1TCUA

Crystal structure of the purine nucleoside phosphorylase from schistosoma mansoni in complex with phosphate and acetate
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
285
structure length
282
Chain Sequence
ESVTANIENVKKVAHHIQKLTSIVPEIGIICGSGLGKLADGVKDKITIPYTKIPNFPQTSHSGNLIFGTLSGRKVVVMQGRFHMYEGYSNDTVALPIRVMKLLGVKILMVSNAAGGLNRSLKLGDFVILKDHIYLPGLGLNNILVGPNQEAFGTRFPALSNAYDRDLRKLAVQVAEENGFGNLVHQGVYVMNGGPCYETPAECTMLLNMGCDVVGMSTIPEVVIARHCGIQVFAVSLVTNISVLDVESDLKPNHEEVLATGAQRAELMQSWFEKIIEKLPKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures for the Potential Drug Target Purine Nucleoside Phosphorylase from Schistosoma mansoni Causal Agent of Schistosomiasis.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Transferase
molecule keywords purine-nucleoside phosphorylase
total genus 90
structure length 282
sequence length 285
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2004-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1tcuA00
2QSUA 2RJ3A 4YJKA 1U1EA 1RXYA 4LDNA 4GKAA 4F2PA 1M73E 1ULBA 1JE1A 3KVYA 1ZL2A 5B7NA 3EEIA 2IQ5A 1JE0A 3PHCA 1V45E 4JOSA 1JPVA 1RSZA 4D9HA 1B8OA 1ODKA 1V4NA 2B94A 4JWTA 2A0XA 4QFBA 1OV6A 1SJ9A 3UAVA 4EARA 1PKEA 1PR4A 1U1GA 4RJ2A 5B7PA 1PW7A 1Z35A 4WKNA 4F3CA 4DANA 3FWPA 3KU4A 3FOWA 3T94A 1V2HE 4BN0A 1I80A 4WKOA 2A8YA 3NBQA 1A9QA 4PR3A 1K9SA 4TXHA 1OVGA 1Z5PA 1CG6A 3FAZA 3OCCA 3O6VA 1Y1TA 4D8XA 4TS3A 3ODGA 4TTAA 1Z33A 4TXMA 1Y1RA 2AI1A 3INYA 2PGAA 1T8YA 5F7XA 1PR0A 1K3FA 1PR2A 4OF4A 4G89A 1Y1SA 1RR6A 4LZWA 4OGLA 5IU6A 1RFGE 4JP5A 1JDUA 3NM6B 1T8SA 4BMXA 1A69A 1Z36A 2GUWA 3FUCA 2A0WA 1Z39A 3EUEA 3E9ZA 1LX7A 1T0UA 4YNBA 4TS9A 1G2OA 4TXNA 5EUBA 1NC3A 2HSWA 5EFOA 1T8WA 4NY1A 1Y1QA 4QASA 4R31A 2OXFA 3FB1A 3PNPA 2OC9A 1ODIA 4DA0A 1ODLA 1RYZA 1U1FA 1YQQA 4GLFA 3GB9A 4DAEA 3OZDA 2QTTA 4QAQA 2AI3A 3OPVA 4MARA 4U2KA 1PBNA 1ZOSA 1A9PA 1RT9A 2AC7A 4WKPA 3IOMA 1PK7A 4BMZA 1JDZA 3E0QA 1ODJA 4NSNA 5F7ZA 1Z37A 3ONVA 1OU4A 4LNAA 4TXLA 5JPCA 1LVUA 2XRFA 2P4SA 4MCIA 2HWUA 2HN9A 3EMVA 3KHSA 2A0YA 5IFKA 3IEXA 5CCEA 1VHWA 3MMSA 4P54A 3DPSA 4DAOA 4D98A 1PR5A 4ECEA 1CB0A 5I3CA 1PK9A 3OOHA 3D1VA 3OZBA 5FAKA 1YR3A 4M7WA 1Z5NA 1PWYE 5F73A 1YBFA 3KUKA 4F2WA 1C3XA 1OUMA 2BSXA 4BMYA 3BSFA 3LBAA 4DA6A 1TD1A 2H8GA 5F7OA 2QDKA 3DF9A 4TTJA 4L0MA 5ETJA 4DA8A 3P0FA 3K8OE 3TL6A 1FXUA 4YMLA 1U1DA 5B7GA 1TCUA 1K27A 4TTIA 5F77A 2HRDA 2ISCA 1A9SA 2AI2A 3OF3A 1YQUA 1PR1A 4OY3A 4TXJA 1U1CA 2Q7OE 3UAWA 3OOEA 4L6IA 4LNHA 1V41E 1RXUA 3U40A 4QARA 1YRYE 1QE5A 3KVRA 4E1VA 4R2XA 3E9RA 1JDSA 1SD1A 1T8RA 4F1WA 1VFNA 1Z38A 1Y6RA 1TCVA 4I2VA 1Z34A 4TYMA 1JDTA 5F78A 2OECA 1NC1A 3C74A 4H1TA 1RXCA 3BL6A 4L5YA 3KVVA 3BJEA 3LGSA 3NM5A 5CXSA 1Z5OA 3DJFA 5CCDA 4MCHA 5F7JA 4D8YA 3OZCA 2I4TA 1JP7A 3UAZA 1SQ6A 1VMKA 4LKRA 1N3IA 3BGSA 1RXSA 3PHBE 4WKBA 1OTYA 4GLJA 1TGYA 3UAXA 1RCTE 5CYGA 1V3QE 2ON6A 4EB8A 4KN5A 1B8NA 4NS1A 4IP0A 2OC4A 4OGKA 1TGVA 3F8WA 4G8JA 2QTGA 4OEHA 3QPBA 4DA7A 4GMHA 3OZEA 3O4VA 3MB8A 4M1EA 5KB3A 4YO8A 4D8VA 1NW4A 1PF7E 3P0EA 4DARA 1ECPA 1V48A 3GGSA 4L5CA 3LA8A 3DP9A 5K1ZA 5B7QA 4FFSA 5EPUA 3DDOA 1SD2A 1ULAA 4R2WA 4PNPA 4X24A 4G41A 5CXQA 1PR6A 4WKCA 3UT6A 2QPLA 1JDVA 1VHJA 1XE3A 5CYFA 4QATA 3ENZA 1Y6QA 3EUFA 4M3NA 1OTXA 2I8AA 4OJTA 1WTAA 5DK6A 1A9RA 3FNQA 3PNSA 5C80A 1Q1GA 3UAYA 4F3KA 3K8QA 4L5AA 1A9TA 3NM4A 5F76A 4DABA 1A9OA 1LV8A 4UC0A 3SCZA 1JYSA 4QEZA 4K6OA
chains in the Genus database with same CATH superfamily
1BYUA 3ENQA 1ZG3A 3IBTA 3WKDA 4RH3A 4GI2A 3O3OB 2Y3IA 4H27A 1NQVA 3QEMB 4KO2S 3LPDA 3JATA 5EJEA 2EOAA 2G08A 2IP1A 1PWZA 1U2PA 1S02A 4KEAA 3P2YA 1JE1A 3O31A 2J3DA 1EQUA 5C0OE 6ABPA 4TKZA 4W9MC 4ONEA 5IM4F 2CL7X 4O1IA 4FILA 1NJGA 2GJSA 2NU6A 2QN6A 3KYBA 2R65A 5A4JA 2NO9A 1QZXA 3U4MA 4HDRB 1NQ5A 1ZLYA 4MR8B 5EKSA 3BD6A 2NMVA 3I28A 5BV2P 1M1XB 2AK2A 2WJYA 3LLVA 4NENA 4BL5A 5J4LA 4WPGA 1JG2A 1V4NA 3BGIA 2A0XA 2OHVA 5DHQA 3DS8A 2O9JA 3W1VA 3NXKA 4O4JA 1Z0KA 2IYZA 1FTNA 3BE4A 1VBMA 2GM4A 1Z4LA 3BIWA 3BXGA 5CH3A 3GCDA 4H1UA 1C80A 3KAKA 4MKHA 4CLXA 3JCZA 2HK8A 1MQSA 2WTBA 3LL7A 1QBKC 4RNDB 4AO7A 2Z2KA 3DQPA 3QUQA 1MA0A 2IH4A 4F3CA 3NI2A 2ERXA 5KOJA 1MAWA 3NGXA 4RTPA 1IHXA 3GJ7A 2WYUA 4TRRA 5DHSA 1U0TA 4FR2A 4UEQA 2FHSA 4X95A 2UZ1B 3WMFA 3NOQA 2GYVA 2WF8A 3HDJA 1HBJA 1NW9B 4KQKA 3RJTA 2HA5A 2PUWA 4MUBA 3UJBA 1BGVA 4HEHA 1HETA 4JVNA 2ENWA 2AV6A 2RGDA 1P2BA 1PO7A 1M5RA 4EZIA 1EVJA 4DEXA 2WIBA 2YY6A 2YHUA 2KLHA 4I5DA 2RD2A 3CONA 4Z9XA 1DBVO 4IXWA 3O8QB 3B36A 5EHGA 4ARZB 4D57A 2XB6A 2QXTA 2YCBA 1GJRA 4HDOB 5AVOA 2NVOA 4C7MA 2WIGA 5HNKA 4XSGA 3ADBA 2F1KA 2GEJA 4A0HA 4B75A 4HC4A 5JZ9A 2VTBA 3V42A 3E8SA 3Q4GA 2ZSAA 2RI0A 4J03A 4ZAYA 1C41A 4DB2A 2XUZA 4XUGB 3WKAA 4F4JA 4LMPA 4IYRA 4J0EA 3MLEA 2YMMA 4LHYA 1C8LA 1MX5A 2AZ4A 5CAEB 4RZ3A 5IULC 3IR5A 5JY1A 2RG1A 3CSSA 1J8YF 1TM2A 1JYEA 1Z5ZA 2Y1EA 2AI1A 3OZAA 1NL3A 3ASVA 5JH7F 4AP6A 1QHGA 3E5MA 3NDPA 2KX7A 2X9VA 5FAXA 4YCNA 3JQ9A 3M5PA 1HKUA 2J9RA 3RIMA 2JH3A 4RTLA 3EXEA 1VJCA 3QG5A 1O95D 5HBGA 2R86A 5TS2A 3UVEA 4RACA 1GPMA 2ZXUA 3P8ZA 3WLRA 4CQMB 1E3QA 2VYQA 1CY6A 2FPKA 5LKAA 3O91A 4Z9YA 3JQGB 1L4BA 1R8QA 2D0PB 1RHQA 3GJYA 3L05A 5AESA 1I9CA 1O6FA 1WPQA 5FL7D 3CX7A 1AURA 1GLNA 2DRIA 4DZRA 4DL9A 4IO0A 1HR0B 3AEUA 4CEHA 3ADDA 2A1TS 2X4GA 3IUBA 2LNDA 1RFGE 2DBVO 1EEXB 4B6PA 2PR2A 2V6JA 5GZ1A 4ZC1A 3A4MA 1E2MA 1CDDA 1G20E 1K3TA 3DYVA 2J32A 3K2EA 4PFJA 2BPOA 1RJGA 1J0BA 1KYTA 5DSTA 4BKUA 2XNJA 5C8DA 1VPLA 4PG6A 10MHA 1P29A 1RKXA 5AI9A 1RLUA 2NUTB 4O5AA 2W6MA 1CRZA 1Y7HA 4PGHA 3IEMA 1RAIA 4UHJA 1PG5A 1P61B 3TNLA 2BGMA 4NMHA 1U0RA 4O3MA 1U11A 3AF4A 3B8HA 3ZKWB 3GJRA 1D2MA 3QI2A 4PZUA 4RO0A 3MLBA 5H02A 1Q1ZA 4DCVA 5CNJA 4A6DA 3DKPA 5JJ5A 4ARCA 2HSWA 4RGBA 4K9PA 3WRXC 2QLLA 3IDSA 3NS7A 3NBXX 4EQZA 4TTRA 1FX1A 2YMLA 2CMGA 3A6ZA 5GIOE 3KQMA 2ZDGA 1WXDA 1JHQA 4FEEA 3UJPA 1J42A 4NYMR 5JBNA 1OYOA 1SOMA 4HB4A 1QZ3A 1ODIA 2G80A 1G41A 1KOLA 3SZMA 5K45A 4ZTUB 3ELWA 5AI5A 3HCWA 1UJ4A 1U1FA 3OH8A 2QG6A 5G0SA 4MI1A 1GHTA 5GV7A 4X8LA 2A88A 5F1KA 3SSNA 3QWHA 2WJIA 2ZYIA 4GE0A 4A8JC 5JNVA 2XWQA 1W85B 2PS9A 4W7HA 1EEHA 3KXKA 2VSNA 9LDTA 5HHTA 4B3TB 1RMQA 1KI6B 2QM7A 2WTEA 3QE0A 1SVIA 3DDCA 4GC5A 4QAQA 3A05A 4G8DA 2CZQA 4QXRA 4IWNA 2CLOB 1A88A 1S6YA 2Q1UA 4QODA 2R00C 1M10A 1HFKA 5FPSA 1PKXA 4N40A 3RU2A 4YFYA 2DFPA 1CW2B 4QQNA 1VKHA 1C0PA 2OUIA 4UVIA 4DLWA 1SWVA 4PNEA 1H2FA 1TM3E 3VDQA 4XLTA 3EODA 3TZLA 1OU4A 2VNKA 3NVMB 4J4HA 1QHYA 3GFSA 3M5DA 1BX1A 1EX1A 4RTSA 1EBFA 2RH9B 3PHJA 1Y33E 3I1IA 3AEUB 3PVZA 3AIMA 4CEHB 1PQYA 1DTSA 1URPA 1IY1A 1XSEA 3P26A 4QWWA 4FD3A 1GZDA 2WKPA 5K3FB 1ZGBA 3EIFA 3SN6A 3ZW8A 4TM7A 1X7XB 2W98A 1IZ8A 4CIBA 2QVXX 1G2PA 3K70D 1S01A 4M0KA 3L84A 4MHOA 4AT1A 1ZRMA 1T4MA 2Q6IA 4FMCF 4AY4A 5IWCA 4WXHA 3ETHA 4ZYWA 2VBGA 4C4SA 2BGTA 2JGJA 4K7JA 4DDHA 1NNSA 2QTVA 4M7PA 2CFOA 4EF4A 5FAKA 3VBCA 1PEYA 3K0AA 1FZTA 1YR3A 4KFRA 2E89A 3GJQA 3B5IA 4ZARA 5LMCA 3H5VA 4EHAA 5B57C 3T7IA 4BO5A 5SY9A 3W7AA 3FFWA 4JODA 3HNPA 5F73A 3AI3A 1SN7A 1RM5A 4GXTA 4DQVA 4FCWA 3FMFA 2KHZA 3L8DA 4QPPA 2JFXA 5IJ0A 3MERA 1KZ4A 4ARUA 2BFBB 1JALA 1KO8A 3QVGA 3R3YA 5CR9A 2HU7A 3HWX1 3W6UA 1KZ9A 4CF6A 1E7RA 1LZLA 3VU0A 2VNJA 1SD5A 1EU1A 3MJFA 2FWNA 2YXNA 4TTJA 2HCBA 3KOXA 4C0XA 4MVYA 2ATIA 3UJAA 4TL6A 5KOHA 4OLHA 3ETCA 3IJ5A 4ZQEA 3ZWXA 5JADA 1JT9A 4DBLC 2VPPA 2C4VA 2FW6A 2R1VA 4QPDA 4B33A 1X7DA 1NV9A 4XVRA 5KSWB 3NBMA 4D0SA 3MRXA 2WSSA 1OYYA 3GH3A 3R0XA 1NR5A 3UG6A 1WS6A 4FZRA 4X7BA 4UMFA 1A97A 5CJPA 2NLOA 2HCJB 2KW5A 1H2EA 1PLKA 3MMNA 1IBCA 1D2HA 1SBQA 1KP9A 2JBWA 2BLLA 1D5CA 1CZRA 2AG0A 2QQFA 5CM9C 1A9SA 2HD4A 2VDRB 2Y9MB 1V7ZA 2YOFA 2QZZA 3A04A 4PLFA 4UMDA 2Z3ZA 1NMSA 1QVVA 2Q5CA 1NZDA 3SYRA 3UN1A 1GRRA 4L6IA 5KYKA 3BD7A 5HXAA 3CVXA 1E4EA 5L7TA 1LKZA 4TKVB 4HQRA 1JHVA 2ZUSA 2C7BA 4E0BA 2V4ZA 2ZIGA 1KH2A 1GIAA 3I9LA 3TW8B 2B21A 2VK2A 2GPJA 2YQ4A 1DZIA 1N5RA 2C61A 2PANA 2IWRA 3EZ2A 3CLTC 3NEJA 1PAUA 2E18A 3NNDA 4FHDA 4HAWA 4RHEA 5KSZA 3ERCA 4ITRC 4G1MB 1A4UA 2IA5A 5I48A 4CMBA 1O5OA 4JJIA 4BLRA 5KWJA 1JZQA 3K1JA 3DXZA 5KYYA 1ZQ1A 2EHJA 3SM9A 2C1ZA 5A1JA 3VNAA 4HWTA 1Y63A 4KMRA 3GVIA 5IABA 1RAEA 2YXLA 1NW3A 1NR7A 1H23A 4XIGS 2XPCA 3U3ZA 3W78A 2VP5A 3H1AA 1Z34A 3RYCA 3JD1A 1SQ5A 4E3ZA 3EFEA 4UVHA 5F78A 2NSLA 1ACJA 4OPMA 1D8AA 4LXHA 3L6EA 4UBJA 4B74A 1B3BA 2ZQZA 2BKLA 5I7RA 1ONPA 1UKEA 1KZ6A 3UHJA 3QW2A 5ARBA 5AOAA 4B31A 4EFMA 4UTNA 2MHCA 3OSZA 4FFBA 3VKWA 1N75A 2OCXA 2BTQB 4G0PA 1NJ8A 2FR1A 3O83A 1DBQA 3AEKB 1R0YA 5GOTA 4RCYA 1E3SA 2H4JA 5CXSA 4HVLA 2DUUA 3DGFC 1H4TA 3SHQA 1K68A 3S5UA 2WZDA 3HU5A 4NV3A 3H6HA 3HWWA 1T2VA 1YBAA 3LKVA 2WHYA 3NT4A 1PVOA 1NXWA 5EFZA 4TRNA 5HIMA 3T3DA 2Q4DA 3UJ9A 3TL2A 1MV5A 4F4CA 3HZHA 3NBZC 3LTNC 2O2YA 3M4JA 4GEKA 1NKTA 2XLBA 5LB4A 3AP2A 2IVZA 3RHZA 3L0BA 1UPFA 5F7JA 5ICGA 2VUUA 2WU4A 3O9MA 1EESA 1I4OA 2PA0A 5C35A 4J49A 1E9VA 1L5OA 3ACBA 3KUXA 3HVJA 3RTAA 3CT4A 4BN4A 3MTGA 2O19A 2WJ6A 4IDDA 1E3LA 1SVUA 1UODA 1JIXA 1C8VB 1FZQA 4QO7A 1W75A 2P3LA 1RXSA 2J3QA 2XB9A 5JCOC 2P2GA 3L6DA 3A26A 3CUSA 4WK4B 4DS3A 4DC9A 4MWDA 4MLCA 5MN6A 1E63A 1P4RA 4K8OA 3HMKA 2WE7A 3EW9A 3WMEA 4BFUA 4F11A 1GL6A 3EWSA 3W2EA 4BNFA 3L04A 3LUKA 1E2GA 4HUQB 5AJHA 2ONZA 3RLFA 4QFDA 4DPLA 1N9GA 4UNIA 3AEYA 3TRHA 3IB3A 2P79A 4D3XA 5AW3A 2HA4A 1EGQA 5AVRA 3VC7A 1Y8RA 2Q49A 4TMZA 1XK7A 1FUKA 3F5QA 4U3JB 4MVJH 5BNTA 5CXUA 2AZTA 3VSBA 5I7FA 2SBTA 2Q21A 4DRXA 1G5PA 3CISA 4IVNA 5LMNB 2J08A 3USES 1LX6A 1XTIA 1MJHA 5JLAA 3G79A 3E1SA 2I4MA 3TAHA 1VMEA 4L57A 1GGJA 1J5XA 4GEGA 1JQ5A 3GUVA 1P60A 1JMKC 1C3EA 2YJNA 4FE4A 2OV2A 3L7MA 4MDHA 1XDBA 4TQUS 1VE3A 4R2JA 2BZSA 1EGHA 2B7LA 3PV0A 2W2VA 4AQ7A 3G9ZA 3N6RA 4D8VA 4O2BA 1J00A 1J7JA 2ZBGA 4ZFNA 1QB7A 3K0AB 3ROFA 2FVYA 1NULA 4K9RA 3TUZC 1OH6A 3G2HA 1UEIA 2A5LA 3ANTA 3HGMA 1V48A 5KPJA 5T8KA 3AM1A 4NJEB 1F8UA 2BRUA 5HKKD 1ZK4A 3FNRA 2XV1A 1M34B 5JHHB 1J8MF 1LS1A 1UDBA 2HK6A 3DP9A 3R6TA 1HDIA 1SXJC 4IVPA 5EP4A 4XR4A 2V1XA 4X91A 1G9XA 2MR6A 1JPNA 2YXBA 3IXQA 1LEHA 1K75A 3X44A 3H99A 3EPHA 1SKYB 4NBTA 5LZ7A 4DRYA 4MS1B 1O2DA 1XAJA 2W2LA 4Z1MD 5G02A 1W5TA 2AQIA 4AS1A 2BONA 1MAHA 2NNLD 2P4QA 1I30A 5DI3A 4OOEA 3FKJA 5H8WA 2CJWB 1ZICA 3RFXA 1CEQA 1T10A 5FUYA 3SC2B 3I01M 3G89A 1JSXA 3OWOA 1JW9B 1VJ1A 4JL6A 4DYHA 721PA 2OR3A 2EBWA 4NZZA 2QBYB 3NWOA 1JLSA 3H65A 1TM1E 2MSDB 4BATA 4RGQA 4DJFC 5F52A 1N5LA 4O8CA 4L02A 2BR4A 1CF4A 3VU1A 4FP9A 3E23A 4RDXA 5GZ3A 4G4SO 2AG1A 1QP7A 2HYDA 1MTOA 4JBHA 5LMUB 1QHSA 1GUAA 1ZH2A 2EU8A 1YL6A 5DW0A 2IUTA 3CEJA 2R9VA 3MYYA 4H7PA 4KKXB 4X1KA 5DRYA 4D9CA 3UMMA 3U56A 1IATA 3WO0A 2F17A 1QDEA 4YJ3B 4ZICA 2C97A 3A7EA 3IO3A 3K1TA 2W6PA 4FLMA 3GJ0A 1VB5A 4ZU1X 1RLJA 2NO4A 1BKDR 3SVLA 1V7QA 2XKJE 4TVBA 3HS3A 3NM4A 2D62A 1IXKA 1NW7A 4ENWA 1YC2A 2DFNA 5CYPA 2RH8A 2AYYA 3QHQA 4UC0A 2O2CA 4E94A 1VCIA 1EP3B 1IYZA 4LV6A 2IHJA 1Q74A 2VCHA 1Q50A 2I6XA 2Z1MA 2GJ8A 1OFHA 2PMBA 3NP9A 3QPDA 1G3QA 3EMBA 3P20A 2PL1A 3U7IA 1FUUA 1K5DA 1PSZA 3KAPA 3VJLA 4DYVA 1SUSA 2UUBB 4OX9B 2ZJ8A 4ABTA 2FDCA 1R5JA 4UTOA 2F9MA 3DVSX 1JQAA 1ULBA 4UE3S 2F8TA 2WU3A 4QSMA 1BYIA 5EN4A 3VSAA 2HHLA 3PRJA 1KVTA 3HWSA 1HDZA 1C29B 4E2FA 5B3JC 2D5AA 3UK0A 4QRIA 5DCYA 1NNLA 4Y6PA 1JN0A 5AKLA 5D1HA 2C7PA 1DXYA 2D7CA 3J80A 4XOIA 1NQOA 3D7SA 1HT3A 3W5HA 4E5UA 3DMNA 3EMDA 1S8OA 3JQFA 1ABBA 2NM0A 3TLZA 5JUWA 1XNJA 2BFEA 4BLWA 1JIVA 5HRAA 1RP7A 1JJIA 4QHTA 3JR3A 5JAQA 1N2BA 1YE5A 4I1OA 3IDOA 4YIKA 4EARA 1MENA 3X1XA 2OD2A 3B2NA 2R2GA 4HXGA 1DBIA 3GL9A 5FDFA 1IHYA 3TZCA 5EZYA 1XCGB 3MTDA 3RC2A 2X3UA 4G86A 5B7PA 1I2ZA 4HNGA 4F5DA 1GRNA 2XB8A 1KS2A 3SHTA 4WBNA 4YQEA 1F60A 2FW7A 1CPYA 3NTRA 3O7MA 3ZJ4A 2QLJA 4B6QA 2NZWA 4CM8B 2M2IA 4ZAWA 4IINA 3UHPA 1X1QA 4WK2B 3ZIAA 4WZ6A 1CF9A 1KK3A 1V8ZA 1JR3A 3KL2A 2CEKA 3CUYA 4J07A 3FWPA 1FNDA 3IE1A 2F67A 2C2ZA 3M1YA 4RSGA 2QJWA 3WIDA 2A8YA 4LK2A 1ZK0A 3GA0A 3BGWA 3DUFB 3RSFA 4QJ3A 1TB4A 2HV8A 2D59A 3RHFA 4YN3A 4OLFA 4AFNA 4WE3A 1HA3A 1VPDA 1E5XA 2XCLA 3SE0A 1U8YA 2DPLA 1LPMA 2BKEA 4US0R 3T3EA 1T5DX 3GLTA 1FDUA 1EUZA 4YT2A 4C22A 1Z5PA 3CH4B 3BTUA 1UXJA 2I67A 3CPJB 1GGHA 4WV3A 4JT9A 4IX9A 3N70A 2Q9CA 2YRFA 3EBOA 3GAZA 2W58A 3K30A 3U81A 4DQ0A 5TDHA 1HNZB 2NSDA 4L9WA 4B2PA 4MPJA 4EY3A 4XDYA 4ZI2A 3SKVA 1T0JB 3IT1A 5CGQB 5GVSA 1PD0A 4TTAA 3T5GA 2NTNA 2WJJA 5BYBA 4L8WB 2BM1A 3TMYA 4BCDA 1ESZA 4YWJA 4WLEA 1XCMA 2A58A 4CR7A 4ZGWA 5KOIA 1ZJ4A 1ZD2P 1XEAA 3UW1A 4F8YA 3I5XA 2W5UA 2XY4A 4G2NA 3DLBA 2V9ZA 1L4MA 5DIZA 3QVMA 5AUQA 1L9KA 4KE8A 4Q4AB 1GILA 1BWQA 2EG9A 3MGKA 2X86A 3B1WA 4DDVA 5DXJA 4XEUA 2O8VA 3CEPB 1IEWA 1UPTA 4YRBA 4DUZB 1H3EA 3PDUA 2HJHA 4PYQA 3W4KA 3CE9A 3HCOA 1NUAA 2JCXA 4PCLA 1QS0A 4QQ8A 1BXRB 1DJPA 2IPNA 4R16A 5ADVA 1AHNA 4IZOA 4KN6A 2O1WA 4ZVQA 4HDRA 1AB5A 4IV0A 4LZZA 3VYSB 3DVLA 4KQ1A 2GCNA 2WZCA 1BS9A 3C87A 1PZGA 1EYZA 1UK7A 1MJGM 1GPNA 2H4HA 2Q2OA 2ZUCA 1T1GA 3DVRX 4PSCA 5GM1A 1ZJWA 1REQA 4RFLA 1FFAA 3ZI4A 4F6RA 2PT7A 3Q5DA 4RH0A 4MH0R 4V0SA 2UUAB 2IF0A 3TCNA 1U2GA 4Q7JB 1WMFA 3W79A 3QUSA 1SBZA 4FS8A 4PO1A 2UVDA 1WF6A 2XQIA 3OJFA 1Z36A 2VZEA 5C18A 5IJ0B 2P9TA 3REGA 3RYFB 4GBGA 1NN1A 2FP3A 1G8JA 1B16A 3WICA 2HLDA 1CJMA 221PA 3QV1A 4F5EA 1Z63A 2RKBA 2NU8B 1IPFA 2J31A 2O5RA 3PQCA 1ZIPA 2QSYA 3U4IA 3A9RA 3RYTC 1H3FA 1EFRD 3IDFA 1R8JA 4I1IA 1YI1A 3WRXA 5T6BA 4CKYA 5NLLA 2CV2A 3FYTA 3QPAA 5CM8B 4JQYA 1EFDN 1RWVA 3P0HA 2VF2A 2V03A 4NH0A 3RVLA 3VZCA 4BQNA 2YFYA 2OB1A 1JQLB 2AFVA 3LXXA 3PJEA 3UATA 4M1WA 2HJWA 2AMJA 4URHA 1A9XB 4EUKA 2J7PD 2FX3A 1AGNA 3AW9A 3OQHA 2ZT5A 3W9YA 4BO6A 2ZBFA 2XNCA 3AQ4A 1N1GA 3EXFB 2GS9A 1R9JA 1KEEB 3CPSA 4E11A 2GQ0A 4ZI7A 2O54A 2P1DA 1XZEA 5MFZA 4RF2A 4FWIB 4A4DA 1A2KC 1N2XA 5JCXA 2VZ8A 2ZR0A 3VVMA 1YQXA 1NP6A 3LP8A 3NRBA 3WS7A 3WLQA 3WFJA 3LKBA 1Q7TA 5IS2A 3IOMA 1XZCA 4L2IB 4X63A 4P6VF 4BMZA 4DSTA 3PBKA 2QP4A 3E0QA 2VDJA 4HNVA 1RW4A 1TKBA 4EUHA 3EEFA 3QKWA 1GFIA 4PAMA 4BNTA 4PZAA 4RPGA 1WSAA 1MX3A 1T3TA 3COJA 1ZNZA 3DEAA 5C8YB 4EHIA 2XRFA 1VJGA 4ARSA 1E2BA 3VO2A 3DXFA 3EC2A 4HDSB 1YGPA 3MN1A 4EAAA 3WAKA 2I55A 2E49A 3OIUA 4JSYA 2JFYA 1L1EA 1AV6A 2PX5A 3N8GA 3ZY5A 4BXOA 1KMMA 1T9ZA 2BE9A 5EA2A 3AK4A 1P9RA 3EOZA 4D4MA 4DDKA 1UKYA 1R4ZA 2HBYA 4J1SA 1OKKD 5FTMA 3NORA 4N5DA 5TPWA 3RKUA 1K63A 4RLQA 2ZJOA 3OA0A 1BVYF 4U5QA 5H9VA 3D1VA 1EUYA 4N41A 4P0TA 1WLYA 2GBLA 4CMAA 4M0MA 1Z8FA 2C4KA 1HTBA 2VQSA 3NU1A 2GRAA 4JU9A 3EC1A 3H9BA 4TLEA 4ADSG 1EWTA 1G9SA 4KK3A 2AF4C 3NVKI 2W6JA 4R1UA 3HJNA 4F21A 1NDHA 3OMWA 1EMDA 1QOQB 4D9KA 1PWYE 1RWQA 1G3IA 3ZDDA 2GGSA 3KUKA 2R7LA 3NO4A 1XQWA 2GKOA 3GJ8A 4ZYVA 2VPYA 2UUOA 2UZ1A 2QMUA 5ALKA 1A4RA 4QNMA 4BTEA 4Z3OA 1JR6A 3DOIA 3ZJTA 2WG1A 2YJTD 4CN8A 1OPXA 4J2HA 3MA0A 1SXQA 4GR4A 4D7AA 2QLTA 1EVKA 4QTTB 3CO5A 3NUQA 1J25A 4BFXA 3SBEA 3WHLA 2YZNA 3IAAA 2C9YA 1RYHA 3HKCA 4ZEOA 1H4SA 4LOIA 4DA4A 1K6MA 2BR5A 4FIZA 3PEWA 1FCJA 5ELLA 4I5FA 3DFUA 3R5HA 4ZV4A 3TIGA 3GWZA 1ZVMA 2NT4A 5BNWA 1FTQA 1Q3HA 3NVDA 5B7GA 3E3AA 1C4WA 1VIAA 3WWOA 3UMYA 1ZD9A 2V58A 2GESA 3AT1A 5K9ZA 2B8EA 2CDNA 1I6LA 1DT5A 1DAFA 1FW8A 1MX1A 1V5EA 3R4CA 4QPZA 4WLVA 1R0CA 1QGUA 3V4PB 2AFIE 4EKNB 2GZHA 3IDQA 2CF6A 5H83A 4AF8A 4EX7A 4QZVA 1YQUA 3F4KA 2YWJA 3BE5A 4J2OA 3OZWA 2D0DA 2ZCVA 3DCIA 4DIKA 4YR9A 2Q7OE 1CR6A 1YOVA 2M6LA 3UAWA 1XQ1A 1A76A 2DFKB 2JRLA 3R6DA 2PUVA 4S24A 3W90A 3I6IA 4ALLA 2CL5A 1BOOA 2I2AA 1U0NA 1XQYA 3R24A 4AZVA 3C3WA 1P1FA 3HXKA 5AVZA 4O5OA 4I14A 4AWAA 3BCRA 5C4IA 1DV1A 1LSJA 4PG5A 5JQGB 1KQGA 2VOEA 1P1CA 4LBZA 3HV2A 1Y3CE 2R751 1YZLA 1BH2A 2PUHA 3I52A 3JQQA 4R3NA 3BK7A 3NW9A 2G82A 1T3LA 3LW8A 3UWDA 4KPEC 1G3UA 1Y8AA 1ECGA 4FHGA 9ABPA 4RVGA 5LLDA 3FGOA 1QK5A 1WKVA 2DBQA 2EDAA 3GRZA 4LECA 4XOUA 2AJCA 2ZFUA 1UQTA 4N48A 1Z28A 1FXSA 4UU0A 3LYAA 1OYWA 2WP8J 3DB2A 3OPNA 3OU6A 3H5AA 5BR4A 5B4VA 3CINA 2GHRA 1L5FA 3DBLB 4GR5A 1JKJA 2C1EA 2WWWA 3S1AA 1QH0A 3UXEA 4JR2A 2HSDA 2Y0CA 5D7BA 1M2NA 5GJVC 5E9JA 3HGQA 2P6NA 3JVDA 2HF7A 3AF3A 2W2TA 1C81A 2I7DA 3T5BA 2CVPA 2XB4A 3O5AA 2PGXA 3RODA 1JNXX 5LR6A 1YR7A 3OTGA 5FWXB 2FKNA 3IP8A 4Z0NA 3RAFC 4NC9A 3VPDA 2L19A 3SQOA 1A5ZA 1DKPA 3ESAA 2JHPA 2O7SA 4B46A 3L8MA 2XRMA 2W6ID 1V1RB 3U3OA 4HAZA 2YS7A 4F8EA 2IE8A 4OUKX 5IT9A 4IXNA 5CJ2A 5CCDA 1SKQA 3CNOA 4OXRA 3MJDA 1BDHA 1NBWB 4HYYA 4MCHA 3OT5A 4IWYA 4B4KA 2JIZA 5H82A 4BVEA 2A9KA 2ZATA 2PKEA 1HMPA 1WKBA 2QUHA 3F98A 1RXVA 2Y1LA 1KRWA 2GLUA 3LYHA 1SRRA 3UAZA 1T34A 1GQFA 4NCHA 3ESCA 4I4IA 2DYKA 1GG8A 4KPUA 1AGXA 1V9LA 1CVLA 3PVSA 1JI3A 2BRUC 4IDHA 5FV4A 1QV7A 1O0BA 4QOJA 1V5IA 3HKCB 1MB3A 1ZEJA 1E1DA 1YCDA 4X1KB 4X8HA 4OFXA 1CJSA 4OYYA 3THOA 4LHWA 3VQTA 3SLKA 4CUKA 2JCVA 4ZI3A 4Q16A 3C8HA 2QG9A 1P74A 1GR1A 5GOZA 4MV7A 5F1YA 3EF3A 1VSVA 2WJZB 5REQB 3ICEA 5C2JB 2PUDA 5CB0A 2OK8A 1WW8A 2FUCA 1CE8B 4GBJA 4REQB 4F71A 4MW2A 2X8WA 3GFRA 3VV3A 4BDSA 3QXCA 3VR6D 3KKPA 4U0JA 3A32A 1ISFA 3WLIA 4OJKA 4C7XA 3RU3A 3VNRA 1U3WA 4BFZA 2Z1NA 3AUXA 4PYOA 1JQBA 1F2TB 4R6XA 4CTJA 3O4RA 3C48A 2OD9A 4JUCA 2QTGA 3O8OA 3FRHA 3RTCA 1T4DA 5DXAA 4BX9A 1QRTA 4UPEA 3CVVA 5CJJA 2VJKA 1OXMA 3EGDA 3QNWA 1CR0A 2P2DA 3A37A 1RPTA 3FPAA 6YASA 1U0EA 2Q4TA 5HEKA 3HCFA 4CE6A 3ZHSA 4JBGA 3CKLA 3IJEB 4YASA 1UDCA 1UT5A 1J2RA 1EX6A 4RD2A 3WKEA 1GNVA 3KZVA 1EX9A 2O2HA 3AG5A 3ZUGA 4DMKA 3W5IA 1VHDA 5MHTA 3QWIA 3ZNQA 3KKQA 1HV8A 4PZ9A 3WFIA 1S89A 2OLJA 3X1MA 1VMAA 1FDRA 4XW2A 2FEKA 2GFIA 3DHYA 3NWEA 3C6QA 1W8DA 1RRVA 4FKBA 4FNMA 3OZVA 4HUJA 4CL2A 4LJ4A 1U28C 1WCWA 3WL7A 3SGLA 3AOEC 5DYNA 4C3UA 5EZYB 4A27A 2ZAIA 3EZLA 3LQYA 3O84A 1TLTA 3MYRA 2A5JA 1KJJA 5CBPB 4D0LB 3ZD8A 3QVWA 5JO9A 2AFHA 4EHBA 1B3RA 1JHRA 1NOJA 1ZH6A 5BW6B 1JTFA 1OY1A 1NJFA 2JKYA 4FR0A 4M21A 1N8KA 2WNHA 4MVJG 4OUDA 5A9TA 4DQLA 4WZZA 2GD1O 2OFPA 1Y80A 1YIAA 2QNRA 4Y7CA 2WKQA 1E6KA 1YGYA 3SHOA 5BNIA 5JNWA 3E81A 4MP3A 4C6HA 1B23P 2HKIA 5CIYA 1WF3A 2LTAA 3IS3A 1A27A 3ZW9A 5B2FA 4ESVA 3EBPA 4MHSA 2DTXA 4K2AA 2L18A 3R0IA 2NSYA 4KQGA 1G2IA 4R40A 1KMCA 2ZITA 5ICEA 1E2LA 1NVTA 5AXCA 1EB9A 1SU8A 1TYEB 4V02A 4XH9B 1G5HA 4RETA 1ZESA 3P1JA 1CQWA 1HDRA 3CEHA 4LFAB 5MGBA 4CHTA 1UM9A 1TVMA 3QXHA 5SY4A 4WAUA 4UEJA 1N0VC 4QUDA 4XSVA 3OTHA 4XCQA 3UANA 4IDQA 1H69A 1B8VA 1NLFA 5IVIA 3T0FA 3SHFA 4CL0A 4QDXA 2YY5A 1ZI9A 2YXEA 3X2SA 2CB9A 3QE3A 5G3ZA 4ZCSA 1X1CA 2O8CB 4L5AA 2YKGA 4G07A 1Z88A 2IC5A 5LSAA 4JK3A 4KDRA 4MVJI 3MWEA 5SV2A 4FKZA 4MQBA 5CFLA 1XD2B 1DDGA 2C04A 4GICA 5E3IA 4FFRA 5AK4A 3VOBA 1ZN7A 2C9MA 1DRUA 3MRTA 4WJKB 4Y98A 5DLQC 5HOQA 3KXIA 4QE3A 5JSFA 2GTPA 1SHZA 1XBTA 4KACA 4RMJA 1EA7A 1V8PA 2RK4A 5CD9A 1FMLA 3KUDA 3OLCX 1XTSA 2IX9A 2I2WA 4R1SA 1UWVA 3EXEB 3KG2A 2XDQB 2JH8A 1FNSA 3M82A 4CN9A 3LHFA 1QQ7A 3ZOKA 5KUTA 5A9SB 3GUHA 2GXUA 1XZLA 2ZYDA 3TW4A 2IXFA 3ON5A 1ZGAA 1AQUA 3VGPA 2HEGA 1FU4A 4LNUB 2GHTA 2IW3A 3KKEA 3JWIA 5ECDA 3WYNA 5A62A 1XD2A 1HOXA 4RYDA 3KQLA 2XUOA 1KA9H 1Z6ZA 2A3RA 1L8LA 1N4DA 3I30X 4KXUA 4IHKA 4OB7A 3H18A 3EAFA 4NBSA 4Q01A 4QFBA 1QONA 2XTJA 5FI0B 3I53A 3LLUA 3I2KA 3RTEA 5EQDA 3JWEA 4DSUA 4DUYB 1QFMA 1SKMA 3WTBA 1CIPA 2MSLA 1P6UA 1H8ED 1PKEA 1NJ1A 2VAXA 3C8UA 1L5HB 2JF0A 4Q3KA 3UMBA 1WXGA 1FTWA 1QGED 2I9PA 3LIPA 1EBUA 4LDZA 5A3RA 3VSEA 2HYIC 2XZLA 1G7SA 3SYLA 3QKSA 1CY4A 1CJTC 4EW2A 1WZIA 1AHIA 2OV6A 3GRVA 3ITKA 2GBFA 1ZAKA 4L15A 2BY4A 4UCWA 5CT9A 5EWMB 2PBFA 3KE9A 4KBGA 2F1RA 4ILEA 1NXVA 1EFPA 2C4UA 5IEJA 5KYNA 1GSHA 4A9AA 2PBZA 4FW9A 4V1CI 4EA7A 3PICA 2FETA 2JLCA 5BSEA 4G0VA 4L08A 4F38A 5LVAA 1CJBA 2GI4A 3GDWA 3P2EA 1TTHA 5JAZA 1NBMD 1SHLA 5D6NA 5BRNA 2D3WA 3IVMA 1QG0A 4KQMA 7REQB 3KFVA 4W5TA 3K70C 1ZVVA 2GO7A 4AG3A 4H0FA 3KS9A 1SNYA 4O2BF 4DJEC 3IRUA 4HY3A 1W36C 1GTJ1 1ZC3A 1I7PA 4HEA1 3BJMA 4LC9A 4OXQA 2O4UX 3WV4A 1F9AA 3GPIA 1DQNA 3W5VA 1Y3IA 1ZI6A 4RA9B 3F97A 4MUGA 4QM6A 4P22A 1W19A 2UU9B 2G7MC 4EPVA 2JATA 3A4YA 4QEDA 2BL4A 4GKJB 4D74A 1GZ6A 1QDUA 4QDOA 3PFNA 4Z53A 4OVKA 3CNBA 4I9FA 4YRPA 1QIFA 4O4LF 1HX7A 3A8TA 4NZMA 5KYGA 4MYDA 5TVKA 4P81A 3L8FA 1GOTA 1RTTA 4D9MA 1U80A 3WL4A 5SZKB 4AI6A 3LY9A 1BHSA 2Z5LA 2OGWA 2ZI6A 3CZQA 3S8YA 3C0KA 3VR4H 4ND5A 4WZBA 3P97A 4M37A 1SUDA 2OFWA 1DOZA 4HNRA 1EVZA 3AKCA 3RRFA 3VKVA 4DA9A 5KQSA 2XCTB 5JATA 1JHAA 2R6CA 1U2TA 2ZZKA 4I4TF 5EKUA 3UH1A 4GX0A 4QVIA 3KR2A 2H51A 1EP9A 3R23A 1FSFA 2RHLA 2B5OA 2PX6A 3BHJA 4X1YA 4X71A 4XD7D 5SZIA 1XTRA 4Q0MA 3RAPR 3V5NA 4ALKA 4BO7A 2AN5A 3EW7A 3PFWO 3ZCVA 3MS4A 3FWHA 4YO7A 2RGWA 3MWDB 4PSVA 3T3MB 2A0UA 4BB5A 1U7PA 1N2SA 3MTJA 2V0GA 2PZMA 3OLVA 4F4UA 5ICCA 3TLCA 3Q7IA 4MV8A 3MFQA 1QV6A 3DPUA 3GX1A 5CHYA 5TQJA 5K3OA 4KSBA 4GGPA 1R10A 4IDGA 1YZTA 3FUCA 2V9CA 2J85A 2DOKA 3BZBA 1W5SA 4TPKA 5F51A 3WMWA 5K0ZA 5LXTB 2XKAA 1UUFA 4FPXA 4C6RA 2CE2X 3T1YB 3DD1A 5BSGA 1JL3A 1ZXBA 1DJLA 2X4LA 3DB1A 4JEIA 4RZSA 4YAOA 2WQ7A 3ETDA 3MJVA 1XN4A 4Q4HB 1ODSA 4QUAA 1BE0A 1L7RA 1UK8A 3BTSA 1L4KA 1QRDA 2WFMA 5AM1A 1T0UA 1ZC4A 2FAXA 2QN7A 2VYNA 1NTOA 4PRYA 4E13A 3AKEA 1J0DA 3AJEA 3C7AA 3PQ4A 2BFBA 1LPPA 3K2BA 3U6BA 3TS1A 1GNQA 1TPYA 4ZTZB 2JFHA 3RCBA 3I2IA 4RQAA 4K6MA 4UFNA 3ORFA 2GWHA 3LQKA 5HX7A 1OBOA 2QTHA 4P4NA 4QFCA 2W2PA 3A4LA 2J6IA 4P4UA 5J47A 4RF5A 4YCJA 3ZNPA 3K5IA 1NZJA 1EGMB 2ZE5A 3GFOA 4PBRA 1DCMA 1FJHA 1KDOA 1U7WA 3GU3A 4JITA 4UBMA 5DH9A 5BORA 2H18A 4FT2A 4DSZA 3QW4B 2ZRMA 3F8SA 4NI5A 4JL8A 4DM3A 1S9DA 2BGNA 4JMLA 4G1VA 3S28A 5HILA 4EI9A 4CETA 1L5WA 4CQLA 4BVJA 1FFXA 1UAAA 3L8ZA 3E4CA 3AY7A 4QT0A 4BWYA 1JHZA 2BFFB 3KSAC 1ZXLA 3MIIA 3N2EA 3ZLVA 1EB8A 4CMKA 4EH1A 3VU9B 4CGYA 3JALB 1GUZA 3EGWA 3LA6A 5B30A 1DVRA 3GVPA 1QIIA 5IJZA 1VRWA 3KPVA 5JISA 3TO5A 2OCAA 1S2NA 2F3TA 3BIOA 2NUBA 1OAAA 1JRLA 2B4QA 2R68A 2XMQA 2CNBA 2HWUA 4AJEA 1CS0B 1TF7A 4HP8A 1NBIA 3BBLA 2AJDA 1H6AA 2GYWA 2N47A 3RT9A 3L0ZA 2ZBEA 5CCEA 3U31A 3HCNA 4M38A 2CXHA 2M6KA 3WLMA 5EMNA 4O4LB 4MX8A 3SS9X 5FFNA 2CLEB 2K4MA 1CFZA 2YC2C 3FR7A 3OE5A 3IUQA 3PKJA 1YU6A 1VYVA 4N7BA 2GSWA 3A3NA 4IRUB 4UPVA 2G9ZA 2JGMA 3UMRA 1IBKB 4ZOLB 5DBHX 3VKHA 1RTKA 4UFOA 4MQEA 1J0AA 1ZGCA 1UJMA 1P1HA 3OZBA 1W9MA 5I7SA 1E1CA 1VL6A 2QYOA 3B60A 3PK0A 4N3BA 821PA 4OHBA 3LFTA 4N76A 4PONA 1DC7A 3QGMA 3IUJA 2PX2A 1KYZA 2PGDA 4X0EA 4X5OA 1UZMA 3KEOA 2NIPA 3Q3JB 1PJ8A 8LDHA 2IIVA 4NQZA 4Q1CA 1E0DA 5DSXA 5EPEA 4ZV9A 3EAQA 3L46A 5FOWA 4C5BA 7ADHA 3MXOA 4YDRA 3IPXA 1Q83A 1XQ9A 1YRWA 1P44A 1S2MA 1HUQA 2HFKA 2HGSA 2P30A 2ZDHA 4D81A 1AO0A 2RONA 4WCFA 3L1VA 2WMNB 4HGPA 2IYTA 3GBSA 1DFIA 1TMOA 2Q4BA 4DLSA 3EGXB 3DTYA 1EUDB 2X58A 5LQSA 3KOOA 1N7IA 2IYRA 3K0SA 3D4IA 3AUKA 1TO1E 2FZCA 1I36A 3OIDA 2B1GA 1U9CA 4E08A 1MRSA 3E2IA 1H85A 4BP1A 1J2UA 2JG3A 1WXQA 2XXAA 3WYDA 4L75A 1OHHA 3DH0A 1ZIYA 4FNOA 4W5WA 5LA6F 5BOVA 2IV7A 1P5HA 5CG2A 2ODQA 3T3GA 4TTIA 5BMVA 1BDJA 1TOAA 4RM2A 5KNBH 2IX3A 3KB6A 3VDXA 4CPDA 1IQ0A 4G0UA 3C41J 4IXMA 1QP4A 2JLWA 1T5HX 4IUDS 1R88A 3JQAB 3AHJA 1Y48E 1OJ7A 2HMAA 1UKVY 3OZTA 5GTDA 2YFQA 1WU7A 3CT6A 1U04A 4DLLA 2EKDA 3BKXA 4LQDA 5LCXA 4OAPA 4BNGA 3D6HA 2BELA 3TIXB 2PMFA 1W8IA 2VBCA 4ME6A 2UVPA 2JLQA 2FY8A 3SS8A 5HQ3A 4M0UA 3OURA 3F6BX 2INGX 1UOPA 3TLEA 2H4ZA 2GLTA 1DQSA 3T7RA 3JALA 1NYRA 5AFSA 1KSJA 3R40A 3B6IA 4X1YB 5D51S 3W4IA 3TLYA 4GSKA 3SJ7A 4BNNA 5C8VA 5KHLB 1LC3A 4GRDA 5CH5A 4RY8A 3URKA 5LMZA 4TM8A 3OQOA 3K8YA 1B1CA 1TUBA 4BLPA 3EWNA 2Q1YA 3H87A 2WHXA 5BVHB 3SVTA 5H3CA 4UPDA 2RGNC 3H16A 4E2WA 2OECA 3JTMA 2QK4A 2W2MA 3JYLA 4KMOA 4AX8A 4LDQA 2IS6A 4LVUA 3QH4A 3OIGA 4D0NA 1R1DA 3IKJA 2QORA 2WB4A 1FQWA 3ROPA 2QL9A 3PQ5A 3F5SA 1WHSB 2XUPA 4WW0A 3EC7A 4C43A 2AE1A 4JT4A 4PZYA 2QQ5A 2JJMA 1GNRA 5EOVA 4ZVKA 2ZREA 4XEHA 1G5RA 4MV4A 4ZVVA 1J8FA 1G21E 2OHOA 4BTLA 4EELA 3BDAA 1M1NA 3SQNA 3O92A 1E59A 2F59A 2FRXA 2G6BA 4XIIA 1ZR4A 5DI3B 4JSTA 1G4AE 5C5CA 4Q4HA 3SR4A 1JZTA 4TOIA 3REOA 5JALA 5LJLA 3UUFA 1GPLA 3DNMA 3HXMA 3WIVA 3S8EA 4UU8A 1C8BA 1IH8A 4X7PA 3PUXA 1C0LA 4CQMD 5EGSA 3MK31 4IFBA 3HCBA 2Q50A 4F3TA 5GONB 3QVUA 4M8NE 3T1VA 2RI6A 1GXSA 4AYTA 2PRKA 1UXHA 3DM5A 2PWYA 2X5OA 3OP1A 1HH4A 3JAKB 2VEDA 4RVSA 1TIKA 4XIJA 5G0TA 1G7TA 1KJ8A 1ZONA 2QENA 4XWTA 4AJPA 3ZGNA 2BFAA 2PGOA 4FOTA 2ZM6B 3L8EA 1L5QA 3PU6A 4GQBA 3UCXA 4GLBA 2D7DA 1KETA 4ZGGA 1UT6A 1T4GA 4I5EA 3V1NA 4JQCA 5EAIA 3RG8A 3M6AA 1D6MA 4XQCA 1E3EA 3F1LA 4O4HB 4S04A 5BWOA 4RUKA 3UK1A 3KT0A 1RYEA 1WB4A 1DEAA 4US1R 4CKXA 1YDEA 1FSPA 2X0DA 1EE1A 5LA6B 4RL6A 2KQUA 2WYOA 3AF1A 3DZJA 5FLEX 4NZ9A 2ZU6A 1HYHA 1P7YA 2ZAOA 2FUKA 3GEBA 4ZJPA 3I04M 4PVCA 4V3BA 4J90A 2YZKA 4TV8F 4K9QA 1A8SA 1ZDMA 3KNZA 4C7BA 1CUZA 5KKAA 3H13A 4D4KA 3MB8A 1HSZA 4XJSA 4P4TA 3LC7O 1FSZA 8ADHA 1EIZA 3SF8B 4Z51A 3QHPA 2YWDA 4ZOLA 1YA6A 1RRGA 1E18A 3COPA 3KDPA 4P3PA 1JV2B 4DCCA 5JAUA 4L8FA 4LZPA 2VHEA 3CUVA 3QKRB 4LW8A 4XAQA 5E1BA 4B81A 4JASB 2O3UA 4M99A 4PYMA 2RC5A 3TEMA 4TWIA 1VKZA 2PAAA 3C1OA 4BRZA 3RIHA 3A6HA 4I50A 1HG0A 1U0HC 5PNTA 4L0CA 3O9VA 4OQZA 2FLVA 2LE0A 3ELYA 4IRMA 4D4GA 3CNLA 1YZQA 4PLCA 2WF7A 3T3OA 2PYIA 1XAGA 4A26A 3IAM6 1QMPA 4D6YA 5KYXB 1JHYA 2J0UB 3H84A 3GZ4A 3TPCA 1E1KA 1GQOA 4TVKA 4F06A 1AKNA 5K1ZA 4KLAA 1MO4A 4ML3A 2QN1A 3JTEA 2XD9A 3GNTA 4QHSA 4B4DA 3DT6A 4UU7A 4FE3A 4ZALA 4KQ6A 1N5IA 1GZ4A 2AL7A 2EV9A 3RUFA 4LF5B 4YONB 1ISJA 5HZKA 1E92A 2ZT6A 2W00A 1NXTA 1IZYA 4D5GA 4CCSA 2F7SA 1IEVA 4QU9A 2ZTSA 1JDJA 1DGQA 3THRA 3LHIA 3DDOA 5KNDD 3VPHA 1OWPA 3DAHA 3E5NA 1CUXA 5DP2A 4K9LA 1XHEA 3EDOA 4HAYA 4PZ0A 3V1YA 2PL5A 5IASA 1YS9A 1DP4A 5CU7A 5LNK6 1PUJA 2GWRA 3I6ZA 1CY8A 3CUWA 3TR5A 1ZI8A 3SVZA 1RQXA 3BCHA 4H3VA 1KOGA 2GEBA 4Q4JB 3I72A 4X6LA 2OXEA 3NTOA 1E6EA 4UEWA 1X7WA 1JR2A 1XFAA 1A50B 3JQAD 5M2QA 2XCSB 5DGXA 4HSGA 4YMIA 3UWPA 1UINA 1RI1A 1MPTA 3ZDBA 2I65A 3EZYA 1LFDB 5ALOA 5FWYA 4CBVA 2ZTVA 1JR3D 3RVPA 4E5MA 2GN4A 4KPGA 5AJWA 1XMVA 4MW6A 4XFDA 3CCCA 3HACA 2QTZA 4NG5A 4YPFA 1R0XA 1EVQA 3FDZB 5ELMA 3TBFA 2DGDA 3QU4A 3TGWA 5K20A 3QEAZ 1CDEA 4Q19A 3P4YA 1MCZA 5DYWA 4CIWA 4PHHA 4LMBA 3UXMA 1H2XA 3RYCB 1CVRA 4RPJA 3R09A 4UUQA 2RAVA 3FPCA 3ICVA 4FVTA 4J7CA 4Q1EA 5GGXA 4LFCB 2GAIA 2A5GA 5AW8A 4RIEA 1FU7A 3BB3A 1D1PA 1IBLB 3C43A 2EARA 2P5TB 4G6ZA 3TLKA 2ZIWB 2JFGA 3CWZA 2QSUA 3LUBA 1ZEMA 3NIGB 4V3CA 5E6UA 4ZJZA 3ZVKA 2PA3A 3HH8A 4N5LA 4XGNA 3S81A 2WAYA 1N2CB 5K0NA 3VKFA 4JLDA 3X3HA 3WYFA 4W5RA 5EJGA 5EKTA 3WV5A 3Q7SA 1KAEA 3OZ7A 4NESA 2ZYTX 4DPMA 3ZBPA 2HZBA 3CPHA 3HL0A 3KEMA 3H7IA 2FF7A 4RE5A 1F2DA 3GIDA 4H4CA 1HYQA 2WOJA 4G26A 4DEYA 2HJVA 2A0FA 2YIVX 4QG3A 2GDZA 3TR0A 2MYPA 2RIRA 2A78A 1EINA 3IUMA 3MAAC 2YJ6A 3P0IA 3U13A 3KWMA 4KZKA 2HF2A 3ZV6A 1LQUA 1X70A 1LQ2A 3KB1A 2Y4NA 3WBKA 1P0IA 1RP1A 1B8OA 3JD4A 3QU2A 1OAOA 3CRMA 3KZNA 4DMUB 3BERA 3QFHA 2V59A 4JWTA 4EHLA 4HQLA 4EKGA 2E4ZA 3M6MD 2WHPB 1DAIA 5JR3A 3CLUC 1OV6A 2OGZA 1L5NA 2BC9A 2PSHA 2EX0A 4EEXA 4DJJA 1W0JA 4K0RA 1NJ5A 1JEAA 3CEMA 1PS0A 5JI3E 2PYZA 5AI6A 3AVXA 1PQ4A 2WFLB 2SKEA 4P08A 2IUEA 4PO9A 4JBNA 3QEBZ 3PTLA 2IYWA 4OHRA 4QUIA 2HV9A 3EEBA 3IUSA 3O26A 1OAOC 2R1UA 4Q4CA 4BEVA 4K86A 1DT3A 4NU6A 2NOAA 5K0BA 2ZKIA 2FPLA 2ANCA 3LV8A 1E1CB 2IFTA 3OC0A 2HIHA 3UXYA 1CR1A 3BTVA 2FRDA 3KYJB 1CUWA 3PDIB 4M1YA 1LJUA 1VHLA 1PG2A 3D9QX 4MKIA 1Z4MA 1M7GA 1RI2A 2QRLA 1G4UR 3PWKA 1XR3A 2GD6A 3EZNA 4LYEA 4LTMA 4U9HS 5BR7A 1Q21A 3E9MA 3HB1A 3W06A 1NG9A 1AC5A 3QVXA 4KMMA 3WNDA 1J23A 3UTCA 1MB4A 5JD5A 2NYUA 1U8ZA 4URZR 3SI7A 4UOZA 1VJDA 2F3UA 2RB5A 2SECE 4FWTA 3L0CA 1WMSA 4CL3A 4S1TA 1QLWA 3D6FA 4RJIA 5D01A 3RQIA 5HM8A 2DSNA 2W6CX 4MV9A 2ZQ5A 2BJVA 1O03A 2DH5A 2HNBA 1YBHA 1WL8A 2PX4A 2ZGVA 2Q6TA 4L8YA 3WFZA 4F56A 5LZ9A 3TKAA 3UJ3X 2I2FA 3E35A 3FI9A 4Z4QA 3TCKA 2O8CA 3GLKA 1PDOA 2ZUBA 4EZEA 2QQGA 1SHUX 3U7GA 5JMPA 1KJNA 2F43A 2LZ0A 3A1NA 5IUNC 3R9IA 3EAGA 2DTEA 3INRA 1E69A 2V7EA 3LDAA 3AXSA 2EWVA 2OCLA 1KJZA 1J7KA 5KHAA 2ESRA 2IUSA 3B5EA 5F64A 4AY5A 1PWXA 1KFEB 2G0AA 3PYXA 4RKYA 3W9UA 2XOKD 1K97A 4MKRA 1KY5A 2CN1A 1T8YA 4JA0A 5FL3A 4O2LA 3FPKA 4JUFA 4PC1A 5IKEA 1YB7A 1FYEA 1X77A 3M6LA 2Z5VA 4KR7A 5K7SA 2YOHA 1T3SA 3DOUA 5AW9A 1U9YA 2CXUA 4F9GA 2RGRA 4TL9A 3TZ6A 2OK7A 2R7NA 4B48A 1S2OA 4X8OA 4C7OB 3I9MA 1IDOA 1T3HA 1I2DA 3QJYA 3ND8A 2ODEA 3F7TA 4HLNA 4LZWA 3U9SA 3DAOA 4J16A 5IUKC 4F5WA 5IU6A 5IYZA 4IH1A 4TMVA 1ZL0A 4QJIA 1R4MA 4HKTA 4R9SA 4FJ1A 3P2KA 5HFNA 5IHXA 3BHNA 2QX6A 2P0YA 3FHLA 2Y4OA 3AUAA 2HSGA 5AJVB 4CDGA 4TTPA 1UOOA 2QYTA 3ADPA 4P0QB 3G3EA 4JJFA 5I7AA 2JGFA 1JMYA 4EIWA 2F4NA 4RLFA 3EUEA 1U6IA 3ZZ1A 3LIIA 4AJNA 2VSYA 1AA6A 1YMUA 1SIWA 5AWFC 1X14A 1G0OA 3C16C 5JRDS 4JV5B 2J0EA 2AXEA 3PGVA 3Q7TA 1QIEA 2YQZA 2CK3D 2RHCA 3MC1A 3Q2IA 1NC3A 4KE7A 1N9KA 2ATCA 3Q98A 4UBOA 4BZXA 1JJ7A 3AVOA 1HQKA 1VBFA 1KKUA 2DBYA 1U9IA 1PJ3A 4P4LA 4YMTA 3U4GA 3V2HA 2H08A 2ZUUA 1XA3A 2NACA 3HEBA 3LT1A 4PQFA 1UBOS 3KOUA 2WINI 5DHAA 1DO0A 1VBNA 1TQDA 4KW7A 4LX8A 4ZZ1A 4EHJA 2FX5A 3EVGA 3MS7A 1ODLA 4OI2A 2X13A 4WUTA 5KYWA 5B53A 4E88A 3MHPA 2FUNB 2W8ZA 3EH1A 1OZFA 2QVLA 3D3NA 4ZODA 1L5KA 3QU5A 3QX3A 2IDKA 5ELXA 1L3BA 2UZ3A 3R7WB 1MDFA 5CH8A 4MR7A 4U2KA 4A92A 4AJ9A 3GFBA 2VBFA 5ICSA 1HE1C 1SAYA 5EL0A 2QTRA 3OPYI 1TM4E 1X1SA 2P3QA 4O33A 4W1QA 3V48A 2G7ZA 1NVMB 4QDKA 2H3EA 5BN4B 2HDOA 4J3JA 3TMAA 3SS7X 5BPFA 2C99A 4Q9DA 1ODJA 5KOHB 1W87A 4OQNA 2GCPA 1U94A 4P80A 1EGVB 3LXUX 1EP1B 3O4JA 1RPAA 3JQEA 4X61A 2FPRA 2QTAA 4W7IA 5G1OA 4CKBB 5I01A 5JPCA 1XEFA 4D9BA 3H75A 2XUAA 3FFBA 1OX4B 3QFRA 1KDZA 2WV9A 5BVHA 3QEOA 1F7VA 2CCGA 2OCKA 3AZPA 2WF9A 4IM7A 4EYEA 2A0YA 2Q3BA 4BFYA 1RABA 2OVFA 4GPAA 3AINA 3BFVA 3JQ7B 4Z99A 5IAEA 1RJEA 3PNMA 4K88A 3ZXIA 4B3XA 4J0FA 5JFTA 4KZPA 3AVWA 3QX8A 2DUJA 1U2RA 2MSEB 1L4YA 1FDTA 4XX1A 3ZC3A 5CDSA 5BSTA 4ETNA 1N6IA 3C5WP 1BE1A 2I7TA 3ETJA 4UU1A 3LLSA 2DLNA 2QAGB 3GGPA 2FMUA 4MUXA 1QAMA 2WUWE 3HA5A 2LV8A 1NVXQ 2GAJA 4G9BA 1O54A 3FVRA 4GP9A 4LSGA 1ISGA 1PT8A 1TT7A 2X1VA 1QFSA 1BAPA 2RH5A 4KFSA 4X44A 4EVIA 4U8HA 3S2SA 3F9IA 1RJ9A 3OBIA 3P9CA 2D5IA 1HDYA 1C3XA 1WTCA 3DXYA 1ZUWA 4HEQA 4DUGA 5ERGB 1V96A 4CIXA 3GUZA 5BOSA 1E0AA 1GPKA 1BQ3A 3AETB 4JX9A 3EXHC 2H85A 3H1PA 4RA6B 5LUBA 3VR4D 2H8GA 2IQIA 1A4XA 4WZAB 4F5ZA 1U2ZA 3PQ2A 3VKGA 3G85A 4QOSA 4KYVA 3K72B 1L6IA 16PKA 1WZ2A 4RXMA 1NM5C 1LBTA 1S3GA 1TRHA 3PE6A 3VR5H 3AEXA 1NYTA 3V2UA 4ENUA 2VJQA 3QRWA 2TECE 2QTCA 2CNWA 2WTNA 4BNWA 2Q45A 2Z2ZA 3ZLJA 5TT0A 3GCZA 1FXUA 4U6QA 3LP5A 4H7KA 4KCGA 3GLRA 3NR2A 2GHQA 4BE4A 3V80A 4DE5A 2PD3A 2Q8NA 3EBLA 4RORA 1PJSA 1K1EA 4XGQA 1LF0A 2AN3A 2B8NA 3ZCXA 1BJTA 3WBBA 4YV2A 5A4FS 3ZDEA 5BP7A 2DJ5A 4IXTA 3A4TA 4XWKA 1ENYA 2IHBA 3HE3A 4BVBA 2L42A 4OB6A 2Q3HA 1Q2UA 3CRQA 3WZ2A 4HFMA 1QIHA 4NK4A 5BW5A 2B1QA 3RJZA 1ZYUA 1JQ3A 1AY0A 1LSUA 2GA9A 3SE7A 1R4NB 2ZEJA 2XR1A 4UZSA 5IAJA 3RBVA 4OY3A 2BCGY 2CYAA 4ED9A 2YV4A 1U1CA 1F48A 1GNPA 1GPDG 1V5FA 2BSAA 2V7GA 3BK1A 4QNNA 4FN5A 1UT8A 4IJQA 2HU8A 3L7DA 1H8HA 3ZPXA 5AW2A 2AN4A 4B3CA 5IMSA 1JG6A 1EH5A 2YRWA 3BA1A 2V7UA 1MH9A 2HCRA 3L7KA 5B3KA 4IFIA 2CXRA 2QRVB 4HSEA 4ZA2A 2PH5A 5F5LA 4DG8A 3BKWA 4EFDA 1QB8A 1ZNQO 3M6VA 2QOEA 4TMWA 3R6LA 3BZUA 1YK1A 1GT6A 2G9UA 2VBIA 3E9RA 4YJHA 5KO2A 3QEKA 3L7CA 2GBLC 4MQ5A 1OKKA 3K8ZA 3CQ9A 1RRCA 1ZNXA 4I4CA 1A9YA 3E9YA 3LOQA 1MRZA 2HJ9A 1K0UA 3VZSA 5AVTA 4BAZA 3ZK8A 1GPH1 5FORA 1TRKA 3V7NA 1N78A 3GFQA 4LGMA 4YJGB 2G9RA 4RJKA 4HYEA 5GMOA 1KQ3A 1RWOA 4A2PA 4E5KA 1SZDA 2GBGA 3FCEA 1LPAB 3DMDA 4M98A 4RM3A 5L7WA 4L5YA 4YJ3F 3IPRA 3HG7A 3IP5A 2H2DA 3P2MA 3G9QA 4YP9A 1GLGA 1UZNA 3X43A 4H0CA 1YCGA 3VPBA 1OXVA 1KYIA 4DV4B 3M1IA 3F2IA 3IRVA 1KIMA 4AYWA 3EA4A 3JARB 2B7CA 3MCVA 2JIQA 3SZOA 3G2MA 3HJFA 3D8UA 2EKBA 3DDNA 2QJOA 2JANA 3O4IA 4BO3A 5HK9A 4PHCA 1RE1A 2BBSA 1HFEL 3KKMA 3SP1A 4ISCA 4DY4A 2BH2A 4Z9BA 1Z82A 1HK7A 2XZPA 4AZ0B 3HN6A 3A9VA 3ZCPA 2MYTA 4IFEA 4Z7JA 1KPHA 2IH2A 3JASB 5BWBA 2C8VA 2VAMA 4KO3S 5LDDC 1EJBA 3RSOA 4DJAA 1GCGA 2XYQA 3ITDA 3F47A 3EISA 1I5RA 1PNQA 3ZHVA 4OQQA 4C0QC 4WBXC 1RU3A 3ABRB 3ABQB 4WKBA 4V1CA 2YQ5A 4GMGA 5C7OO 2VJNA 3FH0A 3ZVNA 1Z6GA 1ZRHA 2X5NA 4ZQBA 5DM0A 3PNBA 1W5BA 4QELA 1ZD8A 4R1NA 3KPWA 4PRKA 1AKTA 1KDRA 5DFAA 5C1DA 2JIOA 1R0KA 1RRMA 1QOPB 2BDEA 2X2EA 3VC3A 3L0DA 4BCBA 1YZVA 1NF8A 3T52A 4DQUA 4DBZA 3JS5A 4NR0A 5I7WA 1TMGE 4E1AA 4E4RA 2XAUA 1PJAA 1PV4A 3PZBA 4Y2RA 2PNJA 3IHWA 2CMFA 2IEDA 3LOUA 4P98A 1RAGA 3SJCA 2VP9A 4E31A 3IOEA 4YJ2F 3M5WA 1XYGA 5J9FA 2QX9A 1GSIA 1ADYA 1QFJA 2Y77A 5GJWC 1TGVA 3SEAA 2QJFA 1VE6A 3EQZA 1PQWA 1VZ2A 4F72A 3O4VA 2SHKA 2VIIA 3TW8A 3KYDB 4YRRA 4Y6QA 5KVQA 1P0MA 4JLBA 2PWZA 4UQLA 1Q1AA 1ODCA 2CJYA 2X9NA 3C6ZA 2JGRA 3RTGA 3O4FA 4LZJA 1K5HA 4R2MA 3H2SA 5ALYA 1X7HA 3DEFA 3R8XA 2VHZA 4KQEA 4XR9A 3SDBA 3IOCA 1F5SA 2NN3C 4I1YA 1H2BA 4MWBA 4PZPA 4NDAA 3RSQA 3ZHRA 2AEMA 3UG7A 1JFTA 3HBJA 3BMQA 3DZIA 3MT9A 4LISA 1NI5A 1Y7TA 2ZUWA 1O6BA 1AQNA 4MV0A 4PX5A 4LK3A 3SDZA 2W11A 4A03A 4KRGA 4DV0B 1DMRA 4IMJB 4JJ7A 2HFJA 1C8KA 1XYVA 1L5VA 1ZK3A 3WGMA 5AD1A 2FEWB 3G0OA 5FFMA 1DCTA 4TMFA 4F4HA 1VCOA 2ZSHA 1I7SB 4URYR 1D4AA 2O06A 1GFZA 2C5AA 1W2WB 3AHGA 1CUFA 2BF4A 2R7MA 2VHWA 3QMWA 3GQVA 3PWZA 1AKWA 1GZ3A 3N8DA 4LZNA 5LP6F 4WDQA 2AQ8A 3ZXUB 4R1MA 3LGXA 3FNHA 1UKCA 1P2DA 1KI3A 4PCUA 5K4HA 2VTBB 1IIRA 2MDTA 1M7BA 1L7AA 4ETIA 1YAHA 4X45A 1GR0A 1QCZA 3QI7A 4UBLA 3C3JA 5ESWA 5AKIA 2IV2X 5JYBA 1YB4A 3PLNA 4OYRA 4DN6A 1C0IA 3HXPA 1EVEA 3G7NA 2Z6QA 4Q48A 3FZYA 1TZMA 1VL1A 1BW9A 2AFIB 5F1OA 5GONA 4LRQA 4EGCB 1FVFA 4MIYA 1G6KA 4Q4JA 3FMIA 4X84A 4LHEA 4URFA 2HAEA 1JQDA 5ALMA 2XYGA 1B0UA 4BV8A 1MU0A 4ZU6X 1T35A 1AX9A 2HBRA 3ITEA 3LF1A 2J0VA 3Q9UA 4E1BA 3A9CA 3O1HB 4YUZA 1BWSA 2D2IA 3ZE6A 3ZQKA 3ZWVA 1XRJA 1FNMA 3EZ9A 2ZI9A 1GTSA 1R66A 1OTXA 3PE3A 3AHHA 3EVAA 2MCFA 1USWA 2ETVA 1P75A 2YNMD 4M36A 1R3UA 1IAQA 2H65A 4B9AA 4EL5A 3VR6A 2VK1A 3GEDA 5IKXA 2I91A 1P0PA 3T95A 3WDSA 2W9XA 2NO5A 1FSSA 1NBAA 3HM9A 1K7FB 4WT7A 1GAXA 1NBMA 1A9TA 5F21A 5DM1A 1KIAA 4N6NA 2R8XA 2X6QA 2VYVA 4EWLA 2X5KO 2Z3WA 1C9MA 1DQPA 4YRTA 3DTVA 2AOUA 2QXUA 1NMYA 1SEPA 2C2OA 2VRBA 4E4YA 2Z4TA 4JHXA 3CMCO 4UDNA 3V6MA 3EIEA 4YXFA 2YUIA 2BUCA 4FFOA 3DKIA 3N5CA 2FR0A 3KZCA 5MF6A 4JDUA 2D5BA 4JKIA 1P31A 5FULA 3DHNA 2FU5C 4ZO7A 3TF5A 3PQEA 1USKA 4AUEA 1UDRA 4AW9A 4FQ7A 2VPWA 2FJUA 1JKMA 2O2DA 3KBOA 4ZYXA 3L8CA 4WBNF 3EZ7A 2MTBA 3NTLA 1WSBA 1VRVA 2E5WA 3FPEA 1OWNA 1B43A 2BAGA 4IHJB 2FEOA 3OJLA 2IDJA 4YV7A 2OBNA 1K92A 3ISVA 1A0OA 4IOKA 4OMDA 4POAA 4RELA 5BWLA 2GERA 2ZR9A 3QEMA 1V45E 1M7HA 1O58A 3TXYA 3SC4A 2DZDA 1HLDA 1NN3A 2POQX 3UJ6A 4BO8A 1FP2A 4AWBA 1C7RA 4B44A 1PSDA 3OPMA 1E98A 3HUEA 4V2UA 1ZOLA 2PPVA 1Z29A 3G2NA 4GP7A 4D26A 1DJMA 2FFQA 4S05A 3H17A 4PYIA 1YJCA 2WFLA 4PAWA 1PR4A 3NV9A 4PPFA 4U0KA 4AICA 1H5NA 2WAMA 5LQCA 1SA0A 1ZN9A 3LBHA 4FX2A 4MVWA 4N0PA 5MN5A 4H4DA 3R5XA 5BSWA 4ND1A 1VJRA 2NVWA 1PVVA 2M9MA 3DV9A 5DTRA 3OWXA 1D4FA 1LRJA 3L49A 1Q3TA 1VYUA 3LP6A 2P2YA 3MF4A 4XUEA 4LBWA 4Y1FA 1LW7A 1DKMA 5LD2C 3S2GA 2Q6KA 3NYWA 2REBA 3JXEA 2P9JA 4OK5A 4W1PA 3V8QA 2VJDA 1OLSA 2R44A 3TJRA 4ESHA 3ZDCA 3JU3A 5AK0A 3CPEA 4RV5A 4WNAA 4PG8A 5AVUA 3QXXA 5IYZF 1GQRA 1DTEA 3CLHA 4Z0TA 3UXHA 4IGEA 3GP5A 1FP7A 1AQ6A 4B8YA 3ZJYA 4C0AC 5G2OA 4P3KA 1DXHA 2G28A 4H7FA 4BBAA 4IOMA 3TSZA 4BV9A 1SO8A 1EWKA 4MQ4A 5HZHA 2AXNA 2VF5X 4TKMA 3T9CA 2EFHB 1USVA 3GLIB 4P8RA 1SCUB 4KLRA 1EQ2A 1QFYA 1DEHA 1QJCA 2P2SA 2WSBA 3QQ5A 4R8RA 1X1TA 3I6MA 3LQRA 4HGYA 1E0KA 3WJ7A 1VE7A 5AKXA 5CEEA 4WBSA 5AOVA 3AWDA 3C6KA 4EDHA 3NTVA 3CX3A 4DR2B 1ZMOA 2P7HA 4FQ5A 5AW4A 3G23A 4FGJA 1H1LB 3J81k 1T36B 1WOYA 4K9KA 5AOBA 4RXTA 2WI8A 3T4PA 3CRRA 1IOLA 2O6HA 3ZU3A 4N8DA 2XTNA 1FW6A 4JD5A 3S99A 4RAOA 2HRCA 4PAQA 1DL5A 2DPXA 2HQBA 3JYHA 5CCBA 3KZMA 4HQ6A 5KC9A 3VSCA 1GPWB 1FXWA 2WVAA 1PZEA 3ESYA 3H7AA 3KP1A 4OXIA 3TRIA 1M74A 3UMGA 2P7IA 3NB0A 3UT5B 1K3FA 2EJVA 3LBNA 3OFVA 4OREX 2FSHA 5DB4A 5AW6A 1OU0A 1JTEA 2ATEA 4NPCA 4KOEC 3C3DA 4MVJE 2QD3A 3ZH9B 1PZXA 1CUDA 3BXFA 4KQFA 3H1EA 4K87A 4W9RA 1Q11A 1SPBS 1AB6A 1NQAO 5CB4F 4RMNA 4UCQA 1GSAA 2PIAA 3NHBA 3UJNA 2X7XA 5CG1A 3IKTA 1F38A 4FEYA 4EG5A 3OFKA 5DWDA 3AG6A 2WJAA 4IJ6A 2BMEA 3HM2A 3PIRA 4HTFB 4RK7A 4XM1A 1CQZA 1M2EA 4DV5B 1U2EA 3MTAA 3S44A 3DBLA 5JV5A 4XM0A 1T8SA 2EFYA 3G5UA 1Y81A 4ZEVA 5JASA 2YBDA 1PT9A 5IEBA 3FVWA 1JR3E 3WK6A 5ABPA 3Q8MA 1V8DA 4EKDA 2EZUA 3KV3O 2Q5HA 5GWXA 4PSUA 3KSRA 1KRHA 1SFRA 2Z2XA 1CSEE 1BW9B 2AFIA 3BRWD 3DR3A 3G02A 4HGNA 2HXYA 1LFAA 3M5CA 3QVJA 1JS1X 4AUNA 1C1YA 1W4BA 3KJNA 4JOBA 4TLBA 5KKNB 1L4UA 4EL0A 3V4VB 1JEJA 2ZSJA 4HXYA 1NAIA 2KPOA 3F5FA 2DT8A 3V8BA 3QX9A 1P8JA 5IXSA 3WYGA 2QP9X 4TKLA 4RPCA 1OFUA 2H17A 3HBLA 1OGJA 3T7CA 3U80A 4PZZA 5EE1A 1H2AS 2ZIAA 2ZR7A 2B30A 3SBXA 5B6JA 2C98A 4LWZA 5DGTA 3S27A 1A4IA 3AKYA 1FFDA 1XB2A 1X7GA 2FZ4A 3F2VA 3NBFA 3I6BA 5JPDA 3EG9B 2NV6A 1OD6A 4BWFB 2QPTA 2VDKB 5M34A 1Z2DA 4MV3A 1PL0A 2IY7A 1CNEA 2I4IA 2JA2A 2O1SA 4TQGA 5JI2E 1G17A 1W85A 4DNQA 1RBZA 1WKCA 2H16A 1XU9A 2BCJQ 3RH0A 1E9EA 1LDEA 3LDHA 4TUYB 2CHVA 4IZHA 1E9RA 1X15A 4X6UA 1CY0A 3DTVB 2CJPA 1EM6A 5A2GA 1OGIA 2WG0A 4PS1A 5L40A 1O9GA 3IIEA 1NKSA 4F6LA 1PBNA 3RF7A 2AC7A 1UJ5A 2PUGA 1SK9A 3LU1A 2FPXA 4R8MA 5JJIA 2BMDA 1PK7A 5KVVA 3LHSA 2ZS8A 1CUHA 4M0LA 5B1YA 4LOKA 4EW3A 1DDIA 3B1YA 1S7CA 1IEQA 2R25B 3B7WA 4Y30A 2JIBA 1BWRA 1Q19A 2ZRGA 3GO4A 2GVDC 4KQWA 1A7UA 3M7IA 1MVLA 3B3JA 1T3GA 2F3SA 2HA2A 1YV9A 1G5QA 3C85A 1BGWA 4HPJB 5LP6C 4IV8A 5DKFA 2ID7A 1K8ZB 3C45A 4MI6A 4EPWA 3AHDA 1WPXA 3M6XA 4POOA 3F3KA 1YS2X 3K16A 2MIIA 2JH9A 4ZRDA 3RT1A 3G2JA 4EATA 2D0OB 3WQQA 3CF4G 4ENTA 1I2CA 4NJMA 4AUKA 4JB0A 1THGA 1VMIA 4HAIA 3TMKA 1S1MA 3EY9A 1PYGA 2FW9A 2AC2A 1OFTA 5KHOC 1QGAA 1VLLA 5LZ4A 4D92A 4X7MA 4A0GA 1NVGA 2QRHA 1E7WA 1H4VB 4HPWA 1C3LA 4DCSA 1YONA 5K4AA 2C57A 3UV3A 3RYIB 4NCIA 5G1NA 1QVRA 4C08A 4F2WA 1OILA 2OP0A 2QD5A 3R75A 2QV0A 4LG1A 1X80A 1RIIA 4RS4A 4Q21A 4UUPA 1Z2CA 1LA2A 3HCDA 3CN7A 4NATA 4XGRA 2DWPA 1RPNA 3WAGA 1O96B 4P3NA 4ARBA 3Q6IA 1R5BA 3R9KA 1F51E 3WZLA 1U6JA 4ZQIA 1NYLA 2WIJA 3TDMA 4BU1A 4G0YA 2PUTA 3SEFA 2JFVA 2ODNA 2WF5A 1RLMA 4QHYA 4LWOA 2BVNA 2PLWA 4H1HA 1MDBA 4OKNA 3FTCA 4TT3A 3T5CA 2PCLA 3A3YA 4QYWA 4K46A 4KKVA 4W9NA 1YDGA 1CUIA 3A27A 5DNEA 4BYGA 3PXCX 1UC9A 2FG7C 5FWXA 3PRKE 5FUXA 1U5BA 3JQ8A 4K3UA 4AN0A 3NFRA 4MGKR 2ALJA 4AF6A 1IMOA 1XVIA 4XKJA 2ZTHA 4HUTA 4RMHA 4LY6A 4ARZA 2VP6A 2PCJA 3MILA 4I6GA 2C77A 2OXIA 3TSAA 3R9XB 1XVAA 4R1QA 4O8ZA 3NHJA 3O9ZA 4D99A 4TN5A 2IUUA 2EJCA 4EAQA 3DBVO 4GVPA 1YBMA 5FWYB 5AM2A 1PHPA 3D6TB 3G8BA 2W22A 4ZVOA 4CM4A 4KGDA 5HQJA 4BNZA 5DGIA 3ROKA 2CW5A 2HT1A 1RZ3A 5EMHA 3UJ7A 1JVSA 1QG4A 2OHHA 2A4KA 4G0QA 1QR2A 1YVRA 1FFWA 3QKIA 5B37A 3RBXA 4TGLA 1XDZA 3U44A 5BPHA 1F8FA 3FUXA 4WA8A 3T7EA 1L7MA 3VR0A 1GKKA 3PEEA 4JI7B 2GEKA 4BX2A 2FH5B 1T2EA 4ER5A 4B3FX 3DNPA 4M9CA 1GL7A 2VJBA 2H0RA 1ZCAA 3U9TA 3RSZA 2OOSA 1YQWA 2RHMA 3PRHA 2OGSA 3O90A 4XYMA 1OIXA 2F48A 1C4XA 5JNLA 2ET6A 3VYVA 4A6EA 3DO6A 1WCXA 4X65B 3NALA 3SC3A 4YJ2A 1I4TD 2GN0A 1NIPA 1BS2A 3DA8A 1JU9A 3H4VA 5DVZA 4RESA 3K1ZA 3TN7A 5FO1A 3LGSA 3E05A 1R0ZA 1J99A 4TYPA 1CYEA 5A7HA 2CDAA 4MTCA 2OY0A 1TO6A 4GYYA 3LD9A 2QUZA 3NONA 4QXOA 3KSBC 4Q82A 2B2NA 3QBTA 4IOLA 2WSIA 3V8NA 2BJWA 1L3IA 1GD1O 2I5PO 3KALA 2QM0A 3OY7A 4RSMA 5JPIA 4A10A 4CNQA 4ENVA 4IGIA 1J70A 1KPGA 1YR2A 2XRYA 5CPBA 4ZANA 3UOWA 3ZWWA 3UMFA 3GLFB 3U7JA 4MW4A 4V24A 3Q0TA 3PUHA 1IM2A 2FGKA 2G72A 4KGVA 3AFOA 1P3DA 1JXQA 3OE1A 4G5GA 4MVJM 1MO6A 3STVA 1JG4A 1KH3A 2Z08A 5TGTA 1X7ZB 3K05A 3HEMA 2O5CA 4JXXA 4MI3A 3PA8A 2G5TA 1A9ZA 1PUIA 1OTYA 3MZ0A 3OLXA 3RVKA 5FA8A 3WLFA 2P69A 4UTXA 3UAXA 1GA6A 2P4EA 4O4JF 1RCTE 1MIOB 1RCUA 4DIEA 1XALA 3KOZA 1TT5A 5CTJA 5EJ4A 2G4VA 2GH1A 5JSQA 1V6AA 1VSUA 5IJXA 1VSQA 1ZOOA 1OLXB 4RZQA 4GF5A 2LIVA 3AEZA 4W99A 4DSNA 4YRIA 4BXOB 1A96A 3FFAA 3RHSA 1T91A 5ULLA 2OBLA 4OHUA 1XFDA 3IBYA 4DC1A 1JFVA 4C04A 2JS7A 4NS1A 1AS0A 4YAEA 1ID8A 3HB9A 5ICFA 1W5AA 2H4WA 2YV5A 4I4LA 1KSFX 3ETNA 1SVKA 5ALIA 4ALNA 1BA2A 1UMDB 3NX4A 3T61A 5LUAA 4OEHA 1E0SA 1PJTA 3OZEA 2PXHA 1R18A 2QRGA 2B0CA 3O7WA 4PLHA 1Q0QA 1UZUA 2YN4A 2ZRJA 2EF1A 3FSJX 3L0IB 2VNSA 2B20A 2PL3A 1T24A 4P4SB 1TQ4A 4JFRA 3ZLUA 2O59A 4AKHA 2Q0XA 1TMKA 4E22A 1Z6AA 4XWOA 1WUJS 2YXDA 5DM2A 4WL0A 2FZEA 4PYKA 4KR3A 1O87A 1LK0A 4PY2A 3FCUB 2FN8A 3IAFA 3JQBC 1T6ZA 2OSVA 3C6BA 3FZNA 5JAOA 4J3FA 1ORTA 2PKWA 4N9QA 3G0IA 2QUAA 1DINA 4AKTA 4NBUA 3MCZA 1PJZA 3B82A 4MA4A 3OEHD 1ZIDA 2WPDA 5BOSB 1O95C 1BH6A 2PN1A 1LTHR 3CB4A 4B32A 3CS3A 5JCZA 1EFVB 4LHZA 1WCYA 5K0JA 1SA0B 4W8HA 2Q9AA 3HL4A 1YNSA 1Z7BA 3JVVA 1PGOA 1XHFA 1AUQA 2PH1A 1NYQA 2YH2A 4YQYA 5ALZA 4DYDA 1OZAA 4JDPA 4DXDA 1D09A 3RJ5A 4MB0A 1N8NA 4R51A 3VR2A 4GOKA 1R0RE 1C9DB 1VPVA 4W9NC 2ZJ3A 1T6XA 4YIHA 3LBIA 4C0KA 4I1SA 2GD0A 3GFTA 3PX3A 2BEWA 5TC4A 5FEMA 4Y8VA 2CSXA 1N6RA 1WHSA 2XYRA 1GYQA 3RE1A 3VPFA 1A8HA 5FYDA 4PNPA 2ZULA 2BYTA 3EFOA 1H1TA 3PR1A 2PXAA 2BKUA 3KLMX 3I3OA 3KHKA 3G8CA 2HT6A 2ILTA 2F90A 2WWFA 4LTDA 4ZV7A 4YREA 3LKZA 4BQEA 4XGIA 1XE3A 3BXXA 4K6HA 1IDN1 5CA1B 3JZFA 4M0EA 3A6FA 4U6NA 2ZLBA 4UXIA 3FOZA 3BAFA 2VSOA 2CGEA 1X92A 3ZD7A 5DISB 1X1DA 1ZKDA 3JWPA 3I2GA 3AERB 3RRMA 4CODB 5SYMA 1ZMTA 2ZYGA 3GVCA 4DDWA 5KTMA 3K9NA 4J94A 1W96A 3HB7A 1UBFA 2YR0A 4ZPXA 4YI3A 3K96A 4YV1A 1SR8A 1ZCJA 5FF9A 3FDXA 2O6LA 3U4HA 3ZGZA 2N9UA 5BQ5A 2XCUA 4MP6A 5F76A 4DABA 1K8YB 1X6VA 1CC1S 4DBVO 4B85A 1II8A 2C29D 3DZBA 2WVJA 3C3MA 2H1HA 4XSHA 1N6HA 1UBKS 1W47A 4IGAA 4Q1AA 4K6OA 4Q7KA 2IH5A 4RQUA 4Q9HA 3WL3A 1QUFA 1L4FA 1N1DA 5IJAA 1ZSYA 2WTAA 1U1EA 1RXYA 4YJGA 4R1LA 4DSAA 4EKYA 4ZGBA 5EHIA 3STTA 2CBXA 1M73E 2JB9A 1V1RA 3ZY4A 4AURA 1WEHA 4RWEA 1DWQA 1PEDA 3MWDA 2N1BA 3ZIAD 2ZTMA 2XXBA 3EEIA 3WLPA 4RTMA 1NRWA 1NI4A 4F04A 4EBFA 1SUBA 2Q2NA 4C06A 1N5KA 3T1TA 1W5EA 2G9VA 3RS8A 5ALPA 2JKVA 4LVNA 3LRXA 1K4MA 4BUZA 2Q2WA 3ESBA 4JHLA 1IE3A 3IFSA 4FYWA 4UD2A 1AKRA 3UBMA 2B94A 5B1EA 5BQOA 1IU9A 3L7BA 2C54A 1TCBA 3V1TC 3FE2A 5JS8A 1SBYA 3ORHA 2FPMA 3EEYA 1HQDA 3CCBA 4G56A 4M60A 4BQOA 3FNBA 2WIDA 3OMXA 1VLQA 1ZMBA 4LJRA 3NTXA 1G8PA 1WVMA 1TUGA 3HZOA 5AHOA 5AKHA 1S8FA 5BSFA 2QRUA