4LXQA

Crystal structure wlard, a sugar 3n-formyl transferase in the presence of dtdp and 5-n-formyl-thf
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
273
structure length
273
Chain Sequence
b'GHMIKICIAGKNNIAVNSLQFILKNYFEADQIVVIPNKNDKGIDSWQKSLLKFALDNNIKIVTLDEIYNIEQIIFFSLEFDQIIKIENFKSDRLFNIHFSALPKYKGVFTSITPILNNELESGVTLHRIDNGIDTGNIIDQHCFPIDINDTARDLYFNYLKYGESIFKKNIQTIINNSYKDLKQTNINSSYFSRKDINLVHKINFKKTSFEIHNQIRAFIFQEYQLPIINNSKIIKSILANEFIGYNVFEEFENYFIISGIDGFKIIAQKLNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WlaRD, a sugar 3N-formyl transferase
publication title Structure of a sugar N-formyltransferase from Campylobacter jejuni.
pubmed doi rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Transferase
total genus 90
structure length 273
sequence length 273
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12230 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4lxqA00
4LY0A 4LXQA 4LXTA 1Z7EA 4LXYA 4LXUA 4LY3A 4LXXA 4WKGA
chains in the Genus database with same CATH superfamily
4J7UA 3TOXA 5I8PA 2IHTA 4RMJA 1VLMA 5DBEX 3W7VA 3I76A 1UR5A 3AHEA 1YZQA 2R79A 2H17A 1XRRA 3LWNA 3F5FA 3PC3A 4REOA 1K3FA 4QPZA 4ALJA 4DQDA 2VLBA 2Q5JA 4IHJF 4BKOA 4CIVA 1TTTA 1P2VA 4ARCA 1L5MA 4F2GA 4FS8A 3LCVB 3UMSA 1JSLA 2V6GA 3BFJA 3JQAB 4DDUA 3D7LA 2ISQA 4OL0A 5IULC 1JDBC 2EKDA 1K7YA 1N2EA 3O94A 3OTGA 1I4DD 2JCYA 4HWOA 4QYIA 2D1QA 3AGQA 4O4IF 4GC9A 5DFAA 4C4YA 4NU6A 4Y9RA 1Z56C 2B9EA 2WSIA 3JQ9A 1Z35A 2XAUA 4PTZA 5DASA 2P2SA 4PF1A 4ZCPA 4BX0A 2D0PB 1QHEA 4YCBA 3TO5A 3E3NA 5JAZA 2XZLA 5AWFC 2YWJA 3DM9B 2O8FA 3T8YA 4Q7JB 3D31A 2WR8A 4P7GA 3TQSA 2BFFA 5IJ9B 2I2CA 5IS2A 4ZP1A 5LQDA 2ZRQA 2DTDA 3Q5DA 3EGVA 4WCFC 4CU5A 4EKYA 3KKNA 4LFCB 1VB5A 3RAEC 4LZOA 4B09A 1C0EA 1KETA 3I2FA 4P1ZA 3E7DA 3DF9A 2AB0A 5FLEX 1TA9A 1Z45A 2AK3A 4NG4A 5EXEA 1CZRA 2Q8NA 3NETA 4P82A 5DTMA 5A0FA 4BP9A 5JS1A 1AG9A 4QICA 1LBHA 3AY3A 4UVHA 4YVFA 1DELA 1UKVY 3P9SA 1W7AA 4GZ5A 3C4JA 3T9FA 3H2GA 2RBEA 5FWXA 2DTXA 2VRBA 4CG3A 2IP1A 3P0HA 4ZT7A 1YQXA 4DL9A 4XUGB 4GI1A 3ES9A 3MT7A 4FQ5A 4QUAA 2JRCA 4R9SA 1RWMA 3KJGA 2W6OA 3GUCA 4WEQA 5ALRA 4WZBB 1NN1A 2QTNA 1UWCA 5IXSA 4YP6A 2VHTA 5FWYB 5JOQA 5C53B 4DT1B 1I0ZA 4RGYA 3SR4A 1FP7A 2XMRA 4H17A 1SD2A 1SHKA 1R0SA 2W9XA 3FMFA 4J0QA 4NFSA 4NFHA 3GJ6A 4ZOCA 3TIXB 3HYSA 3V34A 1W4CA 4PNHA 4ZHSA 1H5UA 5I3CA 1QB8A 1GDHA 4PFSA 1PI3A 1XAJA 2QN9A 2FWPA 1GKKA 2LUOA 3ST7A 3T7SA 4ECAA 3DF7A 1QLWA 1R6AA 4IIJF 3TRKA 3OI7A 3TRHA 1UBFA 4HFNA 4PHCA 4XQEA 3WLOA 4EQ6A 2A9VA 1C41A 4AO8A 1LPSA 3GQBA 1HQCA 3GJRA 1JG1A 2W6PA 3JD0A 3OCUA 2P8JA 3ZZ1A 5L6LB 1ZHHA 4EPYA 1SR8A 1P45A 2W43A 4XA8A 5IT9A 5FTJA 3HSYA 5ICCA 4CKWB 3BKXA 1WMDA 2D5AA 3D81A 3K3PA 1GTZA 4IQFA 3SY8A 4EI9A 4XASA 1FNBA 1CUJA 1XBTA 2OLJA 2W6ID 3DBVO 3E1GA 3KEMA 1GAWA 5DT2A 1R9JA 3RUFA 3HRIA 1PWZA 3FKQA 3V1TC 3L6RA 2HD4A 4LK2A 4C30A 1F17A 4E32A 4DMKA 2V7BA 5BSGA 5LB4A 1Q0RA 1XLTC 3I01A 4ZOLB 5KNDD 1IXZA 2WVHA 4KQKA 4N1AA 1Y8AA 3AR8A 3R5XA 4L95C 5LP6C 5TT1A 3CLRD 4BBJA 3RYTC 4CXMA 1KMHB 1IEXA 1M9NA 1UK8A 4GDMA 2FR8C 3IP5A 4Q37A 5A06A 3KJXA 4TSRA 5EC8A 4H0NA 3B20A 1JE1A 4M0EA 2CEAA 1KFKB 1VMIA 1UWVA 3OZ7A 4OQ4A 4B8WA 2PBRA 1RHQA 3HNOA 1XVIA 2TYSB 1XN4A 4YRFA 3EDMA 4JODA 4FGWA 5DNWA 1S8OA 3G5TA 5B6JA 4AN4A 4YP5A 2J8ZA 4W5RA 2VTKA 2XWQA 4L4XA 2PZMA 4J0IA 4RV9A 2IV2X 1HZJA 1KJYA 4PIVA 3THWA 4NICA 5AXBA 2ZRAA 5BN5A 4KQMA 2CVOA 3UT5A 1C3VA 4B87A 1EJBA 1EG2A 3DDHA 4KLRA 3HY4A 1DKMA 3PLNA 2PT9A 4BEVA 2HFJA 5MN4A 2BZ1A 3AW9A 3NPMA 3L77A 4ZCIA 3U62A 1U2GA 1Z7EA 2UVDA 4OXIA 3ZZUA 4BMZA 4F8JA 1LFAA 3VSEA 4KL8S 1HMPA 3NJ8A 3GLIB 2OXRA 3TX6A 4NX2A 1R5JA 4XVHA 1ZH4A 1U94A 4Q21A 5ELLA 1ID1A 5EY5B 3T7TA 1MO2A 4C0HA 1Y7HA 1CT9A 4M7PA 3PYLA 1QC5B 2QRGA 3E9CA 4XGNA 3WP0A 4RGBA 3U1VA 4HZUA 2AG1A 2HA5A 3P0FA 1VGVA 2PMEA 3VV3A 1KZYC 2ZQ5A 4U6QA 4HNTA 2JGJA 1P2BA 2BCJQ 3OJXA 5DMHA 1RQPA 5EIOA 4GVXA 3WHPA 1E1RA 2FPOA 1Q1EA 1ZQ9A 4Y8VA 5DLDA 1W8DA 3GUYA 3U4IA 4IWXA 1VKZA 4GXTA 3D3QA 1EA7A 1EVKA 2ONZA 2X6QA 3Q87B 4IFEA 1M0WA 1A8PA 4CF7A 3V1KA 1Z68A 3IODA 2NVUA 2IYZA 3WGQA 1IM5A 2EATA 1M1NB 1VOTA 2HJHA 2R8RA 3W6PA 2HADA 2QE7D 1A95A 1MB9A 1XVLA 2GFIA 3E61A 3CWZA 2FMIA 3R3ZA 1BHSA 3KX2A 3GIWA 1VIDA 3PCTA 4L4SA 1XR3A 1MRNA 5CLFA 1G3MA 1OWPA 1V8OA 3ZE6A 2M6SA 2O2CA 3KU4A 3ZWBA 1WTAA 2PSSA 1QZXA 4WINA 3BGSA 3PICA 4CEIA 3OAAD 4QARA 1F0NA 1XTSA 2O6HA 1RXWA 4YYZA 4KQIA 2OLKA 4HZGA 4BO0A 2W11A 1D07A 5KAMA 1GZ5A 2QTTA 1KE2A 3GEDA 3WLFA 1QBKC 4EUEA 1B76A 4YV2A 2HRRA 5IXYA 5FTWA 1RYMA 3BHIA 2P5YA 4IS3A 4U2EA 3WBBA 5AHKA 4B6PA 4BO3A 5CAEA 1G3RA 4MAMA 3RB8A 2P4EA 5FBLB 3RVMA 5JZVA 3HG7A 1MT3A 3ONFA 1NE7A 1NW7A 1SUWA 3NNNA 4N5DA 2XUFA 3C6MA 4BDTA 1QKJA 2I3ZA 2CJWA 4ZDKA 4BLOA 4WECA 1BEUB 4OU4A 1AGXA 2HDNB 2IP4A 2YMMA 1A5AB 4GYJA 4PO3X 3S2EA 1M8PA 1MO4A 2EWMA 5A2QA 8ATCA 5CGZA 3VR6A 1UMBA 3MRXA 3ZDFA 2FB9A 9MHTA 4QX6A 4RKQA 1TA0A 4C22A 1ZMBA 2NXCA 3COPA 5DXFA 3S2FA 5K05A 3LYLA 4U7FA 3TNLA 1ORDA 5LP6F 3HCAA 3FDJA 4A03A 3EQ9A 1BROA 2P0AA 3X0DA 2XCSB 1C8KA 3TTVA 4AZTA 3NGMA 2JIOA 1EX9A 3GEGA 1S4MA 4H1HA 4QE3A 5GOTA 5HK8A 4ISBA 1UC9A 2LIVA 4UEWA 2E87A 2P9GA 1TYDE 3AJ8A 3PQ5A 4FOOA 3CE6A 4RQBA 1XFAA 3SEFA 3ZDZB 3ZKWB 3QUSA 3V8VA 1UBSB 1VYHA 3F98A 4BVBA 3GEBA 4KIGA 3JQ8B 4OQXA 4C9BA 1NJSA 1QF9A 1MV8A 1WHSA 4HATA 4D4JA 2NT4A 3X2FA 3HRHA 1CUAA 3EVNA 3O2QB 4IY1A 3PDWA 5J2UF 3MUNA 3G0BA 4D99A 1SKYE 1RJWA 2B4RO 1GSIA 4YEDA 4Z3OA 1XPJA 2A86A 3O38A 4V0NA 4W5OA 2O23A 3RC7A 2FETA 1QB7A 3DA8A 5AW1A 1B73A 1Z0AA 2W2LD 2FEWB 2WC1A 3MINA 4G26A 2B5VA 4GXNA 3SQOA 4C0LA 1HT3A 3V1NA 1T0JB 3G49A 1H2EA 4LHVA 5AOAA 3BIJA 2CXXA 3T5MA 5I4BA 4OP2A 1P9LA 3AM5A 2Q5LA 2FPWA 3GG9A 3F0TA 4TMXA 3M3DA 5BW5A 1KRXA 4QECA 4YYEA 1WHTB 2WYOA 4FQ8A 4RETA 3CYFA 3TSCA 2YVQA 4KVAA 3GNTA 4E13A 1YBMA 3NQ41 2RH8A 2QR2A 3L1JA 4XWYA 1KDTA 4O29A 2QMZA 3WB1A 5BYAA 1L6RA 4OUDA 2XI4A 1FPQA 1N33B 4MOWA 3ZPXA 3WTCA 3K4PA 3VPGA 1H0KA 4D3SA 5HUQA 1ZGHA 1R8JA 3DBLA 1T29A 4H60A 2ZYDA 1OX6A 4OBWA 3SR0A 5CDFE 4R0NA 2XZDA 2Q8QA 2FSVC 3PC6A 2VRCA 2ZB3A 1P8AA 4YK7A 4F85A 1E2GA 3OX4A 1QH8A 4MO9A 2L2QA 3Q2IA 1C4OA 3X1XA 3DL0A 1UUFA 3ROQA 1D6NA 3NT4A 2HBYA 3B3GA 3CA8A 3GRPA 2B20A 4P7KA 2X8JB 4WBXC 4ETIA 2SKDA 1EUDA 2VP0A 3DBHB 3QEAZ 3UMJA 2P9HA 3WGUA 3VZSA 2P6NA 4HC4A 5B7GA 5TPZD 5K8TA 1D2HA 5EN4A 2JAXA 2QP9X 4HAWA 2HAEA 3Q88A 1UZLA 3FUTA 1JJIA 1DFGA 4AS1A 3M6VA 4EB6A 3LU1A 3WYNA 3C15C 3B5JA 1C4WA 2HDOA 2PLRA 2H08A 3KZMA 2PFGA 4AUEA 1Y63A 2N75A 5DBIA 1VE7A 1FUEA 2F90A 2QT0A 3CKLA 1RKVA 3OLZA 4ARSA 2G6BA 3T4XA 2QW8A 5JAUA 1W36C 3G6WA 2NVOA 2VNJA 1E64A 1GRQA 3W3ZB 3LYAA 2ZPUA 2VI5A 2HN9A 1E96A 2RI1A 5HF6A 1YQTA 1XP5A 2WKQA 1BIFA 4L9SA 3WOVA 4B73A 2PO5A 4J76A 4DXAA 3FF1A 3NLLA 2YWCA 2RARA 1IU9A 3BRSA 3N3BC 4FMDF 4GUDA 5HSGA 3OCZA 3KIPA 5DHUA 1KSFX 3NP9A 4BMYA 3ER9A 1U98A 4NYJR 5BWOA 1XAGA 3AJ9A 3C3MA 3COYA 4BMPB 4ZV7A 3K1AA 2OOSA 4C6TA 4JI4B 1TB4A 1KK2A 1FJHA 3KLBA 5H3CA 2I4RA 4DGSA 4R7GA 4B2LA 3GCZA 1W19A 3CPSA 1ADGA 1ANKA 4MROA 1NTRA 4GP6A 5FCDA 3GN2A 3ZY3A 4A1OA 4BTVA 4HQOA 1Q84A 1GN8A 4N7BA 1C2YA 5INTA 5MHTA 4R6WA 5AOCA 1NXXA 4D8WA 3L7AA 5D85A 1JQ3A 1JHZA 2PYIA 3ILVA 2QYSA 2BGWA 4WY8A 1TQHA 2R751 3MAJA 4PN7A 5FBVB 5T8KC 1L9XA 5DISB 3IEPA 2OM6A 3PXBA 3N0XA 3L49A 2ZB4A 2WMDA 1U8YA 4YJFB 3FGOA 3ND6A 1DKNA 2BMVA 2QQ0A 2ZOSA 5JAOA 1IWOA 1D2CA 1V3QE 4HDRA 2OFOA 3ODGA 3PXAA 3OTIA 1JHAA 4P38A 3MLAA 1P0FA 2IZ5A 5F33A 3RYFA 3VISA 5JNRA 1QCZA 4B74A 1M1YA 3EYAA 2BHNA 1PW5A 3JATB 2C7OA 3EH1A 3UWOA 1BN6A 2BM1A 3KSRA 1XZJA 3R9KA 2IYEA 3LX8A 3EGCA 4MLPA 2WJYA 4DEYA 2XRFA 4H27A 4PZAA 1SB9A 1GU1A 1P6UA 3SXUA 2RHGB 3AVVA 3GNQA 4TWZA 2RGYA 3SC2A 3ZE9A 4GXQA 2GF0A 4JI5B 5IDXA 1GM5A 1Y6QA 1R5BA 3DOJA 4QJ4A 4QQRA 2R6ZA 1IN7A 1GTL1 4OLAA 3EIOA 4BX8A 1V3TA 3KLMX 1L1QA 2QX8A 2WM3A 3F6YA 4Z9AA 1JNXX 3LGXA 3RF6A 4KRXA 4K9KA 1T3SA 2JVIA 1W29A 5K0GA 4RPHA 5EL0A 4P3NA 3AR2A 1JECA 1VE1A 1NW9B 2IUSA 4M88A 4URVR 4NP6A 3FN4A 5KNCD 1U0RA 2JLAA 3OUTA 4QEZA 2CF5A 1OXVA 5AVVA 1Y5MA 2YYYA 1CEXA 4AT1A 4W1QA 5GIPE 2XRYA 4W4TA 4UAUA 5KYYA 1NY6A 4WW0A 4XTRA 2SNIE 2BUAA 2I91A 2EAUA 2J87A 3RRFA 2IBTA 2PWZA 2J67A 4GOMD 1ZU4A 4FPXA 1DKUA 3OTWA 1ZK2A 2HMAA 3DLPX 4Y9TA 2FN3A 2ZBVA 5D2CA 5CA1F 5KOHB 2AQKA 4F3TA 1T9DA 2VDJA 1YCFA 3RYHB 5CFQA 4NYIR 2JGNA 2PNFA 4I2NA 3BCUA 1MTOA 4WKCA 2QRMA 3KUDA 2CJXA 3NEPX 3O4GA 5LLSA 3VSDA 1W5SA 3FVRA 3EMVA 1JDNA 4FYHA 1WL8A 3P9QA 4LDPA 6Q21A 4PQRA 1JG4A 4XIYA 5ICGA 1SO8A 3C43A 1DZ3A 2I1VB 2H0RA 4GPBA 4A6DA 3LWDA 4EB8A 5IYZF 1TYZA 3EFBA 3OP4A 1X7HA 3B6IA 5C8YA 5C1IA 4CKCB 2EFEB 2I7CA 1NFRA 1WCIB 3QMWA 3AIMA 5EMMA 5A9RA 1JUDA 2FKNA 4BZQA 4R05A 4BMXA 2BSAA 2FV8A 4O4HB 1FSFA 1I5RA 5E3JA 4HYYA 4M89A 1H4TA 1QHIA 2ZROA 1QMGA 3LCCA 5JBQA 1P2UA 4W82A 2W2MA 3EIXA 3FRIA 4DADA 5IEBA 1N4DA 4L5IA 5A4MS 2GJSA 4M60A 1UBLS 3IA7A 1F06A 3P27A 4B1FA 4HEHA 3PFFA 1HKUA 2WILA 4PX9A 4ZJZA 2HO4A 1I6WA 4M0PA 3MF4A 2DT8A 4JJFA 1GZ3A 2ZUWA 1VKJA 4CHTA 4TRRA 4WK0B 3IDAA 4JJ7A 4XSGA 2AI2A 1NX9A 4M6WB 2ZVJA 1ECCA 2JIQA 4KQGA 3WYAA 1M6EX 2D1RA 4M4SA 5EIAA 3I1FA 1Z3IX 1CNFA 4BCDA 1FXSA 2HF2A 4W7SA 1E9EA 3G1UA 1QTQA 2YIDA 4JVLA 1SHTX 4LYFA 3BWXA 4RDCA 4QPCA 4ALNA 1ZVKA 4YCJA 1HL7A 4UNIA 2HHJA 2GVDC 4RZHA 2HA0A 2YOHA 5KVVA 1KI8A 2P5UA 1FUUA 1JDPA 2XKJE 3ZVRA 3BDIA 1VJCA 1DIOB 1HPLA 1NYQA 2BGRA 3AZPA 3OCCA 4ODIA 5KNBA 4Y6GB 3V9PA 5JBNA 1Q1GA 1U9JA 3O8LA 4QC2A 3PTAA 1EUQA 4LZNA 2CL0X 2NTJA 2VT3A 5KTYA 4FT4A 4R5MA 1E5DA 4GICA 1E9BA 4KWHA 4QOEA 1R0BA 3H8VA 4PRKA 5JH7B 2BGMA 2B30A 1UKCA 1XQVA 1ATZA 3KM0A 3N2YA 1CU1A 1T5DX 2BDEA 2C4VA 2P68A 1HEYA 3AVQA 1M6VA 4IHQA 4OGWA 4EGQA 1ZLYA 5JY6A 1YJAA 4Y1RB 2WTXA 3EG5A 4CLHA 2VDOB 4RVGA 1JHXA 5CB4F 3AP1A 5KMGA 1ZC4A 2I2XB 4BRSA 5JR3A 5JATA 2ZBGA 3OIWA 1L4UA 4X44A 4E6EA 4ENQA 1CHNA 2BFCA 1J8QA 2I7XA 3EEYA 1JGTA 4U7GA 1ULAA 3NHLA 4WRRA 1VHQA 2CL7X 2JAWA 1AHPA 1QS0A 1NYTA 1Z4QA 1CUXA 2DBRA 2W7TA 1Q77A 2CUNA 1U7UA 3K72B 3NWJA 4FBMA 1T13A 1DAHA 1VGRA 2JGDB 4US0R 4J4TA 5KHLB 1NVFA 2FP4B 2QM7A 2XCTB 3FCCA 1N36B 2O8BB 4BJ3A 4CL3A 1JR3E 1TF7A 3TD6A 2AJ8A 1I6MA 4LEIA 4LNAA 2G1PA 1RJ9A 4X45A 2XQGA 1QYIA 3VH4A 1JEQB 1UBNA 4CM7A 1SU8A 2EQ5A 2X9QA 1ZKDA 3ESZA 3TLYA 3U81A 1ICIA 3HO8A 4F46A 1JR2A 2V1UA 4EJSA 5ILOA 4RNDB 2BEKA 2F3QA 1E3WB 5B1DA 3QGMA 2RCYA 3M8KA 1OZHA 3IP9A 4REMA 5BW6B 5JYDA 4NDZA 3AF3A 2R6HA 4JELA 4N39A 4HT3B 2WTUA 1U0BB 1YBVA 5DYTA 1W88B 2ZXFA 1ZRNA 1PG0A 5CLQA 1F9AA 1J70A 1R88A 4RH0A 1RZUA 3PNKA 3ZY4A 4C78A 1TX4B 3FRJA 1ZGAA 1W5FA 2WTMA 5IZCC 4S2EA 2NO5A 2FGJA 2O3JA 2PR2A 4XQCA 3UC5A 3KKEA 3PJRA 2HXYA 3OFND 2NP7A 3HK2A 4GMXA 4L4ZA 3WJAA 3F97A 1PZEA 3VPSA 3O8RA 4KOAA 3TDNA 1KZHA 4YQZA 2NPOA 1YAJA 3N87A 4MRPA 1USVA 1PP4A 4PM4A 3FRHA 4AIIA 2P0YA 2PPVA 1FJGB 2ZDQA 1P4AA 1H2BA 4M1OA 4MMYB 4PLPA 5KVQA 1BJRE 3FNGA 3GZ4A 1GKIA 3PTZA 4EHLA 2FMFA 2H59A 1TFUA 1II9A 5KB3A 4JLVA 3RC1A 2CEKA 2YICA 1KYIA 4LXIA 2ZTSA 1QRSA 4TROA 5FFFA 1G7TA 3O8CA 1J5EB 3N58A 1FRVA 4OHBA 1B2LA 1X7YA 3MD0A 3TPCA 2PN1A 3T5BA 4L0QA 3W0LB 3ZR4B 2I4LA 2GN6A 4ER5A 2ID4A 2W83A 1GCUA 1GP2A 3HN2A 1N77A 4JI2B 2YL2A 3KP1A 1FTYA 3M83A 2R7LA 3GLQA 3CLHA 3K9CA 4JIMA 4RD0A 3WMRA 2X13A 3BSSA 3O3OB 1OVMA 4NYMQ 3IPYA 3QG5A 5CBKA 2VQSA 2FF7A 3D4OA 4JC0A 2WB2A 1FSPA 2YZGA 2FVYA 2NO1A 2XYQA 3LYHA 2I99A 1IN8A 1T4MA 3PP8A 4FNMA 3WQRA 4C0BA 5I9LA 3WWOA 2EEPA 4DV5B 4MEAA 4ID9A 1RYEA 3FCEA 2IHJA 4RGVA 3WO0A 4BNVA 1MJGA 4TV9F 4XKJA 1J1UA 1D6SA 3Q2KA 3HDHA 2QG6A 2JJ8A 2P9TA 1XZFA 3BORA 5LA6A 5F12A 2WAXA 1C0PA 3A9CA 3FDZB 5HBGA 2Y68A 3DMTC 4YRLA 2YWRA 2YMQA 3PHBE 4FB4A 1ORVA 2Y2UA 3RBAA 3VPDA 4PZLA 2GAIA 2Y0DA 2VBCA 4DNPA 5IHPA 3BPSA 4HQLA 4EP1A 3DHWC 1GYRA 4K8RB 1SPBS 2DVMA 2F1OA 4MJXA 4E70A 2GZAA 1AN9A 1A7AA 1DG3A 1VFNA 1BVRA 1JWAB 1QANA 1EFUA 1R2QA 2C95A 1FC0A 1ZEMA 3I32A 4DPMA 2FEMA 1TAHA 4CT4B 1CJVC 1Y3HA 4BNKA 4ZYWA 2GS9A 4LBZA 4BP3A 1J2RA 1MVLA 4IXMA 3ZGVA 3DMPA 2Z9DA 2X2EA 1QO0A 4JKYA 1TNDA 3ASUA 5I7SA 3CCFA 1K1EA 2GT1A 4TQAA 1LDMA 1TU0A 3I2GA 3QWBA 4OKSA 1R5OA 1QHYA 3GFTA 3U4QB 3H4IA 1VL8A 5KDDA 1HOTA 4MI6A 4A0SA 4ZT6A 2C7RA 1L5OA 4MS4B 2CXSA 2F62A 1BNCA 4LJ9A 5BN4A 2CLCX 2J9YB 1E8NA 4EVRA 5I9NA 1XEFA 3QW2A 2DHQA 3H2JA 1JR4A 2BZ0A 3TLGB 2I6UA 1A2KC 1EFCA 1KC1A 1PZHA 1TCBA 5AJWA 2E1PA 3NOXA 1S7CA 5KYVA 1KYTA 1A98A 1U1CA 1RRVA 1X70A 2VTEA 3DULA 4RKWA 1KWKA 5K3CA 2VRNA 1CTQA 3BXZA 4E5SA 4CKEB 3CR3C 1HDZA 4DTIA 2HH9A 1JH9A 4NBRA 4G97A 3CEHA 4EJFA 4R0MA 3RJ9A 1GRRA 3FWYA 3IGFA 2YZ7A 2OZPA 3VGJA 1IOZA 1CNEA 1TJNA 2C8LA 2VK2A 1DG9A 3X1JA 4A0FA 4YJ2B 2A9KA 4DLPA 2QOEA 4RLFA 3LX5A 3FWNA 5AM1A 4DARA 3A3PA 4ZYUA 2WF9A 3D5EA 3E05A 3GLRA 4X92A 4ZQHA 5G4KB 2BD0A 1QBGA 5CHYA 5HE8A 1EIZA 1KO5A 5DK6A 3R7WB 1EP1B 3ZY6A 4MPPA 2BTEA 3BD9A 2EZUA 3AIKA 3DD5A 1NP7A 4IDAA 4HNGA 3AEQB 3E9RA 3MWDA 3FSGA 1IZ7A 5DZSA 5HDBB 1M33A 3S6JA 1E6MA 4ZCLA 4A0RA 3QX7A 4CLEA 7AT1A 4K87A 2E3JA 1AKYA 3D4BA 3O4VA 3RBXA 2VYFA 3RNLA 2FW0A 4DEVA 1JW9B 5FNVB 4NMXB 2BGUA 3STXA 3HJAA 3OMWA 4TWBA 1YB1A 2YVKA 1WXIA 2WQ7A 5ALJA 2OUKA 4ZIRA 2VDVE 1H4SA 2P11A 1NKTA 2NTNA 3DO8A 4RY2A 4UBOA 3K4HA 1XZLA 2NYUA 1W93A 3OLYA 4KQEA 3TL6A 2Q6VA 4IX1A 4P98A 1A9ZA 2QD1A 5B3JA 1B00A 2ZJ5A 4PO1A 5HJ7A 2WTEA 4MEJA 3GK3A 4G0MA 4O4JB 3FZYA 1X9HA 4NZYA 3E9EA 2WAAA 1C1HA 3BGVA 2ZIAA 3HYNA 4L0CA 1NMQA 1SGWA 4IDPA 4R3WA 1CJMA 4RFSB 2DGDA 3H1PA 4LOKA 1XNJA 4B33A 1IIRA 2NAFA 3TQFA 1HT2E 1LVHA 3WLJA 3U5TA 2VJBA 2IEZA 3HMKA 4LRXA 5BSMA 3WDSA 2Z9CA 2UVPB 1NUPA 2QU8A 4ZQEA 5KSWB 1CRZA 4GKBA 3F5QA 2JJ2D 5LR6A 2W6MA 3E8MA 4PNPA 4WA7A 4CNBA 1DB3A 4IKEA 1T1RA 3WRXA 2AKEA 2F1IA 1NNSA 3LP5A 4Y67A 2KBEA 3ID6C 1I3LA 5JXGA 4FEYA 4Y2HA 2EKBA 4MQFA 5REQB 2IOQA 2SCUB 4K26A 4HAZA 1XRNA 1WSWA 1U0GA 3R3HA 4LFBB 1EG7A 3VHXB 2WZQA 1VYVA 2PU7A 3PEFA 1X1RA 2W6JD 3ZE7A 4WNAA 2HFKA 4DLKA 1D4AA 1TTHA 2AJTA 1C3XA 4HH4A 3P9NA 2F43A 4EUKA 5A0VA 3FR7A 5KI6A 1YVUA 3DKVA 1PYOA 5EHZA 5J43A 3IJPA 2N42A 4LZAA 1SBHA 4XE5A 5LZ5A 2O0JA 2A9OA 9LDBA 4TLMB 2E6KA 2FOXA 1QP8A 4X41A 1SXJE 4X3CA 3JQ6A 3PFBA 3Q7SA 4RD4A 5HCNA 3VPFA 3E8XA 1YKFA 3FNIA 2RD2A 2V4MA 4OJNA 1U9IA 2HSZA 1U0OC 2NPFA 2I3GA 5C80A 5B1EA 2BFEA 4YDSA 5CDFA 2AOUB 2D7CA 1H0RA 2PKRA 4YH1A 4AJKA 2VHXA 4HB4A 5JD5A 3ZIUA 1E98A 2CDCA 1KK0A 4BUCA 5IH3A 2PMCA 1T0HB 5T4EA 1E59A 2FW1A 3OA2A 3VJRA 1WKVA 2GA9A 3LP8A 1DDOA 1XDSA 3EUAA 2PX8A 3QWIA 5ELMA 4DLTA 1TF5A 4J0GA 4EFDA 1RTTA 3MOSA 4CBVA 5C7LO 3A14A 4IUCS 2PJDA 1NVVQ 1V1MA 1A77A 3RAJA 1DEAA 2N9UA 2EX0A 2LW7A 2P2DA 4M1ZA 4MV7A 5CNKA 2W2KA 3I64A 4QXOA 4K9LA 3LG2A 3R6WA 1Q50A 1UT5A 5BXYA 4MA0A 2IITA 4X8OA 4M99A 2W2VA 1E4YA 1GYPA 4XZ3A 2QX4A 3CNBA 2EW1A 2QL5A 3KYCB 5BOSA 1FJXA 4DIFA 4HGYA 4UOZA 4EA8A 2RK3A 4DA7A 3U19A 3M49A 2YFKA 1P0IA 5BW8A 1MPTA 5AHXA 1CPYA 4U00A 3WRYC 1SQGA 2OWDA 4MW2A 2J1LA 1IH8A 3K0CC 4M0UA 4QWWA 4XW2A 1PYDA 2AJDA 1GRNA 4X6XA 5AVYA 5THKA 3C7KA 5ESDA 1G7SA 3HH8A 2UYCA 1EXNA 3GJ8A 4Q4AA 4PAWA 4CCYB 4OJMX 2B8EA 1BKSB 1JHYA 2O07A 1OX4A 3BK7A 2OSVA 1FXUA 3ELWA 3LUGA 3NYWA 4WJKB 2AX3A 5AK3A 4US2R 2ZIGA 4CR8A 2DBYA 1E0DA 4A8JC 4FFMA 4WCFB 1N5KA 2R6R1 1VGQA 5CFLA 3DVAB 4UASA 3P97A 4LSMA 4ND6A 2GJ4A 2VHQA 4BFZA 1QH0A 3DV2A 4DB4A 1D04A 1BHO1 4NDAA 4Y6PA 4M9ZA 4LW8A 5K01A 1RAFA 3ZHQA 3V8PA 3Q9LA 1NJFA 3HB1A 3UGTA 1ISMA 2OKCA 4I1PA 4EGAA 1R6BX 2EIHA 2OOKA 3CZPA 1AH2A 5IPFA 1RWWA 1U3WA 5B53A 4E7PA 1DO2A 4JUDX 4S12A 3WXBA 5TX7A 4PZUA 4QGFA 5D3MB 3QSYA 3QLVC 3RS0A 1RJGA 3A3KA 1KI4A 4WE3A 3FYCA 2WMOB 1KJWA 4NCIA 2IUYA 1K4YA 1CKEA 2WIBA 4Q66C 2BRUA 4BEBA 2ZVDA 5JAMA 3GGCA 5B58T 1VL0A 5KC9A 2QHXA 3FBTA 4HQFA 1Y7LA 2IZ1A 4LTDA 4DREA 2VF2A 2XVZA 1CQIA 1J1ZA 4ZAZA 3D4NA 2WWVD 4I1SA 2B5WA 2G9NA 2QVLA 3VOTA 5K3DA 1NOJA 1RHRA 1HF3A 3A1SA 1FSSA 4H7JA 2NXJA 5LJIA 2H07A 1II0A 3V7YA 1U4SA 3EWIA 4UMVA 5IM4F 3E7PA 1LKZA 3K09C 4YIHA 2ONYA 3S55A 2UXCB 1UBOS 3V8MA 2JBAB 1T4CA 5AM0A 2JIPA 1L8QA 3O84A 1YI8A 3AEXA 5FA8A 3S4YA 3V2GA 4TVSA 2Q0SA 4BGVA 1XAIA 5DWVA 3L02A 1F60A 4EOGA 3IT0A 3AYXB 2BR3A 4PGAA 3YASA 3UAYA 2ZE7A 1VIAA 4L5BA 2VH5R 3AI2A 1NL3A 4A9AA 2PR7A 2Z5LA 4A91A 2A5GA 4I6EA 3RV4A 4E5DA 1M1UA 1DX9A 5MN5A 2X86A 3EDYA 3FR8A 1B74A 4JEMA 1RD4A 3FMOB 2J9FB 2CDBA 3PLRA 3WK8A 4TKUA 4D79A 4F6CA 1XROA 3N8KA 3VYUB 4L2IB 4B3BA 1Q1ZA 1DWQA 4DPLA 5TQ2B 2O50A 3R9XB 4BWVA 3TSYA 1S3GA 2D0IA 2AFIB 4N3NA 3AU9A 4NVRA 4DCCA 1TJ4A 4BECA 4EI8A 2IPOA 4IWNA 5HM8A 1PT8A 5MDHA 2JCXA 4ZC8A 2VWGA 4MITA 3V3KA 2ZUTA 3OMXA 1L7RA 1BE1A 1GPUA 4E1BA 3MRTA 4Z49A 3BN3A 3KZVA 4P4NA 2C7BA 5FFMA 3RSQA 1IUNA 3H9UA 2M1XA 3X1DA 1H6BA 1GA1A 4LJYA 4HMOA 5HXAA 3EJWA 2KB0A 1B26A 1BH2A 1KBZA 4RY9A 2ZCVA 3U44A 3GELA 4TX1A 1LX6A 4XB1A 3BMOB 1SHLA 2C99A 5ENDA 2ZBRA 2GKSA 4K9OA 2BFDB 1L4HA 3CLTC 2FGKA 1UJ6A 1O95C 1SXIA 3PUXA 4NYJQ 3WYCA 5TLSA 2P3LA 3IJRA 2JFOA 4AO7A 1YC5A 2EWVA 3W5IA 2JFYA 2BMWA 3QITA 3JRWA 1RI1A 4G5GA 1TFRA 1D2AA 2FZKA 1NNLA 5ERGB 1QE0A 4RS4A 2CHEA 2DWUA 3ZI7A 4KFRA 3CB2A 1QKIA 1JZQA 3D02A 3D8NA 4KGVA 2EFDB 1N0HA 2H4ZA 1VLLA 2GSWA 3CEAA 3MWEA 5FWAA 4FFPA 5FWYA 2PGXA 3L1VA 4UU0A 4UAJA 1H8HD 1V5GA 2OVBA 2QUZA 4EG3A 3ZWQA 2NZUG 1NR5A 1U3FA 5CK4A 3C45A 4XUDA 5BSEA 1ZNQO 4TXJA 3BICA 1OFHA 2X0JA 3Q1LA 3A4YA 1LGYA 3Q6MA 3OTHA 4ITRC 3PWSA 3CU5A 1Z7WA 2Y71A 2QRHA 2WIFA 3DKIA 2QENA 3WMFA 2FQWA 2BDTA 4ZO8A 3TXXA 4I6GA 1SHJA 2I5PO 3HKCB 2Q21A 3KVVA 4HJRA 4FZJA 1VQ1A 4PHHA 4YI3A 2VSOA 2CSXA 4UHEA 1H9BA 1MABB 3L8EA 2XT9A 1JI0A 2FYTA 2H5IA 3X43A 5ICMA 3MQFA 4PG7A 1NIJA 5J3JA 4X5OA 3TWOA 4RC9A 3BKWA 1DBVO 2WV7A 1TUBA 1DIHA 3F5DA 4RMHA 2A7QA 1F2TB 2FI1A 2H5LA 1Q0PA 1I13A 3VPXA 5BYJA 2O8CB 3WL7A 4JGBA 1JSCA 4D4MA 1LS6A 2R47A 4PG5A 2LR0A 2JLBA 5K6AA 1TL7C 2W70A 1VLVA 5CHEA 1FEZA 1JQBA 3ZZMA 4YMUA 4AP6A 4DXHA 2QM8A 3F4LA 4N8DA 1V45E 3A2KA 1NJ1A 1N7IA 1X9GA 1QK3A 2CW5A 3BMXA 1QVWA 1A5BB 3OQPA 4I9NA 5TY0A 1DXYA 4Z6KA 3UKDA 3V7NA 3HA5A 1DC8A 3VMFA 2P41A 2GPYA 1SHUX 3ENKA 4WADA 5GZ6A 3JVIA 4GRAA 4BMOB 3AVUA 3LQ4A 4UTVA 3PC8C 2DHEA 1LDNA 4IIUA 4ZAYA 1INLA 4BNHA 4GNRA 2XTNA 5JRZA 1E4OA 4I5DA 3OZDA 3K8YA 4QUEA 1CX9B 3I2JA 3ADCA 2C4MA 1S02A 4LHSA 3M82A 2AMLA 3SX4A 4CDNA 1Z0FA 1T2CA 1SCUB 1JR3A 1MW8X 1N3BA 3QU7A 5SZKB 4QYXA 5BUQA 1WLSA 4XJTA 4R2LA 1PFWA 2WD7B 3PDJA 4IW3B 2DECA 4MQMA 2FFBA 3Q15C 3IELA 4QIHA 4CUJA 5BMVA 4M1EA 2JFXA 5JD3A 1FU4A 4UD2A 5K20A 1XJCA 4R83A 4U9HS 5A7GA 3IP1A 5L45A 4L73A 2FK8A 4EO4A 3BMQB 2QAGB 3NRJA 1F3OA 3RAFC 3N2GA 5AUPB 4HS4A 3F71A 4RIEA 4N01A 1VKRA 5IDWA 1PWYE 2ZFUA 1NJ6A 2RI0A 4JITA 3WMGA 2UKDA 4B7AA 1FTSA 2PJUA 1WUHS 2A1TS 1OFTA 2IYAA 1DOHA 2PTHA 1EE1A 3P4UA 4E7OA 5JC8A 4DV7B 3GD7A 1ONOA 3EDOA 3EQZA 3OJCA 5IMSA 2GDJA 2AZXA 2OCAA 5DYYA 5GPBA 2HIAA 3H6HA 3JTMA 4GWKA 4HDCA 2FFJA 4RTQA 2GCOA 2ATCA 1WM1A 3DOUA 1IJBA 1X6VA 5KEIA 2X1LA 2PS9A 1E61A 1HNNA 4D0LB 4V3BA 2J6CA 3IAS6 4PR3A 4CQLA 3L40A 4F9TA 3WRVA 2OEPA 5B58C 1JEEA 2BE7A 5LZ9A 1QLHA 5JCXA 2WHPA 4AJPA 4DSTA 5LPNA 2JGMA 2XZPA 1TADA 4X8MA 5HKLA 3T5TA 1L8AA 3WLKX 4EM6A 2HYIC 2CYBA 4R98A 2QY9A 3ESRA 1KFCB 1B8OA 3H2KA 4MR7B 3W2FA 2V7EA 3WLPA 1GSHA 3EAGA 4RJ2A 2YX1A 1V71A 4LMAA 3G2MA 4N12A 4PVCA 5JNWA 3FFTA 3ADDA 3ZLTA 3VAYA 1NIPA 5IH7A 1D4OA 4PC2A 4BTEA 3QKRB 4L8FA 4P34A 4MLZA 3MIIA 3ERCA 2JFGA 5LWQA 1P1FA 1QG4A 1WU8A 4GPTA 3SLRA 1QAOA 2PMBA 4A8TA 2YJ3A 5KINB 5SYAA 2WDPA 3IUEA 4JLWA 2FN9A 2QTLA 4TTVA 3IKTA 4XYMA 4FWBA 4Z7OB 1Q19A 2OO5C 3LKDA 5HIAA 2ZANA 1PUXA 2ADOA 1V1JA 2PQ6A 3OZSA 4BQIA 2PL5A 3KQLA 2OBLA 3Q5GA 2VDQB 1RZRA 4BFVA 2B4QA 4HDAA 2ZI3A 4EG1A 5KKCA 1EI9A 2O54A 2EBUA 4WZBE 4UKDA 1UIRA 2PO7A 1YUNA 2O20A 3M2PA 1BQ3A 1R4NB 3MAGA 1YQWA 1UMKA 3G9UA 4HUJA 4R3UC 4E5NA 4Z2AA 1T1SA 3SOPA 4FN4A 3UJPA 2I3AA 2XF8A 3TM4A 4UE2A 1G2IA 2O7RA 5DYGA 3KPVA 2ZRNA 2K4MA 4PLFA 2G07A 2CFCA 3CRQA 3H2HA 3TB4A 5HQ3A 1KOJA 4KR3A 3M1LA 2RGAA 1DBRA 2EHDA 4LSZA 5DLPA 3GUUA 1BCRA 1EWTA 1U7PA 2HX1A 3K0FB 3MJEA 3BL5A 1IVYA 3HDVA 3TZLA 1UMDB 4RTPA 2RJOA 1BWSA 1I32A 3F74A 3L8YA 1JYFA 4CETA 5DJ5A 1W581 5HUJA 4JYPA 4MR8B 3A6HA 5EGNA 1C8LA 4NJEA 5JJCA 5E1DA 4OA5A 1RXEA 1WB5A 3A11A 3TTYA 1AU9A 4LCEA 5FBKA 5TF4A 2OCPA 1SKUA 2WG1A 2WPNA 1BMFD 2DKNA 3DQQA 3H5RA 3KJQA 3R3WA 3F8TA 1XTBA 1PAUA 3QY0A 3W2GA 4W8HA 5EKSA 2BP7B 1FFEA 3R8FA 1XRMA 5BWLA 4Y6RA 3FPKA 3ZGLA 3T4UA 3CRRA 4M49A 2IUEA 3RTCA 1XD9A 1WIWA 3VR6H 2YJGA 2W93A 4K1LA 1EXVA 2EQBA 4IGKA 4RY8A 1EKXA 2MR6A 2GEVA 4MQUA 2XUOA 3SVZA 5BSKA 4R2JA 2Q4EA 3BD6A 2IU4A 1QIKA 4KPEC 1BXGA 1N2CB 3WE7A 3AYZB 3SX2A 4PZPA 1BS2A 1TM4E 3QI2A 1K9SA 4FUQA 5LOVB 1RRFA 3AB7A 3ROKA 4BGIA 3U13A 1X87A 2PRJA 3G17A 5CD1A 1ST3A 2VHUA 4ARAA 2JDIA 3NDPA 4G6ZA 5L51A 2FPIA 5TQ0A 1ST2A 1KKMA 3IAEA 4QGHA 3O1IC 1A72A 1D6MA 1T8UA 1V16A 2GOYA 2GRJA 2IF0A 4LC9A 3VR3D 4B4OA 3E0XA 3K70D 3FDIA 4TYWA 1CR6A 4FHDA 4R1NA 1LLDA 4JWTA 2JLQA 4MW7A 3M81A 4ZU3A 2BDUA 4JFAA 4MQ5A 4F60A 1JQ5A 1NAIA 3L0YA 1BG6A 2BL4A 2GM5A 3KKKA 4KO8A 4UREA 3MBKA 4HDKA 2G28A 3H2ZA 4L15A 2PMKA 3HN7A 4FGKA 2EF1A 4B3RB 5ESWA 1ZCBA 1YB7A 4HQ0A 2E49A 3SJBA 3JRXA 3VNBA 4M21A 5EERA 1TUIA 1ZWKA 3OPXA 3KYIB 4Z99A 3VH2A 4XH9B 2CFOA 2XCQA 3N0TA 2NTYC 2QUBA 1FXWA 3STWA 4A5OA 5BVHA 3QSGA 2CXRA 3GAMA 1TIPA 2CXOA 3QKTA 2ID8A 4DLZA 3NBAA 4BATA 2QBYA 5I7EA 1IJFA 3HWX1 5F2NA 1RVDA 4IDQA 2LCQA 1FVHA 1IRIA 1KXJA 2P0EA 3OY7A 3PGVA 1LPAB 4HP8A 2IGTA 2VHYA 1EBFA 1J0BA 3OEHA 1QIEA 1UPTA 2VF4X 1P8JA 1IBCA 2GO1A 5BSTA 2GHQA 2I34A 2YS7A 1KO1A 3ITEA 3PUIA 4FVTA 4I9UA 4R2XA 3SBEA 3STVA 1UFQA 4AMVA 5IAKA 4JSYA 1IAQA 1Z8FA 1X38A 1G2QA 4URYR 3T1OA 3LOUA 4G1BA 3F1LA 4E2YA 1N6RA 4GI7A 4G41A 4G25A 3ICEA 3UMGA 4B3XA 1YA6A 2GPWA 4MV8A 5JROA 3KD2A 1Z7YA 5K3FA 4J75A 2WJVA 2HO5A 3C3PA 3PUVA 2QX6A 2CZQA 3F1KA 5EEGA 1CUGA 2QRVB 1JT2A 1QFJA 1WDLA 1V7QA 2NYVA 2WJJA 3HCDA 1GCOA 3D7MA 3LQQA 3C3EA 4P3KA 4WXRA 1SXJA 4XCXA 4RF5A 1UAAA 2GPJA 4D81A 2B5OA 1JMYA 4DMMA 2HR1A 1JAZA 4C5BA 3HXTA 1SH7A 4HVAA 4MUNA 1NRWA 2HWYA 3GEPA 4H1VA 4IIGA 1EPUA 4DCPA 4FDVA 1Z82A 5EXTA 4ZVKA 2ZRDA 4UC0A 3KJEA 4P4SA 4Y1GA 3CTPA 4P92A 3HDJA 2C9DA 5KOIA 1A9RA 4BBAA 2RGRA 2ID7A 1KJZA 1N2ZA 4ZZ1A 4IYRA 3PPXA 2O48X 1AA9A 2C5HA 3BTOA 3W9SA 2W2OA 2CDNA 3E82A 1CY2A 4PGMA 4JUAA 3SDBA 1Z8NA 4KNYA 5IC4A 1P61B 5D00A 4IINA 4JGGA 4EPWA 4KQ9A 4OMCA 3GRRA 1HFKA 5E2BA 4ROSA 3KFVA 1UBGA 4GSKA 2VN8A 2YV3A 3VYWA 3OLCX 1N9ZA 1TEVA 2A58A 2E4AA 3MJTA 3OPNA 2CV2A 4PY2A 4CDMA 5G0WA 2YDXA 3AY7A 3G8CA 1QQ7A 1J2JA 1W96A 2IXBA 2Y4OA 1GGKA 3LO5A 4YMSA 1V3VA 1DRWA 1ZIYA 1T3TA 5EZ5A 4A2QA 2XMZA 4MP8A 5CDYA 2QNRA 1L7AA 1UJNA 1VIYA 3QBJA 4AN1A 1RI2A 3GAZA 2C94A 2M1ZA 4ZVVA 3GXBA 1ESMA 4AJ1A 5EUMA 1C7IA 8MHTA 1EX7A 2X42A 1Z5WA 1VCMA 2PMWB 4L72A 4QU8A 1SRRA 1F4PA 1GT6A 3D8BA 5LYJF 1GSOA 3FNFA 4B4UA 4JDPA 2PG3A 3PIDA 5BNIA 1P4JA 4XDZA 2AZMA 3U6BA 1OAOC 3OU6A 5CLHA 1JHRA 2C54A 3SS8A 4ECEA 1PHPA 1CUHA 2YZ2A 4YQEA 3VYVA 5F7XA 4WLUA 3GP8A 4RTLA 2CNNA 4D8VA 2C1ZA 3W5VA 3LX4A 3OE5A 3IHLA 1NRIA 1TVMA 2VYQA 3TI9A 3I1IA 1AHNA 4E51A 2MSEB 1ULZA 4KDRA 4BLPA 3E2MA 4EEKA 1CUYA 1K6JA 3SJZA 4CQMD 3PRJA 3IV7A 1J9ZA 1MC8A 1TVKB 1B14A 3CKKA 4MRMA 4J1TC 4NMHA 1COWA 2PA0A 3K73O 3K71B 3QKIA 1WVGA 4DUZB 3H9EO 3OZXA 3BHMA 4B2IA 4BNMA 1P60A 1ZC3A 3QLUC 1ODSA 3A2LA 4H4EA 3RDPA 4PYIA 1HETA 4U5XA 3LCUA 3DVSX 3AVOA 2HDHA 3E58A 1PR9A 4HAIA 3BVPA 4V03A 4KI0A 4LVOA 1ORHA 3RK1A 2RCNA 1LBIA 3B9PA 3LA8A 2MYPA 1BU8A 1PL7A 3HJGA 1WXQA 1RPNA 1ZOIA 1DS6A 2WFLB 1W2WB 1TEZA 2Q2NA 5C52B 1E1DA 2H0QA 4PG4A 4X1KB 3UK1A 3B5EA 1QIIA 5L3QB 4W8GA 1C14A 1ECBA 4PC1A 4U2GA 1UADA 4Q4JA 3JQPA 4V39A 3K70B 2HJWA 3EIWA 1TT7A 1R3UA 2V74B 1AZLA 2A35A 4GLLA 4GM4A 2QROA 4LF8B 1N3YA 4TSFA 2D7JA 2VZEA 2VPZA 2PUCA 4QBFA 1I4LD 2V55B 3D5TA 5EPEA 4U7WA 4REQB 3D2BA 4YBZA 4YCMA 1TKRA 4PZCA 3HM2A 3QELA 4ARZA 1DRVA 4BEWA 1G18A 1QK4A 3L82B 5H59A 2REQB 3EEFA 2W4QA 3PQCA 1YWGO 2Y1WA 1M8KA 4ZGBA 1J56A 4RFLA 1R27A 1ZJ5A 1RXYA 4E5KA 1OHHA 1DJNA 1UPCA 3CV3A 3T54A 3QPBA 2J9RA 4K9SA 2OCDA 3QFTA 3B1XA 4TXHA 1J8FA 2PKYX 2ZI9A 2FTKE 4JVMA 3OQJA 2H7VA 2C20A 2XIQA 3FNQA 5JW6A 4YGXB 4L4YA 2VNKA 4M7RA 5B4UA 4HDMB 5EZYF 3B2NA 5GY7A 4E2FA 1K6MA 1UH5A 2OFWA 2HTEA 4ZI7A 3CR7A 1EJ0A 4OQLA 2DG2A 1B6RA 3HA2A 4H7IA 1MEEA 3GLKA 4IFBA 1GU7A 4S24A 3D59A 1DSSG 2O1EA 2RGBA 3DZBA 4GBMA 2H2DA 2W6NA 3VVLA 4A7PA 3U49A 3WYEA 1KRWA 3T7DA 4DG5A 3EC2A 3EG9A 3BM5A 1CP3A 2ZYGA 2M98A 4JDUA 1L5RA 1IQ0A 1PJZA 2XLCA 1P3JA 1VMEA 1WNTA 2DUWA 3G2QA 3QFSA 1VKNA 4JQOA 2R4TA 3OIUA 5AXAA 2J3IA 3EAFA 3P2IA 4KQCA 1ZBDA 2X0FA 1A2OA 2OHFA 3LT1A 1OYVA 4ND2A 2F59A 5TSDA 4E5MA 5K8CA 2WKPA 5EXDA 4I99A 4L9RA 1BZYA 1ORRA 2ZW9A 1IDN1 4W9NA 4WTOA 1I1HA 4YJ3B 4I3HA 3AERB 4AKTA 1EVYA 3HJUA 5J47A 2I9KA 3A7EA 3CZAA 3RGGA 4M1TA 1EHYA 4PPGA 3SHQA 3LC2O 3RC9A 1ML3A 4ZN6A 4CL2A 1UDWA 1B6GA 4TWIA 1ILEA 1UPBA 3MB5A 3IAXA 2P1DA 3QA9A 3A36A 3WADA 3KR0A 3RRBA 2J7PA 3Q8KA 5FTNA 2ZZMA 1VA5A 4LNUB 2ST1A 4GLOA 5ALFA 2X3UA 2OAGA 5KNBH 1KP2A 3I9FA 4AKHA 1E1CB 3ZDDA 1EM8B 3OH8A 4V0RA 1YOVB 1IQUA 2J6BA 2X15A 3CKMA 4P3YA 1PQPA 1R4ZA 2QV7A 3OEEA 2SICE 2WUEA 4BVLA 3W34A 5DLEA 1UBUS 3C0KA 3I4FA 5GONF 3BT7A 3JTEA 3D3WA 1LRLA 3DGEC 1F0KA 5F98A 2C5GA 2Z8YA 1VDZA 3KZ1E 3M4XA 1ZS9A 3NGXA 4PSKA 5HDQA 3KOYA 5CU7A 1HE2A 1U2DA 4F2DA 2P6RA 4JP5A 1I8TA 1XRJA 1M74A 1KZ9A 4KQ6A 1I7DA 4TUYF 2VP4A 5HVNA 4MIOA 1P1BA 2QRZA 3MXOA 4WASA 5JZSA 4NIMA 1MH1A 4NJMB 5EE9A 5K8JB 4CM4B 2G4CA 3FOBA 1CQPA 1FQKA 2NZXA 2OA0A 5CFNA 2Z2KA 4G0QA 2AC4A 3QE4A 5C1PA 3A28A 4MVJD 4EW6A 4IRXA 3BMCB 3BIXA 5G0UA 3RODA 5DNYB 4S05A 2BKAA 1GGNA 1YVRA 2EBFX 1ZDMA 2IHYA 2XVYA 3D8RA 3O74A 2UVQA 4RHXA 5DTJA 3E4DA 5FBQB 1H2HA 3HB4X 1N0WA 2Z4TA 4CDRA 2VTBA 2IUTA 5SYMA 4HPWA 1L5VA 5NULA 4DJ5X 1T35A 3A31A 3OPMA 3QUCA 4YBRA 5FPQA 2PXCA 4B31A 1W9MA 2I1WA 2Q27A 2D2XA 2WTAA 1J5PA 2G17A 3MTAA 3TSOA 4JOSA 2DB3A 2FPUA 1YC2A 2WHQA 4R9NA 3OF3A 1RAGA 3N3AC 3MSCA 3D7KA 2ZEJA 4R0VA 1WNFA 2P9CA 3C48A 5L9AA 1OE0A 2JF0A 4DY6A 3HRKA 5A5FA 1IHOA 5LD2B 3T35A 2FN4A 4K2AA 2VC2B 2VTDA 2ID9A 5EWJB 2OHHA 3ZCPA 1K6EA 1DIBA 2CXUA 1DQZA 1P7VA 2ZJ7A 5KCMA 3I52A 4M54A 1FU7A 1AD2A 3QYJA 4N3AA 4HNAA 5HFNA 5TS3A 3JPYA 2H8KA 4HGZA 3DJYA 1WPGA 1R66A 3TJZA 5ADUS 1Q0SA 1X8KA 1KP3A 3P5SA 3K0EA 2X3FA 4RD3A 1J24A 3U0BA 1U5CA 3QKSA 4NR0A 3ZU4A 1FP4A 1N5MA 3R6TA 4AWAA 1LS1A 4RLQA 1U8AA 1CE8A 1LK5A 2XKAA 4DYDA 2E48A 4TT8A 5JZMA 4XIIA 2HNBA 1YF3A 4X66B 1Z7BA 4MDHA 1TTQB 2V3CC 4KGDA 3AUYA 4L0DA 4EMTA 1Q0ZA 3A06A 3N6RA 3L6EA 1IIBA 4QU5A 2MDTA 1XNHA 3EJ6A 2JHCA 1GITA 3OUUA 4RZSA 2ORYA 1L5GB 4MI3A 4Y1EA 4AZ3B 4ND5A 4HWSA 5LQCA 3FVVA 4NAUA 3WBJA 3ZHCA 1E79D 1NF3A 2PWAA 3UV7A 4MV4A 4WBNA 2ZS7A 4ALKA 3QVGB 4Z0TA 2UUPA 4DJTA 4CEHB 3DQPA 1NUAA 3WLIA 2ONJA 2X0RA 3QY9A 3MILA 4LS3A 4YDHB 1RABA 2EFHB 2IUUA 1JQDA 2AN9A 3BWYA 4NH0A 3GEHA 5FTMA 2EJTA 4J6EA 3WBFA 2XCUA 3COZA 3ESBA 4PXAA 3QVOA 3SEZA 3WP1B 1FNMA 2ILTA 1DTWB 2CXHA 3JQAA 3QF7A 1ADCA 3T1QA 4JV5B 2WSSA 2IYFA 3BDVA 5TEVA 4NOJA 1USUA 3I3SR 2PUBA 4MW4A 3IAM1 4EYOA 2A9QA 1YCDA 2GA8A 3KQWA 4QBHA 2DF8A 4NCNA 4RZ3A 4OHKA 4DIEA 3WHIA 1IZYA 5BQ3A 3ROZA 4XVRA 4B3CA 5BXQC 2ZSEA 1ZPDA 4D0SA 4KE9A 4RKFA 2ETXA 3P19A 2V8OA 4N0MA 4X3PA 3ZGXA 3HA7A 3IUPA 1EEXB 3K5HA 3OZFA 4QNMA 1YDMA 2FG6C 3LY7A 4YECA 4G23A 3VR2A 1WDKA 2OENG 3BCHA 5IJ9A 2WJPA 3MBIA 3L1UA 5B1HA 3S7ZA 2R8ZA 4P93A 3ZS9A 4S2UA 2ZYHA 4M1QA 4RTNA 4Y30A 3TYXA 2DWQA 4X71A 3QUTA 3T5DA 3CMMA 5LKRA 5F77A 4LKRA 3I42A 1N8KA 3PUWA 4YAOA 3MHTA 1IXRC 4U2BA 5DCLA 2RHDA 3UKOA 3WYDA 2JLZA 2AA3A 2B21A 3KYDA 2VPPA 5CVUA 1TZCA 4N8SA 2GK4A 4JEHA 4OOEA 1D0IA 1WO8A 4RHYA 2QXUA 1J2UA 4WZAB 4EEZA 3J7AC 2QLFA 1AS0A 2YY5A 3P9PA 5CURA 2P75A 4C7BA 1XF1A 4EHBA 3EEBA 4KV7A 4P6VF 2BH2A 1IM8A 3F2IA 3QBEA 1ECPA 1SK8A 5L53A 1W47A 2GASA 3N5CA 3QM1A 1FP1D 2BZGA 3QX9A 2OBMA 4YALA 4WZBA 5DTQA 2QI9F 5FRDA 1KSGA 5A6VA 1ZZGA 3FLMA 4DT1A 4F0JA 3RFXA 5ITWA 2DHRA 4CM9D 1PT9A 4GX5A 5FI5A 3TR6A 3A05A 4X54A 2Q4TA 3JARB 4M9XA 2KS6A 4RIGA 4MS1B 2WPDA 5DW0A 4X1IB 2VSYA 3ILSA 4LMRA 721PA 3RW9A 4LYAA 4EHHA 1AKVA 1P17A 1XTQA 5ALIA 1P4GA 2IODA 1M1XB 5T3YA 4DBZA 2FZCA 4DV6B 3UMBA 4FJ1A 4NULA 3U7RA 3MQ2A 4Q3NA 1UBTS 5PNTA 4GD3Q 1FFXA 1YR7A 2CF6A 1B8PA 3EZNA 3HUTA 4N0QA 4CN8A 1LFDB 4CG2A 1U1GA 2HM7A 1EFRA 4INPA 4YQFA 3AHDA 1HDIA 1H6DA 4CKWA 2ANBA 1G9XA 1AUPA 5C5IA 3TQCA 4GL4A 2FWNA 1MGPA 2OCYC 4F1WA 4B34A 5CDUA 1JA0A 5GMOA 2EWWA 1UDXA 1O96B 2IYYA 3CH6A 4MV3A 4QEKA 3AEYA 4V0OA 4XTCS 1J2YA 2HUPA 3IAM6 4B75A 4BNXA 5BSHA 3H86A 3IEMA 2IYUA 3ZVNA 3MFYA 3BB3A 2XE7A 4UXHA 4XXHA 2VXOA 4HH3C 2VDWB 2V54A 4MSUA 1O5OA 4ZOLA 4DUYB 3L7IA 2FLVA 2H7XA 2H4XA 4J9VA 1C9MA 1KMHA 2WSYB 2GVZC 1O54A 1LBSA 3WQQA 1E2PA 4IF6A 1KNXA 3F2VA 4QSMA 5DI3B 4I4IA 1CLEA 1HFEL 1EESA 2II6A 3WKDA 1E2IA 2ECOA 2HJRA 3I9JA 4BVEA 1JXOA 4ESHA 3E9YA 2C2MA 4MVJM 1UT6A 4KLNA 3LTNC 1PZXA 4TTPA 5CDSA 1OVGA 1AXRA 3LPMA 4H3SA 4P33A 4ZOEA 5BQOA 1IEVA 4IQ4A 5KTOA 2VCHA 3L92A 4B6OA 5HIIA 1WU7A 4PANA 3WO1A 5JTTA 3MCUA 4GX1A 2B3DA 1NULA 4R1UA 5AICA 4NS1A 4M9CA 3WIOA 1TQ8A 4DLWA 4OUKX 4A92A 3P52A 1RWPA 3NBKA 4MQ4A 5G4LA 3SSAA 2XNHA 1OFUA 3FMVA 5DSZA 1OPXA 1O94A 1T8RA 4PG6A 1VE3A 2HREA 1YMUA 3RQSA 2TMDA 1J97A 4ML3A 2JI8A 4BTLA 4D82A 4F71A 3QOWA 2IV7A 3GLIA 2G71A 3LK6A 4BLTA 4HZIA 4YMHA 4HWGA 1YE5A 6REQA 1XD2B 3UG7A 1IBRA 2OC4A 3SYRA 1KDOA 5KTTA 3LL7A 1ZUHA 2CUZA 1RBQA 1LDGA 3FGPA 3W9BA 4ENTA 1YB5A 2X19A 1MAUA 4K88A 4DG9A 1W76A 1BOFA 4RYDA 1E2QA 4K2HA 3T9CA 4QXQA 3HABA 2V1XA 3P5BA 3CVYA 4S04A 2R86A 2YVUA 2BW0A 3FVTA 1L4MA 3GBVA 3LUCA 4ZKDA 5IJ0B 4M36A 4OQYA 3PCRB 4AMGA 2W42A 4IJQA 3DHNA 5EJAA 4PC6A 1SOVA 3V48A 2XYVA 4MDFA 2ZATA 1LTKA 3UMCA 2VP6A 1ZNYA 2W00A 3USES 2ADFA 3BCSA 1F8YA 1TKBA 3IVCA 2BY4A 2VIIA 2WKSA 2Y6UA 3IUQA 4WPGA 3WY9A 1P7YA 3ZCXA 1Q1QA 1M1NA 4E07A 4E3ZA 3JW8A 4GI3A 2BEWB 2D5LA 4PCAA 4CLDA 5C8ZA 4MW9A 2OAEA 4E03A 3SZGA 4FINA 4XJSA 2IS1A 3TEJA 5JAHA 2XYHA 1D0VA 4UTZA 3TR5A 2XAAA 4DDVA 3SCZA 3H11B 4BNTA 4I50B 1TC2A 5FUQA 6YASA 1NQUA 1HEUA 1QV7A 1WY7A 2ZJBA 2Y1EA 2X2FA 4Q4DA 1NU6A 2OPHA 3RKUA 3WHLA 2NV2B 4CWAA 4V1CB 2IYRA 3KHKA 3K2BA 3A8TA 3PDHA 4NSNA 1WG8A 4BS9A 5E9QA 2C2HA 5AIAA 5K2OA 4TM8A 1EP9A 3BSFA 4JK3A 3MCTA 5JS6A 3SSMA 1KMNA 1G2PA 1W25A 3GD5A 4UZSA 2BJHA 5DYWA 2QRQA 3TNDA 3L07A 2GCIA 2A92A 2B2CA 3GDOA 1QCDA 5D5HA 3LC0A 1RRPA 3A7DA 3F3YA 2W2TA 4KH1A 1CZOA 1M2HA 1FDOA 3G2IA 3WGNA 4C4AA 1O3YA 1REQA 2CDAA 2IY9A 1ZA2A 3RKSA 5BNTA 5JAIA 1T0UA 2RIRA 3K9BA 3KWMA 5FEMA 3AKEA 3U80A 1E63A 1G38A 2GTHA 4FFRA 3TLXA 3H1BA 1ZESA 1FVOA 1NRJB 1ZCJA 4JEIA 2XRZA 1HY3A 2PA3A 3P2EA 1GTG1 1RQ7A 4Z4CA 2JFWA 1J25A 2Q3EA 1WXGA 1EINA 5D5QA 3TL2A 2QZPA 3M6UA 1FDVA 5L3RA 3UATA 3RWMB 4TYYA 2VSNA 5ITVA 3ENZA 2YN0A 1PE0A 2OV6A 2JAUA 5CJ2A 5CH3A 1MDFA 3K94A 1BXKA 1QFSA 2HPVA 4UNSA 2OAP1 5IUKC 4AURA 4D6XA 1XMIA 1YVDA 2VK1A 4GPD1 5EIWA 1D9ZA 4TL8A 1W4BA 3RSOA 2C97A 3IL2A 1H93A 3IP6A 3ISVA 3LIIA 4JIGA 4P08A 3V7UA 1JSRA 4UBLA 1N9GA 3TKAA 4MUEA 1AQUA 2QD3A 4G4IA 2XV1A 1IB0A 3OM8A 5CYPA 4KXQA 3ZY5A 1AXGA 2EW8A 4Q7MB 3VA7A 2Z58A 1MIOA 2LNDA 3DP9A 1EXMA 3DZHA 3OE7D 3M4YA 5IN5A 3UY4A 4PINA 1PVOA 3W1VA 5CFPA 4E0BA 1FU8A 3MRSA 1K3UB 3V32A 2W6IA 2VFAA 4BO7A 2QMHA 5AP9A 3EGDB 2YOGA 4R1MA 2J0UB 3JPWA 4NENB 2PY6A 3ZE8A 3M5DA 3FYSA 4L1KA 2FXVA 3ORHA 2HB6A 2R87A 2VUSA 3HZRA 2HSEA 2OYSA 1NW4A 3ZU2A 4IH4A 9ABPA 2QS9A 2Q1XA 3IHKA 2IJGX 4DSUA 4Z54A 2A0WA 1PSWA 1WB6A 1VCHA 2FWJA 4W1PA 5KNDA 2FZEA 3DLCA 2QJWA 2XMSA 2PBFA 2VKTA 3D8UA 5EMNA 5IWCA 4P31A 1P1RA 1Y6RA 4FHGA 1OLOA 2IDZA 5KQPA 4HUQB 3B13B 3WZMA 2FFAA 1I5EA 4MW5A 4A15A 3DONA 2JEOA 4W63A 5B55A 3WLLA 4AYXA 3BRQA 4B44A 4FP9A 3MK31 1Y89A 4LDJA 2J41A 4ZVOA 2W5UA 3IUMA 3KPUA 3UPDA 1XJQA 2KLHA 2PZKA 1IY2A 3KOXA 4Y6OA 3TW8B 4DWVA 3UWSA 4ASUD 2O06A 5E9AA 3RTDA 1M8FA 5K3BA 2IHVA 5KYUB 4HNUA 2X8JA 4Z4EA 4WAUA 1P6XA 2DZDA 2OQIA 1C3EA 3DBHA 1DC7A 4Y0AA 1XXHB 3NM6B 5FL7D 4E2XA 1SUSA 2WP8J 3QFHA 3E7WA 1UKZA 1A9SA 3Q12A 2VJNA 4ZC1A 5GTDA 5L4SA 1IE3A 1Q3KA 1ZOSA 2GEBA 4E12A 1RWXA 2GUWA 2Y1CA 4IOMA 5GM1A 1NBEA 3EA0A 3IRVA 2CBZA 4RK4A 2AH5A 3DVLA 3LUJA 5HF5A 4GQAA 3WMEA 5IK2D 2PX0A 5IAEA 3CSDA 4FZVA 1TJ5A 1WPXA 3TEMA 2HQOA 3PZBA 2WAOA 3ZWPA 1E18A 3T95A 3VZRA 3ZJ4A 1OXSC 3JYHA 1V8DA 2GEUA 4OM7A 4WY2A 3W6UA 1T3GA 5LQNA 2O2DA 3N70A 4H1TA 1HM5A 2QMYA 3ZTTA 2FRXA 3KZNA 2W0MA 3W9YA 4EYGA 4P0QB 2DJIA 1RM0A 4WZZA 3WLNA 3ZGYA 1U5BB 3ROEA 5AW0A 2FSHA 3MJRA 3HEBA 1N0UA 1VHLA 1YJ5A 4KLZA 2VQFB 4PTLA 1Z2CA 1ZYUA 3BS4A 2YY6A 3PFCA 2QE7A 1FQOA 3B9QA 2B8TA 2IS4A 1E2DA 2YY7A 3AUJB 3SFVA 1UIMA 1W2GA 4NFYA 4N47A 3V8EA 1XTRA 2H00A 1PR6A 2PLNA 3P71T 4UAVA 5AQEA 5B2EA 3ADBA 3SI7A 2NN3C 2PSFA 4M2LA 2C57A 2Q3LA 5IF9A 3LECA 1HYHA 3U09A 3V2IA 4D3YA 1F8XA 4ZODA 5JMPA 3KVOA 3S29A 3IO5A 2QPTA 3ABQB 3HDYA 3LPAA 3OAAA 5BOVA 3REFA 4WSOA 3C5EA 4XWGA 4PLZA 1S1MA 4E08A 1HXHA 4R84A 1V4NA 4HWKA 2BI7A 2NLOA 3QG1A 4QNNA 4YV1A 4MUHA 1WXWA 4ZEXA 3UUWA 4KNWA 4BQOA 5DHAA 4CIWA 5D1NA 2Z9BA 4K7JA 5D3QA 4BO5A 2FMHA 3GMSA 5J1SB 4YUZA 2XGMA 5JSQA 3E4CA 5TQJA 3NV9A 3PGXA 2R6GA 2POQX 2X8AA 2QLNA 4MTCA 4XQ9A 1EAMA 1XL0A 4ATNA 1D09A 3KETA 3S3TA 1U1EA 4OAOA 2BONA 4NG5A 1ZITA 2QVZX 5ALVA 4FD3A 2Z04A 3NZEA 2Q2QA 3TECE 2FXIA 3QMVA 2AEMA 2VPWA 3QXSA 4B5LA 3DEYX 4BIIA 3RG8A 1IPFA 3VU9A 3LWZA 2AE1A 2XITA 3IMGA 3PI6A 2WWIA 4HKTA 3VU8A 2RE8A 3UAVA 5JADA 4ENPA 4FILA 3AWIA 4K9DA 4NL4H 5F78A 4AF6A 1Y6GA 4F45A 2WIGA 1ZW6A 1NR7A 2WSBA 3D2LA 3TLJA 3EW9A 4KR2A 3C8UA 1G1MA 3S8MA 5IARA 5B7PA 3FD8A 2WJZB 4YRZA 5J5AA 1D0SA 4DXDA 1GGMA 1TZ2A 4MW1A 1KFEB 1MGOA 3F6SA 3KFLA 5FDFA 2GKOA 2YWHA 3GGPA 5DNDA 1ZJJA 2O0MA 3ABIA 5AJHA 4OHXA 4EPVA 5KIAA 4RL6A 4M0KA 4OYYA 4DFDA 3VNVA 4DQVA 2Q1SA 5EIBC 4IVRA 5L4LA 3E7XA 3ZEAA 3OFVA 4F11A 1V5WA 5MFPA 1WSDA 2HOQA 1U7HA 5IUJC 1ZJYA 1CQJA 3JQ7B 5DNVA 3CNEA 1XYYA 4OSPA 1P5RA 1IB6A 5KJ6A 4O3FA 3BE4A 4OGGA 3LIPA 1QIDA 5ALUA 4ZQCB 2CFSA 4AMUA 1Q95A 5FD8A 2ZR0A 4BP1A 4DMGA 3E5RA 2QLBA 4KE8A 3HVUA 1J0EA 2EQAA 3UT6A 1NI3A 1X3SA 3AHCA 3HUDA 2J3KA 4FOLA 4PV7A 3RYHA 2W2LA 1USWA 4Q3DA 4RMNA 3GA7A 3VNQA 5FEUA 1PQWA 2ZR9A 3EZ2A 2FCAA 2VPYA 4NPAA 2R5NA 1L7QA 3HMQA 4B3DA 5SY4A 3KT6A 2P9BA 4N82A 5TVGA 3JR3A 1KQ3A 1NXSA 3H99A 3IFSA 3JQ9C 3L7LA 3OLVA 3KUKA 3OKFA 1LC0A 1YB6A 1QK5A 3E7FA 1KDZA 1ENYA 1EQAA 4FE4A 1XEXB 2CZCA 4EELA 1QYDA 2BYTA 1V8ZA 1IQPA 1LZLA 3JWEA 5G1OA 4CKCA 2O2SA 1II8A 5DBGA 1WCIA 3PX3A 4KG7A 4RZUA 3LQ1A 4ZYXA 2QLJA 1X7XB 1B0AA 2E4ZA 5I5GA 4UD6A 4O4HA 4BX9A 4BGEA 3TIVA 1EWKA 2Q3BA 1DLIA 1RQNA 4JASB 2EFGA 1RAHA 5AO9A 4OBXA 4AJOA 2P79A 3FOAA 1NXTA 1N5IA 2VEDA 4ZO4A 3GZNB 3IIJA 3EQ6A 4HB3A 4OQFA 4TVBA 4ZDJA 1N2XA 3IBSA 1U1DA 3CH5A 3O73A 2DM6A 4U0JA 4D0GA 5I4KA 2Q5OA 3TD2A 1Q0TA 4HVLA 2J3LA 4BV9A 4EX7A 2VJDA 2QN3A 4D25A 3KB2A 2E5LB 5BRJA 5TPZA 5DP1A 1A8QA 5AFSA 1TDJA 3ADOA 3EOZA 4KCGA 2XE6A 3C3BA 1FE8A 1JMVA 2YNMD 4M6WA 4ZD6A 1ISIA 2O3TA 5KPJA 3IE1A 2C5LA 2H1HA 3LBFA 1WSBA 1XKTA 3TDMA 1NNI1 4BO1A 5DYNA 4QO8A 3Q7TA 3V55A 4EY3A 2JIZD 1TEHA 2ABWA 4PLCA 1XPRA 2PQ2A 4D9IA 5A62A 2I62A 2C96A 2R2AA 1BE6A 4KHZA 2CLKB 4Y1FA 4EHKA 1CEEA 1KVRA 1QAQA 2CBGA 2NW6A 4N3CA 3H1AA 1XMJA 2UUAB 4WCVA 2ZVQX 1THTA 1GLNA 2HNAA 2NXWA 3OZCA 3QFCA 3NIFB 4AJJA 3ZHRA 5HUHA 1PX0A 1C50A 4EIWA 2OK7A 1XHFA 1X1BA 1SG6A 4OLBA 3P0EA 3L4BA 2X0EA 3G5MA 3RADC 2GN4A 4DMCA 5C3MA 3WGTA 1SIWA 5JH7A 5JZ9A 1IY8A 2ZKIA 3IXQA 3ET5A 3IEIA 4XSVA 3I2HA 1P4RA 1CWUA 1EUCA 4PFJA 2YCBA 1KI9A 4PHGA 5J58A 1M2KA 1IDOA 1VHDA 4Y1RA 1AT1A 1WPRA 1OA0A 2V5AA 2YZMA 2ZYRA 3ETJA 1ELOA 1UPUA 4ONEA 2GBGA 1NV8A 1D1TA 4RWZA 3LF1A 5C7OO 1DZIA 2Z1NA 3H83A 3RUHA 2CKMA 1YVPA 3L01A 4X60A 1KQPA 4Y2YA 4A82A 5C5EA 1N1GA 3DYVA 4KUEA 3RNOA 2JLUA 4FCCA 2FFHA 3G0GA 3GX1A 4XX0B 2FMXA 3N05A 4HNSA 1IN6A 2OCBA 3I28A 3MPUA 4RF4A 3OC0A 1KAMA 1SC6A 5DX0A 2Q5HA 2ZIWB 3AI3A 3RHSA 4ZHQA 2SECE 3AV3A 4KXXA 5HHTA 1BDIA 2JGDA 1MAHA 2RAFA 2FP4A 4U7TB 2J5BA 1P0PA 3K35A 2MR5A 1DJLA 1IULA 5A4KA 2WFAA 4LFAB 3QPCA 4Y2PA 3W90A 1AKWA 2EV9A 1JEQA 1FTWA 1ZRMA 2X23A 5LDGA 3AEUB 5CA0F 2IBSA 3DE5X 4NU5A 1SQ5A 4R2MA 7YASA 2SKCA 1TECE 4ENWA 3MB8A 3O8QA 4MB6A 3ZN2A 1DCKA 2ZRCA 4ZV9A 2HMWA 4F38A 3L84A 3B9RA 1ETHA 3KXIA 1U2ZA 1U2GC 2YV5A 5AI5A 2HSJA 4MWCA 5U4XA 2HHAA 1BFKA 5JPCA 1JG7A 2OSBA 1C4KA 1X14A 2ZIEA 3A9UA 2VAXA 3NW9A 1W88A 2RHTA 2Z3VA 1XA3A 4H7KA 4JLBA 4U1RA 5FV7A 5CXXA 1OTHA 3KKLA 3MTQA 5DPMA 1FUYB 3K53A 4NRDA 4L22A 2V7VA 4N54A 4ZO9A 1IC6A 4XI9A 3FZGA 1VZ2A 4FC7A 16PKA 4RZXA 1EXWA 4GKJB 4DDMA 4EVQA 3U1TA 3KBBA 2HT6A 3CNLA 2B78A 2W48A 3W5UA 3INYA 3DS8A 1VSUA 1UQUA 1YB2A 4NDNE 4OATA 3MMSA 4XCVA 2PS0A 5H0IA 5C31A 5JJLA 1QYCA 1GR1A 4FDUA 3TBHA 4YCNA 3CXUA 5BWCA 4NE2A 3HGQA 1DOAA 2IXAA 1AGRA 5M5BA 4A8HA 4GAEA 2NO4A 2FZ4A 2QTBA 3AJAA 2WLTA 2FSSA 5KNCA 1J4AA 1XMPA 4B76A 2QUKA 5EQFA 3BL8A 1Y8CA 1P0CA 2INGX 2GZ2A 2Q1UA 1U3UA 4HGNA 4G2NA 3H7AA 4W9RA 3KJHA 3MPOA 1PV2A 4TV8B 2XGGA 5D7NA 3SKYA 4NZOA 4YHHB 2ODAA 2Q5CA 3RYIB 1YDWA 1JRLA 3B5IA 1IK6A 1U8EA 3F78A 3I58A 4KFUA 4HEA1 4GBED 1HE1C 1G16A 3ROMA 4AZ0B 2Z1MA 4N41A 1QF6A 2FW6A 3G85A 3THYA 4OI0A 3C74A 1E2KA 2VP3A 3G2HA 2Z2IA 4LJ8A 2HCJB 4XWWA 3TLKA 4DCSA 5IJWA 3PGJA 1GO2A 221PA 1PR3A 2PSHA 3KEFA 3GIDA 5E2AA 1G21B 3MUEA 2GYWA 1QPZA 2CCJA 3VI3B 1M66A 2DMRA 1BFUA 2RONA 2B2NA 4HQ6A 1Y3BE 2DPYA 2HJSA 4HLNA 3B3JA 4B40A 1Z5NA 3FDZA 1K4MA 4E46A 2QRNA 1KO4A 5K8VA 1Y8RA 1SUEA 1XZNA 1PHRA 3AVYA 1QZ3A 1TMOA 5EJ2A 5GVSA 1XWWA 1FYEA 1DNPA 1QRAA 2P65A 3SBDA 1BFDA 3GRFA 3KKPA 4AXBA 1MRZA 1BOOA 1AUOA 1Z25A 2I6SA 1I4TD 3LWBA 5E1MA 1Z0DA 3ZWCA 1IXKA 4C0AC 5BPHA 2DLDA 2J0UA 4A73A 1WQ4A 1G7RA 1K9VF 2NU6A 1XAHA 4FLMA 4QRIA 5B3AA 5A05A 1TO6A 1L5HA 2IXDA 1PGPA 3WK6A 1CJUC 3QVXA 2BMJA 2V4UA 3K8QA 4X6YA 4UDYX 5KOYA 3O31A 3NWPA 3TTTA 3NASA 4YMWA 1OMOA 2VP9A 4OIMA 1L7NA 3LPCA 4L9WA 3D3JA 3KB8A 3P4XA 2GZDA 5M29A 2GJ9A 3U4QA 1JL3A 2HU8A 4MS4A 1NQXA 3MW8A 3WI7A 1NDHA 2WT4A 4JWKA 4QJ3A 3JVEA 3TLCA 4PYKA 1OI4A 4PAGA 3QBDA 4LJSA 1AO3A 3N6VA 3C6BA 3TLGA 1P44A 1AB5A 4DS3A 1IM2A 1UQTA 4ZJUA 4HTAA 3SQDA 3VU1A 1XLWA 3JQGB 1K5PA 1UDCA 4TLAA 1S1CA 1KU0A 5B6PA 1W52X 3MERA 3OLXA 4JLJA 3LFHA 3GB9A 2O8EB 2I2BA 2Z30A 1OYWA 3DDWA 3VC3A 3C70A 5H82A 3ZOKA 2IS2A 1EWRA 5MN6A 5CP8A 3DHYA 3ZHOA 5AT1A 1ZGZA 1HLPA 2GEKA 4AXXA 4YJ2A 1TM2A 5I8WA 2Q41A 2C4NA 2QN2A 1DI0A 1V2GA 2OG1A 1WSAA 2SKEA 2W6CX 5AUQA 5EKDA 5G4KA 4INAA 1QIJA 4QBGB 1IZ9A 1YB4A 3WNDA 1PNQA 3BWEA 4Y2RA 4YFVA 1P80A 2O3RA 3LP6A 3NBYC 2QTZA 3FTQA 2XWPA 1Z5GA 5KSOA 1ISGA 1MX3A 1TYAE 2XD4A 2XZTA 2Z5GA 4U02A 3AEQA 3AX6A 4ENVA 5D51S 5JPDA 9GPBA 2F4VB 4QXPA 3O2SB 1JKXA 1T1JA 1DFHA 1Y42X 1M6YA 1H4VB 2I33A 1NZDA 3QVKA 4NESA 4WN3A 4Z0HO 1HLGA 5BQPA 5TXGA 4OD0A 1JN0A 4E2ZA 5DVZA 1QTRA 3KALA 2FWMX 3DFMA 1QWSA 2R8YA 2A0YA 2PEYA 1E3TA 3M7IA 4NQZA 3S1AB 2B99A 4CLOB 1EMDA 4PC3A 4EFKA 5B1IA 5C46F 1EVLA 2WYVA 4HPJB 1KKLA 3D6AA 5AVOA 1N2HA 1T3HA 2Q4OA 1ACJA 2P2NA 3Q6NA 4O4JA 4N7JA 3SHVA 4D96A 3KXKA 4Z51A 1XC7A 2BKVA 3CKYA 4EPTA 2CFIA 2C7QA 2O2ZA 1BC5A 4Q3OA 4TLDA 3VKUA 2XHZA 4UCQA 2E9SA 2JBHA 1EK1A 3QZUA 5GP1A 1ZVVA 1H66A 3KQYA 3K92A 2NPIA 5A4IS 2UYGA 3IEKA 5IT5A 2WLSA 1EFPB 2EZ4A 5DIFA 4WUVA 1ULHA 2FFQA 3ZUPA 4C6HA 1K0UA 2UVPA 4G0ZA 4EUSA 2JVJA 2XLBA 1EDZA 1WULS 2QLMA 5IDQA 4PZ9A 4XQGA 3JQDA 1TIBA 1UZNA 4FFLA 3DE2X 4CKZA 4FKMA 5AVUA 4UM9B 1GPH1 1V47A 2ROQA 2W6QA 3OFNA 3RBZA 3MT8A 4ERNA 5J4KA 3UB4A 5REQA 5TMPA 7ABPA 3AG6A 5F1PA 2BELA 3B1WA 4DWOA 4HLCA 5JXHA 3OX3A 4YMIA 3NHSA 3VHXA 4DLBA 2H1FA 4GZ3A 2VA8A 3SS9X 4I4TB 3CBGA 3SVLA 3W7BA 5I45A 2WT9A 3JVDA 5KYKA 1BTOA 1S2MA 1A0OA 1JU3A 1FDIA 3GOQA 1K5GA 5ABPA 3D7RA 2ZU0C 4LJ6A 2YXNA 4DVJA 4FYXA 3M4ZA 3THRA 4BV8A 4PFQA 4UTNA 1QGUA 2JFVA 3RRJA 1OZGA 4UTXA 3GZTB 1AMOA 3QXJA 5LBTA 3TIGA 1XDBA 1XD8A 2WVJA 3FE2A 3E1KA 5CLGA 1FDRA 2PL3A 2GM3A 4BZZA 3FGZA 3PDIB 2V45A 4PZYA 5JDIA 2AOUA 2ZTVA 4S1NA 3ZGNA 4TMTA 2WINI 1KEEB 2K87A 4MB2A 3PE6A 4GNKA 3CRVA 1PQUA 1E3IA 3KZKA 5ALTA 1XYGA 1K08A 3A1WA 3CG0A 4BYGA 3QEKA 3L4JA 1E89A 5ALXA 3UJAA 5JSZB 1L5NA 5AD1A 5B6IA 3LXUX 1Y8QB 2R11A 3T3HA 4ZI2A 1RKUA 1WS6A 2AEFA 1VKHA 4GE3A 4QJIA 4XLZA 4XYBA 4YN3A 2O3SA 4HAXA 1M72A 3L8GA 4FXPA 4B2YA 2J4DA 3I53A 3SJUA 3INTA 2I4MA 5F51A 3WIEA 2I55A 4J7CA 2HMYB 3HKDB 2QSJA 1QUEA 3G23A 1SZJG 2Y0BA 2I03A 4L85A 2FFRA 3DEJA 3SSNA 3ZU6A 1RQRA 4YUXA 2HCRA 1GQRA 5F5XA 3K15A 4FMCB 4DUGD 4EB3A 4M8NE 5KO2A 1AIPA 4M1WA 3V9AA 4QATA 3ZJTA 4DABA 1GPAA 2Z09A 1F2DA 3KSBC 4UTOA 5IX8A 4JA2A 2FPLA 5CTJA 3W7AA 5BNWA 1X1TA 1V41E 2HA3A 4BQPA 1JDTA 3BOSA 2O8VA 5EMJA 4F6RA 3I9KA 3NU1A 3QVLA 3ZHVA 3OF2A 1QOPB 1PRYA 5DDIP 4CCYA 1HDOA 3PI7A 4JBYA 1ZD8A 4X1YB 1VM6A 2P3QA 2P4SA 4OOFA 3DTVD 5FULA 1TXGA 2BHLA 2YV4A 1DAKA 3G9QA 4O1HA 4BNFA 3UHAA 4C05A 2ATXA 3A4LA 1RWOA 1PGQA 2G5PA 3DVAA 4QUHA 3HSKA 3OJOA 5EXXA 2PU5A 4JJEA 2O2HA 4R1PA 1PLJA 2CB0A 1CUBA 1GZ7A 1N6HA 3H87A 4MJ7A 1Z5ZA 1JMKC 1MFPA 1QGAA 2RH4A 3A6ZA 2D1FA 3LC1O 1DOZA 1EP3B 3AUXA 4H7EA 1OLXB 2X5OA 3L7KA 1FB5A 5JG7A 5D3MA 1ZEJA 5TMBA 5FPKA 3CMCO 2B98A 1D2MA 4JJIA 4RK6A 1XZKA 3N0WA 4DDWA 7ADHA 4B9AA 2ZSAA 5CB0A 3DMRA 3FPFA 1QVAA 1KVSA 4FHFA 3CVUA 4GZ6A 2CJYA 1E8DA 4O4LB 1KI2A 3HKBA 3DM5A 4UU7A 5ALHA 1N5RA 3VJLA 3L0IB 4H7HA 4RACA 3U4DA 2L82A 4R8MA 1P31A 2ZVPX 3HVKA 4WLVA 4DQLA 5AW7A 2PUWA 2E89A 2XWSA 4FOTA 5EJ7A 2ETVA 4ILKA 4GFDA 3TG8A 3DB2A 2A4KA 3CNNA 1U1FA 3ABOB 3JQBA 1VHWA 3I6QA 1I2BA 1SEVA 3I2IA 4EDFA 1RC0A 1F6WA 1MOQA 1HDYA 4C14A 2M6RA 3RH0A 2Y05A 4CIAA 4B3FX 3GVXA 2FDCA 2QJRA 3REGA 2JBAA 2IDKA 1LV8A 1NZFA 2YHAA 3E48A 3SEQA 2IKSA 3PA6A 3DV9A 5IKMA 4KR6A 2JHFA 2ZRKA 3N74A 2OK8A 1C0LA 2Z2YA 1F8FA 3FOZA 1RIFA 2QXYA 3PJEA 1VP9A 4IIBA 2JD0A 3ZGOA 4D9BA 3L0ZA 3UCEA 1QG6A 2JHPA 1J0XO 1COZA 2XYGA 4JD5A 2B2XA 1S0UA 4TS1A 5CLLA 2ZAIA 4G85A 3FHLA 3UT0A 4MVYA 5E6SB 1L4NA 3B1ZA 3T3MB 1TLTA 2HWWA 3DTYA 2AOWA 2P4UA 3TZEA 3VKFA 1ZH6A 1R1DA 1OV6A 3L7MA 1G0OA 2WD9A 4FYJA 1I2MA 3II6X 4JUIA 3ZJYA 2J9FA 4N6NA 3ELBA