4LXQA

Crystal structure wlard, a sugar 3n-formyl transferase in the presence of dtdp and 5-n-formyl-thf
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
273
structure length
273
Chain Sequence
GHMIKICIAGKNNIAVNSLQFILKNYFEADQIVVIPNKNDKGIDSWQKSLLKFALDNNIKIVTLDEIYNIEQIIFFSLEFDQIIKIENFKSDRLFNIHFSALPKYKGVFTSITPILNNELESGVTLHRIDNGIDTGNIIDQHCFPIDINDTARDLYFNYLKYGESIFKKNIQTIINNSYKDLKQTNINSSYFSRKDINLVHKINFKKTSFEIHNQIRAFIFQEYQLPIINNSKIIKSILANEFIGYNVFEEFENYFIISGIDGFKIIAQKLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords WlaRD, a sugar 3N-formyl transferase
publication title Structure of a sugar N-formyltransferase from Campylobacter jejuni.
pubmed doi rcsb
source organism Campylobacter jejuni subsp. jejuni
total genus 90
structure length 273
sequence length 273
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12230 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4lxqA00
4LXUA 4LXYA 4LY3A 4LXTA 4WKGA 1Z7EA 4LY0A 4LXQA 4LXXA
chains in the Genus database with same CATH superfamily
4BP9A 2EWMA 4PYKA 1A9ZA 5D5HA 3Q4GA 3L79A 4ZCSA 1EBUA 3TIVA 3LP5A 4BE9A 5ER6A 1OXUA 2ZQZA 2RK6A 4LSWA 1JEEA 4M0PA 2GPNA 2QXTA 4QVKA 1UPAA 4MQ6A 5CDFE 5BR8B 2BFEA 1G9SA 1EFPB 3KO8A 4MQLA 2WMOB 1YZTA 3EGDB 2GMWA 1AO0A 2FNAA 2O0MA 2UVPA 2V7XA 4MH0R 1JJ7A 1YOVB 3QVUA 4RMJA 2N1BA 3NH9A 3WRYA 3ZHSA 4Z4QA 1TRKA 2OCBA 3MWEA 3QH4A 4ZA2A 4NBWA 1RPZA 2R47A 3LRXA 6ADHA 1A5TA 5A9TA 4TMWA 3I2HA 1O0CA 4JI2B 1Z5NA 2OCXA 1JH8A 4U3JB 2JGEA 5DHTA 4QQRA 4GBMA 1W0CA 1IUKA 2V7QA 5EKUA 1MB9A 3DC7A 3RSSA 1TJ5A 4WZ6A 4CM9A 2V7QD 1TECE 3VR3A 3J80A 1WDTA 3HB0A 4CM9D 4JJ6A 3VR3D 3OG9A 3I05A 3E22B 2B30A 521PA 2EEPA 3SK0A 1NVUQ 4FHGA 3TZBA 4BTLA 3ZLJA 3DJYA 1FXWF 5B1EA 3LPAA 2IZOA 4L0MA 2JL1A 4DMKA 3QEAZ 2R8RA 3A6DA 3HCEA 2FEXA 5TXGA 3GBSA 3P32A 2RIPA 2B5OA 4V2IA 1PZNA 4OEHA 1S2DA 2DMRA 4XUDA 3ILVA 5AW6A 1RHMA 2FDCA 2W2NA 4PWZA 1UBRS 3TL6A 1MV5A 1ZRSA 1Z74A 2J3LA 3VR4H 3R44A 1ZH6A 5FQNA 2ZPUA 2FMXA 1QRDA 3BE8A 4HZUA 4K81B 4R1PA 3W4IA 1HQDA 4ERXA 4NP6A 1I7QB 4CF5A 4IG4A 5DYGA 2X8BA 2XZLA 4MYRA 4LHSA 1E2NA 5EMKA 4TL8A 3I1FA 1NI5A 3D02A 1C14A 4F97A 4YGXB 3R3HA 2IYUA 3OQMA 2C9YA 4FBLA 3Q5GA 3K4HA 4KSYA 2PJRA 5G53C 1GLVA 1GNTA 4NZPA 1HT3A 2HF2A 1I80A 1B2RA 1K7EB 2AMFA 4JXJA 3HEAA 2ZG6A 4XX0B 1FTYA 3B5EA 5AUOB 2HJGA 3DVLA 4CLEA 3HMQA 1XEWY 3NAZA 4IJQA 1JFVA 5JANA 5DCYA 3L6DA 5CB4B 1PS8A 4U2KA 5JALA 2JLXA 4Z3OA 3GYGA 1P4GA 3MK31 2YQ5A 3NUQA 5F9HA 2XUHA 3SQLA 1O03A 3FUXA 3TLJA 1S2LA 4RF2A 3PFNA 1R0KA 4NCNA 4XWKA 4FYYA 4BV9A 1LBSA 4FHZA 1HQCA 4M7RA 2M6LA 1JFSA 1CJTC 4O33A 1NVVQ 4D96A 2HSJA 1GRRA 3CBGA 3OIVA 4JP3A 2GCGA 3EF3A 1M54A 4EB8A 2ZPAA 3PT5A 5F5LA 1PL0A 2PD3A 3C1OA 4C0BA 2B8NA 4WVFA 5I9BA 3V8BA 1CUXA 4D8TA 3PPIA 3E9NA 2H3HA 3KHUA 4XQGA 5CXUA 2AKEA 1Y80A 2JFQA 2ZIFA 5I48A 3EEOA 3W3AH 3IQZA 2PQ0A 3H5NA 1A5BB 1P2TA 1MAVA 4DAEA 1U0LA 4D44A 2IW1A 2YINC 1WMSA 2BFEB 2H6EA 2QRUA 1ADBA 2Q3DA 3Q6IA 3RU2A 3W5VA 2ATIA 3ZI7A 1LPNA 3C5CA 5I3ZA 3AEXA 5DYYA 1WF6A 2UVPB 3QHPA 4J0GA 1ZAKA 4KQKA 1GPKA 2Y68A 3MWEB 1YQDA 1SHKA 4DWVA 4LQ4A 5J2UA 1IQUA 3FPHA 3C6ZA 4D98A 5ALRA 4HY3A 2YC4C 3WYBA 5JCPA 5MN6A 4KE6A 1AUXA 4ZHSA 1P3Y1 4QTUB 2Q5JA 3QW2A 3WZLA 1IATA 1D8AA 4IKOA 4ZAFA 3SZGA 2ZP1A 5MGBA 3QOXA 5ALDA 1XEFA 2YQ4A 1X13A 5A3SA 5SY6A 4H6VA 1UMBB 4RMHA 2IPOA 4QDTA 5LQAA 1IZ0A 1JQDA 2HWXA 2OHXA 3N58A 5IBQA 2EYQA 2KLHA 4CE6A 4PN3A 1PFQA 5BPFA 5CD9A 3DZIA 4HZUB 5EXPA 3BXFA 3DPUA 1BA3A 2R86A 3O4FA 4Q19A 2TMGA 1ZD5A 3ETGA 4K6HA 3VC2A 3UNXA 3M9LA 4RJKA 3Q5DA 2LR0A 1PCXA 4WOKA 9LDTA 3SHWA 1HDGO 3BZWA 5D6OA 2QPTA 1O9HA 3CKLA 5J4LA 2PT7A 2R6HA 1FNNA 2HQSA 2CL5A 4MZDA 3HGQA 1H2RS 4W5WA 1B0ZA 2PH5A 1KFBB 3AUJB 2AC2A 5CXXA 4HVAA 5DBHX 5FOSA 2NP7A 1OGYA 1OOEA 1UBGA 1WABA 1GSOA 4H7EA 1SN7A 5BWNA 1JI0A 2G5TA 1A7KA 4HS4A 5G2OA 8ABPA 4G23A 3S1SA 4JVOA 4NZZA 4AQDA 3EGCA 3O95A 1KSFX 1NVEA 3R3YA 4AZTA 2X19A 4XARA 4TRMA 4RFVA 2YOGA 1T3SA 3GXOA 3HBNA 1KFEB 1V41E 5IDQA 2GFIA 3TLCA 4EI8A 2VUUA 4GBJA 5FPHA 3EPKA 2X7HA 4H6PA 3ZCRA 1U0NA 2EW2A 4MUNA 1E4VA 1G2QA 1X3LA 2XYRA 4BFXA 1GGKA 5IVHA 1SOAA 3OUUA 1J0BA 1D3AA 2ON6A 4YRZA 1WL8A 3FCYA 1LW7A 3JVIA 3MRXA 1BE1A 3B9QA 3VSDA 2ZWOA 4LZLA 2B99A 4TL7A 1BHO1 1Q19A 4CIYA 2E4VA 2RGNA 3R75A 3ZK7A 1RZUA 3W2GA 5AVZA 3GLHA 4W5TA 2PE5A 1NM5C 2J6HA 4LOKA 4X41A 3BTVA 4F56A 5KCMA 4N9WA 5K3CA 4KRYA 4FMCB 1A9SA 2HKIA 1NYRA 3GVHA 4P82A 5KKNB 3DAOA 2CXNA 3IVGA 2CNNA 3D8NA 3ZZUA 4PFSA 3NMUF 3OOHA 3E23A 4FLEA 4QOSA 4IIDA 2IXAA 1U1IA 1Y8ZA 3ZQKA 1Q5PA 1A8QA 5J2UB 3ZXYA 4XTRA 5FBLB 5DV9A 1SXHA 1U9IA 1YRQA 3R5SA 4FKMA 3THWA 4RQBA 4PY2A 3W5JA 2VWHA 3DGFC 3TMYA 4EVIA 3ADOA 1R5OA 4D4MA 3S7ZA 3ZE6A 4UNNA 4BBZA 2YVQA 3H1EA 4CMKA 1GTL1 3WDKA 2OG1A 4F3CA 2QUKA 3SCZA 3VO2A 4LZWA 2W2QA 3D9QX 5ARCA 2DPLA 4OY3A 2PFSA 2PWBA 1C0EA 2QR5A 2YWGA 1NF8A 2YFYA 3W7AA 5FAXA 3JSAA 1JG7A 3O0DA 3PJFA 2VH2A 4C7VA 2VYQA 3P96A 3HWRA 2J67A 4JIGA 1I3NA 2VEDA 1QIKA 3VPSA 3FYUA 3QVLA 1J1UA 3KKLA 2PBLA 4TMVA 2CVQA 4X44A 4F4FA 2QF7A 1XAIA 1WV0A 3SU8A 2PS3A 4M0CA 3WJ2A 4PE5B 5FYDA 2BP7A 4N03A 2IUSA 2B4TO 3GY0A 4GOLD 4S2EA 3A6EA 4V1CA 1BG6A 1Y89A 4J0DA 3RRYA 3TFOA 5DLEA 5KTKA 3WKBA 1M6NA 3DO6A 4LQCA 4UU0A 1I3CA 4MUEA 2OOKA 5IWAB 2Q62A 1Q84A 2DXIA 4R7GA 2GS9A 4UCXA 5A9RA 2FWMX 3A3YA 2W8ZA 3RHTA 4HWPA 3F90A 3B2QA 2CLFB 4Y9DA 1U5AA 1WBJB 4AJHA 4XEHA 3V6LA 2DBRA 2X6TA 4WE3A 2ZAGA 5C8YA 1PBNA 3VC7A 2IIQA 2VJCA 4UTVA 1PBTA 2XOEA 1SCDA 3UFBA 3TH5A 3E05A 3CZ9A 1OR8A 2I2DA 1MO5A 2TMYA 2ZT6A 3H9CA 3K9QO 1E1CA 1MZVA 3CNEA 1CIPA 2EFYA 3H1GA 1YIDA 1VPVA 1SXJC 2EBFX 4O25A 1ZP6A 5FOWA 2QSUA 1CYDA 3ZLUA 2W6OA 4RV5A 3U26A 2JHGA 4B8YA 3H05A 4MA5A 1SXPA 3RVLA 3MS7A 4YCNA 3BSFA 3FMVA 2XUKA 2CD9A 3IKVA 4GRIA 5BNFA 4FT4A 4EWLA 3SP1A 4AO7A 1OH6A 1SXJE 1TD1A 3K6KA 2JD2A 3EIXA 4FYMA 4I2NA 4PS0A 3U7QB 1N8KA 1UJ2A 3RCBA 1UMDA 5E4JA 4BEBA 1VZ3A 3NONA 4MO9A 1CZLA 3GJ0A 3C14C 4H2DA 3D0QA 3R7WA 1JFRA 2BYTA 1T2VA 4OUKX 3I1JA 4DMMA 1R12A 3PDIA 3HCPA 3GLHB 1TZJA 3DBVO 5EOVA 1GV1A 1TJNA 3HVUA 3LWNA 5KOHB 1YB7A 1PVOA 4Y3UA 3CSUA 4HDAA 1T15A 4XVUA 5P21A 2JLQA 2OCGA 2C29D 4BO5A 3J81A 3UOGA 2JA1A 1CF4A 2M1XA 2NYVA 3Q2KA 3WLRA 1TD9A 3CF2A 1H0RA 3LUKA 1MQ8B 1V43A 4DMUB 4LX8A 1XU9A 3MF4A 4LW8A 4HCJA 3THWB 1ZWLA 1CW2B 3OZIA 3LL4A 3ODPA 2G5GX 3D6UA 1Y81A 2GCOA 2WSYB 4NECA 4HDNA 4Z86A 4YY3B 4TWJA 3EXAA 2R8EA 4Y0NA 4ZAVA 4J2OA 2QTWB 2Q5IA 1B8NA 4LZZA 1CZOA 4J6EA 3TUIC 3RTAA 4PCVA 1ADCA 2GD0A 4QWMA 4WOBA 5FTNA 3ZNNA 3ZWCA 5LP6A 5M5BA 3FYUB 3NHFA 1TYZA 1KBZA 2B98A 2QLLA 2Y2UA 4EPVA 2CYBA 2HF7A 4HPXB 1NFFA 4RPGA 4ESOA 2ATCA 2BP7B 3R8FA 4UAVA 2WU3A 3QBEA 4EGJA 2GK7A 4ITRC 1YB5A 4YJHA 5AK5A 1Z0JA 3HGTA 3N0VA 4V1CB 4TWRA 1MOSA 5HTOA 2W6ZA 2PWPA 1HURA 1MENA 4BBPA 1ISIA 3R24A 4FD3A 4GPAA 4HAOA 2KJQA 2QTRA 2OZKA 3GFGA 4QODA 4XCXA 1M8GA 4KEAA 1OYVA 5A04A 5KVVA 1FF9A 1TC2A 3LT5A 4WSOA 5JI3E 1FLAA 2W0MA 1BXZA 3SFVA 4FIDA 4E15A 4D82A 5C8YB 4BNDA 1ZZGA 4HYQA 4Q1VA 3OJCA 2V7PA 2YOHA 5GONB 1YZ3A 1TU4A 4IRUB 1Z4OA 1V0JA 1E1CB 2GKGA 3A1FA 3A4VA 2BHSA 5ILGA 2AI1A 3GIDA 3GGJA 4I3FA 4XTCS 3PJGA 1Q77A 4HDRA 1RMTA 1BQ3A 3DCYA 2FZKA 4O4HF 4Q15A 2PRJA 3LYLA 3LLCA 3VI4B 5J58A 3SIRA 4KUEA 1I9GA 1CJCA 4QREA 4RS3A 4E6PA 2GO7A 1B0PA 1LV7A 2PXCA 4TUYF 4AY3A 1SUCA 3NGLA 2Z8ZA 4F92B 5HJ7A 2FWRA 4C78A 2IH4A 3OBIA 3MS2A 3UKDA 1UMDB 4OMUA 3H2KA 3DF9A 4CL2A 3MWKA 4MUYA 3CIFA 5FF9A 2JJQA 2FPUA 4NYMR 2PBRA 4OB8A 3R7WB 4DLPA 1QWOA 1ZVKA 1LS1A 5K4AA 1P1HA 3DEFA 3PDIB 1XFAA 1MJGM 1WUYA 2OVFA 3CU5A 3JVVA 2FN9A 5CM8B 5K3FA 4JT4A 2AX4A 2WE7A 4XIFA 2VJLA 3IAEA 5J2TF 3E7WA 4BZXA 3JD2A 2WEKA 3P2OA 3O94A 5JNRA 2J9GA 2W93A 1GIAA 1CUVA 1L4BA 3B6IA 2JBHA 3IBYA 1OPXA 5FB3A 2GRUA 3MUNA 5KHAA 3QNWA 3RFXA 4HLUC 1QE0A 1P72A 1CNMA 3LQ2A 4OHCA 2CXUA 5HFNA 4F38A 4HEJA 4FYHA 4NCXA 4AUEA 4JK3A 1ZD2P 2DGDA 3BSWA 3A2LA 3ET4A 3ZDYB 2JI6A 2ZIWB 2QNBA 1ZGGA 5KOYA 1GZHB 2IU3A 4HF7A 1HKUA 2GCOB 4RX1A 2BFBA 3AR9A 4HDNB 2FZCA 4OFWA 5KB3A 4IXTA 4LXXA 3KPUA 2R00A 3DBRA 1M1YA 1VKOA 4KVZA 1O4VA 2GN4A 4JSYA 4HOYA 2Z6VA 5JNLA 1G4HA 4MRMA 2F6RA 2WZQA 1P9RA 3NUZA 3R7BA 1W49A 2EU8A 4DT1A 2ZDGA 5AHXA 2BY4A 2EQ5A 3D7NA 2PL1A 3Q0TA 4LY0A 5LP6B 1FYWA 1RYZA 3INGA 2BVNA 3JWIA 2B9EA 3SVTA 1YWGO 4TT3A 4DXDA 1D0IA 5EUCA 2IDMA 2G5CA 4J03A 5T5QA 2SKEA 1XTSA 3ZI0A 2F00A 3AETA 3PG5A 5FQOA 1DG1G 4YJHB 5JIBA 3LMKA 4WLFA 2H1FA 3KHKA 1JR3E 2Q6OA 2XUFA 3DL4A 2CUNA 4EK9A 1RJDA 3ITEA 1E9CA 1JVSA 1NMSA 1T9CA 4JUIA 1DTSA 5BQ5A 3T7IA 3AFMA 3G9ZA 4AYWA 1KMHA 1XYYA 2PX6A 2V45A 4JLMA 4ZJYA 3OKCA 5NLLA 2CE7A 3UENA 5JU6A 2C7VA 5ENDA 1GU7A 2BEWA 1RABA 2BMAA 4PGHA 3O8RA 3ORHA 1T9GS 4J4TA 4BNDB 4Z4EA 3FMGA 2GJKA 4OQ4A 5EJGA 4V38A 1CDOA 3C6BA 2VQ3A 3JQBC 2DY0A 2OXIA 4C2BA 5FTJA 2O0JA 3TIFA 4GW3A 3C85A 3MC1A 4Q0MA 2CXPA 2FSUA 1PFGA 2FCRA 3I8XA 4HDRB 2AWOA 2G8NA 4US0R 3W0LB 5L3QA 1HRKA 2XJ4A 4GPTA 4RK5A 5F52A 2NO9A 1QR6A 3EY4A 2P1ZA 2D6FA 1ID8A 1K89A 4Q3KA 3RAGA 3QSYA 3SQWA 1LLDA 2BFCA 3NIWA 1Q0TA 4RW0A 2R0QC 5KNCH 4XOIA 3K72B 2IYOA 1L8OA 4DZRA 1EK2A 3T9FA 1O8CA 4WXEA 5EA2A 3OICA 2VVTA 4OA5A 1PV2A 5BRJA 3GFTA 2XCLA 2ORED 4EF6A 4DNOA 1FZTA 3OLWA 4GDMA 2ZI9A 5K3FB 1JFFA 4EI9A 2ZK7A 4IQGA 2ISSD 2CZCA 3B53X 1VRCA 1XZEA 4H0NA 3K6SB 1U2PA 1YR2A 2FRVA 1HV8A 3PDUA 4I7EA 4QZVA 3HYTA 2ZI3A 3KUUA 4H7KA 5ERYA 3BXOA 5C32A 3DP7A 2C9DA 3OCVA 2JI9A 2ZE5A 3VPAA 1RHUA 2ODAA 3OZDA 1K97A 2QVYX 5ALKA 1UJCA 2OSVA 3BB4A 2VCYA 2Q9AA 3QUBA 3ESCA 4EIWA 4ND3A 1BVRA 3MJDA 3NKVA 1LVHA 2GSDA 4RADA 4GVXA 2ADMA 3U3MA 1RAIA 2CL6X 2BFBB 3CX3A 1WIWA 2IZ6A 3FROA 3TNFA 4RVSA 1M1YB 3TIGA 2E4YA 2RI1A 3ZUPA 2GK6A 4MRMB 1JTFA 3KKOA 1A7JA 1ZNXA 4BLRA 3U56A 4DT1B 4KCGA 3WGZA 4A36A 4H7PA 4LRUA 5UKDA 2QTVA 3L6OO 5ITZA 1HWYA 4ENRA 3QF7A 4INPA 1EFKA 4GPEA 4WHMA 1G3QA 3GJXC 4QL3A 3PFBA 4NCIA 2AOWA 5DRTA 1KRHA 2HU2A 3AETB 1RYMA 2FGJA 1G42A 3C3CA 3VPGA 3ESZA 3G5AA 3P8ZA 3IAS6 3UIEA 4ND7A 4PX9A 3W6OA 3X1XA 4P4UA 1A8UA 5JCOA 3WIOA 1JDPA 1KMHB 4YV0A 3CT4A 3REOA 2I34A 1CQXA 3ADDA 2II6A 3MCZA 1QV6A 3OU7A 3BXPA 4P3KA 5B3AA 5JCJA 1JKXA 5TV2A 3SYTA 1ZW6A 2XBMA 1JDNA 2BEWB 5JCJD 3ZWWA 2D54A 4J0KA 2ETVA 1W581 1QZ3A 3FYCA 2YQZA 4YRTA 7REQA 3LD9A 3A32A 1GQRA 3TRFA 4BYGA 4MYTA 2O2HA 3P1JA 1AS3A 2J4CA 2ZYAA 3IV7A 1RLMA 1JXMA 2P9ZA 3E3OA 1B8PA 1AKEA 1YA8A 4U7WA 3S2YA 1K1EA 4I6GA 1QP7A 2C2HA 2X41A 3PIRA 5L3QB 4X60A 1R15A 3IDOA 1K8YB 4RMIA 1LDEA 2GX6A 3FSJX 5BWMA 2WTMA 1EB8A 3LOUA 1W6RA 1Y1RA 1O94A 3RC8A 3M3DA 4OI1A 3MQFA 1O2DA 2BFCB 3P19A 4Z7JA 1O94D 4HEHA 2OYRA 1Q3HA 3ZNOA 8ADHA 3VKGA 5JFGA 3VV3A 4L78A 5IJWA 1L4GA 2Q45A 3I6YA 4F6CA 2P3SA 2JGIA 3VAYA 3PFCA 5DNDA 3BRQA 4C3UA 4RY9A 5IVPA 1Y6GA 1CR6A 1L4MA 1WZIA 1TPYA 2OY0A 4FHFA 5KSPA 1DX6A 3JPYA 2ZAMA 3E15A 1JFFB 1RVV1 4IOJA 4GYJA 4JBIA 3B89A 1NI3A 2BMEA 3GPCA 5BSFA 3CVXA 3AM4A 4G81A 4XSGA 3ZD9A 3VSAA 3O7MA 2KBFA 4P34A 3Q15C 3K3PA 3D2BA 3IMGA 4EYEA 3PFHA 4LE0A 1ST2A 3QBVA 3VYTB 2RGWA 1YAJA 2DBVO 5C1PA 4U0JA 3HBFA 4YONB 1HM5A 2OECA 4I4IA 2QN1A 2QJOA 4H6WA 4DV4B 2VOEA 2VNAA 5KOIA 2AG5A 4HNAA 4O2AF 3HG7A 2O50A 3LA8A 5DHAA 1VLVA 1U8CB 1ULUA 5E6SA 2WPNA 4DNPA 2I76A 5LA6F 3G5LA 3WWOA 3CRMA 4AL4A 4OQPA 3T4XA 2NPOA 2IS1A 1CLEA 2C3UA 3FDZA 1E5VA 2I80A 3IBGA 2V1UA 1R10A 2J48A 2X0FA 3MWFA 2QTVB 3FVQA 4IHAA 4BO2A 5JADA 5EJ5A 4OK6A 4BO3A 1I2BA 2HK8A 4H27A 3F3MA 1Z5VA 3ENWA 2A88A 3JQQA 3VH4A 1YS1X 2A0UA 3IQHX 4MVJH 3BXHA 4L15A 2CDAA 1P9OA 4B44A 4YN3A 1L7XA 5CA1F 2AZXA 1UXOA 1CZRA 1CR1A 3DDNA 1VC2A 4JCCA 3A2KA 3QUCA 4NR0A 4G9EA 1FYDA 4M8NE 1I94B 2DTDA 1TW2A 2ZU6A 3SGLA 3MCWA 3L0CA 4QUDA 1H2YA 3WBKA 2PXAA 5I8PA 2NU7B 3UMGA 4A6XA 1T8WA 1F8FA 5EHQA 2HRRA 1BFUA 1SZCA 3L2OB 2Q3HA 3R5HA 1M3SA 4HMQA 4RYLA 1NBMA 3P26A 2GCEA 1P5JA 3BJIC 1NBMD 7REQB 3MINA 4P4TA 4JI6B 3WLAA 4YNBA 3C6MA 5IKXA 3PXEA 3EQ9A 3ZWOA 2JAWA 4HBGA 2GQ0A 1WVIA 1CQZA 5JS8A 5KO2A 1IBKB 2NSHA 2R8ZA 4X6YA 2Q0HA 2BEUA 1C4WA 1VJCA 1E8DA 3QU5A 3JRWA 4UHEA 2ZB8A 3DWFA 4GZ6A 3C74A 1MIHA 1YBFA 2HBRA 2OEPA 1UOQA 1Y7IA 4YJ2F 2A59A 1JLLA 2D0IA 3ETLA 1DBIA 4FDMA 1BJKA 4KKXB 4TQUS 3T0IA 2SCUA 3DCIA 3AILA 2AC4A 4HWSA 3V7YA 4FYVA 5T57A 4LZPA 3SF0A 3GMTA 4QNNA 4URVR 3NCTA 2PZMA 5EP1A 1EFLA 1N75A 1OXSC 4XB1A 3VTFA 3WQRA 4LBWA 3FR7A 1KJZA 3WMXA 2C98A 4OLBA 1T24A 1Q1ZA 1VI2A 1GRQA 1JI3A 2NO7A 2HRZA 3DTVA 4KDCA 2A94A 5DM4A 1Z6AA 1PVDA 1QVAA 3KJFA 3DTVD 4PXAA 1A7UA 3PXUA 3SX0A 4V1CI 4LE1A 1ISRA 1MAHA 2P7IA 1ORHA 4PPGA 2QTGA 4ZOLF 4O5OA 2P6RA 4OHRA 3GPLA 3ZKAA 1VLMA 2G25A 1KKLA 1T34A 1KK2A 1QBGA 1JT2A 4UXHA 1XNQB 4JJ4A 4I1UA 1YE5A 3EXG2 3ZCPA 3GHYA 1SQ5A 3C39A 4HNAB 5BYJA 4QJ4A 1H3NA 1KSHA 1OI7A 1L5YA 2BI8A 3BK2A 4UDYX 3TSAA 3KJEA 4DLYA 1ENPA 5E6SB 4GOXA 3WTBA 3B7WA 2ZJZA 3PGXA 4TLEA 4PQFA 5IK2A 5CNIA 2NU8A 4I6EA 4Q02A 3BL8A 3HU5A 2PUAA 2E9SA 3EUFA 5CFPA 1FS4A 1W36D 1I4WA 2HSWA 4M9ZA 1ZM7A 1KOFA 4P31A 3FNBA 4B8ZA 1VIVA 4NG4A 4CG2A 1Y42X 5CVCA 4RA9A 1XHEA 2FX2A 5LP1A 3RFCA 2R85A 5TJHA 4GI7A 4JOSA 1MF7A 1AV7A 4PSCA 1K7SN 4NIMA 3I30X 5JVDA 1T4CB 4G5GA 2QJFA 1AHNA 1GZ7A 1XCMA 1NULA 4BU0A 4NYIQ 1HR0B 4Q6WA 1J8VA 1PO7A 1OD6A 2IY8A 4FJ2A 3A7DA 4RK7A 1UAYA 3EAGA 5LU9A 4UULA 1RM0A 2RGNC 2ZYGA 5FBQB 4N7MA 3ZX5A 1T43A 1BXGA 1SNYA 1EK1A 2FFHA 3G8CA 2IV2X 4GMFA 3U48A 1X7GA 2C03A 4PLVA 1ZNYA 2WWIA 3KS9A 2PMDA 3MINB 4MYHA 4FGJA 2C1XA 2IUYA 3AI2A 4DB2A 2RHWA 1S8NA 1FFYA 3GLHE 3GRVA 4YJKA 1NR5A 1PTKA 3DE0X 1PFVA 3T7TA 2C2KA 3ZIUA 2B94A 3WXBA 3W04A 2BEUB 4RELA 1AN9A 4EH1A 3Q72A 2J3DA 3DBOB 2HNKA 1DRUA 1P4JA 4OGLA 1JZTA 1PJCA 3PS9A 2AVNA 2G70A 1JLLB 3GEIA 4UDXX 1N1GA 3U7HB 2SCUB 4B74A 3N9IA 1LV8A 5FHQA 1T6BY 1OWOA 1O97D 1QMGA 3UAVA 5J9FA 3FUTA 1UJBA 4P98A 3W8EA 3E9YA 4EYKA 4E08A 2EFGA 4K5QA 2QTLA 2QTFA 2EGUA 3U4CA 4O5AA 3WGUA 4D8XA 4RTNA 4MGEA 5JJKA 1TYAE 3FYUC 3RS2A 3DTVB 3E9RA 4OBWA 4W6ZA 1OA1A 3BK7A 1KI2A 1E1LA 1NOJA 1YH3A 2BEKA 2JBWA 2YC2C 4CTJA 3T5DA 1WW2A 2WWFA 3SJCA 4F9TA 3L1JA 4J3FA 5C4MA 1F51E 4MW6A 2NPFA 1MPTA 3PWTA 1OAAA 1I3MA 2DPMA 3FW1A 3HCDA 3PP8A 5KWSA 3N8DA 4O0MA 2BGKA 1Z29A 2Y77A 4E1AA 5JR3A 3MEQA 5KQRA 5K0CA 1GSAA 2OVBA 5DM2A 2ZDHA 4D3SA 4O3MA 1BYIA 1QQ6A 2QV7A 1SU7A 4GXQA 5DDIP 5T4HA 2YCBA 3O4GA 4LWQA 2J0VA 4AX4A 5CVVA 6GPBA 2X0KA 2OXFA 2I3GA 3QJGA 1J5XA 4KGDA 4YQEA 4AULA 3ZY6A 1AQ6A 5DTMA 3ZJ5A 1T1RA 2NU8B 2LZ0A 2PUGA 3FPGA 4F2HA 1UK8A 1MDFA 3CVOA 1UIRA 1W36B 5IMSA 3TBHA 2WIKA 3OI7A 3U37A 2YJTD 4N49A 2OQ2A 4IMRA 4BKRA 1W8DA 4OU5A 2GARA 1SPBS 3ZCVA 4MKIA 3LRTA 2TMKA 1R0ZA 4G07A 4B6RA 2DWOA 3DO5A 3F67A 4MP3A 4RA9B 2ZTSA 1N2SA 5AJHA 2ZEJA 3L8MA 2C88A 5L95A 3FNIA 2PKCA 1AA6A 2F3UA 5SYNA 4HDQB 5JVDB 2GETA 3W1EA 4JBXA 1NQWA 2IH5A 2QV0A 3AEUB 1L7NA 3H4TA 3CLSC 4JQYA 3T3HA 1DUIA 3GP8A 3BN3A 4JXXA 1B15A 1PZHA 2ZI7A 3P7MA 1E77A 2XW6A 3N0XA 5EE5B 4CDMA 3ZBQA 4D6PA 3UQZA 4JJFA 1ZD3A 3MTQA 2IKQA 1BXGB 1ZSYA 3KB6A 2WM8A 2QM7A 2HO4A 1SBTA 3AHIA 4OB7A 4CLXA 4CDRA 4O29A 4ZZIA 1DELA 5A02A 2P2SA 4TM7A 2BHNA 4ZRMA 4G8CA 3FYSA 1KE1A 3V9AA 1U7PA 1Z3IX 3UK7A 4J1TA 4IZ6A 1GKKA 1XRRA 4C20A 3S1LA 1TZMA 2IK8A 1W1WA 3L18A 3PUKA 4NLLA 1KAGA 1Y1PA 5L6MB 5KQLA 4XFKA 2PR7A 3S0JA 2PV7A 1QCZA 1B6SA 2O14A 1MGOA 4GUAA 1F8XA 4UBKA 1D9ZA 1JSCA 1BGVA 1OILA 1Q1AA 2GAOA 4R1NA 3NBYC 3RWMB 4MAFA 4E5MA 5JAUA 5LQUA 1OFVA 2XQFA 4M1EA 3W05A 4UUBA 3T7SA 3IIMA 4OX9B 2ZSHA 3RIGA 3V5NA 4U6SA 1XTIA 5LZ7A 4NPCA 5LMNB 3ROKA 4PYOA 5DHUA 3UJAA 1AK9A 1CYEA 3EZ9A 1DRKA 1RSZA 5F78A 1ZJ4A 1MW8X 1FW6A 4URZR 2VP4A 3IE1A 2X5OA 1A76A 3DKIA 2A78A 4B40A 5K8IA 1GRCA 4D9KA 5JZMA 1H5QA 2IYZA 2Z9CA 4ZTZB 3M34A 1YCHA 3WOVA 3PITA 2BF4A 1AY0A 1JFTA 2CFCA 2H5IA 3FHCB 4BQIA 2AR7A 1AS0A 2P62A 4WTOA 1XNGA 2HZ7A 2XAAA 3QTLA 3C43A 5DT9A 5D3MA 2OHIA 3OQIA 1KP2A 1X9GA 4OG2A 3A1WA 3KWMA 3FTDA 2VF5X 1JZQA 1OFUA 3PL5A 1L9XA 2I6TA 4XJVA 1N2IA 3RC1A 3TPCA 2ARKA 3P2JA 3QEKA 3EA0A 2AJ8A 3IEKA 2I8CA 2VJAA 4EPXA 3F6SA 3CVUA 1JFLA 1QKKA 1N5LA 1VKJA 1QC5B 6YASA 5HE8A 1HKHA 3OM8A 3TLBA 1XDDA 4BBJA 1RJ9A 5DSXA 1DEHA 4R1TA 3FOAA 1UJMA 5U1PA 1HLGA 2P6PA 5FTWA 1DWQA 3NM5A 1UXJA 4O1HA 1JQLB 3E27A 4NZNA 1SUIA 4PFKA 4WBSA 4B4WA 1YONA 1CZNA 2C57A 3KXKA 1NPTO 1A0OA 3LDFA 4OFBA 4WOCA 3X1WA 4QLOA 3EMDA 5LYJA 4B7CA 3T1TA 1NOIA 1TLTA 2B7LA 2IF2A 3THOA 1XC7A 3R3VA 2B1GA 2ZSKA 4LSGA 4IDEA 1IL0A 1Q6ZA 3LT0A 4BS9A 1T2NA 2FFAA 1ZMRA 2A1IA 4ND2A 4HLDA 4HTFA 1U8FO 3FUVA 1DEKA 3UKJA 4XQCA 3A1SA 2JI4A 4K05A 1G8SA 1PK7A 5JZSA 1C8KA 5H9VA 1E9SA 4YQZA 5CNKA 4ZQEA 4Q39A 4CLOA 4CV3A 1X3SA 2IXBA 3HNPA 4DLRA 4F5ZA 3UOWA 4YRKA 1UMCA 1V7QA 1T3TA 2J46A 1PLKA 2P1RA 1KAQA 5CTJA 1P1JA 1Z4MA 5AHKA 3DE3X 4HG2A 5AUNB 2HSZA 1TGYA 1JQ3A 3MNFA 4BQNA 4MQUA 2BE7A 2AYZA 4ME6A 5DEIA 2OP1A 1P75A 2IEDA 1V8PA 2R00C 3DGEC 4HB0A 4Z2AA 5BSWA 4KR6A 3L0ZA 2OAEA 3HXOA 3AEQA 2QUZA 3V7NA 1QRAA 1PNQA 4FFDA 1AQYA 2QRPA 5BSUA 3EN0A 3C98A 3LIIA 4L4XA 2Z4TA 4LZNA 2XT0A 4IYJA 2PKWA 4YV1A 2D00A 4FQ8A 3LXXA 1UZLA 3CZ5A 3GFBA 2OFOA 4XGRA 3D4OA 2A58A 2Z1DA 3GUVA 1XR3A 4KE9A 1TTQB 1W48A 1XZBA 3D43A 4AP9A 4D0RA 3GGCA 4JQZA 1XYGA 3A1CA 4PINA 5EERA 3TPFA 1F60A 4B73A 1NGSA 1GKYA 1K92A 3WNCA 4XWWA 3RAPR 3BCHA 3TAXA 5U9CA 1M2FA 3BIOA 3K0CA 3WLOA 2HK7A 5CDSA 1D8TA 1YTUA 3F71A 3F5MA 1T4GA 2A0KA 5HEKA 2BJHA 2QRQA 3D6HA 1U2DA 3HSYA 3ZLBA 4L5BA 5D3MB 3OQIB 3R9XB 2QL5A 1N2CE 3W2HA 1L5HA 4EHLA 1QK4A 2WU1A 1S3SA 2OZEA 2POCA 3QVVA 1DFIA 2ZRBA 4P4LA 5ALOA 1PUJA 3D6MA 2PS0A 3F8SA 4D3ZA 4PHHA 1X2EA 5KHLB 1TLLA 3ELUA 1Q7BA 4ADSG 1QANA 3MAAC 1WP9A 4FFLA 1RJ9B 4C3VA 3P2IA 2UYYA 4WLEA 1FQJA 2FEMA 2EQBA 1GTJ1 1RXCA 2QD2A 4IXWA 4QTXA 3OPMA 4DVGA 5A5EA 1H6DA 2J6BA 4X9XA 3C0KA 1ZHOA 4RS4A 1RTKA 4PAMA 4CT0A 1R6TA 2CNLA 3BH0A 2OQIA 3LUBA 3HU1A 3O8QA 1L5GB 3T9EA 5LYJB 1UBTS 4J4BA 2XTAA 5FOVA 1F1JA 2ES4A 3BWCA 4MR7A 1Z75A 2YIMA 1HNWB 2XCRB 1GV0A 4M8LA 4LCEA 4QVGA 4GKJB 3U4DA 4N1AA 1QTRA 3G5MA 3PPXA 3OD5A 2PD4A 4MXDA 4HTFB 1FJGB 1WR8A 1X1DA 1A9RA 4P4SB 3H1PA 2MYNA 4ZEOA 3WXMA 4UDOA 5TIIA 3R9WA 3FDJA 4ZDKA 3PF8A 2NU6A 3PTLA 1C8VB 2VOJA 1V6SA 5FNVF 2BMWA 3KBOA 4CLOB 2ZBPA 3FFWA 5IM4A 4RLHA 1UMCB 5AR1A 3RUAA 3PGJA 5DJ5A 5CB0A 1HG0A 3AP2A 3B3JA 1XDGA 1KEZA 3WFIA 3SFTA 1RMQA 2A9FA 3TE7A 5IAJA 4N9QA 4B47A 3SD7A 4JQSA 3X1YA 1G1MA 4OXQA 2AQHA 5FA8A 3D2LA 4L4RA 2GAJA 4ENWA 5DTQA 3PQ8A 4N0DA 3PXGA 4K0RA 1FOEB 1V26A 5FYQA 3GOQA 3AEQB 1E60A 4M3NA 1YB6A 5K8CA 2F17A 2AFRA 5EPUA 3UPDA 1E92A 3Q3HA 3HV0A 3LE8A 3HH8A 1PSDA 3C5EA 5SYMA 5YASA 4LF7B 3COWA 2AMLA 2A6PA 3TJMA 4LDNA 2CLMB 3TMAA 3X2FA 3HUTA 2EERA 3OUZA 3V2IA 1FYFA 4OXKA 3PEYA 3TGPA 2WWYA 1KBOA 1KA9H 2HJSA 3U31A 3E61A 4YRQA 2B3DA 4QOHA 1JLMA 1FEZA 1IG0A 2GPTA 2Q41A 4ISBA 3V1UA 5ED4A 1O6ZA 4FX2A 1BXKA 4KXMA 5IKEA 1QZUA 4J7UA 4TLDA 1GUZA 4LXGA 1WDKA 4WZBA 4YQFA 5CBKA 1C2YA 2OD7A 1JJBA 2JW5A 3JR7A 1WXFA 2Y1XA 1L5HB 2JAQA 2JJ1A 2QT9A 3WL3A 4WL0A 5JTUA 4BXOA 1HDZA 4EO7A 2GXUA 2JJ1D 3D5EA 3HB9A 1PT9A 1MGPA 1DX9A 2PVCA 2AHOA 4UASA 3X44A 4CVNA 4LJRA 2VYVA 1RADA 2VS1A 4OI2A 1NW7A 1D0SA 1SH7A 1Z17A 2R68A 2VTEA 2VYVD 2QIOA 2M32A 2WHYA 2UU9B 3BHNA 2YUIA 5JFTA 3M1IA 2GNPA 3L7MA 3BEOA 4Q1BA 1U7TA 3KC2A 2XE6A 2ZS8A 3U3XA 4M54A 1FXUA 2PEYA 4R8LA 4MKZA 1U0TA 2LP4Y 1N2BA 2P40A 1QPBA 1IIBA 4OMDA 3QY9A 5KIAA 2D1YA 4DNXA 3J81k 4G8JA 3O8QB 3NEPX 3HKEA 4W5QA 4BP3A 3AJRA 4PHFA 4QSMA 4RKQA 5I5GA 3S5UA 3N0WA 3BE5A 4LJ4A 4OHVA 4MR7B 2QJRA 2R7LA 2RAFA 1QAOA 3LXUX 4EUEA 4G0YA 2J4DA 4ZKEA 1IPHA 3RIYA 1EM8A 2CKMA 1QZZA 4M2LA 1R00A 4DV1B 3IO5A 2B8WA 2JFYA 4ZTUB 4KITB 3KNZA 4I9FA 3JWHA 4CM6A 2MT9A 3I09A 1AQLA 5L40A 2DWUA 2HJWA 4DIOA 2GCPA 1VJDA 4CFZA 3ZNQA 1BO6A 4II2A 2VQ6A 1FTWA 1MQAA 2WMNB 1RYFA 2PPVA 3QA9A 4ZVSA 1EJ2A 2A9PA 2IRWA 4FFPA 3GFSA 3K20A 1XELA 5A4MS 5CIYA 13PKA 1CIJA 1CUZA 3GT0A 1I7LA 3TMKA 1C8LA 1QE5A 2UZAA 2PJDA 4GMXA 3NS7A 2AJCA 1OGIA 3R6TA 1E1RA 5CFMA 3IHKA 3QLUA 3NT5A 3PDCA 5KYTA 4XM1A 3U3RA 1QUFA 1JBEA 1M75A 3EDRA 4HTAA 4AW9A 4YALA 4B7ZA 3L7IA 4BNYA 2CL7X 1C9NA 1PWYE 4CHGA 4BEWA 1E61A 3GLFA 1KU0A 3REFA 1BEZA 2WAYA 1O9BA 2XD9A 3MRVA 1YQUA 5I7UA 2CV0A 2CSXA 1OBVA 1J22A 5CYGA 4ZYYA 3E8XA 3LI2A 3EPPA 4EPRA 5LN1A 1LSSA 2WHQA 2WYUA 4ND8A 3WYNA 2X6QA 3EDQA 5DNCA 5F35A 2QTNA 1TU0A 2EFDB 4PG4A 5HBRA 3I2FA 2R87A 1DRJA 1Y6JA 2Y6UA 4O2LA 4P86A 4JBGA 1NYQA 1IQRA 1D07A 1FP6A 4OYLA 3W9BA 4E14A 2J7KA 1WZ2A 1LVGA 3EFBA 2WAXA 1VHQA 3GP5A 4PZ9A 1GN8A 3GGSA 5A5DA 3MUFA 1VOTA 3L6BA 3TLYA 2J5KA 4QBTA 5EQTA 4H3SA 3KUKA 3DLTA 5F9MA 3NVAA 4WZBB 2MYPA 1A2KC 2NUAA 5CK5A 3X1JA 4E2ZA 4AK9A 2A0FA 4UFPA 1CP2A 4MDHA 4NX2A 2UV8A 4L4ZA 3CY6A 3FGPA 3SS7X 1C7QA 4BXOB 4D81A 1GSIA 2HEGA 2VHEA 4BO0A 4KQMA 1J8QA 1XV5A 4R2KA 5KYYA 1JR4A 1IY9A 4QFDA 1NVWQ 1U8AA 1XEAA 3TXAA 1KI8A 2GASA 3TTXA 4BNJA 4C4RA 1NBME 2JATA 1X6VA 2VBFA 1W9MA 1YR7A 1RAAA 1QGZA 2VPIA 4D4HA 3M4ZA 5AVRA 1TT5A 2EFEB 2CNWA 1KDOA 3BJZA 4GBED 1XMQB 2X3FA 2K6GA 2CNWD 3CX6A 3ZWQA 4JJ7A 2Z5VA 4B80A 4K8OA 3FNGA 1ZG3A 2H1SA 2Y1CA 2WVJA 4ZC1A 4IXDA 2KBEA 3HKEB 4Q34A 4BGUA 1IXYA 2DFVA 1WEHA 1LC0A 4N3BA 3KPJA 3U3OA 1U3WA 3GCDA 4CUKA 1OFUX 1TVCA 5IM4F 4P36A 4LZJA 1EM8B 1ZQ1A 2J32A 2I65A 4ZAYA 2R4TA 4IF4A 3BD9A 1Q7CA 3CMMA 3PDJA 1X9IA 1NKSA 2DUNA 2IGTA 4RKYA 1V25A 2IZ7A 1UKAA 4KLNA 1P0MA 5JNTA 1DFHA 1MH1A 2I62A 2VSXA 2VUTA 4PZ0A 4ZV7A 1GPYA 2QB5A 1SK8A 4KO2S 5G0TA 3ZY5A 2YNMA 4TROA 1Y5IA 2WIDA 5AI5A 2VN8A 3BGDA 3PB3A 2YNMD 4WNIA 1LLFA 1QNFA 1W0KA 2P3OA 4P54A 5TQ2A 2EHDA 3RSLA 4EW1A 4RD6A 5BT8A 1EDEA 1GTG1 1W0KD 2OHFA 3TB4A 4NATA 2V4ZA 4GICA 1P0PA 2PFKA 3RF7A 1PK8A 5AUPB 1N2HA 1AB5A 1E94E 1UM9A 1KQGA 3B2EA 2HZBA 2L42A 3QFTA 3QVJA 4GI1A 1YDHA 3GI1A 2WJVA 4F5EA 1SOWA 4FZVA 4U63A 4A8PA 4W8HA 4MKHA 5E2BA 5C34B 1VFNA 3GLFB 3LQ4A 1KPHA 4FFRA 1N5MA 2O2EA 5K3BA 2VJOA 3ONVA 1H5NA 3E9QA 3WHPA 3PNVA 2R79A 1OH8A 2JD0A 3BL6A 3H9QA 4ND8B 3U7JA 1TO2E 3DEIA 1CVLA 5ALPA 5IC4A 3A4MA 2O7NA 2Z5GA 3JQ9A 4NAHA 1CUSA 3ZVLA 1P9WA 4KIUA 4AS2A 4D6YA 1DBQA 3NZEA 1YHZA 3ICWA 1LWOA 1E2GA 1JHUA 2XNHA 2FSVA 3QQ5A 4L0DA 1Z2NX 5F2KA 4Q37A 1YDWA 1ONBA 4R6XA 4Q93A 1Q1BA 3EH2A 4A27A 3BREA 1DIBA 4KQGA 4J9VA 2H9IA 3HCAA 4NFYA 1VKHA 4KJZA 1SQSA 1UEIA 2NUAB 4BFVA 4LXQA 4J0HA 2E6KA 3NVKI 1PYOA 1A2OA 2B7BA 1GPJA 3KVNA 5G0WA 3IB6A 3HN6A 1RZRA 2GN6A 3WWDA 1LBTA 2RJNA 5FBHA 3UH0A 2E1PA 1VHDA 1GZ6A 2OXEA 4W5OA 1LCIA 2G82A 1VL0A 2B0JA 1F4VA 1DT3A 3CWCA 3HJGA 3QW4B 4NULA 3G0OA 4Z0TA 4BNMA 5KYYB 3OQNA 2OPHA 3U7GA 2IXEA 3I2YX 5JNUA 3RWBA 1M1NA 2O48X 1J8FA 1UXHA 3NYIA 9GPBA 2VHTA 2CBXA 2OLEA 3LNTA 4CEHA 4JOQA 3WADA 1TT5B 1I7NA 1D04A 1U9ZA 3OY7A 1SHZA 4NZMA 3ZCQA 5CBPA 2LDXA 3BF8A 4FS3A 4ENQA 4D74A 5DH9A 2XB4A 4GUDA 2ACEA 5HMMA 1DTWA 1KK1A 2XA1A 5L3ZA 2DLCX 4LEIA 4G1BA 3AJ8A 2GEVA 2EFJA 1LQUA 2O20A 3EVAA 4FMDB 4UHCA 4B3SB 3FY4A 3TIXB 4YPOA 5BWBA 5JYEA 1G0NA 4G5YA 1T13A 3WIVA 3JRNA 3F7OA 3NYQA 1NATA 1QYRA 2HXSA 2NU9A 3NIBA 3T5PA 1MRSA 5B37A 1RRGA 2JZNA 3BGIA 2ZYVX 4I1VA 3DNPA 2YUTA 4D5EA 3WKEA 1OJLA 4KH0A 3HO8A 1TAGA 4LYGA 4M8IA 1T8PA 1UZNA 5DBEX 1S3IA 1EGQA 2IEYA 3BH7A 1ECLA 8MHTA 5TMDA 5TQ2B 1T6NA 3R09A 2H4YA 4OKNA 3WWZA 3HY4A 1QF6A 2W37A 1B3RA 1F9EA 4G56A 4MCHA 2Z6UA 5EVJA 2K7FA 1UWLA 1UM9B 1F0PA 5D84A 1SZDA 3PGVA 4GFDA 1I24A 1QIEA 1HYBA 3PI6A 4KX5A 2R4UA 3T5GA 1YUBA 2ZB3A 4K9NA 4ZK2A 1YXMA 2ZUTA 4RVCA 4UXJA 1II0A 2MSLA 4Y2YA 1TTTA 1IB6A 2X8LA 3KU1A 2C04A 4DJFC 3OPQA 1YJBA 2O7RA 4GMGA 3SYNA 2Z04A 3DMGA 4AURA 3ETHA 3VHLB 1OB2A 1KKUA 1RXUA 1VPWA 3H4MA 1F3OA 4XQ9A 2P9YA 3MA0A 3AUAA 1YZKA 1U9YA 2OE2A 4G6ZA 3FHLA 3PHLA 4L85A 5D5QA 2AZ4A 3LC2O 1J6UA 3QGMA 1CDZA 1T2FA 1C3JA 3UUGA 2Z30A 3CNNA 1C3EA 1Z2OX 1E18A 2IHTA 4R1SA 3Q3VA 4GR5A 5A7GA 5C8XA 4H4CA 3HP7A 3HZHA 2J9RA 4IDPA 4FEEA 4TYMA 4UAJA 5B3JA 3A3PA 5KYUA 2PLNA 3AL3A 1YDFA 2HDWA 4ZN6A 3MJCA 5HILA 3A1NA 1Y7TA 1V9SA 4PO9A 4X84A 5AXAA 3GJ3A 2B2CA 1WZNA 2XB8A 4BIMA 2ADFA 2QBYA 3TR6A 2Y0BA 2XODA 3CLTC 4C4ZA 4BMZA 3CB4A 2X9QA 2CEAA 5M34A 2IKSA 3HJUA 1Z7YA 1BQ4A 4EG1A 3WLTA 1JIQA 1OY1A 3DDZX 4Y9TA 2FPSA 1Z82A 3NHUA 2R2GA 3VUEA 2ZTHA 2ZCJA 3E3LA 3I04M 1J70A 4G9BA 3SEFA 4QGSA 4DZTA 1E98A 5CVEA 3I5UA 4CEHB 2JFNA 3S2IA 1T0IA 4H0FA 2X1HA 4WCFB 3LUHA 3D4BA 1NJ2A 3DAGA 1IRIA 3QKSA 4EG0A 5CBPB 4EELA 2F3RA 1IDN1 2GPWA 4C3ZA 5B4VA 4KE8A 5DTRA 3A4IA 4I0WB 4EJSC 1ISMA 2NV2B 3CCCA 1DTWB 3ZKWA 4QLBA 4BB0A 5AD1A 5E9JA 3K0SA 4UE2A 2WHEA 4PYJA 2QRHA 2QOEA 3LP6A 1VLJA 3FBTA 5JPCA 2B1JA 2JS7A 3O3CA 5CYOA 4GXTA 1UUFA 4MV8A 1LD3A 2H8KA 4WINA 1J5EB 5KX5A 1O0SA 2NU9B 3SIXA 1XAGA 5F33A 1N2XA 2G6BA 1H6BA 2SBTA 2VQSA 4MGHA 3NFYA 4EHJA 4DBVO 4WERA 4IILA 4MUBA 3K1TA 1U63A 1E2MA 3QFCA 1WSWA 3MGBA 2Q1TA 3ADKA 3PKIA 4J4HA 4RACA 4MVJG 1NJSA 2D1SA 3DB1A 3E9MA 2LPMA 2NSDA 4RORA 5HSGA 5EE9A 2FRDA 3ROPA 4BX0A 4ED9A 3UJHA 4DWOA 1DBWA 4MPPA 4FZ5A 4OQMA 4P33A 1TU3A 4M1WA 4N12A 1BYUA 1F1BA 2I66A 3CEAA 4TS3A 5BOSA 1NSFA 1NN1A 2QDXA 2XUZA 3GJRA 4ACBA 1IZ7A 2HLPA 1JHXA 5CT4A 3GPDG 4HATA 2H0AA 1LGYA 2QY6A 3BRSA 3LBIA 1Z4KA 3OZCA 1AZWA 2FZGA 1JF8A 1YGYA 3I39X 1PGPA 2ZBQA 4ZVPA 2D06A 1B00A 2CVOA 3NTQA 4NS4A 2JGLA 2Y6VA 4RCYA 1QPGA 3SE7A 3UB2A 1EP9A 1NAHA 2I1QA 2RJOA 2PXHA 1JPVA 3UWSA 3IQWA 4WFIA 4M1YA 2O57A 2P68A 1XEXA 2XI4A 3EWAA 3SNKA 1CEXA 1K2VN 1V5WA 4WT7A 3UQYS 5BQ3A 1XTUA 4M0DA 4DQXA 1JSLA 3C3PA 3GAAA 3KHSA 5IZCA 4DM7A 1RKQA 1GEGA 5JEEA 2JZCA 1ZRHA 4G86A 4LK3A 3TOZA 4EKNB 4JI3B 4B4OA 2EARA 1WP4A 1GU0A 4II3A 1USIA 4GLJA 4DDKA 3QVXA 3NKFA 2JH3A 1RU3A 2NIPA 4HAZA 4LOHA 4UW9A 5EGNA 3WJ1A 4DXHA 1P1RA 4F4CA 4ALKA 4HS9A 4WGFA 1JA9A 3HR8A 5K0BA 2K4MA 1EVZA 3QG1A 4ZQFA 5KYUB 3TLKA 1N2EA 4X54A 2AEJA 5ANRB 4PLPA 5D8DA 3KB8A 2QBYB 2D1TA 4GOMD 5THQA 1F38A 3DDWA 4GAEA 2P78A 3B6EA 4GT1A 5HUHA 5HQTA 3HYCA 3WFJA 4FHDA 2PA3A 1THMA 4JVLA 3I3SR 1K66A 2HF9A 1TM1E 3D6FA 3DBLA 4HRAA 4QDZA 2OM2A 4FFSA 2AL7A 4BNLA 1RYHA 1L4UA 2QQFA 3ZDEA 3R1IA 1JKFA 3VR4A 1YR9A 2VSNA 4PSUA 2PKQP 2BL4A 1CR2A 4DLUA 4WMLA 3VR4D 1E3EA 3NJ4A 4QYSA 4EEZA 4POOA 3QKSB 4TLAA 1N8TA 5F77A 1FFAA 4TS1A 3WTCA 3BWYA 4FHEA 3G0BA 4AJ2A 4PTYA 3B1XA 3T5BA 2NACA 2ZIGA 1T5IA 3DF7A 3ZKWB 5B7PA 1CRPA 3B6KA 1OFTA 4M36A 3VPDA 2YXNA 4UTRA 4X00A 4CG1A 4UEJA 4E51A 1TTPB 1JAYA 4NFSA 1KEEA 4U7DA 4R81A 1O1YA 1AB6A 3EEQA 3O8CA 3PEWA 2GCIA 1OBHA 4HO1X 1Z62A 2EYUA 5KX5B 2P6NA 3MGGA 1LPOA 5E7IA 5FBWB 3VGPA 2GF0A 2F3PA 1KVQA 1NOKA 3D59A 3HFRA 3ISJA 4DLTA 3DPSA 5A2QA 4P0PB 2FZVA 3C24A 4AUNA 1KJNA 4KREA 2ONJA 4MAMA 5LBUA 1PV4A 1HNXB 4NHOA 3K0CC 4Y2VA 2ZXUA 1VCOA 3A25A 3K8ZA 3OJOA 1ZUD1 2FR8C 3IC5A 1W75A 4KK4A 5KTSA 4OXYA 4ZHQF 2CMGA 2CUZA 2WW8A 3VKWA 1DAPA 2FPXA 2CW5A 3CH4B 1E96A 3LLMA 4R6WA 1JH9A 1RQRA 3HNOA 5BOSB 3GG2A 1AZSC 1JALA 2BGTA 3PQ2A 4DYHA 1GL9B 1P33A 3QUQA 2YRXA 3OZFA 1Z12A 4TVBA 1PQPA 2C42A 2WYWA 1KY3A 3HQ4O 3PTZA 4Y67A 2I8LA 3B12A 5HIKA 5IM5A 2AMJA 1NUSA 3DFUA 3OJFA 4NE2A 1W30A 5AVOA 2FK7A 2FWAA 4RPLA 4XVQA 4YT8A 3AUUA 1DCKA 2OD9A 1XEXB 1SQ0A 2PQ2A 3F2IA 5K6TA 4BO8A 3C16C 4DLVA 4L4YA 3I72A 3I0NA 4LNUA 5HPYB 1JUDA 2B8EA 4D4LA 2Q29A 3IP1A 4YRMA 1Q2XA 3DKKA 3M6UA 1TUEA 4LJSA 4MX8A 2QLBA 3GJYA 1WMBA 1I6KA 1PJLA 4X1KB 5SZKB 1G2IA 1DLJA 3KLOA 3PVZA 2X76A 3TD6A 4B09A 1UJ5A 2D0DA 1R9JA 3CUVA 4ZARA 2C0PA 3MJVA 4BTEA 2AEFA 2ZREA 4OF4A 4RHEA 2V4MA 1NNSA 3I53A 4OD0A 2CVFA 3FCSB 3A11A 3JATA 4C0SA 2O23A 4HNUA 2O2IA 2CB0A 2F59A 4YB8A 3HP4A 3KT0A 5EGSA 3REQB 4JP2A 4BEVA 2HMAA 3DBLB 2UZ0A 4UHJA 2G8LA 1F4PA 1GZUA 2X0JA 3QFSA 5DIFA 5BW5A 3OJ0A 4CLHA 2P9HA 3SSOA 1UOPA 3TRHA 4OMFG 3VDNB 3WY9A 3KRTA 2AIRA 1EZ1A 1THZA 1W2WB 3NP9A 4QYTA 4G0PA 2V7EA 4WCFC 5GV8A 1T0BA 3LUDA 1HMYA 1XZGA 2M9MA 2WILA 2P2DA 2HHJA 3KV3O 4KAFA 5HKOA 5K05A 3QMVA 3JW8A 2NZYA 4B82A 3B3FA 1I2ZA 1BEUB 2O8VA 1E0JA 2GF9A 3SDBA 2R6FA 3SLGA 1Q7RA 5EKSA 4FUTA 2W6MA 2FMHA 4Z9XA 5BUZA 2I2FA 1VLHA 3OFKA 4XWAA 3ZZTA 2JFWA 4RSHA 2QKYA 1VRWA 1D0VA 3EX7C 3A36A 2OO7A 1N6RA 3I76A 5I5EA 1G8YA 4F93B 4HRYA 2ZXFA 4OSPA 4S2UA 5LYYA 4DLXA 3TXXA 5I7EA 2CDRA 1QUEA 1OQAA 2CNDA 5EUBA 3PXAA 3HCCA 5I9NA 4FKZA 4Y6SA 4IDNA 4MIEA 1AKRA 1JP7A 1RBMA 4I50A 3T3GA 4ARCA 4RLSA 1YNSA 1G20A 2NXCA 3I37X 3QLVC 2EF1A 5J4HA 4EEKA 4DFDA 3LC1O 5EHIA 4D9CA 1IXZA 2NOAA 3FXAA 1B41A 5GM2A 3JYQA 1Y9AA 3DKPA 1UBLS 1U2EA 2UVQA 4MUHA 5E3HA 2XUGA 3QI7A 4ER3A 1ADGA 1OREA 5HOEA 1CZHA 4WZBE 4BZQA 5K0TA 1QNLA 2I4LA 3FNFA 3TBKA 4B6OA 3QPWA 2C3OA 2RGYA 2WJHA 5LQJA 2UUPA 2BH2A 3RSOA 4MUMA 3EZXA 4NG5A 4J3JA 4M87A 2NTVA 1R74A 4DCUA 3PHCA 1QRRA 3FYHA 3JVDA 3PCXA 4OH7A 3K6JA 1D2CA 3WSWA 4MCAA 1CULC 2GZAA 3AHDA 2PA0A 4LNUB 1PT5A 3V32A 1VGRA 5KTOA 2OC4A 1MNQA 4UE6A 2CXQA 3EULA 4EJ2A 1ACMA 1G8MA 1SRQA 1E99A 1X0XA 3OTIA 3P9KA 4JU8A 3VDXA 4DMCA 5CDUA 5DGDA 3I2GA 5HIAA 2IP1A 4XDGA 3V97A 1UBNA 2XF8A 3DW3X 3L8DA 3C4QA 3C8ZA 4AKTA 2YIDA 3AV0B 4MLPA 1KO1A 1AXGA 4J07A 2P2CA 1X74A 4PTZA 1HYQA 2CCKA 1GGEA 4XGKA 3UGQA 1TVKB 4B3FX 4UFOA 2PKQO 1N3YA 3MJEA 3OLCX 1QO9A 4MWEA 4E0BA 1DC5A 3BULA 3JATB 4ND1A 4QDOA 4ZQBA 3DDCA 5F21A 1ZESA 2NTYC 5U4QA 3AT1A 4C4XA 1A5SB 2RAVA 2ST1A 1QOQB 2C97A 3HB5X 2NO5A 4KQIA 1P9LA 1Q0QA 2RFLA 3B20A 4PYMA 1C1HA 4R01A 5CG2A 5JDIA 4DDVA 3TF5A 1VL1A 5BYBA 3K4PA 1VI5A 2MSCB 6REQA 3D7KA 1RWXA 3PJDA 3DL0A 2PRIA 1VL2A 2WT8A 3MGCA 2EJUA 2GD2A 2QAGC 5G3ZA 4X6XA 2PWAA 1XLTC 3L3BA 4MR9A 4URFA 5G4KA 4JLVA 1E9EA 1RP7A 1ZH2A 1DQPA 3RVOA 3UUWA 4RVHA 1DEOA 4RTRA 2FW7A 2WWGA 4K6GA 1YB2A 2I33A 3M1LA 2WMDA 3QYJA 4TTTS 3CRRA 3GL9A 5AVJA 3WGYA 4D97A 2D7DA 5DYIA 1IN5A 1R18A 3LFTA 4J1SA 3RS0A 2VA9A 1QXSA 1XZ8A 2VPTA 3S8MA 4DCPA 3PUWA 1EWTA 2H7YA 4JBHA 4PBSA 3GLFE 1OAKA 2DQZA 2JFHA 1A50B 2NXWA 3TO5A 4BKOA 3A4NA 3VNAA 3EG5A 2VO1A 4ZCPA 3SOZA 1OU4A 4WH0A 5FLEX 2TECE 2Q2QA 2BGLA 4Q4AA 5A71A 4S0ZA 1V8OA 2FN3A 1Q50A 3EUAA 4K1XA 4PX3A 4KRFA 5IXYA 3UHFA 1DBSA 1L6IA 2ZI6A 2QRLA 1Z6ZA 5IAOA 4I50B 1DAGA 1XQXA 2HNBA 4JYBA 1KR2A 4Q1DA 4UM7A 2G9NA 1IY2A 1P91A 3EUEA 3S2GA 4BMXA 1RQNA 3AHEA 4LGMA 1NKVA 3IGFA 5TLSA 4ZVNA 3OY2A 3E5NA 3UB4A 2CFTA 3F6EX 4BNZA 4J0CA 1PWZA 1JJIA 4K3UA 3MG9A 3S81A 3UK6A 3G59A 3PC3A 2C8KA 4D02A 3HL0A 3NEYA 2WJJA 4GGPA 1VG8A 2R11A 4TYYA 3AY3A 5CCBA 5JI2E 1WVMA 4QM6A 3EFOA 4D9EA 1ONNA 3IBSA 4J0JA 2C7PA 1G8AA 1GL3A 1AKTA 4G0MA 1ITZA 5SYAA 3L04A 5FWDA 2BTOA 2ZJ6A 3AFOA 4CM4A 1DDGA 3IAHA 2ZPTX 4EX6A 4A16A 3KR2A 1SCNE 3MOIA 1S1CA 2ECPA 3BWMA 4RD0A 5A5VA 1HNZB 1O7JA 1PJTA 2CFSA 1RDFA 1PWEA 2JIBA 3CKYA 4C6TA 4KQ6A 4F7DA 3IBTA 2G1JA 2BW0A 1ELOA 1CX9B 1OZFA 1VBFA 3RLIA 4I4TA 4JP8A 4RE5A 1PEAA 1FLNA 1DNPA 2MMCA 2QR3A 2FPPA 3NOXA 5DYWA 4N47A 1MR3F 3W9YA 3WRXA 1NLYA 1RXYA 5MN5A 1ODJA 3AZOA 1XZQA 3JZAA 4MJ3A 2X8JA 4OFZA 5K6RA 4LQLA 3GEHA 2DX7A 2J5XA 2PYDA 1KFJB 3QUSA 3BZUA 4RSMA 2FPWA 2ONYA 3DL2A 1WKBA 4OI4A 3Q2OA 2YNMC 1LX6A 4ZO7A 5SZIA 4NC9A 1IZZA 2GT1A 3IOBA 5K1ZA 1L1EA 2B8JA 1EHCA 2HM7A 3F98A 4S3MA 2HA3A 2YWXA 1F14A 3ITKA 4M86A 2A9VA 2CXOA 2M2IA 4W9NA 5EKDA 6REQB 3OUTA 3DCJA 3O1JC 4MA0A 2P9GA 2PMEA 5CB8A 1B26A 1TQHA 1KC3A 4ER6A 3BCSA 1T2CA 5BW8A 1J20A 1UXGA 1K9SA 4ZVRA 4MR9B 4D0LB 3UJDA 4V3CA 3A9TA 4O4IF 5G4KB 5BSMA 2GK3A 5KWIA 3I5XA 2QMHA 4QASA 3GRKA 4Y2QA 2WA1A 4HQLA 5G1OA 1P8JA 4QUJA 1LLUA 4Y6QA 5H59A 1Z0FA 1V96A 4DOMA 1UBEA 5LLTA 5EZSA 4Y9RA 3FPBA 4C0AC 2G77B 3VVBA 3IDQA 4WBNF 3LZCA 3PSAA 4X94A 3M4XA 3AVTA 1BJRE 1M7GA 3AZPA 1HFWA 1XNRB 1CFZA 3I42A 4B79A 3Q7TA 2O7VA 2DU8A 1MQSA 1NVFA 1NVTA 1P45A 1Q17A 2NV0A 3JQ9C 3GBPA 4FDAA 4IS3A 4MGZR 4G0QA 4BNVA 4CG0A 1I4DD 4DCSA 4H7DA 4WKNA 2Q9UA 2QRGA 4Q4AB 2ZJ4A 5FHRA 5BSVA 1WS6A 1LEHA 4I1OA 3KYDA 4EG5A 4TQ9A 1NN0A 4RIHA 1D6NA 2HO5A 1ZKDA 4UEQA 4IOMA 3VNSA 3W7BA 4EY8A 4TVKA 3SOPA 2PGDA 1YCGA 2PX8A 3E70C 1SWVA 3JARA 4EB6A 4JA2A 3AOEA 5FWAA 3RJMA 1G9XA 3U60B 4MICA 4J43A 1F12A 4UAGA 1GYRA 2PX4A 2C58A 5F73A 1P61B 3SZUA 1NMXA 5E1DA 1E7QA 1RMYA 2O6LA 3N2IA 4W82A 2B4AA 2FEPA 2VHUA 3IAM1 1NUQA 1Z15A 3EFOB 4HXGA 4RZHA 5HE9A 1ARZA 1XAHA 1KI3A 3GFPA 3KKMA 3HYNA 3T38A 5AHOA 3WWEA 2O3JA 3HKBA 3CS3A 1NNEA 2QW0X 1YFKA 4EW3A 2L0XA 4PICA 4CM4B 1H2AS 7GPBA 2BV3A 1W96A 4JGBA 1S9HA 2ZB4A 2BTEA 3V2GA 3E8MA 4KYIB 4YUWA 4C6TB 3KJHA 5IX8A 5I9MA 2X0RA 5CTAA 5DM1A 5BNIA 3W8FA 4G01B 1YTLA 4UFNA 1M0EA 3PCRB 4I4TB 1KL7A 2CKDA 3IKLA 5J23A 3FTFA 2FPPB 3VHQA 3NWPA 2FX3A 2P9CA 4Q3NA 3KTAA 3V4LA 4YV7A 2I7CA 4R1LA 4ZPJA 3SBXA 4D8VA 2X8JB 4OI0A 1RWMA 2RHBA 4UQPA 4IDFA 5AW1A 2RAUA 3KEOA 4TTSA 2IY7A 2IYWA 3CVWA 3UY4A 1ESNA 4WWHA 5I47A 4C2TA 1G2OA 1S96A 1DV2A 1POWA 2W98A 4ENVA 2FA9A 4JNKA 1DCMA 3ZE7A 1GPLA 2OBNA 3F6RA 4XVHA 2EG9A 2ZYSA 2NZVG 3GZNA 3OCWA 3RSGA 5BPHA 3S8YA 1EUDA 3D3WB 3PXDA 4LVCA 4CCAA 4EECA 4HNGA 2D8MA 2CV2A 3DM9B 3FPKA 3KFXA 3ETCA 3F3SA 5BQOA 1ECGA 3HUUA 2LBPA 4ENSA 2QN3A 2RHHA 2DCUA 3VPBA 4G4GA 4M99A 3MLBA 4E32A 1DE0A 1PDVA 5B6IA 4QO8A 1T0HB 2ODBA 4YJFB 5CDGA 3QF4A 5EIBC 4D80A 3N59A 2EKZA 3FNRA 3TQFA 1H22A 3OEHA 2REQA 3QMMA 3AVPA 4U2BA 1QHEA 1ZCZA 2VFAA 2VKTA 3OEHD 4ZU1X 3P2YA 4NK5A 3ECCA 1L3IA 1S2NA 4WGGA 1DBPA 2ATEA 3MBIA 4TV9A 2ZS7A 3M2PA 2WJYA 2PANA 4TWBA 5K0LA 1J2YA 3KYDB 2OV4A 1N5IA 4F1WA 3VHRA 2FFRA 2A5YB 3HBJA 1KZGB 2PQ6A 2WFLA 3O8LA 4EB6B 3JARB 3Q7PA 5T4BA 1BKDR 3AV3A 5KNCA 3PUYA 3I9FA 3NAQA 1WQ1R 1OHHA 2C84A 1G8PA 2O1XA 2QN7A 2C2MA 2DSNA 4QFCA 5C7LO 5KNCD 3FH0A 3A7EA 3QWHA 1N6KA 1OHHD 3QE2A 4G2TA 4GQBA 4L3WA 5ALXA 4LFAB 1XQ1A 2R8XA 1X77A 4LHZA 3TLGA 4V0RA 1A8PA 1E2FA 2AXEA 2RHCA 1OFIA 4G5XA 3EEBA 1DJLA 3DDUA 4KN6A 2Q50A 3R0QA 4UM8B 5IYZF 4CETA 3IALA 2O7SA 3AHFA 1XMPA 5AI9A 3KB2A 2XXAA 5KUTA 1VSUA 2CFRA 2I55A 2QUBA 1W5FA 5CXSA 2JA2A 3TCXB 2VBIA 3HKBB 1TT7A 2OMKA 5FOQA 2FG6C 1EPUA 4GL2A 1NRIA 3HXMA 1JWBB 3EQ6A 5C0OE 1KK0A 4IIJA 1D1PA 4P2GA 3ADCA 1KYXA 4CMJA 1M8PA 2QTCA 3RF6A 3K35A 5GJBA 3RKSA 1JG2A 1XG5A 4HHEA 1E2LA 1I1QB 1POXA 2YXEA 5D1NA 1T5TA 2AD1A 4D2IA 3KTAB 1G21E 1NMZA 2Q7DA 3VVMA 4BEJA 1X92A 3NV9A 1M2NA 5A5GA 5CVTA 1J9ZA 1FP2A 1M76A 1TKRA 4URHA 4JCOA 3H9GA 3USCS 1HDXA 1WNFA 4BASA 4L5AA 1XU4A 4MGKR 4QT0A 3FI0A 3F74A 1HTTA 1IUPA 3ZGZA 3HJCA 5BRNA 1JKJA 3EISA 2FDRA 3F5DA 4N4AA 4PLYA 4R9SA 1KHHA 2QXYA 2CHVA 3LW8A 1MO6A 2BFMA 3BB1A 3K9GA 3GZNB 2NG1A 3NRCA 3T35A 3AIIA 1EUDB 4O59O 4D9JA 2HLNA 4UARA 5K7SA 2CJYA 4YCBA 1GG8A 2JGKA 1R3UA 2NXEA 1B6TA 2J0SA 1NG9A 2FTKE 2WVHA 2B6NA 1HDYA 5HGXA 4UPEA 1T3ZA 4DJDC 4JVMA 1QX3A 1H6CA 4CI9A 1E9AA 1L4LA 4BX3A 3JD0A 1GYPA 3SZ3A 1E5QA 4HKTA 1KGDA 5D3QA 4KWTA 4JLJA 1KAEA 5HA5A 5JJCA 5D51S 1MOPA 1EVLA 1VFPA 3KOXA 3QF4B 2PG3A 3AUYA 4OH1A 4TTIA 3K9BA 4D0NA 4ZMRA 4ECAA 3TFWA 1W35A 4F4HA 1M8KA 4LF4B 2REQB 2OHOA 4PR3A 1N5RA 4Q7MB 1WW3A 4IKEA 1QB8A 4IZHA 4X7RA 4PPQA 4A8JA 2XUJA 4AIRA 3WHKA 5HJ5A 5JRDS 1T5HX 1TOAA 4HPWA 2D3TA 4OLFA 1XEWX 2ZCVA 3LBYA 1NBWB 4TV9B 3RWOA 2WV9A 3SC6A 4AY6A 5F3WB 3VNVA 2QZZA 5C8VA 5I7SA 2ZE6A 1FLDA 4AKGA 5JAMA 1TQ6A 1NW5A 3E84A 1QLWA 2WFLB 2NXNA 3W5DA 1CHNA 2YYSA 4TLCA 4F3YA 3RIXA 1XX6A 1Z4PX 3AFNA 1RLUA 1BU5A 4F11A 4Q3BA 2PUWA 3GLTA 5IU6A 2Y1LA 1HX7A 4Y9SA 1NP6A 3U3DA 4OHMA 2FLKA 3TLGB 3KQNA 2FU5C 4YBRA 1JT9A 1U0RA 2ANCA 3IELA 2QMUA 4OQQA 1UBCA 2VSOA 5ALZA 4RIIA 1YFLA 2XXAB 5BY2A 3KJNA 3JAKA 4MB2A 4D7AA 2IIBA 4XM2A 5AOCA 2ENWA 3CW8X 3O9VA 4QOGA 4H7FA 1WZUA 3KQVA 2FQ1A 1AO3A 4G1EB 2R66A 3CUSA 3P97A 2J0UA 4H18A 5WRFA 3WSTA 3VU3A 3ZHZA 4DB4A 2FV8A 3HVJA 1CY1A 3M9WA 2POQX 3IXLA 4IIJB 2FZLA 1W94A 4BV8A 5AJVB 5CLFA 1QPZA 1P5RA 2H4WA 3H1AA 1P4RA 5LQCA 2HA0A 3I0ZA 4JIMA 4RWZA 5DZSA 5EINA 4C30A 4P32A 4ENTA 1P0CA 1B0UA 3PUXA 4DJTA 3URMA 4HWKA 4PN7A 1OX6A 1WVGA 3OX1A 1QE3A 3GAFA 4I5EA 1R37A 3O2SB 1K7CA 1ES9A 2WFMA 4KQ2A 2K5UA 5AHWA 5P8WA 4YUYA 2N47A 4X8MA 1JAHA 4DR1B 4S05A 4LRTB 5D3KA 5B1YA 2IPNA 3AY0A 3E2IA 1Z8NA 2KYRA 1OT3A 3JQEA 2G83A 1ZONA 2YJ3A 4LXTA 2Q4EA 1A1VA 4M9UA 1QQTA 2XHZA 2BFNA 1JKJB 4Y1FA 4I55A 4M53A 1T6XA 2VLBA 2FQYA 2BFOA 4MVJA 3R74A 3W90A 4GF5A 3P9SA 3PIIA 4MVJD 3EDCA 4RCZA 3ZWYA 1DIAA 4DA9A 1WV1A 3QPAA 1IMOA 2ZIAA 2YXDA 4M8KA 4J94A 2CXHA 5E9QA 4BZPA 3B5IA 4W1SA 1P31A 2YHAA 1ILEA 4BFUA 1BKSB 2QQGA 1QJ4A 4FXOA 2GBLA 4BC1A 1Z4QA 3FBGA 3SF8A 2HRDA 1YR6A 4EY6A 1VSVA 3E0QA 1RWNA 2EKQA 4ZV9A 5JW6A 3LCJA 1ZVJA 4O2BA 5I7WA 3L0YA 1VIDA 3BDAA 3WG9A 1P4AA 2PL3A 1L7EA 1ZGZA 4A8JB 4YAJA 5EHGA 4ZKDA 3VH3A 2V7UA 2G9UA 1W47A 3UW1A 2HA4A 4QIHA 1ZW1A 4KFUA 1EGAA 2WTEA 5TVKA 4R1QA 5GINE 2IBSA 2BUCA 4YAWA 3PEFA 5EZYF 3ZDXB 1E6UA 1AGXA 1PSWA 4OGWA 3ZGVA 2IIPA 4B34A 1O95C 1I36A 1TEHA 5DK6A 3O38A 1ZKMA 4QUEA 1XALA 4P3YA 5JV5A 1KVRA 4HN9A 1M5UA 1DAKA 3B1KA 1OTHA 2WYIA 4B4DA 5B7GA 2NZXA 1M7HA 1ODTC 1VJTA 4NFHA 2FE1A 4G3XA 3F47A 3OC6A 1XD8A 2LD4A 3G49A 3KOUA 3JAKB 4H1HA 2PMWB 3KTFA 5LDGA 2Z9DA 3DMPA 2GYYA 4QXMA 8GPBA 5T8KC 4HGOA 1AHHA 2ETXA 2YVLA 5FO0A 5GV7A 3W2FA 2J0UB 1TDJA 1TKBA 1MRNA 1R6UA 4E4RA 3I5MA 1NT2A 2SKDA 4KXQA 1XK7A 5CR9A 1GRNA 4AF8A 4AKHA 2FMTA 4TSKA 1L7RA 1DOAA 1AKYA 2OHJA 3GDOA 4GI5A 3L01A 3NTVA 2XZOA 2GZ2A 2XWSA 3JTMA 2JIDA 3TVTA 1KVTA 1MLDA 2W2MA 4UMDA 3COZA 2BDUA 4IG9A 5CT9A 5LBIA 2HJVA 3NT2A 4PC1A 4URUR 2XWBF 4QWWA 4C0QC 1MORA 5HCNA 3HTXA 4C7OA 3MTGA 3C1UA 2TSYB 1T91A 1X70A 1P4HA 2NUPA 1RQGA 1N33B 2O8BA 4UNRA 5JNVA 3KOYA 4I55B 1Q20A 2VAVA 2XYQA 3ROQA 5CEEA 2OGTA 2Y9MB 1E9VA 2AI2A 1TADA 4N5DA 1GQYA 2QWXA 4WQMA 1U1GA 3TLEA 1YZNA 1R8YA 3OPXA 5FP0A 5H8WA 3L6RA 1A4RA 3RIHA 4HVLA 3Q8MA 1GKIA 2OGUA 2XXBA 4KXUA 4KXVA 3IQFA 3R0ZA 1E20A 1YL7A 2ASVA 3OP1A 4LOJA 3BE6A 4LRQA 1T9GR 3U1TA 3UM9A 1SM4A 4Z51A 4ZDIA 3UYLA 2I4MA 2V97A 3MTEA 5DGIA 4FGZA 1D6SA 1DG9A 4YPFA 1G8KA 3RUEA 1B16A 3KQOA 4XAQA 1ZK1A 4H15A 5F7JA 3SF8B 3RT7A 3V1NA 1F8GA 1QRSA 3KJZA 3BD7A 2JCSA 4J8PA 1ZOOA 3DFMA 3WWYA 2X13A 1H9BA 4G36A 4MROA 3A4YA 3DLCA 3CB2A 2A5LA 5DHPA 2KB0A 3D3QA 3ZYZA 1KJ8A 2JAOA 5GVRA 4E94A 3S2ZA 3ER8A 4K88A 4KFRA 8OHMA 4RTSA 1B6RA 3PFWO 1ATIA 1DTEA 1GL7A 4R98A 2FR0A 1TKAA 2HMSA 3EXHA 3FGZA 5JLJA 3IP3A 3WGOA 5I4CA 1Q0SA 4DILA 5B4TA 2FLVA 3MLAA 4UMVA 2C7RA 3JZMA 3R3SA 4GSLA 4QPZA 2WUGA 4X6LA 5SZJA 2CUTA 3RS8A 3WDLA 3QSGA 3N2YA 4HDKA 5AH0A 4HFRA 3WISA 1N5DA 3L7LA 1BCRA 5CG1A 3M8KA 2AOXA 1K4MA 3OTOB 1A71A 1GY8A 4QAQA 1QQ7A 3D3EA 3HZRA 4EBFA 1Q91A 1P2GA 2WJIA 3G13A 4KO4S 3WVNA 1U1DA 3D6JA 1RI1A 1S0UA 4WJLA 2R8BA 2G06A 5JY1A 1I6MA 3ZDAA 4N41A 4ILKA 4YRFA 1TIKA 5DMXA 3CRVA 5ESXA 5J3JA 3ABIA 5KNLA 2HL6A 1P5FA 1D2HA 4B4KA 4UUPA 4BKQA 3SR4A 2DERA 4A2CA 1AF7A 3RV4A 3OKFA 4UNIA 4EENA 5HRAA 3JYNA 2YMPA 5CA0F 4K46A 3UCFA 1XO1A 2SECE 3GC6A 4ID3A 2W4QA 4D9IA 1PZGA 2DWQA 2ZR9A 1TUIA 5T6BA 4C7OB 4KRXA 3UAXA 2VHQA 3H04A 2Q7OE 3HO6A 4M83A 1ZLXA 3O21A 2NUPB 2VYNA 1DAFA 2TMDA 5AI6A 3MPUA 3TW4A 5JYCA 5JZ9A 2O8BB 1AGNA 3V8RA 2VYND 3VTAA 3PD0A 2HW8A 2KWIA 3LUAA 3LZ6A 1XGKA 4FQ5A 4HGQA 1NRXA 2BKAA 2NZWA 1N6OA 2Q3LA 2VNKA 3KEFA 4QARA 4V0SA 7YASA 5I7VA 3ILSA 4PNPA 4P2BA 3BIXA 1M2GA 3FZGA 4HRVA 4LCJA 1X8XA 4ZQGA 3P0HA 4IL5A 4BGEA 1WMFA 2X40A 4J91A 4E4YA 2GDJA 3CH6A 1V95A 4O2BF 4UUOA 5KJFA 1CLUA 2C95A 1YQ9A 2C4MA 1N5JA 3KVYA 1XF1A 1KEWA 2PZKA 3KVVA 4JEUA 4TLBA 3VAAA 4EMTA 2HA6A 2O1SA 4G63A 2EP8A 3HA5A 5NULA 3S7TA 1R6AA 2GWHA 2VZ0A 2C96A 3MQ4A 2IELA 4KQEA 1GG5A 3EJWA 1NI4A 5EE0A 1IOWA 3RC2A 4F21A 1BCSA 1KI7A 1YHYA 4I1RA 4NICA 3V1LA 2P2GA 3MRSA 5GTDA 2ZJAA 1ZITA 4KLRA 4XGNA 3F3YA 2PGJA 2QS9A 1L4YA 1Z4LA 1V9CA 2XWQA 1AOXA 2F4NA 3AM5A 3AOGA 3AR8A 4PR0A 4TRRA 2AMVA 1XMXA 3O3NB 5JHHB 3H0KA 1A9QA 2O0LA 1E63A 3EXHB 2R7KA 1RD4A 2DKFA 1EHIA 1B73A 4DSOA 5BWLA 2D59A 2ZRGA 2BM8A 3I4CA 1C1YA 1NPYA 2EX1A 3JZFA 1SZPA 1JDBB 1TNDA 3O2JA 3OOSA 3GIWA 3PCTA 4GLBA 4DCJA 1TQDA 3F4LA 1BWSA 3UWDA 1ZQ9A 5DM60 4QA9A 1BH6A 2WUVA 3OTQA 1NF2A 4QG3A 2H4ZA 3L77A 2A92A 1BCRB 2WHPA 1D4FA 4LN1A 4W9NC 4F8EA 2BMFA 3SQDA 1L7PA 1BS9A 1H8EA 2F9MA 2ZSJA 4GEGA 1G6Q1 2GB4A 1PHRA 4UJ5A 4B3CA 3GA0A 4BOYA 4CQMA 1H8ED 4M37A 4KIWA 5JYDA 4CQMD 5B36A 2GEFA 2QRJA 1BH2A 3JQFA 4MQBA 4PZZA 2Z08A 2WAMA 3LVRE 2OXRA 3MD9A 2V5AA 1P7YA 1U7OA 3H2YA 3Q87B 4C5BA 4LFBB 3AL2A 3FUCA 3UN1A 1MTOA 5J5AA 3O2QB 2ZRCA 1RQLA 2IYNA 4RK6A 3DLAA 3X2SA 2V4UA 3VTKA 1DPGA 1U8YA 4BN4A 1G3MA 2OC9A 4JP1A 3H2GA 3AUXA 2H92A 4PRZA 4BDSA 3TG2A 1KJJA 1LDMA 3GROA 1J33A 4V0NA 3ITDA 2XTMA 3HFGA 2A7XA 1KEUA 1LI7A 2OCLA 3ROTA 2HGZA 3R3WA 4FCWA 4MRRA 1AZTA 2OHGA 1K6MA 3U3ZA 1GCAA 1R4NA 2ZKLA 1G3IA 2HTFA 2H4FA 4RKEA 4QUGA 3TR0A 3GRPA 2WYHA 4NYJQ 3U9TA 3KAPA 3KSRA 5HDQA 3ZHYA 1ETHA 5DHQA 2RGEA 2JASA 2OB2A 4JR1A 4RIEA 1ECPA 4I81A 3NTXA 3CA8A 3Q7EA 5BSHA 5JMTA 5BSEA 1K5HA 2QYOA 3W8NA 1IJEA 3GD7A 4R7TA 2YJNA 3V8VA 4LIPD 1FY2A 1RPJA 2GZHA 4G85A 2VTBA 4W8GA 2OUKA 1YIOA 1J1IA 3SXUA 1ECJA 1MUUA 4AN1A 3V2HA 3O4IA 3NDIA 1D2AA 5A4JA 4JX9A 3PTAA 1UBSB 4HYEA 1G64A 3EBOA 3BFXA 2PUEA 1S2GA 1NI4B 4FOOA 3DOEA 3H2IA 1BCSB 3KKEA 2X0IA 1EX1A 1M73E 1C7RA 3DZ8A 4FJ0A 3HDTA 4RMNA 5CT8A 5DXJA 2WSMA 4YQYA 3E9DA 1ZD8A 3GXBA 3OOJA 3WGTA 1G17A 4XUGB 3TZ6A 3HCBA 4DM4A 4LTMA 1C9YA 3T1OA 1BOOA 3IPLA 2KM1A 1JHDA 1M66A 1NBOA 3OOWA 4D4KA 2LTAA 4PZYA 2O8EA 1GGVA 1YD7A 3FLEA 3HKCA 4E2YA 2BGRA 2FFBA 3E5MA 4KQJA 1NVAA 4QNMA 2UUAB 4AZVA 3SC4A 3RH0A 3AR6A 4KG7A 1QLHA 4RTQA 4GKVA 2IHZA 3L41A 2WP0A 5CT6A 1E5DA 3UMMA 1TYBE 1GDHA 4S1OA 3LS2A 3NHMA 4ZAXA 2NP6A 4ZXFA 5JD6A 1JTVA 2WHPB 3GJSA 3OAAA 1L8XA 2HYIC 1ANKA 3OFNA 1CB0A 3U3KA 1S7GA 1B8OA 3G6WA 3OAAD 4UQOA 1C50A 3H5IA 3WQBA 4B5KA 3OFND 4EL0A 3E18A 1ZSVA 4CQMB 5PNTA 4N8DA 2AR0A 1XHLA 2J5BA 1IJBA 1CY2A 1D4OA 1P7CA 1WAMA 1XJQA 3OLQA 1VBKA 4YA6A 1RWBA 3ES9A 2XUQA 1QU2A 1W2HA 2IXGA 4FOLA 4R2XA 3AU8A 3AINA 1WB6A 4RM3A 5DBFA 1EFAA 3ZGXA 1KHTA 4F4JA 3KZNA 3VZQA 3GDHA 2OZVA 1E62A 1PL8A 1GAEO 2ID9A 3KDPA 3M3PA 3COVA 5EIFA 1IE3A 4N76A 1NZFA 1BTOA 1UPTA 2KW5A 1GZ3A 4J9UE 4XLLA 1XL0A 2C59A 5I45A 1NQUA 2PMFA 3F9RA 2BLNA 4HUJA 1PIWA 3ADPA 1XMSA 1RR6A 2OKCA 3H2BA 1EXMA 1WNTA 3T61A 5CEFA 2F48A 4ZGWA 4B84A 5FBKA 3S44A 1PGOA 2DT5A 5MFZA 3Q11A 4I6JA 1F06A 1ZUNA 1R4NB 3LP8A 5IJZA 4J7XA 1N1DA 1MC8A 1XRPA 5IAEA 1P2DA 2P3QA 1QO7A 2E89A 1TZCA 3VO9A 3FKJA 3VZSA 3ZWNA 2EDAA 1SB9A 1XCOA 1U28A 2W2KA 3LXRA 2CLCX 4GYWA 1H2HA 3VOTA 2UXBB 1UANA 5FUXA 2VTVA 4NQRA 1PAUA 3ILHA 3T5MA 2G07A