3ICQB

Karyopherin nuclear state
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
167
structure length
167
Chain Sequence
PTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGLEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exportin-T
publication title Structures of the tRNA export factor in the nuclear and cytosolic states
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Rna binding protein
total genus 43
structure length 167
sequence length 167
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3icqB00
4PO9A 4BWYA 2CDNA 2VHJA 1NN3A 1KSGA 2J9RA 1DAFA 5JRZA 5CJPA 3QPVA 3P4XA 4NYIR 3QKSA 1Z06A 5C1BA 2AKYA 4NHOA 3ZDQA 1KAOA 1W4BA 4BPBA 1YR9A 2F9MA 4JLVA 3CM0A 2DWOA 4GPTA 2W58A 3FKQA 4PHFA 3EWSA 1DELA 4LBYA 3ZQJA 4EPYA 4ZDKA 2XB4A 3K0CA 1ZIOA 3RSLA 4WZBE 1Z5ZA 2AFIE 2GCNA 3MFYA 3NKVA 2DB3A 1JB1A 4PFSA 3T1QA 4PAQA 2HV8A 4JLPA 1XPOA 2WSMA 1E79A 1CRPA 1IY2A 2IK8A 1KDRA 1K5GA 4O25A 1SVSA 4Z1MA 1UKEA 1Z6AA 2C9OA 2RGNA 3VKGA 4DHEA 1GILA 2ONJA 1ZM7A 2BEKA 2HCBA 4RD3A 4A6PA 2P6RA 4RD6A 1F2UB 2H8KA 1L4UA 4TLCA 5F2EA 4QHTA 2A78A 3BC1A 4CF7A 4NYJR 3KZ1E 1NVWQ 3SOPA 5GVSA 1XNJA 1OFHA 4G3XA 1KK3A 2CCKA 1XU4A 3GLIB 3P26A 5IF9A 1TAGA 1HURA 3LXRA 2QAJA 3BB1A 1NN1A 2NO1A 1L8QA 3H2YA 2LKCA 3LWNA 5EP4A 2OXRA 3MAAC 3EC2A 4MRNA 1ZIPA 3O8CA 1W36D 3U5ZB 2MSEB 2XSZA 5DYIA 3VNVA 1GKUB 4FN5A 4XD7D 4HEJA 4IHQA 1Q3TA 4DLRA 5TMPA 1YR7A 1JPNA 5FOTA 4M1OA 3RVBA 1CIPA 3AF4A 1QDEA 3ND8A 3WP0A 4IVRA 3LO5A 2CJWB 2IYYA 2ZAOA 2JLZA 4A36A 1XDBA 3LV8A 1F60A 3GLIA 3MWKA 2CHQA 4HLCA 1OXTA 4TT3D 2JCSA 1N5JA 4LJYA 4F4IA 2X1VA 1DVRA 4XWOA 1IOZA 4WVFA 4PPFA 2NPIA 4WZ6A 5FPKA 3L82B 4DCSA 3N2IA 3GLIE 3KQLA 3OFND 4WXRA 2MSDB 1ZCBA 4MYTA 4B6EA 4KI0A 1WMSA 1H8HA 4AKEA 3MUFA 2VIIA 2CHVA 2GJ8A 2WSSD 3GEEA 1QVAA 1RIFA 3VX3A 1KK1A 3FFAA 3I8XA 3T5GA 1TU4A 2OAQ1 2BCJQ 4A0HA 3ZS9A 3EZ7A 3KTAB 1TUIA 4DJTA 2CJWA 4JLKA 1OIXA 1KO8A 4F7WA 4JLNA 5ELXA 2F7SA 3FPAA 3DKVA 5LB4A 1ANKA 1GWNA 1TF7A 2OE2A 4ZIRB 4TLEA 3VR5A 1OH6A 1X86B 3OIVA 3FYHA 4YONB 1XJQA 4C2TA 5L3VA 2W2TA 4TMVA 3FGNA 1GL7A 4HUTA 2EFDB 1E32A 1M2OB 4KFSA 3F3YA 4LGMA 4MKIA 2EVWX 1MRNA 2GDJA 4TQUS 2ANCA 1C1YA 1KDPA 3K53A 5FBQB 3VFDA 4BE7B 3RRNA 4KAXA 3PENA 3UANA 1KY2A 5ANRB 1GNPA 1T3HA 2F6RA 1NSTA 1XTQA 2ZRPA 5JWOA 4C2UA 4GI7A 3KTAA 1E9BA 1SVLA 3NBZC 4ITRC 3AUYA 1G3RA 2FFQA 4LRWA 5EZ6B 3AP3A 4PHTA 3GEHA 2GVDC 2ONKA 5IK2A 4B74A 2J5XA 1EXMA 2VP4A 5H70A 4NCHA 2FEOA 3BE4A 3IGFA 3EWAA 2PZGA 3RSOA 2QROA 4LPSA 4DDVA 1W2GA 4F4CA 3CW2A 4LBZA 1N6HA 1Z0IA 4LV5B 3CNNA 4A15A 1S1CA 4Q1AA 1N25A 1XMVA 2ODEA 1DBSA 1G5TA 1EFCA 3MSXA 5FOSA 3EC1A 1RKBA 2REOA 2XNDD 1N6RA 4YXWA 4K81B 1EWRA 3THWA 1SKQA 1ZM2A 3U44B 1II8A 3ADDA 2WPDD 1HA3A 2UZIR 3LH5A 4OI4A 1XTKA 5IDVA 5TVKA 3K0CC 3OEHD 5L3SB 2ZROA 1Z47A 4YC7A 3UG6A 4N3NA 1W4AA 4D0LB 1VECA 5FTKA 3AGQA 4US1R 2D62A 4M1YA 1S9HA 2D4HA 3NDPA 2GK7A 2IS6A 2EW1A 2IYSA 4CZ2A 2RGNC 1EK0A 2DHRA 4W5JA 4TT3A 2YC2C 4KFRA 4PAMA 1RJ9B 3C4JA 4TLBA 2IT1A 3RANA 3MWYW 3QENA 4JBWA 3PXGA 3W34A 2O8EB 4M2LA 5JBQA 3I4LA 3U44A 1RZ3A 3MMPA 2OCPA 3OFNA 1AS3A 2IYZA 5HKKD 1G8GA 4XJXA 1ZYUA 1U9IA 4LC0A 4B76A 4XVQA 3EG5A 2R6DA 1C9KA 5L3SA 3QXJA 2ZE5A 4QG7A 1ESMA 5E7MA 4MGZR 4A2WA 5K8LA 2WVJA 1WE2A 2V1UA 5J4YA 4C4PA 1HYQA 1DARA 4JVNA 4RZUA 5AK0A 2QEQA 3TBKA 1PUJA 3WRXC 2XB2A 2FF7A 2CMKA 1VCOA 2XOKA 2ZITA 2QE7A 4FMCB 3IHLA 3BRWD 4IVPA 4PR0A 4V0NA 1G41A 1OFIA 5CIQA 1KJYA 2P67A 2CVHA 2G3YA 2QUZA 4DLSA 4RZ3A 1B0UA 1LTQA 3CPJB 5B2ZA 3KJGA 3TVTA 1X8KA 2XJ4A 1WF3A 4PO8A 4DXAA 4B2PA 1U90A 4OK6A 2OBLA 4AWXA 4IKEA 1R5BA 2HJVA 4UXHA 3UWOA 4HUQB 3QF4B 3RS2A 2P5SA 2HYIC 3X1YA 4MYHA 1TADA 4O2RA 3DOFA 3PITA 1SGWA 3GJ0A 4HB3A 4I4LA 5DH9A 1Z63A 1JI0A 2WTUA 2B92A 2GJAA 1BYUA 2QN6A 4Y0VA 3SJCA 3ZZUA 3U6KA 1UKYA 2G9NA 1NIJA 2D2FA 1IBRA 3WRYC 3EAQA 2WWHA 3HU3A 1SVWA 1DAKA 2AWNA 4KBGA 1P60A 2ZVPX 3DL0A 3NBYC 5EXXA 3CBQA 3I62A 1AGRA 4C0SA 4URWR 2PZFA 2YHSA 1WBDA 5DO9A 1I4LD 1P2SA 2ZUCA 3KKNA 4W9MC 2QSZA 1XTJA 4YMTA 4XSHA 3O8RA 1KIMA 1U98A 1T5LA 4OQXA 4PSKA 3LXXA 3WNBA 1TNDA 3EPJA 3AVTA 2NOAA 3OHMA 1SXJB 3CNLA 3GMTA 2PEYA 4HUQA 2GXQA 3VHXA 2NQ2C 1P7CA 1JR6A 4OBEA 2EYQA 4URZR 4FI3C 4QM6A 5E7JA 1IHUA 2RGAA 3QI2A 4KFUA 3KUDA 3HYTA 4PX9A 2G1KA 2J46A 2JATA 4JLBA 3OEHA 4LCBA 5KSZA 2FWRA 3TR5A 3GCGA 4A6XA 3KQKA 1UBGA 1Q1BA 2H57A 1AQYA 1XB2A 1XWIA 3LW7A 3O8BA 2VP9A 1VIAA 4M1TA 3TQCA 1X8LA 1GUAA 3PEVA 1P2TA 4DCNA 5EP1A 3D3QA 4M1MA 2GCPA 1ZINA 3HU2A 1YZTA 4AG6A 1GSIA 5FBLB 1SXJA 1F5NA 1XEWY 2PJRA 4L16A 5HE9A 1GKYA 2A5DA 2O0HA 1KK0A 3K70B 3SE0A 2Z6VA 4B3BA 1OYYA 2R6AA 1F3OA 5HKKA 2B7CA 1VHLA 3BERA 4JBXA 5BYJA 1HUQA 5CB6A 3K8YA 1SULA 2ZSBA 1SXJE 1VYUA 1R7RA 2I3BA 5L3RA 5GADl 4AC9A 5JHGB 4TN1A 1VG0B 2BJVA 3CB4A 3K0EA 3SBDA 4Q1FA 3B8HA 4HLUA 3FMIA 4UKDA 3QF7A 5KHOC 5BQ5A 2ZRCA 4OJQA 3ZIAA 4YMVA 2CCJA 4GSYA 2GXUA 3KX2A 1T91A 1W36C 4G5QA 2P0EA 4AKGA 4DSNA 1GRNA 2DWPA 2GF9A 4DLVA 3FKSD 1RRGA 3U6BA 1JXMA 4C0KA 5JLJA 4MRPA 3T1TA 1KI8A 2D06A 4DLUA 2BDTA 4OK5A 3C5CA 1CBUA 2FFAA 1SHKA 2ZR9A 4BRWA 4C9BA 4DEXA 1KGDA 2VP6A 4G1UC 2ZJAA 4ZDJA 2QNRA 1G1MA 5GJVC 2XEXA 3K0AA 1C4OA 1XEWX 1U0LA 1ZU4A 5TARA 4OJKA 4CYMA 4C30A 5CITA 1U9IC 1M7GA 1W0JA 2V4ZA 3BORA 3B82A 4JLOA 5FTMA 1MO5A 4Q7KA 821PA 1GM5A 2ZS8A 2J7PD 1COWD 2ZU0C 4B71A 2Z4SA 3R9XA 4L8GA 3DM9B 4ACBA 2RGCA 2E87A 3EA0A 5FUYA 3TQFA 5G3ZA 3ASZA 5JWRA 2H18A 4OK3A 3WBKA 4YMWA 1NRJB 3KQUA 4UNPA 4JS0A 1BYIA 1SVMA 5HTKA 2ZRKA 3NHAA 1NBME 4C0HA 3EZ2A 2FPLA 3E2IA 3QE0A 4Q9HA 2KBFA 4U5XA 3OZXA 4UXJA 3AVOA 4MA4A 4RD1A 5B58C 1UM8A 1JR3A 4DLWA 1XD9A 1E2KA 5GJBA 1E0SA 1Q3HA 1S8FA 4GP7A 4JT2A 4LUCA 2J7KA 4OYHA 5JI3E 1CS4C 4F91B 2N46A 4B47A 1HEIA 3ADKA 3FMFA 4WZAE 3D8BA 2VRWA 4H1UA 4JVLA 1JR3E 2ODNA 3ASYA 4MITA 4Q4HB 4IOJA 2ZJBA 4EPWA 3GFPA 2OXCA 4EFMA 2J0QA 5FUXA 4TMXA 1XJ0A 2IS4A 4BLQA 2FFBA 3TUJC 3WY9A 3UATA 4CVNA 1G3IA 2OFWA 3DEFA 2AD5A 3AH8A 4DKXA 1DE0A 2W6JD 2YC4C 1AK2A 1ZUIA 4MQBA 3DZDA 3BB4A 1ZM3A 2C9CA 1JEDA 2JLWA 4DUGD 2CL7X 121PA 5EXSA 3B1YA 4DSUA 3IKJA 3UMSA 1KI7A 1W44A 2HT1A 5JWHA 3REFA 1NMXA 2V9PA 1NSFA 4Q7MB 4HB0A 4Q4HA 3ZLJA 2CHGA 4X8OA 3NWJA 3BK7A 4LJ7A 3WYGA 4MRVA 1QBKC 3CIOA 3RYTC 1Q20A 3AP1A 4FMBB 4NZYA 3NHBA 3QQ5A 3UKDA 4ZV4A 5JZVA 4C7OA 3TJZA 1AZSC 2QPOA 4US0R 2DFNA 3A36A 4TYPA 2AN9A 5CJ2A 1NNEA 2FX3A 3EW9A 3FKSA 1OIVA 1DO2A 1ZCAA 5CB8A 1OH5A 3IIJA 4ESVA 1SVOA 3MJHA 3PUVA 1D6JA 5AJWA 2IA5A 3OIUA 2OG2A 1ZAKA 4L15A 2UKDA 3U7GA 4ON9A 3KFXA 4KYIB 3KL4A 4BLSA 5EE5B 4ZO4A 1YR8A 2PT7A 4PPNA 2J0VA 2VHQA 1W49A 1SXJC 4BFWA 2YKGA 1EFRD 2XITA 4KFTA 4MRSA 2ZQ5A 4DZZA 1N6NA 4OHXA 2YWGA 3EPLA 1P9RA 4UNRA 3WHKA 3CONA 4C0JA 1X8JA 4FCVA 2JJ1A 4ABYA 2GWHA 5KSPA 3F5FA 2Q3HA 4QC2A 1LF0A 4UNQA 2AKAB 3K9NA 4EPRA 3I61A 2ZSEA 3LA6A 4Q9JA 2GJ9A 2J0UB 2ZE7A 5FR2A 2ZRGA 4IDPA 5B57C 4KLZA 1PZNA 4TTPA 3BH7A 2FNAA 2IEZA 2ZJOA 2J45A 1JPJA 3B60A 4Q1BA 4KU4A 2FSIA 4RKEA 1DAMA 5P21A 3VHLB 2AWOA 3LLMA 4NDZA 2HF8A 4DDWA 3B9PA 1UBCA 1XEXB 4QJ3A 1ZNXA 1G64A 1NF3A 4YDSA 2RGXA 3UXMA 2CL0X 2EU8A 4P4TA 5CM8B 2QA5A 3BB3A 2H16A 1ZUNB 5SZKB 3TKLA 4HDCA 2BMFA 1E9DA 5FH9A 4ZI2A 5KNCA 2NG1A 1K6MA 4JLAA 2H1LA 4TMKA 1G5RA 1GZSA 2BIFA 5DHFA 2J0UA 1US8B 1R8SA 2WKRA 3T15A 3KXKA 1XP8A 1W0KD 4JMPA 4DCUA 4ZCLA 1VMAA 3CKLA 2JLSA 4D4JA 1KY3A 1XCPA 3TGPA 2Q0HA 1R8QA 1E2GA 4D80A 4DLTA 4BFYA 1XD8A 4HSEA 1UDWA 2IYXA 2X2EA 4Z8YA 1NLYA 2JDIA 2V55B 1AGPA 4NYMQ 1YU9A 5DE3A 3OEEA 5EJEA 2F9LA 2GF0A 3RS7A 1AN0A 3T1OA 3IPXA 1G17A 1ZNYA 3Q3JB 4EUNA 1Z6XA 2XTMA 3JZMA 4OL0A 5D3MB 1JQJC 3EARA 3B6EA 4LC1A 1OKKD 1G3MA 4BZQA 3VR3A 2ASEA 2WJYA 2QTFA 1W5TA 4TSFD 4LHYA 3X1DA 2YOFA 2FZLA 3CRRA 2NZ8A 3AVWA 3P4YA 3TVDA 4L9SA 4QGFA 1Z0KA 4Q21A 4C3ZA 4U00A 4Z54A 5JRJA 2DWQA 3PQCA 4HATA 5A4JA 4HAUA 1S1MA 1TEXA 1IN4A 3NDBB 5FI1B 5EQTA 5JCPA 3FMOB 2ATXA 5D3MA 3ADBA 1NN5A 4Q01A 2W2XA 2WOJA 4NONA 1I2DA 3ZD6A 3PVSA 1FQJA 2VYFA 2O8CB 4D6PA 5EXTA 1A5TA 2QPTA 1XJCA 2YWEA 1MABB 2ZRMA 1E2FA 1AM4D 3OAAD 3I5YA 4G5GA 1EFHA 3WNDA 1HE1C 2DPXA 4LYJA 3W3AA 3AVUA 3Q72A 3B1ZA 1E9RA 2C95A 1UJ2A 2CBZA 4Q4JB 4LOAA 1W4CA 1R0ZA 1LB1B 1XRJA 2W0MA 3IILA 4MYCA 3CRVA 2MMGA 3ZJYA 4CGZA 2W2VA 3AF0A 4G5SA 1QHIA 4JSTA 1E0KA 4B3DA 1QHYA 3CF6R 1KDTA 1YRAA 1PLLA 4E5UA 5DLQC 1N6OA 1E9SA 2QENA 2O8CA 3CZPA 2JJ8A 1ONBA 2KWIA 1E9CA 3EZ6A 3TSWA 1MABA 3UWKA 2EWWA 1I4DD 1P9WA 1XPUA 1NG1A 3IPYA 4LJ5A 1BKDR 1HT1E 3W9YA 1Y3AA 1OJLA 5BW8A 4HDQB 3G82C 1OT3A 4PQYA 1T4GA 1HTWA 521PA 4DIDA 4Q4JA 2EFEB 3QG5A 1E1RA 2ZI4A 3N5CA 1LVGA 4ASUD 1N2CE 1W0KA 4J0QA 1G6HA 2QM7A 3QXCA 2A5FA 3PUYA 4Q19A 2ZIAA 5EUMA 3CLVA 4CIDA 2WJJA 3E70C 1IN5A 3KJEA 4IDNA 4NMMA 3SU8A 3UMRA 2CK3A 1CRQA 2GEDA 4TYWA 2YVUA 4IXMA 1II0A 3OE7A 3LFUA 5FOUA 3CH5A 1VHTA 4MYUA 1Z2AA 2HDNB 4C0AC 3FHCB 4BRUA 2VHUA 2FGJA 5M04A 3AQ4A 1FZQA 4Z51A 1FW6A 2HF9A 3W90A 1G19A 4MKGA 2QMOA 2QL6A 2QQEA 2ZRLA 2VHTA 2NTYC 3RWOA 4H1VA 1MRSA 2R65A 5KU1A 4OQFA 4TL9A 4IFEA 3TAUA 3B1VA 1B23P 3RC8A 1TX4B 4LHXA 1TF5A 1U0JA 3SYKA 1ZW6A 2V6IA 2FA9A 4A1FA 2JEOA 4AYTA 1BMFA 2B7BA 4FWTA 1Q0UA 4GOJA 2WWXA 1D9XA 2VP5A 2ZUBA 1FQKA 4TMWA 4XWAA 5KPJA 2ZI5A 4LI0A 5AJYA 5F9HA 1NMZA 2WMNB 3RC3A 4A82A 4FCWA 3UPUA 1WA5A 2A3RA 3B1WA 3PUXA 5G40A 1M34E 1Q57A 1OB5A 1XXHA 1ZMXA 2MSCB 5JCZA 1M7HA 1QHHA 3L8YA 5GVRA 3VMFA 4E22A 3RDPA 4NP6A 1KHTA 2OILA 1IJFA 1Z83A 1KYIA 1KO7A 1IN8A 2A7QA 4CEJB 1XXHE 3OAAA 1ZM9A 2ZTSA 4R71A 1VYTA 2W6ID 3WMEA 4XIGS 1KNXA 4WW0A 1CLUA 3U3MA 3THWB 1II8B 4DSTA 1JNYA 4ZCIA 1VG8A 5JHHB 1W36B 3SHWA 5K8TA 1S96A 3A1WA 3C8UA 3KKMA 2ZPTX 3WMFA 4LDJA 1PVOA 2GEUA 3IEVA 3FWYA 2V6JA 3GP8A 2RHDA 1SKYB 2J41A 3T12A 1D2NA 5JFGA 1GP2A 3EZFA 4MKHA 4O2LA 1P75A 3W3ZB 3D31A 3IDQA 4TYQA 4WAUA 2VA8A 2GK6A 2QMEA 4P4SA 4DB2A 3OF5A 3AM1A 4V0LA 4B2LA 1NKTA 4CEJA 1GAJA 3IIMA 2V1XA 3U7FB 1EFUA 3U7HB 1LFDB 1R0XA 5TXGA 5KPDA 2EFHB 4MUAA 3I8SA 4TQ9A 5AUNB 1YZLA 1OLOA 3H86A 4NCKA 5LB2A 2I1QA 3CRQA 3L0SA 4OQLA 1CXZA 2F1HA 4ZKEA 1N3BA 3W5IA 2V7QD 1Z6TA 4XD7A 1UBFA 3TAHA 5HZHA 5JI2E 2P3SA 1OB2A 5DN6D 3BH0A 3RABA 2GZDA 3GFTA 4EQ6B 1U8YA 1Z22A 3REGA 4RKFA 1UEJA 4Q9LA 4B3GA 3DKPA 3MCAA 4M9QA 3QKUA 1WCV1 2H17A 4E09A 1SVKA 1H8ED 2JGNA 4M8NE 2R62A 4LJ4A 3MLEA 1SKYE 5CYOA 1LW7A 3QKTA 1AA9A 1E9FA 4D4LA 4PANA 4DRZA 1M8PA 3R20A 3GLGB 1IN7A 4QGAA 4QNMA 3S1AB 4BFXA 4M0LA 4R9UC 4PSAA 2PZEA 4BZXA 3ICQB 3SJBA 4NKRA 1KSFX 2BMDA 3SN6A 3VR1A 1JECA 4F92B 3AVQA 3TLXA 2WSSA 1KI4A 1KKLA 4EQ6A 1G5PA 3PEUA 4NYIQ 5A0FA 2ORVA 4O3MA 3E5HA 4QRHA 3AVPA 1N0VC 3PG5A 1ZNZA 2REBA 2XAUA 3ZQ6A 4IDOA 1G21E 1YJ5A 2CEAA 5TY0A 2ZRHA 2GJSA 4HAXA 3B13B 4M22A 2J87A 4KVGA 4V0MA 4F38A 4GDFA 1N5IA 4TWZA 2IUSA 1N6PA 4LV6A 4Q7JB 3GJ5A 3BBPA 4FMDB 5AJXA 4S2EA 3CR7A 3B78A 2IXGA 2HXYA 1KDOA 1ESNA 2YWFA 3GLGA 3K9GA 3S1AA 4IOLA 2V3CC 3TR0A 2B8TA 3FTQA 1W48A 5GJWC 4AI6A 4V0ME 1HQYE 2GAOA 1D2MA 4TTRA 1XBTA 4DC9A 5EE0A 2A5GA 5AUQA 1E4VA 3GLGE 4TZ0A 1Z0AA 3A58B 4XVRA 2J3EA 5CYPA 1KI2A 1YZNA 1VG1A 2IS2A 2BHRA 3IIKA 1DAHA 1Z8FA 2GVZC 4NYJQ 5DYGA 5FR1A 3CWQA 3WYFA 3GJ4A 3OESA 4X8MA 1KAGA 2GXSA 2OCYC 4LJ6A 1G20E 4B2IA 1LY1A 4TMZA 4A0GA 3SFZA 4NE2A 1JXOA 1H65A 1EESA 5FUWA 2CE2X 2GKSA 4LY6A 5AUOB 1RRCA 2OCBA 4AKHA 1E0JA 2WBLC 4M9ZA 4A2PA 2FH5B 3GJXC 2O8BB 1Z2CA 1U8ZA 2IYRA 2XNDA 2DFKB 2ZJ2A 3LNCA 3QY0A 1U94A 4KXFB 5H68A 2ZI9A 2PL3A 4OI0A 3THYA 2PMKA 2ZE6A 1XPRA 2WPDA 4DSOA 3EIEA 2WAXA 4MRRA 1MOZA 1TEVA 1YZGA 1T3LA 3GJ6A 3GEIA 2VSOA 4OI2A 3Q9LA 4NH0A 3TIFA 3NVAA 4Q4AB 1LS1A 3D7MA 3C16C 4BFTA 2F3TA 2X8AA 5AJVB 4BEBA 2OUKA 3CPEA 1R10A 5LDDC 2AHOA 2ORWA 2ZJZA 4R98A 3I73A 4RJLA 1CEEA 3GQBA 1WB9A 2QQ0A 4Q1EA 1TU3A 3DMNA 4FINA 3N2EA 3DO6A 1L4YA 1GL6A 3AF2A 5AR1A 2QAGB 2O8BA 3H4MA 4NCIA 3F8TA 4LJAA 5IRCD 1MV5A 1XCMA 2O5VA 3AF1A 1ODFA 2VEDA 2IHBA 2ZS7A 2WV9A 5JSZB 621PA 5CK5A 3A1TA 3HR8A 3B9QA 2QMHA 1T0JB 2IX3A 5AJZA 2D7CA 3A1VA 2IYVA 4Q5IA 4Q4AA 1QRAA 1QHSA 4QL3A 3U4QB 4TYYA 3K0AB 3VU9A 2F43B 3I3SR 3T61A 3SYNA 2AK3A 1P9NA 4MGIR 1F48A 4AY2A 1E96A 1NY5A 1FUUA 3WXMA 4OQMA 1A82A 2XZPA 4ZPXA 2JLUA 3NEJA 2AFHE 1TMKA 2ZRBA 4KO8A 4KODA 1MO6A 1YHNA 2X77A 4A9AA 5JEDA 4JLDA 2QAGA 4AIIA 1U99A 3BFVA 4A0RA 3L2OB 3QPUA 4RZXA 2VL7A 4EDHA 4A8JB 1TQ2A 2R8RA 1YE8A 2H5EA 1OV4A 1PUIA 1Z07A 1Z0FA 2YOHA 2IWRA 5JSZA 1G6OA 4JSYA 2H92A 1GITA 3QEOA 3QVVA 2WHXA 1IY1A 3QOFA 5F3WB 4B35A 2LWIA 2ZSFA 2ODBA 4M1SA 4ERNA 4GL2A 1UEIA 1LF5A 2HLDD 4CT5A 3VTKA 4B73A 1Q22A 3SEAA 3QNUA 3U4QA 1XX6A 3SDZA 2F43A 4D26A 5KNBA 3VR6A 3PEWA 1OXUA 4PQFA 3EZ9A 2G77B 2KSQA 2F3RA 1TQ6A 3UG7A 3ETLA 1II9A 2ZE8A 2P6UA 1P61B 2JLYA 4CW7A 4DVGA 2QT0A 4FMCF 3B2EA 3K0FA 4R2HA 4TLAA 2NO0A 2AXPA 2QI9C 3PJRA 4A8JA 1A4RA 4LJ8A 5J4KA 1E1QD 1NVVR 1QHXA 3H1TA 3CRMA 1IN6A 4KSBA 4B48A 5HPYB 2ZYVX 4GNKA 2DR3A 3A4MA 2OV2A 3PV0A 1NP6A 1FPMA 5SZHB 1EX6A 1Q1ZA 2ANBA 3IUYA 4M9SA 1OFTA 2XTZA 2C03A 4JYCA 3UIEA 4IDHA 4HB4A 1G4AE 4DLXA 1J2JA 3THXB 3A37A 4XH9B 2WKQA 5BYKA 4A4DA 2XZOA 4NL4H 2B6HA 2WWYA 2OFOA 1R5OA 4B3CA 1IONA 4W5WA 2OCAA 4URVR 4LYHA 2F1RA 4EPTA 1WXQA 3NC0C 5KSOA 1G7RA 4D0GA 2ZYUX 1KZ7B 3M0EA 5HZKA 1JBKA 1SHZA 5EE1A 1CJTC 2CXXA 4EAQA 5CDFA 4LHWA 1GRRA 3PUWA 4OHYA 1Z0DA 2GCOA 1NMYA 4HAZA 1FFHA 1QVRA 3EIQA 1E6CA 2PBRA 4C7OB 4PC7A 2JLRA 4GP6A 4D82A 3M6AA 2ZRIA 5BWMA 5CDFE 3L43A 3GLHB 5DI9A 3THXA 3X2SA 1OFUX 4OKSA 2GZHA 3HP1A 1OIWA 1DTSA 1XTSA 4EFLA 3KDSE 3DZ8A 3L8ZA 4O0MA 3FHTA 1UBEA 3QKRB 1IM2A 5CLLA 1FTSA 2ZJ5A 1ZC3A 3MWLA 1KSJA 4TLDA 5F98A 5J47A 3TSZA 3R8FA 2JIZD 3AVVA 1GDDA 4MDFA 5FFMA 1E2HA 1ZD8A 3VKWA 1ZC4A 4D2IA 2ZYWX 2OLKA 4II7A 5H1YA 1Q1EA 1RC8A 1RYHA 1UF9A 2ZUDA 3NH6A 3F0TA 1F6BA 1OHHD 3VR4A 3LBNA 3UK6A 4M1KA 1WDTA 4EJSB 1FP6A 2WWFA 1HE8B 1T8UA 2BWJA 5TB5A 2KE5A 1NN0A 4HB2A 2BBSA 4JT4A 5J4VA 1XTIA 1D2EA 2YOGA 2NO6A 1X3SA 5EE9A 1E3MA 2VSXA 3GLHA 3QEJA 4Q02A 3Q5DA 2ZJ8A 2HJGA 3NTUA 4IDQA 1HV8A 1XCGB 2PCJA 1W46A 2SHKA 3QKRA 3CO5A 1NL3A 221PA 1G8FA 3HWSA 3CF0A 4Q47A 1KTVA 3GLHE 1MR3F 5TDHA 5L3QB 4DT1B 2NZJA 2ZJYA 2X19A 2D3WA 4Z8XA 4HAWA 4K46A 4KLNA 1FMLA 1HT2E 2G1JA 2ZU6A 1DEKA 4X8LA 3TW4A 2XTNA 2X2FA 2ZSDA 3X1WA 2GBLA 1X1SA 4EJSA 5HCIA 1RRPA 3ZVNA 3PIRA 2QMUA 3OIWA 4KVAA 4L4UA 5FI0B 1AKYA 2IXFA 4EFNA 3ZZTA 4BUJA 4QBGB 4JJKA 2DFTA 2J7PA 1COWA 1K8RA 2G88A 3ND9A 1FNNA 2IYTA 2OT3B 5J4HA 5KO2A 5C18A 2ATVA 4LYAA 5FBRB 5K8UA 1OXXK 3CUEF 1UFQA 1A2KC 4KHZA 4PPGA 5C46F 1FOEB 2D2EA 2F1JA 3KB2A 1J8YF 1E4YA 2KJQA 3K1JA 1D8TA 1VKJA 4NPHA 3A4NA 5KTYA 3HDTA 3L0IB 2KB0A 3HYRA 3U2QA 3BS4A 3HR7A 1M74A 4MGKR 421PA 4BLRA 4DT1A 1NY6A 2QRZA 4XTRA 4URXR 2VH5R 4S35A 1CJVC 2QAGC 2FFHA 4FCTA 4V0KA 2AD1A 3SBEA 3T5DA 4BFSA 4LPKA 4AYXA 1MH1A 3NIBA 5FPTA 4F4JA 1ZP6A 4M21A 4JVMA 4Q48A 1RW4A 3Q5EA 5J40A 1N0UA 1E79D 1D9ZA 2BVNA 3CX8A 5FTLA 4PZZA 1E2PA 2EWVA 4Z1MD 2G0NA 1RVDA 2VO1A 2C78A 4HDOB 3HPRA 3T34A 2OESA 4OHWA 3W6OA 4DB4A 4GT1A 3TW8B 4CDGA 1AQUA 1KI1A 1OPXA 4Q18A 1R6BX 4Y0AA 3LDAA 4B3XA 1NG9A 1CR2A 1DG1G 3T1VA 2W6JA 4LBWA 3I5XA 1FMJA 4D4KA 4I1UA 4YMUA 3WMGA 4A8JC 2QY9A 1AIPA 1UKZA 1MKYA 1G291 4DUGA 4B32A 2GRJA 3QBTA 1HH4A 2YZ2A 4JYBA 4OHVA 1T6NA 1GTVA 1NLZA 1ETUA 4WBSA 5E7IA 3TK1A 1E9AA 5JECA 4RCZA 3RLFA 3KUCA 3U3JA 1XF9A 4U02A 4LZZA 5KNDA 2QT1A 5C4MA 1OHHA 2Q21A 3BGWA 1NVXQ 4JLMA 2IYUA 3PCRB 5K8IA 1XTRA 2ZI3A 4JBYA 4KBFA 3IQWA 2CE7A 2GHIA 1A7JA 2WKPA 2I4IA 1G7SA 3FOZA 2V8OA 2GEVA 5G53C 4GFDA 1PJRA 2BM1A 4LBVA 1E98A 4NU0A 1DG3A 4I1OA 1J90A 4PZYA 2ZRNA 1EFTA 2ZETA 4FWIB 4P0TA 1JALA 3BD9A 5BXQC 3ECCA 4RD4A 1OH7A 4GZLA 4N0DA 3ADCA 3C15C 4JVSB 4UNSA 3LBIA 3DDCA 5FPHA 3TUIC 3KJIA 1QHNA 2BCGY 1EFRA 4JZKA 1H8HD 1E9EA 3KKQA 4PZLA 3K9HA 3O8DA 4OHZA 4KCGA 1KMQA 2C77A 1BIFA 4HZUB 3QXSA 5G3YA 3SI7A 3BFXA 1U8AA 1CULC 2O52A 3P32A 4XTCS 1P73A 1EWQA 2CLDX 2FSFA 4A92A 1J99A 1ZVQA 3I1FA 2XX3A 5L8VA 1AS2A 1CJUC 4XSGA 2PLRA 3ZD7A 1JAHA 4V03A 1VTKA 3HPQA 2IS1A 4RFSB 2ZXUA 1X1RA 2BMJA 3V4RA 2ORIA 1ZUHA 2BEJA 1XD2B 5IHPA 4CEIB 3RS5A 1RE0A 3MWJA 3NBFA 1P4SA 1GNQA 1E2DA 2EQBA 2FZ4A 1JQLB 1VIYA 2D74A 3TSOA 1LS6A 2FGKA 1A2BA 2Y8EA 2BJWA 4HZUA 2XGJA 1ZM4A 2WAYA 3V00A 4BLOA 4CEHB 3P20A 2PLFA 3WBJA 2R6GA 2QZ4A 3IHWA 3IO3A 3CX7A 1N6KA 1J70A 5EE3A 3X1XA 5IK2D 1KO5A 4EKDA 1NJGA 1XMSA 1TTTA 2TMKA 2WWIA 2GBLC 4RFSA 1OH8A 4EJSC 2QGNA 4HLQB 2FEMA 2GJKA 1T9HA 3Q7PA 5BN3A 3GLFB 4C0QC 1XD2A 3JVVA 4CEIA 3LW8A 3D6TB 2Z83A 3SJZA 3BIFA 2H7VA 1KSHA 2E1RA 1J8MF 4ZI3A 2C99A 1EX7A 1P6XA 2R6CA 1D5CA 4TZ6A 5F9FA 5EP3A 1O3YA 2OSBA 1YQTA 4PAOA 4B3FX 1WBBA 3A1SA 3A1UA 4YXWD 4DCVA 2OAP1 4FW9A 1W1WA 2A2ZA 2RMKA 4UXIA 4CEHA 4GBMA 1RFLA 2FG5A 3GJ8A 5E95A 1GFIA 4P31A 1E2EA 1P5ZB 3QXXA 1OKKA 1XXHB 1Q21A 2J59A 4JKIA 3BXZA 1E2JA 1QHHB 3ZVLA 1VG9B 4DIEA 1G18A 2IC5A 4BFVA 5E4FA 1F2UA 1KO1A 3FE2A 1S3SA 3AF3A 2RGDA 4TSFA 2EFGA 3SC3A 3GLFA 4QM7A 3KB1A 4MH0R 1FTNA 3X1ZA 1S9DA 3KJHA 4BQSA 5J4LA 1QF9A 4AG5A 4DLYA 1OXVA 4C0LA 3L0OA 2ECKA 4AK9A 1DO0A 4UQOA 1JJ7A 3GLFE 1V5WA 1W2HA 5FOXA 2C04A 4Q03A 4QJ4A 3KXIA 4C0BA 3LAWA 5SZJA 3U61B 2Z43A 3QVUA 5DIFA 3QJYA 1UAAA 3B85A 1G3UA 2Z0MA 1G8PA 2IUTA 4FD2A 2G0TA 2FV8A 2LKDA 5J5CA 4D81A 2NMVA 2ZEJA 3AKCA 3Q7QA 3BWDD 3SR0A 4B6FA 4F93B 2V54A 4DDTA 3B5JA 3NXSA 4X8HA 1CP2A 4MUBA 4P4SB 4AD8A 1YR6A 2W83A 2WIBA 1YZQA 1JJVA 1Q12A 3T06B 1RYFA 2YWHA 5HCNA 2NGRA 3PR1A 4JKYA 2IWHA 2BC9A 5JJIA 4B33A 5SZIA 1EGAA 2BM0A 2XOKD 2BMEA 2CLCX 2IYWA 2QE7D 3IO5A 4PC1A 1UKVY 2J1LA 3DOEA 5EUQB 1TF2A 2C8VA 4BEJA 1VCMA 1CU1A 2RGEA 2G6BA 1E99A 1I4TD 3EXAA 1KJZA 2P65A 3VX4A 1XMIA 2O8FB 4P32A 2AXNA 2VHCA 4IW3B 1KJWA 5L3QA 1T5IA 2AL7A 1CJMA 2OEPA 2A9KA 1BS1A 8OHMA 3LQRA 2QM8A 2OHFA 3GD7A 2C9YA 3QBVA 4ZCMA 5LD2B 2W0SA 5DSZA 4N1AA 4B75A 3EPKA 2JLQA 2PH1A 2PMDA 4TMTA 1G8HA 2O0JA 4KITB 3AKEA 4ZIRA 1DAGA 1W5SA 4PHHA 2WZQA 1QHGA 3N70A 2B8WA 4ASUA 2HT6A 2Z4RA 3U3KA 1E94E 2QP4A 3G5UA 1RRFA 2OLJA 4WXPA 3LRPA 5FBVB 1BOFA 2EYUA 2HUPA 1IY0A 1OSNA 3L0PA 3ZH9B 3ZVRA 2Q9BA 2PJZA 4LHVA 1OW3B 4MGYR 4CT4B 2O8FA 1G3QA 2ZRJA 4JLJA 2I1VB 2FJUA 4FXPA 3LY5A 3NC1C 3ICEA 3SZRA 4LYFA 2DBYA 3C14C 2QPAA 2RHMA 3LVRE 1M6NA 2A30A 3GJ3A 3LX5A 2FOLA 4B44A 2YYZA 3AGPA 2VLIA 3M4YA 3CX6A 1E2LA 1KKMA 3K09A 4WA7A 4WIAA 5EP2A 3RS4A 3RAPR 1IJEA 5G41A 1NJFA 4TL7A 1G16A 4V0OA 2A5JA 5CM9C 3W6NA 4LK2A 5LBIA 5JEEA 3EX7C 2ZAMA 2Q6TA 3K9LA 3LQQA 3R9WA 1GOTA 3AVXA 2F1IA 3KKOA 1IXZA 3SJAA 1GKIA 4GRAA 4U7DA 3MGCA 4FIDA 2QG6A 2ZI6A 4PPQA 3A6PC 1MO3A 3KQNA 5JJLA 2DYKA 2UVQA 2QP9X 4NCNA 4RSGA 5DISB 1SXJD 3KFVA 4RY2A 1UADA 4W7SA 1HQCA 1S3GA 1AS0A 4Q7LA 3RS0A 6Q21A 4ZDWA 4DDUA 2F55A 4XVUA 3H0KA 3CWZA 3QIAA 4TQAA 1TUEA 1Q44A 2QTHA 5B64A 5FPYA 3TNFA 1FL9A 3AKYA 1U0HC 2E9SA 4QXAA 2HXSA 1XEFA 1S4QA 2JJ2D 5KDDA 1WQ1R 2HEIA 2JA1A 5DI3B 5KSYA 1ZJ6A 5JJKA 2RB4A 2ZANA 4EPVA 4DBLC 3ZIAD 1KOFA 1OE0A 1AKEA 3SQWA 5FUVA 1F2TB 1OXSC 2W6IA 3Q8XB 2PX0A 4UNNA 3QUSA 1HY3A 1IQPA 2NO9A 2QGZA 2VPPA 1Z6YA 4IOMA 3THYB 2DCUA 2NIPA 4QNRA 4R7ZA 3WP1B 1RJ9A 1CR1A 4POAA 1KO4A 2O8EA 3JZAA 4RCYA 3K70D 3C7KA 1MT0A 2PCLA 3FDIA 3FHOA 2RCNA 1FNMA 1IXRC 2FU5C 4RVCA 2REXB 3MRSA 4ACAA 5DI3A 3KQHA 1CKEA 4IOKA 4M4SA 4RD2A 2P6NA 3FMPB 2FSGA 4MKFA 4DWJA 1FUKA 2PX3A 2J0SA 1ZBDA 4P33A 1F2TA 3I32A 4G0NA 4Q00A 4EPXA 2UZ3A 4IFBA 1ZD1A 1W0JD 4UJ5A 1U81A 4PHGA 4I81A 2WJHA 4GOKA 5DNYB 1GG2A 2CL6X 5KYKA 1GRQA 2YV5A 2Z5FA 4QHYA 4TL6A 1NBMD 2QSYA 4TL8A 5AUPB 2V7QA 2ZI7A 1T0HB 2C2HA 2ERXA 1BO6A 2ZVQX 3AV0B 3MG9A 5DN6A 1P3JA 1VCNA 2ZS9A 1EG7A 3CRW1 4BGDA 3MD0A 4A0FA 1VDZA 3CH4B 1DADA 1U2RA 3VU9B 1G7CA 2IF2A 4I99A 3G0HA 3QF4A 1S0UA 2C5LA 2GZAA 4URUR 1H8EA 4I1SA 3IEUA 1JR3D 4KV9A 1ZNWA 4B43A 1E2MA 1KNQA 2IW3A 4AURA 2IUUA 3AUXA 5DGXA 1L7VC 2WJIA 1YVDA 2ZRFA 4JL6A 1OF1A 2BBTA 3C5HA 5FOVA 1G4UR 5FL7D 4M1WA 1CR4A 3RS3A 3EIHA 4NCJA 5FPSA 4RFVA 4HAVA 5JS7A 2ZM5A 1LNZA 1TL7C 3TUZC 4LWZA 2N1BA 4M53A 4D4MA 3BH6A 1DS6A 3W8NA 2VTKA 1CJKC 5AWFC 4HAYA 3R7WB 4ESHA 2R2AA 5KUTA 2GAAA 2PT5A 4MDEA 1XMJA 3DHWC 4PSVA 3THOA 2JAQA 4DEYA 2DY1A 2Q3FA 2VP2A 2W00A 3K0FB 3IBGA 1QG2A 2XNSA 1KI3A 4B34A 4DCTA 4RZ2A 1X6VA 4BLPA 2JJ2A 4P4UA 4JL5A 2IEYA 1WP9A 3CZQA 1Y63A 1Z0JA 3Q85A 4Q4LA 4BFUA 5JS8A 3W5JA 4DLZA 4NYMR 2GETA 1R0YA 2RAPA 3ZZ0A 3SNHA 4PC6A 5FTNA 5LD2C 1N0WA 2QBYB 1TQ4A 3K09C 5UKDA 4Q66C 3U3RA 1UPTA 3R7WA 2D7DA 2RGBA 3U3OA 2ZRDA 3SYLA 2DFLA 2IBMA 2VF8A 3P27A 4V02A 1NI3A 1NIPA 4FMDF 3SHFA 5B30A 1XZPA 1PLJA 4ZKDA 4JJZA 2ZYTX 4UJ3A 2ODWA 3SS8A 4M9XA 2GCOB 4QHSA 5HE8A 3JVUA 2FMXA 2GA8A 2VP0A 3SFVA 3J81k 3KKPA 1N6LA 3FFBA 2R44A 1N5KA 3R9IA 1GNRA 1KZGB 2OM2A 1Z08A 1GVNB 1FP7A 2FPMA 4E03A 2IHYA 4AKIA 3V4FA 5CK4A 2VF7A 2ZSAA 2QBYA 4LHZA 2CVFA 4QGGA 2O8DB 2IL1A 2FSHA 5EZ5A 1W4RA 4IRUB 2JJ1D 4OQNA 4GOXA 1R5NA 2ERYA 5CIWA 3BFKA 1NBMA 4YMSA 1E69A 4URYR 3CR8A 4QOSA 4ARZB 3U60B 1R0WA 3GFOA 4IJMA 2GESA 1TPZA 2CNWD 1A1VA 1E2QA 2MMCA 2GTPA 3M1IA 5TV2A 5GJCA 3B1XA 4IEIA 4W5HA 2C98A 3H84A 3RRZA 1R4AA 1P62B 3DM5A 1DAEA 4PXAA 1T8TA 2FDCA 2YNMA 1JEEA 5C4GB 5HR5A 2WOOA 3DVLA 4ILEA 1E2NA 2O8DA 2FE4A 2OO7A 2QORA 1PLKA 1G9XA 3BJIC 1M1YE 3VAAA 4BFZA 4D25A 1FX0B 5FL7A 4PO1A 4RD0A 1NLFA 3VR2A 1Z29A 1T3SA 4ARZA 4XWKA 2IXEA 5E3HA 2VSFA 4BZPA 4G5RA 5KOYA 3UMFA 1NVUQ 2WM9B 4BECA 3V9PA 3RRYA 1Z6GA 3QXHA 4NBSA 1P2VA 1MO4A 4TYNA 1YKSA 1V43A 1CR0A 1VYVA 3T35A 4PTLA 4KSCA 2BV3A 3BOSA 3DPUA 5FL3A 1E2IA 1WRBA 3NG1A 1VCIA 2JDID 3P1JA 3ZYCA 3R8CA 4ZDIA 5A5GA 3VNUA 3O47A 2YJTD 2OBNA 3OEED 5C2JB 1SQ5A 5H8WA 4HYYA 2O0KA 3I72A 4NTZA 2QRNA 1DOAA 1GIAA 3LD9A 1DPFA 1FX0A 3WHLA 1DAIA 4N0EA 5KDLA 2OBMA 4LSGA 5BN5A 4LX0A 1JAIA 2KBEA 4K8OA 1N6IA 5JMTA 1G7TA 4PC2A 4TTQA 2HLDA 2HCJB 3AVYA 5KDOA 2IF0A 1ELOA 1W47A 1PV4A 4QBFA 4QFMA 4A2QA 2EFCB 2PEZA 4P3YA 5FOWA 5BN4A 3HU1A 2Q9CA 2BBWA 2WWWA 3NH9A 1YRBA 1ZD9A 1P72A 3PEYA 1YZKA 2L0XA 1L2TA 1SZPA 1KK2A 4QBHA 2B21A 4BASA 2AX4A 3KXLA 1K5DA 2N42A 1E1QA 3QSYA 1P2UA 4GMDA 3TMKA 1QZXA 2NPFA 3RHFA 3NBXX 3EASA 2BOVA 4L5BA 4LJ9A 2VQSA 2OZEA 2IYLD 2ZRAA 4QJ5A 4IXNA 3OIYA 4WOPA 3ONWA 3W8RA 4XOIA 2GILA 3LVQE 1TQDA 3EA5A 3QPWA 4GZMA 2ZR7A 4QGHA 1KI6B 2C96A 3DMDA 4PC3A 3WYAA 3ZS8A 2QTVB 3IQXA 4HI0E 4YDHB 4I1VA 4HLUC 4G01B 4KJZA 4LV8B 3AP2A 3AB3A 2BBOA 2FN4A 2RKOA 2CNWA 1G8YA 1XFAA 1UDXA 1LV7A 3LX8A 4CRWB 2BKUA 3TH5A 3BAFA 2XXAB 3LLUA 1Z3IX 3VKHA 3GJ7A 2XJ9A 5LPNA 3TRFA 3QG1A 4YLGA 3FVQA 5FBWB 1IXSB 2ZR0A 3MJRA 4AYWA 3K70C 1CTQA 5IT5A 2G83A 1CF4A 3RRMA 4QBIA 3ZVMA 1W7AA 1ZRHA 3CF2A 3PFIA 2HYDA 3IBYA 4KYUA 1KI6A 4Q1DA 3WNCA 5DHAA 2WIAA 3CNOA 2WWGA 4OI1A 4IEEA 1IAQA 1RPZA 4G5OA 4Q9IA 4H9GA 2XZLA 2JIZA 1GL9B 2Q3MA 2K5UA 2VBCA 3EPHA 3C41J 2P2LA 1E1RD 2A5YB 4GMXA 3W6PA 3ZGXA 1VPLA 3FB4A 4US2R 2JASA 2XSZD 1R2QA 3SQXA 1S2MA 2WJGA 3LBHA 3RNLA 1KMHB 721PA 4QKQA 2XXAA 3AKDA 4HLDA 2QP3A 2OFXA 3U7EB 2ZREA 2LCFA 1QG4A 4JIMA 2CK3D 2JLVA 2BKEA 4BLTA 3OE7D 1XEXA 2CLSA 2NO7A 4IVQA 5EXPA 1YZUA 4PQRA 2JLXA 2FPKA 2YINC 2IYQA 2WMOB 3NEYA 1M7BA 1OYWA 4R2IA 3B7GA 2RH5A 2WJVA 3E1SA 2RGGA 3VQTA 3QKSB 3HJNA 5FTJA 1NKSA 3I92A 2Q9AA 1ZU5A 1US8A 1XZQA 4D0NA 3A8TA 1O87A 1KI9A 4HZIA 2KI5A 2P5TB 4Q1CA 2R6FA 1N5LA 1BH2A 2R9VA 3CPHA 5CLQA 1AZTA 1Q1QA 1KMHA 1AJEA 1E0AA 3A4LA 2GNOA 1Z28A 4JL8A 1NVVQ 2AK2A 3TE6A 1BMFD 2CCGA 3K0SA 3PUZA 4Q9KA 4E07A 2GXAA 4EIWA 5D3QA 2QU8A 2WICA 1SVIA 1I2MA 2AR7A 4L9WA 1J7KA 4YQFA 3AEZA 3RWMB 3GPLA
chains in the Genus database with same CATH superfamily
3GA7A 4PO9A 2PNJA 3RGWS 1MOSA 4JC8A 1QF7A 4EF5A 3E22B 4IM7A 4IDEA 4H7EA 2J9RA 1YNSA 5CT4A 2FHPA 4J1SA 3NHFA 5CJPA 4ALKA 4DQDA 5C1BA 4Y67A 2AFIA 5C5DA 1MFZA 1A2QA 1UT8A 4M87A 1Z6ZA 4X93A 3CM0A 1ZWKA 3UC5A 1E3WB 3I2IA 4KRYA 1QIEA 2BONA 2NNLD 6REQB 2P9YA 3T54A 2WWTA 3FKQA 5I7HA 1DELA 5FD8A 3ZQJA 2YYYA 1EXWA 2P2DA 3RSLA 4FFPA 5FAKA 3Q5GA 4JODA 4YDQA 4JROA 2B61A 2R6HA 3MBIA 4RHTA 1JB1A 5EQDA 4PFSA 1GN8A 1F06A 5J2TF 3WZLA 5C1OA 5JZSA 4PAQA 2HV8A 2X42A 4YAGA 2FXVA 2HLNA 4ETIA 2PRYA 1E79A 5GIPE 4KAFA 1KDRA 1GPKA 1R16A 4O25A 2QRVA 2IV7A 1Z6AA 2O2YA 1EFLA 3D43A 2C9OA 1D6SA 3LDUA 5BUZA 2RGNA 4G0PA 3JYPA 2VCHA 1R4MA 1ZM7A 4Y6GB 2HCBA 1GZUA 1CLEA 2ZYGA 2A0UA 5EJGA 1DG9A 4RD6A 3W4IA 1F2UB 2Y1XA 4KGZA 2V7GA 4PIPA 4Q3KA 1AXRA 8ADHA 4NYJR 3OM1A 3KWMA 1ABFA 2NUTB 5L4NA 5GVSA 5BSUA 4OHFA 2XRZA 1FIUA 1C7FA 4M8LA 5E2AA 5BOSA 1EEHA 4PLWA 2CZCA 4Q3CA 4F9GA 1FY2A 4G1BA 2Q3DA 1K4YA 4ZO8A 3BB1A 3URMA 5KU7A 1HDYA 1VYHA 1L8QA 1H0SA 2LKCA 3LWNA 4MQ5A 1NXVA 1XZEA 2MU1A 2YJNA 4XR4A 4YBZA 4W5NA 1P2DA 3LP8A 2EDCA 6CHYA 4O4LB 2BEUB 1F1JA 4F5EA 1GKUB 4MPDA 3EVTA 4HEJA 1WR8A 1EVQA 4MKZA 3IESA 4EENA 1LSUA 2Q29A 4RKRA 4Y0NA 3TRJA 5TMPA 2EX1A 3S2EA 4E0BA 3IE0A 3M83A 4WOJA 1G9TA 2QL7A 2ZUVA 1AHIA 2PUJA 3ICCA 2C4HA 5GOTA 1F17A 3HL4A 3OTOB 2PN1A 1FF9A 2IYYA 1IUNA 2H4WA 3AG6A 4U9HS 1HMYA 3UCFA 3IBTA 3B5EA 4MLZA 2IHNA 1NZJA 3VVMA 1ZVJA 1A7UA 3MT0A 2EJUA 4TT3D 1N5JA 4LJYA 4F4IA 4MB0A 2X1VA 4QUIA 2XBMA 2VJYA 3CSUA 3MWFA 1QPGA 1VBMA 4MRMA 2NPIA 3V8QA 4D4GA 4E30A 4KW7A 3MYYA 5LBUA 3FXAA 2DBZA 3B9BA 4DCSA 1IBLB 3QE3A 2P0YA 3ZTWA 1WEHA 3OFND 3QYPA 1WMSA 2R4QA 4ZYUA 4YROA 4AKEA 4FHCA 2VIIA 1D4AA 1CE8B 1HLGA 3SLGA 5A06A 3VR0A 3GRZA 3U7JA 1CJBA 1TU4A 3IA7A 4H7HA 2JGDA 4MR7B 3FIUA 4FFDA 2Q7XA 4O4IB 3NX4A 3G2QA 4DXDA 4N4AA 3A4VA 5DLDA 4EQZA 2XUHA 1S2DA 1VLHA 3OTHA 3IUEA 2PRIA 3DKKA 3KTAB 1U02A 1T6YA 2PTHA 5AXAA 4AJ2A 2QRKA 4L3WA 1OIXA 3NKLA 4H31A 3T3MB 4K88A 4ZFNA 3T1NA 3TGWA 1N8NA 3WK6A 1ZN2A 3OJCA 4R1SA 5LB4A 1TF7A 5JXIA 5AKKA 5DX0A 4F1KA 4CIBA 1OH6A 1X86B 4IIBA 1L5HA 5CLJA 3AUKA 3FYHA 3PGKA 3IL2A 2Q45A 2PX5A 1YAJA 3NTXA 5DXFA 1USWA 2AZTA 3DHEA 4YONB 1U1FA 2VOEA 2GNPA 1ZJZA 2JCBA 3H9QA 3PWSA 1QO0A 3BCSA 3NAQA 4OIFA 4GYJA 1Z37A 3KS9A 3LQ1A 2VHYA 4LGMA 4MKIA 2JD0A 4O6VA 2VSQA 1TKAA 1U3UA 3W2TA 3AF6A 3SSOA 3FYCA 3K6SA 2H1RA 2PUDA 3K53A 4GZ5A 5FBQB 4MIEA 1TRHA 4BMZA 3CXUA 3OBBA 3PENA 4ZRDA 5B4TA 3REQA 3PQFA 3IALA 1Z5WA 2JCGA 5ANRB 4ZVRA 1ZCFA 1ZWLA 2F6RA 1QONA 1XTQA 1UDRA 2PA0A 3F97A 1KEPA 3MWEA 3TNDA 1D07A 2XUFA 2WYUA 3IBSA 1BTOA 3N0TA 2O5EA 3NBZC 4LXQA 3AUYA 4CKCB 4CG0A 3EZXA 1CJCA 4LRWA 4BKUA 4F2PA 1N5MA 3OX1A 3E8XA 3M3PA 4YJKA 2GVDC 2FQWA 3AL3A 2AUMA 4LCJA 4B74A 3MT7A 4BYMA 4ANFA 4E15A 4OGWA 3SQMA 4IGFA 1WMBA 4NCHA 3AEXA 5IEBA 1IQRA 1QHEA 2R00C 1Z5UA 1ZJ4A 5KOHB 3RSOA 1W2GA 5HZGA 4F4CA 1N6HA 2Z3VA 1Z0IA 1U8XX 3O38A 1U4OA 4E31A 2Q4OA 2AV6A 3CNNA 2A14A 2Z2YA 3DOIA 3MUNA 3QXGA 4ZA2A 3PD7A 2ODEA 1DBSA 1JG6A 1EFCA 2ZIXA 2OYRA 3NYQA 4YA6A 3X0DA 3H4TA 5AYVA 2CLMB 4K81B 4W9RA 4JI7B 3MXOA 4MUEA 1II8A 4ZZ2A 4LWOA 3VO1A 3IVAA 2YWCA 4ICIA 4IO1A 4OO3A 2WPDD 1HA3A 2UZIR 5IW8A 3USZA 1UWVA 2HA0A 3OT5A 4P34A 1VSUA 4KPUB 1Y5NA 3KQOA 3OEHD 4R7TA 4MWSA 1ODKA 2QE6A 2XKKA 4Q9DA 5ERGB 1FJXA 3L1JA 2FRVA 5JS6A 1W4ZA 5GWXA 1X1TA 1Z47A 2KPOA 4YC7A 1UT6A 1UC8A 1W4AA 1Q19A 3UWDA 2IH2A 5FTKA 4I5GA 4OPMA 1GCIA 3NVMB 4DV3B 1HLDA 3QU5A 3N7AA 2IS6A 2W48A 1VL0A 1W94A 4F60A 5CA1B 1EK0A 3EISA 2DHRA 2FVXA 4TT3A 4CM9D 4KFRA 2YV2A 3A6KA 3CISA 3N53A 4EJ6A 1HZJA 4B4UA 3TR6A 3QENA 4N54A 3UJ9A 2HCTA 1C7IA 1BC5A 4M2LA 4RHCA 1VMIA 1AZLA 3I4LA 2FMIA 3MMPA 1PFWA 4YT5A 1EWTA 1JWBB 1KEZA 2OCPA 3OFNA 1RPAA 4EG8A 4J7UA 4KC0A 4AT1A 3A4IA 1Q91A 4FR0A 4QWMA 1T5OA 3HEBA 4IMPA 4F3NA 1C9KA 4FHZA 4A2WA 3C7TA 1ESMA 5E7MA 4MGZR 1ARZA 1DBQA 1NVKA 2WVJA 3N6XA 3OKFA 1G55A 1Z73A 2SCUA 3I2FA 4FEAA 5J4YA 2BH2A 1BVUA 2R96A 2X3FA 4C4PA 5IVKA 4MHSA 3NDIA 4M83A 2A9RA 2YHUA 5AK0A 3WKAA 4EA9A 4WLUA 3STUA 5FLXA 3AI2A 1PUJA 1C4XA 3WRXC 2O1EA 3BWEA 4ZCQA 4FFBB 4C2AA 4ER7A 4ENVA 2VG8A 1E8NA 2B2NA 4ZVKA 1TVMA 4F8EA 2CKMA 1E3EA 1A5BB 3BRWD 3GDOA 4H6WA 2P67A 2V58A 2CVHA 3DZJA 2XWJI 2JIPA 3BE5A 4RZ3A 1B0UA 1QP0A 3TCXB 3I04M 4P5EA 5B2ZA 1SCBA 2C4MA 2PX8A 3PNYA 3MTGA 3U7QB 2BEWB 2MSWA 2V97A 4F4DA 4YRSA 1ACMA 2VNIA 5H9VA 4ERXA 2GNAA 3VMMA 3UWOA 1OXBB 4KPEC 2ZAGA 2P9HA 2Y0CA 2YN4A 2YXNA 4QASA 3X1YA 3D7RA 4AUKA 5HHTA 5JQGF 3T5PA 3OG9A 1SKMA 5KNBD 3VR6D 3L0ZA 5CFMA 2C59A 3FWPA 1JI0A 3UXEA 5GP1A 3U6KA 2PT6A 3PLRA 5FXMA 2AJDA 3OC6A 3FR7A 1IBRA 4KMRA 2WWHA 3L77A 3O1IC 1SVWA 2O2JA 1DAKA 1XLTA 4KBGA 5TMEA 4INZA 2IEGA 4W5QA 5ALFA 2JANA 4CLXA 3ESYA 3IT1A 2C4TA 2PO7A 3BE8A 2CN1A 1TVKA 3E58A 3FRJA 5K6AA 2ZUCA 3N2LA 3VGPA 4W9MC 1ULSA 3H6HA 1WEKA 2QSZA 3O5AA 1B93A 4HDSA 1XTJA 4KKVA 3G7UA 4YMTA 1IPHA 1KIMA 3B2QA 3WNBA 1JFLA 4JOCA 1WDWB 1W88B 2NOAA 3HKDB 1BU5A 1SXJB 3NRJA 3T41A 2PEYA 3LYLA 2IZ7A 4DMLA 3T52A 3ER6A 3OZFA 3KL2A 1LDGA 4URZR 4H1TA 3RV3A 5E7JA 3DJFA 4QDOA 3I0NA 3WA6A 5CVCA 3EW7A 3PXEA 4GDMA 3QI2A 1NI4B 2LUOA 3GZ4A 1GA4A 2DT5A 1DBVO 4PX9A 1BE8A 3UVEA 3CX4A 2J46A 5AVOA 4JLBA 3PLNA 2NVWA 2PUAA 3OEHA 4LCBA 5KSZA 2N3ZA 1PR4A 3P97A 4BVFA 3MRXA 3GCGA 3QH4A 4Z7QB 3JWPA 4A6XA 5HQ3B 3IPCA 1TU0A 3KQKA 4GXNA 3DV0A 1TT5B 3G2MA 3HI6A 3RC2A 1Q1BA 3JQ7A 1LBEA 4IRXA 1I1HA 5U4QA 1R37A 3UMMA 1VIAA 3SNKA 4QULA 4FYMA 2QD5A 3B70A 3SU8A 5EQJB 2WJPA 3NTLA 4OP1A 1GNSA 4ISCA 2ZSIA 4OU4A 3D3QA 4FHDA 4M1MA 4UBJA 3QTTA 1T35A 5AW0A 3UAYA 3WYNA 2I2XB 1YZTA 4MKXA 2BTQA 4NS1A 1RPNA 1F5NA 2PJRA 1RXEA 2ZDQA 5L53A 1DCFA 1BH6A 4JI1B 3QBDA 2ZOSA 4FYPA 4EHNA 1NSYA 2H1CA 2Z6VA 3FIJA 1O9HA 1TLTA 1TEHA 2B7CA 3DV9A 4KQHA 2WMDA 4MCIA 5ED4A 3EXFA 1CPYA 2PVCA 2ZSBA 5FV7A 1N3YA 4D0SA 1VYUA 3HKCB 1YTUA 4AC9A 4RWEA 3VAYA 3H1GA 1EPUA 1FU4A 2GRAA 1NQVA 3A3YA 4L0MA 2YR0A 5KHOC 5BQ5A 2A84A 2E4ZA 2IXAA 1LFAA 4OJQA 2CCJA 2RG7A 4TQGA 3WQQA 4YMVA 2NYUA 3EXEB 1T91A 5A03A 4G5QA 2PZKA 3BRCA 3OMWA 1W36C 2XE4A 4YRFA 3FZNA 1P29A 3IV6A 5LMNB 4M38A 4DSNA 1T0PA 1DHRA 1QOPB 3CX3A 4MJ3A 3O75A 3IDAA 4DLVA 4RE6A 4F84A 5FWXB 4NFHA 3GAZA 3U6BA 5YASA 1IIBA 1WCYA 5EYPB 1QP7A 5CX1A 3BRWA 4EVIA 1Y6GA 4DR6B 1Y1PA 3T1TA 1EXNA 2ZG6A 4MLCA 3BFPA 4JCOA 5A1TA 5E1DA 4DQ0A 3HM9A 2WEKA 3IS3A 1CBUA 1FYWA 1KARA 1SHKA 2ZR9A 1DAPA 4C9BA 1TKCA 2CMFA 4DEXA 1Y1SA 2NTEA 4IMJB 4F46A 4NHEA 1URPA 2Q2OA 4WESB 1F8UA 4MARA 4BVHA 4AKTA 4YR7A 3KYCB 1ADGA 5DNDA 4RS3A 5DFAA 1XLUA 3H5VA 1EVKA 1K0UA 3GEDA 4CYMA 1H2WA 4UM9B 2OK7A 3NU1A 1RAIA 3VA7A 2G5PA 2I2DA 4UMFA 1RXUA 3D0RA 4Z9AA 1W0JA 4CMGA 1N2GA 5JYBA 1RRKA 1THGA 4YR9A 4GC9A 5I7FA 4Q7KA 5DDIP 1GM5A 3VJRA 2ROQA 1COWD 1VHDA 2ZU0C 5E1OA 1AQIA 4L8GA 3DM9B 1CUYA 2Q07A 1ZVKA 3OCXA 2WWVD 3IR5A 5G3ZA 5IXJA 5DV9A 2BGUA 5A0VA 2I76A 5I9NA 5JWRA 4YBRA 3WBKA 3EWNA 3L1UA 3N8DA 1LPMA 4TMFA 4YMWA 2R6R1 1NRJB 4R8SA 4UTNA 1FBTA 5HTKA 1U80A 1LC3A 2H1IA 3NHAA 2YJ6A 3EZ2A 3E2IA 5L3VA 2C83A 4Y2VA 1L1FA 5ICFA 4BATA 3BSYA 4LHSA 1P33A 1IG0A 4WZAA 3AVOA 1OWPA 2G17A 5B58C 2P9FA 3PUJA 2XB8A 3TZEA 4EY8A 1KYWA 1IOVA 2FP3A 5GJBA 3OQ6A 3UW1A 4GP7A 4E1BA 3PWZA 4XIJA 1V39A 2J7KA 5JI3E 1RWXA 1INLA 1RP7A 2W2NA 1WD5A 2TECE 4HEA1 4UCXA 2WPNA 2QX4A 4UHJA 2SKCA 1NUSA 4DR2B 2H2DA 2NZVG 2E4XA 2CY0A 4H1UA 4JVLA 2ODNA 1H23A 3ZWKA 1N1EA 3HWWA 5DIZA 3C43A 4IOJA 2OXCA 2JGAA 4YNBA 4EFMA 1RLTA 1FUYB 3NWPA 5FUXA 3A06A 3WL3A 2OHJA 1UBNA 4JB8A 3H1AA 4OHRA 1NZFA 4B3HA 3WY9A 5DGDA 4Z7OB 4AP6A 1LDYA 2RC6A 2OFWA 3FRHA 1OX4B 4M6WB 2JIQA 3CEHA 1TCCA 5I9LA 3FUVA 3O8QA 1QZZA 2FPUA 5LM3A 2JPDA 2W6JD 3I9NA 3FSGA 3WQRA 2WLTA 1ZUIA 1XIVA 5F1YA 3DZDA 3T7AA 2P3OA 3IKMB 3BB4A 2OL4A 2B82A 2EF1A 1ZM3A 3QVJA 3RR2A 3QWFA 4C3OB 4Q12A 4DUGD 1L4EA 5BVGB 1FLVA 5DWDA 1CY8A 1M66A 5DEIA 3Q7SA 1H6CA 1KI7A 3UMSA 1O6FA 3F2IA 2PZBA 4QVIA 3TSZA 2RCYA 1NMXA 3ECSA 4Y2HA 4FOSA 2C4WA 2RI6A 4IJWA 4WCFC 1Q92A 2CHGA 1RXWA 1M1NB 3Q7TA 1QFMA 1ISIA 3VPFA 5JMWA 1Q20A 4FMBB 4NZYA 4LXHA 2BFOA 3OZSA 4O08A 3TL3A 3UKDA 5JZVA 1ULAA 1J5PA 3NYRA 2QPOA 2X5NA 5CJ2A 2DFNA 2VF4X 3A36A 4Q3LA 4TYPA 3FTDA 2FX3A 1B74A 3N2NA 3H5TA 1XRMA 1V8PA 4EKYA 4IIYA 3DDUA 1ECBA 5C5CA 5CB8A 1OH5A 2PGJA 1P1JA 2DKFA 1OQAA 2WHRA 3A4YA 3PUVA 5TEWA 4OQQA 3BMQA 2XYQA 3U7GA 2I4RA 4QDZA 3B3AA 3FTPA 1NW3A 2YV1A 1RE1A 2AXQA 4MB6A 4QXQA 3CC8A 1XDWA 1HK7A 2C7GA 4KIWA 1YR8A 2A1TR 1QIFA 3RT7A 2PT7A 3C4VA 2YKGA 2WDPA 2FUCA 5G0VA 1KE1A 1U3VA 2VK1A 1EFRD 3BSFA 4KFTA 5IXSA 4EGCB 1LV8A 2AN3A 1TAHA 4M76B 4IINA 4DZZA 4TS4A 4YRNA 3IH5A 3H8JA 2CXTA 4O4HA 3S3TA 3U56A 1QG6A 2P79A 1L7EA 5ISMA 2IP2A 3ZKAA 3I01A 4WX2B 5BRNA 1X8JA 4FCVA 3LC7O 4FYHA 4ABYA 2UU9B 1QU3A 2GWHA 2NV6A 1RRMA 1N75A 1SKAA 4DJ5X 2WE7A 4ZK2A 2CJPA 1V7CA 1Y8RA 2AKAB 4IS2A 2ZKLA 2HOQA 4PYOA 2ZSEA 3VKFA 2OCLA 2FMTA 2GJ9A 1MA3A 5FR2A 2ZRGA 3GUZA 1R88A 3LFHA 2EIXA 3FM9A 4HRVA 1VL5A 3SOZA 4W5OA 3KLPX 1MGPA 4ZVTA 1YBVA 4XIFA 2LP4Y 2I8CA 1JPJA 1NQUA 1YR2A 3M33A 4KU4A 5DEOA 5ADUS 3TZ6A 4QEDA 2L17A 4I7EA 1LXCA 2FSIA 2Z5VA 1E7WA 3CLSC 3FLAA 4IMRA 4RKEA 4RJJA 4UBOA 4OP2A 3WDLA 4JOQA 4DNOA 4DDWA 2CNOA 3LG2A 1UBCA 2XVZA 1SFRA 2V4UA 2V8BA 3FPCA 4FYIA 2CL0X 3TZBA 4MUHA 5LQKA 4CJXA 2E4UA 2QA5A 3U5TA 2FDRA 2H16A 4U7PB 4FZVA 1MF7A 2PS3A 5CNKA 1XRPA 3KOUA 4OOFA 2ET6A 4RL6A 4G09A 2NG1A 2Z8XA 3AI3A 4FFVA 2WW8A 2X5OA 4DJEC 4AJJA 4WEQA 2BIFA 1E5LA 2MTBA 4H27A 5DHFA 3DXXA 3MAJA 1BG6A 1FUIA 1NWCA 3PGJA 3RPEA 2AQ8A 1XC7A 1B6RA 2O2HA 3E7WA 3V2UA 2DTDA 3U16A 3CKLA 2JLSA 4M3NA 4PSDA 1XCPA 2IPMA 1KC3A 4RHXA 4XFKA 4K3VA 5J9FA 1R8QA 1O2DA 4F06A 4P81A 1MDFA 5COQA 4DLTA 2XGOA 2BN4A 2VCYA 1UDWA 2IYXA 5A4IS 4K05A 3ETHA 4N40A 1AGPA 4BGEA 2BI4A 2FPWA 1RYYA 3L7JA 4R2KA 2O6HA 3OEEA 4PRYA 4TUYF 5DE3A 3S29A 5EJEA 4XCVA 3TEJA 1AN0A 4FE7A 3IPXA 1BDHA 4CV1A 4YJHB 5G1NA 1ZUNA 2XTMA 4O2AA 4HSGA 3PICA 2GQ0A 5K3BA 5CRIA 2C57A 4PBSA 1PGPA 5D3MB 3TOXA 2I7XA 3LCCA 4LC1A 3TO5A 5TS3A 5CFOA 5DJ5A 1L5YA 3DBOB 3K1ZA 5DK6A 4BZQA 3TW8A 2ASEA 4N9WA 1WUKS 2Q5IA 2X6TA 2C58A 4G0WA 3WAGA 3EVCA 1YUBA 1EFAA 2FPOA 3LVFO 2FAXA 1E64A 3ZXSA 4KQIA 2M9MA 3X1DA 2YOFA 5EHQA 1BVYF 1HX7A 2R68A 1OZGA 1OX6A 1PDOA 4FWBA 3L01A 3P4YA 3AVWA 3KLBA 1DKUA 3HUTA 3IDSA 4C3ZA 4U00A 2BUAA 4ZVOA 4Z54A 1WVGA 1USVA 2B3DA 5A4JA 1P80A 4Y9DA 2DPHA 3V1MA 1TEXA 2GZ1A 1KEKA 3BHIA 5JROA 2GHQA 4YCSA 2ZSHA 3COWA 3JZFA 2X7JA 1ADBA 4YREA 2PQ2A 2COKA 3ADBA 2C7VA 2WOJA 4NONA 5K4GA 3V8BA 4PNEA 3ZD6A 4PO3X 3BT7A 3CJQA 5EXTA 1XJCA 2NSHA 2HUNA 1VPTA 1IHYA 1J9EA 2ZRMA 3CKYA 2VUTA 1WZCA 1E2FA 4TYMA 2ODTX 3M89A 3MLBA 4CIAA 3ANMA 1AVTA 2J9YB 4B7XA 1IVYA 1EFHA 4F2HA 2DPXA 1RQGA 5F4ZA 3W3AA 3AVUA 2HIMA 2ZJ0A 3WLIA 2Q3EA 3Q72A 3LKZA 1ZZEA 1E9RA 2ONYA 2Y1KA 4CT0A 1Z39A 4I5EA 4LOAA 3ANTA 5HM6A 5LMZA 4BLWA 2O6LA 1XZKA 2XCOA 1JHOA 1XCLA 1DUSA 4WMLA 5A02A 4QE3A 3ZJYA 2VHVA 2W2VA 2ZJFA 5E9QA 7MHTA 1YU6A 2NUPA 3R7NA 2A35A 1E0KA 1UOEA 2HMUA 3KCQA 5C52B 4EL5A 1WDKA 3ZR4B 1KDTA 3CURA 1PLLA 1U5AA 1U0OC 3ROGA 2O8CA 3OTIA 2JJ8A 5AM1A 4R9RA 2KWIA 1E9CA 1TD9A 2D0OB 3EZ6A 3EWIA 4LZLA 1MABA 3KQMA 5JO9A 1KZ4A 2P2CA 3T9CA 2ORED 3E7FA 1FX1A 3VOAA 2A86A 4P0PB 2H8GA 3FLBA 4EUFA 3K3PA 2V7TA 3DTVD 1N2CA 4MUXA 3SZUA 3IPYA 4LRQA 4MQ6A 1V3QE 4M8KA 1T2AA 3ZE2B 1Y3AA 2B8EA 1TLFA 2YYAA 3G82C 3ZIDA 1T4GA 1HTWA 4X7MA 1KDZA 4ND8B 1FRZA 1KBQA 3LNTA 3HDVA 1EM8B 2AUNA 3HCNA 1CIVA 2R85A 1XZ8A 1ZN9A 2F67A 4ZAFA 3E2MA 2FSUA 2PUVA 1TYDE 3L8EA 4FZ3A 3SGLA 2YFHA 3VVBA 1SZJG 1ZG3A 4KXQA 1UANA 2GTHA 2YMQA 4L50A 3SZLA 3KJEA 1IN5A 4IDNA 4HS4A 3ORYA 5NULA 3VU1A 3W6ZA 5C5IA 2XXBA 1WSAA 3U26A 3ZD9A 4DXHA 2C2KA 3I1YA 2J5QA 5JSFA 2CLEB 2Y1GA 3CH5A 4BQRA 1I7QB 5D5PA 2B8NA 4YUZA 2HDNB 5BSWA 5IPFA 3GAMA 3FHCB 4KB5A 2VHUA 5JAOA 2GPWA 4M8SA 3BMCA 2HF9A 4DV6B 3I6ZA 3TPCA 3TQRA 5DNEA 4YIKA 2IZ1A 1P4RA 4QOIA 5E1BA 5LLDA 2OPBA 1F51E 1TKRA 1ZHFA 2AOTB 2W37A 1MRSA 5DYTA 3FWZA 4DMHA 3U4HA 4IR7A 1N2OA 4YAFA 1M0TA 3TAUA 1QGUB 2R60A 2ON6A 1TX4B 2BFAA 4LSMA 2E85A 3JVDA 4CTNA 5DSTA 3BXPA 3HXPA 2RAVA 4IQ4A 4UBIA 2JEOA 3IDZA 3P2JA 2B7BA 4FWTA 2WK1A 2WWXA 1D9XA 4MWCA 4FEYA 4BB0A 2ZUBA 3AOEA 4TMWA 4P54A 2POCA 2VXCA 2X0JA 2SICE 4GX1A 1Z7EA 1UM9B 3SS7X 4MXDA 4I3HA 3UHPA 2Q7DA 1GAWA 1EZZA 1J0EA 1KKUA 1Z2DA 2HU8A 4A82A 3HKEA 1J0CA 2RHJA 3UPUA 2A3RA 1JVBA 1E1CB 4XLLA 1M34E 3BREA 3TZKA 4D44A 4TKVB 4R0VA 3C5VA 4IHJA 1ZMXA 4HKTA 5EHIA 1QHHA 4N48A 3L8YA 3VMFA 3D3NA 4FYJA 2Y1LA 2Q46A 4C14A 2MJLA 2HSEA 4UEWA 4EHFA 1KHTA 3QUCA 4ZARA 2Q2NA 2V0NA 1QBGA 1ZS9A 4QUDA 4C7BA 1YONA 1Z83A 2AMVA 3Q7IA 2A7QA 3BEDA 7ABPA 3IRUA 4JHLA 5EC8A 1DAOA 1VZ2A 4XOUA 1E1NA 4ZU1X 5C8YA 1K08A 4Q15A 2ZTSA 4R71A 3DXYA 1VYTA 4KNWA 2IBTA 3KJFA 4CF3A 1SEPA 2Z3WA 1U9YA 3NV7A 5JANA 3U3MA 1NBWB 3N2GA 3SK0A 2WNSA 4E3ZA 4EHBA 1I13A 1W36B 4FGKA 3I42A 3QWIA 1J0BA 2X3YA 4OGLA 1PTJC 4MS3A 3IUMA 2X0FA 1Z9BA 4UDYX 1PFVA 3G23A 3ZJTA 1FVFA 5EOVA 5HZMA 3GARA 2PRZA 1PWHA 5JYDA 4BNTA 1DNPA 2GEUA 4Y30A 1YH3A 4RLHA 3IEVA 3AY0A 2FEAA 1SKYB 4RY9A 3OPMA 3T12A 4KMSA 1JQBA 1SCIA 4O2LA 3QLTA 3QVSA 3W3ZB 1TTPB 2AN5A 1K1EA 3A3KA 1PGOA 3IDQA 4HGZA 4LNAA 5J5VA 5IFKA 3HXOA 2VA8A 5AKYA 4IDFA 2YZMA 2XCSB 1H4TA 2PD6A 2NWQA 4NS4A 3RC9A 5F35A 1DIGA 3AM1A 1WZEA 3HFJA 3DTVA 3U7FB 4GMKA 3T4PA 4TXHA 4KQKA 1E8DA 1R0XA 3T7EA 1JF8A 5JTUA 3PRJA 4GPD1 1EK2A 4PZCA 3DBVO 3HC7A 4TQ9A 5AP9A 4EBBA 1NU8A 5AUNB 1TTTA 1Y3HA 1H5NA 5PGMA 3T9AA 1J23A 3CRQA 2JI9A 4FS8A 4RMJA 2Q1SA 4AUMA 1A8UA 4OQLA 4ZKEA 2BFPA 5HZHA 2VAPA 1KVRA 3AR6A 1Z6TA 4RHUA 1XTPA 4XD7A 4P4NA 5JI2E 3TTSA 3E0QA 3BBLA 2HWYA 3LSYA 2QZZA 1JHZA 3LVBA 4EQ6B 5DN6D 2GZDA 1VMDA 1Z22A 3FGOA 3REGA 1PQWA 3M6IA 1BRTA 3WLSA 4G56A 3H42B 3A04A 3FVRA 4RA9B 4BWFB 5H4GA 4P38A 2DHDA 3OZDA 3QKUA 4XLTA 2DLNA 2XHZA 4PN3A 2RKWA 2GO7A 4F4UA 1BE0A 3OPXA 1ZNQO 3N0VA 3UM9A 1NBHA 2B2XA 3P9KA 5CYOA 5A1JA 3MLEA 4G5YA 5EEGA 1AA9A 1KJNA 2VT7A 3B89A 1ZITA 1X0XA 2J3DA 3R20A 1ZGHA 4FC7A 4MV8A 4BFXA 4Y6SA 1B8OA 4M0LA 4R9UC 5ALYA 1CEQA 2D1RA 2RK6A 2ZAYA 1J2EA 4EAAA 5IEJA 1R6DA 3SJBA 3ICQB 4D9CA 3IXQA 1KSFX 5FO0A 1YS7A 4KN6A 5LQJA 3ZDDA 4YPFA 1S4MA 3AVQA 3O9MA 1WD7A 5CDHA 1KFJB 3ADCA 3M81A 1KKLA 3F98A 1A04A 2FP4A 3IV7A 3PC2A 4MSUA 3P9IA 4AQYB 4KOAA 1UBRS 1V35A 1PR2A 5G2OA 1K97A 4FE3A 3PG5A 3VYVA 4YO8A 2WU0A 2FPSA 1G21E 4LISA 4KG7A 5B1EA 5FWNA 1I5OA 2GJSA 2QTCA 3B13B 4GDFA 3R4CA 2HDWA 4ENTA 2XKBA 4F2WA 2BFFA 1RRVA 3GJ5A 3L7NA 5AJXA 3OECA 4RPHA 4WERA 1THZA 3B78A 4CKWA 1KDOA 4OIMA 2JZNA 1QE3A 3R7AA 3GPBA 3S1AA 3ZI4A 2I6QA 3ZHYA 3FTQA 3E3OA 4AI6A 1TUGA 1M6HA 1Y89A 1XBTA 3LCJA 4JLUA 4BKQA 4DC9A 4BV8A 5EE0A 3AEUA 5E1MA 1VRCA 5CCDA 2A5GA 4QAJA 3GLKA 3EIUA 3ZX5A 1CQPA 4NV1A 3ZE9A 3CY6A 1BXZA 2W8ZA 3MB5A 1U4SA 4LJKA 5TJ9A 4C7KA 4U5QA 2J3EA 2BRUA 5C53B 2IP4A 4QYIA 4H7FA 2YUTA 2BHRA 3IIKA 3PGA1 2XI4A 1Z8FA 1RI1A 2COEA 1N9GA 1QWSA 1NBOA 3GZTB 1BZYA 2GBFA 3DZGA 3OCVA 2C2WA 2QX6A 4PSUA 4LJ6A 3WZ2A 3Q0TA 3DT8A 1W5AA 4B2IA 3U4MA 2BFBA 2KW5A 3TLGA 4ONEA 4P22A 1MG0A 4KAAA 1XTBA 2CDAA 1GU0A 1JXOA 2O48X 4PGGA 3UJ3X 5EJ6A 1DI0A 4ARIA 2CE2X 3N1UA 4YI3A 5K01A 4X6XA 4Z4EA 2NAPA 1A4XA 1QH9A 5JRDS 4UREA 1E0JA 3AF5A 4XEHA 3RAFC 4M9ZA 1JG1A 2EBUA 5SYNA 4XB6B 1Z2CA 4EVSA 1FS6A 1GPAA 3KV1A 4ALJA 1V7PC 5B1HA 4AICA 4G37A 2ZJ2A 4YRIA 5KC8A 5REQB 4G5HA 5H68A 4L8WB 4E32A 2ZI9A 5CU7A 3ZZMA 4OI0A 1RMQA 1G6Q1 1TMGE 3I3OA 4U2DA 2MR5A 1CEYA 4TTSA 4H35A 1BCSA 2GFHA 5TX7A 4MRRA 1LQUA 1TEVA 4LTDA 4B79A 1LDMA 6ABPA 1JKIA 4NH0A 4MVJG 1LLQA 3MGGA 4JJIA 3D7MA 1C0PA 2UDPA 2XOEA 3ZGYA 1KA9H 3G8YA 4KI7A 3RIMA 2X8AA 1Q2UA 5IZ4A 1NUHA 4KR9A 5K99A 4P53A 4BEBA 2DUWA 5LP1A 1KC1A 2XVXA 4ZT2A 2PSSA 3I73A 2QQ0A 4UOQA 1J56A 1WMEA 4XGRA 3A32A 4FINA 3K6JA 3N2EA 4FTWA 4W1SA 4X7RA 3AF2A 3KALA 2OXEA 3U4GA 5IYZA 1NVAA 1V8DA 3H4MA 4NCIA 4DYDA 5H82A 3UAXA 3A3NA 1MV5A 1HORA 3OX3A 1JEAA 2RJ3A 3QYJA 4J0FA 1B42A 5FFFA 1GLGA 2VEDA 4P86A 2UVPA 4ZJPA 2H59A 4NLLA 2WHQA 4PLGA 4JP5A 4FUQA 2BW0A 5KYGA 2KYRA 3QLEA 4X20B 4CFYA 4CIXA 2H2FA 5HQTA 2Q50A 5BMVA 3F9RA 4B80A 3A1VA 3TKLA 1QRAA 3BJZA 5GIOE 1RAHA 3S6JA 1IUPA 2GN4A 2I54A 3OA2A 4O02B 4QL3A 3SQOA 2Z2JA 3I3SR 1EFDN 4BV3A 3UQZA 3T61A 4MGIR 1U0GA 5EIBD 1WTAA 2XD9A 1V1RA 4BNJA 4AY2A 1PSZA 3OJXA 5CLIA 1A82A 4Q3EA 2H11A 1KZ6A 3NEJA 3KJZA 1H1LB 4RH1A 4ZPXA 2BEVA 2AG5A 4KODA 3PFGA 3RSSA 3SXUB 3TS1A 5JEDA 1KYZA 5EJ8A 4CCSA 2QAGA 3A9WA 1ZH6A 4F3KA 1DB3A 1KMNA 3QPUA 4WWHA 4F0JA 3JWHA 1T10A 4RULA 4IFTA 4QO8A 4RBNA 3P9SA 2XODA 4HX9A 1ES9A 4ZALA 4GW3A 2IWRA 3AEKB 3HO1A 3T3IA 3R3UA 2B2CA 1G6OA 1Y7HA 2JW5A 3WICA 5IJ0B 1IY1A 2GN8A 3BWYA 3QOFA 5F3WB 2LWIA 2ZSFA 2D54A 3WFZA 4GL2A 2G76A 1H5QA 1AG9A 1KH2A 5DOZA 2H0RA 3W2GA 1CSEE 1WHSB 2C92A 1K5HA 3EPRA 1SY7A 1Z4QA 3OE4A 4IIJA 5AVZA 5IJ9A 3U4QA 3HVJA 4F2DA 1JPUA 4D26A 3GJYA 1GCUA 4GKKB 2PPLA 3DTYA 1A69A 2FWBA 2G4LA 4G4IA 1B3RA 5HUHA 4K9QA 1LLDA 5DLEA 1HPLA 2YCBA 3S5UA 3GELA 1YB2A 4IIXA 4CMJA 2QT0A 4HL6A 4ARAA 1E59A 2R7NA 1Q7TA 5FKJA 4MZXA 1Y3FE 4A8JA 3VJLA 1A4RA 4OHKA 1GAEO 4WI1A 5EZYB 3RTEA 2DQKA 1FZTA 1QHXA 3KYDA 5AI0A 1CB0A 3II6X 4E14A 3CRMA 4EGAA 1KWKA 1IN6A 1L7MA 1YMUA 3G68A 3G2IA 3R3ZA 4GNKA 1PL0A 1GADO 2OV2A 1JRLA 5AW7A 1NP6A 1QKJA 2YHIA 4M54A 1Q1GA 2XTZA 4ZVUA 3C97A 4DF3A 4NQRA 5EAIA 3W77A 3SAJA 1G4AE 5E6RA 4DLXA 4BX3A 2W4IA 5T3UA 1GTZA 3A37A 4R01A 1LNSA 2WKQA 4ZOLA 5BYKA 4ROTA 4A4DA 4JA0A 2VPWA 1J0DA 5MN6A 3GF4A 4B3CA 2G8LA 2YXDA 5BSVA 3L8MA 5E3IA 3ZCSA 1DO8A 3LF1A 4BP3A 4D0GA 4EI7A 2HIAA 1L4LA 2ZYUX 3TZLA 1YDWA 2BGIA 2CXOA 1ZK4A 1N5RA 3M0EA 1JBKA 3MCTA 4KWIA 1CJTC 1OVGA 2VWPA 2ZBGA 4TSRA 4E5MA 4EAQA 2YY6A 1L6IA 1SZDA 1NMYA 3NZEA 2CVOA 4WLVA 3WLMA 4BL5A 1HDGO 1K75A 1U5CA 4HBZA 5J2UA 3EIQA 4DWOA 4XXHA 1U7OA 4X1KB 4ZU3A 1UFVA 4ARBA 4CMBA 1JLLA 1F8GA 2QHXA 3LJKA 4GP6A 3WX0A 4D82A 1GZ4A 3KV3O 5CDFE 3L43A 5DI9A 2QN7A 1BMQA 2Q2VA 2Z9DA 1GLNA 1OFUX 2O7QA 3CG0A 1P0MA 2F1KA 2GZHA 2H07A 1E0DA 1OIWA 5I45A 2YDXA 4NATA 3KJQA 4EFLA 1GKLA 1YCHA 2VJOA 1UBHS 4MHTA 2AOUB 3ZBTA 4L75A 1JU4A 4ZT3A 1T9BA 5AI8A 5AOAA 4YV7A 2H7CA 2II6A 2VJMB 2X76A 3ZCXA 5J47A 2JIZD 3S0JA 3S8YA 5LQMA 4P92A 1QFZA 4W8HA 5FFMA 2C7PA 1ZD8A 5TJHA 2IELA 4PYIA 1RZRD 5H1YA