOIA 1HETA 3Q1LA 3IS3A 2GPTA 3IP3A 3PIIA 5I7VA 4AJPA 4RVHA 3GVIA 1IPEA 2GNAA 3O26A 1T2AA 2BD0A 1K6XA 1Q2XA 5T5QA 4G5HA 4Y6SA 3GHHA 4AFNA 4XIJA 3PPIA 4GLOA 4MJLA 5AXAA 1GTMA 3FR8A 1GADO 4MOWA 3EC7A 3ENKA 3GQVA 2PKQP 1KEPA 2CMDA 3ROPA 4L9RA 1FK8A 3PQDA 2H63A 2D2IA 4CMKA 3VKUA 4J2OA 1ISIA 1M66A 4GGPA 4RDIA 5LDGA 3OEYA 2BGLA 3P19A 5BNTA 4CUKA 3B70A 4WLNA 3L4BA 1S7CA 4ZQEA 1BSVA 3FRJA 4ZA2A 1X0VA 5ILGA 3R3SA 2Q4EA 3UN1A 2AW5A 4UVHA 1SMKA 4Y6RA 4RZHA 1GL3A 3HWRA 1MXFA 3DAFA 4OGWA 5G0UA 4J6FA 1N1GA 3PHHA 1PJBA 3FTNA 4TKLA 2CNBA 4J4TA 2RAFA 3TOZA 3VH2A 3KYDA 1UXGA 3JQFC 5LCXA 1EEHA 4II3A 3E48A 1U3VA 1PJSA 3UW3A 3JQ6A 3OQBA 2J3JA 3M1LA 4BNLA 2EHDA 1YS4A 5HM8A 3GA0A 3ON5A 3AUAA 2V7PA 1QV6A 4GLLA 3ZWXA 3HE3A 1R37A 2Q2WA 4AJOA 1KYQA 4BO3A 3PJGA 1LLQA 1XEAA 1O6ZA 3H9GA 1MLDA 1LRLA 4FDAA 4XQ9A 3L6EA 2VYNA 1IPFA 3DEYX 3BMCA 3R3JA 2W98A 4Y98A 2G5CA 3GPIA 4IS2A 2DBZA 4BQPA 1NBOA 3TSCA 5F21A 1E77A 1JVSA 4NFSA 3D4NA 1YQXA 4W9NA 1LC0A 4H3VA 1WNTA 2FPGA 4XZ3A 5L9AA 2C5EA 4BGIA 1EDZA 4HBGA 2GZ1A 2Y68A 1KOLA 5J23A 4PLVA 3H9EO 3HQ4O 3WLFA 1PGNA 3LT1A 1HLDA 1DRVA 1VL8A 4J1TA 3KEQA 2GCGA 4BNFA 4XGNA 1A7AA 4YPOA 1CDOA 4GSLA 1FDSA 1M76A 3F5SA 4KOAA 4IDCA 4DYDA 2AEMA 1BW9B 4OSOA 1XR3A 3WQSB 1J6UA 4Y8VA 3T7CA 3IUPA 4B8WA 5A05A 1B8PA 4CLRB 3BAZA 4PZCA 4EUEA 1ZXBA 4K6CA 2X0NA 4RLSA 4LK3A 3ZV3A 4OL9A 1PZGA 9LDBA 2E4AA 4ND2A 4YRBA 4LW8A 1NFFA 3FWZA 5F5NA 3DBHA 1Q0LA 2FRDA 5EJ2A 4FC7A 4DQVA 4XDYA 3PHLA 3VC7A 4PLGA 3BMOB 1LDMA 2B35A 5G0WA 1VI2A 2JKVA 3DMYA 5KKCA 2QRLA 3FF4A 1SB8A 3L6OO 1ADBA 1VJ1A 2R6JA 3OEWA 4CMHA 3M1AA 2QZ9A 5I8ZA 3WOHA 4EUHA 5KKAA 2OORA 1WDMA 4ALLA 4D0RA 4HUJA 1PL7A 3B20A 3HZZA 1LLDA 4MVJH 3TFOA 4FGWA 2UUPA 3RUIA 2BHLA 3IQDB 5G4KA 1PR9A 1PL8A 1YQDA 2DU8A 1EUZA 4YR9A 4N7RA 2BFAA 1P33A 3D0OA 3KEOA 1EK5A 3O9ZA 5I8WA 1XELA 2IZ1A 3GPDG 1WDLA 3EGOA 3OJFA 4B7UA 1WVGA 3GOHA 2I9PA 2ZB8A 3DQPA 2PTGA 2X6TA 1NVGA 1DFIA 2H6EA 4J4BA 1NP3A 1CEQA 4TZTA 2AMFA 1H6BA 3TOXA 4R41A 5JYDA 3JCZA 2D5AA 1P3DA 1U28A 4B3JA 4IJKA 4JIGA 4IDBA 4EDFA 1Z74A 1I01A 1GQYA 4FC6A 3CINA 1FDVA 4IQGA 1JKFA 3F47A 4FN4A 1E92A 1LUAA 4FPXA 4NG5A 3I9KA 4FSHA 3CKYA 3S2EA 3OQ6A 4W99A 5TT1A 3ASUA 2HLPA 3H9JA 3IKTA 4GQAA 1ZXLA 5GZ3A 2DTDA 2EEZA 1UZMA 4BNVA 4EBFA 3ETGA 4RV9A 1CERA 2Y1OA 3OHSX 1S6YA 4J2HA 3O38A 1L7EA 1PWZA 4HV4A 3QA9A 3Q9NA 2UVDA 5A5FA 1MX3A 3WMXA 4P4NA 5ADHA 1CIVA 1PZEA 4PLCA 3V5NA 2ZYDA 3CSDA 2AEJA 1ZH8A 3UUWA 3OP4A 2HMUA 1YH3A 4XCVA 3ITKA 1YB1A 5HTOA 2NNLD 4YRAA 4NU6A 3MCVA 3LC2O 5TJHA 4W7IA 3EHEA 5B1YA 4HNGA 1VSUA 3VZPA 4BOYA 1KVRA 4M55A 4XQCA 2X0RA 2D8AA 4K26A 2PD3A 5ER6A 4MDHA 1MXHA 3ETEA 4GWGA 3VH3A 1B3RA 4RQTA 4WLUA 2EW8A 2HK8A 3FBTA 1XHLA 3UVEA 4CMBA 4NBUA 3ROMA 5TSDA 4BHTA 4H7PA 1E1NA 1K5HA 4N54A 1M6WA 1WLYA 3DBHB 5GZ6A 2D0IA 2HCTA 1EBFA 3P2OA 3W6ZA 4DMMA 1YJ8A 1QLJA 3MOGA 3QY9A 4R3NA 4OOFA 3L9WA 4KWIA 4BNYA 1NVMB 4FJ0A 5B12A 4N5LA 3RCBA 1MFPA 4DIBA 3B1FA 1R4MA 1ADCA 3PI7A 3E8XA 5KIAA 4IJUA 1LSJA 5U4QA 4J9VA 1DAPA 4ND1A 3GY0A 5G4KB 1TT7A 3VOSA 4D44A 1E7SA 2OP0A 4IDFA 4XB1A 3STHA 5L7YA 4ND4A 1PL6A 1T4DA 3NDRA 3KVOA 3K8ZA 2DM6A 3HNPA 1ZK2A 1JAYA 1RM0A 3A14A 2Y1EA 5BSGA 2EV9A 1HRDA 4ZJUA 1GYPA 3ZWNA 4JP2A 1Y9EA 3I9NA 2FR0A 2CZCA 3MJTA 3UHAA 1Q1NA 3C1OA 4L0QA 1B7GO 5I9LA 1PS9A 1HDOA 4DBVO 4ALKA 3EVNA 4PZEA 2GASA 2J5KA 3PQEA 4CR7A 1P44A 3GVHA 2NTNA 1I10A 4J91A 1A4UA 2O48X 2CDCA 4P38A 1SOVA 3TPCA 2DFVA 4CV2A 1M67A 2ZYGA 4NIMA 3RBVA 4J7CA 2Q45A 3AI3A 2R00C 4IZHA 3DHEA 1Q7CA 4B4OA
chains in the Genus database with same CATH superfamily
2V6GA 3BF7A 3NP9A 3MRVA 3T1NA 1X8KA 4FE4A 4K6FA 2VLBA 5T3UA 4WUTA 2VP9A 5DT2A 4GXRA 2M32A 1LDBA 3KL4A 2E48A 2IYOA 1H5UA 3LDGA 3RROA 5AESA 5IZCC 4ZDIA 1FNCA 4C88A 1OI3A 5KNCH 5CM2Z 1JVBA 3OO1A 3ISJA 2RI6A 3E9NA 3DB2A 3NH6A 2QYTA 2J5XA 4AJ4A 4I9GA 1ESNA 5CBPB 4P7BA 2ZDGA 3DOUA 2B0CA 3PQ6A 1XPRA 2HADA 3DPUA 3ZWOA 2IT1A 4PNHA 3D59A 2QAGB 2P6MA 2B82A 4Q1BA 4M88A 2NWQA 3RUHA 3A4NA 3II6X 2ZJOA 4N8SA 4LOLA 1RM3A 2A5DA 3FKSD 5IYZB 5LOVF 1AG9A 1HL3A 3SJ7A 4E2ZA 1GTRA 1TRHA 2QEQA 4CN8A 1VA4A 1ISRA 1JFRA 1C80A 1JHVA 1ZEJA 4BWVA 4IDOA 4LCEA 3MQFA 1VJDA 3CF4G 3H65A 3H0CA 1T3ZA 2WDZA 3EQ6A 4CL2A 3RS2A 5JDCA 4TLCA 3LI2A 3AIKA 3MD9A 2PSSA 2QROA 4ZOEA 4NMXB 2V8OA 2BCEA 3A25A 1ACLA 4D45A 3M5PA 4B8ZA 1HH4A 4PSKA 1TZMA 4W5WA 2O7NA 2G1JA 1KHHA 2AKYA 1J56A 2QUIA 2WG0A 3CLHA 3F2VA 2FN9A 1AZSC 3GFPA 3KR0A 3H4MA 3LWZA 2I6XA 3RUFA 1WQ3A 1Z2EA 4D9MA 3UJPA 3U44A 3QX3A 3KTAB 2H54A 5KB3A 2P62A 4PHFA 1XVLA 2DUMA 4W1RA 2I99A 4Y9DA 4G86A 5DXFA 4XVQA 3WIOA 3M6XA 2MJLA 2P0AA 5HFNA 4K40A 5ALXA 2ZSJA 4MW1A 3DZHA 4DT1A 5EZYF 4KO3S 4OHUA 1LNQA 3K9QO 4I4LA 4J0QA 5IKOA 2BMJA 5ARBA 2Q0SA 2O9JA 3N28A 4QFDA 4MDEA 3CMMA 4GR9A 2GD6A 2JGRA 3OZRA 5KUTA 4JI4B 2RK3A 1N2BA 2IKSA 4Y9RA 1N5MA 3WZLA 1ABFA 8ADHA 1IUNA 3ZLVA 3MCAA 4QGAA 2XQJA 2B61A 3SJBA 5LKRA 5ENDA 2XA9A 3AR8A 3FTQA 4H3KB 1U7WA 5LQDA 4I1UA 3WDMA 4WE3A 4TMTA 1CBUA 3CEAA 4DDUA 4ID9A 4ACBA 1JLHA 2Q1SA 4J9UE 3WMWA 2WTNA 3RB8A 1GKUB 1AHPA 3DGFC 4GP9A 1I4TD 5EWMB 2XCUA 3FWKA 5KTKA 3HVUA 2OVFA 1ZM4A 5AKEA 5ALOA 1ZM7A 3WSTA 1IHPA 3FLEA 1L4NA 3V7UA 3ADDA 1HL7A 4XWGA 4WXRA 3TX2A 4YT5A 1EMDA 3NG1A 4YN3A 4DQ0A 1JG7A 4DCNA 1LF5A 4JI2B 4J49A 1SQ6A 4XFDA 1ZLXA 2FTKE 4JUIA 5COAA 5AVQA 1P62B 2G40A 3CNOA 4EG8A 5ALYA 2H5EA 5EFZA 1TJPB 1ULBA 3B2NA 1HDYA 4U4AA 5FB3A 3WBBA 3ZZ1A 4WBNB 1X9GA 3R6GA 3T38A 1KA9H 1NYRA 2JAHA 1NJ6A 1Z0KA 3ZH2A 2BM9A 3TSZA 3A9SA 3G1UA 3A1SA 4MA5A 5KTOA 5JU6A 4GMHA 1DCMA 3CJTA 1QPZA 1OMOA 3TX6A 2H2FA 2PKXA 2BR5A 5IASA 5BRAA 1KDRA 1WKCA 2VPPA 2E6UX 1QO7A 4MV6A 3A2NA 4D9CA 4L4ZA 3U4HA 2J5BA 2X13A 1BDJA 1QRAA 2ZBUA 3H3FA 3QFHA 4Y2GA 1CP3A 5KJEA 2UVPA 5DYWA 2I3AA 3R23A 4HVCA 3GFTA 3H13A 4ZAGA 1IB6A 2OV1A 3P2JA 2OFFA 1Q0PA 1EQAA 4NOJA 1YB6A 1ZK1A 3NRJA 1NE7A 3BJRA 3SX4A 1Q2UA 1EK2A 3SHWA 3TLBA 3LE8A 1COWA 2HGSA 2OCGA 3ZNOA 5K3OA 2I1WA 4TUYA 5JSQA 2EJCA 5JNVA 2CVZA 2EL9A 2FMUA 3KV3O 4HAUA 4AO7A 1RTKA 2YZNA 2HTFA 1MB9A 4MQ5A 3VYWA 1JEJA 2W43A 2GUGA 3C3YA 4XYMA 5KCZA 4LISA 1GVHA 1EVYA 4OK3A 3DZIA 2GGSA 3ZBUA 3A3PA 2O7QA 1X42A 3AY7A 3OAAA 3WBKA 3WK4A 4E32A 3U5ZB 2OEPA 3GN1A 4CMEC 1TM4E 4Q1VA 2C7VA 2RI1A 3DL2A 4WK4B 1RIIA 1Y3BE 1MTZA 3LP8A 3UH0A 2EAUA 4RK5A 3WIVA 4MVWA 1H5NA 1KPGA 1ESZA 1T2FA 2J48A 1SOWA 2ZUBA 2IXEA 2Q3FA 2DF8A 4OH1A 1UK9A 3TI9A 5JH7F 4J0IA 1ZGCA 1YQ9A 1NW5A 2PFKA 3EZ2A 2NMVA 4BVAA 3BF8A 5TEWA 1FFCA 2ZYHA 4Q4LA 1K9VF 4CV1A 1AMNA 4NYMR 3K8OE 2NOAA 3DFMA 4RJKA 4ZRDA 1V8OA 1UBSB 2P2NA 1SKYB 4REMA 3AM1A 2HY7A 4O0MA 2O8CB 1UOOA 1KQFA 4AG5A 3CEMA 3NASA 3O9VA 1PQ4A 5GGXA 2AK2A 2NPIA 4DT1B 2NZWA 2JS7A 3I2FA 5BNIA 4NZYA 1QGYA 1OAOC 5FT9A 3X1ZA 4H6VA 3TS1A 1SC4A 2HO5A 1OZ0A 5BOVA 3WDSA 4K3VA 1CT9A 2O3RA 1F0KA 1BMFD 1ZK0A 2BGRA 3FAZA 4IDGA 3G17A 4S12A 4Q9JA 4LYDA 4DQKA 4G65A 2CFRA 4LY6A 2Q62A 2K5UA 2F3SA 3GZ4A 2HU8A 3EDCA 1JDTA 4L08A 1Q0ZA 3IBGA 3VNRA 3PL5A 1LPPA 1O5OA 3DWFA 3S29A 4D9BA 5JD5A 2O5RA 4GPIB 4JC4A 1H93A 2PH3A 3S0JA 3CLKA 4Y2PA 1XK6A 4FJ1A 5ALWA 4L50A 3W90A 4HVLA 3RS3A 1DUSA 3VDXA 5BSWA 5JFTA 3DVQX 3K30A 1FTWA 5ABPA 4UFNA 1P1FA 3SKVA 4PWYA 4G0QA 2FGJA 2JEYA 4P86A 2QUJA 4G0NA 3IAFA 4BQIA 1Z0AA 2FPWA 5TE9A 1Q3TA 3ZY5A 3S1SA 1XJ0A 1UIMA 3F90A 1EHIA 3U2QA 3EB9A 5EL0A 3L8FA 1R0ZA 3TL2A 1J5XA 1PZHA 3TG2A 3F3SA 4EYQA 2I3GA 1TTPB 1YZGA 4RTOA 4X8LA 5FTMA 1T25A 3N8HA 3M5CA 3OQPA 4C20A 2HMVA 1AO0A 2H07A 1F14A 3I0ZA 3U61B 1RHUA 4QUIA 4QEDA 4QPZA 2YDYA 1RRKA 3HGMA 2ZYWX 4QULA 1BMDA 4RXTA 1RJGA 2G83A 4NPCA 4PQGA 5ES3A 3U9SA 2FKNA 1MGOA 4LMAA 4Q3DA 3KKLA 1SAYA 4POOA 3K0SA 4AI6A 1E3DA 1VJRA 3AONB 4O25A 2AZDA 4F72A 1FFEA 3KELA 4G8JA 1LDYA 2ZR7A 1X2BA 4C2UA 2YVAA 4MW5A 3B6EA 3ETNA 2FPRA 2PL5A 1ML3A 5GOZA 3W7AA 2YZMA 2ZRIA 4R71A 1TT5A 1UDWA 4XVCA 2QX8A 3WGQA 1OFUX 1HKUA 1A04A 5MGNA 3EVEA 1KI9A 3RG8A 5JHHB 3LDUA 2VDKB 4HWPA 3KRTA 1OTYA 2UVPB 2O14A 3P0FA 5FKJA 1KJNA 1O89A 4CTJA 2A92A 1E6LA 3ILXA 3EGVA 2NO9A 1N2CA 1OT3A 3FVRA 1FFSA 3IOBA 5HPYB 3GRYA 1PHRA 2PNJA 2BKLA 1X7HA 5AOVA 4S2EA 5LXTA 1KEVA 2ZTHA 2EG5A 3LV8A 4XEHA 2HHHB 3AUYA 4TQUS 2EXXA 2Y67A 3I2IA 3B9RA 4G36A 1JHUA 4ZRMA 3V2HA 4X94A 1IM5A 4TZ6A 1BE6A 4O08A 4PNZA 4BMNA 3UICA 1AUQA 2IQ5A 1E6KA 2P1DA 2XF8A 5EMNA 1H5QA 3VKVA 4E1VA 5H80A 3CH6A 4WLVA 4J2TA 2GXAA 4XR9A 3WYEA 3R6TA 5HKAA 1MDFA 3URKA 2TMYA 1TI7A 3RFCA 4Q1FA 4E13A 5L3VA 3IA7A 5LQMA 2PTHA 4URFA 1LWOA 1WW3A 2RMKA 4AUEA 1ZX1A 4BFTA 4MVJI 5IDQA 4U7WA 5B6JA 1OC4A 1SG0A 1LBHA 1CR0A 1OC2A 2R2AA 1NXWA 2YXPX 1YC5A 4Z3OA 2V54A 1A2OA 3VDNB 3AI1A 1WF3A 2IOFA 2BE7A 3QJ5A 1NPYA 4XIYA 5T4BA 4WRRA 5CCEA 3OQIB 2YUTA 5FOTA 1TKAA 4RJLA 4QTUB 5D84A 2LIVA 3W34A 5A4AA 1BDIA 1OV4A 5EXTA 5ICFA 2GSDA 1K3TA 4LRYA 1IK6A 2B36A 1CQXA 2NVWA 3WL8A 2V6MA 2Z3WA 1W52X 2Q6VA 3A6DA 1KU0A 4HDSA 4RAOA 2G25A 3NAMA 3USZA 2C3OA 3TZEA 3FSJX 3EZ9A 3H19A 4P5PA 2C4HA 2YOFA 3KSDO 2AJLI 3LUBA 4MARA 4MR9A 4YMGA 4ZAYA 2V9ZA 1B41A 5D6OA 2JFFA 2JIPA 4KQ2A 1OT5A 3DS8A 1WUIS 3MWKA 4M8KA 1XA0A 1Z37A 2PMDA 2WTXA 3RWMB 3K53A 4KPFC 1NQWA 3EVCA 1H2ZA 5AUOB 2IBMA 2C2KA 3GJQA 2D06A 3F5MA 3KJEA 4NBSA 4DCVA 1S8OA 3JYLA 3LUJA 4Y0NA 4FU0A 3K9WA 3IDZA 2TSYB 2H52A 2ORVA 2QX9A 3GRPA 1E1RD 3WWEA 1ULTA 1LI4A 2HA7A 4K9PA 3AEUB 4E1BA 2Q5JA 5IABA 2P2DA 1OW3B 1L5RA 5HSGA 3CUKA 3DMNA 1RRPA 4DFDA 3REOA 4EVIA 1GUAA 1BFUA 2WAMA 1ADGA 3CSSA 4HYYA 2WJ4A 1HQKA 1VJCA 4DQXA 5CDSA 4RY0A 1NBMA 3COPA 1WV0A 3PG5A 1Q17A 3LHIA 4YP9A 5KYWA 4UTZA 2IEIA 1R9NA 4JFAA 3QXGA 4G0PA 4M7PA 1JS1X 3AKEA 3NETA 4YYEA 1V2HE 1ZVKA 1KYXA 2PGDA 4IRUB 3LF2A 4DCTA 4PLTA 2MHCA 4QFMA 1Q95A 3HB1A 2PRSA 3ZGOA 2MSWA 3TK1A 2B8WA 3U3DA 1AXRA 3MXOA 3QWIA 4NJEA 5HE8A 3V42A 2HU2A 4W8HA 3M3HA 3LUPA 4R9UC 4CM6A 4PAMA 2D5IA 4G85A 2IUEA 2CVQA 4OP3A 4RHYA 4ZQBA 3NBYC 2ZTSA 2I03A 3CC8A 4A7PA 3B1ZA 4NXMB 2Y9MB 3BZUA 1FFHA 4E88A 3Q2OA 2YFHA 3K1AA 1FPMA 4A2CA 4RD1A 2Y1CA 5EWJA 2FR8A 2HSEA 4G5FA 3ANMA 1JHMA 1KSHA 4NYJQ 4KKVA 2OORC 4B4KA 1OIWA 3PVSA 3WQRA 2HMWA 2X9LA 3UEOA 3W3AD 4E2XA 3UT0A 1RC0A 1TT5B 2BR4A 2DBVO 3N3AC 1MJGM 2IDZA 3TEMA 2H7CA 5J4YA 5ALFA 3ZI4A 4Z54A 2FMFA 2LDBA 4KZPA 4DSAA 4R8MA 2CFOA 1I14A 3GHYA 4NL4H 2LRHA 2IHZA 5DYTA 1N2CB 3V1LA 2TECE 4B81A 1G8YA 2WFLA 1Y8RB 2WJAA 3AHIA 2WSLA 2COEA 3HXTA 4Q1EA 3GU3A 3WWPA 5LXTB 2PUDA 1CW2B 4URWR 5HXAA 4LI3X 5EXSA 2GBLA 4LPKA 3HCRA 1UKEA 3TFWA 4DZTA 1J39A 1V5EA 2ZVQX 3MS4A 3TAUA 1U3WA 1C3XA 1QE0A 1GGMA 1Z4NA 2GB4A 4GEGA 3TECE 4HLUC 1P0CA 4M22A 4OJKA 2QAIA 1N2GA 4RVDA 3H9QA 1YBHA 3GLHA 1SVKA 3GJYA 3FZNA 3UCXA 4R3WA 4OAQA 1E5QA 2RC6A 5FL7D 3I9OA 4GM4A 3RS0A 1WPXA 5DNCA 4MVJA 2ZE7A 5AJHA 1JYEA 1DJNA 2ZJBA 4ARSA 5JZ9A 4DR3B 1RWOA 4FFMA 1EWRA 4BC0A 5F7XA 3U16A 1Q22A 3SM9A 1VG1A 1DIOB 2EW1A 2X76A 4TN1A 3WICA 3NHLA 2GN9A 4PZUA 2ZIXA 3DULA 3OOJA 3F3YA 2MINA 2PUCA 2EZTA 1QF9A 5J4KA 4WCVA 1BZYA 3TPFA 3OFJA 4ZKEA 3HKCB 4K46A 1DO8A 3OA2A 5FNVF 4HWKA 4BN0A 2J3MA 4BNUA 4BEBA 4DBLC 4ZODA 2GYYA 4UQPA 1JFFB 3DDNA 2Z2YA 4GC9A 2YHIB 5AKXA 4A5SA 5L53A 1OLXA 3GN2A 4BEWA 5FWDA 4LDRA 1DS6A 1GG5A 1Y1TA 1O94A 1QLHA 3LNCA 1X13A 1TVMA 4HDSB 3ZXIA 2WAXA 1ZGAA 1UC4B 3PLNA 4BJ1A 3DEHA 3GT7A 4MR9B 1SGWA 1VP3A 1Y9AA 5BQ3A 3FMVA 5I4BA 3HBMA 4C9BA 4IIFA 2WKWA 1UT6A 1T9BA 2IELA 4II7A 2XODA 4FDVA 4DV1B 5C46F 4Q7MB 5E4FA 2PZEA 3UMRA 4IIHA 4GW3A 5H5JA 1RP1A 2F48A 5FLKA 5CT8A 1BN6A 2NUAA 4EUFA 1KE1A 1OI4A 1XRNA 1KORA 4DCUA 3QYFA 3W5BA 3FR7A 4QICA 2RFLA 5IK2A 2BEWB 4LQ4A 1WTCA 1N3IA 5A5GA 3QRWA 3QMWA 2G70A 2O52A 1K08A 2Q5QA 1E3LA 4MPJA 1WLSA 4NEQA 4CT4B 4C14A 4QTYA 5C5IA 1G7SA 1KJWA 2ACWA 1WCXA 3L7YA 2A35A 1Y7TA 1MMFB 3G5AA 3ZHXA 1AZLA 4P98A 4DSNA 4YQEA 2REOA 2IP4A 2QHXA 3EEYA 4Q47A 4OCZA 5EVJA 3P9YA 3N6VA 3KQQA 2F9FA 5C2JB 4RTQA 1GAXA 1BKDR 1CUZA 1D0VA 2VK8A 4ASUD 3WKBA 1XU9A 3LP6A 3UMJA 3TAHA 1PSZA 1TRKA 1JE1A 1QP8A 1T9ZA 4UCFA 1C0PA 4D3FA 2EF1A 2QSUA 5KYWB 2B4YA 1LDNA 2HQSA 1FQKA 4M1OA 4M99A 4W1PA 4YGYA 5JSFA 5AW3A 2VNSA 3ECAA 1C9NA 3PI6A 5FA6A 4OLAA 3GXOA 6LDHA 3L9XA 2ESRA 4FMPA 3RFXA 3CX3A 5C31A 4UMVA 1C7FA 4DJJA 3AX6A 4RF5A 1PUIA 3CWZA 4QXMA 4OBEA 1JHRA 2UYCA 3U7IA 4ABTA 1JT9A 3VO8A 3TDKA 3EEFA 5DM70 4Z0PA 1Y4SA 2Z8YA 3PDJA 1XX6A 1J23A 2FZLA 2QM7A 4FR2A 4PYNA 3X2EA 3ZLTA 3K1AB 3K71B 3I32A 1Z56C 5EWJB 4AC9A 4BP1A 2ZBQA 3VYVA 1F0YA 2QTRA 1I94B 3HVHA 1ENPA 1R6XA 2VEDA 4H7HA 3PK0A 1MOQA 1KZ4A 1P0IA 5AW0A 2VUIB 5CJ2A 5H9VA 3ZHVA 4AULA 1RXUA 2VZLA 5KYNA 2OC4A 1D6NA 1DX6A 2B7LA 2RGAA 2PGXA 3OT1A 1KY3A 4RK7A 4DS3A 3VKWA 3NATA 1KYZA 2YHUA 3VDMA 3HRKA 2A84A 1U2RA 3MUOA 1R8QA 2C1XA 1G9XA 2FWPA 1DOAA 2WFLB 3QPDA 4DWOA 3G0HA 2JI4A 4RDXA 4LZWA 5BYKA 4ZC8A 2W4IA 2C8KA 2V03A 5EXXA 3FWYA 4EA8A 1FYEA 3K9BA 4MWSA 4DLYA 1S3FA 3D7LA 4XI9A 3O4GA 4DUGA 2WZDA 4OYHA 3NJ4A 1XWWA 5HIIA 2XZLA 4JK3A 2W2QA 1OZGA 3JQRA 1SXJE 2V7TA 3D6UA 2ID9A 3PUZA 3TGPA 2GEBA 3QMMA 1C4XA 2ZFUA 1GU7A 4G07A 4J3JA 4PLPA 2X5OA 1JB1A 1J9ZA 1Z4IA 2ZITA 3L01A 1KOJA 2DRIA 4OLFA 4AYWA 4CUZA 5K0TA 3IIKA 5HWSA 4P7FA 3HVKA 4Q4AA 4PLHA 1SQ0A 1NASA 1J07A 3DE2X 1JPUA 3KB2A 3LGAA 1SPXA 3U39A 3V32A 3BM5A 4K1LA 5A3JA 5A1JA 1D6JA 1NV8A 2LBPA 3OQOA 5I7UA 3JD0A 2UZ3A 5AJVB 1ST2A 2HSGA 3BBLA 3F4BA 3ZQ6A 1OWMA 1L5OA 4IW3B 4IV5A 4LRUA 4R0NA 1O5IA 1YDWA 3RUDA 4E5NA 4ZZ2A 3ANYB 1MX9A 1BEZA 3LS2A 4PTZA 1L3BA 5AI4A 5EZ5A 2MSLA 2X2EA 3IEXA 3JXEA 4B85A 3WRYA 4BFZA 4KPGA 3G2OA 2ZW9A 5TXGA 2B5WA 2HQ1A 1OLXB 2W2NA 2JAUA 2NQ8A 3L8CA 3PF9A 3RBZA 1H3FA 2FSVC 1YK0A 2ZXEA 4P3OA 3OX3A 3RLIA 1KYIA 1M83A 2WUWE 5E2BA 1EB8A 4LHEA 4D56A 3ASVA 3F6YA 4WOBA 5B3KA 1Q11A 1YNOA 1RPAA 4BL5A 1E2LA 4LC9A 4ZQCB 2HT1A 4YAIA 1G7RA 5ELMA 2SKCA 1R0WA 2J7PA 1YZQA 2POQX 5TPZD 2O2XA 1LS6A 2G76A 3DG9A 4LVOA 4RPIA 4DW8A 2ZS9A 3MIIA 1ECJA 2I2BA 4MROA 1UBTS 3VDQA 1IE3A 2NUAB 4B73A 3OLZA 1HF3A 2YYZA 4J07A 4E51A 3U19A 2VWQA 1CF9A 4JFRA 3EVFA 4Q34A 1HFJA 2GM3A 3HBAA 3ONWA 4UBIA 1RI3A 1SD1A 5BYBA 2FWAA 3BGDA 4U2EA 2C7QA 2ST1A 4BPBA 1W5TA 2WWIA 4PGFA 2WUVA 1AK2A 4NS1A 4Y6PA 5AK0A 2AMJA 5ARDA 2E49A 1QRDA 4R4JA 3VDRA 3IDFA 4B3CA 3CR3C 4RCYA 4X9XA 3CF6R 3ZS8A 3KE8A 2NTVA 2QZ4A 4D3SA 2CFIA 4AIRA 3SC6A 4KN6A 3SPXA 3ZVMA 1MA0A 3CJQA 2OCKA 1A82A 4QBFA 2GNOA 1QNLA 2ZT6A 5C3UA 4K5QA 4CKEB 4TYWA 1MFZA 4BE4A 3I05A 2WJIA 4FKMA 4KQJA 2ZPTX 4JUDX 1AC5A 1EE9A 2YASA 3WG9A 3G0OA 2YHBA 5ESRA 3OPMA 2GCOA 3ROTA 2YRXA 4BFLA 3BSYA 3EDOA 4DQUA 2H51A 4ESHA 3KFVA 4RSRA 1IXRC 2EFEB 4HQLA 1PWHA 2NSYA 3UAGA 3OMLA 6ABPA 4M9QA 4BGVA 2QXTA 1NBHA 2D1YA 2QYOA 3FRIA 3FOWA 2I4TA 3MMSA 3Q87B 1BCSA 1AF7A 4G4JA 4X71A 4XIFA 3RVDA 1Z62A 2E82A 1PYOA 2QVCA 1NDQA 1X7YA 4DA4A 3KIPA 3DMRA 4Y67A 4HDCA 4ENUA 4BAUA 5CCDA 2OBXA 4UEWA 3U4CA 5JXWA 3BHMA 4QZVA 1DKMA 3FYDA 2GRJA 1DARA 1C4OA 4UHCA 3A4MA 4TQ9A 4B82A 1FP1D 3MNFA 1LSSA 3OT1B 3K9FC 1KAEA 1Z5WA 2VHCA 3AUKA 4MA0A 1RWBA 3OHPA 4XE5A 4X3PA 2GN1A 2PWZA 2XYVA 4KPYA 1NXOA 3LPDA 4EJ0A 2PKWA 3OZTA 2FSPA 4HB2A 2WA2A 2X77A 3JPWA 4PPQA 1WY7A 4IOMA 3K94A 5DP2A 2WUGA 4WGGA 3DHWC 4X8HA 2C8JA 5GOTA 2HT6A 4BNHA 3HFGA 4PC1A 4F86A 1XDDA 5KVAA 1U9YA 2IEBA 2RGNA 3IQEA 2ZRBA 721PA 2XB6A 3RHSA 2JIRA 4QUHA 1V0JA 4MW0A 5AICA 3O91A 3PNQA 5I8PA 1P2VA 2O0KA 1XFAA 4LV5B 1RKBA 2DLDA 2I80A 4FX5A 3V2GA 1J90A 3S2IA 1NJGA 1LTKA 3ETJA 5I7WA 4MMYB 4TRRA 1RXEA 1KJYA 1WXIA 3U3ZA 4Q4AB 1EUDA 2VF5X 4BQRA 1ZHFA 2OO5C 3ZD7A 2F17A 2UXCB 2VQEB 4C4AA 2FEAA 3I2KA 1L7VC 5JBNA 2IS6A 1E9EA 3THYA 3ONFA 4YWHA 1TB4A 1YE5A 1KQGA 1V9CA 5A7HA 4RIIA 1YL5A 4S1NA 3BGVA 2FR1A 1L7PA 5DGXA 2DVMA 3DAHA 1GKKA 4JI5B 4F9FA 4YPVA 1G59A 1XCLA 4OOEA 4TT3D 3WGOA 5ENZA 1OGJA 4K9NA 2VPTA 1I9CA 1HSZA 4TKZA 4Z9XA 5TV2A 4DL9A 4TWBA 2Y1WA 4DB4A 4E3WA 1BH6A 1WL8A 4BWFB 4TRJA 3LQKA 1B2LA 1KI1A 1QE5A 3V34A 5JD3A 4CEIA 3ZDEA 3OPYI 3DLBA 4FFNA 2IW1A 1II9A 3PTLA 4FE3A 3ROGA 3Q11A 1E0SA 3WRXA 5AJZA 4DNOA 3A4YA 1NJFA 3QHPA 2X9QA 4RS4A 4HDRA 3NC1C 3WADA 1FCJA 5AM2A 2R68A 4FR5A 3I1IA 4DLSA 2FHPA 3PICA 1BWRA 3GP5A 3ZWDA 4EHJA 4CNBA 4HNAA 3BD8A 1G0NA 2BMDA 1N1DA 1RVDA 1SOAA 1TW3A 1RJWA 1XLVA 4FQ8A 3VR2A 4CMJA 2GRUA 5C34B 1VG9B 4CQMB 4GAEA 1X7ZB 1QB8A 1U7UA 3ACDA 1N7HA 1JHQA 4Y0AA 4BC1A 1P2BA 2HDWA 2FJUA 2JKYA 1PEKE 2V0NA 3AINA 2YIVX 3C85A 1Z22A 3IP9A 3IOYA 3KHTA 3KYIB 4ZVUA 2BGUA 2HA5A 3EF1A 2X8JA 4D0SA 1Z5NA 2X4DA 3QXJA 4HOYA 4RIFA 4X84A 4V0NA 3JYQA 4OYRA 3QNWA 1IUKA 5F33A 2Z08A 5K1ZA 7ABPA 5TVGA 2CBXA 2HRQA 2OHFA 1EXNA 1DBWA 4E4TA 3Q98A 4D4LA 3O94A 2C2HA 2G5PA 3DMTC 1ECBA 3DMDA 3UKOA 4I6JA 1F20A 1H8ED 1QJ4A 2GESA 1MAHA 2OQ2A 3D2CA 4IVPA 1N4AA 3EOZA 6PFKA 2O05A 4W7HA 1G6OA 4AZ3A 2UDPA 2GCOB 1PFQA 5K99A 1QOZA 4FDMA 1PJTA 1YK1A 3I23A 1NQTA 1H05A 2DAPA 1W5FA 1WUYA 2GJSA 3M70A 5HM6A 1TDJA 2WF6A 4RIHA 3GDGA 4NYJR 3IA2A 1SK9A 1X1BA 3QKSB 1R6DA 2KBFA 1DELA 1ZWKA 4FFOA 3E7DA 1LEHA 4M6WA 2PX6A 3U1TA 1DJMA 1BCSB 2ZAIA 3DF7A 1LSUA 1Y8CA 2AOWA 3QVUA 2WKSA 2YWXA 3DDZX 3W5IA 1T5OA 4V3CA 1S1CA 2AS0A 1U94A 1UM9A 4YY3B 2PEZA 2Q1WA 3FMGA 4CIBA 5KU1A 2QTBA 5TQ0A 2OT3B 3ZWYA 1D2NA 1WKBA 2NVUB 3ZU6A 2PUBA 1I6MA 3WI7A 1GFIA 2WT9A 4KK4A 1P2DA 1TC2A 2IYSA 1GAJA 1OLSA 2D2FA 2QLBA 4GPAA 3PX7A 3AILA 4TSRA 2RAVA 4BCCA 3B6ZA 4N6NA 1KPIA 3MJDA 4GKVA 4IKPA 4IX1A 4ZV9A 3BE4A 1FZQA 3ZDDA 3O4IA 1LD3A 3MLBA 3Q3VA 2ONKA 5TGDA 1SVOA 3L02A 3VNBA 3EXG1 1FVFA 4KBYA 4CEJA 1NMEA 5BV0A 2GZHA 4I3GA 5K8LA 4JB8A 1JT2A 5AKIA 3H97A 1P81A 2H9YA 2OHJA 3Q6MA 3EZNA 4RE6A 3LYHA 1X3SA 2HI0A 3AIOA 2AE1A 4F7DA 5LLTA 1CJUC 1IMJA 4BQEA 1NOJA 3C3KA 1PV2A 3CW9A 5CLHA 4NOLA 2C4VA 5DHTA 3TQFA 4C87A 1W6UA 4H60A 5FLEX 2C7RA 1PFKA 3EZYA 1B76A 1EUDB 3D7NA 2BL4A 4MUHA 4QA9A 5CYOA 4M0EA 5G4LA 3PUWA 4KLAA 1RRCA 2Z6VA 3THYB 4BFYA 3UMMA 1WF6A 3DL0A 5DHFA 2R1UA 2QN8A 3EVGA 2VBFA 2FQQA 3L0ZA 4KDEA 5K6RA 1K63A 3GUYA 1IVNA 4MA4A 3ZV5A 1QV9A 3O1HB 4X3CA 4IIEA 3QSYA 5BOSA 2A4MA 2HA2A 5T8KA 2IYAA 2E0IA 5IBRA 4V1CI 2HRRA 2QRHA 1V6AA 3HCPA 3RUCA 5JLJA 3Q3GE 4DDHA 3H4IA 5DTEA 5DN6A 1F5NA 5FJIA 1TYBE 1QP4A 3M5DA 2JIQA 4PGMA 3DO5A 2LKCA 3FZEA 3FZQA 2DFPA 2VC2B 1KO4A 1OYVA 1HLPA 1TUGA 3S7TA 4NF2A 2XXAA 3EDMA 1C3EA 3EJWA 2D5CA 5JTUA 2ATCA 4OD0A 4US2R 4UVIA 1Q3KA 5KNDH 3OPYA 4MP3A 2JC3A 3AF5A 5KWEA 3O8RA 5ARCA 3DBIA 2YJ6A 3BK2A 4K7JA 5CFMA 3OIVA 4LJ7A 1KJIA 2B94A 4RVUA 5F1PA 5HRUA 4PO3X 5F4ZA 4HDRB 2TS1A 2BH2A 1ZD9A 5ICMA 3O8QA 5DLQC 4CL0A 3GCWA 5YASA 3BORA 5A6VA 3MHPA 3RVJA 3K0EA 4AZVA 4AKEA 2ZT7A 4HNAB 4S04A 3AHCA 1OH7A 5JCPA 1Y5MA 4INOA 3HSSA 4DE5A 3ER6A 2IX3A 4UPEA 2M6SA 2H1IA 2QL9A 3WGMA 1ECLA 1SY7A 1TKCA 5CJJA 2OP1A 1YMQA 3GZTB 3OZBA 5CX1A 2X8JB 1WAMA 4J0FA 1JQ3A 1R9MA 4R2MA 5I7HA 1KFEB 2DECA 2JBAA 2M1XA 1Z38A 3Q10A 4JI0B 2I8LA 2XQGA 2AZ4A 3OIUA 1FTGA 3IAXA 1GPDG 1GG2A 3OZGA 3Q7RA 1VC2A 3V97A 3J81A 4QO8A 4D6YA 2ADOA 5TQJA 5KDDA 1TJ3A 4D4JA 4YJ3F 4YV7A 2H00A 3HN2A 2C7GA 2JD2A 3EJ6A 3R41A 5E8RA 3ZKWB 4JBXA 1CK4A 2NZ2A 4FXPA 4AZ3B 3C7DB 3VI3B 1IZYA 1M8PA 4MDFA 4INZA 1DBPA 1CIJA 4PCVA 1EFUA 4Q6BA 4NU8X 3DPIA 1M54A 3A6KA 1O0SA 5HVNA 4PX3A 2I66A 3Q2KA 4HNQA 2DBQA 2VF8A 2Z2KA 2Q4BA 1F17A 4JEHA 3MD0A 4HAXA 4MHOA 1BD4A 4U7PB 3FJ1A 4LSZA 5LZ2A 2V0CA 2ZBPA 3IX7A 1W30A 4A0QA 1Q57A 4E5DA 1Q91A 3V6LA 2P68A 2TMGA 2XB4A 2DH5A 4M1SA 1PDWA 1UM9B 2O50A 3F4LA 3RBAA 1IRIA 3OOHA 3GRUA 1EFDN 4X91A 4EELA 4BO6A 3FGPA 4FDLA 4FYMA 5TQ0B 2XYQA 2VJCA 1CY1A 3DGEC 3VKHA 1M2OA 3OIFA 2Y99A 1JXMA 2EFCB 2DBYA 4DSOA 1YZVA 1EWQA 1MIHA 1OLSB 4GGMX 4ZYTA 1FMLA 2BDEA 1CULC 3V1TC 5AVUA 5F64A 3KS9A 4BBAA 1E2FA 3WK8A 2D54A 4UHHA 2WJ3A 4BP9A 1ZKDA 2G63A 1CUDA 3NHSA 2R96A 1V1RB 1FX1A 3H16A 2GPAA 2BFPA 1XZCA 1INLA 4HEA6 3VOTA 5ISMA 1VE1A 2XT0A 2YXEA 2Y0PA 3IDAA 4UARA 1MD9A 3DC7A 3TDNA 2NU9A 3UCFA 1LRKA 5JYBA 5BR8B 1T15A 3SLKA 4D92A 3NWJA 4XA8A 3R3WA 3DR5A 1KIFA 1B6RA 3I1JA 1F7VA 1QH9A 2CVFA 4TXMA 4AKTA 3KT6A 1E2UA 1FYWA 1L4HA 4UJ5A 2E3JA 5LMUB 1R12A 5CBKA 4EVSA 3PHBE 2G77B 5HQJA 1HFWA 5HE9A 4JI6B 5DOVA 5BWLA 1Q5PA 2PWAA 4RENA 1E4OA 3K09C 3VC1A 1K6EA 1Q1GA 3H75A 1P2TA 5EUMA 4P3NA 5C9ZA 3FCYA 3HDJA 3OJLA 4FZ5A 5KHOC 1EXVA 3H5AA 1P5JA 3BRCA 4IXMA 1DIBA 5BOSB 2D4HA 4V1CA 5AOBA 1OXUA 4AUKA 1EA5A 2EFJA 4L5AA 3ZWBA 4P80A 1U0FA 4XVHA 1JFVA 3DDCA 4ZXFA 3U5TA 1QTRA 3BIJA 1ESEA 1OBCA 1Q7GA 3EUFA 3FD8A 3M0EA 3WMGA 4NE7A 3WTBA 1UJ6A 3LBNA 2FP3A 2XXAB 3NT4A 2YXBA 2AMLA 4LRSB 4N76A 1VCMA 3ESQA 5ALZA 5JO0A 3JD4A 3DQQA 3OPYB 4MB6A 3WNDA 2GJ4A 2IK8A 4HO1X 1A71A 3A4IA 3FNHA 1D6SA 4DWJA 1Z4LA 3HLYA 2PS3A 4TV8F 3HR7A 5EINA 3KCQA 2WNIA 3B6JA 4DYVA 3O82A 2AN4A 4F91B 3ZJVA 1QK3A 3O8QB 2DQZA 5B64A 1QQ5A 3WK9A 4ZOCA 3G7UA 1MX5A 1MU0A 2H29A 3V8RA 2GARA 4CMAA 5I9LA 1TEXA 4IFEA 1XHFA 3BZBA 5KREA 4L0CA 4KFCA 1J0XO 1YS2X 4N5DA 4ENQA 1EFKA 3OEHD 4ZVTA 1TCAA 2GEKA 4NHEA 4Q4DA 4XSHA 5CB4A 3U3RA 1R6UA 1WSBA 1OSNA 2CF5A 2X58A 2HYIC 1VRCA 3IPCA 3F6PA 3GGOA 4YV2A 1M33A 2ROQA 2RAUA 1I24A 4KWHA 3PRYA 1JR4A 2YV2A 5CX1B 2PGIA 3HXQA 3A3NA 1XGKA 2NAPA 3RC1A 3AR2A 4JOCA 3UWSA 2YVLA 1N57A 3QHAA 2VDUE 3BJEA 1IN4A 2JBAB 2VPZA 3KOZA 3NC0C 3WSVA 1THGA 4KRFA 1U7XA 2HNBA 1Y3IA 4M2LA 4QOHA 4CIVA 2FUKA 1JU4A 5E9AA 4H27A 5BT9A 4MP8A 1GHTA 2CCJA 1CY7A 2H3EA 2A59A 4N8EA 4B75A 4D81A 2AUNA 1SBIA 4LQDA 1P8JA 2H4FA 1L5KA 2NV2B 1WZCA 1FUIA 2DSTA 2VHUA 3PEVA 3PNMA 3QK7A 4FYKA 3RWBA 5LNK6 1JH9A 2VJNA 5F7JA 4KG7A 5C81A 6ADHA 1NN1A 1FB5A 2O3UA 4DYHA 5JY6A 1KZGB 5LJLA 2P40A 3A4LA 3OPXA 2UYQA 3C4VA 2G82A 2ECFA 5L3ZA 3LQ2A 4FHCA 3V8EA 3STTA 5HKBA 1UH5A 1RYEA 1Y5LA 4U3JA 4KXXA 3JWIA 2Z4RA 1R00A 3B7PA 2HUNA 3CUWA 4D9GA 4X60A 1OVMA 1WZEA 3ZOZA 1YVEI 2IE8A 3A28A 3UPDA 4EIWA 4LDQA 4I8DA 3UZUA 4I4NA 1G5FA 4JVMA 1V4NA 2OG2A 4KXMA 3AR7A 1H2RS 2I3BA 3QY0A 4QGHA 1GKYA 1S2GA 1M34A 2IVZA 2BC9A 3IAS1 1NPTO 4PW0A 3IQIX 1W49A 3DSRA 3ZWQA 2JLZA 3K73O 4TMZA 1V3TA 5DX1A 2CJFA 2X0KA 2ZRJA 3T15A 1G8FA 4N40A 1A9XA 5FI0B 3T3IA 3WDKA 3DTTA 1LK7A 2JFWA 2B8EA 1GPH1 4RGQA 2OB2A 3H9UA 3LWDA 2NU9B 2WTEA 3BGIA 3T34A 4BP3A 5IWCA 3SBEA 1E7MA 4NBRA 3GJ3A 1K06A 2IYYA 3AM4A 3IHLA 3QENA 1IM8A 5C0OE 3OQMA 1Z34A 3L4EA 3NNDA 4HZUA 5KTTA 1D4AA 1Q0SA 1RJ9A 4MZDA 5F98A 1USUA 5AUNB 4OIFA 2RGGA 4D0GA 1PKXA 4B6JA 4YA6A 2O8EB 1S2OA 4XDZA 4YGXB 4BIIA 4MUYA 1HDEA 1E3JA 4DUZB 5AW5A 2ASEA 3ZZTA 4XD2A 4U6QA 2J8ZA 1QQBA 2LP4Y 3O4HA 3UY4A 5BVGB 1MHTA 1NUPA 5BWNA 5EJ6A 2RGYA 2DE0X 2OMEA 3RF6A 2WILA 3PDHA 1XVTA 4Z0NA 5I6DA 3GLIB 4V1CB 1XL1A 1JI0A 1E0AA 3NAQA 3UPUA 2ONCA 2CDNA 4R9SA 2EF0A 3HXOA 3I9MA 5IW8A 4NESA 4IHJF 2UUOA 3I37X 4KLZA 4KN9S 4NLLA 4F4JA 1DRJA 1NT4A 1W4BA 2VOJA 1VJTA 1LPSA 2A5YB 2R6AA 3FDZA 3TXYA 4DARA 1JILA 2IXAA 2ZIWB 5KTNA 1C7ZA 1SXJD 2DT8A 2PO7A 4US0R 4G24A 2ATXA 2JLWA 1T8YA 4IIXA 4RORA 3KPJA 3KTDA 3KUXA 5ECGC 4BLVA 3FI9A 5L7TA 3DEJA 2BOVA 5B7GA 2AH5A 3R0IA 2RBKA 1QHFA 2QQ5A 4G6ZA 5BQPA 5KYUA 5C3MA 5FH9A 2PY6A 3BRWD 1RRGA 4FGUA 4X63A 3SEAA 3MMXA 4KO8A 3PHCA 3FTFA 4C3VA 2BTQA 4UTVA 2VHEA 4YRZA 3AH8A 2QLLA 1AE1A 1LKZA 1X7XB 3PQFA 1OWNA 3AESB 3LZCA 1PJZA 3T52A 4F84A 4UTPA 1QRUA 2Q6KA 5IXYA 2CL5A 2I1LA 2VHXA 3W8DA 3U09A 1K6JA 1OB2A 5F3WB 1TXGA 2HNAA 3F7NA 5EIFA 4NONA 5CB4B 1QG6A 1Z8NA 2O5VA 3IUJA 1EQ2A 3K1JA 3PC7A 4FFWA 4ENSA 3LK6A 5AVXA 2QENA 3AF3A 1TTQB 2YZKA 4M7OA 3URMA 3GJXC 1WW8A 2QF7A 5A9RA 1WB5A 2D00A 2OFOA 3U3XA 3H11A 3PQ5A 1IVSA 2OCDA 1OIXA 1HT1E 2EGHA 2Y0DA 4KOEC 3WBJA