3ICQB

Karyopherin nuclear state
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
167
structure length
167
Chain Sequence
PTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGLEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exportin-T
publication title Structures of the tRNA export factor in the nuclear and cytosolic states
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Rna binding protein
total genus 43
structure length 167
sequence length 167
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3icqB00
4F92B 5IRCD 1ETUA 2IYRA 2FE4A 2F7SA 3AVVA 1EFTA 3IO3A 3MLEA 3RLFA 1Z28A 4U7DA 2JATA 2KWIA 3RC8A 3OIYA 3V4RA 1NRJB 2FEMA 1UKEA 1D5CA 2QMUA 4FIDA 1W5TA 3Q7QA 4IXMA 5FOWA 3WHLA 4CVNA 2ZUDA 4O2RA 4PSKA 5JCPA 1YR8A 4H9GA 2CL6X 3MWKA 2ZRLA 5AUOB 5GJBA 1N25A 1Z47A 1KZ7B 1TF2A 3E1SA 2FU5C 1R10A 2GA8A 3TAHA 1ESNA 1N6NA 3SBEA 4ILEA 4UXJA 1HQYE 6Q21A 1TADA 3OZXA 2DWQA 1XTJA 1VCNA 2Z4SA 3CRW1 1L4UA 1XU4A 3TSWA 1SHKA 2RH5A 2HDNB 4OJKA 1FMJA 4RFVA 3WNBA 2PZEA 1N6OA 3RWMB 4V0OA 4P3YA 2B7BA 3AEZA 4P4SA 1W4RA 3GLHA 4KLNA 2W0MA 1T8TA 2GESA 2RGNA 1W5SA 4NPHA 1EX7A 2BIFA 4B43A 1ZM2A 5CK5A 1AK2A 4TYPA 1OIXA 2D62A 3BFVA 4IXNA 5FUYA 3NBYC 2ZRGA 2IYVA 3EZ2A 3RANA 4BRUA 3GEHA 2F55A 2JLUA 1AKEA 3A36A 2IXGA 5DI3A 2ZYUX 4A2QA 1OIVA 2X1VA 3GLHB 3W90A 4KITB 2WMOB 4JT4A 2QROA 4JSTA 4ASUA 4OJQA 4OK6A 1JR3A 2VP0A 5HTKA 3SJCA 3BBPA 1VDZA 2UZ3A 3DMNA 2P3SA 3IPXA 4L9SA 1FX0A 5SZKB 4Z8YA 2NZ8A 3I32A 2FSFA 3OEED 4DC9A 3I73A 4FINA 4PHGA 5DI3B 4HAUA 4JT2A 4DIEA 4CZ2A 4EJSC 1Z0JA 2CNWA 2GKSA 3FKSD 4PPGA 1UPTA 4PC3A 4HATA 4QGGA 4QFMA 2W6JA 1BMFA 4C30A 4M2LA 5HZKA 3AVOA 2JLVA 2WSMA 4B2PA 1MABB 1ZVQA 1RFLA 1FX0B 2O0JA 1NLFA 3CF6R 3THXA 2EFDB 2PH1A 3Q3JB 4ZDKA 2KSQA 1DAMA 5A5GA 1G21E 1XD9A 2BWJA 2RGGA 5JRZA 4M4SA 3CB4A 1FP6A 3S1AA 4QKQA 1A82A 2ZRBA 4BFUA 1OB5A 4W7SA 3W3ZB 4B6EA 1BOFA 2WAYA 1UBFA 3QIAA 4GPTA 1F60A 3H1TA 1QBKC 2AHOA 3RDPA 1G8PA 2ZETA 4R2IA 4URVR 3MRSA 5K8IA 3C14C 4RSGA 4ZKDA 1HYQA 1IQPA 5CB8A 4FCWA 3MWYW 2DY1A 4TMWA 1XJ0A 3LBIA 5SZIA 5GJVC 3PEUA 4TMXA 1W0KA 4WA7A 4BLQA 3LW7A 1JEDA 1WP9A 3A58B 4YMVA 1T4GA 2PLFA 5CLLA 3RYTC 3LX8A 4Q1FA 3S1AB 4HEJA 4U5XA 2AL7A 4JVMA 3NG1A 5HKKD 2FMXA 1KI8A 3MMPA 2Q3MA 2R6DA 1SXJE 4QXAA 1N5LA 2ZI5A 2IYLD 5J4HA 5J4VA 1IM2A 5FR1A 2YWEA 4V0ME 2CL7X 4TMZA 5GVRA 1AGPA 1GL6A 3AP1A 3BH6A 1ONBA 3WP1B 5HPYB 2FWRA 1YJ5A 2RHDA 1G291 4RD2A 3KKMA 2YOHA 221PA 4JBWA 2RHMA 5K8UA 4D25A 2ZI6A 2Q21A 3L82B 2GCPA 4XD7D 3F3YA 2MSDB 4CIDA 1XEXA 3T1TA 1T3LA 3I3SR 1MO6A 2QL6A 2QAGA 4A92A 4BFTA 2J46A 2QBYA 4QGHA 1SVKA 4DDVA 5AJWA 4DHEA 1Q0UA 2ZI7A 3QPWA 5DN6A 1I4DD 1KNQA 2FFHA 2C78A 3DO6A 3VQTA 5F3WB 3EARA 1H65A 1RW4A 1UDWA 3AGQA 2XOKD 2I3BA 3PQCA 4ESHA 4RCYA 2GZHA 1GITA 4M1OA 1XEXB 2B7CA 2CJWA 3ZD6A 1QF9A 2A2ZA 2L0XA 4LCBA 2HUPA 3AUXA 3GEEA 3BK7A 2ZAOA 2QI9C 3K0CC 5KSOA 1AZSC 1XTKA 3PENA 2DWOA 1A5TA 2QBYB 2JLRA 4KHZA 4LK2A 4HI0E 4PC1A 2FSIA 4V0NA 4DWJA 4UNSA 2ZSBA 3RSLA 4IRUB 1ZNZA 5F9FA 3X1DA 2ZRFA 1LB1B 1MRSA 2A78A 3BFKA 4NYIR 2IX3A 2JJ8A 3N70A 2V55B 4DDUA 1T0HB 4B44A 2VIIA 4DCVA 4EPVA 1NMZA 3C8UA 5F2EA 2R6GA 4Z54A 3BD9A 2WJGA 5A4JA 4KFSA 1Z29A 1U8YA 1LTQA 3I92A 1Z0FA 1LV7A 2YHSA 4LOAA 4NH0A 1FFHA 4Q18A 3QXXA 4QJ5A 1OFUX 1DEKA 1Z6XA 4R9UC 1VIYA 2EYQA 2AD5A 2YV5A 4MGKR 3IIMA 2EYUA 3HU3A 3SNHA 4EIWA 1D8TA 1BIFA 3EZ9A 2QTHA 5EJEA 3DOEA 2WSSD 4TT3D 1E4VA 5P21A 3QF4A 3P1JA 3A8TA 4DBLC 2ZRPA 1VHTA 2ZRHA 2VP2A 3EIHA 5TV2A 3SYLA 3UWOA 3K70D 3LQRA 1N6PA 1WB9A 2BOVA 2J41A 3CNOA 2Q3FA 5UKDA 2GJ8A 5EZ6B 3TH5A 3ZS9A 2O0HA 4QM7A 4JLJA 3AB3A 3B1XA 3FFBA 2OO7A 2UVQA 2GXQA 3KJIA 1SQ5A 1XDBA 4WXRA 1AQYA 1EG7A 1CRPA 1R8QA 1E1RD 2IXFA 3CO5A 1N6LA 3RRYA 3SS8A 1F3OA 1XP8A 1IBRA 2OAQ1 1N6HA 3L43A 3QF4B 5BN3A 3FHTA 1W4AA 2VYFA 2GHIA 2J3EA 5SZHB 1CBUA 1L8QA 2QMOA 1BS1A 3CKLA 3KKQA 4PO9A 3QXCA 3EWSA 1F2TA 3LBNA 4WZBE 3UMFA 1ELOA 5D3QA 2OZEA 3GLFB 3ND9A 1LS1A 3THYA 2QGZA 3EIQA 4KSCA 4KLZA 3KJGA 3K53A 2NO0A 1UFQA 4BPBA 4A82A 1PZNA 2ZPTX 3NEJA 2FPKA 4KYIB 2BBTA 1US8A 1KMQA 2XJ9A 2J7PA 2QEQA 4HSEA 4O2LA 4BLPA 3QXSA 1KO4A 4HLUA 1GNPA 1OH5A 5E3HA 4LJAA 3VHXA 4NZYA 3IKJA 721PA 2AFIE 4BECA 2IF2A 5HE9A 1E2DA 2H16A 3DVLA 1JALA 4OI1A 3ADBA 3KTAA 3IHWA 3THYB 3ZS8A 2WJHA 3ADCA 2ZYWX 4AD8A 3SYNA 3CX8A 1ZW6A 2D2EA 4Q1BA 3BOSA 1II9A 2HEIA 4UJ5A 2OLJA 1T3HA 1US8B 1G4UR 3IBGA 3MSXA 1KO8A 4JBYA 2OESA 2AK3A 5KSPA 2PX0A 2DYKA 4HAYA 3JZMA 1KK3A 1G8YA 5CDFE 3W6NA 5J4YA 1ZM7A 3BH7A 3QPUA 5DE3A 2WWGA 3IEVA 1EGAA 2A5FA 2Z83A 4I99A 3EASA 1GL9B 1W36C 1ZM4A 2DHRA 3KTAB 1CRQA 5FPKA 1GUAA 3ZD7A 2AN9A 1Y3AA 2HXYA 4Q1DA 4HAVA 1SXJD 5LPNA 4TLCA 2CHQA 5JWRA 1NMXA 1NN3A 2JJ2D 3BRWD 3DZDA 1OXSC 1S9DA 4Q48A 5FPTA 2V3CC 4BLRA 3GMTA 2EFGA 1Z3IX 3M1IA 2G88A 1GOTA 2R44A 5JZVA 5JI2E 1PV4A 3WRYC 4Q1AA 4A0RA 5EE0A 1NY6A 3MG9A 2QP3A 3EA0A 5EXTA 4QBGB 4PC2A 1T6NA 2QT0A 4HB2A 4BFXA 1EX6A 4BEJA 1S3GA 2QTFA 2GXUA 3IILA 2J7KA 2CBZA 4HUTA 3KB1A 2FZ4A 4M9SA 2JLZA 2R6AA 3L8ZA 4G5OA 4M1TA 1E2MA 4KAXA 2FSHA 2KJQA 3AQ4A 4MRVA 1KYIA 2IYUA 2W83A 2QZ4A 3RABA 1Y63A 1A1VA 2JLWA 4KFTA 3VHLB 4A2WA 4D0GA 2G6BA 2OCAA 3PUYA 2XNSA 4DCNA 4LBYA 1XMJA 2QMEA 2YOGA 1ZCAA 2I1QA 4XVQA 1OE0A 1T5LA 4LV8B 1A2BA 1VIAA 4TYWA 4RY2A 2CCJA 1P2TA 3GJ7A 2EVWX 4KCGA 4L16A 5D3MA 4KU4A 5HKKA 5KSYA 1IY0A 3GCGA 2D06A 3A37A 4IEEA 5DHFA 4A4DA 3C5HA 3GLIE 4WXPA 1P2VA 5E7JA 2FDCA 1MOZA 3H86A 3T5GA 2ERXA 1W4BA 3ZQ6A 2A5DA 1WF3A 1HE8B 4K8OA 4X8HA 1QHXA 4FXPA 4RD1A 3WYAA 4CT4B 3NBZC 4TMKA 5KHOC 4PZZA 2IWRA 5DH9A 3H0KA 3GLGE 3T1QA 2OFXA 1E9BA 3ZJYA 1EWRA 5D3MB 2H57A 3FE2A 4B47A 1ANKA 1Z6AA 2ZQ5A 3CF2A 1G5PA 4OL0A 3QE0A 4H1UA 2QU8A 1QDEA 4AIIA 2ECKA 4NMMA 4GFDA 4LC1A 4LI0A 1W46A 2W2XA 1G19A 2IL1A 4DDWA 1ZUHA 5DYGA 2OCBA 3CX7A 3TW8B 2FPMA 5F9HA 2W00A 4IOJA 3WYFA 3EZ7A 3RRZA 2PCJA 3GLFA 4BFYA 2BKEA 5BW8A 2V9PA 3X1ZA 3C16C 4QRHA 4ZPXA 4B6FA 4LJ4A 4NCNA 1ZUNB 1G8HA 4HB4A 4DCUA 2W58A 5J40A 1QG2A 2F9LA 4UJ3A 3WYGA 2A5YB 1V5WA 3QXHA 2ERYA 4EFNA 2AKAB 5KOYA 4LUCA 4Q19A 2Z5FA 1RRPA 5AUQA 1N5JA 2ZR9A 4EPYA 1W49A 4AWXA 4MA4A 2OBNA 1C9KA 4IDNA 1PLKA 2EFCB 4YONB 2IA5A 2CDNA 3Q9LA 3SDZA 3AVYA 1FZQA 5C4GB 3C41J 4G5RA 1XPOA 4XWAA 3GFPA 3GJ3A 2QMHA 4F93B 2JCSA 2QG6A 2ONJA 1KK2A 2UKDA 2IYXA 3UIEA 4F7WA 1JXMA 1SVOA 4A8JA 3VR5A 3ZIAA 2GJAA 2YJTD 1ZD1A 3CWZA 3DL0A 2HJGA 4CW7A 4DLYA 4L5BA 3T12A 2BV3A 4XTRA 5FBWB 2KBFA 3B9QA 3EC1A 3QENA 3K70C 3K0FA 3NHAA 2ZE5A 4ZI2A 2Q9BA 2ZR0A 3FMFA 3NIBA 2JJ1D 3IO5A 2Q0HA 4KJZA 4C4PA 4CEJA 4PQYA 5DLQC 1E2JA 1Q3TA 3QQ5A 1XPUA 4B3FX 4JVNA 4LRWA 5JLJA 1E2PA 4A8JB 3CH5A 4FWIB 1Z6YA 3NDPA 1P9WA 3Q7PA 4E09A 3RS5A 1BYUA 1DAIA 1MRNA 3EXAA 3MWJA 2G9NA 2CVFA 4HAXA 5FL7D 4A36A 2FPLA 1AZTA 2WSSA 3U7EB 4JVSB 5AJXA 3ZVNA 3FKQA 1WMSA 3CH4B 3GFTA 2GZAA 3AVWA 2Q3HA 3K0FB 1QZXA 5FUWA 1KY3A 4CEJB 2A9KA 3AVPA 2EQBA 4R71A 2BMDA 2JLSA 2VP9A 1I2MA 4B3DA 3DDCA 3A1TA 2HJVA 2QA5A 2OHFA 4US1R 1K8RA 2IT1A 2XGJA 1E1RA 4DRZA 3WP0A 1L2TA 4TL9A 3EZ6A 1TAGA 2D7DA 5GVSA 4IDPA 2NO6A 2WM9B 4IVRA 4A0GA 3DM5A 4Q4HA 4QL3A 3LVRE 2OE2A 2NOAA 1NVUQ 1K5DA 1LFDB 1W2GA 4QJ3A 5IT5A 3QY0A 3WMFA 3MJRA 5JHHB 4TQ9A 2PJRA 3Q5EA 2H17A 2J1LA 3TLXA 4XVRA 3OHMA 1R0WA 4NCIA 1SVMA 1AS3A 2GK6A 3F5FA 2RCNA 5FOXA 1T5IA 1FUUA 4TL7A 1UADA 3OFND 2AFHE 4ZI3A 4Q4HB 5FPHA 3C4JA 5TB5A 1ZAKA 4N0EA 3ECCA 3ETLA 5EP3A 2ZJBA 3H4MA 1UBEA 5EE9A 2YKGA 1T0JB 3V9PA 4B33A 5BN5A 3L0PA 1IXRC 4IKEA 2CXXA 2YZ2A 2QE7D 1TPZA 5EP1A 2ZUCA 2ONKA 2FA9A 4M1KA 1KMHA 2AKYA 4QHSA 4P33A 4BLTA 3AKEA 1OH8A 2IHBA 2JA1A 3QXJA 1I4TD 4PSAA 1Q1QA 2OFOA 4HAWA 3MFYA 1OLOA 4PAMA 2ODWA 4TLAA 1J8YF 1CKEA 1E2EA 4YXWD 2DFKB 1G18A 1OT3A 2V54A 4LBVA 4BZPA 3N5CA 2GJSA 3RNLA 4E07A 2ZE8A 5KDOA 3WBKA 1NIPA 3SEAA 1ZIPA 1P7CA 3LWNA 4IVPA 1FMLA 4DLZA 1G64A 3SQXA 3UATA 1SXJA 2BEKA 1KI3A 1KMHB 2GF0A 4JLVA 4RFSA 3O8CA 3FOZA 3U5ZB 3TJZA 1N6KA 2JJ2A 3L0SA 4ACBA 1WE2A 3KB2A 2FV8A 4Q4AA 4V0MA 1TF5A 5J4LA 2XEXA 4OK5A 1U9IC 3D7MA 3B60A 2DPXA 1KOFA 5FL3A 2OILA 3NBFA 2HF8A 2OBLA 4IFEA 4A15A 3VKHA 3VFDA 4DVGA 3CBQA 3FB4A 4JVLA 3EPLA 1NSFA 2CE2X 4C3ZA 2VP5A 4CT5A 1S3SA 5CITA 3AH8A 4MYCA 4Q47A 2R8RA 5CJ2A 2I1VB 1RRFA 5FR2A 2IYSA 1SXJB 2OM2A 4X8MA 5JJIA 4RFSB 1VMAA 2B92A 3VR3A 1R0ZA 2ZJYA 2QTVB 4Q4AB 4W5WA 1JR6A 1OH6A 4RD6A 3D8BA 4RKFA 4TTQA 3SN6A 4JL8A 5A0FA 1SHZA 2H5EA 3TBKA 2DWPA 1TX4B 1FW6A 4OI0A 4LYFA 1R6BX 4TWZA 4Y0AA 3EPHA 1XJQA 2WWFA 1Q12A 3A4NA 2XNDD 4P4UA 4AKHA 1U99A 4AYTA 1MR3F 1QVRA 2QSZA 2XITA 4I1VA 2JIZA 3UMSA 5KNBA 3R9WA 1ZNWA 2O8DA 4DUGD 2WTUA 1SGWA 5DO9A 5FTKA 4Z1MD 1WRBA 3KQLA 1VKJA 1YU9A 1GRRA 3D3QA 4US2R 5KTYA 1RIFA 1S4QA 4V03A 3R8FA 3OAAD 4LYAA 3SJZA 2DCUA 4MKHA 4XSHA 5AJZA 5BWMA 3D31A 4QNRA 3SHFA 2ZI9A 2RGNC 1YQTA 4HB0A 5KDLA 5FTJA 3VNVA 1E9FA 4DJTA 4PZLA 4HDCA 4A9AA 4B3CA 1O87A 4NYJQ 1TTTA 2XTZA 3MAAC 1GFIA 2O8DB 1UKZA 4OBEA 1GRNA 1G5TA 2HT6A 5L3QA 5C2JB 2BBWA 1E2GA 3E70C 1VCIA 4DCSA 4L15A 1NN5A 2OFWA 1OV4A 2QQEA 4JJZA 3X1YA 5AJVB 1R5NA 2KI5A 3KJEA 4XIGS 1E9AA 4CRWB 1E2NA 4MRPA 4A0FA 1MKYA 4P4SB 2RB4A 3MJHA 5FOUA 4G01B 5KDDA 2CLCX 2W6ID 1VPLA 3R7WA 4QHTA 5BQ5A 5KUTA 5EP2A 3EA5A 2ZJAA 3AF4A 1UEIA 4AK9A 5L3QB 3W9YA 3PUXA 1IN5A 1G3IA 5JRJA 1TUEA 4NONA 2OXCA 1S1CA 2V6JA 1PLJA 1SVIA 3BC1A 1DG1G 3TK1A 521PA 1YZKA 3LXRA 5DGXA 1FTNA 4CDGA 4D4JA 3B6EA 2PEZA 3I62A 1GTVA 4QM6A 3JVVA 2WJIA 2YNMA 3EPKA 3KQKA 2B6HA 3ZQJA 1DAFA 1IN4A 4AI6A 2G83A 1G7TA 3ASZA 4BWYA 2VPPA 3B1WA 4C0KA 1QHIA 1CLUA 3DPUA 3HWSA 4IDOA 4BFWA 1IN6A 1Z6GA 4RD0A 5EZ5A 1S9HA 1SKQA 2AWNA 4K81B 4US0R 3W5IA 3U61B 1IY1A 3TSOA 3SU8A 1OHHA 1ZD9A 2BMFA 1W36D 4ZIRA 3LA6A 4EJSA 1AGRA 4TTRA 2H18A 2XZLA 1XMVA 1KI4A 4S2EA 1UBCA 1COWD 4MKGA 3WXMA 4Q7LA 4QBIA 3TSZA 1J70A 4H1VA 2MSCB 3SR0A 1ZMXA 3BB4A 2GK7A 2NPIA 2IS1A 4WW0A 5ELXA 2WWYA 5L3RA 3RS0A 2JJ1A 3FDIA 3THXB 1IN8A 3SI7A 4FD2A 5TARA 3NC1C 2X19A 2V1UA 1IY2A 4B76A 1G8FA 1II0A 3NHBA 4B34A 3CR7A 4DDTA 4IJMA 2YC2C 4ZIRB 1XPRA 1H8HD 4KFUA 1VYVA 1XMSA 4P31A 1IJEA 2ZANA 621PA 1G16A 3AP3A 1YZUA 2GAAA 1Z5ZA 2YWFA 1A7JA 5CK4A 2GCNA 4OHZA 3LBHA 3DMDA 4TLEA 2OSBA 4LPKA 3OEHD 2NMVA 5EUQB 4LJ8A 3T1VA 1FOEB 4O25A 2GWHA 2VEDA 4PO1A 4F4IA 3TE6A 2WWIA 1KNXA 3CNLA 3AM1A 2QP4A 3L0OA 5FTMA 1KHTA 3SZRA 3FPAA 3OESA 1JXOA 1NVWQ 3M0EA 5JWHA 3F0TA 2X77A 5CDFA 4LHWA 4PHHA 1FUKA 1P6XA 1VECA 3BXZA 1SKYE 2CLDX 2ZRIA 1Q1BA 1KDRA 2P2LA 1JQJC 2J9RA 1U0HC 3THOA 4HZIA 2ZEJA 2CL0X 4HUQA 2ZSDA 5AUNB 3AV0B 2DB3A 4C0AC 3QJYA 3U4QA 4NCHA 3QKSA 2MMCA 1XB2A 3B5JA 1HT1E 3VX3A 421PA 4UQOA 1PUIA 3RAPR 4GP6A 3CRQA 3CRVA 4ON9A 2PJZA 4HB3A 3FGNA 5EXPA 4KSBA 1WXQA 3K9LA 3LY5A 3GEIA 3OFNA 4PC6A 5C46F 1D9ZA 1QVAA 4GMDA 4EFMA 4IOMA 3MUFA 4CEIA 3AF0A 2QAGB 4LV5B 1XBTA 2V7QA 3LH5A 4LJ7A 4FI3C 1GKIA 3B78A 3NC0C 2ZVQX 4Q5IA 4Q02A 4HUQB 2N1BA 3B1VA 3DHWC 3U4QB 1CJUC 4Q1EA 2VSXA 1OB2A 4MUAA 4IHQA 4OQNA 2LCFA 1TUIA 4XSGA 5EE1A 3K1JA 1NN0A 1AS2A 4R2HA 1W1WA 2ODEA 4DT1A 4GI7A 3QG1A 4Q9LA 1ZD8A 3FHCB 2P6UA 2IHYA 4PHFA 3NEYA 2FZLA 2OUKA 2CJWB 2EFEB 1Z0IA 1U0JA 3WRXC 4DB2A 2C9OA 1NI3A 3EZFA 5CIWA 1XEWX 3A6PC 4ZDWA 2VH5R 3R20A 2KB0A 1DAKA 3UMRA 3K0CA 2QRZA 3CW2A 2WAXA 3FMPB 3KUDA 1E79A 4E22A 1CU1A 3AUYA 3E2IA 3GLIA 2EWWA 4DT1B 4U00A 3LQQA 1JI0A 4PPNA 4N0DA 3VMFA 2YWGA 2EWVA 4D4MA 1DELA 1P3JA 2Q6TA 3KDSE 4Q21A 2WJYA 5G53C 2PZGA 1EFRD 3TIFA 3GLGA 1U2RA 2GILA 2D2FA 3PUZA 4PFSA 3I72A 4LWZA 1JJ7A 2F3RA 2C99A 2ZJ8A 2E1RA 2Z4RA 3ZH9B 1KDPA 4RD3A 1WBBA 1R5BA 8OHMA 3SBDA 1X8KA 3GLIB 3LXXA 1N0VC 1Z0DA 1L4YA 4URZR 4MDFA 4IVQA 2F9MA 3ZDQA 1Z6TA 3UG6A 4Q9JA 1BH2A 3OIWA 1DOAA 1N5KA 1GDDA 1KTVA 2HLDD 4WIAA 3B85A 3HR8A 2QRNA 3GLGB 1DADA 2V1XA 4Y0VA 3CZPA 3KUCA 2GXSA 2XNDA 1E2LA 2NPFA 2W0SA 2OXRA 3P26A 1IJFA 1QRAA 1TF7A 4JLPA 4DLRA 4Z1MA 2WPDD 4JLMA 2ZUBA 3K0EA 1FNMA 4CF7A 1TU3A 3A1UA 1IONA 3OAAA 3ADDA 1JAIA 1RPZA 4W5HA 2W2VA 3HPQA 2CCGA 3REGA 1TQ6A 3RS4A 1AKYA 4FMDB 4DLXA 2G1JA 2GVZC 3BERA 1M7HA 1XEFA 1OFHA 1ZNYA 2QPOA 2DBYA 5FUVA 5KSZA 1CULC 2IYTA 4EFLA 3E5HA 5LD2B 1XTIA 4WOPA 2H92A 4YMWA 4IEIA 3CR8A 4MGZR 2ANBA 2DFNA 4GOJA 3RRMA 3PV0A 3ICQB 4F4JA 3DEFA 1F2TB 2VF8A 2CMKA 2QN6A 3TUJC 3MGCA 4MYUA 4DEXA 3W8RA 2NO9A 3GJ4A 3A4MA 4YMTA 2W6IA 4LJYA 2FFAA 4LHVA 2K5UA 2GJKA 1JPJA 3KKOA 4JYBA 4ACAA 1G41A 4NHOA 5E7IA 2VL7A 1P75A 2QPTA 4PC7A 5HCIA 4B71A 1OYYA 4DEYA 3UANA 2XB2A 3OEEA 1G20E 2QUZA 5CM8B 4NYMR 1Q22A 3KZ1E 1Z22A 2FN4A 2G77B 3QG5A 3REFA 3RS2A 4K46A 3QSYA 3QF7A 4MRNA 2O8CA 3UPUA 4P4TA 1HA3A 2A7QA 3FKSA 3ZZTA 2ZSAA 4Q9KA 2VHCA 2BCJQ 2GVDC 1E98A 3N2EA 1HY3A 4V0LA 3NBXX 5TY0A 1XCMA 3T15A 3BIFA 2GDJA 1RRGA 4URUR 2HYIC 3CZQA 5IF9A 1NG1A 3BH0A 4ZV4A 2O8BA 2N42A 2KE5A 5FOTA 1MO5A 3QEJA 3ZGXA 3HP1A 2RGCA 2V6IA 5J5CA 3KQNA 1GNQA 2O8CB 4DLUA 3W6PA 1H8ED 4OQXA 3RSOA 4M22A 1W4CA 4UKDA 4ZKEA 4Q9IA 1NVVQ 2RAPA 2ZYVX 4A2PA 5L3SA 4GNKA 3U7HB 1LF0A 2Z0MA 1E9DA 1M7GA 3W6OA 1P5ZB 2AXNA 4DSOA 4TL6A 1FNNA 2ZRMA 3AF1A 2O8BB 1XD2A 4FMBB 4Q03A 1DAGA 1QHSA 1R2QA 2CEAA 2JDID 2BKUA 4C9BA 1ZRHA 1KDTA 4I1UA 1DO2A 1FP7A 3IUYA 4IDQA 3SOPA 1M6NA 3RHFA 4TQAA 5DSZA 2JASA 4TZ0A 1P9NA 2BM0A 4D80A 1E2HA 1E99A 1ZU4A 5EQTA 3CNNA 4M9XA 1G3UA 4DB4A 2UZIR 4PZYA 4E03A 5L3SB 1DVRA 1B23P 4F91B 3RC3A 5JMTA 1EFHA 3IEUA 2CHVA 1F5NA 1XD2B 3C7KA 1KJZA 1UAAA 1DTSA 3O8BA 4NYJR 1XXHE 1TEXA 3T34A 4I1SA 3BS4A 4RZ3A 3W8NA 1EFUA 4KXFB 2DR3A 1XZQA 4KYUA 5F98A 1GZSA 4NCKA 1KZGB 4FMCB 4G5QA 3WMGA 5TVKA 2FG5A 2IBMA 1ZNXA 2ZSEA 4UNRA 1QHYA 1T8UA 4XD7A 1KKLA 4KFRA 4DLWA 3JZAA 1GM5A 4L9WA 4DIDA 5DISB 4YDHB 3W34A 2IYYA 1YRAA 5FBQB 4JL6A 4LC0A 4JBXA 1E0SA 1EFCA 2IEZA 1U81A 1ZIOA 2JLXA 1NP6A 4MUBA 1GP2A 3PFIA 3AKCA 3M4YA 4D82A 4LGMA 2AR7A 3IBYA 4PXAA 1S0UA 2WKRA 2VQSA 2VHJA 2XOKA 5B64A 2ZRJA 3EC2A 4C0HA 4EQ6A 3TVDA 4BLOA 4UXIA 1OXXK 1CJKC 1XTSA 4C0BA 4A1FA 5JSZA 4EPXA 1DAHA 3U7GA 4BZQA 1NJGA 4EPRA 4OI4A 3WMEA 1G3QA 1HTWA 1TQ4A 1E6CA 2WIBA 5CJPA 3TR5A 3AVTA 2FNAA 4ASUD 3VKWA 4TMVA 1JR3D 3GPLA 2QQ0A 2J59A 2WWHA 1Q21A 2G3YA 1UF9A 2NIPA 3DKPA 2VO1A 4IW3B 1GL7A 3UKDA 4DCTA 4EQ6B 2IK8A 4KVAA 2ZS8A 5JSZB 2IUTA 2PT7A 2VF7A 1XZPA 1YZGA 1GSIA 1KDOA 1OFTA 1ZINA 2JLQA 2CNWD 5G40A 4C7OA 4G5SA 2REBA 3T61A 3SE0A 2FF7A 1TQ2A 1XCGB 1BMFD 5GJWC 3J81k 1CIPA 1E0JA 2XX3A 2WWXA 1WBDA 1E2IA 3C15C 2ZRDA 4ZCIA 1OSNA 1PVOA 1KAOA 2VHTA 4OQMA 1DO0A 5EXSA 1XWIA 2ZREA 1D2EA 3BFXA 5KPDA 3SFZA 5JECA 2KBEA 1DE0A 2ZE6A 1NJFA 1W0JD 1E2KA 821PA 4C7OB 2BJVA 5JI3E 1X3SA 3EX7C 1Z83A 2GBLA 3VR6A 5LDDC 4GP7A 4TT3A 1U8AA 2ANCA 4EUNA 4BGDA 4OYHA 5KPJA 3ZVRA 1UKVY 2R6CA 4EDHA 4QBHA 2VLIA 4LJ5A 2RGDA 5CM9C 1Z2AA 3RS7A 2JAQA 3HU2A 2ZS9A 1OF1A 1KSGA 3CM0A 4PPFA 2QORA 2HLDA 2PMKA 2GXAA 1E3MA 3CWQA 4TSFD 3R9XA 4MRSA 1W0KD 2GTPA 3K0SA 3QVUA 4FWTA 2ZU0C 1G17A 1VG8A 4NDZA 3DKVA 2QNRA 2WMNB 1SVSA 4JKYA 2AWOA 1RC8A 3BJIC 4MYHA 2ODBA 3FYHA 5TXGA 2WOJA 1N6RA 1WDTA 3PCRB 4AKGA 2X2EA 4NKRA 4J0QA 3EW9A 5JBQA 1OKKD 3HPRA 3K70B 1R0XA 5C1BA 4E5UA 4W5JA 4AC9A 4QGAA 1XTQA 3QKRA 4LHYA 1PLLA 5EE3A 5CB6A 4ZO4A 3U3OA 1ZC3A 1W2HA 4B2IA 3K8YA 1CJMA 2ORIA 2ZYTX 5SZJA 4M21A 4OHWA 1Z08A 4HLDA 5K8TA 3F8TA 3B8HA 2P6RA 5BN4A 3G5UA 4YQFA 2F1RA 2O8FA 3W5JA 1P73A 4L8GA 3TR0A 1D2NA 2B21A 4WAUA 4DSNA 1YR6A 3QKRB 3ZZUA 1DG3A 2OEPA 2ORVA 4MITA 4URYR 5K8LA 2ZE7A 1S1MA 1XRJA 4LJ6A 2PMDA 3PIRA 4PSVA 3RVBA 4RZ2A 4GOXA 2VHUA 3I4LA 4ZDIA 2ATVA 2OG2A 1A2KC 1BO6A 1KK0A 1ODFA 1OIWA 2Z43A 2OBMA 4JSYA 5DIFA 3U3RA 4GMXA 4CEHA 3BB1A 2O8FB 1OYWA 2CK3D 4NYMQ 4B35A 4D4KA 3LLMA 4B32A 4G1UC 4PQFA 1EESA 4B3BA 3ONWA 5FTLA 1ZUIA 1GRQA 1R0YA 3AP2A 3GJ8A 3P4XA 2VP6A 5JJLA 2BEJA 2IS2A 2GAOA 4BFSA 5HZHA 2P65A 2QPAA 1M8PA 4UNPA 2VTKA 3HYRA 1GG2A 4YC7A 3KFVA 1UKYA 1OXUA 3N2IA 4AY2A 4HDOB 1FL9A 3VKGA 4F4CA 2QM8A 4CEHB 1Z07A 3L0IB 121PA 1XFAA 1F2UA 5HE8A 4CYMA 2GRJA 1XD8A 1H8EA 3HJNA 2J0SA 5FBLB 1FQJA 2LKCA 2HYDA 3K09A 4II7A 4PANA 4GOKA 4I4LA 4X8OA 5FBVB 3VR1A 2H1LA 4GZLA 2VHQA 1B0UA 3MCAA 4LY6A 1Q1ZA 1X8LA 3TRFA 3U44A 1M74A 1OPXA 3PUVA 2WWWA 1J99A 3DOFA 1M2OB 1F2UB 1G7SA 3AF2A 4HAZA 5FI0B 2DFTA 3BWDD 3Q5DA 1Z06A 2RMKA 3GFOA 1G6OA 3QOFA 2REXB 3UXMA 1Z0KA 1SKYB 4B3XA 2Q9AA 3CUEF 2FGJA 4IOLA 3PG5A 3CIOA 2NG1A 3KXKA 1G6HA 4ZCMA 2C9YA 3U44B 3P27A 4KVGA 5DNYB 5FPSA 1E4YA 4Q7JB 2RGBA 4JJKA 3MWLA 1G9XA 1P60A 2O8EA 3LFUA 3NXSA 1ZU5A 1VG9B 4TZ6A 1MV5A 4TYYA 3AKDA 4TTPA 3QI2A 4QJ4A 4M8NE 1KGDA 4FCVA 4L4UA 3AVUA 1KO7A 4D4LA 1RZ3A 3U7FB 4AURA 4LYHA 1ZC4A 2C77A 2HCJB 1NBME 2REOA 1AA9A 1KK1A 2BBOA 5EXXA 2O8EB 5KO2A 2O0KA 4FW9A 2EW1A 4BFVA 1GWNA 3LAWA 4KODA 2ZITA 1E9EA 2VRWA 1NLYA 2OCPA 4M1SA 2VSFA 2NO1A 4UNNA 5JEDA 2QSYA 1E9RA 2E9SA 2J7PD 2XSZD 1E9SA 2OLKA 4NU0A 1ZBDA 5JJKA 4IFBA 1D6JA 4B3GA 3T35A 2C8VA 2VSOA 1S2MA 2QY9A 4B75A 2F1IA 4KBGA 5H1YA 3V00A 3IHLA 1HV8A 4NBSA 4LJ9A 4P0TA 3B13B 5DI9A 2B8TA 2ZRCA 2RGAA 3R7WB 3X1XA 1KO5A 4A0HA 3CRMA 4Q1CA 3LW8A 2J5XA 4KBFA 2J45A 4M53A 5FOSA 2FX3A 1AJEA 5KNDA 3M6AA 3PVSA 4RZUA 1ZM9A 3K0AA 1L7VC 1OXVA 1MABA 2BHRA 2IYZA 4JLNA 4WZAE 1VCOA 4FCTA 1ZP6A 2FFBA 1I4LD 2IF0A 3GJ6A 2ASEA 1N0UA 3TVTA 2WICA 1QHNA 3QBTA 4KV9A 1LW7A 3AVQA 3BB3A 5JWOA 3IPYA 2F1JA 1CJTC 3ASYA 3Q85A 2XZOA 1NVVR 3LDAA 4LHXA 2IS6A 3PUWA 1YKSA 2NGRA 4Q7MB 4DSUA 1FTSA 3ZVMA 1JNYA 1R5OA 3A1VA 1DPFA 1E32A 3K0AB 3R9IA 3B1ZA 3KKPA 4B74A 3BGWA 1E69A 2OV2A 4M9ZA 4R98A 2C96A 2V8OA 2XTMA 4DKXA 2DFLA 2GJ9A 2GZDA 1IAQA 1R7RA 1VHLA 2EU8A 5FFMA 5E95A 3U60B 3LX5A 1W7AA 4P32A 3ADKA 4NE2A 4QC2A 5H8WA 1W0JA 2GETA 3O47A 2D3WA 2WV9A 4AG5A 4EJSB 2R9VA 5FL7A 1J7KA 2P0EA 5KNCA 3EIEA 1YZTA 2FH5B 4JS0A 3P20A 3R8CA 1P61B 3G82C 1X8JA 2WBLC 3GD7A 2ZJ2A 1T91A 2WJVA 3IDQA 4TSFA 4O0MA 1JECA 2ZR7A 3CLVA 3TAUA 1U90A 1QG4A 1GVNB 3B7GA 4JLBA 2G0NA 4BLSA 1Z0AA 3SJAA 2G0TA 1CP2A 3LLUA 4BRWA 1P2UA 1AM4D 4M9QA 3THWA 1J2JA 4DZZA 5H70A 3P4YA 1GIAA 4Q01A 1KY2A 1DS6A 3OE7D 2QAGC 2RGXA 1K6MA 4QBFA 2ORWA 1OKKA 4RJLA 1YR7A 2IW3A 4C0LA 4F38A 5B2ZA 1NG9A 1DARA 2P67A 3Q8XB 1Q44A 4JLDA 4C0SA 4N1AA 1YR9A 1G1MA 3KXLA 4C0JA 4TN1A 1OFIA 1RRCA 1K5GA 3KJHA 4Q00A 1SVWA 2AK2A 2GF9A 3LNCA 3HU1A 4AYXA 5CLQA 4Q66C 4Z8XA 4OHYA 4HDQB 4B48A 3THWB 2FEOA 2ZI3A 1IXZA 1P72A 2VBCA 1S8FA 2X2FA 4MGYR 1D9XA 2JGNA 2YINC 2CVHA 2F3TA 3T1OA 4LYJA 2CLSA 5B30A 3KFXA 1JB1A 5GADl 1UDXA 2A30A 2IWHA 2QE7A 1E1QD 3P32A 3QKSB 4DLTA 3SFVA 3T5DA 4DLSA 1J90A 2WKPA 1Q1EA 1G5RA 3A4LA 4OK3A 1HURA 2ZJZA 3O8DA 1A4RA 1RE0A 4X8LA 3SC3A 3X1WA 5DYIA 2FSGA 1E0AA 4YXWA 4CEIB 1Z63A 1LF5A 2AX4A 3QPVA 3IQXA 5FUXA 3IIKA 5AR1A 1N2CE 3SJBA 1KJWA 4D81A 1LS6A 2CK3A 3CPEA 2NTYC 4TMTA 3NTUA 4YLGA 4D0NA 1J8MF 4C2UA 2QAJA 3LD9A 2PT5A 3GLHE 3KL4A 4IOKA 1HE1C 2ZROA 5LBIA 1XJCA 1LY1A 2PX3A 1GAJA 3VR2A 5TDHA 1LNZA 1F6BA 5FPYA 1AN0A 2PLRA 3I5YA 1NY5A 1XXHA 3LV8A 3B1YA 1E96A 3PEVA 1C4OA 1KIMA 5JFGA 1HH4A 2YOFA 2ODNA 1W48A 1EXMA 2A3RA 3ZIAD 3GJXC 2WKQA 1GILA 1NIJA 4XJXA 1N6IA 4ZDJA 3KKNA 3CX6A 2HT1A 3PEWA 2J0QA 5KYKA 1Q20A 2QP9X 5IK2D 2QT1A 4EPTA 1OJLA 3GP8A 4W9MC 2WVJA 3ZLJA 3MD0A 1JR3E 4TQUS 3TQFA 1M1YE 1CR1A 1NL3A 5JS7A 1NBMD 1XXHB 3I8SA 2JLYA 1P9RA 2D4HA 2IUSA 3B2EA 2ZSFA 3CRRA 4YMSA 5EP4A 2VP4A 4UNQA 4AKIA 2C5LA 5LD2C 1XNJA 1W47A 1KSFX 2BVNA 4QGFA 4UXHA 2GEVA 1KI6A 2C2HA 5FOVA 1SZPA 2P5TB 1YHNA 4DUGA 4G0NA 1YZQA 3PR1A 3PEYA 2LWIA 4POAA 3QKTA 1HQCA 1RVDA 3FFAA 4JIMA 1MO3A 1XEWY 2EFHB 4I1OA 1NNEA 2QENA 1FQKA 4NTZA 3ICEA 3H84A 2N46A 3CPJB 1ZCBA 2GEDA 4C0QC 3QUSA 3TW4A 4FMDF 2I4IA 1BYIA 3V4FA 4XTCS 3DM9B 2XZPA 4AYWA 3EWAA 2R2AA 4JMPA 2XAUA 4Q9HA 1KI6B 2XXAA 4BUJA 2WZQA 4BEBA 3B9PA 4QNMA 4PX9A 3L2OB 4HLUC 3G0HA 1P62B 4JLKA 4D26A 4XWKA 1U94A 1KI1A 1NMYA 1YVDA 4I81A 4HZUA 1Q3HA 4U02A 3QEOA 3ZVLA 5KU1A 5EUMA 4TYNA 1VG0B 4URWR 5AK0A 3WHKA 1QHGA 5JHGB 3BE4A 2D74A 2RGEA 2CCKA 1XCPA 2XXAB 2ZVPX 4NCJA 1KSJA 3CF0A 4GL2A 3PXGA 3U2QA 1VYUA 3K9NA 3KQHA 2XSZA 4O3MA 5E4FA 3CONA 3NH6A 4JLAA 1N3BA 1GKUB 1AIPA 1PUJA 4HZUB 2HCBA 4MYTA 2ZTSA 2C95A 2OAP1 4ZCLA 2BDTA 2B8WA 5HR5A 1YRBA 1G3RA 4RKEA 2X8AA 1X1RA 1CR4A 5G3YA 1NLZA 1IOZA 3WY9A 5ANRB 1E9CA 1UM8A 4QOSA 2XB4A 2A5GA 2ZS7A 3QNUA 1Q57A 1U0LA 4WVFA 3U3MA 1CS4C 1QHHA 2WHXA 2MMGA 1KI9A 1TQDA 1E2FA 1E2QA 3IGFA 4JLOA 5B58C 2Q9CA 1ZYUA 2QM7A 3W3AA 2NO7A 2ZRNA 4LPSA 4S35A 1OXTA 4PAOA 4ERNA 3DZ8A 1TNDA 3IIJA 3C5CA 1CTQA 4QG7A 2IC5A 3PITA 1COWA 1PJRA 1NN1A 1YE8A 4B73A 3AKYA 3Q72A 1WA5A 1I2DA 1QHHB 3U3JA 4RVCA 3KQUA 1MT0A 4XWOA 3X2SA 1P2SA 2JEOA 4HYYA 1NSTA 4ITRC 5C18A 4YDSA 2IS4A 2ATXA 1GNRA 2AD1A 1KKMA 5HCNA 3VAAA 1DAEA 1W36B 1H8HA 2O5VA 1UBGA 2IXEA 1NVXQ 2E87A 4R7ZA 2HF9A 5JEEA 4ABYA 5IHPA 2ZAMA 4EKDA 3NDBB 3OEHA 3BAFA 1W44A 1KAGA 4DLVA 3H2YA 2P6NA 5BXQC 1X1SA 4JYCA 5EE5B 5CYOA 2C03A 5LB2A 2PCLA 2HV8A 1D2MA 1ZM3A 4GZMA 2JIZD 4BFZA 2LKDA 4V0KA 4Z51A 2PEYA 4FMCF 4PTLA 3OIUA 1JPNA 1U98A 1Z8FA 2J0VA 1AQUA 2CHGA 2IYQA 1CR2A 3OE7A 3ZZ0A 1IN7A 2CE7A 1R8SA 2D7CA 4G3XA 5FTNA 2ZXUA 1SULA 4G5GA 4LX0A 4OQLA 4RCZA 1G8GA 2R62A 2PZFA 4LBWA 1VTKA 5CYPA 1NKSA 3AF3A 4WBSA 5H68A 1G7CA 3LVQE 3I61A 3WBJA 4HLQB 2PL3A 3NWJA 1CXZA 5AJYA 1VCMA 1RYHA 2V4ZA 3RRNA 4XVUA 2NQ2C 2H8KA 2VA8A 5BYKA 1BKDR 3NH9A 2WIAA 2YWHA 4Q4LA 2F43A 4LDJA 2AXPA 2G1KA 2YYZA 4LV6A 4A6PA 5L8VA 3VU9A 4PO8A 1XTRA 1YZLA 3JVUA 5G41A 1X6VA 4TLDA 2OT3B 3TUZC 1Z2CA 4M1WA 1HEIA 3OF5A 1LVGA 4OQFA 1E1QA 5C4MA 3WNDA 3GJ0A 4FN5A 4Q7KA 5CIQA 3U6BA 1CEEA 4PHTA 4B2LA 3FHOA 4OHXA 4XH9B 1XMIA 5IDVA 3QVVA 3AGPA 1IHUA 1VG1A 3EG5A 3FMOB 4A6XA 1CJVC 2GCOA 4LZZA 1WCV1 2H7VA 4OKSA 4QHYA 2F43B 5JS8A 4A8JC 4IDHA 3VX4A 3FTQA 3VU9B 1N0WA 3LO5A 4GDFA 1EWQA 4KI0A 3QKUA 4M1YA 4YMUA 2BCGY 3UG7A 2IYWA 3GJ5A 4M0LA 4JKIA 2C98A 4D2IA 2W6JD 5GJCA 4CGZA 1E94E 1JAHA 3ZYCA 2TMKA 4MQBA 2GCOB 4V02A 4GT1A 4PPQA 2PBRA 2ZJOA 5G3ZA 1CR0A 2MSEB 3B82A 4EAQA 1MH1A 1TMKA 3KXIA 4NYIQ 3TNFA 1EFRA 1XF9A 2BMJA 4HLCA 4ARZA 1RJ9A 4LHZA 3RS3A 3HDTA 4GSYA 4AKEA 1II8A 2GBLC 3U3KA 1U8ZA 1OHHD 3A1WA 1CF4A 2BBSA 1X86B 4JL5A 1RYFA 2BMEA 1T9HA 5IK2A 5FI1B 4PQRA 4Q4JA 2F1HA 1C1YA 4DXAA 1F48A 1FPMA 1G7RA 1NKTA 1NBMA 3TKLA 3L8YA 4URXR 3O8RA 4ARZB 1RJ9B 3FMIA 3T06B 5M04A 5AUPB 2XTNA 4OHVA 3UK6A 3CPHA 1VYTA 1G4AE 1II8B 1JJVA 3VNUA 1JQLB 1N5IA 1TEVA 1KO1A 1KI2A 4MGIR 2WPDA 2OCYC 1HT2E 1XX6A 4MKIA 4Q4JB 2F6RA 1KJYA 4LBZA 1KI7A 1SVLA 4RD4A 2XJ4A 4BASA 5JCZA 1NF3A 4WZ6A 3IQWA 4DSTA 2WJJA 1ZJ6A 3I1FA 2RKOA 2ZU6A 3OIVA 1R4AA 3SHWA 4PAQA 2YVUA 1KSHA 2ZJ5A 4BQSA 2IEYA 2ZIAA 3U6KA 2WOOA 1G3MA 4JZKA 3EAQA 2ZRAA 5DHAA 3RWOA 4OI2A 3PJRA 2J0UA 3QBVA 4EPWA 5B57C 3VTKA 4MDEA 4C2TA 1T3SA 3GQBA 4GBMA 2C04A 1IXSB 4D6PA 4NL4H 2O52A 1ESMA 3A1SA 2BJWA 1YZNA 3D6TB 2P5SA 3TUIC 3AVXA 1AS0A 5DN6D 5AWFC 1MO4A 2NZJA 4BE7B 2IUUA 1RKBA 4N3NA 4MKFA 3VR4A 1M7BA 4MH0R 5LB4A 3TGPA 3K9GA 1V43A 3UWKA 2J0UB 3I8XA 3HYTA 4PR0A 1TL7C 2V7QD 2R6FA 1O3YA 1SXJC 3NKVA 2FGKA 4AG6A 2ZI4A 1EK0A 4ESVA 2A5JA 5J47A 2FFQA 4GRAA 2R65A 1OW3B 1JEEA 1UEJA 2BM1A 3BORA 4M1MA 3WNCA 3FVQA 3I5XA 4NP6A 1GKYA 2FJUA 3NVAA 2J87A 2YC4C 4TYQA 1S96A 2BC9A 2W2TA 4TLBA 1P4SA 5BYJA 1UJ2A 1HUQA 1JBKA 5J4KA 4XOIA 5FBRB 3SYKA 3TMKA 3K09C 2Y8EA 3K9HA 4RZXA 4LSGA 1DBSA 2ZRKA 4TL8A 1M34E 5TMPA 1E79D 4BZXA 5E7MA 1WQ1R 2QGNA 3SQWA 4MRRA 1TU4A 3ND8A 5L3VA 1OH7A 2HXSA 3FWYA 3GLFE 2C9CA 2SHKA 3HR7A 4D0LB 2ZM5A 3TQCA 3EPJA 3KX2A 3LRPA 2FOLA 1E0KA 4KO8A 1U9IA 2JDIA 2GNOA 2Z6VA 2GEUA 5FH9A
chains in the Genus database with same CATH superfamily
4Y2GA 5IRCD 1FYWA 3ZJVA 1RJEA 2QD1A 4RIFA 3LCRA 2IYRA 4IKOA 4K6FA 2GCIA 4XDYA 1Z28A 1C3EA 2KWIA 1GA4A 5IJXA 4DOMA 3BMQB 2XCSB 4QUAA 4KREA 1QP4A 4LYYA 4WCDA 2V65A 4X7RA 5C0OE 1W5TA 3GV0A 1U0TA 4BLWA 2YRXA 1NBWB 4CL3A 1EE1A 4CVNA 5LOVF 2HMVA 4EY3A 5IZCA 1EQAA 1ZITA 3BMCA 2W11A 4KW7A 2UVDA 3RG8A 1OR8A 3ORQA 1TC2A 5BT8A 1GPJA 3GLIA 4Z0PA 4NIMA 4LMRA 4H18A 3LM8A 4KQJA 3RVOA 1KZ7B 3K1AA 4OQEA 3VPBA 4HWRA 5K05A 3SAJA 4ZVSA 1R10A 3TAHA 1O95C 3LP6A 4ILEA 4UXJA 1HQYE 2Q7DA 4LZOA 3KOZA 3OP1A 1JMYA 4BRZA 1NDQA 4GLFA 2XMPA 1RBYA 3UAGA 5JADA 3CRW1 4GAEA 3CT6A 3H87A 2VTEA 3ZDXB 1K7SN 3TIVA 2HDNB 3BMCB 3CY6A 2FPRA 3MTBA 4I8IA 2R8EA 3WNBA 2K7ZA 1YDHA 1N33B 2QF7A 3RWMB 4ZCTA 3C1UA 4V0OA 3ZU4A 2EX4A 3O03A 3HU5A 3C6XA 2ISSD 3K1AB 4IDCA 5FOQA 1NZFA 1ACLA 4O4LF 4XDGA 1ISIA 1L0BA 2GYUA 2VJOA 2RGNA 5CCDA 4O4LB 4NPHA 3RK4A 1G59A 3IUBA 2H9AA 2Y1CA 1MB0A 4RTJA 1T6XA 2IV2X 1V5IA 1GZ3A 4JOQA 5FUYA 1QANA 2C9ZA 4IWXA 2ZRGA 3BCRA 4Q9DA 1GGHA 3WAKA 4EENA 1GADO 5FHQA 2X7JA 3C24A 3AKZA 1SPXA 5BNZA 2GZ3A 3EHEA 4LFBB 3TZHA 3VH1A 4CKCA 2YNMC 2ZYUX 2BFBA 1RC1A 1GGNA 3E3NA 4A2QA 2ZYSA 2WMOB 4GPIB 1D6SA 1QFSA 2VJCA 1CUWA 5EIOA 1T9GS 4OJQA 4HNHA 4OK6A 3ZWBA 3GLFE 1JR3A 2VP0A 5HTKA 4P2GA 1U7PA 3NM5A 4TVKA 1IFXA 4R4JA 4IHJF 4N6GA 2UZ3A 1VLMA 2TSYB 1HNXB 2JAWA 3ZDRA 4IHJB 4XGQA 3R75A 3DMNA 1X8XA 1GTSA 1V3UA 3GUZA 2E85A 2EHDA 3IPXA 4MV5A 4J75A 4TUYF 2H52A 4ENRA 3H3FA 3I32A 1LC3A 5CD9A 3I73A 4PHGA 4MW1A 4CE6A 4CKCB 2ZK7A 4RZSA 2BFBB 5JLAA 3UEOA 2P2NA 3WGMA 1JB9A 4DIEA 1JHQA 1C50A 3FDJA 2VKQA 2CNWA 3LY9A 4EJSC 4P22A 1NXPA 2XPCA 4YT4A 1ZK1A 4DR7B 3GROA 1UPFA 5ALSA 3WLTA 5DKFA 4QFMA 1S8OA 1I3KA 5P8WA 2W6JA 2IHVA 1DCTA 3ET5A 5ETJA 3FX2A 4YCSA 4DR6B 1MABB 2YIDA 1PV2A 1SKAA 1ZVQA 2LIVA 5EZQA 1F0NA 1RFLA 2JGFA 4DUZB 4Z4FA 3GGGA 1CP3A 2RAFA 4AQYB 2EP8A 4NBUA 4ZDKA 3I9LA 1DAMA 4DMRA 3ZY5A 3Q6IA 5CFPA 1A9TA 5B2EA 3CB4A 1WBJB 4DANA 1FP6A 1KPIA 5HF8A 3UOAB 1Y33E 3HZRA 5JC8A 1MEEA 2V7VA 4BFUA 4W7SA 4MWSA 4X1OA 1BOFA 1UBFA 4R0VA 1BG6A 1F60A 1YVRA 2DLDA 2JA2A 3JQPA 2X3UA 1G8PA 1J00A 1QO0D 2HKIA 3MRSA 3LVFO 2NYUA 1EPUA 1ZIYA 3K31A 4ZKDA 4O8ZA 1K2VN 4MKZA 2WY2D 4UTVA 4F7DA 4OF4A 3R5KA 4FCWA 1M1UA 1KYWA 3A2NA 1WD5A 3QMMA 3E9QA 3TLKA 1W0KA 1WUHS 2X2OA 2Q7XA 3R0QA 5GV7A 1C4WA 3A58B 4YMVA 5CLLA 4UVIA 2UYOA 1NOIA 2HRRA 2JJMA 2CFTA 3JQBC 4Q1FA 3ZDDA 4P2BA 1N4DA 2XD4A 5A9RA 2XCQA 5IJ0A 3LSYA 3PIDA 1DKMA 1S2GA 2FMXA 4Y6RA 3WJ1A 4RTKA 3W4KA 1NW3A 3UYLA 1HI9A 4U2DA 5ADWA 4QXAA 1O94D 3K6KA 2IYLD 2YXDA 3I12A 5J4VA 2AA3A 2BH9A 1WCYA 5AD1A 3JQGA 5KCMA 1SQ6A 3T0IA 5IW8A 1GL6A 1IJBA 1V4VA 3RJZA 2PL9A 3P2EA 5F7OA 1V26A 4HN4B 1CQZA 3U4HA 4I9FA 3DHNA 4NNJA 4MEBA 4XGRA 1UK7A 3TXAA 1Z2DA 3KKMA 1XRLA 2VAXA 3GVCA 3NO4A 4JBWA 5IJ0B 3ETHA 1BHSA 3IVXA 5K8UA 4OJMX 4IS3A 4GWLA 2Q41A 3A4TA 2Q21A 3FUUA 2X0FA 3ZWNA 3ENNA 4XD7D 4XKJA 3GGOA 4V1CI 1EDBA 4K7JA 3JQGB 3I3SR 1MO6A 1DLIA 2ECOA 3NGXA 2J46A 4BFTA 5EIEA 1NNUA 4D9BA 3KQMA 2AGVA 3DOUA 2F1KA 3G2HA 3A9VA 4OBBA 4QGHA 3RASA 3VNRA 1CY0A 3WWEA 2ZZMA 3KLNA 2A14A 1TVMA 1BMQA 3NI2A 2BHNA 3BHJA 1V5GA 2Q5JA 2C78A 4RELA 3VQTA 1NVKA 4MVJE 3PQ7A 4OXQA 3MRVA 1LBIA 4AY5A 1UDWA 3LKDA 5K0BA 3AGQA 2XOKD 2I3BA 3L7CA 2OXFA 2Y1EA 4L6CA 4ESHA 1B74A 1JEAA 3G1WA 3R3SA 4D8UA 2L0XA 2OMEA 3EUWA 2R0QC 2VATA 3AUXA 3GEEA 3BK7A 3K0CC 3MBKA 4OP1A 2DWOA 3GRRA 3O8NA 4GHWA 2YXPX 1TM3E 2FN3A 1VL0A 2FSIA 2I34A 5KWJA 2ZSBA 5LQUA 3TGLA 1FE8A 4LMBA 2QZJA 5F2OA 2NVWA 2FP4A 1BGXT 2RC6A 2ZRFA 1AB5A 2G70A 1FEZA 2BT4A 2R7KA 4NYIR 3VO2A 4BBPA 3DMYA 4HDSA 4BX3A 4DDUA 1X19A 2Z1NA 5E2AA 3O4VA 4B44A 4DCVA 1R0SA 1XLUA 2X0NA 3N6VA 2QTGA 2VBGA 4RMJA 1XKXA 2QVYX 4RJJA 4CETA 5F2EA 1L6RA 2GD6A 2WJGA 4O5AA 5F9MA 4DC0A 4HP8A 1KA9H 1U8YA 1KZ1A 1S89A 1OC4A 1L3IA 2VDKB 3N39C 1IHPA 2NZYA 2QV0A 4LOAA 3TZKA 4ZJUA 2O5EA 1MAVA 2FP4B 1FFHA 3FSRA 4P82A 3GBVA 4RS4A 1P91A 3RAGA 3GVIA 4Q18A 4JQCA 3QXXA 4YA6A 3RF7A 1M0SA 3FNEA 4LZNA 1Z6XA 4KR7A 4HDSB 5K3DA 4Z7OB 4H60A 1JHOA 1TTHA 2ZW9A 4A0SA 1E59A 2NVOA 2YV5A 4UAUA 4YDRA 3ZCTA 4PN3A 4CQJA 2C4MA 5EZYA 3I9V6 4MI1A 4EIWA 1DIRA 1T0IA 4MV1A 1QCZA 3D0RA 4GXTA 4B81A 2VDQB 1AA6A 3ESAA 2QZSA 1NWCA 3WLFA 3QEMA 4TT3D 3ZCPA 3NT4A 1S8AA 3E03A 3DMRA 2C7OA 1M10A 3KE8A 3A8TA 4DBLC 2Y9PB 2ZRPA 3QYAA 3ED1A 1FDIA 2DQKA 2ZRHA 5TV2A 4G8CA 1GARA 5DW3A 2RARA 2XDQA 3A4VA 3DE1X 4QTYA 1JLLA 4JK3A 5BWBA 2IEBA 1UXGA 2FAXA 5DEIA 3VR0A 5F4ZA 5UKDA 3HM9A 1CK4A 2OORC 3ZS9A 1L5VA 2CB0A 3B1XA 1A76A 1XQYA 4M8SA 1SQ5A 1EG7A 3ZI7A 4A2CA 5E9WA 1U1EA 3RRYA 4MMZB 3QEMB 4NULA 4TWAA 3Q6NA 1IBRA 1SK9A 4JUFA 2DCMA 5BN3A 5EHXA 2VLBA 3LX6A 5TPWA 3RBVA 5KTNA 2GHIA 1Q91A 3FHTA 1CBUA 4QECA 1QRDA 4F8JA 4OM7A 1A8HA 4Q1VA 1CY6A 2XDQB 3U7JA 4ADSG 2F3UA 5ENDA 4JZYA 3G5MA 3ECSA 4YCLA 3GAFA 3T3MB 4MLZA 2GBIA 1Q7GA 2QT9A 5KYTA 1DKQA 2QGZA 1XDZA 1D7OA 2VQ3A 2XB6A 4IDFA 2NO0A 1UFQA 4KLZA 4X6XA 2AC7A 3BJEA 5H16A 4EB0A 4BPBA 1RD4A 4KXVA 2Q4DA 3V8RA 4BVLA 4R54A 4O4IF 1A8IA 2VPQA 3BCUA 3V32A 3S8YA 4B6QA 2BBTA 2BKXA 4Q82A 3HVRA 3HO8A 2XJ9A 2AZMA 2JFGA 3NDRA 5BN3B 2WIJA 4ROTA 5TPWB 2ON6A 1QVWA 3QXSA 1UANA 4B6JA 4MAMA 4ZJPA 1RFGE 5E3HA 3HK2A 1GAEO 1EDZA 4LJAA 3MTQA 3IKJA 5F1KA 4OHPA 1GV0A 1JIVA 2XE4A 4EX6A 3H2ZA 2C1EA 3V1UA 3UXEA 3KTAA 3IHWA 3TAXA 1TRHA 3ZS8A 3C87A 1J2EA 4Q93A 1D1PA 3ICPA 3WJ7A 4G1FA 1DDOA 4Q1BA 1RPTA 1I3LA 4R7TA 2IYFA 2E3JA 3T7IA 2XTJA 3JVEA 1T3HA 4N7RA 2WIFA 3G02A 1M0EA 4QWMA 2XT0A 3ACCA 4JBYA 4ER6A 1R5JA 4LEIA 4EMUA 2OESA 3WSTA 5KSPA 3FR8A 4E4YA 2DYKA 1R6XA 5AHKA 2BGKA 5CVUA 5PGMA 5CDFE 3W6NA 4QWWA 3NKLA 3ON5A 1TPYA 1A77A 4AS1A 1EG2A 1W36C 1BU5A 2QM3A 2RBGA 3E8XA 3KTAB 3LYAA 4UTRA 5EZSA 1Y3AA 2HXYA 5F4BA 4Q1DA 2NSLA 4I3FA 4HAVA 5LPNA 2C3PA 4MV6A 3WOHA 3PTLA 2JJ2D 4BV8A 1QGZA 5JWRA 4IX1A 1XTUA 2NXNA 4WY2A 1NVTA 3QYJA 4LIPD 3FYUC 3H2HA 3MYYA 5IUNC 3F96A 2NAFA 3R0ZA 4Q48A 4RH3A 4MR7A 1FFWA 2JLBA 2XZLA 4L73A 1QRTA 1QE0A 2VHWA 3AHGA 4X7BA 1QZTA 4YFVA 3SIWA 4E5DA 1USKA 2WP0A 5JZVA 4IJWA 1Y37A 4FFWA 4OV6B 3PGVA 1XDGA 3AG6A 1M33A 2QP3A 3Q3IA 4PU0A 3TXXA 1J07A 2ZSJA 4QBGB 5DK4A 2XUKA 1GDTA 5GM2A 2C5GA 3HNOA 4BFXA 1EM8A 3EDQA 1YTLA 1S3GA 2QTFA 3IILA 3NTXA 3HXPA 2WNSA 3BQMB 4BEJA 3HXMA 3KB1A 1LLQA 2FZ4A 1Q7RA 4PFKA 4X1KB 4QVGA 5H81A 4ZYLA 2ID8A 2PV7A 5JVDF 1E2MA 4MR7B 8MHTA 3AQ4A 3RABA 2QZ4A 2VYCA 4IIBA 1CE8A 3DZBA 4KFTA 4QREA 3UKJA 4NDAA 1NE2A 1MC5A 1NUHA 3SEFA 4V24A 4LBYA 1XYVA 4EHBA 3QVLA 1JQAA 4G5HA 4XVQA 1T5LA 3IOCA 1VIAA 4TYWA 3DDHA 4WN3A 4RY2A 2CCJA 3AUUA 2AI3A 1P2TA 3GJ7A 4L16A 1T4DA 1EM8B 1PWZA 1TDJA 2LGJA 3DBHA 4KU4A 4EW1A 3IMFA 4MP3A 1NTOA 5FWDA 4YPOA 1S02A 2D06A 3MWDA 3OPYI 5DHFA 7GPBA 1JFSA 3GLIE 1P2VA 4I0WB 1H9AA 4UM9D 2HIAA 5E7JA 3MD9A 3MZ0A 5HS4A 1JG2A 3W7BA 1N77A 4M0CA 3ZQ6A 2QLJA 1RQLA 3ZWQA 1CE8B 3WKBA 1VRCA 2JPDA 4X8HA 1ZH8A 2QVBA 2UDPA 4FXPA 4LVCA 2G5GX 3QBJA 3WI7A 3WYAA 4CT4B 4EGJA 4TMKA 4IS2A 4MROA 1GSHA 1EEHA 5DH9A 3GLGE 1LWOA 3JWPA 3LYLA 3UW1A 1FPQA 4KNVA 1A8SA 3WLPA 1OZGA 4IJUA 1I1QB 3NTLA 3UUFA 3DBHB 2Q4BA 3CLTD 3STXA 1SOAA 4PR3A 1N78A 3MWDB 1G5PA 2KPOA 1SKUA 4K3VA 3QE0A 5EJ7A 3EB9A 3LQ1A 1WETA 1ZUNA 4RLFA 4MJ3A 1JT2A 2XB9A 2HHHB 4RYLA 3MTEA 2X23A 4YJ3F 5CNKA 3TRKA 3B36A 4GGPA 1GZVA 3OCVA 4IUBS 4DDWA 2GSWA 5F2KA 5JASA 5EJ8A 2W6QA 3DOJA 5C7IO 3W04A 1E60A 1HDRA 1NVMB 5F9HA 2GAFA 1UZMA 3OOJA 1WXFA 4LZLA 2JFPA 4JGBA 1X7ZA 2AMJA 3S2FA 3B9RA 2PCJA 3ONNA 4KI7A 2UYGA 4BFYA 3MGBA 4IF4A 3C16C 2B4QA 1GZ7A 4KOAA 1T1RA 2Z8YM 1YOBA 1ZUNB 3N2YA 4I7EA 2CZCA 3D4BA 1GCAA 2YV1A 4DCUA 2V5VA 3BZUA 4QDXA 1TLLA 2W6PA 4LA4A 3WGHA 4F1JA 1UM9A 1PVDA 1QG2A 1GUYA 3WYGA 3R9KA 4GKVA 4FEGA 2ERYA 2P6OA 2AKAB 3DDSA 2AV6A 2R68A 4YUXA 1X7ZB 2FEKA 4CI9A 3ORHA 1H3NA 1YAHA 1PLKA 2EFCB 2O57A 5CLGA 3LZCA 3Q9LA 4NWIA 5E2BA 2DR2A 2NXWA 3DE0X 3GDOA 5E7QA 3IUMA 2O7RA 1T2VA 3SZGA 5J63A 3A26A 4XWAA 4YYZA 4FYXA 1IZ7A 1NXXA 2JCSA 1L7RA 2QG6A 3FMVA 3NLLA 3UIEA 1JSXA 4IV5A 1A69A 1UM9B 1YK1A 3C74A 2HJGA 1KH3A 4GE0A 3TD9A 4CW7A 3Q2OA 1DKRA 3FDXA 4G65A 1RQRA 4L95C 3DLCA 1O8BA 3BXOA 2BV3A 4XTRA 4KXLA 3LCJA 5IUKC 1C3LA 2IODA 4MK4A 3PNVA 4IH1A 3G6WA 1KGSA 3B9QA 3K70C 3RM3A 2ZULA 4FYKA 2JIBA 2Q9BA 3BRQA 4TLMB 3V4PB 4ZI2A 4FGWA 2JKYA 2JJ1D 5EA2A 1MW8X 2INGX 2C2YA 1VHDA 4CEJA 2GWRA 3BWYA 3ROMA 2F8SA 3EXHC 3LL7A 4FNMA 3QQ5A 3WDLA 4B3FX 5AW6A 2PUCA 4RIHA 5JLJA 1U02A 3D8UA 4RZQA 4DV5B 2G5CA 4LOIA 1RP1A 3NDPA 1P9WA 2LIPA 2ERCA 3ZTTA 5B1EA 5LQAA 2R6HA 1BYUA 1RHRA 3O38A 3KV3O 2C29D 1HORA 3CKMA 3DFZA 3QVTA 1QYRA 1SXHA 5I4CA 4HAXA 4A36A 2XNHA 5JQGA 2WSSA 4JYZA 1MAUA 5KNCD 1GCUA 3ZVNA 3FKQA 4K1XA 4ALMA 3KRTA 2P9EA 5HJ7A 2WG2A 3KS9A 5C31A 1DZIA 5AW4A 2HU2A 1KY3A 2X6TA 4CDNA 4CEJB 4GU5A 4MHOA 4AJ1A 3E7DA 1N0HA 3AOGA 3U1TA 3FBWA 1ODSA 2HBRA 3GEDA 1I2MA 3CXUA 3ENWA 1CQXA 1L5WA 3A1TA 2HJVA 5T3UA 2QA5A 1NZDA 5IAKA 3PHGA 1RNLA 4TL9A 5EMLA 3OKCA 4BKOA 4B5KA 5JQGB 4D44A 2DETA 5GVSA 2D7DA 1IN1A 4AJPA 5KYVA 2NO6A 4B80A 1JA0A 2WM9B 4IVRA 4KRYA 3NATA 1N7GA 1CZUA 1EZ4A 3H2JA 4GXRA 3CTPA 2QWXA 3LVRE 1TAQA 2P4EA 4TS4A 1LDEA 1NC1A 1V1MA 1LFDB 5JS1A 4QJ3A 1T4BA 2C88A 5IT5A 1P9OA 4B3SB 3A4YA 4ITUA 4WA8A 4RHCA 1VPDA 2VR1A 2X1HA 3Q5EA 3DMHA 2WB4A 4LG1A 5D1HA 1ZVVA 5KOHA 3T5PA 1B2RA 1MGOA 2IXBA 2QXTA 4XVRA 2C54A 1WZCA 2H63A 2PA3A 3KYCA 3O6VA 3NFYA 1TA0A 2HQSA 4E5YA 2FSVA 3V3TA 1U0FA 2RCNA 3IOBA 3BA1A 3V8EA 4KHPB 4FHFA 4LRYA 3OFND 3NHYA 3WADA 3X1JA 1ECBA 1T35A 1V1MB 3LG2A 3LHDA 4K86A 1G21A 3OMXA 3ECCA 4N0EA 2VDWA 1RXSA 2H4JA 1B26A 2ZJBA 3C7CB 1ISHA 1YUNA 4MQ5A 2IE0A 1KOLA 2J4FA 4B33A 3L0PA 5JDCC 3FXAA 5KOHB 1Z5PA 4R41A 1LSSA 5EHQA 1SIUA 5G0TA 1DJPA 3CUYA 4QRIA 2B1GA 4M1KA 2PX4A 1YA4A 3KYCB 3HCEA 4UOZA 2ZCJA 1QWSA 2J3MA 2JA1A 4G8JA 1IHXA 2EDCA 4MWOA 3MK31 1Q1QA 3KETA 2OZLA 2D54A 3DNFA 3W2IA 1NRWA 1X94A 2X5XA 4PAMA 4U7FA 3VH3A 3I01A 2Y4NA 1DQNA 3KWLA 4RUKA 4TLAA 1J8YF 1S6YA 2VJQA 3DZGA 4LX8A 4BZPA 1G18A 2V54A 1G21B 4JLWA 4LBVA 3V7FA 1TD9A 2VDWB 3KP1A 2XI4A 3G5AA 4YJFA 2XCTB 3RNLA 2AYXA 2ZE8A 3BQNB 4E07A 1BJRE 5ALVA 3OIDA 4PXSA 1WLYA 3TL6A 3K5HA 1L3BA 2YCBA 1P7CA 5DHTA 5AXBA 4P93A 3LWNA 4BTEA 3MUEA 4IVPA 3VV3A 3CJRA 4DLZA 4HADA 1G64A 4N3BA 4S2UA 4YRIA 2BEKA 1NBHA 1YHYA 4G0MA 1FC0A 2HZBA 2ZDQA 1XQ9A 2CN1A 4ACBA 3IP7A 1TF5A 2G6TA 2OZLB 4NX2A 3VR4H 3VR2D 2ZBEA 4INJA 2CMHA 3AF5A 5BRJA 3PHHA 1UDCA 3U31A 3CKKA 3VKHA 2G17A 4DVGA 3CBQA 2YY7A 5H3HA 4JVLA 2UVPA 1LPSA 4YJFB 2HDWA 3EPLA 3M81A 1D04A 2VP5A 3K8OE 1S3SA 4JB3A 4QPCA 5CITA 4ZVQA 2GMWA 3GUVA 3HGMA 3QFHA 5A5VA 4PG4A 2I1VB 5FR2A 3UUGA 3R0IA 4XUGB 3UMMA 5BQOA 2OM2A 3Q8MA 1MC8A 3DDZX 1FZTA 1QO7A 3GJZA 4LTMA 1LNSA 4L5JA 1JR6A 4QOEA 4RD6A 4TTQA 1ZCZA 3DCYA 5G0UA 5IKEA 1V35A 3CWCA 4PZCA 5DF1A 4OI0A 4IKPA 3W1EA 1XJQA 3JS5A 2B8NA 2WWFA 2PU5A 1H3EA 2RE8A 3H8VA 1MR3F 1CJBA 2I8AA 2PTGA 4AYTA 1QCDA 2EEZA 2JIZA 2XVAA 4KL8S 3UMSA 4F6LA 1ZNWA 5K0FA 2O8DA 2R25B 3SQLA 5KVCA 5DO9A 5FTKA 3ZWMA 1VKJA 9ATCA 3IAS6 3I6YA 2JFZA 2VN8A 3FKJA 3NRBA 3GFRA 2B7LA 1S4QA 1C4XA 4E88A 4YI5A 2ZP1A 2NSYA 4PM4A 5BP7A 3VPDA 2CF5A 4J1TA 4ZJZA 2XWJI 3PJGA 1Y80A 3QE2A 3D31A 3SHFA 1MDFA 1E6LA 4HB0A 1SA0A 1X42A 4QDTA 1E9FA 4HDCA 1IZ8A 2I2CA 5EFOA 4A9AA 1EJ6A 3BSYA 1QM5A 3T1NA 4GLJA 4AJ4A 5D01A 1ACMA 3S8MA 2FWPA 3WIOA 1TTTA 5AP9A 2O8DB 2R79A 3HUEA 1QZ3A 4RJKA 2HT6A 4HYQA 5L3QA 3SJUA 3WGJA 3JYHA 4GPD1 4FOPA 1RPAA 2KLBA 4XI9A 6REQA 3QEAZ 2BBWA 3JAMA 1MQ9A 1QLJA 1Y81A 2OOKA 1YDGA 1JTFA 3FVTA 4AP9A 1NN5A 1OV4A 5ITVA 5AJVB 3TSCA 3ZG6A 1CNFA 1XA3A 3NAGA 2DLCX 4CRWB 1SA0B 2E4AA 2V59A 2RB4A 3MJHA 1J0XO 4HDKA 1HZZA 5AKXA 3R7WA 3SEQA 3PQ3A 5EN4A 4QHTA 1RAGA 3FWZA 1Y7IA 4RLHA 4JT8A 2P9YA 4IGIA 1KMCA 4FGUA 4YUVA 3ROFA 5L3QB 1ZGGA 4KMOA 4RK4A 3W9YA 1Y9EA 1IN5A 3GRCA 5CURA 1WXGA 6REQB 1ONOA 4NONA 1SUAA 3IL2A 3TTYA 1SVIA 3TK1A 5C5EA 4GGOA 1YZKA 2LP4Y 3I0NA 4K6CA 4XJTA 1P4RA 3M3HA 1GPNA 2Y1DA 1UL1X 5KAPA 2FHPA 1EVIA 3JD2A 4HH1A 1QB8A 4M7RA 4HDKB 5KYWA 3EPKA 2GM4A 1DAFA 4V0QA 2V03A 2ZVDA 2ZRQA 1IN4A 1DIBA 1QK4A 3G2IA 2ACKA 2VYND 3ZEAA 4TTIA 1JYFA 4DCJA 1K89A 3WOVA 4BWYA 3H4VA 1U7TA 4W63A 4AZWA 5EUCA 3MJ4A 2CMFA 3DQPA 1WZUA 5CA1F 1DTEA 3B3QA 1QHIA 1I4WA 2G72A 1TD1A 2YZKA 3ND7A 1PL0A 4Y9RA 2CXOA 1S8NA 4IDOA 2O3QA 5CDHA 4LJLA 3JX9A 4YMGA 1S9HA 2DF8A 2AWNA 4IDBA 4K81B 2XA9A 4US0R 4AUNA 2IUFA 4RHUA 1FUYB 2YFQA 3SU8A 5KYWB 2EV9A 1OHHA 1ZD9A 3B6MA 3D2CA 4Z2YA 4ZIRA 3V2UA 1JHAA 3WXMA 2CJXA 4Q7LA 3ZE1B 3TKAA 4E5NA 1SBZA 2V7UA 2MSCB 1ZMXA 2ZWIA 4KB5A 2BF7A 3RVQA 4IJQA 4XLZA 1PS8A 3C3AA 1NR7A 3FOAA 1TCCA 2H08A 3GZTB 2WM3A 3I53A 3RS0A 1UBTS 5ILQA 3SI7A 2IPLA 2O2SA 3WTBA 2SICE 2GN2A 4YP6A 1YKGA 4O2AA 4XZ3A 1G8FA 3N74A 4DDTA 3TS1A 3JV7A 4CMJA 4IJMA 1PQ4A 3QUQA 4PZPA 3H65A 4ZIRB 1XK7A 2VJDA 3C3WA 2SNIE 5BV7A 4BU1A 2I29A 4DYHA 1KEUA 1O0SA 2OQVA 4ARVA 3DMDA 1NVAA 2N1MA 3ESZA 3JD0A 2NMVA 1RXYA 2R96A 1SHLA 4HBGA 3ZWXA 2Z57A 3T1VA 3B1FA 2CNDA 2W22A 1Y5MA 2EF1A 4PO1A 4FBLA 1TLFA 2JFUA 1KEZA 1KVSA 2O2YA 2ILVA 5G02A 2PO7A 1CX9B 1M8GA 1FJHA 5GAJA 4O2AB 1ENZA 1V9LA 1I51A 4ND3A 5IF3A 3OMWA 2HXGA 1JXOA 4PQEA 3F0TA 3LF1A 3ZWYA 5BMVA 4EVIA 3I1YA 1UT6A 3CNHA 2ONZA 4QPDA 4Q7EA 2I71A 2WSYB 3BXZA 3IMGA 4FR5A 2HU7A 2ZRIA 2EKBA 3RSHA 2K2WA 5DU2A 2J9RA 2NSJA 3H0EA 2OL4A 3ZLUA 4MTCA 3TZ6A 2CL0X 4QYIA 4R3NA 1MQ8B 2OO3A 2R97A 3OX4A 5AUNB 3AV0B 4C0AC 1SO8A 4YR9A 1TFRA 4INAA 2MMCA 1HT1E 2O2XA 3C1TA 4KX5A 3T38A 1GYQA 3VX3A 4BGEA 1A9RA 5KKCA 1QU3A 1DX4A 4L1KA 5IYZA 4BBAA 2FWJA 5IMBA 5BMVB 4W5RA 4B8WA 4HH3C 3INGA 4BVBA 3JAWA 1QVAA 3AK4A 3JQRA 1EAYA 1ZICA 3C4VA 1O5OA 1P1CA 2P91A 2QAGB 4I1YA 1Z6QA 2XE7A 1NQXA 1GU7A 3MQFA 4FI3C 3NC0C 3S7ZA 2ZVQX 3SXPA 4QYIB 4F3YA 1X74A 4E1AA 5BQFA 3SVLA 3B1VA 4QPPA 2B36A 2A8YA 5JSFA 2EZ4A 4Q1EA 2VFAA 4OQNA 3RFUA 3K1JA 1D0VA 1DHTA 4RY8A 5LCXA 1AS2A 4PFQA 3NP9A 4R2HA 1OOEA 4REQA 4X90A 4AJKA 4EKIA 5IYZB 3CKYA 3F74A 2P68A 2V7PA 3IPRA 4LDNA 1MX9A 1G2PA 1ZBQA 3JWEA 1ENYA 1ZD8A 4GICA 5JCJD 2VG8A 3HDVA 3HCPA 3LLSA 2OUKA 4A0GA 3EY4A 3WNQA 2EFEB 4ZOQI 1Z0IA 1U0JA 2ZBFA 1L9KA 3VC1A 2C9OA 4BX2A 2Z6AA 2OBBA 5AVZA 1QG0A 2Z08A 4DLNA 3PFGA 3R20A 1DAKA 5IAOA 3KPUA 1ONPA 5L7TA 5CHYA 3UMRA 3UHPA 3CZCA 3V55A 4AZTA 4JOCA 5CW1A 3IIEA 1V9CA 2VP3A 1XZJA 4REQB 4NC9A 3KHSA 3ESXA 3ACBA 5LDHA 2EWWA 1QPZA 4Y18A 4ARIA 3CUUA 2JAPA 3NB0A 3O91A 1JI0A 3ELUA 3PUHA 1KRHA 4PPNA 5C80A 2YWGA 2FX2A 4D4MA 1P3JA 2FETA 3REQA 3SK0A 5G53C 2FPOA 2HDHA 4HXEB 5DLYA 5JSUA 1U2RA 4Z5XA 1NRIA 3C1AA 4LWZA 3G0CA 1CUHA 1FVHA 2OHJA 4OHUA 4G2NA 3M9WA 1TJYA 1KDPA 3HG7A 1WBBA 1EUDB 3ZJUA 4Q15A 1RSZA 2UUBB 1Y6ZA 5F7XA 2VF2A 3S27A 13PKA 1Z0DA 2QSJA 3EUFA 4U7HA 1MJGM 1V39A 5JV5A 1NFQA 2F9MA 1DBRA 3SNKA 5B5SA 3IYLW 1X0XA 1MB3A 4TTVA 2BP7A 4GR4A 2IZ7A 3C3XA 4FUTA 4DNQA 2PXXA 1GDDA 3TXYA 1ZOSA 3UO8B 5JAMA 1MG0A 2G06A 4HX5A 1LDBA 3REQB 3HB5X 3BJZA 2PKCA 1VLJA 4EO4A 3KUCA 4ND7A 5I47A 3JAKB 5ER6A 4FWBA 2NPFA 2C7QA 3P26A 4N82A 5JROA 4ZZ2A 4AF6A 4QTTB 2IIPA 3D3KA 3GLTA 1TF7A 4JLPA 2QTMA 1R0BA 3RRXA 5BVGA 5C4IA 3AWDA 1Z36A 2ZXEA 4RVSA 1TU3A 4K9KA 2XT9A 4GYJA 3KU4A 1IONA 2BP7B 4P53A 4MVJG 2H1OA 3OQBA 4OYLA 4PLPA 3TBHA 4YT2A 4FFOA 1TQ6A 4ENSA 5C8ZA 3ANMA 2RK4A 4IHAA 2YV3A 3BERA 2DTEA 4F3KA 1KEKA 2JZNA 2RI6A 1EXWA 1ZNYA 3VDMA 2WZCA 4GRIA 4D9KA 3DC7A 1KFKB 2GX6A 3EQ2A 5LD2B 2QN8A 5ALLA 3WAGA 4B3MB 4O2BA 4WOPA 2B4KA 2H92A 2QNIA 4MUEA 2PQ6A 5F76A 5BVGB 3CR8A 1XZ8A 3OA2A 4OA8A 3RRMA 1NX6A 2HPZA 1JRLA 2C58A 2JI4A 2LW7A 3TBFA 1KQGA 3FTDA 3DB2A 2HQRA 3DEFA 1F2TB 1IDN1 3KHKA 4PIVA 5FF9A 4EHLA 5EXEA 4DEXA 4KEAA 2DH5A 4RDCA 3ZEIA 4YMTA 2W6IA 3SYTA 5JSHA 2Q62A 1VA4A 3QXGA 1R12A 1YBHA 1FF9A 2OCXA 2XYPA 3K2BA 4O2BB 1M76A 2HC9A 3G0OA 2XF8A 1RI2A 5DYYA 2VL7A 4EYKA 1P75A 4RORA 4MUHA 4PC7A 3M5PA 3WWDA 2GKGA 3AIKA 5AOBA 2ZSUA 1DIAA 4BUCA 2XB2A 4MQLA 4RACA 1G20E 4U6NA 5MGBA 1MOQA 3WX0A 3DAGA 4EG7A 2FN4A 3RS2A 5K2OA 4IX9A 3B53X 5AKZA 3QF7A 5FPQA 5LZ4A 4N3AA 4P4TA 2A7QA 4JXXA 1SHTX 4CF6A 4CN8A 1Q0LA 4TS3A 1HDYA 2VHCA 3LQKA 1NJ1A 6ADHA 2O54A 3KAKA 5GONF 3T15A 1XCMA 1WABA 3BIFA 1W4LA 1XZGA 1ZMBA 2GDJA 5FAXA 5FRDA 3GT0A 1RRGA 1OVMA 3QUCA 1BQEA 3CZQA 4RMGA 5IF9A 2ZG6A 4HUJA 2C4HA 1VA5A 5EQJB 4KQGA 1BU8A 1VJ1A 2KE5A 3OJEA 3WDMA 3CTMA 2LDXA 4KLAA 3TVYA 3H13A 4O59O 3NCTA 4ENPA 5JPCA 2LD4A 3FVWA 1J97A 4DLUA 3S68A 1IIBA 3EEBA 1ENPA 3RSOA 3I3OA 4M22A 4QAJA 5JZBA 3DQQA 2RAPA 4A2PA 5JDIC 2H1IA 4BWFB 3ZGNA 3U7HB 1Y4ZA 2Z0MA 1OV6A 4DSOA 2X1LA 3R4VA 4ZAWA 5F7JA 1FFBA 3M6VA 3NGMA 1WSBA 3BL5A 4PWYA 4RDXA 1Y3IA 1MB4A 1NNSA 3LQ4A 3M5WA 5DVZA 2Y92A 5JCXA 1ZXBA 3G9XA 2B0CA 3IUYA 4IM7A 4P54A 3SOPA 3MWEB 3UC9A 1P9NA 4D80A 3DTVD 9LDBA 4TZ0A 5HFNA 2AFHA 4U7TB 1YI8A 5AVWA 1TZJA 4WN9A 2Q1XA 4CMGA 4F0JA 1BXGA 2YZMA 1B16A 1FVOA 1RYZA 1YL5A 2Q28A 4PSDA 4GE3A 4HVCA 1NQVA 2BFFA 4ZT4A 1T4CA 3IEUA 4UHHA 4D5GA 2QRHA 4J7UA 4FKZA 2WT4A 5E0OA 1BFKA 1ZKDA 1UAAA 4B84A 3H9UA 1ZH6A 2AW3A 4KMRA 1JYSA 3B38A 4NYJR 2PZKA 1J0EA 1H6CA 1T6BY 2L19A 2ZFUA 1TO1E 2VOJA 3G8CA 5A6SB 4N6NA 2CBXA 5BSKA 4UDOA 1I0LA 5CEFA 2VNIA 1L8OA 3V8BA 1XZAA 1XZQA 2FN9A 2AFHB 4ZV7A 4JBGA 2GBCA 4L5CA 4V2UA 4WN9B 3CEHA 3PQFA 1BXGB 2ZSEA 3ZI0A 1QHYA 1T8UA 4H4CA 3HDYA 4TMFA 3RKRA 3PX3A 3JZAA 1GM5A 2BFFB 3UBMA 4MP8A 1T4CB 4DCCA 4DIDA 4X3PA 2PQ2A 2NN3C 2GB4A 2ID7A 4JFRA 2IXDA 2Q1SA 3MGAA 4KO2S 3W34A 4HV4A 1P1BA 2BMWA 2P2CA 2GZSA 4D7AA 2IH5A 1Y42X 2D5LA 1E0SA 5INTA 2IEZA 1U81A 4P7KA 3OLWA 2ZIUB 4EGFA 2DTDA 2GLTA 4YRGA 1K7XB 2NNWB 2VDPB 3P71T 1GP2A 2H4FA 1V6CA 5CW2A 3PFIA 3M4YA 4H3VA 3T7AA 2YWBA 3OTHA 4LGMA 4D82A 5K5EA 5LP1A 2ZSKA 4YK7A 2WKRA 1U63A 2G9VA 2VHJA 1G38A 4RL4A 1R3UA 1BDJA 4EQ6A 4Z4CA 2PKQO 2HD4A 2A94A 2O1SA 4OA5A 2JIQA 3WGZA 4EPXA 4G24A 4KV7A 2J6CA 4XRGA 2J3IA 2JCVA 3ZZMA 3TLBA 4OI4A 1MX5A 5FX2A 2ZJ4A 4DJEC 1RTKA 3KQYA 4B0PA 2XKBA 3F9RA 2WHYA 5BQ3A 1N92A 2R6JA 1JR3D 2FPWA 4D4IA 2EKPA 4FNAA 4ZT2A 2J59A 1PVVA 2R4TA 2WWHA 4P81A 4YAWA 1KZ9A 1Q21A 2G3YA 1CUAA 1E1LA 2ZT6A 4BMDA 1LPMA 2VXYA 1MVLA 4RKQA 3UJ3X 2VHEA 3BUSA 2VO1A 5AVUA 1M6VA 4L7VA 3HBFA 5FPPA 4UDYX 4EQ6B 3UKDA 4GKJB 1ZESA 2IK8A 3G0BA 4KVAA 3UJ6A 4BNDB 3HEBA 2PT7A 2VF7A 1QONA 2ROQA 4DS3A 1GSIA 1H2HA 1MNQA 2CDRA 3EJWA 1QIGA 1YCGA 3T3OA