4LXQA

Crystal structure wlard, a sugar 3n-formyl transferase in the presence of dtdp and 5-n-formyl-thf
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
273
structure length
273
Chain Sequence
GHMIKICIAGKNNIAVNSLQFILKNYFEADQIVVIPNKNDKGIDSWQKSLLKFALDNNIKIVTLDEIYNIEQIIFFSLEFDQIIKIENFKSDRLFNIHFSALPKYKGVFTSITPILNNELESGVTLHRIDNGIDTGNIIDQHCFPIDINDTARDLYFNYLKYGESIFKKNIQTIINNSYKDLKQTNINSSYFSRKDINLVHKINFKKTSFEIHNQIRAFIFQEYQLPIINNSKIIKSILANEFIGYNVFEEFENYFIISGIDGFKIIAQKLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a sugar N-formyltransferase from Campylobacter jejuni.
pubmed doi rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Transferase
molecule keywords WlaRD, a sugar 3N-formyl transferase
total genus 90
structure length 273
sequence length 273
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12230 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4lxqA00
4LY0A 4LXQA 4LXTA 4LY3A 4LXXA 4WKGA 4LXYA 1Z7EA 4LXUA
chains in the Genus database with same CATH superfamily
2V7WA 3NT2A 4A0FA 4IH9A 2NGRA 4GQAA 1O08A 1F8UA 2QA5A 3RAPR 4XVQA 4RPJA 2FHSA 2VVTA 4BNUA 3NBYC 1P77A 1DQPA 1GTZA 5KTOA 3PPVA 3DDCA 3MINB 3GEEA 5C4IA 4R0MA 1CRPA 1VKRA 1HLPA 1U1IA 1XTSA 4IZ6A 4WK2B 5CLHA 5HDQA 3GNLA 1FSFA 1GY8A 2OWDA 3ASUA 2QR3A 4Y1RA 3NAGA 5ANRB 3PFCA 5LR6A 3M2TA 5LA6F 3WYGA 1CDEA 3QY9A 4BV9A 3AETB 4RC9A 2HZ7A 1XYYA 3OQ6A 3CVWA 2OD9A 4TXJA 3WZLA 5LYJB 1KMMA 3H9EO 2FQ1A 2MTBA 3GOHA 1KZ7B 3W8RA 4YUXA 5LU8A 4FWTA 4GX2A 4CLDA 5H02A 3BFKA 1IBRA 3C1AA 1K8QA 2ETVA 3H0CA 4IP0A 5M2QA 2FQQA 5B53A 4KLAA 4EZBA 1J23A 2XUOA 4MW0A 1NN1A 4CUZA 1SEVA 1ZIYA 4PLZA 4PYKA 3MTJA 4XDZA 5A03A 4YO8A 1GDTA 5AKLA 5F78A 2ZJBA 3UBTA 3AUFA 5IW8A 4KXMA 3E48A 4KEAA 5IVDA 3BKWA 3BL6A 1MNAA 2PE5A 4RVFA 3EYAA 3AJ9A 4YCCA 5K20A 1BCRA 5I51A 1RAGA 2CV1A 3KQPA 1FDUA 1WMDA 1FS4A 1OFUA 1YV9A 3PD1A 1VP9A 3T95A 3GRAA 1PO7A 4GBMA 3RIGA 2SCUA 1E8MA 4UBNA 4D0GA 3OLCX 1DWOA 4FFPA 4HRAA 1GG9A 3CH6A 4QTXA 1THZA 3HGQA 2BTOA 3LDAA 3O94A 2PGXA 4NZ9A 2VT7A 2JVJA 3DQQA 5G3ZA 1JAIA 1K7EB 2JFGA 1YRWA 3TZKA 5DO9A 3W3AD 3W9UA 3DXYA 4C4XA 2I6GA 2N47A 2VBCA 3A3OA 3WA6A 2H48A 2O3UA 1M74A 4FEGA 3W2HA 3QBTA 2O05A 1D7AA 4FJ0A 1NW7A 1ZITA 4FEYA 2R1UA 3NM5A 1QIEA 3RC9A 2HA3A 3EA4A 4BFSA 4AF6A 4BHTA 3PEUA 1GQ2A 4C4OA 3N53A 2QTWB 2QTVB 3IBFA 4N3GA 3MT8A 3HRIA 4AC9A 4YV1A 2PUGA 4EG6A 2JCSA 4EL5A 1HXHA 4ZVKA 2Z2YA 1U1CA 2VSFA 1WLYA 1G20E 4MYTA 1C9MA 4WX2B 4XX0B 5EUCA 3FNQA 3KVOA 4KDFA 3S2GA 4F7DA 2CNOA 3BAZA 1B93A 1B6GA 1ZCFA 2CE2X 2L42A 2ZBUA 5EUMA 1OWMA 3RVBA 5AVUA 5EHZA 4QBHA 4YMWA 4DLSA 1E6EA 1H23A 1DKUA 3BXXA 1QDUA 3NNNA 1JXQA 3V7FA 4FFRA 4ZU3A 2CVFA 4P84A 2OKGA 3T1TA 2F9LA 2CLOB 2E0IA 4KNYA 4V03A 1W9MA 3B6JA 5B3JA 4DMFA 3LM8A 4ZYZA 2QRZA 4JYZA 2X3UA 1VRCA 2G07A 3TRKA 4IDNA 4TYYA 2QS9A 2BEJA 3B3QA 4QUDA 3QENA 1VL1A 4HAZA 4BFLA 1I32A 4MVJD 4NZPA 3CZMA 5G0WA 4QICA 4QDTA 3U4QA 3KKOA 1CS0B 1MX5A 1MO2A 3OX3A 1QMGA 1RJFA 3W7AA 3P5BA 2I2CA 4EPYA 2GD2A 5DN9A 2I3GA 2NZYA 1VIDA 2PNJA 2WSSA 5DE3A 3I1IA 3H19A 1M2VB 3ZI4A 2ZIAA 2FA9A 3A4LA 3SF8B 5K8TA 4D99A 3FMFA 3OBBA 3T9DA 5FCDA 1WUKS 2RE8A 1H2FA 2JB9A 3C7AA 3SYNA 2APJA 1N2OA 1QB7A 4U7FA 1DGQA 4PSDA 1OXTA 2SICE 3G0HA 5CMLA 3I64A 1JV2B 4FVTA 3F6EX 4E32A 4NL4H 1KMQA 4X64B 2JCYA 2OD2A 3AFOA 3DE1X 1W52X 5AKHA 1VHDA 2X15A 1S2MA 2FSPA 4UUPA 1XI2A 5ALSA 2WU4A 2QKYA 1C50A 1RLUA 3FAZA 2PJDA 2XMZA 4IXMA 1G8HA 2EWWA 3LT5A 4XB1A 3IYLW 1VSBA 2GXAA 2K7ZA 3DM9B 1XQ1A 2WF8A 4EATA 2PZGA 1JI0A 1LF0A 3SAJA 1JEQA 3JATB 1U4SA 3DMNA 4JUFA 1JLHA 2ERCA 4I0WB 4RXUA 1EVEA 2UKDA 3ZY6A 5DLPA 1X77A 5EHQA 2XZDA 5I45A 5B37A 3DB2A 2EU8A 3COVA 1RHMA 4FYIA 4AD8A 4CR8A 1KK0A 1EDDA 1LBEA 1U1DA 1H8ED 5A9SA 1IAVA 1XXHE 5JTTA 2Z30A 3OZGA 4L4UA 2J6BA 2CLHB 1CUJA 1L7QA 2J3DA 1NZFA 5J5AA 2XT6A 4FW9A 1SVWA 4DCUA 3V4RA 1RPAA 1ZH6A 2A86A 4OO3A 2VJAA 1H65A 5F23A 1ZD9A 3LT4A 3DL7A 4M54A 5HBGA 1E3LA 1JEDA 1T0UA 1G60A 4DA7A 3NH6A 3AI2A 1T36A 5CVCA 5EOVA 1ZKMA 3D3JA 2XIJA 1Z2DA 2EQ5A 2ZJ3A 2NN3C 4UMDA 3L8YA 1YR8A 3AERA 4J49A 4EFLA 4QZVA 4AKIA 5ELLA 2RGCA 1W36C 1IUNA 3C5CA 1ML3A 3EXFB 3AWIA 3JD3A 1NHGA 4K2HA 4DLTA 3H5AA 4UJ3A 4ZKDA 2HO5A 3K6SB 1EHCA 5I9TA 3GLGA 3KTFA 2JI9A 3LUPA 3YASA 1FLDA 1UKYA 2CL0X 4CLEA 4QQ8A 3WV5A 1WJGA 3CZ4A 3NQ41 3OZAA 1UP6A 3HP7A 5EE3A 1T1EA 2IYAA 4FYHA 3T34A 2PRKA 2W8BB 3O8CA 1YDWA 3IDZA 2JEYA 3ANTA 4LI3X 3SR4A 3HK2A 3K3PA 5CCBA 1Z0SA 2FEPA 3LUJA 4G1MB 5EHIA 2JJ1D 5AVZA 2H1HA 5B6IA 1KA9H 1PIWA 1YWGO 2PVCA 1E9AA 1XLTA 4TS1A 1TFRA 4U2KA 4ARBA 1IATA 4FCVA 1SC9A 5IZ4A 3FMPB 1XRPA 2JEZA 5E7MA 5ENZA 2JCVA 4XD7D 1T13A 2HGSA 4C0WA 4Z4GA 4OJKA 4HN2A 3BHIA 3EDCA 3OM8A 5TXGA 1UKZA 3L07A 4LBZA 3NBFA 4Z9AA 4AG3A 4BAGA 2NU8B 1CY2A 1QZXA 4DMKA 4CM4A 4BS9A 3MJ4A 2P5TB 3KV1A 2IZ1A 4E51A 1E69A 2P9HA 2OY0A 4I8DA 5D3ZA 3SI7A 3TRDA 4MB0A 1AGNA 1AB6A 4MP6A 1P1IA 3QVLA 5EZQA 1NDHA 1QLJA 3D02A 5K3EA 1NWHA 2C2GA 1MF7A 1U7XA 1HE4A 3GAMA 2ZPAA 3ZXIA 5IKPA 3GN1A 4MUMA 1OBCA 1C9JA 3TFWA 3WJAA 4RMIA 1QU2A 1Y4UA 3P9YA 1I80A 5BP7A 2J32A 2CK3D 4FFNA 5I9IA 3K1YA 2YWCA 1LBQA 3R7WB 4EW2A 4P3PA 4U7DA 2YN4A 1X7DA 1MX3A 5ER9A 1F8GA 2F9FA 2X4LA 1M1UA 2ZI7A 1FCJA 8LDHA 1A9RA 4L74A 1AH2A 2ZR8A 4ASUA 1QFSA 3I8XA 1P1RA 1HQDA 3U4HA 2I9KA 1HTWA 2OK8A 4WN9B 5F7JA 1NNI1 2GPNA 5G0SA 1KTVA 4E4YA 5U1PA 5CDFE 1E1DA 3GD5A 5C46F 3FOCA 3SBEA 4NKRA 5HBRA 5FTLA 3RYHB 1Z6GA 1V5WA 4Z1MD 4Y3UA 3FGZA 4G56A 4BASA 4DIDA 3QPVA 5LMUB 4GG1A 5SV2A 4BNWA 2OO5C 2P5SA 3UATA 4BVBA 3IDSA 1SCAA 5KSOA 3HS3A 3ZV5A 1RRGA 1ZBQA 2J0QA 3KQYA 2O3SA 1PJQA 3PIDA 1XKQA 5LDHA 2FXIA 3UQZA 2C7PA 1WD7A 1OYYA 1UCFA 2ET6A 2JIBA 1UZMA 2P68A 2RBKA 2R8OA 1N5MA 1FJHA 4FMDF 4KLCA 4LV5B 1HTTA 2CW5A 2VNIA 1LNQA 2HWKA 3TIVA 5JADA 1QG2A 1EXNA 1UEIA 1JUDA 3IOMA 3R9IA 3CMCO 3ZWVA 1D7OA 2CUNA 1F06A 1ZYUA 1X1RA 5IJAA 1YVUA 1GLNA 1KKUA 1T43A 2A9OA 4L75A 3UNXA 3CVYA 3U49A 3HEAA 4S12A 2VWHA 4FQ8A 5E4YA 2CE7A 2GCOA 1Q57A 3ML1A 2PRZA 1NQUA 2Q4BA 3KB6A 2AA3A 4BO1A 5LXTB 4JB0A 4JNCA 3OZIA 5HG0A 1CS4C 1I1NA 3L7AA 3PS9A 4HNAB 4MIOA 3U4GA 4CLOB 7YASA 2WTUA 4Q1DA 1XKXA 4YPFA 1QWSA 1CDZA 1MG0A 1U1FA 3KOWA 3NETA 3PLRA 4ONEA 1HWYA 4BJ1A 1O94D 5T41A 1YE8A 1J0EA 1E2KA 1PQ4A 1KS9A 3VC2A 4CGZA 2ZWVA 1KAGA 1NRJB 4CT0A 4EGFA 4DLNA 4HPJB 1YS7A 1DKRA 1Q12A 4IFIA 1ZD2P 5GM1A 3PGMA 2VF4X 4IR7A 3C5VA 1IPFA 3QIAA 1OYOA 1V2GA 2R3SA 5AW4A 2JGFA 4MRVA 1XZKA 3S1LA 3WO1A 4OYLA 2PMWB 2NO9A 3P26A 4CIDA 4J29A 3UWSA 3VR5H 3ZJYA 1UAYA 4PEVA 2LBPA 2YJ5A 5DBHX 5DNEA 2NXNA 1EA7A 2M32A 2OM6A 4LF9B 3T3PB 1G5PA 1E1RA 2ZKIA 3E27A 4D5GA 1BCSB 3S4YA 3K9NA 3UEOA 2ZIFA 1UMKA 3MUFA 1S5PA 2ZB3A 4D9MA 1EJBA 2B4TO 2IHZA 1A2BA 1DOAA 4FINA 3FPJA 1NBMA 1HMYA 1XZMA 4G5XA 1Q7GA 3O83A 4MW2A 5K4HA 1Y9AA 4W9MC 3KC2A 2YHAA 3GLVA 3IP7A 4MQ4A 3V4VB 3D8UA 3H17A 2E4WA 5DT9A 4EDHA 1NDQA 3L0BA 2B0JA 1HE8B 2J0VA 1YJCA 1OX5A 2HHJA 3D81A 1GQQA 3F6BX 3P94A 4MUHA 2XE7A 5ERYA 3TW8A 2I91A 2HSJA 2QBYA 4EITA 5K0GA 5KVAA 1P2VA 5PNTA 1CQJB 1FFXB 1J1ZA 2R65A 3P9IA 3SF0A 4DDUA 4OAPA 2FUKA 2ZRNA 3HDHA 2QENA 2PZEA 3OEEA 3ESBA 2MOKA 1E7QA 1L5FA 1QFXA 3CT4A 3G2QA 3STYA 3SY8A 5AD1A 2DPYA 2NT4A 3NBKA 1A8IA 3M9LA 4CMJA 1YR6A 3DUWA 3IGFA 3TUZC 2BL4A 4G4SO 4RTSA 2ERYA 4XYMA 4OP3A 1K92A 4F4IA 1X74A 4MUJA 3F74A 3JQCA 1VFPA 3DWEX 4OG2A 1SQ0A 1ZWKA 3SOZA 1EBUA 5JFTA 4GNKA 1FTNA 1L7NA 2XNKA 4EVIA 4MX8A 4UTVA 1EFVB 4DCNA 3VKHA 2PGDA 4RTMA 4NVRA 3UK1A 2SCUB 5EXTA 2D5LA 2L17A 4CF7A 1G42A 1OWOA 4RGYA 2G9RA 3R75A 3CR8A 3E35A 3I53A 3U26A 1Z45A 3DE3X 3FH0A 1MAVA 3RG2A 1ZA2A 5H9WA 1CERA 4K9OA 2R7AA 2TMYA 1XRJA 3QFCA 2B2XA 3OWHA 2GPJA 1NC3A 2ZSIA 4S35A 4WVLA 5DGHA 2HT6A 2G83A 4HDMA 3E1SA 1P0MA 4P4LA 3ZDBA 1MV5A 2AN3A 3EIEA 4MAFA 1KI6B 5CNJA 4B4VA 2NXJA 4W8GA 4J6FA 3SXUB 1G2IA 4BVKA 1XDZA 1GQOA 2OORC 2YV5A 3ZY3A 3BMXA 5BV1A 4OK5A 4D9BA 1P6QA 3DDHA 4OAOA 4F12A 3AVPA 4OBXA 5DN6D 3PXEA 5F9FA 4ODIA 2XYVA 3BUSA 2CJYA 4JP1A 2GA9A 2L19A 3OIUA 4DLKA 5A1TA 5JCPA 2ATCA 2IE0A 4YJHB 1ZC3A 1SXJE 1ZH8A 3DVQX 2AYYA 4G26A 1OMOA 3OUZA 4HP8A 3SHVA 1DQZA 3C3DA 1WNTA 2BFBB 3DAGA 4EW6A 4B9AA 1AM4D 1VJRA 3HLKA 5ED4A 4H4EA 2H54A 3IH5A 1V3TA 2I6XA 3R7NA 3CO0S 5AHWA 1X7YA 3CY6A 2WJ3A 3W5JA 1KSFX 2CBGA 2VOEA 3FOBA 2YC2C 2NU9A 1F0NA 1CJUC 4K28A 5LN1A 3N2GB 2QPOA 3LCMA 1BJRE 1E64A 1M6YA 1ELOA 2EJTA 4NYMR 2CJXA 4QVKA 3USCS 4X1YB 5C5IA 2VPWA 1GZ5A 3JQ6A 3LVFO 1ZUNB 5JEDA 2Q41A 2OFOA 2YRFA 5T6MA 4Y2YA 3ZPXA 3AC0A 2LKCA 2LE0A 2OOKA 1ABBA 1QKJA 1WCIB 5KSZA 1YCFA 1WPRA 2Y4NA 3MINA 4S3MA 4A0HA 4YMSA 4GI2A 4X1KB 4K8RB 3MSXA 4HFNA 3TLEA 4GLFA 4UM9D 5BNFA 1JJBA 5M04A 3GLQA 3U62A 2C92A 4A0QA 4BXOA 2AVNA 1X19A 2CXPA 3D6TB 4ZANA 3LF1A 4D74A 1NG1A 1L1RA 2YS6A 4MVJA 1NOJA 2J8ZA 4HWOA 3H05A 3ROQA 1UQTA 4GOLD 4AMBA 3N0TA 2CNWA 1E96A 3OA0A 2Q4RA 2HN9A 4YRPA 3RRJA 4AJ9A 4YT5A 2HRQA 2Z2XA 4XH9B 3MBIA 4M1SA 1TB4A 1JVSA 1H2BA 1TKAA 1CLUA 3ESYA 2GK6A 3P2EA 4P5DA 4R6WA 4M99A 1F9AA 1ONNA 3ODPA 5CM9C 1Q0UA 4IXTA 2VTEA 3PQ2A 4LOHA 1X8LA 3WLSA 1BXGA 3GLHB 3KT3A 3DEAA 3LQYA 2B21A 2ZREA 1G21B 2VK4A 3PE6A 2WHPA 4TTIA 4Y6RA 3R76A 1WPXA 2B4RO 3A4NA 3KTDA 5BQPA 3LLVA 3G2OA 3PEYA 2B34A 2JDIA 1GAWA 4EO4A 3GJ5A 4I14A 3LHIA 2H2DA 2QRQA 3DW3X 3VJRA 3QW4B 2PO5A 1G20A 2AMLA 3CKKA 4MMZB 4JWKA 1O4VA 3B1FA 5BXYA 1WHTB 4PR3A 2Z0MA 5A0FA 5EWMA 1Q14A 4XQ9A 3U61B 4NONA 1HDIA 2F1JA 2GLXA 2P62A 4YAGA 3UHPA 5MGBA 5LIPA 4RQTA 3HV0A 5E6RB 4E2XA 4E5KA 2AXNA 1TZBA 1V26A 3B38A 5AW3A 2PVPA 4BL5A 1OA1A 4GYWA 5TX7A 4AFNA 3ZOZA 4R81A 4B82A 1RC8A 4LMAA 4B3MB 4JHXA 1DRKA 2ODQA 4JL6A 3KKKA 4LRQA 4U00A 2FP4B 4D3XA 4YRNA 3GFOA 4J3FA 4FOPA 1DBIA 1WZEA 1XN1A 1V45E 3EDOA 4L8GA 1X7XB 4WPGA 4Q9LA 2GRJA 2Q6OA 1R0KA 4I9UA 4X8LA 5KQPA 4E11A 2VPXA 1JPJA 4HATA 2GBPA 1FP4B 4O4HA 2JK0A 3DVAB 4QDZA 3QKRB 1O2DA 2EW8A 1PZXA 2H1VA 1M75A 2AFHA 4UM7A 5FYDA 1F0KA 4LYGA 1YFKA 4CFYA 2WUGA 5TQ2B 1MJNA 3KKMA 2JBWA 2F3UA 3LWNA 3MLAA 1ZISA 3H8WA 2C83A 5EWJA 5JQWA 2ZM6B 1WXEA 3ZU4A 1PF7E 3H1GA 3HKBB 2OLJA 4U8HA 1YI0A 5JPCA 4Y6OA 4PPGA 3F97A 3SQNA 2ONJA 4Z4EA 3I01A 1H2XA 1XROA 3EPRA 5JD6A 1TEZA 3C1OA 3ZWMA 1ES9A 3WSVA 4JGIA 3IE1A 4ZOAA 3JRXA 4ZYUA 3IXQA 2H59A 2PBLA 3WRWA 2MSNA 3N8NA 3UW1A 1XBTA 4I1VA 4MI6A 4DLPA 2Q4OA 2I87A 3AF6A 1QRUA 2KW5A 3L7YA 4LY6A 1RMTA 2Z43A 3EVEA 5HQTA 3B48A 4Q9IA 3CUKA 2J45A 4MV9A 3QWIA 3NHRA 4R5MA 1PNQA 1YKFA 2WYHA 1VLVA 2H4XA 1U28C 4QRDA 3PX3A 4IIDA 4E5NA 3W6UA 1PDOA 2ZRHA 4NOKA 2YYZA 3UA3A 1EXMA 3TR5A 5HM6A 4WDQA 4BZXA 4BYGA 3LK7A 4P3KA 1COWD 1P6XA 3ESCA 4IO0A 4XD7A 4CKCA 3NIFB 5CTJA 4ZHSA 5HKOA 1T2DA 1VDZA 3V1LA 1PV1A 1LSUA 3ZDDA 4RV9A 1QQAA 4TTPA 2CEKA 2XTMA 4FILA 1ZZEA 1MU0A 2R6GA 5TQJA 3GRKA 1PFYA 4KJZA 1C1XA 2Q50A 4U3JA 3ZBTA 3EFHA 1HM5A 3LQ1A 3LY5A 1YR9A 3LOPA 5CD9A 1E32A 4ZC8A 1DEOA 1PN3A 1Q50A 3DWGA 3I9FA 3JATA 4XYGA 5AUQA 3GRVA 1TZKA 1B42A 4PY2A 1V4VA 5AI6A 1GPLA 4C29A 1EHYA 2FWPA 1APBA 1BGWA 3AU9A 4QHSA 4ID9A 3TLJA 4G0VA 1DG9A 4RZUA 3KG2A 1O54A 4X00A 5EUQB 3A4MA 3L7DA 2YZ7A 2WJYA 3S1AA 4EYOA 3DLHA 1A8UA 1CUXA 2B94A 4RVGA 3DMHA 1GGEA 4JIMA 4CODB 3S40A 1KJNA 3KVRA 4N0EA 1Y1PA 2GESA 3RRZA 5JZMA 5IKXA 4N5MA 4HDKB 3U09A 2XYGA 4I9GA 2V03A 3WHPA 3VR3A 4OSEA 1AHIA 3MMZA 3QG5A 5LP6A 4PHCA 3PUJA 4IX9A 3FLBA 4G67A 4LJ5A 5B1DA 1LI4A 1ZG3A 1SR8A 2QN1A 2X7JA 3MJCA 1TTQB 3AM4A 4KAJA 4LSGA 4WY5A 5AW2A 1MENA 5EIBC 2O8FA 1H8HD 2QMEA 1LPMA 4HO1X 3FFXA 5LZ9A 1DQYA 3K2QA 2XNDD 3D0OA 4S2UA 3AP1A 3OZWA 1O96B 3WS7A 4ND5A 1J0XO 4MLCA 2Z9DA 1AQ6A 3PJGA 2BGTA 4JWTA 4RK0A 3KSBC 3OZCA 5I01A 2I6TA 3A10A 3G5UA 4D3ZA 2TMKA 5KMGA 1U8TA 1UDWA 1ZCAA 3G6WA 1L4UA 1P8JA 4RH0A 4X6YA 3GFPA 4Y2XA 4FYJA 5A5GA 2H00A 2ZT8A 2QJRA 3C6QA 4PYOA 1E7WA 3A25A 1GU0A 1SKQA 2ZSUA 3VU1A 1ZJJA 4YO7A 5JMTA 4C7MA 1REQB 2C4UA 3PE4A 5D84A 5TPWB 2HHHB 1K1EA 1NMZA 4L9WA 3PHLA 5ALTA 3ZYCA 1IY1A 4GKJB 1USKA 4PLCA 3N2ZB 2NUAB 1GTVA 2DFDA 5AOCA 2WD8A 4NBVA 4RIFA 2E4ZA 4DIBA 5JASA 1SQGA 3I2GA 3VR0A 4LHEA 1YK0A 3WO0A 1I4LD 1ULAA 3A36A 5B6JA 3T3IA 1ZUD1 4K9PA 1TYBE 2JCGA 2BKUA 5CT5A 4QTYA 1J25A 1MV8A 4EKEA 2WE8A 1DC6A 4QEDA 4LCJA 1FF9A 4MPDA 4CM7A 5BR8B 3BHNA 4FT4A 3ANYB 3IEVA 3HBNA 2H51A 5C81A 3RGWS 5CLJA 1JIIA 2VDPB 3FMVA 5L3RA 4F4JA 1O94A 4YECA 2ISQA 1VE6A 1RXVA 2R1TB 3A2NA 1MORA 2XXAB 1ZNXA 4UUAA 1AKYA 1E5XA 2D3WA 3LGXA 4XOIA 3EAFA 4ESOA 5FH9A 5CEFA 3GUUA 5FLKA 2YN2A 3OECA 4ZQGA 3CKLA 1RJ9B 1YS1X 4EUNA 2W0MA 4BJHB 3ET4A 1BEEA 1IPHA 3OLZA 5IM4F 3S70A 2JKZA 3HYLA 1L7XA 4I5EA 2XDYA 4TM7A 4RTJA 1M0WA 3K1JA 5H3CA 2BF4A 4JUDX 3TOXA 2AFHB 2C0PA 5L3SB 5SY4A 4R2XA 3E9RA 4DVGA 2BP7B 3PUZA 3RWMB 5H7XA 3THSA 4BB6A 2JH9A 1IOVA 1U4NA 3PXUA 3IIMA 4QQRA 4XWTA 2B61A 3OIWA 5M3BA 2XKAA 1SOVA 4BBJA 5E4FA 1JKIA 3GL9A 1B0PA 3O8OA 5BRJA 3NTVA 2HMSA 1YZNA 4TMVA 3B70A 2Y99A 4WQMA 1L6IA 5DHTA 3TQRA 4WN9A 3VPHA 1L9XA 3CN7A 3DJFA 4G8BA 5L4NA 1J0DA 2HLHA 4MP3A 4KXVA 5LWHA 2QNIA 2VXBA 4HYYA 4EUHA 3NBMA 5CB0A 4GOND 3C7TA 4J0EA 221PA 2JGIA 3U39A 4QUJA 3UHJA 4J0QA 1TUBB 3QG1A 2ZWMA 3HA7A 1BOFA 2PX8A 3WX0A 2QQGA 4KK3A 4YCLA 4G0NA 2FPMA 4GLJA 4MR8A 3V2IA 4R1TA 4CT4B 3AO0B 2XYHA 3LT0A 4UULA 3TPZA 1S7CA 2HU7A 5CVJA 4UOQA 4RELA 4DIKA 4ZA2A 1F6BA 1AKMA 3BWDD 4BX2A 5B7GA 3EFBA 3T5PA 2H7VA 2GSWA 1AUQA 1T8UA 3CH7A 3E9EA 3NYQA 4M9XA 5KOJA 1IJFA 1LDEA 1CRLA 4I1SA 1B1CA 5C8DA 3CVJA 1Q84A 3BMOA 4CYMA 2Y0EA 2CZQA 5AHKA 3G79A 3F3SA 1OFGA 1SIWA 3SXUA 1QHHA 2UVPB 4QDUA 5E9JA 3R5FA 4DV6B 3WADA 5D86A 4L76A 1A76A 5D51S 1GZDA 2AHRA 3U7QA 4UCFA 4C3ZA 3Q3GE 1XFDA 3H0KA 5H9VA 2QAGA 5DBIA 3TD9A 1ST3A 1I8TA 3ZDZB 1M8KA 2DWOA 5BNIA 1SQ5A 3HYCA 2X1LA 3CZAA 2BE9A 1XGKA 2XBMA 1SUDA 3IDFA 7AT1A 1BWPA 2XWSA 4KDRA 3EG5A 5EEHA 4J07A 3LX5A 1THMA 3Q98A 5KJ6A 3FN4A 2A59A 4MEAA 4KAXA 4AUKA 3FUXA 4O1IA 4G2NA 5F52A 3DMYA 4Z51A 3HZRA 1U3GA 2BMWA 5LQDA 2GCEA 4QO7A 3NHKA 3I6YA 4V1CA 1ZRHA 4OOFA 3HKCB 5KYKA 2CSXA 1W59A 2GJ8A 2ZTHA 4G8DA 3SZRA 3MYYA 4UNRA 4CMEC 1XRLA 2LDXA 2Q0SA 1XLUA 1L7DA 1JSXA 3IMGA 3W6NA 1TE2A 4JNKA 1T26A 5JS7A 4UE2A 5H80A 4FGKA 4IHQA 2WFLA 1Q5PA 2IGBA 4GF5A 1WP4A 4PIPA 3FDZA 4RK6A 5IVKA 1ECFA 4WY8A 1O9HA 3T54A 4LHZA 4CV1A 1DE0A 4IDFA 4N5DA 2XNDA 1MXHA 4JVOA 4ZK2A 1CP2A 3K92A 5HQJA 2ZSAA 5B4VA 1P81A 2DLNA 4MA5A 4LK2A 1YQUA 2QTLA 2YUIA 4ARVA 3RVJA 4ZCSA 2JRLA 3DZFA 4YP5A 2W6JD 2NNLD 2C4WA 1KZHA 3PF9A 4LGCA 2J0UB 4PPFA 1H6CA 2DLCX 2P2NA 3WNDA 4CV2A 4HFRA 1A98A 5DYNA 3THXB 3HDYA 4Z2YA 3LC7O 3AUTA 3MERA 5I6DA 3ZWAA 3GEMA 3KBBA 3T52A 2BGRA 3X2FA 1K8YB 2W90A 5THQA 1WZUA 1XMJA 1Y7PA 5E6SA 5KTRA 2GDJA 1TO6A 3URMA 5KWJA 5JIBA 4JBWA 4RPIA 1Z16A 4EG5A 1GTJ1 4GH5A 2WHPB 3ZHZA 2WHEA 5I48A 3WB0A 3A6JA 4DT1B 4BLSA 4LYFA 3HMQA 4U63A 3CW2A 3AVYA 2HWWA 3DL2A 1JTEA 4ZZIA 2JJ2A 1IBSA 3GLHE 1VYTA 2H1RA 4N6NA 4H1UA 1UOOA 4YGXB 1QVAA 4E21A 1N5KA 5EIBD 4PFJA 4NTZA 5FOQA 4H1WA 3NVKI 4YRKA 1JHMA 2CJWB 2NWQA 2PS0A 4NWIA 1W7AA 2Q1SA 3H1TA 4OPMA 1X14A 4KZPA 3VKFA 3MAJA 3RS4A 3JV7A 2IS2A 4BFUA 4CTJA 3WBJA 4DR5B 3SC2B 1W30A 4UBJA 2GBIA 3ICOA 4URUR 3GLFE 3VKUA 4K86A 3KOXA 3WRXA 1VFNA 1QQBA 3ONVA 1FFYA 4K6HA 5H4HA 2DBQA 3E9CA 3PQDA 3BGDA 1PLJA 3D2BA 4PSAA 5CEEA 1M6HA 3C1UA 3GA0A 5J4LA 3GRFA 2J33A 2FMXA 3OZVA 1MT0A 5EJGA 1V11A 3ABQB 5SZJA 5JC8A 2HDWA 1HYHA 3JVEA 3L7JA 1BKDR 2PYIA 1OU4A 3BE4A 3BL5A 2Y67A 3KO8A 2B4KA 2C7VA 5TT1A 2QMZA 2V3WA 2WK1A 4ND6A 4PTZA 1H2AS 4NJOA 3WFIA 2QY6A 3RKRA 2O4CA 4U7HA 4E12A 5KZMB 3TTXA 5LL6P 3NUZA 2Z4SA 1MC8A 1OIXA 2A5GA 5CFMA 1PR3A 3FCXA 1O5OA 4ED9A 1TUBA 2YOFA 2Q5EA 2CGEA 4F2DA 3NXKA 5L53A 3MN1A 3A1WA 1EFAA 1V35A 2RG7A 2W8BA 3E22A 4ZAYA 1XPJA 3BGWA 1PZNA 2D1YA 3I6IA 3E9YA 3EPLA 1AKUA 1OBHA 3JU3A 3FJ1A 5I7VA 2RJ3A 2WYIA 4QJIA 1D1SA 1Y5RA 3OX2A 1RWBA 1Y37A 4FYKA 1L3BA 2BFEA 3IQXA 2X2OA 4OLBA 2H5IA 4Z9YA 3ORQA 5IARA 1Z6YA 2BOVA 2FV8A 3ER9A 4JU8A 2VFAA 2BAGA 3WICA 3UY4A 4HEJA 3HN7A 4DW8A 5BMOA 1S0UA 5JDIC 3OLQA 3D7MA 1V71A 3WV4A 4A92A 1PBTA 1VMKA 5BYAA 3L46A 3D1JA 2PD6A 4GSKA 3FYUC 3VDXA 1PR5A 1J49A 1JHAA 1KMNA 2VP4A 2XA2A 2WUFA 3NTOA 3TLZA 1TYZA 3KNZA 5TC4A 1K3UB 1P17A 2W8ZA 5KYTA 3WGLA 3HGMA 4GC5A 1BRMA 1QP8A 2NM0A 1DINA 1PFKA 2ZYGA 4X66B 1RXUA 5AOVA 4E0BA 1IQPA 1E4EA 2DYKA 2P4EA 1YJBA 1CY6A 2QLBA 3IE0A 4I1OA 3S7ZA 5M29A 3CNQS 1OLOA 1XF1A 4MQ5A 1N2CA 1VE3A 2P2DA 3F6PA 1DADA 3PHCA 4XWAA 5BVHA 4LECA 2FFHA 4MEBA 2GZHA 4HVLA 3HI4A 1UFVA 1AUXA 1Y7LA 3OFND 5IH3A 1C81A 2C9ZA 3C3AA 1QHYA 1W46A 4URVR 1Q1EA 3C8DA 4WZAB 3RIXA 1M2OA 5I4CA 4S0ZA 1VECA 4ZI2A 4UCWA 1BXZA 4V1CB 2ZRPA 4HG2A 2Q21A 4FM9A 1TOAA 5EXEA 1R4NA 3GFBA 1FQJA 4E5YA 1QV7A 2VF8A 4R9UC 2WJJA 1PJ8A 3AR6A 2HYIC 4OKSA 2C8KA 3GGJA 4UOZA 3TIFA 1JH8A 4PHTA 4LXXA 3UK6A 1J8QA 1RC0A 3BSSA 2Q1WA 4RJLA 1VPLA 1OV6A 3OQOA 1GKLA 3LA6A 2C3UA 3LQRA 4BE7B 4ZHQB 5FUYA 3FSJX 3S27A 2YVLA 3QU4A 3ZE6A 3GFGA 1VLLA 3QFFA 3SMQA 1NN0A 1OXMA 4F60A 5A1JA 1Z13A 3HJTA 4NCJA 3KXIA 4OQPA 2W70A 3IEMA 3OIFA 5FP0A 3CLTC 2OAGA 2HZBA 2ZPUA 3LPMA 1VKJA 4JEUA 3FYTA 3AIOA 3SIWA 1D5WA 2AUTA 1R6XA 3ID6C 5HPYB 3DKVA 4LFBB 1N8KA 3GBPA 3Q8WA 4ARZB 3THXA 5I7FA 1KFJB 1JH9A 5JEEA 3HRKA 1RU3A 1UXKA 4RQAA 4CIAA 1IBLB 4IDAA 1ZD5A 1H0RA 1RYBA 2W6JA 4TXNA 3L7IA 4WOJA 4LAFA 3EPKA 1H5QA 5F2EA 1QAMA 1GPUA 1XEFA 2D2EA 4L0QA 5F21A 2VO1A 1EX7A 2CJFA 4AKTA 4YUYA 1FX0A 3UXYA 4JMPA 4CN8A 2ZXFA 1SCIA 2MYTA 4LJ8A 1DCMA 4AZ0B 2H2FA 1NQOA 1TMGE 3HWSA 4N5NA 4KOAA 4GQBA 1WSWA 3LT1A 1LZKA 1H2WA 1WMAA 2OHGA 2X7HA 3FSEA 1MGOA 1YZVA 2A94A 3LFUA 3OIVA 4W1SA 1XDGA 2QSZA 3IODA 4FDVA 2PBRA 3AW9A 4LCEA 2ZRIA 4NDAA 3GRUA 1XRSB 4GYYA 3QKSA 4JS0A 4KLNA 3IV9A 5DM4A 1TM2A 2D8MA 5SY6A 2DWQA 1P61B 3T3GA 3EMKA 3PUIA 4HLDA 4BKQA 2FPWA 5CFQA 1IEQA 4LQCA 4Z1OA 2CNLA 3A7DA 4B6FA 4V0LA 3QEMA 2JFFA 4F46A 3W5DA 2I80A 1E1QD 3MFYA 5FD8A 3GI1A 3SDBA 3PX7A 3TB6A 5KX5B 1AS3A 2CFTA 4NARA 3SSOA 5BWMA 5ABPA 2JI8A 1XWIA 3GFVA 4ZP1A 3KU1A 2IPMA 2FGKA 4MWBA 4N76A 1FFGA 2R86A 2LKDA 4MPRA 2IEZA 4OGKA 4YFVA 5D5HA 1R10A 2J6HA 5ENDA 5EWLB 4CCWA 2JZOA 3IKVA 1K5GA 4H7JA 1SIOA 1SKBA 2CSUA 2GD1O 2A58A 3F1KA 2V7PA 1I2DA 2DY0A 3A04A 5JS2A 3TX2A 4B34A 5A5DA 3LG2A 2Z57A 1U6JA 5ALIA 1GT6A 1WQ4A 1Y5NA 1Y89A 4IQ0A 1CUSA 1WVIA 4WSOA 3KZXA 1XZJA 1MB3A 3BMQB 1ZH2A 3R40A 3D7RA 1K0FA 4BNLA 5EZYB 3HZOA 4WESB 1NXVA 3DLCA 3KYJB 2A5YB 3SJBA 1F4PA 3BXPA 2Z3ZA 4GAEA 4O2BB 5TARA 1L7AA 1IVSA 5EZ6B 1HYQA 1GTL1 2JAUA 2XQVA 4BECA 2YBDA 1S8OA 2YY5A 3G82C 1KEVA 4TT8A 3LI2A 1WNFA 4W99A 2VH5R 3IJPA 3CISA 4GI1A 3A1SA 3NI2A 2PL3A 5I9BA 1P4RA 3UG7A 4ZDIA 3VNAA 1HNXB 4L0CA 1WTCA 1M6VA 1QRAA 1FYEA 4GMFA 2HQOA 1AO0A 5ECGC 3VOTA 5EJ7A 1FFDA 1DP4A 1ZN7A 1ANKA 4I50B 5F7XA 2PGLA 3DDZX 4PNZA 4V0OA 4TRRA 1JP7A 1K4YA 2ZVQX 2IE8A 2WU3A 1XCJA 3U4IA 3DFMA 4NBUA 5ALOA 3OCUA 4G4GA 5CW2A 5E7QA 3FIJA 1Z5PA 5CVUA 1XV5A 3T7SA 5FFFA 3LY8A 4GUDA 3ZCUA 5LMNB 1OZAA 1YOVB 3P0EA 1NW9B 1NG9A 2QVZX 3R0IA 2ZM5A 3CNOA 4QRHA 4U9UA 2ORWA 1X8JA 2JRCA 2MSWA 4N54A 1W29A 3JQRA 1KBZA 3GRZA 1BFUA 3JQ7B 4RF3A 4UBOA 1YFZA 2XVZA 2HA0A 3C8ZA 3DVSX 3HC7A 1YQWA 3U13A 4M0PA 1S3IA 1T1GA 5HJ5A 4OLAA 1SBYA 3Q3CA 3CLRC 4PAMA 3ZY4A 3TBFA 4WZ6A 3ZHXA 5IAAA 4FR0A 2XWBF 1FDWA 3BFXA 3HPRA 4JLPA 2HK9A 1YBVA 4YLEA 2ZUTA 2TECE 5HWSA 5A3VA 2OHIA 2F43B 2CXRA 3IQDB 4QO8A 4NZMA 2W6CX 1ZXLA 1KOLA 1OCEA 5BQXA 3LSYA 3U1TA 5A4MS 1OPXA 3WGKA 3IUEA 4QELA 4F1JA 3O4FA 4QM6A 5FTMA 2VRBA 1AHNA 3L5KA 2BH2A 1YRYE 2MYUA 1YU9A 1JZSA 1IZ7A 3QI7A 4L4RA 4NS4A 2C0QA 4DG8A 2VXOA 1F2VA 4Z2AA 2GKOA 3DVRX 1YC5A 4H6VA 2ONCA 4RKWA 1Q20A 1VXRA 3O91A 2WG1A 1SBCA 2N1BA 3I09A 5E4JA 1QH8B 3FZQA 3M1LA 4MDHA 4DXDA 2PTHA 2JS7A 4OQLA 3RARA 5EIEA 2CYAA 4M6WB 2JIZD 4MV3A 2WMNB 3P71T 1G8AA 4JQZA 4L72A 3BDIA 4N7MA 2N46A 4AULA 3WBBA 4B9EA 1RLIA 1CQIA 4QOSA 1KQGA 6LDHA 4INJA 4QYMA 1BVRA 1CJKC 4G0MA 3RTCA 3UMSA 5E6UA 5JHGB 1CEEA 3SQLA 1V1JA 3PA6A 4DNXA 4BMDA 1KAEA 2QW1A 3OZFA 4IVPA 1NP7A 3I9NA 2L69A 4RJIA 1ACLA 1K86A 4FXOA 3AHDA 4G1UC 1FMLA 3QOWA 4QD3A 4EBFA 1VKZA 1P2BA 2GS9A 2X40A 1Q91A 2JARA 2QMOA 2B1RA 3GELA 3MFQA 3K9GA 3PDUA 4OJNA 3F9IA 4UOEA 4NV1A 4P3XA 3V3TA 4X1KA 1ZX1A 4NMMA 2QAGB 1XTPA 1YL7A 4K6MA 3VHXA 1NVMB 1A4XA 3B7GA 5FADA 2AKEA 1RAHA 1NASA 3LFHA 1RWPA 1L8AA 1XXHA 3AY0A 1CTQA 4Y1GA 2KM1A 2KWIA 3VVMA 3VMMA 3W4KA 1EVQA 3ST7A 3GPIA 4G5HA 2VDWB 1M34A 5JV5A 4GX1A 1B3BA 2FUG1 2PYZA 1ID1A 2MWMA 1K66A 2WE7A 3D2CA 3D6AA 3DPIA 1Z83A 1PL0A 2WSMA 4E4TA 1NGSA 1PG2A 3PNVA 3WYBA 5CB4B 1XNQB 4AY2A 1OYWA 2AUNA 2J9YB 2X76A 2WWFA 4M3NA 4XGNA 3VR1A 1QRSA 3N7AA 2JLQA 5U9CA 2WAOA 2ODNA 3A9RA 3K1TA 4FGWA 4HPXB 1SUPA 2IYSA 1G21A 4ZXPA 3V00A 5EJEA 3PQ4A 1PS8A 1LBTA 4LXQA 5DGCA 5LFAA 4F0JA 3W06A 2HHLA 1P4GA 2C8VA 1QG0A 2DUMA 1XL0A 4A03A 4BMSA 2DQKA 1UODA 3H7IA 4FC6A 3JD0A 5J5CA 1JDBB 3HB7A 1EVZA 4JC4A 3O26A 1B8NA 4GE3A 4GECA 5F2KA 3NZEA 4N0DA 4FCTA 3FXAA 5JYCA 1G18A 2H8KA 1I7LA 5AIBA 5KOJB 2I6SA 4HB3A 3TDMA 1W6RA 1W34A 5EE1A 2IYRA 3REOA 3R0QA 1AGRA 4YRGA 1IZ9A 3VO2A 2WQ6A 3EVCA 1MNQA 3KELA 3LUBA 4MR9B 4WINA 1QQ6A 2PU7A 1NF2A 1S2IA 3ESRA 2QQFA 3IEUA 1YUBA 1B7GO 1EWVA 3PXDA 4W6ZA 2RGRA 1DRJA 1T8RA 2EWVA 2GCIA 5JYBA 4LRXA 2P0EA 2WUDA 2SBTA 1YNSA 1F1JA 4GZ5A 4E5UA 5TT0A 1ZMOA 4IF4A 2UZ1A 1XN4A 2PR2A 4CDNA 1M73E 5ALUA 4ME6A 4CHTA 1Y1KE 4C20A 1WKCA 3EK2A 4H7HA 4EMUA 1LVGA 1PFVA 2DR2A 1ZOIA 5EKUA 2REBA 4G1EB 5JBIA 2O1WA 4JITA 5JS8A 3LQQA 4QOIA 1KYIA 5K3AA 4L3VA 3GCZA 4WKBA 3SYKA 3DOJA 5EINA 1ZOOA 3E3LA 2JA2A 1MHTA 2ASVA 1EUQA 2R25B 3J7AC 4UHHA 1N6OA 2FW8A 2I8LA 5L6LB 2ODEA 4QBTA 2P69A 2J9FA 1W85A 3UAXA 5LOVB 3A6PC 3DOCA 4JSTA 2MHCA 1C30B 1VXOA 3EJWA 4B79A 1ZOLA 3AR9A 2G67A 3MELA 1BROA 3NKVA 1BXRA 2V4ZA 3OFKA 4PXYA 4LDPA 3TMKA 4JKOA 3TN7A 4A9AA 2XUDA 2PT7A 1UFRA 2LCQA 4NV3A 5JSQA 2BLNA 3S2ZA 2VPYA 4E13A 5IPFA 2GZ2A 4O2RA 2NPIA 3DONA 2H85A 2H5JA 1EMDA 2I62A 4MKGA 1SA0B 4LE0A 4MV4A 5K2MA 4B8YA 2D1FA 1DV1A 1N7IA 5T4HA 4BZZA 2HFKA 2YX1A 1D6MA 1XQWA 3I1FA 1T0PA 3MBOA 3UJ3X 3GJ8A 4J7AA 4R68A 1IUPA 3GXBA 4E14A 4L85A 1NOKA 3BD7A 5TV2A 1Y1LA 3PVSA 3K94A 3DE4X 3TE6A 3VH1A 5AXCA 4DQKA 3DSRA 3GFFA 4WASA 1UQRA 1QHIA 2DG2A 3K9WA 2JLXA 1TQ4A 4U2CA 3I0MA 3CRVA 3TSOA 4I08A 2JANA 1ND6A 3R7BA 3BRQA 5H81A 4G0PA 2B98A 4UHEA 2FN8A 4KE6A 3LBAA 4W5JA 2JLSA 2ZRKA 4G5SA 3WMGA 3GPLA 3R5JA 4FMDB 3S28A 4OXKA 4OQ4A 2GTPA 3PDWA 4NESA 1RRMA 4OHRA 4XUDA 2A7XA 3JQQA 5D6OA 2I2XB 3B5EA 4BFVA 5DHUA 3D0RA 3EC2A 3HGTA 2ZZKA 4ALMA 4DOMA 3V7YA 3U56A 3VX3A 4RTQA 1X1SA 3BHMA 1EA5A 4GVXA 4DZTA 4XARA 9GPBA 4IWXA 3KAKA 4WA7A 3R0VA 4PWYA 1C3VA 1E3IA 1OA0A 4U9HS 5DBFA 1DLIA 4GMHA 3T5BA 4YT8A 2CJWA 2AT1A 4KSCA 1N2ZA 1WBJB 4KQIA 3H16A 4QUHA 4ZQEA 3DT6A 3KJEA 2XNCA 2VWQA 3KR2A 5FOTA 4BQSA 1J39A 4C0XA 4WBNB 1YBFA 1DKNA 3FFAA 4M8NE 1IN4A 4OFBA 4ND4A 3ZZTA 1KWGA 4CG2A 2XDWA 2VHTA 4KE7A 5D1HA 2ZVJA 3PZRA 2X9NA 4G01B 4GX5A 1MW8X 4ND1A 5K6TA 2VZ9A 4B47A 4EUFA 4UBLA 5CXSA 2DRIA 5KINB 2IPAB 5JNUA 2O3TA 3D6FA 8MHTA 2O19A 5ALJA 3I6MA 3UA4A 1A77A 5EQDA 3HHPA 2OQ2A 3L8EA 3B8HA 3QU5A 4OTZA 4I4LA 4Y6GB 5FTJA 1Z36A 4XZ3A 3WL6A 4R1NA 3FYUA 4IDPA 2JC3A 2XR1A 4BCCA 1DC7A 3TD2A 1NV9A 1XEXB 3L84A 2E9SA 3PC8C 5HMLA 4WBNF 5K8CA 3NKFA 2P91A 3NTUA 4RPCA 5K8VA 3F5QA 4FCCA 3OE7A 3TLMA 4RE5A 1ZVQA 3R77A 1CS0A 2G7MC 3K0AA 4B17A 5CB6A 1A7AA 3M3PA 2G5PA 4PHFA 3AFIA 4DV1B 2OBBA 3ZUPA 3PXGA 3T9FA 1GNTA 2E1PA 1TK3A 5SYNA 4LF8B 5AVWA 2NUAA 2B4QA 4XGRA 1R2QA 1KEEB 2BEVB 4MS1A 5A06A 5JJBA 1Y81A 2IQ5A 4PYLA 2A78A 4NDNE 3RD5A 3GEDA 5IX8A 3R3JA 2GXQA 1TFUA 3C70A 1NJSA 3BWVA 3OOSA 1WCXA 4RADA 1E7YA 4QT4A 1W44A 3DL0A 5HVNA 2Q2OA 3DTTA 3WB1A 1DDGA 5KSYA 4JAVC 4J1SA 1G3UA 4GI5A 1GFZA 1FU7A 3HR7A 1S02A 1C7ZA 2GYWA 3ZHOA 4OXXA 1N8SA 1KY5A 2QN7A 1ULBA 3FFBA 1KOGA 2QTMA 1O96A 1H3FA 1IEWA 2YVUA 3IVGA 2VDMB 3TJRA 3L40A 4U7TB 1U8ZA 3THWB 4K1XA 1P7PA 3A9TA 3KQTA 1SKMA 1YRHA 3S2SA 4B43A 3EX7C 1WDTA 2IYPA 4Y9DA 4DMMA 1XWFA 3MWLA 3R1IA 4CKEA 3ITKA 5G2OA 3O84A 2EQAA 4TT3D 1X1TA 3OICA 3IILA 5L3QB 2O5RA 5TS3A 1BVHA 4WECA 4EX6A 1FVXA 2RH4A 4N5HX 3RSLA 2XYQA 3U3RA 2J9FB 1HLFA 1YCGA 2CLKB 3ADCA 1DLJA 5HIMA 3AVTA 4B8ZA 4PAQA 2I4OA 2JCXA 4HDSA 1DTWA 4FOSA 1XR3A 4MUAA 2IXEA 1IN6A 4CUJA 1B15A 1D1PA 2R60A 2OG1A 2HJHA 1GTMA 3RSHA 1F51E 4DIMA 1ZVKA 1XA3A 5IEBA 4L57A 4Y6QA 1JHQA 4IDHA 2HCBA 3ZDFA 4DCOA 1G16A 1I3OA 3JAKB 5I7RA 4MQBA 4YMIA 2Q5JA 4IIJF 2G04A 3U3MA 4GDMA 5BV8A 3O90A 1MB9A 3SD7A 2UYYA 2VN8A 2DEUA 1XVLA 3UUWA 3JQAB 3QGMA 1F48A 4DA8A 4JEIA 4F6LA 3VOBA 2PUCA 1U3CA 1A27A 4KIUA 5H1YA 4CGYA 3QELB 4PIMA 4EA8A 3DTVA 2O8CA 2VDOB 4CEJB 4FHEA 4P31A 3RF7A 4CFZA 3LYLA 3TSAA 1QGDA 1AKVA 3KSZO 4YS6A 3WHKA 1BDMA 2ATXA 3MD9A 4QHYA 5DOZA 5CA1B 1KC3A 10MHA 1I5EA 3MAGA 2IYNA 1Q1BA 2H0RA 2C77A 2OHFA 3JR3A 3NHMA 4W7IA 4Q48A 4FLMA 3RYTC 1POXA 4RVDA 5DHPA 1YU6A 3WGZA 1LW6E 1BDJA 3I42A 2E37A 3IVMA 4OIMA 2J5KA 2FFBA 2C20A 2QOEA 3PHJA 4HLUA 1KF0A 5C1IA 1UIMA 1F6DA 3M7IA 4KXXA 2ZIWB 1XALA 3PL5A 3DLTA 2V3CC 1WE2A 2IW3A 3K09C 3L0ZA 3OCYA 3Q0EA 3QKUA 4O0MA 3FOZA 1GU7A 3Q40A 4A1FA 1AK9A 1YR1A 3ABOB 5G0TA 1BMFA 1KK3A 2NO4A 5C37A 1NW8A 4CQMB 4XWOA 1M6WA 2RKOA 4HSGA 4KGDA 5DNUA 1NV8A 2Y1OA 1XTVA 1BE8A 1KL7A 2BKEA 1OIVA 3IAXA 4CLHA 5KWEA 2JJQA 3ORHA 1DEXA 1JFRA 5FLEX 2PXAA 3NHUA 1LWOA 3G2IA 5AVJA 1ECPA 4MR8B 1XDDA 3ILHA 2PPVA 4P7GA 3N7UA 1LQ2A 4HX2A 3GRCA 3LHFA 5A7GA 3ZKAA 2A5FA 3FFTA 5JS1A 2P9ZA 1U02A 3ZNQA 1YHZA 1A9QA 5ESRA 5HYVA 2CCGA 2PUVA 1NN5A 4LWPA 4NZZA 1PR4A 1YMUA 2FW7A 2A3NA 1NI4A 2MYPA 3F9CA 4YRJA 3UHAA 5I4IA 4RAOA 1XTJA 5GPBA 5TIIA 1QH1B 3OCWA 2DR3A 3TZHA 1L8LA 2R79A 1M67A 1MJHA 2Z4TA 1P8AA 1QCZA 5AI5A 3I1JA 2BT4A 1PGOA 4D0SA 4UBKA 1QC5B 1R0SA 3DBOB 3U7QB 5JALA 1JHUA 3WAGA 3DKPA 2JD1A 3M5PA 3VHQA 2XF8A 1JL3A 2V7GA 1A88A 1Q3HA 3STUA 3BIWA 4KR6A 1N7HA 2QM0A 3I9MA 4P7KA 4N39A 1P2DA 1CHDA 1B16A 4OB8A 2EP7A 1DSSG 5D6NA 1S9HA 3WHIA 3ZCTA 1U0BB 1QTRA 1QNLA 4RY2A 2OOSA 1XELA 1GYRA 3IJEB 3NO4A 2XDQB 1RCTE 3NC4A 3SLRA 3KEOA 1SULA 2B36A 2YIDA 1YZUA 3OWOA 3OZTA 1JSCA 2IYVA 1TYAE 1C3EA 4Q5IA 4UEKA 2W48A 3RVOA 3K4PA 4G41A 4LFAB 1YDHA 3UBMA 3GWGA 3I58A 1HETA 1QO7A 5BW6B 3TTUA 2DWUA 4PZ9A 4F3YA 1SVOA 2XH8A 4NYIR 3KQSA 2GAAA 3BTOA 1XXLA 4INOA 3RJMA 1HH4A 3DV9A 4G24A 2GD0A 2WT4A 4XRRA 1CJSA 1EJ2A 4AKEA 2WF5A 5AVXA 3IXMA 1BTOA 5B30A 4CL2A 3FTFA 5BN1A 3BRSA 2NP6A 3GA7A 3C16C 4TLBA 1O8CA 3V42A 1ZRSA 2XB8A 4DDHA 2DHCA 2BJHA 4LWQA 3P2IA 3WB9A 5IDXA 3R9XA 4P32A 4BLPA 3SHOA 2O0KA 1SUSA 2YWEA 5IKOA 3SC4A 3W5SA 5K99A 3ENVA 2OO3A 4D44A 4YUZA 3LLSA 4Q47A 4ARSA 5L4LA 1G5HA 3IP3A 5JHHB 1A9SA 1DC3A 3AOEC 3GDFA 1KRHA 3EEYA 1GG8A 2AX4A 2J3IA 2IJGX 3DBRA 2PA0A 4MTLA 5DF1A 5AYVA 3ROEA 3UTCA 4F7WA 4ZZ1A 3GB9A 4IIGA 1OV4A 1V11B 2ZUWA 5LA6B 3CUUA 1GZ6A 2MMCA 3DA8A 4WZAE 4XFKA 3OHMA 4YIKA 5EZ5A 3TTSA 2Q3BA 5IWAB 4RZQA 4QUAA 3D4NA 3QVTA 1TUIA 4L02A 1HE5A 4KK4A 3E84A 4DKXA 5A6VA 1KJZA 1DL5A 1NATA 3BEDA 3SZOA 4WK0B 1TPYA 4EPXA 2ZBDA 1I2MA 1BU5A 1ACMA 4OFXA 1HSZA 1WQ1R 4HQKA 4TS3A 1DAGA 2R6HA 2GVZC 2CHUA 1Y4ZA 3ACCA 5A6SB 1VCNA 3KUXA 4L2IA 4EOGA 1N6PA 5D3KA 5FOXA 2IPNA 4N03A 4RDHA 4FFBB 3SX2A 5B58C 1YS9A 2QUZA 4UAJA 3G2LA 3NHLA 5FTNA 3ZE9A 2AR0A 3RFUA 4D0RA 8ADHA 4QA9A 3MZ0A 2B6NA 4D45A 2C7QA 2IYZA 4M0KA 2CDCA 5CLLA 1EUCB 3L0CA 3PGLA 1PNTA 5JRJA 3AESA 4BB5A 2P3QA 1A4UA 1GTG1 2IYTA 2Y4OA 3VYRB 2DULA 3K0BA 1M1NB 2JFWA 2E87A 5KNCA 2H6EA 1CC1S 2EHDA 5JSFA 1S89A 3P0IA 4F85A 5FEUA 1U80A 2XMDA 1W8IA 1U9YA 4JLAA 1NR5A 2J87A 4MK4A 3UOWA 2PX6A 3MPOA 4WJLA 2PCLA 3K0KA 5JSKA 4BJ5A 3AT1A 5EZYF 3RSQA 3LZ6A 1UK8A 2XUFA 3PWKA 2RI0A 3B20A 5JOQA 2WWWA 4TKMA 1XK6A 5HGXA 4KHPB 4GPTA 2RGWA 3JRNA 4FSXA 2PUFA 3OC6A 2O54A 2QRVA 2ZI6A 3FPEA 1BNCA 3ITNA 3OT1A 4MW9A 3HU3A 1CLEA 1E6UA 4FD2A 4WXPA 3RTAA 2EP8A 3S1AB 5HOQA 4O4LA 3MM4A 2EVWX 1FLNA 3H97A 4K87A 2A92A 1FYVA 3JWIA 3FAKA 5A4KA 2RBGA 3FLEA 2WIKA 4KOEC 1FJ2A 1FZQA 3H2IA 1SUFA 4V2UA 4BLTA 5GJVC 4ZT6A 1N8TA 2ESRA 3Q85A 3W2IA 1SPBS 4RULA 3AVUA 3UGKA 4ZALA 1L5YA 2B30A 4PPNA 4JVNA 1GO2A 1XQXA 3A28A 4JKIA 1P3DA 3QPUA 1WETA 4DJJA 3M9XA 4WW0A 2WJ4A 5F1OA 3LWDA 3F5DA 2EKZA 4L28A 1FTGA 5AVQA 2WHYA 4CZ2A 4X20B 2IXBA 4PIVA 3RRBA 3CCCA 3RHSA 5HP4A 3EN0A 4TV9F 5AI9A 5GGYA 2OGWA 1ZGAA 3JQ9A 2VP9A 5JSYA 2HEGA 2BMJA 4HQ6A 1YB5A 1TTPB 2NTVA 4AJKA 3K70C 3K09A 3G8YA 4N47A 1T9GS 2JBHA 4ZWNA 1TAQA 4AKHA 1HYEA 2Y1KA 2C07A 3DMTA 4YRTA 1NJ6A 3EGEA 1SHUX 3R23A 3ZNNA 2QN2A 1FUKA 4CQJA 3L6UA 4K03A 4UAUA 5H3HA 3A4YA 4XDGA 1U98A 2G40A 5IBCA 3N39C 1DRWA 4YJDA 2WJWA 3DZDA 1ZPDA 4J8PA 4MSUA 1Y1QA 1GL6A 3HY4A 3RT7A 4TWBA 3MWKA 4ENTA 1KK1A 2DFNA 2OFPA 3D6VA 4GOMD 2OCGA 1NVTA 2JL1A 3GMIA 1D1QA 3PD0A 2GZ1A 3RRYA 3ACDA 1U9ZA 3DZHA 2NMVA 2XMGA 4BB9A 4QWMA 4KFTA 4QPNA 1Z68A 4UHJA 1FX1A 2R8XA 3RBVA 4XB6B 3T06B 3OU6A 3B3GA 1R5OA 2OGSA 2CB0A 1WQ3A 4OK3A 1F8FA 5HDBB 1C5KA 4B2PA 3F7NA 2PX3A 4EKIA 2ZE8A 2ZIEA 1DUIA 3PFBA 2Z58A 4HAXA 5FNVA 1DO0A 2R6CA 4DIOA 5JCZA 3QBJA 1P74A 4ZHQF 4DYHA 5JCOC 1RXWA 3K53A 2C8JA 2RHWA 1D2GA 4E2FA 4ZGGA 1W9HA 2HTEA 3DBHB 3NW9A 4MLDA 5TMEA 1TK9A 3IIEA 1GXSA 1QO0D 4LZNA 4EH1A 4DR4B 4RLFA 3EEOA 4QOFA 4KO4S 3MLEA 2FQXA 1OR8A 1CPYA 5A04A 5IFLA 4U1RA 3GEBA 3FVTA 7MDHA 5JAIA 1B3RA 4ALLA 3KJGA 4IQ8A 3W3AA 2W6NA 2ZIXB 1S8FA 3JTEA 5EI5A 1J1IA 1LS6A 1WDLA 4Q18A 3VU8A 3WLHA 2QBYB 4NH4A 4M89A 3C3CA 3D7SA 4KE9A 1YRBA 4F2GA 1G7TA 3PITA 5FPHA 3JWEA 3RHZA 3CF2A 1ZQ1A 4H31A 1N3LA 2ENWA 2K2QB 3VXKA 1XZHA 3H4MA 3V1MA 3A31A 4JUCA 4TKVB 2DX7A 1FX0B 5JNTA 2VHWA 4DDMA 4V0MA 1PTJC 1HSOA 3BIOA 1NMQA 1OKKA 3C0KA 5B3AA 3PP8A 2O48X 3K0AB 4KKVA 3SN6A 2FHPA 1W6UA 5I4KA 4MMYB 1QUFA 4HXFB 3LDHA 1XQYA 2JI7A 3HFGA 4JVLA 1EFVA 1AVTA 3I1YA 3VR3D 4K0KB 1IZ8A 1SO8A 2X5OA 3H0EA 1QCCA 2B7CA 3QBEA 4QU0A 4U7JA 5GADl 1NQ5A 1OZHA 1FW6A 2OG2A 4L6IA 5J3JA 4CHGA 3MTDA 3QHQA 3JWPA 1GGHA 5EE0A 1JLMA 4NCKA 1H4SA 2X8WA 1YR3A 2Z9CA 3IT2A 4URZR 5C3MA 1TYCA 2VYVA 5LVAA 1HOXA 2IYXA 3H5NA 3V80A 2DETA 2WBLC 1X9IA 3I2FA 3MCAA 4KR0A 3N2EA 4MW5A 4WK6A 3QLUC 5IASA 3JVDA 1I7PA 3O93A 3VNBA 5HIKA 3U4QB 2VQ6A 2H1OA 2C4VA 1HTBA 4MRMB 5TY0A 1XQ9A 2O5EA 1GDHA 2IXFA 3BIFA 1M72A 3JW8A 4Z54A 1ILEA 2RARA 3GCXA 4M37A 4X92A 1K2VN 2AW5A 3R3XA 3C6KA 4JP5A 5H83A 5EXPA 3N87A 3CN9A 3C41J 1JLRA 1N0UA 2EBFX 3HACA 3OF5A 4JQCA 5HJEA 4C6SA 3MMNA 5B3LA 1S8AA 2C9YA 3GLGB 3EXHC 3TMYA 2YJTD 3E0XA 3AL2A 3BJEA 3KT0A 1EFKA 1P29A 1Z07A 2V7QA 1DBQA 1A9TA 1GFSA 2I9PA 3EUEA 1ZK0A 4TQAA 5B1EA 2G0NA 4AJHA 2WIFA 5L3QA 4DV2B 3NGXA 2GPAA 5EIXA 3I04A 2AK2A 3U9TA 2AUMA 2WZQA 2VJPA 1I01A 2AG5A 2I22A 1B0AA 4J90A 3U9LA 1HZJA 4BBZA 1OX4A 3C3PA 3OO1A 1XEXA 3BGIA 4NCXA 1N2SA 1KYTA 1Z8HA 4WZZA 4MO2A 3MVEA 4HYTA 3B1KA 2O3RA 2QW8A 5E3IA 1V3VA 1NVVQ 2EKLA 1KXZA 1JTVA 2HA6A 4WACA 3MUNA 4BBPA 1WXQA 2BF7A 4EEZA 4DCCA 3CVOA 1M9NA 1Y5IA 1XVAA 1B74A 2QYOA 2GQ0A 2GWHA 4Y2HA 2QMQA 4LZPA 3EXG1 4PC3A 5CFRA 4EZEA 3MMPA 3BCHA 3TNLA 3ZDRA 1UEXC 3AB7A 2XYRA 2AW3A 5DT2A 5DGDA 3JX9A 2I2FA 3S8MA 1EFRD 1XMXA 3WGHA 5C1DA 4K05A 2IXDA 3F7TA 3IP9A 2XUZA 2KX7A 3GNSA 1XUOA 1KJYA 1U81A 3CZQA 4DAEA 1W0JA 1LI7A 3UXEA 3DAPA 3O9VA 5CCEA 2NVWA 1ZM7A 3A27A 1ADBA 2ZJYA 1XP5A 3IXLA 2FUCA 2J4FA 1LK7A 5C7YA 3QVKA 1X0VA 3R6WA 1GV0A 1E4OA 1Q83A 2Y3IA 3AF3A 2NOAA 4WJKB 3HYTA 2PZMA 2HCJB 4MVYA 5AVVA 3AVQA 4FOOA 4MV5A 4MYRA 1HT0A 4WKGA 3SJZA 3I5UA 2ZWAA 3HJHA 4DLZA 3VBCA 1V7QA 4DY4A 1WUTA 2V74B 3BL8A 2X9GA 4F6RB 1JQKA 3EXFA 4FD3A 2VTVA 4LDAA 1X42A 4MOWA 1MHPA 4PX3A 5G1PA 1Z47A 3UAOA 1OF1A 1RKVA 2XIQA 4PO8A 3WK5A 2G9ZA 1NPTO 3AOGA 4RBNA 3WGUA 3K4HA 1B2RA 2IUUA 1U99A 1DIAA 4DR6B 3L0DA 5HILA 1R6BX 4IV5A 2FPGB 2E6UX 3K73O 2PV0A 3VPFA 1JEAA 2I5PO 2PS3A 3B36A 3FM9A 3G1TA 4ILEA 3WK8A 2CK3A 2P9YA 1YD7A 4MQEA 4LF7B 3RJ5A 1CUWA 1CYEA 1VLMA 5H59A 1J9ZA 1T2AA 3F78A 3WKEA 3NLLA 1D8TA 3ILXA 3BD8A 3QUBA 5FXMA 3C6MA 4ALJA 2YTZA 2WC1A 1U0OC 1WHSB 2FH5B 2Q28A 3MSCA 4OBBA 1KGSA 3CX3A 3CIFA 4RKQA 2B1IA 5TMDA 2UYCA 2BKLA 4CF3A 3FJYA 1VE9A 3IULA 3TNYA 2UYOA 5BRAA 3H4TA 1UMBA 4KI0A 4F38A 3Q88A 2RGDA 1Z73A 2FSUA 2R1VA 1N5LA 1Z5VA 1NFQA 1KKMA 4N18A 5JDIA 4MHOA 3ELWA 1Y82A 5BSVA 4KMMA 5KYYB 4UHCA 3L6OO 1ILWA 3QIVA 2PSFA 2F4VB 3NIGB 2P4SA 3FBGA 1PWXA 2Q5LA 3D6NB 2I1VB 3EGXB 2PLFA 4D1YA 4JXZA 2WG0A 3L04A 3H2ZA 4CEJA 2Z2IA 1WMBA 2ZRGA 3RR2A 2GVDC 4Q9NA 1JIQA 4K7JA 1FYDA 5F1YA 1EX1A 2YJNA 4E5DA 3BXFA 2ZETA 3ODGA 1PHPA 3TW8B 3HJCA 2EZTA 1X7ZA 1OREA 2IOQA 2QEQA 1MVNA 2FEOA 1V8DA 3AHGA 3DHEA 1T6XA 4WLNA 2HXYA 1LFDB 2L2QA 1V6CA 2CLFB 4A8PA 2HSWA 4DQDA 3HXOA 3WGMA 5KEIA 1Z88A 2D0DA 4JCOA 5BN4B 4YNBA 4TMFA 3WBFA 3PBKA 1II8A 4MI1A 4QPDA 4YV0A 4HF7A 1M34B 4Z0NA 2BCEA 3D54D 1W581 1EB9A 2VH1A 4P92A 1N3YA 4CCYA 2R62A 1CG6A 1A9XB 1VYVA 1RRCA 3BSFA 5EP4A 3RSGA 5C5DA 4UTPA 1SWVA 1KJ8A 1WKBA 2WAAA 3W1WA 1B2LA 3KLBA 2Y1EA 4MUEA 4X3PA 2AEMA 1QAOA 1WB4A 4Y2PA 3V55A 3TNJA 1L5KA 3AJRA 1D2HA 1E2BA 1G8MA 2PV7A 2WB2A 1R8SA 1IYZA 4XAQA 2K6GA 3TOCA 2GH1A 2HK7A 3W4JA 1XD2A 1TCCA 1ZVVA 3MIIA 2WWRA 2Q6TA 3QF4B 4NABA 1L4KA 3ZD6A 1ORIA 1QONA 5F77A 1CDDA 2KJQA 2GZMA 4EX7A 5C32A 2IOHA 4NDZA 2O06A 2O8FB 5EPUA 3M4NA 3U1VA 3A0UA 4LFCB 4GU5A 4QOEA 3DT9A 2B1GA 4WMLA 4PVCA 3PE3A 3E4CA 5EMHA 1QYRA 1OBVA 2OAEA 4KH0A 4UNQA 4YQZA 2JF0A 3V4OA 4ACAA 2P78A 4FHFA 4AKSA 1N2JA 3C5HA 5KDOA 1ZJ6A 3WL3A 1I9GA 1VPEA 2AG0A 3D3QA 3TKYA 2G1JA 1G7SA 3P4XA 1VL2A 3NBQA 2P9QA 4RZ3A 2QUKA 4LGYA 4N4AA 4BO4A 2AN4A 3ZJTA 2FK8A 1LCIA 3NDIA 3CEHA 3RS3A 3A6FA 1HC7A 1XA4A 3IHLA 4I55B 4BQNA 4RK4A 4I36A 1QYXA 4L8WB 3H6KA 4HN9A 2C3MA 4JC0A 4TYWA 4AZVA 3LCCA 2FR8A 2Q46A 1GT91 1PLKA 4RY9A 3H75A 1N5JA 4FW8A 2O2XA 2Z8XA 1MEOA 3PJFA 2FCRA 3FETA 4DCTA 1MDFA 1ZMBA 4CNBA 3H84A 1P1FA 2PH3A 1U28A 5IC6A 1G5RA 2VCHA 2Y2UA 1QGZA 1TQ6A 4Q4HB 2CUTA 5LQCA 3HU2A 4GS5A 3LT2A 4NP6A 1N0IA 2ZCVA 5AM4A 4UDXX 5FORA 4OJMX 2A8YA 4CQMD 5LQSA 2OZVA 1QORA 1FDIA 1ORHA 2P7IA 5JSZB 3QX9A 4ARUA 1DEAA 4ER6A 2FR8C 4NJEB 1NFFA 1CJTC 2BM0A 1A2KC 3WNCA 4CRWB 4HEQA 3D1LA 5DLEA 2C5FA 1D6NA 4BB0A 1NL3A 2RK3A 1KSHA 2GN0A 3EXAA 4L8VA 4QUBA 1SZDA 3L8GA 1ODIA 1G4UR 3OOHA 4XJVA 2C58A 1VMIA 2ZEJA 4ZOLF 3REQB 3T0GA 4AMUA 3K71B 3OQNA 5I8WA 1IN1A 3ECAA 4XEUA 1B41A 3SF8A 4M0LA 1PL6A 2YIJA 1X80B 2JAWA 2W83A 3M2PA 1T8YA 5IDVA 3OI7A 4OQMA 4MCHA 4YCAA 3ELUA 1FSGA 3OZDA 4X65B 3TGWA 3LX4A 5L7WA 1N1EA 1NRIA 3NVAA 1GNVA 3F90A 4E22A 1VP3A 4ZK6A 1PRYA 1PGNA 4TVBA 4AXBA 2ZSHA 5GAJA 1NULA 4G25A 3QLTA 5AM5A 5HUQA 3IR7A 1U2QA 2VOJA 2VBGA 1PG5A 3B51X 1V7CA 3E1KA 3O47A 1KJIA 4O8CA 3KJQA 4ON9A 2H1SA 4LDJA 5TR9A 4NU6A 1NQTA 4LJSA 4OMFG 1PSWA 3MEQA 5IBQA 2A0XA 3ISVA 5TQVA 1T4MA 1U3WA 1TU0A 4QHTA 2H9IA 1K7XB 2H0QA 1KAQA 2D0PB 3NTQA 3VNQA 1VG9B 4WGGA 2OQVA 4B7XA 1Y6QA 2QPAA 3CEAA 1GAEO 2B4YA 4TQ9A 4I2VA 1EESA 2VQSA 3X1KA 2VDUE 4Q1CA 1K8XB 2VDLB 1SJ9A 3CU5A 1VBMA 4OQZA 4YCSA 3RCBA 3L7LA 4G9GA 5LDGA 1NJ5A 1G4AE 4J16C 4WLUA 3Q5DA 4K9RA 3IUPA 2IPXA 3WMXA 4NG5A 4RH1A 1U8FO 3RS8A 1J56A 2I03A 5JFOA 1P33A 2GN4A 1B6RA 1KGDA 3ZLVA 4RMNA 1M8PA 5K9ZA 4I66A 1VZ2A 2P3LA 1S2GA 1WZIA 3JRWA 4L07A 1GPH1 1RQXA 3SVZA 4B73A 2GEKA 1JFTA 3TI9A 3V8PA 4IIHA 1GRVA 5JANA 1DFGA 5GQSA 1E3QA 1GZ7A 1ZGHA 2JBAB 2ZYAA 3H3XA 5A2QA 2IHYA 3WDMA 1YZYA 2IXTA 1PU2A 4LBWA 4DMLA 5CVTA 5KNBD 2D0IA 3KTOA 4IEIA 4TUYF 1QO0A 3GLTA 2FU5C 3T5DA 1IWBB 4H9GA 4RENA 2PUBA 4ZDWA 5GOZA 3T3HA 2YFYA 1J7JA 1I0ZA 1QIFA 3ELYA 3TB4A 2WRZA 2YRWA 4X60A 1S9DA 2P1RA 1RFGE 1FDSA 2PY6A 4MJ7A 3IUBA 5I7AA 1UEJA 4QLAA 4BQEA 5T64A 1YGPA 2XD9A 4NYMQ 2P7HA 2HRCA 3TSYA 1T9GR 3A05A 4HQLA 3WK4A 3PC3A 3QWFA 1T3GA 1CUBA 1NUQA 3MS2A 4FFSA 3TNFA 4DSUA 3I6BA 4YTEA 1TLFA 2R8BA 3SS7X 1YZQA 2IXAA 2WINI 2XE6A 1DCKA 4IDGA 5HOEA 3ETEA 4IW3B 3X1XA 4IIUA 2RGEA 5DHSA 2HNAA 3GVIA 1NM5C 2Z5LA 4FYVA 2VQFB 2Z6UA 2XX3A 2YVQA 2BTQA 1RAEA 4QUEA 1ORRA 4RIIA 4D97A 2IYUA 3HJRA 3ZXUB 1N5RA 2GN9A 3QYAA 2NADA 4WH0A 2FN3A 1OI4A 2JH8A 5DGTA 4LMRA 2ZB2A 1TNDA 1U6KA 2P79A 4N5IX 4M8IA 1ZUWA 4BTEA 4HUQB 1E2GA 4NZOA 1D07A 2BY4A 2HBYA 4R8VA 5BOSB 1V16A 1Y9ZA 3BXGA 4XR9A 5CA1F 3EWSA 4A1OA 3O3CA 5GZ6A 3TPFA 3LKBA 5C7OO 4MLPA 1AA9A 5KJEA 3EY9A 4BX3A 4JA2A 2EGGA 1FIUA 2Q07A 4UU1A 1ICEA 3ZHVA 2WTMA 1B6SA 1QYWA 1XZCA 2R6AA 1NMYA 1LI5A 2VHZA 1M2WA 2VYVD 1QJ4A 3HR8A 2A1TS 4RPHA 2GK7A 5CDUA 4GM4A 4IIJB 1E5QA 2YHUA 3AQIA 4Y2TA 4ZTZB 3R7WA 3RUCA 4BWYA 4RZ2A 1OQAA 4B46A 3L7MA 3SXJA 2O8DA 2PGIA 2QVYX 2HBQA 5THXA 5FEMA 1RYYA 3UWPA 1QTQA 4R7ZA 3G88A 4IHAA 4Y9TA 4D9FA 5C8XA 4EG8A 2HA4A 3ISJA 3UXMA 4X62B 1JG1A 2V8OA 1J9GA 2X41A 3G0DA 3H1BA 1FS5A 3MTGA 4WOCA 5DJ5A 2WSIA 2QE7A 5F64A 4QM7A 2OVFA 4Q4AB 1RMQA 5LB2A 1TI7A 1USVA 4GXNA 4CQMA 4D9HA 1GPJA 1ZBDA 1DNPA 1E8DA 1H1TA 2ZI4A 2QR2A 1F4LA 3HP1A 3OUUA 3T15A 4DDTA 5A5FA 4FDTA 1Q92A 4F2WA 1V8FA 2O2CA 1T2VA 2H1CA 5HIJA 4XX1A 1JDNA 2EFDB 3R41A 4ZKEA 3T7EA 1TLTA 3FB1A 3QJ5A 1YRQA 1CF2O 3JD4A 4QGBA 3G8BA 3LQ2A 3NOOA 3EXIB 1HORA 3OTQA 2NXCA 4LMPA 3SQOA 2IPLA 1EP2B 3AETA 3CZCA 4JI1B 4EHNA 4KQXA 4LHWA 4BMNA 4CBVA 1XEWX 3KFVA 5FX2A 3S8YA 2RI6A 3Q7QA 1FSZA 5BQFA 1OAAA 1L8OA 2XUKA 4XJXA 4UTZA 3WQSB 1A5BB 1SIBE 4PX9A 1E9FA 2ECFA 4HAVA 4TVKA 4F4FA 1HRDA 1Q3TA 4UXIA 3F8WA 4CETA 4XQCA 3KETA 4QQNA 1UJ2A 1V7ZA 5EIAA 1U2SA 5DKFA 1L7BA 3UKOA 5DU2A 4CF4A 3WGOA 5LXTA 4D82A 1KVUA 1L7OA 4A8TA 4KXLA 1M1XB 4PR0A 1B76A 3AEZA 1ZGBA 1Z6QA 4AY3A 5AK4A 1BIFA 2OXEA 1W4RA 2HLDD 2R84A 4AJIA 3UIEA 1CUUA 1NSYA 2V58A 4Z4CA 2Y2VA 4UE3S 3QLUA 3GVCA 5TPWA 1ENZA 2CHQA 3MRXA 4DVJA 2ACWA 4RKEA 1WIWA 2Z8YM 2FLVA 4HFMA 4FDMA 4RWEA 4KQ6A 1AZLA 2X4GA 3VZPA 5ICGA 2ZIGA 2SHKA 2ZT6A 3DFIA 3REGA 5KWSA 3CWZA 1X3SA 5BT9A 4EUSA 2QMHA 3O2QB 1SWWA 1JEEA 2H08A 2W6MA 5JCJA 3VTZA 3KEMA 1EXWA 4RDIA 5B57C 4N1AA 5I8PA 3G7SA 4MYDA 4OQDA 3JY6A 4V0KA 3V6LA 3PPXA 1AJEA 1GA1A 3EVDA 1BHQ1 5JI3E 1KR2A 4NMXB 2WJ6A 4G1CA 4QFCA 2XOEA 1V9LA 1X92A 2PSDA 3QPDA 2O59A 2C4KA 4MVJP 4GKVA 1OFTA 3RC3A 1OZ0A 2JIDA 1NYTA 4CIVA 1QFYA 1QPGA 1RI3A 3FWPA 3PX2A 2XA9A 1N7GA 2P5YA 2P9EA 4FUTA 4U39A 4URYR 4D4HA 4J0IA 3KPUA 4II3A 1KIAA 2NPFA 3AF0A 3CTPA 3IP5A 5DCUA 2F59A 2KLBA 2HHCA 3TQCA 4G4SP 4ZO4A 1VG1A 2KB0A 4UMVA 4DC1A 3O8DA 5JD4A 1I4OA 1I4DD 1CR4A 3GCGA 2V4MA 4KJXA 1DBWA 2GNPA 2OBMA 3ED5A 4WZAA 5CX1A 3DEYX 3PUHA 5AH0A 3SSAA 2D6FA 2Y9PB 3JASA 4CW7A 4DLAA 1FZTA 2O1SA 2JIQA 1N75A 5T7BA 1K89A 2A1IA 2QP4A 3TVTA 3PKJA 4M21A 2YINC 3E81A 3JZIA 4BNNA 3ESAA 3D6UA 4PSUA 3NBAA 4J43A 3TM4A 1OFIA 2QXYA 3BMNA 2J85A 3NVMB 2FCAA 1LQTA 4RAQA 3E5HA 2GXUA 1LY1A 4NJMB 5FWYA 1HO3A 3N9IA 4B5KA 4CLRA 4V3BA 1E6CA 2DTXA 4LXTA 1UPUA 3WMWA 2HY7A 4PRLA 5K0SA 2WLSA 4TUYB 4Q3NA 4IJVA 3GH1A 1WMEA 1UQUA 2V55B 3PFNA 1DAKA 4WXEA 4YI3A 5CDHA 1LPNA 1E63A 3LKVA 1PFWA 1X7WA 2PGJA 2XHZA 4IYJA 4JGBA 1PVVA 4W7HA 4OP1A 5JISA 1UBKS 1TEXA 2X19A 4G5FA 1RZRD 1IE3A 3DV2A 4Z3KA 5FAKA 1U9IC 4OHFA 5L51A 4HS4A 2P9BA 4P4SA 5J2UA 1OROA 3AB8A 1ZMTA 3S5UA 2BFBA 3OJFA 2BVNA 4EQ6B 3EH2A 1LBIA 2QP9X 1CXZA 2VPZA 1RKXA 1XHLA 2WKRA 4ZT3A 2NYRA 4OK6A 4QASA 5C34B 4DWJA 2ONKA 1EHIA 1W1IA 2OBFA 3HL0A 4TTRA 4EL0A 1C2TA 2A14A 3K96A 5JXGA 3CCBA 2WWVD 1ZI6A 2Q3FA 2VF5X 4PXAA 3A9UA 2GILA 1NSTA 4X90A 3D5TA 3N6XA 1K5PA 3GJ3A 5FHQA 4LYEA 2JASA 4XDYA 4P9NA 5HE8A 1I2CA 5BSRA 2H3HA 4HQ0A 1VLZA 3FTCA 4P35A 1Q0HA 4J0DA 1KI8A 1N33B 4MI9A 1L3IA 4GE0A 4ETWA 1FMJA 4EW1A 3I0ZA 1UJCA 2Q7DA 3HJBA 4ZHQA 4F9GA 5B7QA 5LQMA 2ZS7A 3CJRA 1R50A 3ESQA 4FPXA 4HRYA 4JLNA 3TDNA 3UB4A 4CDMA 2NSHA 2MU1A 4R2JA 5CLGA 1FBNA 2DR0A 2XE4A 4J9VA 4Q02A 3PNKA 3V1NA 2R0QC 1ZIXA 3GO4A 3O9ZA 3LA8A 3IIIA 1OIWA 5F35A 2IHVA 2W0SA 3SCZA 3Q5GA 4PCLA 2BFDA 1K4MA 1SVLA 2TMGA 4MZXA 4RKRA 1WUIS 3DEJA 4Q9AA 3I5MA 1SU6A 3GJSA 5JZ9A 3ES9A 5IJ9B 3SHQA 3O7MA 3FDZB 4NOLA 4GRIA 3CB2A 3MWYW 3FCOA 4D0NA 4C7OA 1OLXB 1EUDB 1R0RE 1SD2A 2V98A 3RANA 3T61A 1G9SA 3GAZA 3B9PA 2B1QA 4DQLA 2G8NA 1SVSA 1F0YA 2NTEA 1YIAA 4PHGA 2QM3A 1S01A 4WK4B 1YZHA 5DP2A 4GP9A 5BOVA 2G1KA 4HBZA 3P9QA 1ACJA 1QIKA 4MB2A 2RGXA 4QARA 4D46A 2V6FA 4DADA 4I55A 1QYIA 4YJFB 3EISA 4M49A 4K2AA 4ZVRA 1ZD1A 2RGBA 1NMSA 4R1UA 1E58A 1I4EB 1E3JA 1VPDA 2G82A 2INGX 3A3NA 4KX3A 4PZEA 3UJDA 2OYSA 4UTXA 3PDIA 2NVUA 3UGJA 3HSYA 2IW1A 1Y3DE 2AV6A 1UDBA 2I2DA 4FWIB 4JJ6A 5C1PA 4WXYB 1XZ8A 2I1LA 3DMPA 4GXQA 4Y0NA 4AY5A 1NUTA 1W0CA 2NUTA 2P6OA 3EZ6A 3B9BA 1NZDA 3ESZA 1O03A 5IYZB 1QIDA 4RJTA 2FRXA 4I50A 2A4KA 3I5AA 1IG0A 4FGZA 4CCYB 2GPBA 5I3ZA 3OU7A 4FYYA 1RPZA 2PT9A 4ND2A 1AK2A 5KNLA 4TRNA 5KHAA 4GQIA 3JVIA 4TM8A 2CF6A 4O3FA 3JQPA 4M55A 3J81k 1PNRA 3A6ZA 1W2GA 1WUYA 4W5OA 4S2EA 3K9LA 2VAXA 3VR4D 1NRXA 4C1BA 1V4BA 2BHNA 3MNFA 1YJAA 2FSVC 1WY7A 3R3WA 1YFLA 2WA2A 3AVWA 4O6VA 4OUKX 2PG3A 2CL5A 4IV8A 1WPGA 2I78A 4EUKA 1KO8A 5ALYA 1W4ZA 2NU7A 2POQX 4I3HA 1NM5A 2XNSA 2A9QA 4I6JA 4Y2RA 1FVFA 4EA6A 5A4IS 3EOBI 2UUCB 1T5LA 1P5HA 3E1GA 3G5TA 1QZUA 2ZIXA 3CX6A 3UC5A 4AWAA 4DIUA 5GVRA 5CFZA 9LDTA 4EG0A 1JIJA 3W2FA 1SG9A 4QAJA 3IMFA 4Q0MA 1JVBA 1TZJA 3NDBB 5GJCA 4YP6A 1PQUA 3AFGA 1VZ3A 4P86A 2FLWA 1N0VC 1ZK1A 2K87A 3SZUA 2R8RA 4ALIA 1IB6A 3OO0A 4A15A 2HIMA 2PX2A 5AK3A 3FI0A 3ZHSA 5FV4A 1JHYA 4BFWA 1O95D 4QU8A 3F1LA 2YZKA 4IG4A 1GPBA 3DQZA 4YAJA 2PWBA 3EDMA 4R83A 2ZWIA 2GBFA 2W7TA 1YOBA 2YNMD 4Y2SA 3EXEB 4BIIA 5HR5A 1ZEMA 4Z49A 4CG3A 4HAYA 4L8LA 2WZBA 3C8HA 3GNTA 4O4LB 2AWOA 2K2WA 4WCFA 1T5SA 5T5QA 1GAQA 4MUBA 3PF8A 3ZGVA 5FUVA 3RAEC 1HFJA 3MG9A 2JLCA 1SKYE 2X58A 3B2NA 4H0NA 2QXUA 4UPDA 5HTKA 4EY6A 3MGCA 2R4TA 1G98A 5CCXA 3OEWA 2R5NA 3UW3A 3HG7A 4DJAA 3AP3A 3Q11A 4R5HA 2NACA 4URWR 3IT0A 3T0FA 1M2EA 4JBXA 2ID9A 3PQFA 4RHCA 1EWRA 3IVRA 4WFIA 1M83A 3I6QA 4J0GA 3V2HA 4KO8A 3Q7RA 3VSEA 5DLYA 3M6LA 5EGSA 1PYOA 5AVKA 1T2CA 2EL9A 4NU0A 3QZUA 4B33A 4JEMA 4KQHA 4A8JC 5LYJF 3NJ8A 5E7JA 3HSSA 2IC5A 2JFNA 4IJ6A 1M34E 2R11A 5KBYA 5JZBA 5HSGA 4ZT2A 4EB3A 1Q7RA 3UJ9A 5KTMA 3QWHA 4K9DA 5CR9A 4R8LA 5UKDA 2CBXA 1M5TA 3K9CA 1HE1C 4MKRA 4BV3A 1PVDA 1RW4A 2BI8A 3IBYA 4KW7A 2Z1DA 2FPIB 1NP3A 4BWVA 3TEMA 3ZDXB 1YJQA 2P6MA 2Q9CA 2QY9A 4PNHA 1CUEA 1F9EA 7REQA 2QTZA 1TXGA 4X6LA 3QXHA 5BW5A 2D4HA 821PA 4N41A 4R4JA 2GR9A 1DT5A 1Z6ZA 4ZVLA 5LOVF 1L4MA 4U5XA 3AKDA 1RABA 3NIBA 1YHYA