3ICQB

Karyopherin nuclear state
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
167
structure length
167
Chain Sequence
PTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGLEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Exportin-T
publication title Structures of the tRNA export factor in the nuclear and cytosolic states
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 43
structure length 167
sequence length 167
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3icqB00
1OXSC 1G7SA 1AGRA 1E0JA 1T3SA 3R7WB 5JEEA 1E69A 1DO0A 4LCBA 5CLLA 1CLUA 2HV8A 3CH4B 3QI2A 2ATVA 2VF8A 3OEHD 4ON9A 5FPYA 4DLWA 3MD0A 4MUBA 1DADA 3NG1A 1A2BA 4A2QA 4A8JB 2FEOA 3IHLA 1PLKA 1U98A 5GVRA 4E07A 4GDFA 4XOIA 5BW8A 1HT1E 2ODNA 2V1UA 4HDQB 2WWIA 4P31A 1MV5A 1DAFA 4AY2A 1D5CA 3SC3A 1W49A 3SEAA 1B0UA 1HT2E 2IWRA 1ZP6A 1SVOA 1YQTA 3RC8A 2C04A 3ND9A 5IF9A 5L3SA 2V6JA 1U8ZA 5F9FA 3NWJA 2IYYA 4TL9A 1PLLA 4C3ZA 4A0HA 3B6EA 2BM0A 4KITB 2Y8EA 5P21A 3FKQA 3ZQJA 2BVNA 2YZ2A 4HB2A 3BD9A 3OEHA 5FBLB 1IBRA 3K1JA 4OHVA 2GZHA 3QBTA 1W4BA 2A7QA 3BFVA 1GRRA 1R4AA 3FHTA 1T3HA 3B60A 3SBDA 1KI8A 2YYZA 1XP8A 5LDDC 3OZXA 1KSFX 1VG8A 1N6HA 4Y0VA 5IT5A 3BB1A 3I32A 4OQNA 2RCNA 1VHTA 2RGBA 1IAQA 3NBZC 4RKFA 4RVCA 2C99A 3B8HA 1QF9A 4JLJA 1Z0DA 4H9GA 3UKDA 2WMNB 2CCGA 2JLSA 1ESMA 2JLWA 1E4YA 3KQNA 4A15A 2JLUA 2YC4C 2R6FA 2VHJA 3KQLA 2QBYB 2CLSA 2O8BB 2WV9A 1HQYE 2CJWB 3GLFA 1S0UA 3EIHA 3T1OA 421PA 2VP2A 3CX7A 1D2NA 2VQSA 3N70A 4B6EA 1PJRA 1P4SA 2V9PA 3KZ1E 4D4LA 1EFUA 3FHCB 3PEUA 2GJ9A 4A6PA 4AG6A 1SXJC 5DH9A 1VCNA 1Q3HA 5FBQB 1O87A 2QTFA 2NMVA 2BEJA 2C96A 1Q0UA 4E09A 1F2UB 1GZSA 4EDHA 3KKQA 2EQBA 3Q8XB 1IY2A 1F6BA 3I4LA 4CT5A 4ACAA 2AR7A 2DWPA 2VH5R 3TK1A 4CEIB 1VPLA 4IVPA 3ZGXA 1RJ9A 3GFPA 4BWYA 3NEYA 2CEAA 3RANA 1WBDA 2ZETA 4HAVA 5SZIA 4Q7LA 4B76A 1KI6A 1FUKA 3W6OA 1P2UA 4Q18A 3K0AA 1GOTA 4BLQA 3NVAA 4Z8XA 3KL4A 1OYYA 3O8DA 3GLGE 2X1VA 5M04A 4AWXA 4OI0A 1P73A 3GJ6A 2X19A 1YRBA 2FSHA 4B3FX 2GA8A 4AYTA 4PO9A 4BRWA 1AQYA 2NQ2C 2Q0HA 1CEEA 3MFYA 3CNNA 5J4LA 1U9IA 4G5QA 2QEQA 1G7TA 4EPWA 1VKJA 5KO2A 5ELXA 2E87A 5A0FA 2IEZA 3FE2A 1TPZA 2O5VA 1QDEA 4D81A 3ADKA 3ND8A 5DSZA 2F6RA 1II0A 1X6VA 3W5JA 2HUPA 5HCNA 4U5XA 5CK4A 5F3WB 2GXSA 2UVQA 2JAQA 3CRMA 3WNCA 3CM0A 1RRPA 1DG3A 3E1SA 3K0CC 2GZDA 4PHGA 5CIQA 3HYRA 2C03A 2UKDA 5EUQB 3VFDA 4QGFA 1FX0A 2GRJA 3AF4A 2QZ4A 3QF4A 1ZM4A 2ZI3A 2HJVA 3BIFA 1NY5A 2RMKA 4PC2A 3E2IA 3LXRA 1JALA 3MWLA 4FMCF 1I4LD 4KFSA 3THYA 1SKQA 4OQXA 5L3QA 3NIBA 4OHWA 1G6OA 4A82A 2OAQ1 3RS3A 5BN5A 2A5FA 1UAAA 2HCBA 1NF3A 1KO7A 5AUPB 2RGXA 4C0SA 1KJYA 5HPYB 4BE7B 4QBFA 4HB0A 5B64A 3UPUA 2ZRIA 3GFTA 3GJXC 4I1UA 5SZHB 2OEPA 3BERA 1ZNZA 3EG5A 3KQKA 4Q48A 1S8FA 2J0VA 4A9AA 3J81k 4UXHA 2D2EA 3TQFA 4B43A 3AGQA 5TV2A 4Z1MD 3ADBA 4DDVA 5TARA 4AK9A 1TAGA 1P7CA 4QM7A 1R8QA 1XB2A 5E7MA 3AVVA 1W5TA 5FTMA 5JJKA 2O8FB 3H0KA 1LF0A 1XMIA 2WZQA 2ZSFA 3OAAD 2J59A 3R7WA 1WA5A 4KLZA 2DB3A 1KMHB 5EXXA 4MGIR 3RABA 2IX3A 3LQRA 1G5PA 3TVTA 3AVQA 5AK0A 5JRZA 3MLEA 3U7FB 3RRMA 1Z3IX 3CPHA 3KTAA 4PHHA 5L3RA 4Y0AA 3T15A 2A9KA 4QHTA 4AIIA 4AC9A 3TW8B 3NKVA 4V0NA 2H17A 1G3MA 1W1WA 2IYVA 3GQBA 4CT4B 2BDTA 4JZKA 1OXXK 2NO7A 1GL9B 2QENA 2GEVA 1SXJE 4QGGA 1TADA 1XJ0A 3NDBB 4KBGA 4GSYA 1W2GA 4DDUA 1Z0AA 1G8GA 2O8DB 2ZSDA 4Z1MA 3GPLA 1SXJB 4GI7A 2QPOA 4D0NA 1U90A 1JXOA 2JA1A 2KBFA 1OHHD 1W48A 1ZM7A 4UQOA 3OAAA 4QRHA 1ZU4A 2IYWA 1EFHA 2J9RA 3PVSA 1NVVQ 1T8UA 3BB4A 3VNUA 1Q1BA 1FP7A 1XPOA 2QAGA 4MYTA 4E03A 4TYWA 3K53A 3KFVA 1N25A 3NC0C 3NH9A 3W3ZB 1UADA 2AK3A 3IGFA 4P4UA 3M0EA 4HZIA 1UF9A 2Q3HA 4JMPA 2ZRNA 5FUWA 2R62A 3RS7A 4DDWA 4GP6A 4JBXA 3L0PA 3CRW1 3UWOA 4RZ2A 1IN8A 2FFAA 4PZZA 1DS6A 2UZIR 2G6BA 1E0SA 3KKNA 3ADDA 3UIEA 1RYHA 4DLRA 4M9ZA 1D9XA 2QBYA 2JLYA 2O8BA 1OHHA 3IO5A 3CX8A 1NN5A 4D25A 2CJWA 4R71A 2YOHA 2IUTA 3KJGA 2ZQ5A 4RY2A 5HE9A 5SZKB 3U4QB 4Q1DA 4OI1A 1Z5ZA 2ZVPX 2W0MA 4DCUA 4C2UA 1R10A 2IK8A 4HAXA 3PJRA 4MRRA 1P72A 4RJLA 5FTKA 2IYTA 1II9A 4JJZA 4LJAA 3TQCA 2YWEA 4CRWB 3I5YA 3CNLA 5FL3A 3ETLA 1RFLA 2P2LA 1G4UR 4B47A 2OHFA 2EFCB 1G20E 2FSGA 2JEOA 2O8CB 1SHZA 3L0IB 4CEIA 2P6UA 4LRWA 3ICQB 5FOVA 3RYTC 4MRPA 3IPXA 1RIFA 4PC1A 2R2AA 2BKUA 5GJVC 2XB2A 1T6NA 3U7EB 1U99A 2WIBA 4F4IA 4WAUA 5IRCD 3FWYA 5BXQC 4YMSA 2ECKA 1EK0A 1XU4A 4NDZA 1DARA 1ZC4A 4DWJA 3FYHA 2D7DA 2WPDD 3K70C 2QQEA 2A5JA 3EC1A 4NBSA 2O8EB 1JECA 1YR9A 2Z0MA 3A1VA 3C15C 2OAP1 4PSAA 1DG1G 4F4JA 1OFIA 1W0KA 4TSFD 2NO0A 2QU8A 2QROA 3QG5A 1A7JA 3UATA 3BFXA 2ZM5A 1G7CA 1BS1A 3EWSA 3VR2A 2WAXA 3IO3A 1MRNA 1Z2CA 3RAPR 4TLAA 4NZYA 2BM1A 4QG7A 5B58C 4A0RA 1GITA 2IXGA 2GEUA 1M7GA 2ZI6A 1JBKA 3KX2A 3QNUA 1K8RA 5H68A 3RS2A 2OFXA 5LD2B 2P5TB 2YWHA 2A5DA 2EFGA 3PXGA 3AVPA 3L0OA 4TMTA 4JS0A 5J4VA 3SJBA 1L7VC 1G16A 1MT0A 3GJ5A 4FMDF 2WPDA 3AVUA 4HYYA 1KJZA 4WZAE 4DIDA 4DT1B 4B35A 2D06A 1XCGB 2QP4A 4ITRC 2H16A 3QOFA 1HYQA 1MABA 1KDPA 1KI9A 4JVLA 4TSFA 4ZIRB 1U8YA 3ZLJA 4TMVA 4G5GA 4XJXA 1XEXA 4KBFA 2F55A 2G3YA 3CH5A 5FR2A 3CKLA 3MUFA 2KJQA 3LBNA 4NYIR 4A2PA 1GNPA 1E9RA 3TNFA 2DR3A 4DSTA 1E99A 4FW9A 3X2SA 5H8WA 1KHTA 2ZRPA 3P1JA 2HLDD 4X8HA 3WRXC 2PH1A 4F7WA 1AS2A 3AP3A 2O8FA 1G3RA 1TNDA 4XWKA 2VPPA 1UBFA 5CM9C 5JRJA 4RD1A 3SN6A 4KCGA 5SZJA 2H57A 2GJKA 4PSKA 2ZRJA 2IYRA 3IPYA 4IDPA 4WBSA 3DOFA 1ELOA 3U3RA 4Q9LA 3LA6A 5FUYA 2WJYA 3QKRA 1VHLA 2FFBA 2JJ8A 1GTVA 2ZREA 2QP3A 4IEIA 2B92A 2H7VA 3RRNA 1XTJA 1ZD8A 4RZXA 5C46F 3ONWA 2X2FA 2R6AA 5HCIA 3BE4A 1T5LA 3D3QA 4IFEA 4HZUB 3N2EA 2G9NA 2AWNA 4JYBA 4LPKA 3DL0A 4XTCS 4BFTA 2OLJA 2ZYWX 1IN5A 2O8DA 2VP5A 2HLDA 3C41J 1I2MA 5FI1B 4LHVA 5LB2A 3LV8A 3GJ7A 2VSOA 2Q21A 4MYCA 3M4YA 3ZVNA 5KHOC 4V03A 2AK2A 4PQFA 2RGGA 1GKYA 1S9DA 4URUR 1W2HA 5UKDA 2ZTSA 4LJ9A 1G1MA 3K9HA 4DDTA 2CBZA 2P65A 1PV4A 1OJLA 1GAJA 2XAUA 5F2EA 3PUZA 3LLUA 5GADl 4V0LA 5EJEA 5G3ZA 1TU4A 2ZJYA 1KDOA 1E98A 2B7BA 2QSYA 3KDSE 1US8B 2NO6A 3VR5A 4JLKA 4A0FA 3ZH9B 2AL7A 3K70B 3SQXA 4ESHA 3D6TB 1UBGA 3IQWA 2ZS7A 1KK2A 1AS3A 3CBQA 3EPLA 2FJUA 1E2PA 1E2FA 4CVNA 5J5CA 2XJ4A 1C9KA 1ZUIA 4TT3A 5LB4A 5CDFE 2NO9A 3RRYA 1LY1A 4PZLA 2VL7A 3F3YA 1GNQA 3AKEA 1M8PA 4L16A 3B1XA 1I4DD 5LBIA 1JPNA 4MGZR 2H5EA 4WIAA 1E9FA 1TEXA 1G7RA 3TKLA 3U4QA 4JYCA 4JL5A 4C30A 1G41A 4NL4H 2HXYA 3AKYA 3T35A 3T34A 4TN1A 1G8PA 1N6RA 2RGNC 3EIQA 4K46A 3K0CA 4Q02A 4JBYA 2RGDA 1AZSC 2ZXUA 4A36A 1NBME 2ZEJA 4GOKA 3F5FA 3SYNA 1NN3A 1HY3A 5EE3A 3VHXA 2HDNB 5F98A 3W8RA 1U0HC 1XXHA 1Z6AA 4DLTA 2WKQA 5FOWA 1CXZA 1WQ1R 2FWRA 1LS1A 3ZZTA 4TYNA 1IQPA 3S1AB 3IIMA 3EZ7A 4OKSA 4FINA 2IYSA 3UK6A 3C16C 2YOGA 3HU3A 3X1YA 1ZJ6A 1U0LA 3HDTA 3ZVMA 4Z8YA 1UJ2A 3QXHA 3V00A 2CVFA 3QENA 4M1OA 1IHUA 1YR7A 2O8EA 1HE1C 4Q9HA 1SQ5A 3FFAA 4HLQB 5FBWB 5KUTA 1YZKA 4YXWD 1F3OA 2WJJA 1E1RD 1SVIA 2WWFA 3B82A 5KSYA 1RW4A 3G0HA 3LX8A 2GXQA 1Z0FA 5FPKA 2LKDA 3RWMB 3I1FA 5G40A 2WWGA 4MITA 5JI3E 1LFDB 3LW8A 1E2DA 4DCSA 5C4GB 5FTLA 1HQCA 2QPTA 3QPVA 4RFVA 5DE3A 3VHLB 4UXJA 4AURA 1JPJA 1VIAA 1ZC3A 3MAAC 3CRQA 1V5WA 2O52A 2IWHA 1CIPA 1XD9A 3Q72A 3EZ6A 2WOOA 2B21A 4WXPA 4W7SA 3A4LA 3BRWD 2HEIA 2VP0A 4U00A 3QXSA 4JJKA 2C95A 2MMGA 2ZE8A 1IJEA 3FGNA 3QEOA 2WSSA 4AD8A 4LC1A 2G1JA 4J0QA 3GLIA 3AF1A 2F1JA 4YXWA 3SFZA 4ZIRA 2GTPA 1E1RA 3HR8A 4JL6A 4KVGA 4MKFA 3TRFA 1GRNA 2IYLD 4MKHA 4DVGA 3AF2A 4NYMR 2YV5A 1ZVQA 2FSFA 2FH5B 2XTMA 4OJQA 4PR0A 1CF4A 3UMFA 1CR4A 1YZQA 5IK2D 1X1SA 4LZZA 1N5LA 3THXB 5CM8B 1JJ7A 4TQ9A 5EP1A 3LFUA 3TE6A 1Z07A 5K8TA 1CRPA 3DM9B 1FQJA 3HR7A 3EASA 4Q7JB 1E2NA 1QZXA 4RSGA 3RC3A 2CL6X 2EWVA 1R8SA 1G17A 1Q57A 3BOSA 5F9HA 4UKDA 3NBXX 5JZVA 4DXAA 1JAIA 4DIEA 5DLQC 1RRFA 1W36D 4TLCA 4M9XA 3DMNA 1RVDA 5K8LA 4GBMA 5HTKA 4GNKA 4JVMA 1OLOA 1TF2A 3OIVA 3KQHA 1FPMA 3QXJA 4TTRA 1NVXQ 3RDPA 2ZUCA 2YKGA 4KYUA 2WIAA 3K70D 1CR1A 4II7A 1BMFD 8OHMA 2QGNA 4HAWA 5IK2A 2DYKA 2N42A 3ECCA 4D2IA 2QTVB 4K81B 1GP2A 2XSZD 2ZYTX 2AHOA 4E22A 1C4OA 3AVTA 1GRQA 4LJ6A 4EFMA 2OXCA 1J90A 1CBUA 3UG6A 3B9QA 1E2KA 3P20A 1GNRA 4N0EA 1XZPA 2V4ZA 2Z83A 2G77B 2GF0A 4IOJA 1XMSA 3WYFA 4FMDB 2OILA 4ZCLA 5KDLA 1WP9A 1JR3E 2YC2C 1VYUA 3WHLA 2WWWA 2BC9A 3Q3JB 2NZ8A 2IUUA 2C78A 3NTUA 4H1UA 4C7OA 2KB0A 5C1BA 1BIFA 2ZSEA 1UEIA 1X1RA 3FB4A 2W2VA 4B48A 5TDHA 2ZE6A 3I3SR 4JLAA 2MMCA 4QJ3A 1N3BA 2QL6A 4AI6A 1QHHB 2XB4A 3A37A 4O2RA 4XSHA 3TJZA 1XRJA 2V6IA 1BMFA 1YHNA 1YR8A 2YINC 5EP3A 3T5DA 2IS4A 2RHDA 4BFXA 1M7HA 3KJEA 3EX7C 3ZZ0A 1L2TA 2WAYA 3SJCA 1TTTA 1R0XA 2C8VA 2FA9A 1G5RA 4QC2A 3VR3A 5CB8A 1X8KA 2W00A 2XSZA 3IIJA 2GCPA 3B9PA 2E1RA 1XCMA 4ZCMA 2PLFA 3EZ2A 5CDFA 3GJ4A 4C0AC 2ZS9A 2XJ9A 4TLEA 4CEJB 4HUQB 1XPRA 4W5WA 1NIJA 1N5KA 4W5JA 4NKRA 1YZTA 5E95A 1CU1A 3TSOA 2KE5A 1DELA 1W46A 3WBJA 2EYUA 2PZGA 4KI0A 4P4SB 1FP6A 5EE1A 3MCAA 3EA5A 4RZ3A 2JATA 2CL7X 4X8MA 3UWKA 4CF7A 2FPLA 2Q3FA 3VX3A 4HI0E 4V0MA 2XTNA 2HYIC 3MWKA 1OPXA 2V1XA 3C8UA 3VU9B 1QHNA 2CE7A 1NBMA 2ZUDA 2ZAOA 3LBIA 4Q4JB 4PPQA 1R2QA 2EWWA 2QT1A 3D7MA 1VG1A 1ZNXA 3QPUA 3NBFA 3UANA 4K8OA 1RE0A 1NP6A 2IS1A 1G3UA 3OIWA 2XOKD 3CLVA 1UBEA 1Z28A 5JSZB 3Q5DA 2VSFA 3D8BA 4UJ5A 1QHGA 1XTKA 2R8RA 4PANA 1LV7A 2ZRHA 5AJZA 2YNMA 5KNCA 4GFDA 4PAMA 1YU9A 4A1FA 4DLVA 3FPAA 4PAOA 3FDIA 3GFOA 4B2IA 3LQQA 4L8GA 2OCPA 2CLCX 3JVUA 4IDQA 1DAMA 2ZE7A 3H86A 1OSNA 4N0DA 3BBPA 5DI3B 2REBA 4EJSC 4YONB 2ORIA 3PEWA 1GVNB 2DWQA 1II8B 5CK5A 4PQYA 4O3MA 2P0EA 1Z0IA 4CGZA 3O8BA 1ZNWA 3DMDA 4XVQA 4BPBA 1V43A 4B3XA 2KBEA 4TMWA 4R7ZA 4DLSA 4DCVA 3CRRA 4NPHA 1G18A 2FU5C 1YZUA 3IILA 4PPGA 2IS2A 3THWB 2I1VB 1T91A 2ZAMA 4BFWA 5JCPA 1OH6A 1NN0A 2XOKA 2G88A 2ZJ8A 4X8LA 4CDGA 2VRWA 4JL8A 4YC7A 1O3YA 4HB4A 1P61B 3R9IA 4FN5A 3SFVA 3GLGB 3F0TA 2O0KA 2RAPA 3DDCA 5KNBA 3FMFA 4D4JA 2BCGY 1F2TB 4XTRA 4JLDA 5EZ6B 2IYUA 2ZJZA 1CJKC 1B23P 2ZR0A 2GCNA 1HH4A 1MRSA 4Z51A 1D8TA 2F43B 3AB3A 2WVJA 1I2DA 3GCGA 1ETUA 1SULA 1XCPA 2GAAA 4WOPA 1GL6A 4ZI2A 4ZKEA 1TQ6A 1UKEA 3THXA 3IKJA 1N6OA 1M7BA 3CO5A 3AKCA 2IHYA 3THOA 5KSZA 2WWXA 1CR2A 1NIPA 2IXFA 2OFOA 4TL6A 1GWNA 3NH6A 1KSGA 3SHWA 221PA 1TF5A 2ZRAA 3CUEF 2LKCA 4RFSA 2VEDA 1QG2A 4URXR 1FNNA 2AD1A 2VHQA 3DZ8A 3CW2A 4BLOA 1SVSA 2OBNA 3NXSA 4AKGA 4NYIQ 4Q00A 1CJMA 1HURA 4YMWA 3N2IA 3GLHE 3CZQA 1G21E 2Z4RA 3AVOA 2HT6A 2N1BA 3KFXA 3ZIAD 5KTYA 3BJIC 3GLHB 4P4TA 5J4YA 2P6RA 2EFEB 2ZJ5A 3DO6A 3OESA 1XTSA 2DFTA 5DYIA 4TZ6A 1M34E 2HCJB 3ZS9A 5J47A 4QNMA 4QGAA 4C0BA 2RGNA 3WMEA 1VCIA 1R0WA 1NLYA 3OFNA 1NNEA 1VYVA 1XJQA 2PBRA 2X8AA 1AIPA 1FMJA 3K0EA 5LD2C 2CVHA 2ZYUX 1ZAKA 1ZD1A 1XTRA 4A8JA 1G8FA 3CB4A 4UNRA 1AN0A 2JGNA 1G8HA 3U5ZB 3U2QA 1CJTC 2ZRBA 3EXAA 2X2EA 3TW4A 4D26A 1P2VA 4ZCIA 4E5UA 4Q9IA 4IXMA 5EE0A 3ZIAA 2YVUA 2DBYA 1K5GA 1TX4B 2ZU6A 5CYOA 2HF9A 4GMXA 4QKQA 4B3CA 2GNOA 4LBWA 2F1IA 4B32A 2WKRA 3UXMA 3RS5A 1A1VA 2H1LA 3C5CA 4NONA 4IXNA 1FUUA 3BC1A 3G5UA 2GJAA 1IXZA 3PEVA 1UM8A 1YE8A 4EJSB 1VMAA 2ZITA 2BV3A 3AQ4A 5TXGA 3QEJA 1GL7A 2R65A 4CEJA 3BK7A 1OE0A 4Q9JA 2WWHA 1Z47A 2QNRA 2Q9BA 4XVRA 3AUYA 1EX6A 4M22A 2PT5A 1SVMA 2FGJA 2AFIE 5JHGB 3BH7A 4JKYA 3B85A 2CCJA 3U7GA 4ZV4A 1S4QA 1T0JB 4MGKR 2FFHA 2XTZA 2OV2A 1DBSA 1LNZA 2G0NA 1OKKD 3W34A 1UKVY 621PA 1IY1A 1KK1A 2Z43A 1Z6TA 2J41A 2VBCA 3B1ZA 2I4IA 2PCLA 2QMOA 4MA4A 4TQUS 3VU9A 3FMIA 2AD5A 4Q4JA 1ZRHA 2F7SA 3I92A 4PHFA 2CHGA 2OFWA 2JLRA 2QM8A 2HJGA 3WY9A 1GIAA 4A4DA 1RKBA 3DPUA 4JVSB 3B2EA 1W0JA 4HEJA 4WXRA 4ASUA 1ZD9A 1JXMA 3AP2A 3QUSA 1ZU5A 4UXIA 4JVNA 5JSZA 4HAYA 3O8RA 3BH6A 4B34A 2ZRMA 3QKUA 4LHXA 4N1AA 4RZUA 4OK5A 4F92B 1NKSA 3FVQA 3RHFA 3PEYA 1WDTA 1WRBA 4Q4HB 1OH8A 1W0KD 3M6AA 3TR0A 1SHKA 5FOUA 1UBCA 3M1IA 2OBLA 4DLZA 4P33A 1Z29A 2WTUA 5E4FA 1A5TA 4X8OA 1FMLA 5JMTA 4MRNA 4OBEA 2F3RA 1Z0KA 1F2UA 2NZJA 1GILA 4LWZA 3EZFA 1OKKA 1P62B 3SJZA 5J4KA 1KK3A 1BKDR 4FCTA 1KAGA 5J40A 1IXRC 3DHWC 3GEIA 3ASZA 3P4XA 5FOTA 4LUCA 4B75A 1JR6A 1OV4A 4QHYA 1NMYA 1NN1A 3THWA 3WHKA 4IDNA 3O8CA 3U6BA 1UFQA 2ONJA 4ABYA 1IN6A 3FFBA 2ZI5A 4BEBA 1DAHA 2A3RA 1T5IA 4KFRA 4S35A 5KNDA 3A6PC 4G0NA 3GLGA 1E3MA 2QPAA 5BYKA 4M1MA 1E9BA 4L5BA 3X1DA 3U3KA 1F2TA 1JI0A 3KKOA 4M1YA 1WXQA 1VDZA 3L43A 1YZLA 1TF7A 5JHHB 4KHZA 1FQKA 4S2EA 4AYWA 3N5CA 4EPXA 4GZMA 4ARZB 2K5UA 3QSYA 2MSEB 1BYUA 1XFAA 2F43A 1S1MA 2DPXA 3U44B 1E6CA 2PZEA 2YOFA 3P26A 2FGKA 1XF9A 5FTNA 4DBLC 2ZR7A 4B3GA 3BXZA 5G53C 3TIFA 4G5OA 2VHTA 1NI3A 1A2KC 2A78A 3K09C 2CDNA 1JQLB 1VIYA 1EXMA 2JASA 2F9MA 4YMUA 2WWYA 2AFHE 2J45A 3MWYW 1Q22A 2WSMA 3AM1A 4MUAA 3I62A 2PL3A 2I3BA 4F91B 4NYJR 3AF3A 1M6NA 3BORA 4MDFA 3RS0A 2OO7A 4QJ5A 1T3LA 3TBKA 4NYMQ 5A5GA 3LAWA 1KOFA 2ZSBA 2ZRDA 2Z4SA 3AGPA 3H2YA 1E2HA 3QE0A 1KO1A 4MGYR 4UNSA 2OCBA 2V3CC 4WW0A 1JEEA 3G82C 2DHRA 4MQBA 1I4TD 5FL7D 5JEDA 5K8IA 5L3VA 1SVLA 4IFBA 3GLHA 3CIOA 4QHSA 5CJPA 2ATXA 1Q1ZA 2LCFA 3CPJB 3CONA 4PXAA 1Y63A 1SXJD 1TQ2A 2VSXA 4QBIA 1DAIA 4AKHA 2JDID 4XD7A 2QE7D 2QUZA 5CYPA 4I1OA 5KPJA 1E0KA 4DC9A 2IYXA 1KYIA 2OG2A 3KQUA 4FCWA 2IT1A 4BZXA 2R6DA 3WP1B 1KMHA 3SOPA 1ANKA 2PZFA 1XTQA 521PA 4M1KA 1KKMA 1A4RA 1ESNA 1GSIA 2D2FA 3AH8A 4KYIB 1ZM3A 1AQUA 4IVRA 2D62A 2NPFA 1SGWA 3ZS8A 3O47A 1SVWA 4Q4LA 2WMOB 1XTIA 5FL7A 5AJWA 2JJ2A 1DVRA 4HB3A 1EG7A 3U60B 3DZDA 2DY1A 1CTQA 2D74A 3LW7A 5JLJA 5DISB 4W5HA 2JLXA 3VX4A 3DOEA 4DLXA 2WJVA 4TT3D 2J7PD 5DN6A 3NDPA 5EXTA 5BQ5A 4US2R 1IM2A 1Z63A 1SXJA 1N2CE 2IC5A 4KU4A 3ZDQA 5CITA 3V4RA 2JDIA 4FI3C 1KZ7B 2XZPA 2QSZA 1KDRA 2QE7A 4I4LA 4EJSA 3WYAA 4Z54A 5J4HA 3LDAA 2F3TA 1R0ZA 3CR8A 5DHAA 1OIXA 4TYPA 4MRVA 3QKTA 4YDHB 1P2SA 2PX3A 5EE5B 1Q44A 5GVSA 1GFIA 2GCOB 1AGPA 4FMCB 4QM6A 3KJHA 4R2HA 4EQ6B 1U9IC 2GILA 2UZ3A 1VECA 2P3SA 3MJHA 4BZQA 4D4MA 5JI2E 1G3IA 1MO5A 3EWAA 1P3JA 1G291 4FMBB 4MH0R 1QHXA 4M8NE 5AJXA 4URYR 3RWOA 4BQSA 1OFTA 4DRZA 4MDEA 1E2MA 1DTSA 2G1KA 4M1SA 1E2EA 3I61A 4LBVA 2IBMA 1RC8A 1ZW6A 1G64A 2J7PA 1U94A 5AJYA 2EYQA 3FTQA 4DSOA 1YR6A 1FOEB 2GF9A 3KXIA 4NE2A 2VHUA 2QTHA 2QP9X 2XEXA 2IF0A 3WXMA 5AUQA 1QVAA 1KIMA 1PZNA 3TGPA 3U3OA 4LPSA 1X3SA 5JS8A 1ZIPA 2REOA 2NG1A 4LHYA 2ONKA 1NLFA 2ZJBA 2ZJOA 2IHBA 1N5IA 3TR5A 2CNWD 2KSQA 2ZRCA 2QMEA 4BLTA 5TY0A 2PEZA 3WNDA 1VG0B 2ODWA 2F9LA 4ZO4A 3W90A 4JLNA 1ODFA 3TAUA 1XMVA 1QG4A 4Q4AB 1NJGA 2G83A 3PFIA 4UNNA 2O8CA 3LNCA 2DFKB 2BCJQ 2OSBA 2ASEA 3C7KA 3KB2A 3K0FB 2PLRA 1KY2A 3PUVA 1E2JA 3BFKA 1F5NA 3VMFA 2GKSA 2NTYC 4IW3B 1BYIA 1W47A 1GKUB 2CMKA 3EIEA 5H70A 3SZRA 2ZSAA 4L9SA 1XZQA 3IUYA 4G1UC 4RCYA 2QMUA 3K8YA 3EW9A 4G01B 5AR1A 3ZZUA 1YKSA 4LHZA 2BBOA 1TUEA 4HAUA 2FF7A 2IXEA 3A36A 1UDWA 2J3EA 1M2OB 5JWOA 4PQRA 4XH9B 4OJKA 2WSSD 5BN3A 1W5SA 1KY3A 1KO4A 4V0KA 2GXUA 4TWZA 1TMKA 3QVVA 2CNWA 5KU1A 4IJMA 1CULC 4DHEA 4PAQA 2ZVQX 3HPQA 4QOSA 3TH5A 4YMVA 1XX6A 2V54A 3BB3A 4OK3A 4OQLA 4B3DA 2Q9CA 4PC6A 1OW3B 3KKPA 5LPNA 3I73A 3OE7D 1ZUNB 1XPUA 1X8LA 5TVKA 4D6PA 2FSIA 2IUSA 2ZI7A 2XNSA 5FUXA 2J46A 3Q5EA 3Q85A 1E1QD 4XWOA 4B74A 2F1HA 1NVWQ 3GEEA 3HJNA 2IL1A 1KKLA 1F48A 2B8TA 4DCNA 4DT1A 1KK0A 1W4RA 4Q1FA 4QBHA 2WBLC 1JJVA 4HSEA 1EFRD 3X1XA 2NGRA 3LVRE 4HLUC 1J8YF 3P32A 5EQTA 2QAGC 2OT3B 1KI6B 4KODA 4MRSA 4URVR 1A82A 4XWAA 4DEXA 3W5IA 3K9GA 4KFUA 1KI1A 2GESA 1TQDA 3L2OB 5FH9A 3LWNA 3OE7A 2Z5FA 2RB4A 3IQXA 3TAHA 2MSDB 2RHMA 3TUIC 4HLCA 1UKYA 3LD9A 3B1VA 4BFZA 3FMOB 2BBWA 5G41A 1DEKA 3SYLA 2C9YA 4M4SA 1U2RA 3I72A 1E1QA 1E32A 1EFTA 3B78A 2R9VA 3ZVRA 2FPMA 1VTKA 1ZYUA 4M1TA 1OB2A 1IY0A 4Q47A 1QHIA 3Q9LA 2IEYA 2RKOA 1XJCA 2ZJ2A 3OF5A 3UMSA 2EVWX 4PC3A 4ILEA 3RSLA 1EFRA 1FZQA 2LWIA 3QPWA 121PA 3PV0A 1MR3F 2QAJA 4Q03A 4LV6A 5E7IA 1Z6GA 3UMRA 1KNXA 1FX0B 2HXSA 3QF4B 3NC1C 4Q1BA 2QI9C 4P3YA 3W6PA 3EPHA 2HF8A 4HZUA 4PSVA 1GM5A 1G9XA 2AXNA 3FKSD 5L3QB 2ZI9A 4M0LA 2OXRA 4V02A 2J7KA 5L8VA 3MSXA 1COWD 1CKEA 3PCRB 4DSNA 3U6KA 3DKVA 2OLKA 3TUJC 2SHKA 3EZ9A 1R6BX 3I8XA 4L15A 1OYWA 4Q1EA 2FDCA 3WRYC 3QY0A 4GL2A 2DWOA 2ZRFA 4B33A 1G5TA 4ZDWA 1LB1B 5FBRB 1AKYA 2WOJA 1N6LA 1BH2A 2JLZA 1M1YE 1P9RA 2GCOA 5BWMA 3B1WA 1U81A 2RGCA 4EQ6A 2J0UB 2GETA 3FMPB 1Z08A 1MH1A 4OI4A 1PVOA 4OQFA 1JEDA 4ZI3A 1Z06A 1XNJA 1VG9B 2CLDX 3DKPA 1US8A 4C2TA 3DEFA 2DFLA 2W83A 3T06B 2IA5A 1MO6A 3TVDA 2ODBA 3KXLA 4LV8B 4XVUA 2J0QA 1NBMD 3HU2A 1FNMA 5HZHA 2EFHB 3EPJA 4EFLA 1OIWA 3FKSA 4TMKA 1E9AA 4I81A 1C1YA 2H18A 1ZUHA 4B2LA 4EPRA 4IEEA 1Q20A 1COWA 1HTWA 2BJWA 4GP7A 3KTAB 2Q3MA 2A5GA 4TL7A 4PHTA 4W9MC 4URZR 2W6JD 4FWTA 2W6ID 1J8MF 2GHIA 3EA0A 1EFCA 1IOZA 4JIMA 2FMXA 1LF5A 1ZMXA 2FZ4A 4LJ8A 4QNRA 4IDOA 4DLYA 1R0YA 1KI4A 1LW7A 1YJ5A 2J0SA 1P6XA 1L4UA 2FN4A 4M53A 3VTKA 1Z83A 4C0HA 1N5JA 3K09A 4BGDA 5K8UA 3B1YA 5KSPA 3RLFA 2CL0X 3UG7A 3WP0A 4Q4AA 3HPRA 2ERYA 1KO8A 1R5BA 4LJ4A 4F38A 3K0FA 1P75A 4KSCA 1L4YA 1K6MA 1QHYA 2D3WA 2QG6A 2XX3A 3DM5A 5B57C 1KO5A 2W2XA 2VA8A 3S1AA 2PMDA 2J87A 3GJ3A 4B2PA 2QAGB 2QA5A 3SJAA 1GG2A 5HZKA 3U3MA 1CR0A 1N6IA 4POAA 1YZGA 1XMJA 2HYDA 2QMHA 2VP4A 4CW7A 2FNAA 3T1QA 2GBLC 2W6JA 2GAOA 2W6IA 4XSGA 2P5SA 3TSZA 4BECA 4DUGD 1G19A 2ORVA 3PQCA 1KSJA 4UNQA 2V55B 2O0JA 4RD6A 2IYQA 2Z6VA 2QGZA 4D0LB 4EPYA 4PO1A 2IYZA 1TU3A 1Z6YA 3B5JA 5HR5A 2AWOA 2I1QA 3W8NA 4JT2A 5TB5A 3QXCA 3LRPA 5KSOA 1W7AA 4D4KA 5DYGA 3CNOA 3QIAA 4F93B 3A58B 3AV0B 4TMXA 4B73A 3OHMA 4A92A 3GP8A 4PTLA 2QT0A 2B6HA 3CPEA 2PJRA 3VAAA 3A1SA 2ZRLA 3AVYA 4JLVA 4JLOA 2ZIAA 2B7CA 3WYGA 1OT3A 2R6CA 2PT7A 2GWHA 2H8KA 1ZNYA 1SKYE 5G3YA 4IHQA 6Q21A 2OM2A 3ZD6A 4DUGA 1AM4D 1E94E 2CK3D 1SKYB 1AA9A 2QORA 3ASYA 4OK6A 2QY9A 4R98A 1HV8A 2VHCA 4RD2A 3IBYA 3QBVA 4PPNA 2ANBA 2C9CA 1KI7A 4DB2A 3A8TA 1E2QA 4IOLA 1WMSA 2EU8A 3NEJA 5EP4A 1OFUX 1OH5A 2VTKA 4TQAA 1X8JA 2ZS8A 3CWQA 4GMDA 3C14C 3QVUA 5C4MA 2OBMA 4RCZA 1NVUQ 5CIWA 4C9BA 3ZD7A 3QKSB 3PUWA 2VLIA 5E3HA 1JAHA 4LGMA 5KDOA 5DO9A 3B7GA 2XZLA 1WB9A 1D6JA 1AS0A 4NYJQ 3H1TA 2A2ZA 3IIKA 3OFND 3KUCA 3SHFA 1W44A 4LHWA 4NHOA 4AYXA 3A1TA 1UDXA 4EUNA 2FG5A 1E2LA 4IDHA 2OE2A 4WVFA 4OHYA 2CK3A 3W9YA 1JQJC 4B3BA 3L0SA 1U0JA 2W58A 2QN6A 4QL3A 1S2MA 4DLUA 5KYKA 4US1R 4PZYA 3W6NA 3KXKA 3GMTA 1JR3D 3A1WA 4Q1CA 1OB5A 1G4AE 2B8WA 1DAEA 3RNLA 5DNYB 3WBKA 3T1TA 4YMTA 2FX3A 2Q6TA 3BAFA 4NU0A 2REXB 2J5XA 1OH7A 1D2MA 1QHSA 2WHXA 1S9HA 2WKPA 2XNDD 3LBHA 4BLRA 1MABB 1NRJB 3LY5A 4ZKDA 2L0XA 4FCVA 4B71A 4LC0A 1XWIA 4KSBA 3GJ8A 4TL8A 1ZM2A 1CJUC 1QBKC 3P4YA 2VO1A 1XEXB 4XIGS 2ZR9A 3CX6A 5JWHA 1X86B 4KLNA 3EAQA 2O0HA 4KFTA 1J7KA 1H65A 4FXPA 4CEHB 3JZAA 4KO8A 2J0UA 5DI9A 2ODEA 1JR3A 1OXTA 3SE0A 4IOMA 2GK7A 3C5HA 1DOAA 3AKDA 1N6PA 3K9LA 2YWGA 1QHHA 1ZINA 2BIFA 3IEVA 4TZ0A 3T61A 1R7RA 4LJ5A 5FOXA 4ESVA 1P5ZB 4O25A 2XNDA 3U7HB 5JS7A 2N46A 4M2LA 4Q21A 2WM9B 4HUTA 4JLBA 3X1WA 1FL9A 2DFNA 1W0JD 3VKHA 4ASUD 4PPFA 3QKRB 3EC2A 2F1RA 4HUQA 4LDJA 3TUZC 1R5NA 2KWIA 3MJRA 1KTVA 3ICEA 1BOFA 1WF3A 3AF0A 4KV9A 4I99A 3PR1A 3QQ5A 3REGA 1Q3TA 4DEYA 2VYFA 3U61B 5FBVB 4ZDJA 4OI2A 4P4SA 2G0TA 4KXFB 1SVKA 3IHWA 1N0WA 4M1WA 4UNPA 1QRAA 3F8TA 4DZZA 2QRNA 2RGAA 2PCJA 3Q7QA 4A2WA 4G5RA 1E9SA 4Q7KA 3C4JA 5D3QA 2ZI4A 4KJZA 4DJTA 2YWFA 3RSOA 1KDTA 4HLUA 4JT4A 2ERXA 2YHSA 2P67A 1N6KA 3VQTA 4UJ3A 2GK6A 4P32A 1D2EA 4C0JA 4MYHA 4L9WA 4TMZA 2J1LA 2QQ0A 4CIDA 2AX4A 5C18A 2PMKA 1T4GA 4LJYA 3AVWA 1UKZA 3HWSA 2ZYVX 3VNVA 2YJTD 1BO6A 1WBBA 1VCOA 5DI3A 4EPVA 1GUAA 4DSUA 4ZDKA 1YVDA 3CF0A 1II8A 4NCNA 1OF1A 1XDBA 1JB1A 4NTZA 1P60A 3HYTA 4BFSA 2JCSA 4HLDA 4LY6A 2NOAA 4LYFA 1S1CA 1N0VC 5KPDA 1NSFA 2AKYA 3ZVLA 1F60A 3TSWA 2BHRA 3PG5A 3QJYA 4QFMA 1Q1QA 2R44A 1MOZA 1RYFA 2GEDA 3SS8A 1E9EA 3QF7A 5JJIA 1DO2A 3GEHA 2BMDA 1XXHE 1S3GA 3IBGA 5CB6A 3T12A 3H4MA 1DAGA 2BMJA 2BKEA 1R5OA 4BRUA 3PIRA 4DKXA 4BLSA 1W36C 1Q1EA 1XXHB 1N0UA 3KUDA 1PUIA 5BN4A 1IN4A 2ZJAA 3A1UA 4H1VA 5EP2A 3KJIA 4HAZA 2BBSA 5H1YA 4GT1A 4HATA 1NJFA 4BFYA 4CZ2A 4DB4A 1PUJA 4LV5B 1NY6A 2DCUA 3LX5A 3NBYC 4Q1AA 3QKSA 1DPFA 3LVQE 1T9HA 1J70A 2GJ8A 4PC7A 4TLDA 4XD7D 4GOJA 3SI7A 5GJWC 3MMPA 4TYYA 1P9NA 3B13B 2CXXA 5ANRB 5DGXA 2BJVA 4OHZA 1XEFA 1AJEA 5BYJA 4O0MA 1E2GA 2V7QD 4AKEA 4P0TA 4JLMA 1E4VA 2H92A 2VP9A 1TUIA 1KZGB 5TMPA 1KJWA 4JSYA 1S3SA 2ZRKA 1DE0A 2A5YB 3A4MA 4LYJA 3KKMA 4US0R 5A4JA 1M74A 5FPHA 3AP1A 1P2TA 1FTSA 1Q21A 1T0HB 2JJ2D 1NLZA 4NCKA 5B30A 4Q7MB 2JJ1D 5B2ZA 4TYQA 3GLIE 4C0KA 1W4CA 5DN6D 1NMZA 4D80A 2XXAB 3L8YA 5FFMA 4Q5IA 4QGHA 5D3MB 5AWFC 1FTNA 4Q19A 4QJ4A 3GLIB 1KGDA 1G8YA 3RS4A 4OYHA 4Q01A 2ZUBA 2NIPA 1ZCAA 5GJCA 5JFGA 1GDDA 2W0SA 2BBTA 2WJHA 1IN7A 2NPIA 1XD2B 2VF7A 3D31A 1QVRA 1E2IA 1ZIOA 1JNYA 5EUMA 2V7QA 5HE8A 4DCTA 2IS6A 4HDOB 1N6NA 4PX9A 2BMEA 4CEHA 1ZCBA 2D7CA 1FFHA 4BLPA 5JECA 1NG1A 3DVLA 3GJ0A 1ZM9A 4G3XA 3SBEA 4WA7A 4YQFA 2ZRGA 3R9WA 4NCHA 4FD2A 3LLMA 1ZBDA 1NMXA 1HA3A 1CS4C 4C0QC 2GBLA 4BFUA 2GVDC 2GJSA 3BS4A 4ZPXA 1AK2A 3JVVA 4N3NA 2JJ1A 3SNHA 3WMFA 4EKDA 3ADCA 1J2JA 2AN9A 3R8FA 4MYUA 1PLJA 1IXSB 1W4AA 1KSHA 5DIFA 3AEZA 4JKIA 3X1ZA 4LOAA 1S96A 2RH5A 3Q7PA 1NL3A 2R6GA 2EW1A 3MRSA 3SR0A 721PA 3FHOA 1RZ3A 4YDSA 2FOLA 4QXAA 5KOYA 3SDZA 4GRAA 3E70C 1SZPA 1AKEA 1VYTA 3TMKA 2NO1A 2KI5A 2JIZD 1XD8A 3CF6R 1EWQA 2PJZA 2C77A 3RRZA 2BOVA 2OCYC 1TQ4A 3T1VA 2FPKA 2ZROA 5CJ2A 2V8OA 2QRZA 3R8CA 2GDJA 4EIWA 1H8HD 4C4PA 4CYMA 1W36B 3MWJA 3V4FA 1XBTA 2GVZC 2X77A 4YLGA 3GD7A 5FOSA 1XEWX 1NVVR 2RGEA 5EXPA 3LH5A 1OIVA 4C7OB 4AG5A 1TL7C 1Z8FA 2C98A 3EARA 2PEYA 3CRVA 3AUXA 1L8QA 2FE4A 4Q4HA 2EFDB 4Q9KA 3ZQ6A 2JIZA 4BZPA 4F4CA 1TEVA 5EXSA 3I5XA 3A4NA 2PX0A 5HKKD 2XGJA 4IRUB 3PITA 3PUYA 2FV8A 1Q12A 1P9WA 3QG1A 4U7DA 5L3SB 3K0SA 4NCJA 4D0GA 1K5DA 5EZ5A 1KAOA 2FZLA 4EFNA 4D82A 1UEJA 4KVAA 4M9QA 3ZJYA 2AKAB 4QBGB 2OCAA 4ERNA 3HP1A 1H8HA 2AXPA 4GPTA 4PO8A 4BFVA 4GOXA 1Z0JA 3OEED 1KI3A 4JSTA 3ZYCA 1E79D 2VP6A 4LYAA 2CCKA 4BEJA 4L4UA 4B6FA 2W2TA 4V0ME 3WMGA 1ONBA 4R9UC 1T8TA 1LVGA 4OHXA 3BWDD 4R2IA 1G3QA 1IJFA 5E7JA 3MG9A 1EGAA 2XZOA 3MGCA 4NMMA 2MSCB 3VR1A 1UPTA 5HKKA 1NKTA 3NHBA 1H8ED 2TMKA 3E5HA 4A8JC 4ARZA 4Q66C 4LBZA 3KB1A 3PENA 3GLFE 1LS6A 2OESA 3PUXA 2CHQA 1RPZA 5FPTA 3U44A 2BEKA 4WZBE 1FW6A 3IDQA 3IEUA 3GLFB 3RVBA 3R9XA 3K9NA 4ACBA 2C2HA 2ORWA 4PFSA 1MO4A 5KDDA 4IOKA 1DAKA 4JLPA 2Q9AA 4BUJA 1EX7A 3OEEA 2HT1A 3REFA 1E79A 821PA 1CRQA 3SQWA 2CHVA 2ANCA 3L82B 4LBYA 1E9CA 1NSTA 4BASA 4IVQA 3CR7A 3QXXA 3VKWA 1RJ9B 2ZANA 3CZPA 1D9ZA 4B44A 5FUVA 4EPTA 4C0LA 1H8EA 2ZPTX 3K0AB 4LJ7A 4GZLA 2E9SA 3FOZA 2FEMA 4OL0A 1GKIA 1MO3A 3T5GA 5JWRA 3WNBA 1YRAA 1WCV1 4NH0A 4WZ6A 2XXAA 3I8SA 4TTQA 4URWR 4LX0A 5D3MA 3H84A 3BH0A 3L8ZA 4G5SA 3AVXA 2OZEA 5GJBA 5FR1A 1EESA 2OUKA 5DHFA 4ZDIA 4O2LA 4LSGA 1KMQA 5JBQA 2ZU0C 1XD2A 4AKIA 1E9DA 4NP6A 4I1VA 1IONA 4IKEA 1KNQA 1OXUA 2A30A 2C5LA 3R20A 4LK2A 3EPKA 3OIYA 5AUNB 4NCIA 3U3JA 3OIUA 2C9OA 1J99A 3JZMA 1CJVC 2VIIA 1RRGA 4KAXA 4I1SA 2FFQA 4M21A 4MKIA 1Y3AA 4MKGA 1Z22A 2BWJA 4A0GA 1VCMA 3P27A 1WE2A 2IW3A 5EE9A 3TLXA 1G6HA 4EAQA 3VR6A 4A6XA 3W3AA 1HEIA 5AJVB 4RKEA 1KI2A 1OFHA 3SU8A 2XITA 1MKYA 3THYB 3CF2A 2BMFA 4RFSB 1E0AA 1Z2AA 2WICA 1NG9A 5IHPA 4FIDA 4HDCA 4M9SA 3BGWA 3VKGA 4LYHA 2QM7A 5FPSA 5FTJA 4TTPA 3LO5A 2D4HA 2JLQA 4RD0A 3HU1A 5C2JB 1HE8B 1OXVA 5JCZA 1CP2A 1E96A 2ZE5A 2GXAA 3NHAA 1HUQA 5FI0B 5AUOB 1LTQA 1AZTA 1EWRA 1Z6XA 4RD3A 4OQMA 2WJGA 5JJLA 3LXXA 2GZAA 5IDVA 1RRCA 4V0OA 1U8AA 2CE2X 3V9PA 4U02A 2JLVA 4JBWA 4LI0A 3CWZA 4RD4A 3SYKA 4TLBA 1YZNA 3VR4A 1XEWY 2WJIA 2IF2A 2P6NA 5CLQA 4FWIB
chains in the Genus database with same CATH superfamily
1IMOA 3W79A 4ENPA 3EJWA 1E0JA 4UEWA 4NQZA 1TE2A 4Q3KA 3QE4A 5CLLA 3LRTA 5T67A 2HV8A 4K1LA 4KPUA 2ATVA 2XCSB 2CXUA 2R8PA 3NS7A 2Q99A 3WFZA 2O48X 2C3UA 3MD0A 3V8BA 4D4IA 4M7WA 1A2BA 2O1WA 5FHQA 3CEPB 5BQFA 2GPSA 4D9MA 3SQLA 4A8JB 4ETIA 4NXMB 1RTTA 4DCMA 2A92A 4MWCA 2FZWA 2V6BA 1OI7A 2CMHA 3PLNA 5FCDA 4LFCB 3F73A 1SG9A 1YT5A 4L1KA 1N4DA 1FDUA 1HT1E 2WWIA 1LDMA 2QQGA 2G1AA 3ANLA 5TE9A 3SEFA 1E3TA 2C0PA 3SEAA 1B0UA 4EY3A 1BFDA 1ZP6A 1GSOA 4RVDA 2V8BA 3E22A 2XECA 4G0OA 5IF9A 2FKNA 1V8ZA 5L3SA 2HGSA 2ODQA 2V6JA 2X9QA 3H1EA 4G5FA 3NWJA 5LLDA 4EHBA 1PLLA 1N2GA 4DMHA 5C37A 4A0HA 3TTTA 2H1VA 1NJ1A 1SELA 2WHPB 2XE7A 1RPNA 3ZQJA 4ZHQF 1VKNA 4DDKA 5FWNA 1N78A 4Z3OA 2WWTA 5K0TA 1ZD3A 1Z62A 3FROA 3KR0A 1Z2EA 3W4KA 3UC5A 3EULA 3VPBA 5DHRA 4OHVA 3QU2A 3V80A 1W4BA 2A7QA 2VPQA 1RM3A 3L06A 4X1IA 4ENUA 2VJQA 3E3OA 3A2KA 5IM5A 1O9HA 2K4MA 1KI8A 5IVIA 2WILA 4UOQA 3SOZA 4JOSA 4KIUA 5LDDC 1K97A 1M2OA 2DOKA 4LIPD 4MIEA 3OZXA 2UYYA 2WC1A 5IT5A 3ASUA 4KUHA 4FVTA 1ZGZA 3I2KA 4C4YA 1VHTA 2AFVA 3NBZC 4G5YA 3WBBA 2P6OA 4F86A 5AKKA 1QF9A 3CVUA 2AXQA 3WAJA 1T1IA 3UWSA 4D8UA 4C1NA 2JLSA 5LQUA 4ZZ1A 3H87A 2NX2A 4IH9A 3NP7A 5CLFA 3MD9A 3TB4A 3V2GA 4HFMA 2CLSA 4W99A 4X6LA 4A6EA 5FUMA 1M1UA 4CTKA 3T3HA 2Z8YM 3EIHA 2ZSJA 1T2VA 3N70A 1KRWA 2VQSA 2AB0A 4D4LA 2V9PA 3ZW9A 3FHCB 1Y3HA 4CMAA 4Z9AA 3WGZA 1SXJC 3L84A 4AG6A 4AMGA 3ZK9A 2UVPA 5JG7A 1NUAA 2H4XA 3ZC3A 5C3MA 5FBQB 1O87A 2QTFA 2NMVA 4NICA 1Q0UA 2W6CX 3JQ9C 4E09A 5CIYA 3GU3A 2P6PA 3OY7A 1TJYA 1DKNA 2G6TA 2O3TA 2PKCA 3QSGA 4M6WB 4XVCA 3OOWA 4OP1A 3I4LA 2G71A 2ZRQA 4KWHA 3EF3A 2AR7A 1C80A 1D1SA 1L8LA 3CUUA 3G49A 2DP4E 4JB3A 1ECFA 1USVA 4IRMA 1V3VA 1TA4A 4KN9S 1RJ9A 4RANA 3RTBA 2WQ6A 2Z1DA 4UM8B 1WZEA 4OGLA 4YREA 3GR6A 3Q6MA 4P9NA 4Q7LA 5NULA 5SZIA 4AS2A 2WF5A 4B76A 3ZJ4A 3K0AA 3W5AA 5A7HA 3BTOA 5C7LO 3NVAA 4Z8XA 5LKAA 1F2DA 3KL4A 4ZMRA 2X1VA 3E9MA 2CHEA 4OI0A 4CQLB 5KJFA 3L7YA 4YJ3B 1B74A 4UPVA 3BTVA 4MUKA 4JA2A 5FULA 1AQYA 2NQ2C 3S7TA 2PBLA 3MFYA 4R0VA 4LSZA 3K8ZA 1BVYF 3CNNA 4KREA 3A9RA 2Z8ZA 1G7TA 3L49A 2BSQA 2AG5A 5EIAA 5LXTA 2BHTA 2ESRA 1NUQA 4IF4A 4O2AA 5JY6A 2E87A 2VT3A 2ZLBA 2IEZA 2XCOA 3T0IA 5KX5F 3Q6NA 4D5GA 2I6QA 1H2RS 1KE1A 5ADUS 2C1ZA 2DT5A 1ZH6A 1NZDA 1XN1A 1VJ0A 3ND8A 2PH3A 4LXGA 3ETEA 2F6RA 3RHTA 3VYUB 5HRCA 1J1UA 3PJEA 3R3HA 5CA1F 4FZRA 1CE8A 1BQ3A 3OCJA 3OPNA 3LPLA 3QUQA 4GMKA 3R76A 3SZGA 1CDZA 3I0ZA 2AN5A 1I4OA 3ON5A 3W5VA 4OKNA 1KHHA 3WNCA 3T3DA 8ADHA 5EUQB 3D3WA 3E1SA 4RADA 6NULA 4KE6A 3NPMA 4FW8A 1FX0A 2Z5VA 3QF4A 4QGFA 4U6QA 5DEIA 5H82A 1GKKA 1ZOOA 2XYRA 1ZM4A 3W5HA 2YV2A 1CZOA 1NY5A 2K2WA 2W5UA 3RYFA 3U9SA 1YGPA 4F2GA 4FMCF 3PLRA 4KFSA 1I4LD 2B6NA 3FZEA 4UAVA 2VNAA 4KPGA 4V2IA 3AONB 4AO7A 2AS0A 2HMSA 3LI2A 4FOLA 1NQAO 2DX7A 1G6OA 2QLFA 2OAQ1 4RMJA 3RS3A 3URMA 4B4OA 4JJAA 1UAAA 4HCJA 4H7PA 3C3WA 4IUBS 5JZBA 1KO7A 1ABBA 1KWKA 1T5HX 5F51A 1EVEA 1GPMA 4C0SA 1KJYA 3WIEA 4HB0A 3BWMA 3UPUA 1N3IA 1RHJA 3I39X 2OEPA 3BERA 4QUHA 4JU8A 3LYUA 4Q48A 2J0VA 4WLVA 1ZX1A 4X84A 2WSYB 2D2EA 1NQWA 4W5NA 3VGPA 2ZSUA 4Y18A 3FI9A 5TARA 2YYSA 1P81A 4E3WA 3AEQB 3H3XA 2IPAB 3PI7A 4Z4GA 5E7MA 4CF3A 3LSYA 5IMSA 4RX1A 4UVIA 5IJWA 5AM4A 4UD2A 1TZCA 3LUCA 2ZSFA 2JBAA 3OAAD 3H5NA 3B3FA 4KLZA 3CUKA 3UMVA 1PN3A 2JIMA 1KMHB 4GYKA 3OSUA 3PPXA 1Y8QA 2FR1A 1JEQA 4YV2A 4WN3A 3AVQA 1J2EA 3V3TA 3MLEA 1FLVA 3DF9A 1Q0QA 4ME6A 4HDNA 2Q6IA 2WP8J 3CPHA 1JDVA 4PHHA 5EMJA 4M87A 5L3RA 3RRMA 5ES4B 2E4AA 4IINA 5T4BA 1ZA2A 2BGIA 2EBHX 4V0NA 1AB5A 5AW7A 4N41A 4KC0A 4OGKA 1FTQA 1YFKA 2NO7A 1UPXA 3P19A 5JADA 1XIVA 2VI5A 4NU6A 3NDBB 1YR1A 3D7LA 3PDIA 2Q3BA 1M9NA 4R41A 2IYOA 3SZ3A 1W2GA 3E5NA 1Z0AA 2H1FA 1G8GA 1W96A 5SICE 5KYGA 4LF6B 4Z4EA 4U6NA 1JXOA 3CLRD 2PPLA 1ULSA 2YIVX 4PYLA 1XQ1A 1ZM7A 3HO8A 3AETA 4QRHA 3PWSA 1ZU4A 2IYWA 3HKCB 1B4DA 2J9RA 4IGAA 1PSZA 3D6NB 3FAKA 1XLUA 3KJQA 2CXQA 4MYTA 1ZLYA 3QU4A 5CH3A 3KFVA 1CY4A 2PKXA 1XMOB 2X4LA 3CX3A 3RAGA 4P4UA 1WXWA 4D56A 2Q3HA 5JALA 3ZLTA 3GD5A 1USIA 2VK2A 2H9IA 4DDWA 1ZR4A 5U1PA 4BUCA 1WB4A 3ANYB 4JBXA 4HZGA 5CPBA 1IN8A 2O2IA 1DT5A 3AU8A 5KQSA 1KFKB 4TX1A 1KEEA 3DV2A 1WXDA 3RWBA 2NAPA 2I2XB 4F21A 1SRRA 1RZUA 3TQQA 1JI3A 3JASB 1BD4A 2GLUA 1GGEA 2GD1O 5C35A 3OUTA 3PCXA 1HNNA 2CSUA 4HY3A 3BSFA 3FN4A 1L5GB 4ZAWA 4YJ2A 1B0PA 5L6MB 1QQ7A 4G63A 3D59A 3HU5A 5HE9A 2GAFA 1VLVA 2ATCA 4ZGBA 2WF6A 1Z5ZA 3OE5A 2YMMA 4GQIA 4FI3F 4KQ9A 1K1EA 1C1DB 1USUA 2IK8A 3EMBA 2C5GA 1I0LA 1OWPA 3W0LB 4JJZA 4QPPA 1PNQA 1A72A 3AWDA 2YWEA 2YZMA 1S8OA 4LJAA 5DX0A 5ILQA 5IVHA 1LBHA 2EJCA 2P2LA 4S05A 4FDUA 5THXA 1JHUA 1EWKA 2J6BA 4G09A 1SHZA 2W4QA 2PGAA 5K0JA 1J0EA 5FOVA 5BT9A 4MRPA 5IVKA 3DEKA 4E5KA 1U5AA 3UM9A 1FP4A 3PX7A 3M4XA 2JZNA 1NVTA 3LCUA 4WAUA 2QM0A 3UMGA 1ACMA 3DHNA 1E58A 1CF9A 3MNFA 4JBNA 5KJEA 1EK0A 3AIIA 4NBWA 4WLOA 1DARA 2R97A 1EEXB 4TWAA 4H3VA 4EL5A 2D7DA 2H29A 4R84A 4YRTA 3ANSA 2CNNA 3K32A 5JD3A 3VSDA 2A5JA 2DHQA 2VJKA 3GJYA 4OXKA 1FFYA 1GLGA 1KVUA 2Z0MA 3C15C 2OAP1 3HBJA 3P9RA 3VYVA 4F4JA 1VE5A 3KVOA 2A0XA 1GZHB 3N07A 4MO9A 1OFIA 3T9AA 3A3YA 1H1TA 3QG5A 1A7JA 1QTIA 3T38A 2VNIA 1GPKA 1QKIA 4KLRA 3V1YA 2PSHA 5B3KA 3FBGA 4WNAB 3LPAA 3EWSA 3PFFA 3VR2A 2ZT7A 2ORED 3WLEA 3OU6A 3ZWXA 3ICPA 1ZGBA 3RAPR 4YCMA 1I6WA 1PJ8A 2GYWA 4FKZA 4QG7A 4CI9A 4I1RA 3FCCA 4RY0A 1I3LA 4KRGA 4BO8A 5KS2A 3QNUA 4BEWA 5H68A 3S1SA 4EUEA 4B6OA 2P9ZA 4G0QA 4BFLA 1NNI1 2YWHA 2A5DA 3MFQA 2P9TA 4JS0A 1UP4A 1L7VC 1G16A 1MT0A 1ZNQO 1A8QA 1DOHA 1O94C 2QNIA 2VJLA 2QJFA 3EB9A 3AVUA 4K6KA 1ZITA 4WZAE 4DT1B 2A9OA 1FFDA 4HQNA 1IQUA 1EFPA 1UZUA 3GNQA 3QOFA 4DA8A 2GO1A 2WR8A 4NDAA 3A3PA 4LYEA 4WZAB 1FPQA 3HL0A 4JVLA 1JGTA 3QEKA 2WFMA 4TSFA 4ZIRB 1L4GA 2VDPB 3GNTA 5K4AA 4G5GA 4RHYA 4B83A 1G0NA 4QJBA 4IO1A 4NMXB 1XEXA 1XJ5A 3L79A 4KBFA 3W9BA 3WIUA 3CH5A 3MS4A 5FR2A 3ZDBA 2KLHA 1Q0SA 1Y5MA 2II6A 2KJQA 4IS3A 3LBNA 4Y6QA 5IZ4A 4NYIR 4D8YA 1E9RA 2I1LA 3BWVA 1NI5A 1PJZA 4UULA 5DOVA 1ATIA 2IV3A 1E99A 2B8NA 4Y6LA 2WNHA 6ADHA 3N8HA 2Y6UA 3X2SA 3P1JA 1UZLA 3CUVA 3WB2A 3WLPA 2J5RA 5JQGF 1OAOA 4BATA 2WAAA 1RI4A 2HLDD 2FCRA 3L92A 3WRXC 3TXXA 2JGAA 4DJJA 1KEUA 1AS2A 2XWBF 3AP3A 3L1VA 1G3RA 1TNDA 3LBYA 4IHJF 3ML1A 3N2YA 2E4VA 2NUPA 3ZW8A 2VPPA 5HXAA 4TQGA 5LNK6 2RC6A 5JNTA 3UF0A 1P1JA 3SN6A 3P2KA 5FA5A 2H57A 5SZJA 2GJKA 4N5LA 1IEXA 4J2TA 1Y48E 1IVNA 3PIIA 3IPYA 4WBSA 2PS9A 4UHHA 5H81A 3F74A 3U3RA 1RPJA 1NQVA 1YZHA 2G63A 1FXUA 3QKRA 1IN1A 1OASA 4ZVQA 1GTVA 5A3RA 2ZREA 3VTFA 1E18A 4RDIA 5DNUA 3O21A 2QP3A 3QVGB 2J3HA 4AU1A 3TW8A 1P19A 5I3ZA 4JH0A 2H7VA 1WPGA 1ZD8A 2VZ0A 4CCSA 5FWXB 4DREA 5C46F 3IDZA 5HCIA 5I9SA 4IFEA 1AHPA 4JYAB 3TLGA 3ZHCA 4D8VA 1TAHA 1PCXA 3EXEA 2QUBA 4JYBA 3X1KA 4BFTA 2X0NA 2CDAA 2ZYWX 1USGA 1H5QA 2VP5A 5JDCC 2D3TA 1ULZA 3C41J 1L3IA 5ES3A 3ZWKA 4UOEA 3E84A 3LV8A 3GJ7A 2ZWMA 1IDN1 2Q21A 5KYYA 3ZVNA 3WLTA 2JANA 2BP7A 1DV1A 2FSPA 3A1NA 4PQFA 4Z4IA 1GKYA 1YI1A 4URUR 4CMEC 2ZTSA 1PV2A 4P4GA 3IHKA 1PT5A 4DDTA 1U80A 1PV4A 1JIKA 1GAJA 3B2NA 3CMMA 3LLUA 2BFOA 1OX5A 1T6YA 1I1QB 2QLMA 3AEYA 2I71A 4V0LA 5ILGA 3MCUA 5G3ZA 1X7WA 4IKOA 4QTZA 5C1OA 4BNLA 1Y6QA 1M6HA 2A1TR 2NU9A 2RARA 2WU4A 2BI4A 5DLDA 4D3SA 2Z2ZA 4A0FA 3PA6A 3BX1A 3K70B 3K4HA 2H3HA 5DM1A 4AW9A 4ESHA 4Z7JA 5JYDA 1GT91 1H9BA 1AS3A 5ICEA 2YTZA 5BVGB 1B2RA 2XJ4A 1C9KA 1OWMA 1ZUIA 2B1IA 4UVHA 3TR6A 3N8DA 1M1XB 1F0NA 4ARIA 1NRXA 3ZH2A 3RRYA 2IZ0A 5AVQA 2B3DA 3FVWA 1TOAA 4D4GA 2FMIA 4RGYA 3AKEA 4DA4A 5AM5A 1ORHA 2QI9F 3DDOA 4MIOA 2PS3A 3TNJA 3EF1A 3L05A 4EATA 1QFYA 2B7LA 1E9FA 3P71T 1XDGA 2QX8A 4GAEA 4V39A 3C3DA 3HFGA 3U4QA 4WWHA 4JYCA 5B7PA 1Y1LA 2I8CA 2PO5A 3F96A 4FDMA 4C30A 5LZ4A 3CU5A 1Q2XA 2HXYA 3T35A 4TN1A 2VJYA 2RJNA 2RGNC 3EIQA 3K0CA 4Q02A 4I1PA 4I3GA 3NNDA 5BUCA 1U2TA 2ZJFA 3GV0A 2AFRA 4EYGA 3RGWS 3LQYA 5EE3A 3V4VB 4RTMA 2VJBA 3A10A 2WKQA 5FOWA 4WJZA 4QSHA 1WQ1R 1GEEA 3ZZTA 1XTTA 1J49A 1IQPA 1KYXA 3IIMA 4YP1A 5HX7A 3Q41A 5FNVA 4HDSA 3UK6A 3DF7A 5E2BA 1W0CA 1SG0A 3P0EA 3ZVMA 1NDUA 4DUPA 3GVXA 4QICA 5ALJA 3LE8A 1CK4A 2BMWA 4WZBB 1JG3A 4Z86A 1QP7A 1L5MA 1SQ5A 5FBWB 2BE7A 3G3EA 3R4CA 2WA2A 1U63A 1K4MA 1O95D 5AKLA 5AW2A 4YXWD 2WJJA 3SIRA 5A4FS 1SVIA 3IDFA 3WLFA 5KSYA 4JFRA 3FFWA 3G0HA 2RH8A 3WQRA 3EBPA 4GX1A 2ZB3A 5FPKA 3ST7A 4WY2A 4Z4QA 4PONA 1V7PC 2XE6A 2WZCA 3NHYA 2WWGA 3OJEA 2XEDA 1LFDB 1S2OA 5G40A 1W85A 3GAZA 1M6VA 2XD4A 2I65A 2QPTA 4KV7A 3QPVA 4EG3A 3Q10A 4G4GA 2YFHA 2ZB2A 1JPJA 3BZBA 1S3FA 5CT6A 1VIAA 2ZT5A 3MAAC 3CRQA 3D6FA 3PR2B 4BNGA 4Q9DA 5BW4A 4CMGA 1FVHA 4HN2A 1SQSA 3KBOA 3Q72A 5CYGA 4ZI5A 3GA7A 2B21A 2AV6A 4B7ZA 1QYIA 3GVPA 3BRWD 4LF8B 2HEIA 3W2HA 2VP0A 1RPTA 3UMYA 3LY8A 2VN8A 4Q82A 1L1RA 5DDIP 3BN3A 4TGLA 1SWWA 2C95A 3B52X 3EVNA 5I7HA 3JD1A 3Q7SA 1V11A 3S6JA 1K8YB 5E6RA 2Q1UA 3E9EA 4AD8A 3N53A 2G1JA 4JOQA 3RPEA 1R50A 1YS6A 2XVMA 3W5UA 5KYXB 3HXQA 4MI1A 2XE8A 3GLIA 1NV8A 2Q4TA 4JL6A 1HYBA 3SYTA 1BEEA 2YDYA 3RAFC 3V7YA 4GI5A 2QBYB 3AF2A 5C52B 2YV5A 1VIDA 1ZVQA 5MDHA 1TIBA 4OO3A 4D8WA 3NHFA 2FH5B 5EESA 1UBKS 2AN1A 4OJQA 4ID3A 5FWAA 2LCIA 4FFMA 4RGQA 1L5RA 4GXQA 1KFJB 3VGJA 1M6YA 3IJRA 4LZZA 1FJGB 3DW3X 2RHJA 3THXB 5CM8B 2NM0A 1P1FA 5CDYA 3TE6A 1LSSA 2Y93A 3DM9B 2WHQA 1XFDA 3FPKA 3HR7A 3OPYA 3PXXA 3HCRA 3CVOA 4B6JA 4RSGA 3OIGA 1IATA 1G17A 1R0LA 1SZCA 2DUJA 2HNBA 3PUHA 4UKDA 3HCCA 5CLHA 1T8RA 5CB0A 3EUWA 2QUIA 2Q3JA 3WC4A 1JAIA 1HFWA 4QYSA 2JIDA 1RRFA 4JUIA 5DLQC 3ZI4A 2VCEA 1ZSNA 3F7MA 4HNHA 4NBNA 3ZY3A 3DV0B 1SHJA 3V4LA 1WSBA 5K8LA 2LBPA 4FGZA 2CFRA 4GBMA 1CZUA 5HTKA 3G85A 4L2IA 2GARA 3S40A 4EYEA 3MILA 5KAMA 4NBVA 4RYLA 3NJRA 4Y2RA 5AMXA 3I58A 1NVXQ 4TTRA 3HV2A 5CCDA 3AV3A 3V6MA 4B4WA 1VZ2A 1QVWA 1E64A 2NTJA 3D3EA 1ADBA 2Y1XA 4BLUA 2O3SA 4RTRA 4PHCA 4HAWA 5IEJA 2WE8A 1X2EA 3AR6A 1RI5A 1Z5WA 1ZRNA 2BH9A 2N42A 4FNOA 4H7FA 5B2EA 2FN7A 4K81B 4E22A 2ZYTX 2V0NA 4MTLA 3AVTA 4LJ6A 4EFMA 4O1MA 2WW8A 3PTZA 4H4DA 4L5YA 5CVUA 5KOJA 1GNRA 3EX7C 4E12A 2G77B 2GF0A 9LDTA 4CU5A 3GF4A 3WYFA 2EBFX 4ZCLA 4WLUA 3PXAA 2BGNA 3D6JA 4G97A 1RJFA 1OD6A 2FEKA 3IT0A 4ZRDA 5LCXA 3ZZMA 1VYUA 2JIOA 3AUSA 4YRRA 2WWWA 4CKCA 3AU9A 1YQDA 1RHUA 3V1UA 2C78A 3NTUA 2XZDA 2KB0A 5C1BA 3OQOA 4PS0A 4N7BA 3FB4A 5A6SA 2ZE6A 3I3SR 3OLVA 2MMCA 4ZANA 2BZ0A 4LRYA 5G1PA 4EHKA 4G67A 1Y8RB 4QGSA 5ABPA 1OX6A 1QHHB 2YXEA 3A37A 1ZMOA 4XSHA 5BR1A 1GQFA 3FJYA 3Q9NA 1YR8A 1N2BA 1YHNA 2IHZA 2R85A 3PXBA 5EP3A 2ZBRA 2IS4A 2RHDA 2EZTA 1L2TA 2ECOA 2W6ZA 2W2NA 4PLYA 1R0XA 2QVCA 4NE9A 4L78A 3WK6A 5CB8A 1UT6A 2R0QC 1EB9A 1X8KA 2XSZA 3ONDA 2XD9A 4HNQA 1C0KA 4ZCMA 3HB5X 5JS6A 5CDFA 3GJ4A 4C0AC 2JD2A 2ZS9A 4KR9A 1W88A 4CEJB 2C7BA 2ST1A 1DIAA 3A2LA 1X1AA 3O0DA 4KXWA 4MYDA 2I5PO 1H2AS 3EFEA 3OZTA 2O7NA 4NKRA 5KNCD 1THMA 3TSOA 4AFNA 2EKLA 2YVLA 2EYUA 1BMDA 3AUUA 1YJBA 2A0KA 2DBZA 1IZZA 2HX1A 1OFGA 3RRFA 1MA3A 3DS8A 2YL2A 4ZOEA 4AJPA 2IEDA 2HCRA 4KWTA 3EA5A 3ANTA 2H06A 4NOLA 3GZ4A 3DW1X 1ZVJA 2V3WA 2CL7X 1V7ZA 3EXG2 4ZI7B 2ACKA 5BR8B 3CURA 3VX3A 2XTNA 2X76A 4AJ1A 1N8TA 3MWKA 1OPXA 3GJSA 5HCUA 3GAFA 4BO7A 2OO3A 1IB0A 2CE7A 2V5UA 3LBIA 3H65A 4PPQA 2XLCA 3D7MA 4GKVA 3WYBA 3BE5A 2QTLA 6AT1A 1GA1A 1J8DA 3VNBA 4G1EB 1F14A 3GWZA 3AEKA 4FD3A 2VLBA 3T7TA 5DHPA 3QFSA 4GYYA 4DM4A 4ER5A 1VRVA 1PGPA 3PFHA 3DWEX 1KXZA 3Q5DA 4HWOA 4UJ5A 2BUAA 1XTKA 5DW3A 3UO8B 5KQLA 5AJZA 4MW6A 4QOJA 1WL8A 4FC7A 4DLVA 1H2FA 2W2LA 3BMXA 2SNIE 1B26A 3FDIA 1V26A 3SVTA 2OCPA 4IDQA 2Q3CA 3BCHA 3WNQA 1J2UA 3WL7A 3BBPA 4K6HA 4NXNB 4XX0A 4D1YA 5BP7A 1V71A 4QE3A 2ORIA 3PEWA 1PNTA 1OLUA 3OUUA 3PBKA 1BDIA 3LJKA 4FFOA 4L72A 5CK5A 4DV2B 3AQIA 4GS5A 1ACJA 1P33A 1WNTA 2WIJA 1AGXA 5BWCA 1VJGA 1M8FA 4TUYA 2W2MA 1QC5A 4M7OA 3S5UA 4DLSA 3WLSA 3HKDB 2NZWA 3EYWA 1G18A 3C6BA 2VF4X 3SXPA 4IG9A 4J07A 3WZ2A 2QTBA 2BMVA 2FR8C 3KJXA 4ZAVA 4E5YA 3THWB 4UUQA 4AULA 3PC7A 4UU1A 1U6JA 4INAA 1OH6A 1H22A 2NSDA 1IEWA 2XOKA 3KRTA 1BA3A 1U4NA 2IUFA 4JB2A 3K2QA 4N18A 5E8RA 4CQMD 1ODTC 4HB4A 4GZ6A 1OVMA 3QUTA 3UJPA 4RS3A 4YUVA 4B6GA 4TLLB 1TW3A 1VLHA 1KA9H 2Y9PB 3CLHA 3FSJX 1URPA 4UC0A 5HF6A 1ITZA 3T99A 5J43A 3OFSA 1VE6A 4XTRA 5ISMA 4EUFA 1CJKC 1PX2A 4FBLA 2GCNA 1KWGA 1TXGA 3GT0A 3MT8A 4BAGA 3HS3A 4UEJA 1BAPA 3TZBA 3G9TA 1I33A 1XCPA 4EY4A 4D9GA 4Q3OA 3V42A 1SIWA 1I4WA 4K9RA 4CHTA 3AL3A 1ZXXA 3HKBA 3G2HA 3N28A 3BUSA 1KC1A 1UKEA 2PA0A 3RSSA 4ZYLA 3AKCA 3DPIA 3I3OA 5TPWB 2WWXA 3CCBA 3QTBA 3SD7A 5KOHB 4P38A 2YV1A 1R37A 3N6VA 3SX4A 4PS1A 3OTQA 1ZD5A 4TL6A 5AO9A 1KSGA 5LSAA 3JQQA 4MINA 1A8SA 2FWIA 1O4WA 1J5EB 3ZI7A 1ECGA 3PL1A 1PGNA 1Z5GA 3Q7TA 1HYEA 3SGLA 3OT1B 4B4VA 3U16A 2VEDA 4XFJA 2AQKA 3TZQA 2TECE 2PGXA 1DSSG 1FP1D 1FNNA 1T9GR 1AY0A 1B73A 1NMQA 2X41A 5EWLA 5IG2A 1XRQA 3CW2A 3NRJA 4ZYXA 3NXSA 2OBNA 3BIOA 5DULA 4Q00A 4M83A 3MWFA 3VZCA 4GX5A 5GONA 3K2IA 3L4BC 4OM7A 1JWLA 3AVOA 3CNBA 3HLYA 3ORYA 5TQJA 5ADHA 5BV0A 3L9WA 1YB4A 2IQ5A 2PA3A 4JP3A 1TJNA 5KTYA 3O3CA 2Z5LA 4WFIA 1UWLA 1M2VA 3L1HA 5DVZA 3BSWA 5F76A 1BROA 1I3KA 3OURA 1G59A 3CF4A 2NXJA 5ETJA 1HL7A 3NM5A 3NT2A 4I3FA 4ZEOA 1J0DA 3NI2A 2HCJB 2OKCA 3ZS9A 1LEHA 5JOQA 2PHZA 2ZVDA 1ZQ1A 1VCIA 5A4MS 3SE7A 2BFFA 1NNEA 2JKZA 2B9EA 3OLWA 2ZGVA 2Q4DA 3QFRA 5LQJA 4FLFA 1KFCB 2OB2A 1GPNA 1DKRA 3C5VA 2ZYUX 3NWBA 4MULA 2HK6A 4K40A 2VOJA 1ZD1A 4KW7A 4WJKB 5E9AA 3U37A 4DXDA 1XTRA 5IWAB 1QRUA 3CISA 1KMIY 2ZIWB 3A04A 4PBRA 1DUVG 5EOVA 1CJTC 2ZRBA 3EXAA 4FSDA 4B3IA 1QE5A 2R5FA 2EGGA 1G1AA 1Q1AA 4F9EA 4Q9IA 4IXMA 2ZU6A 5IZCC 2WU0A 2PZKA 1CYEA 3RFUA 1N9KA 1TQ8A 4QLOA 2PPVA 2F1IA 3DCJA 3I9V6 2CKDA 2RIPA 4QGBA 4RH1A 3EA4A 4B32A 1QOQB 2H1LA 5HBRA 1A1VA 1FUUA 3BC1A 5EIBD 5EWMA 2GJAA 2C2KA 3AESB 4M99A 1HFJA 2W22A 3DFZA 3A9VA 3F9IA 3PEVA 4ND1A 2ZITA 4ZHSA 5A5VA 5TXGA 3SZMA 3QHQA 1XEAA 4TS1A 4ZOQI 1DOZA 1CZRA 3DBHA 1N3YA 3BK7A 3WL4A 4MMZB 2WWHA 1X87A 1Z47A 4UCWA 2JAHA 2B4RO 4XVRA 1J8QA 4J8PA 5EIHA 4F2PA 4PSCA 1EKXA 4QAJA 1LFAA 1KIFA 3BH7A 3KVRA 4IX9A 3K1AB 1RMTA 3FRJA 4YQYA 2C5HA 3R6WA 2O3JA 4YK7A 1RQPA 3R3SA 4RH3A 4BQOA 4KXQA 5KU7A 1ZJWA 1LNZA 1TIPA 4L9RA 2B35A 4ROTA 4WGFA 1UKVY 2X9NA 2ZXEA 1KK1A 3FBTA 1GPWB 2Z43A 5LM3A 4A3SA 3ILHA 2VBCA 3EVCA 3OECA 2PCLA 4OEHA 4MA4A 5L7YA 1T9CA 3SPXA 4U7WA 4KXNA 1LH0A 4PBTA 1UWKA 3H9BA 1UWCA 2EKPA 2DH6A 1AGNA 1RKBA 3DPUA 3ND5A 4U6SA 3UK0A 4TKVA 1LQ2A 1VLLA 3FDZB 4K1XA 5F64A 1XZNA 1R16A 1ZD9A 2NNWB 2Z8YA 4P3PA 4WXRA 4ASUA 1CW2B 4WKOA 5JSZA 1TM4E 1TMGE 4C4OA 2QLTA 4EYKA 5LP6C 4B34A 1DRWA 3N74A 3L01A 4LHXA 1NKSA 1QOPB 2V7UA 3FVQA 2CJYA 4YRKA 1WRBA 9ABPA 1G6Q1 2OM6A 3M6AA 3MBIA 2FN3A 4YMIA 2PZMA 3M1IA 2AKEA 1JZQA 2OBLA 3KALA 5EGSA 2DMRA 1DKLA 3STWA 2WTUA 4MV5A 4P35A 1BGVA 3H2GA 3JWJA 4MRNA 1U6KA 5ENVA 2NZJA 1MU0A 1MIOA 3GQVA 1GPJA 3JQ8A 4CKEA 1EUCB 3EZFA 4RZIA 1P62B 3ASVA 3CFYA 4KGXA 1X1CA 4TV9F 3OP4A 3IE0A 3O3NB 4J6FA 4BOYA 4ZVTA 3AINA 2IBSA 1VHQA 3ESQA 3VZQA 1NWCA 3DCIA 2NSYA 4CV3A 4Z4HA 4U0JA 1C9JA 3GEIA 3LDUA 4M38A 3ASZA 3RTCA 4Q3AA 1GAEO 4PYNA 3H16A 4DNFA 3I2GA 1NTRA 2VDWB 4H7JA 1NMYA 2OD2A 4QHYA 1NN1A 4IDNA 2YJ4A 4RQTA 4I8IA 1ENZA 4JU9A 1QO0D 4LQ4A 5FWYB 2ONJA 4ABYA 3FFBA 2QRKA 1TUGA 4RK7A 5HS6A 4Z9FA 1T5IA 5I8PA 4F45A 3GLGA 3A6PC 2X6QA 4AECA 3JQ7B 4BYGA 2VPTA 5IBQA 2WQZA 2G07A 3LA8A 3LZ6A 1B16A 4A5OA 5CB4B 3L43A 4MUNA 5JIBA 4JXZA 4S2EA 4AYWA 4JI2B 4NK5A 2I22A 3ZE0B 3UGQA 2F43A 3O91A 4RM3A 2R3SA 5GPBA 1PFWA 2H5JA 4LRTB 4DCGA 4G84A 1ZGCA 2X8JB 2P4QA 3LFHA 1E6CA 2PZEA 3LFTA 4RBNA 1XF9A 3KQWA 3TLCA 3X2FA 5J59A 2PYZA 4LFAB 1ZI9A 4B3GA 5AK5A 3WGHA 5C7IO 3O92A 3VPAA 2RKBA 3TIFA 3FCAA 3I0NA 2DZDA 3ZU4A 2A78A 1OPRA 2XWPA 2CDNA 5LMZA 1JQLB 2RI1A 3VH2A 4UUOA 1O97D 3WWYA 2OHIA 2F9MA 2WWYA 2YN2A 1NNLA 3ED1A 4CM9A 4R5HA 2BHNA 1Q22A 2V4MA 3DP7A 2C2WA 4MUAA 3I62A 5TMEA 1PFQA 3NGLA 4BTVA 2NPOA 2XMGA 5IJ9A 1DEAA 1SZJG 3AF3A 5T8KA 3U7JA 4MLDA 5KQRA 4QFDA 3GUZA 3TBKA 1ABEA 4CIXA 2JCGA 3FPEA 1Y8CA 3F5MA 4FT4A 1MH9A 1CRZA 3X1JA 2Z4SA 5FUQA 2R00A 3ZCPA 1ZOIA 1MXHA 1U0BB 1NFRA 1JEEA 3QYFA 4WW0A 5EKSA 5JEDA 3AFOA 5L3VA 3NHLA 2FLWA 4OBWA 5CDSA 5HZMA 1X7YB 1O8BA 4PZUA 1LLFA 2OK7A 3GLHA 2KYRA 2QL9A 2YCBA 3N0TA 2O2DA 3R0QA 1CY0A 2ATXA 3EDOA 3EAFA 1QX3A 3HCOA 1DJQA 4KXMA 4YJGA 5DNWA 1VE1A 4GPZA 2O5EA 3WAKA 4B0PA 4LY0A 1N1DA 1ZPDA 1TQ2A 3VVLA 2JDID 4XD7A 2PBZA 2H00A 1VKHA 3GA0A 3HZZA 4F5WA 3GRCA 3AY7A 1GCOA 3BIXA 3IAHA 1V1JA 4HGPA 1E0KA 4I1OA 5A3QA 4CMIA 5AVOA 3ZDAA 1M2FA 3ZV4A 2ZKIA 4KMOA 4FCWA 1TAQA 2IT1A 3KZNA 3O4JA 4BZXA 9GPBA 1EBFA 1B6GA 3LPMA 3MINA 3WP1B 1KDVA 2W90A 5AOAA 4ZCPA 1X14A 1XTQA 4I4TB 3GUVA 2B82A 4DNQA 5JJBA 1K4YA 3OA0A 1KKMA 4KYIB 1ESNA 1GSIA 2E5LB 1P3Y1 3Q0TA 3UFXB 2JVKA 1SGWA 1I7NA 4WK6A 3ZS8A 1U3TA 3WWZA 2R7AA 2QVXX 2VXBA 1RAGA 1V0JA 3HP7A 3PFGA 1WZIA 5JCOA 4EX7A 1T13A 4IDFA 3H3FA 3IAS6 1EG7A 2FR0A 2I3AA 3LW7A 5JLJA 3QELA 3C87A 5TQVA 5EJ2A 3UBTA 1JJAA 3IQGX 2ADMA 4NESA 1HMPA 4R3NA 1NOKA 4V3CA 1A9ZA 1LI4A 2ISQA 3CLSD 3HCBA 2J08A 3NDPA 4MEJA 1IM2A 4ZCSA 1EGVB 3SC4A 3V4RA 2JAPA 3PQFA 2QYSA 3F2VA 5G4LA 4ENWA 1H9AA 2QSZA 4RKRA 4EJSA 2I3ZA 3TEMA 5HM6A 5JANA 1RJGA 2WLSA 3NP9A 2F3TA 1RKXA 3C3CA 3CR8A 3M5WA 4I4IA 2MINA 3IUPA 4ES6A 3I2YX 1EBBA 1Q44A 3LVBA 4HN9A 4UTXA 5HBGA 1GFIA 2QD4A 1HZJA 2CN1A 3IAXA 4WBXC 5GVSA 1QQBA 2FQQA 4R2HA 5AT1A 1MEJA 3Q4GA 1VECA 2JNWA 1B2LA 3GAMA 4BCCA 1YB5A 4D4MA 1G3IA 5K05A 1QHXA 2XMDA 4M0PA 5H80A 3M9XA 1K9SA 5AJXA 4MDEA 1VL2A 2VJMA 4FFNA 3A14A 3T7KA 2FMFA 3JD4A 5CG1A 1NYQA 3CZ9A 2UYHA 4KR0A 3D64A 4XPIA 1NZJA 2GEFA 1RHQA 4S1TA 5D1NA 4DM7A 1JG1A 1S2LA 2X0DA 4YPFA 3S2IA 4I2NA 5ITZB 2BFBA 4NE2A 1XVTA 2J3KA 1N5RA 4GP9A 4P53A 4F0JA 2ZYIA 1J39A 1SZDA 5HVNA 2DQ4A 3EVFA 5AUQA 3TAUA 1XZAA 1ODCA 1QIHA 3ZUPA 4C7MA 1QVAA 2HSEA 1QAMA 1N32B 3GXBA 3VH1A 1I36A 4LY3A 1X3SA 3H05A 4AY5A 2REOA 2RHBA 3EVAA 1U5BA 4CKBA 5LWQA 2L42A 4ZQBA 4DAOA 2EX1A 2KSQA 5MN4A 2COEA 5IXJA 4PSUA 2ZSIA 5TY0A 2PEZA 4O59O 4AI6A 3BE8A 3L1KA 1K86A 4PPYA 1ID8A 4KO4S 1VPVA 4PSDA 2F9LA 4ZO4A 1U1FA 3GFSA 4IFTA 4E1AA 3F8SA 4M9UA 2R5NA 2CUTA 1QG4A 3G9ZA 1NJGA 2B8EA 1Y5LA 4YJ3F 2OSBA 2ASEA 2WTNA 5F2KA 4BZZA 1QQTA 4H6WA 2NVBA 3CT4A 3PUVA 1NASA 1F5NA 3VMFA 5BOSA 1TFUA 3URKA 3U09A 2NTYC 3WGQA 2HU7A 3C4VA 2CMKA 2G5PA 1AURA