1TCUA

Crystal structure of the purine nucleoside phosphorylase from schistosoma mansoni in complex with phosphate and acetate
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
285
structure length
282
Chain Sequence
b'ESVTANIENVKKVAHHIQKLTSIVPEIGIICGSGLGKLADGVKDKITIPYTKIPNFPQTSHSGNLIFGTLSGRKVVVMQGRFHMYEGYSNDTVALPIRVMKLLGVKILMVSNAAGGLNRSLKLGDFVILKDHIYLPGLGLNNILVGPNQEAFGTRFPALSNAYDRDLRKLAVQVAEENGFGNLVHQGVYVMNGGPCYETPAECTMLLNMGCDVVGMSTIPEVVIARHCGIQVFAVSLVTNISVLDVESDLKPNHEEVLATGAQRAELMQSWFEKIIEKLPKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords purine-nucleoside phosphorylase
molecule tags Transferase
source organism Schistosoma mansoni
publication title Structures for the Potential Drug Target Purine Nucleoside Phosphorylase from Schistosoma mansoni Causal Agent of Schistosomiasis.
pubmed doi rcsb
total genus 90
structure length 282
sequence length 285
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2004-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1tcuA00
3UAYA 4R2XA 2OXFA 1K27A 1TCUA 2A0WA 5IFKA 1JDZA 1U1CA 4LNHA 3UT6A 1SD1A 3DF9A 4I2VA 4LNAA 3PNSA 3U40A 5IU6A 1Z34A 2Q7OE 4KN5A 3O4VA 1TGYA 3E9ZA 4L0MA 1JE1A 4G8JA 5DK6A 3FNQA 4DAEA 3FOWA 2QPLA 1PWYE 1OV6A 4F3KA 4TTAA 3UAWA 3LGSA 5F73A 1JP7A 2HWUA 4LDNA 3KHSA 1VHJA 5I3CA 1RXUA 3NM6B 1RFGE 1RCTE 3OCCA 4DA6A 3FUCA 4TYMA 4D9HA 4L5CA 3OPVA 3SCZA 4DA0A 1RXCA 4WKOA 1PR6A 4DANA 1K9SA 5F7XA 1SJ9A 4D8XA 1A9OA 4WKNA 5F76A 5CCEA 1RYZA 1OTXA 5KB3A 1CG6A 4JOSA 3OZCA 1Z37A 3DP9A 5F77A 4BN0A 3MB8A 1YRYE 2IQ5A 5CXQA 2OC4A 3E0QA 2ISCA 4DAOA 1C3XA 2HN9A 4TXJA 4YO8A 4H1TA 4OJTA 4PR3A 1RR6A 2A0XA 1ODIA 3BGSA 4MCIA 1NC1A 3IOMA 1PR0A 3DPSA 1YBFA 1NW4A 4DARA 4R2WA 1I80A 1Z38A 4DA7A 4M1EA 5F7OA 2QTTA 5CYGA 1K3FA 5CYFA 4GLFA 3E9RA 5EFOA 1SD2A 4TXMA 1B8OA 4OGKA 4D8YA 2AI2A 1PR5A 1V48A 1Y1TA 3BL6A 5FAKA 3OOHA 1ODLA 3NM5A 5JPCA 3ONVA 4LKRA 1Y1SA 1PR4A 4QFBA 1V41E 1PBNA 1T0UA 2QDKA 4BMZA 3KUKA 3T94A 2BSXA 4OGLA 1LV8A 3K8QA 5C80A 5K1ZA 4F1WA 1Q1GA 3PNPA 3QPBA 4GLJA 3PHCA 3NM4A 4TTIA 3GB9A 4F2PA 1RSZA 4YNBA 2QTGA 1XE3A 1ZL2A 1Z5NA 1T8YA 3EMVA 1ULBA 1T8WA 3KU4A 4TXLA 3MMSA 4M3NA 4D98A 1VHWA 4EB8A 3KVVA 4EARA 1RXYA 3ENZA 1U1EA 4TS9A 1V3QE 1M73E 3FWPA 3LBAA 1Z5PA 2AI3A 4M7WA 4NS1A 4L5YA 2P4SA 4U2KA 3OOEA 1PR2A 4UC0A 3UAVA 1TD1A 2HSWA 1TGVA 2QSUA 1A9RA 1OVGA 1YQUA 1SQ6A 4WKPA 5F7JA 1PKEA 5EPUA 1Y1QA 1JDTA 1OU4A 2PGAA 4JWTA 4E1VA 3LA8A 5B7NA 4QEZA 2I4TA 4YJKA 5EUBA 2H8GA 1Z5OA 2OECA 1YR3A 3P0EA 4K6OA 1U1GA 1U1DA 3KVRA 3KVYA 1ODJA 5B7QA 3O6VA 4DA8A 4YMLA 3ODGA 4OEHA 3BJEA 4RJ2A 4MARA 2B94A 1JYSA 1PR1A 1A9QA 1V2HE 4G89A 4BMXA 4QATA 4IP0A 2A0YA 2RJ3A 4QARA 5CXSA 1FXUA 4NSNA 3UAZA 1OTYA 1V45E 4L5AA 1Y6QA 3D1VA 1JDSA 3TL6A 1B8NA 4LZWA 5F7ZA 1Y6RA 3K8OE 4BMYA 3DDOA 1VFNA 1WTAA 1ULAA 3DJFA 1NC3A 4JP5A 4TXNA 1A9TA 4TTJA 5B7PA 3PHBE 1U1FA 1Z35A 2GUWA 3UAXA 1V4NA 4TS3A 3OZDA 1QE5A 1ODKA 4WKBA 3IEXA 1OUMA 2HRDA 3EEIA 1RXSA 1PK7A 4OF4A 4QAQA 1ZOSA 1JPVA 5B7GA 1JE0A 1A69A 2I8AA 3EUFA 1JDUA 4R31A 2ON6A 1VMKA 3C74A 4QASA 1PF7E 3INYA 1A9PA 4G41A 4OY3A 1YQQA 3FB1A 1PW7A 1LX7A 1Z39A 1N3IA 4GKAA 4MCHA 4X24A 1CB0A 2AC7A 1Z36A 4PNPA 3F8WA 1Y1RA 1G2OA 3OZEA 1RT9A 1PK9A 4P54A 4F3CA 5ETJA 1T8RA 3OF3A 5F78A 1JDVA 4GMHA 1Z33A 2A8YA 3BSFA 3GGSA 4D8VA 4WKCA 1T8SA 1ECPA 3EUEA 4DABA 4FFSA 1TCVA 2XRFA 3NBQA 4NY1A 4F2WA 4TXHA 3OZBA 2AI1A 3FAZA 4L6IA 1LVUA 4ECEA 5CCDA 3P0FA 1A9SA 2OC9A
chains in the Genus database with same CATH superfamily
3FCCA 4DSZA 2X7HA 3VJMA 3L8GA 4Y1FA 3B82A 5GY7A 1E64A 2OP0A 4PLGA 4G1FA 5J2UB 1WS6A 1JFLA 2JLYA 1RVDA 4WA7A 1IU9A 1JILA 2YJ4A 3E4CA 1MX1A 4G09A 3RJTA 4OQEA 1N1GA 1GA6A 5ANRB 5IKOA 1VRCA 2EDCA 2R4TA 3VPAA 4L78A 4IIJA 3PS9A 3O4IA 3R3HA 2BJWA 4DEXA 4E13A 4J3NA 4M7OA 1I1OA 3RVLA 2CXNA 3RF6A 5A9SB 3T3NA 3LY9A 4OQXA 1MP0A 2E48A 1NN0A 4ZGBA 1FNDA 4N47A 4QUKA 1M6HA 4L9WA 3O4GA 4BNMA 5K09A 2ZIEA 1GP2A 3F6EX 4IXDA 4YRIA 3AKCA 4Y1EA 1L7MA 3UBTA 3BH0A 3VSEA 1AKWA 2CYAA 3ND8A 3KU1A 3UB4A 5DNAA 3RPEA 4DAEA 3P9SA 3WDSA 4DA9A 2C4TA 2A14A 4NYJQ 1K7YA 2G5CA 2Q5LA 1N5DA 5JVDA 2WT4A 3SJ7A 2AJTA 3JTMA 2PH1A 3C8UA 3ESAA 4C6RA 3BD7A 1LXCA 2BMDA 5EKSA 5B4TA 4A03A 3R7FA 3MELA 4D0SA 2D62A 2WJVA 1TAHA 4ZDWA 4AZ0B 4EA7A 1SZPA 2FSHA 3WK4A 4ZK2A 2FTKE 2HEGA 4NTZA 1L5KA 3GVXA 3KQWA 1IQ0A 3I0ZA 3MWDA 3OA2A 4AUKA 4RYDA 1EH5A 2EZTA 3E18A 2UYHA 3HB4X 1US8B 3A6KA 1Q3KA 2J45A 4NXMB 2WK1A 3OVMA 4HNRA 3LGXA 5DNVA 5H02A 2X4DA 4L5CA 4Y2YA 1M2VA 3RDPA 1DKQA 2F43A 2GR9A 1U5CA 1RPTA 3EVTA 5LLSA 3ZH9B 2Y6UA 1JU4A 4EZIA 1FLAA 2I7VA 4TRMA 4ZCLA 3H2ZA 3LNTA 4NVRA 3DNFA 1KMNA 1EFDN 1O5OA 3G9UA 3JVIA 4WKNA 4MSUA 3THYA 1TIKA 3U48A 4PC2A 4MZDA 4ZJYA 3DP7A 4D4GA 3DSRA 3SZRA 2RK3A 3A4NA 1DJOA 3SLGA 3HBJA 4CL0A 3QX7A 1P4JA 1ILEA 1P6UA 3U1TA 1KPIA 2FEXA 5I7OA 2ATCA 3M8KA 3QLUA 4ARIA 4IJQA 4KQEA 1KEKA 2CZQA 3H6GA 4EYOA 1GA1A 4FDUA 1UWLA 4MVJD 3MM4A 3V1MA 1MGOA 5IHXA 3CN7A 2BFEA 2O4CA 4ARCA 4YJ2B 3G7UA 1F4VA 3AKZA 3GFVA 4LC0A 5BN5A 3AI3A 4ND8A 2BR5A 3IOMA 4AN4A 4BB0A 1K98A 3PDUA 5CX1B 2QR5A 1CR4A 1K7FB 1M34A 4ZEXA 4LZPA 2B1GA 4LFCB 3IXQA 4EJMA 2AJCA 2DLCX 5T4HA 1AGNA 4EH1A 3EHDA 3WLSA 5B6JA 3U56A 4ZMBA 2JLAA 3L4SO 3V7YA 1FSSA 4TTVA 5AVTA 3ZX5A 2YOHA 3KQMA 4B6FA 2FOXA 2H3EA 4DVGA 1MIHA 5A04A 1UKEA 4C7KA 2PKEA 2CMKA 1K86A 3IQFA 1PJLA 1UXKA 3AU9A 5FWYB 3WB1A 5C3UA 1WV1A 2G06A 2YZGA 1J1UA 1HG1A 1Y1TA 5AH0A 2VCYA 1OGYA 1Z6XA 1G9TA 1JX6A 3PXUA 5FAKA 1YHZA 1IVSA 3BS4A 3AVVA 3PC8A 1LI7A 2G82A 4IYJA 4R1NA 1M2HA 3DTYA 1XJCA 4B80A 1O77A 3IKLA 3QWFA 2VQFB 4LJRA 5EN4A 3QELB 3NBKA 3H2KA 1EZ1A 3NAMA 1Q1QA 4UZFA 1KDPA 1P61B 2BONA 4J7AA 4PAGA 4E14A 1NPDA 2H2GA 1KU6A 4JJAA 4ZT7A 5G02A 3G0BA 4NBSA 5EKUA 5LWHA 1U98A 3VNRA 1DQYA 2G76A 2Q28A 4PC1A 3ZD8A 1W4CA 4CVNA 3H2HA 1K1EA 2PLRA 2AG6A 4X6XA 5BT9A 4Z4EA 2JCSA 3DLTA 3NKFA 1ZRMA 2DQ4A 4IWYA 4RVGA 4JSYA 5SZHB 4JFAA 3T1OA 4U2EA 5KX5A 3JR7A 4I55B 1IUOA 3ZDRA 3WYGA 3KZCA 4DJJA 4EHIA 4XSHA 4B3DA 2J9YB 3MJCA 5JOQA 4O4IB 3RM3A 3JU3A 2XUGA 1NBEA 4FEYA 2C9MA 4LOIA 4ZVUA 3ABOB 4X1KA 4Z51A 2ZUCA 2F64A 2VS1A 3OQBA 4S1VA 4TTTS 1I2CA 2BFOA 3QPCA 3R8CA 3NC0C 5LZ2A 3U19A 2GLTA 4MRNA 3GPIA 4FR2A 4HK4A 1RMTA 2PSJA 5JYCA 4XIYA 1NW5A 3RKRA 4EZEA 5EJ7A 1KWKA 3FMFA 3RRXA 2VH2A 4JQCA 1AUVA 4RQAA 3EW9A 4K8RB 1BGWA 4IJWA 4R2HA 5ESRA 5LA6F 2IPMA 4XR4A 1FVFA 1JEQB 1WXIA 2WJZB 4KAFA 4KOAA 3GDOA 2PK3A 4N8DA 5HX7A 3Q5DA 4QX6A 5EMMA 3ED1A 2O6LA 4B0OA 1X8XA 1U7UA 3ZTWA 3SYNA 4QL3A 1GTMA 3TPZA 2O23A 4FNAA 2BUBA 2ZIXA 4OBBA 2D6FA 1C4XA 1BWSA 1LZKA 2EHJA 3DDUA 4AZ3A 4D98A 3GRKA 1CQJB 3OEHD 4HAWA 1QP7A 1GR1A 1I7DA 3MGKA 3PXAA 2VF4X 2NUPA 1WXQA 3VHQA 2B78A 4FGUA 4KWEA 1EK0A 3HDTA 1WDLA 3U7GA 4IJUA 2PX4A 5TPWB 4O3MA 2WZDA 4WZAB 4AJLA 2IW3A 1AKEA 3AJRA 4NFLA 1MC1A 3RS3A 1M73E 1KJ8A 2MSKA 4GYYA 1I7PA 4OXNA 3WS7A 5EVJA 9LDBA 2ZWVA 1MVLA 3BCSA 1BD3A 1X42A 3B5JA 2PUCA 3ZK8A 1Y8RB 7REQB 2B7CA 5CEEA 1G38A 3BX1A 5CXUA 3DXYA 1QUFA 1X38A 3FYCA 4GNKA 1GLNA 4QWMA 1EEHA 2IXFA 2Y8EA 4GXRA 4H60A 1C3EA 1PR2A 1U81A 2FDXA 1Q3HA 3MYYA 3UK7A 1RQRA 3LH5A 3NGXA 5K2MA 2QD4A 3IT0A 4IBOA 3W2TA 1MHPA 1BQ4A 1C7RA 2XQFA 3L84A 4DMRA 3TDKA 4F21A 3PLAE 1LPSA 2YMMA 4DCUA 1M0EA 1XDWA 2PMCA 3MG9A 4C76A 4U5XA 2ZWAA 3CIOA 5BQOA 4M1YA 4EUEA 1U7PA 4PZYA 3R1IA 3THRA 3VR6D 2GPJA 3OOWA 1NKVA 2C57A 1JJBA 5DBGA 3ZK9A 1E32A 1QLWA 2P9QA 2BFWA 3I2HA 3K9NA 4R3NA 5EPUA 2NUTA 1RLMA 1H85A 4EB6A 3L46A 4E1BA 2GX6A 4KNYA 5CDUA 5BMOA 4X7MA 4H3HB 4BLSA 4D42A 5HQ3B 3O3CA 4J76A 1QP4A 2VI5A 3RFUA 2PZFA 4AYXA 1YS1X 1ZVQA 3E3OA 4WY8A 2WTXA 4Z4GA 3DZ8A 1QYDA 3A6FA 4LHSA 1UWVA 3W7VA 2GA9A 1PFGA 1E4OA 1KJ9A 1KARA 2A35A 5U4QA 5CB4B 1M5RA 3REFA 4K6OA 1U5BA 3OLXA 3E9EA 1P19A 1CUAA 4PLHA 3U3JA 1C8KA 3ANYB 3D6VA 3GRFA 1EUCA 3NWPA 3TQRA 4RLHA 4QTZA 4JB2A 5F3RA 5JWRA 2GN9A 1X7YB 3TSAA 1RYDA 1MDFA 2WT8A 4GPBA 3VU8A 3WMWA 3O6VA 1WETA 2EV9A 3AZPA 3C1UA 2HO5A 3AHEA 2UZ1B 2BFFB 3Q2KA 1GYQA 2EIHA 2XVXA 1MRZA 1YVPA 2JB9A 5T57A 1XPJA 3HU5A 1S3SA 5CR9A 5ILOA 5KNCH 1E2HA 4Q1FA 4GYJA 4KQJA 2GHQA 4R1OA 1I2AA 1EZ4A 4GOMD 4I4LA 2LCQA 3T7KA 2QG4A 3GJQA 4AJHA 4Z6KA 1UT8A 3KQLA 3W5UA 2X0JA 4FT4A 1RRKA 4HQ6A 4PVCA 3HCEA 2K2WA 5DNEA 5FPKA 4CNQA 1EESA 4LYFA 2H1SA 5IANA 3BE6A 4QPDA 1B0PA 3ADDA 4LUCA 3E61A 5AVUA 2WWTA 4LYGA 4E5YA 4H7HA 5DGTA 2F1JA 3RFVA 3Q7IA 3HXTA 5HIMA 4NESA 5T6BA 1P0QA 4ZYTA 3ADOA 2RAFA 3IILA 3DF7A 4DLLA 3EZGA 4P8RA 1N78A 5B36A 3RG8A 4ARZB 4KPFC 3FB4A 8OHMA 3PF9A 2J3HA 1FTQA 4FHZA 1B8NA 1XZLA 2CFSA 5FB3A 4UQPA 1ZVMA 1D4FA 1L5FA 4KDRA 4P7FA 2MSCB 1R5BA 1IEXA 1XFDA 2Q9UA 3DDOA 4D6XA 3K31A 3K0KA 1Z2PX 4MV4A 5DDIP 2I34A 5DM2A 2ZUFA 3A0UA 3A1DA 4BX8A 4ETWA 4B31A 1BN7A 1UFVA 1BKDR 2GUGA 1QH8A 2QZ9A 3M89A 2AYYA 5E9QA 1DJLA 4OV6B 2R7KA 5JPIA 4B3IA 4TUYB 4MGHA 1GT6A 3WO0A 4AY6A 3GH1A 1TUBB 1MJ5A 2FN8A 2N46A 3L92A 5G0TA 1IRIA 2RGAA 3ITEA 1C14A 4CBVA 1L7RA 3IV9A 4Y2JA 2PLFA 2ZBFA 3ID6C 4J49A 4K1LA 1M0TA 3UIEA 4QJBA 2BH2A 1H05A 5B53A 2ZETA 2FUG6 3BE8A 4ITUA 3R7DA 3R7NA 1CXZA 4XUDA 3R8XA 2HCFA 4QTYA 3NIFB 1UC8A 1PO7A 3NVDA 4ZT6A 2CNWD 4ROSA 1XVIA 4W1RA 1HTBA 4Q02A 4NH0A 4U0JA 3SOPA 1B0UA 3P9RA 2F2TA 3VYUB 1QX4A 3NW9A 3ROZA 3ZVRA 2QAJA 1IY0A 1YQGA 2J9FB 5D3MA 4RTKA 8MHTA 3AFMA 3VSDA 3NWEA 3VI3B 4CF5A 2GEVA 3MRVA 4HXYA 4I5GA 5JRZA 2A88A 1ZMTA 3NIBA 5AMXA 4JLMA 1KI9A 4FLEA 4MTCA 4QDOA 1DP4A 2Z8YA 3OLZA 4YQFA 2INGX 4FNGA 2FZKA 4OF4A 1FDRA 2XMDA 5IG2A 4H2DA 3T3DA 4FDVA 3ZHTA 2FPPA 5FD8A 3OFSA 3NNDA 2NZVG 3MGBA 3F5SA 2ZBRA 4I1PA 2O1EA 3EEOA 2XNJA 2Y93A 2JGFA 1BSVA 3IQDB 1PL8A 4V2UA 5JSYA 1KI1A 2GO1A 2ZU0C 4EY6A 1U94A 3WIUA 2PFKA 5TIIA 3COSA 2D74A 1H8EA 1KH3A 2ZYTX 3LM8A 4BFSA 6REQB 5JALA 3IPAA 4LXIA 4DILA 4KMSA 1LNSA 4R51A 4EGAA 4IPTA 5CT4A 1KEWA 3W8RA 2NT3A 2F4VB 1Q0RA 1QKJA 4ZHQB 1MFZA 1QYXA 2V7GA 4Y6GB 1LX7A 4AP9A 5LPNA 1PUIA 1T2UA 1U2TA 4HDCA 1TDJA 1WD7A 1AQUA 4A0RA 3C6MA 5ICFA 4YALA 2EX1A 3OZEA 1YO6A 1RPNA 1U8UA 4DYHA 1GKIA 4WZBB 1RZVA 3GHYA 3UMSA 4DWWA 1DG3A 3IIMA 3OOSA 1GV0A 2NUAA 5AXDA 1TB4A 3Q10A 3L04A 3C24A 5BN3A 4KSCA 1DG9A 2NO6A 1SGWA 2ZS7A 3AR5A 1GEGA 3LP8A 2FEKA 4OQLA 4KN9S 1FY2A 4B81A 5FUQA 5BRAA 1RYEA 3WRWA 4J6EA 2P6UA 5HJEA 4YXWA 1S7GA 3K1AB 4ZTZB 4FHDA 1Y9JA 2CWDA 5ILQA 5CDGA 2YS7A 4IFBA 5IXJA 1X19A 2NXNA 4PLZA 1VSVA 2XQVA 4PX2A 5F21A 3QPVA 3U1VA 4AZWA 1D04A 3IOYA 4EJFA 2FUEA 1WPGA 2FSSA 4D44A 3WJ1A 5JI2E 5BOSA 1C3LA 3GV0A 4OGGA 4Q37A 1W5TA 3AEKB 4PQRA 5BSFA 3L4BC 1DUVG 2X7JA 3GX1A 4KLCA 3ZIAA 2VTBB 4J2TA 4PZUA 4PG7A 1KI8A 2UVQA 4QLOA 3WWZA 3A1SA 2VZ0A 4Q16A 3J7AC 1Z0DA 3EG9B 4M0LA 2OY0A 4RK5A 4XDHA 1T3ZA 4LYDA 3JALB 4F0JA 1IPEA 4JSRA 2I1LA 5U9CA 3PEWA 3UAYA 4A0FA 3GQVA 3VYRB 4DIDA 1QGAA 5GVSA 2HNKA 1HTWA 2FF7A 3JZDA 4HWKA 5BUCA 1MCZA 4Y6OA 2XWBF 4YRNA 2V65A 5AK3A 1JJVA 1G18A 3D7RA 3ICPA 4FLFA 2GD2A 1BEZA 2HLHA 4G9GA 4IWXA 4KQ9A 3DCJA 2P9TA 5EJAA 2JVJA 2XUDA 2L17A 3CZQA 3V1YA 2OT3B 3JARA 3KYJB 4FHCA 1M72A 1Q7GA 4N4AA 5FTJA 4LNAA 3RLFA 4JYCA 5AXBA 4G0VA 2AW5A 5D5PA 1N1MA 1ONSA 1GPYA 2BOVA 3ANNA 2QTFA 3B5IA 3K15A 3Q88A 4B09A 2W2MA 4WOCA 1Q2UA 2FHSA 3GFSA 2CDNA 4B2IA 5A3JA 4QYIB 4GLOA 4ZANA 2GSWA 2OFOA 3O21A 2UYCA 4Z3OA 2DE0X 2HRZA 2Z4SA 5T4EA 3H9QA 3I8SA 2C9BA 2PAFA 2HJGA 4L4UA 1AS3A 3MJTA 3VZSA 4N49A 5E3HA 3HY4A 2ZKLA 1BU8A 4Q3KA 4B8ZA 4N1AA 1L7NA 3TPFA 3UAWA 1JP7A 1K68A 1ZH4A 3V8RA 4CPDA 1KKLA 1O03A 2JD0A 2QX8A 3A7EA 4UHEA 3ZQKA 4CT4B 5L53A 1HYGA 3DEKA 5P21A 1UKBA 3O8RA 4AWBA 3NV9A 3MTQA 3WK6A 4UMDA 4Y2UA 5I47A 3EBOA 4MO2A 3K92A 2GK3A 1WZIA 3EGOA 2O54A 1B16A 2QE7A 2TMYA 5K0TA 4XWAA 2R7MA 1GVNB 3BF7A 3IUMA 3U7JA 1EWTA 2J08A 4RMIA 3HSSA 5IS2A 1U9JA 3F96A 3JATA 4C6HA 4CMBA 3FHOA 3RT9A 4MB6A 4ZVTA 4B85A 3HCAA 2CHQA 4Q48A 3SC6A 3RVSA 2Q29A 4G5HA 4X3OA 3V8NA 4MV0A 2J4CA 1CRWG 2RGDA 3GYGA 1FTYA 3OQJA 2BFEB 1WUKS 4BYMA 3CC8A 4L3WA 4CKBA 4MHOA 1RJWA 5D6OA 4CTJA 3DZGA 5BQXA 4R7ZA 1E0DA 4NBLA 1XCPA 3EFEA 3P0IA 3RFFA 5HKKD 3LYAA 5FI0B 2XMSA 1D2CA 2IUUA 4GQBA 3KCNA 3CUWA 1IM8A 4J4BA 1NR7A 2X9VA 4M1KA 3ZBQA 1IOWA 3KSAC 1EHYA 1TKBA 5KKCA 4JBXA 4BQPA 1H4SA 4RAOA 1EWKA 2QN6A 1II9A 5T8KA 3LKDA 4JOSA 2EW2A 1QGUA 3S3TA 3VR3A 3ITKA 1WMAA 3WLTA 2VAPA 4X95A 3JYPA 3OM8A 3JX9A 1SU6A 4QU9A 4TSFD 1ZJZA 3DFZA 3BGVA 3M4ZA 5BN4A 3HDHA 3OUUA 3ZWWA 3VAAA 1UOPA 3QXSA 5KBYA 2GBPA 1ADFA 1CETA 1IUPA 2O2JA 1N7HA 1ODCA 3TSOA 4XEHA 3SDBA 2IDMA 3D59A 4LX0A 13PKA 1PFYA 4K9NA 1YR8A 5ENZA 4C7OA 1I3KA 2Q8NA 1JDBC 1O97D 1P18A 3I2GA 3LXXA 2HCJB 2QRJA 2X15A 3WYNA 1A2QA 2PU7A 3C45A 1UPAA 4FS3A 5KTMA 5G41A 3T5BA 1C0PA 2H5IA 1I51A 4IUDS 3ZV3A 5JFGA 3Q9SA 2KLHA 1MJGA 3H19A 4HJXA 2B9VA 4A2WA 3ZIUA 4CR8A 1A5AB 2BBTA 2OBBA 1FP4A 4DA7A 1R4NB 2WTBA 1WVMA 3NHFA 1VGQA 4C07A 3THXB 2HF2A 5CYFA 3GRCA 2O19A 1WSDA 3SHOA 2ZYGA 1E7RA 2HPZA 3LO5A 4CEJA 1Q14A 2WHRA 3O8OA 1SD2A 4OXXA 3EXIB 3F3SA 1DWOA 3B2EA 1XKTA 3HBNA 2VJPA 2ABWA 3OICA 2IYEA 4TRNA 2GD6A 4BZZA 2C5GA 2WU8A 1JSXA 1V48A 4KMRA 5BV1A 2R4UA 2A0FA 5AKLA 2P3OA 3EXHA 3WMGA 2RGNA 3FYHA 3OE7A 3RTBA 5KQLA 2D3TA 1GFZA 2Z5FA 4LHWA 1GPMA 3SQDA 4BAZA 3OZVA 3OZGA 3ZI4A 5LD2B 4AT1A 1ZMRA 4I66A 1Y9DA 3II6X 1ACLA 4YCBA 3ASYA 3HKBB 4C4OA 4DR3B 3HUFA 3SX4A 1MF7A 3FYTA 5KNBD 3ZNPA 4RH3A 4YK7A 4UE3S 4LOKA 3TLBA 4QNMA 3HZOA 2D5BA 3FYDA 4LHZA 1U3CA 1IDN1 1Z4PX 2HMAA 3GGDA 4WDQA 4Y6LA 4HY3A 4UVGA 5KTTA 2ZXUA 3LPMA 1OZFA 3NKLA 4RA6B 3V8MA 2H2HA 1HBJA 4QO7A 3FUWA 5J5CA 4RD4A 1JHYA 1F0PA 5FTKA 4KAXA 1DBVO 3BK2A 3NT2A 5C46F 4I3GA 1KP3A 5JSZA 4QVIA 3TTWA 5HZKA 2OV3A 1II8A 1P7CA 2ORYA 3H9UA 2XMBA 2H2WA 3K9FC 2JGDA 3TB4A 3TIVA 1FQWA 3GLGA 1OWOA 2X41A 2F55A 4MUBA 5BR4A 2XT0A 3AOGA 3PC8C 1SU8A 2OORC 1JVBA 2I1VB 3KZMA 4RPJA 1LSJA 3PHCA 4DZTA 2VUSA 4FE4A 4KHZA 1CK4A 3QBDA 1E96A 3FOEC 1ND5A 1E60A 4G1VA 1DIRA 4R16A 3DVAA 3SX2A 2XECA 1VHLA 4EYQA 4KDEA 4M0MA 1BDJA 2D8MA 4PLCA 1R8YA 4PPGA 5I7AA 3C6BA 5TV2A 3SI7A 1WMBA 5BSKA 3L7AA 4EKIA 1Y3CE 4DYDA 1JA1A 3OD5A 3C2QA 4JBGA 2XOEA 4MK4A 1VGVA 2WHQA 5K3EA 1ABEA 1L6IA 3ETJA 4EG0A 5TMBA 3UH0A 2JLZA 4NMMA 3THXA 2QP4A 2H1HA 1P5RA 2JFHA 4LTDA 1BS9A 5ICMA 2PX8A 2BKEA 4RSGA 2H85A 4M0KA 3E7DA 1UBUS 2VDLB 3M33A 1EBUA 1C29B 1CS4C 1US8A 2V3WA 2V9PA 5T4FA 5C32A 2AR0A 2LXNA 1U2RA 5MN6A 2QBYB 3CE9A 1J8QA 2H1CA 1YDMA 3PGLA 3A6GA 3ROXA 4CLDA 4ACAA 1N9KA 2WUGA 4JLOA 4BMDA 5ER9A 5KSPA 1PSZA 2PJUA 3H4VA 4BKRA 5HQTA 4C08A 2AWNA 3VZPA 3ZTTA 2RI1A 4RVCA 4MRMA 3F4KA 3LPAA 1BMFA 4H6VA 5ADVA 4Q1CA 1QAQA 2DKOA 5EUMA 2NTJA 3OT4A 3EGDA 1RJEA 1R4NA 3KQSA 5HKLA 1E1NA 2HNAA 4LBYA 1XHEA 3QUCA 4RC9A 4WTOA 3DKKA 2H5LA 4ZQIA 4ZYXA 2BISA 3Q8XB 3V7NA 4S1PA 1ESDA 2BFCA 3V8PA 1OFGA 4BJ1A 5L7TA 2PNFA 5DNDA 1Q12A 2QSUA 1U2ZA 3BBPA 1Q2XA 1ZSYA 2AFHA 1PDOA 4P92A 1PEYA 3VPHA 3L5OA 3AQ4A 3W5HA 6CHYA 1II0A 5IJZA 2C8LA 3BAZA 2VNHA 4IJ5A 1FZQA 3DE2X 3BFVA 2AFHE 1V3VA 4RJKA 2PT9A 1CCWA 3FFXA 4YIKA 1LEHA 4BV9A 3GNLA 1YGPA 2YC2C 2RHJA 5ALNA 1ZCAA 2PA3A 4AROA 5LA6A 2BEWB 1I14A 4QXMA 2JIMA 3T4PA 4GGOA 1SBTA 4IFEA 4DXDA 2GERA 2OO5C 3COWA 2NU8B 3T3EA 2JZCA 2P2CA 4JR1A 4AKIA 3CB2A 4RHCA 2GKSA 1X0VA 2REOA 1JZTA 1FMJA 3DLHA 3UJ9A 1XZGA 3DWGA 2R1TB 4H35A 1OLSA 3AHHA 4ZRNA 2Z9DA 3LZ6A 3VNQA 2CXTA 1CKEA 3WNDA 3TZCA 5BT8A 1PZFA 1NLZA 4CM8A 2AZXA 2H8GA 3QE3A 3CLRD 1HGXA 4BVFA 4UTPA 4TMFA 2CFCA 3BSYA 4HDOB 2LIVA 1NUQA 2QBYA 3TYXA 2V7WA 3WE7A 4CEHB 3OMLA 1W8DA 1B0AA 2C5EA 4GBGA 3WYBA 5EQTA 4L4XA 1I4WA 5G1PA 2ZT5A 3TKLA 4BBJA 4U7GA 2FZ4A 2IXBA 2V1XA 2IGBA 2ZUVA 3NTOA 2ZAYA 3DQZA 3MLBA 4YUVA 1JR6A 2OM6A 4RF4A 5EEGA 1PUJA 3IUBA 2FK8A 1S8FA 1T9ZA 1NVAA 3W9YA 3DHVA 1ZK1A 4LFAB 2FPSA 1IQRA 4XVUA 3AEXA 3QWHA 4PO3X 5ALVA 1T3HA 1ICEA 5CTAA 4YP1A 3VPXA 4S24A 1XCBA 3OEHA 4L15A 3A4MA 3QOWA 1FVOA 3MAJA 2WYVA 1ARZA 1U3WA 4JNKA 3W8DA 2YVQA 3EXHC 5AI8A 4URHA 3OAAD 4C7VA 2D3WA 1UCFA 2JIRA 2QTVB 4EMBA 3K0SA 4L0CA 1KQNA 1QG4A 4JOBA 4UHJA 3W4IA 3KEMA 3JAWB 3UPUA 2IYTA 4BMXA 2RE8A 3VH4A 3NUGA 4HL6A 1T5LA 3RUDA 3GARA 1POXA 2YV4A 3H65A 5E38A 1CLUA 1Y0BA 1D09A 1TECE 4G1UC 2DZDA 3G5AA 1I4TD 4NNJA 1T25A 4Q4LA 3NIDB 1K7EB 4GW3A 2WPDA 5IJ0B 4JZYA 3V4RA 2B8NA 1BH2A 5C34B 1KDRA 3OPYI 4ZU1X 5C8VA 4MKFA 3ZY6A 1C1XB 1GPH1 4R0NA 2NO5A 3ZHRA 5A7FA 1OAAA 2YWRA 5KVAA 4G3XA 2LP4Y 1A4XA 3AHCA 4WA8A 3EBLA 1L5LA 3S5JA 1OH8A 2O7NA 2QVCA 2FVXA 2JGIA 3L0PA 1L5YA 2HHLA 3JQ9C 1U7DA 2HYIC 1G20A 1SXPA 2A9VA 2ZSEA 3F5QA 2DBRA 4QXPA 4JGGA 5FUVA 2Q5EA 2ZTHA 4DJFC 3ZTYA 2CL6X 1PE0A 3MVEA 1TW2A 4OKIA 1XTBA 5TMDA 5AHOA 3PGMA 1NQOA 3KKOA 4PQFA 3UATA 4BWFB 4OI0A 2GARA 4RMHA 5JRJA 3O94A 2PX5A 2B5VA 2XE8A 1DCMA 3WSTA 4BUZA 5TGZA 3A27A 1XEWY 1E59A 3UJ3X 1T1JA 1E2NA 1EVJA 3GUCA 4QFCA 1EA7A 4UBMA 4DL9A 2Q0HA 2R6CA 4L8YA 3S2FA 5IRCD 5FORA 1F9AA 3I01A 5DW0A 4ENUA 5CDTA 3DDNA 5DTIA 1AGRA 4DBLE 1WWKA 2PN1A 1Q7TA 5FNVB 2ESRA 4AZVA 1GRQA 2V6FA 4WMLA 4A2QA 3O84A 1MW9X 1N8SA 4KR0A 1ODFA 2OV8A 5J5AA 4D8WA 2HRDA 1RCFA 1PK7A 1RXSA 2OILA 3PFNA 4G4GA 4QBHA 4RESA 5A3QA 2ATIA 2OMEA 3DS8A 1LRKA 1MC8A 3SBDA 3SKYA 1YU6A 3QU9A 1OWPA 1UUFA 1KFJB 1W9MA 1I0IA 1ZH0A 2Q3BA 1J0XO 5E6UA 2R84A 5LYYA 3RYFB 1IN5A 1KIAA 1YB7A 3LAWA 4G5OA 4BO5A 1D2AA 1ZCBA 3DMGA 2E2WA 3PT5A 3REQB 4C4AA 1O5TA 3LUKA 3H1PA 5ADHA 2O2CA 3GFOA 1M6NA 3VNSA 1NASA 3WYEA 1VYUA 3WKEA 3PB3A 3G5UA 4LSWA 5F51A 3V2GA 3TF5A 2V3VA 4OGWA 4F04A 4J1SA 4QU8A 1RPAA 2FZWA 4MHTA 4Y2XA 3K30A 3E03A 2W90A 4G8CA 3H83A 3F8SA 4UTZA 5KNDD 3F8TA 3FH0A 1D07A 3IVGA 4AULA 3CNHA 1XTQA 3DE1X 3ILVA 3WNCA 4CMIA 5GV7A 4TLDA 1JIQA 1J22A 1U80A 3K5HA 1DAIA 1TKCA 3SJBA 4MUGA 3KZOA 4C1NA 1KQFA 1L4UA 2PWYA 2QJFA 3JV7A 1Z6QA 2F67A 3NYRA 4HN9A 1R10A 1Y7TA 4I6EA 4WEQA 5DH9A 5FO0A 1NI4B 2TRSB 2AGVA 1SWWA 3OZTA 3IPCA 4NE9A 2BCJQ 2RAUA 1QLJA 4TVOA 4UQOA 5A6VA 5F9FA 3NRCA 1NVFA 3RH0A 1JL3A 5FBQB 4B6JA 3JAWA 1WZNA 3HO6A 3X43A 5L51A 1NIPA 4MITA 4ZIRB 1WXXA 4PG6A 1TVEA 2YJ5A 4YRKA 1RM3A 3MPOA 4CMAA 1IN8A 2I8LA 1K6EA 3VC2A 2FN3A 4RV4A 1E92A 1T0PA 5DLPA 1D3AA 1I36A 3B1XA 3CGGA 2OZEA 3DC7A 2WG1A 4RVDA 5AJXA 3VGPA 4XWTA 3DMYA 3LC2O 3VDXA 1M2OB 1UDBA 2XUAA 3IKJA 4ZQEA 3RQIA 3TTTA 4JI6B 2DCUA 4XYLA 2WM3A 1LJ8A 2ZP1A 3EZLA 2OCAA 4IDFA 2OB1A 4NFHA 2J9GA 4WZAE 1XMXA 2HUNA 2ZR9A 1UANA 1YAHA 1QCYA 1KHTA 2VXCA 3MGGA 5H0IA 4DABA 4Q9NA 1VXOA 4UTOA 4FWBA 2H9AA 4DOMA 3KX2A 4YCCA 3QNMA 1P5FA 1EVLA 4B8YA 5BWBA 1FPMA 1KI7A 2JAUA 2HA2A 4IVRA 1Z0UA 4NMHA 3AUJB 1O58A 2IP1A 5TF0A 4DJAA 5A4KA 1YOVB 1U8FO 2C3OA 3I37X 4BX2A 1HKUA 6AT1A 1HNWB 3IDSA 1EVYA 3DKVA 1KEUA 4U63A 5CX1A 3WWOA 2GTPA 1QHXA 4L6IA 2FMFA 3VU9B 3AO0B 1V9SA 5DNWA 3GCWA 3I58A 2A5GA 4WAUA 5L45A 3KYIB 3USCS 1RYHA 3WLMA 4N3CA 1FUUA 1QO0A 2ILTA 4PANA 4E5KA 4H59A 2MSLA 5BYAA 3GJYA 1E3WB 1NUSA 4R3UC 1UPXA 4GR4A 1CEEA 5IABA 1SKBA 2IS6A 4E5MA 4PHCA 2BFPA 4D80A 1D0SA 4GMKA 4BLPA 4B3SB 2FJUA 2WYOA 4XQ9A 2PUDA 4OHKA 4AO7A 3KZVA 3FLAA 3O0TA 4QGHA 4UDOA 4RD2A 3ZS9A 3DV0B 4I2VA 1VI2A 2C88A 2CD9A 5K6AA 3PNSA 1N5KA 4OL0A 3HL0A 3OTQA 2WSIA 1COZA 4E30A 1Z34A 3QU7A 4IW3B 1FU8A 1I4DD 3INGA 1DVRA 2A9KA 2AG0A 3W3AA 4MINA 2H2FA 4Q9DA 4Y7CA 4C0AC 5AJWA 3S81A 2XGOA 4MVCA 5D3ZA 5F52A 3T9EA 1Z2EA 1E6LA 1ZD3A 1JG1A 5HIAA 4MRSA 3PDHA 4Z86A 1MXHA 2ZTSA 3S55A 3SAJA 1N5LA 3UB2A 3WYAA 1YS9A 3N05A 4NH4A 4R9VA 4V39A 1F2UA 4GI7A 4KBFA 4IOJA 5L3QA 1NWHA 1IZ8A 2GOYA 1Q74A 1Q17A 4WNYA 4BOYA 5JAUA 2C3YA 2NSHA 2JVIA 4Q4HA 4YRRA 4C1BA 1R0RE 1MC4A 3KQOA 2QLBA 2IY8A 2CDBA 1RE1A 4NC9A 4EVSA 5AKYA 1Z22A 3B1KA 2Q2WA 4DB4A 3ZJYA 4PHHA 3PNVA 2DJIA 4DV0B 4E03A 4ESEA 3STTA 3IA7A 3IIKA 2Z58A 4Q19A 3ZWOA 4K46A 1VFPA 3OZSA 3Q72A 3K4HA 4LF5B 4ML3A 1ULUA 3Q3VA 4X93A 1QBGA 5I48A 1O87A 4XWKA 4N0QA 1PJAA 1LSOA 1LDYA 1L7XA 2CHVA 2V4ZA 3H5OA 3DAFA 4FEEA 5E1BA 2XJ9A 4GZLA 3OSZA 3V4OA 3IEPA 2B36A 3L8ZA 4Z1MA 5BMVA 1ZH2A 4KIWA 5ICEA 2YQ4A 4FYWA 4JR0A 4UTXA 1RXCA 1ZYUA 2QNBA 2YHIA 3TRFA 1K9SA 1LLCA 5COBA 5SY4A 2VNKA 4CKEA 1PW5A 5FBHA 1YS6A 2CYBA 4EI9A 1XZDA 4I9GA 2PGDA 5TLSA 5JY1A 5CH5A 4ZPXA 5IMSA 1CF4A 2CXUA 3O2NA 3OCUA 4CFYA 4G0QA 3GEDA 4H1WA 5CBKA 2XJ4A 3VKGA 1B42A 3L0OA 3E3NA 1R74A 1Z0ZA 3FJOA 1TKAA 1VMEA 3J81A 1A2KC 4RPCA 3GGCA 2RGWA 2OXRA 1E7QA 4YRSA 1ZAYA 4N7JA 4D1YA 1RKBA 3SIWA 5AI6A 1E3DA 5CVJA 4E2XA 5FL3A 1NQAO 2WV7A 4BNJA 2YXDA 4CDRA 1XRLA 4DG8A 5BMVB 3D2LA 3FJ1A 5CUQA 1QB8A 1GADO 3RSGA 2I67A 2ZTUA 1W73A 2JKYA 3OIYA 3P9QA 4P7KA 1MNQA 4MVXA 5EGSA 5HIJA 3W5SA 4BGUA 5A5FA 1DV2A 1RBZA 3NBYC 3ES9A 4MWBA 3TRKA 2C2XA 2IITA 2SKDA 4CR7A 4CEIB 1J7KA 2A5JA 3FMGA 2A4KA 3K1JA 3TBKA 3GXBA 1NC1A 5EXTA 1RRMA 4EY5A 3CRQA 2G4VA 1IIRA 3DPSA 3DTVA 2P4HX 3GGPA 4M9QA 2OAEA 1N7IA 3C5CA 3IESA 4R2WA 5TJHA 5ITZB 1HMYA 2EJUA 1DKOA 2YWCA 2ZB4A 4LJ8A 4QHSA 3DLIA 3BWDD 4UCWA 3D8SA 5KC9A 2A2ZA 2NT4A 2RBGA 4JHLA 3T3HA 3R6GA 4XA8A 5AW1A 5KHLB 1OIWA 5LIRA 3ORHA 4B43A 3GCXA 1OJ7A 3WRYC 1Y4UA 2AI2A 5INTA 1Z68A 1XYVA 3BMQA 4YRCA 1PDVA 1C3OB 2BL4A 1A5TA 1ISFA 4XLZA 3WB0A 2X6RA 1SUCA 1RHJA 3KTFA 4QOHA 1VPWA 1BHSA 1U2PA 2JFQA 2XSZA 1O96A 2VDWA 3DAOA 3JWEA 4NV1A 4XEUA 2OD9A 1KEVA 2W00A 3ND7A 3NM5A 1B8UA 3AEQA 2DM6A 3ONVA 1RHUA 4DSOA 2ZLBA 4K3UA 4X62B 2R86A 5B6IA 3VTKA 2VSFA 4QA9A 1RYNA 2TECE 1LKZA 2PRZA 1PBNA 4FKMA 1BD4A 3PRYA 4MPDA 4YGXB 3WLEA 1E3EA 4BMZA 1KI2A 3T35A 3IQXA 3HC7A 2I2WA 1JBQA 4X1IB 3RYCB 4GOOD 1YZTA 3AB7A 1PGOA 1RLJA 2I71A 3R23A 5EXDA 1ZGHA 2BSXA 3M1LA 4U7TB 4EHBA 3NHWA 4M8SA 4B7UA 1TMYA 1F7UA 4A2PA 5BXYA 1AXGA 4ED9A 4A15A 2BT4A 5C80A 5K1ZA 5BSHA 1PFQA 4F1WA 5A6SA 1V43A 2WHYA 4UU7A 3URKA 4RX1A 1IVNA 1UIRA 2JFBA 3VR3D 3TGWA 4C2UA 4TYPA 5L3SA 3B36A 3WZ2A 3KJNA 1W19A 1O6ZA 2EX4A 2VQDA 1AH2A 4MVJA 4HVAA 1XEWX 1Q0ZA 1MAAA 3DE0X 4FMBB 3PRKE 3STUA 5C8ZA 1RZRA 3JQCA 1KYXA 1ZICA 5EJEA 1FYVA 3JQBC 4IDQA 1FFGA 1KSGA 3ZXYA 1XQ6A 1V5IA 2EG9A 4RXUA 1KGSA 2WA1A 2F00A 4OYLA 2CCKA 1QMGA 2QN2A 4HZIA 1MUUA 3SXUA 2QX7A 2VCHA 4HTFA 3IAM6 4L27A 2JATA 3FOAA 1GG2A 3EZYA 4K28A 4QVKA 4XOIA 4ZJPA 4EJ6A 3DOOA 3V33A 3BN3A 3TH5A 3P2EA 4XYBA 2W2NA 4G01B 2AB0A 3H4MA 2BSQA 1IBRA 3NO4A 4AS1A 4EHDA 4KPEC 5J43A 1JFFA 3W3AH 1C9NA 4KPUA 3VR0A 2WABA 3TCXB 2FP4A 2Q3FA 3G02A 2NSLA 3SBXA 4L76A 3SF0A 3ZZNA 1GRVA 5LBUA 4BFLA 3OTIA 3R7SA 2G9QA 4YFVA 2WWVD 2NOAA 2QLTA 3ZWCA 3RVQA 3UW1A 1JIKA 1LBQA 1XLUA 1W76A 3NHLA 1MV8A 4M8KA 1GQSA 5CA1F 1ISPA 3PUJA 3X2FA 1GQFA 4DKJA 4OB6A 3AR4A 2W4QA 2QB5A 4NV0A 2WTUA 1XJ5A 2AG8A 3VO1A 1GPLA 4CEIA 2C1EA 3PXEA 4WN9B 4HFRA 4OQNA 1ZXLA 3GD5A 1XLVA 4PBSA 4X84A 3UHOA 1LLDA 3VJLA 1W7AA 3KR2A 3MZ0A 1ECFA 5HKKA 2FEOA 4QSMA 3ZDAA 3AK4A 1Y9ZA 1D7OA 3I76A 4TS1A 4UATA 3DT8A 5CLIA 5EZYA 5EE0A 4BVGA 3MMXA 5A2GA 2VKTA 1GN9A 4AJJA 1R9JA 2QX6A 4JYPA 3E15A 1KEZA 1P4GA 2OKGA 4WACA 5T5QA 2D2VA 2ZK7A 2O06A 2ZJ8A 4X00A 1WQ1R 2B3TA 2BGTA 2H29A 4F5ZA 4IICA 4F6CA 4IKPA 5KYXB 4FFBB 2GJ9A 3AEUA 3D4PA 4UOZA 3DMHA 2NG1A 4GRAA 4H7EA 4J0GA 4P08A 5C8YF 2JLRA 2PRIA 2Z2KA 3PJFA 4ZICA 4DGQA 1X13A 3QSGA 2ECFA 4G0MA 3AUFA 5CNKA 1T4CA 2A9RA 5B64A 4N3GA 2DEUA 3PV0A 2C98A 2AYXA 1FFHA 3M3PA 2I4TA 1WW3A 1W44A 3QA9A 3DBOB 5B3LA 3LL4A 4R7TA 5EUBA 1Q7RA 3H2JA 5KQMA 4UARA 1HE5A 1YR3A 2I65A 3HCPA 5E6SA 1BCSA 3G0OA 4MI6A 3MJEA 4PF1A 4YCAA 1KZHA 2Z2IA 1J5EB 2W6IA 3IR5A 2JIZD 3EQ9A 3FGPA 3OWOA 1SA0A 3E35A 3PI7A 4FX2A 1D2NA 3C7AA 4OU4A 4MGEA 5EE1A 2ZUSA 2UZ3A 2YRXA 4RA9A 5FPTA 3M1AA 1W6UA 4JYBA 4NYJR 2WV9A 2O8CA 4BP8A 1LDMA 2VJDA 3PPIA 4V0ME 4BMSA 1D7AA 1DZ3A 2F62A 4YC7A 1Z56C 1WHSB 2Y9PB 3BBLA 4L57A 1BYIA 4BHTA 2PL9A 2Q0QA 4OEHA 1BJKA 3MSXA 3RRMA 3OBIA 3WIEA 2LIPA 1VOTA 4A8TA 1R4AA 2RB4A 2R8OA 3N2IA 4PCLA 1LQTA 2GLXA 1SPBS 3AUAA 3KEQA 4PZ9A 3VA7A 3TLKA 5A4JA 4RF5A 2Y68A 2IWRA 1I0LA 2B94A 4XPZA 4F46A 4L22A 4MLPA 1V2HE 4FKZA 3VU0A 1NLYA 4H6PA 3DZDA 1P33A 1KYVA 3P2JA 4LCEA 4MR7A 1SKMA 1ZKDA 4M9UA 4X20B 4OHBA 4EL5A 5AVXA 1SQSA 4PPNA 1C9KA 1UMCA 3E9DA 2R6GA 5BYJA 3X1DA 4QARA 1ANKA 3SNHA 2XITA 1WZEA 2HI0A 3ZEIA 4UNQA 5JCOA 4I81A 3BPSA 3AB3A 3JASB 4LDRA 3S2ZA 1KYWA 4AJ2A 7ADHA 1AHPA 4YJDA 5LDDC 1BHO1 3BFXA 3CZ9A 2PZ8A 5GJWC 1EIWA 1VHDA 4GOXA 1ZNWA 3P45A 1SURA 1NY5A 2GCOA 3QHQA 3UKJA 1X80B 4F8YA 4FOTA 1LPOA 1E6KA 1NBWB 4UM8B 4H6XA 2VP6A 2XOXA 4HEHA 3T3OA 3UJCA 3HB9A 1Z0IA 2Z2JA 4RD3A 2Y1XA 4ZCRA 2V7QA 3FNGA 4S1NA 5IZCA 3L7MA 5JD6A 3PBKA 2VJOA 5K4GA 1USKA 4ADSG 2JIOA 3AUYA 4G97A 2IE8A 2NU9A 2M6KA 3RSLA 3IMGA 3ICEA 2ZRMA 2C94A 3PXCX 5K0GA 3GJ8A 1M2KA 3D7LA 4AQDA 3FROA 4XVHA 5HTKA 1TVCA 4P93A 1B0ZA 3SEQA 4MAFA 4UXHA 3SR3A 4D3SA 5AD1A 3FHCB 3UMYA 4CTMA 3ZWXA 5AVJA 2ZSFA 1ZR2A 3EC1A 3EJWA 3AG6A 1NLMA 1B2RA 1TJPB 1KPGA 4XWWA 2GPWA 4LRSB 1J23A 1RMQA 3OESA 4JQZA 4RORA 4WLVA 3ZDZB 1SC6A 4D0NA 1G8GA 4OGFA 2BMJA 3HKEA 1U6JA 2OGSA 4KL8S 3WMFA 1ECCA 1H2EA 1W29A 3JS5A 1EGMB 3EASA 2H4HA 4GOJA 4MVJH 2CY0A 2NVUA 4TKLA 1ESMA 5EWMA 4EQ6A 1CEXA 1M34E 1RRPA 3HCWA 4L0DA 2YQ5A 3C7CB 4HDNB 2OLJA 5DX8A 3Q7EA 3CR8A 2AMVA 2O57A 1ZEJA 1SXJA 2ZJ6A 3IEXA 3IQHX 4WEOA 4UQLA 3SWWA 2V45A 1ZXXA 1FJHA 1RKUA 2Q2NA 2X9GA 5E6SB 4BFVA 4WK4B 2F1OA 3D3WA 4QT0A 1TM7E 4GWKA 1D4OA 1UEIA 2I2BA 4KI0A 4Q4DA 2ZRJA 3EPLA 2IP2A 1FA9A 4GBJA 4QAQA 4V0NA 3HJAA 2Q6KA 1R0XA 3BMOB 2OXIA 4C03A 3TUZC 4DUPA 1YFZA 1TQ2A 3KKNA 1XZCA 5TGDA 3QWIA 3UGTA 4AJPA 5JD5A 1VHTA 3EARA 3FPBA 2ZSBA 1YUMA 3FCAA 1KVTA 2PKQP 1BFDA 3LKZA 2AKAB 1U28A 2ZCJA 4JT2A 1G5QA 3HFJA 4KSYA 1BNCA 2BDUA 2X5JO 3I6ZA 3BKXA 2GAIA 4YJ3B 1V1RB 5E4TA 4D9IA 3B53X 4N5DA 3KJIA 4DNPA 1NOJA 2A58A 4KQHA 2AQIA 1HR0B 4M7RA 4ZQHA 3UO8B 2CNOA 2JCVA 1A9PA 2OBFA 4LZLA 4MYHA 5SV2A 3UWKA 3ZI0A 4WUVA 3FB1A 3X44A 3EF3A 4PLPA 1YJQA 1ZFNA 1PEKE 1KZYC 2VDNB 1ATIA 4MCHA 5IAGA 2XAAA 1OE0A 2AC7A 2OFFA 5J1SB 1DT3A 4LXUA 4L7VA 4ZVSA 3WDKA 4F8JA 4W99A 1QTNA 1E9SA 3F8WA 3FBWA 4FMCF 1LQUA 4D4LA 1AKTA 3HCFA 2AFRA 4MCAA 2PIAA 4ZD6A 3JYQA 3WX0A 4EJSA 1KZ9A 4YQEA 1K6XA 4H6WA 4F3CA 2PUGA 5ADUS 5K6TA 3HEMA 3TR5A 3ET5A 3FIUA 1CE8A 3THYB 5SYNA 2V0GA 4M2LA 3AM4A 2VK4A 3M82A 4MUIA 2A33A 3I9FA 1QE0A 4TM8A 5E0KB 1RWPA 2C2YA 2RHHA 1E8DA 1ZUNB 4E33A 4F72A 2GAFA 3L0SA 4WXMA 3B9BA 4XIJA 4DV3B 5FOWA 3NBXX 3LQYA 2FZVA 4QICA 2E37A 2ZQ5A 1QYRA 2Q1WA 3LT1A 2OQIA 4UOEA 1QR6A 3G0GA 3W4KA 1H2AS 2CJFA 1NIJA 3NRBA 4JBYA 1J09A 2ENWA 1CF2O 1EU1A 2VK2A 5M29A 3ASUA 3MK31 4RHYA 2AZMA 4G5QA 4A2CA 2LRHA 3G2LA 4RGQA 5ES3A 4MV8A 3GZNB 2CV2A 2GBFA 4RTQA 2G1KA 3RAFC 3WBBA 1YONA 3DV0A 4BFXA 1IZYA 3D6JA 4L2IA 3JAKB 4RIIA 4B2LA 3HVJA 3BC1A 5IEJA 1SR8A 5DHPA 3R4VA 4NAUA 1C0KA 5CYPA 5IT0A 4IG4A 1ZN9A 2CBGA 2Q2VA 3D0OA 2DR2A 5JZVA 4B3FX 4BEWA 2A59A 3E2IA 1EHCA 1PJ8A 4K9PA 5IJWA 3KO8A 4OKNA 1PG2A 1AQLA 2WJAA 1DDOA 2R00A 2G3YA 3MT8A 2BTQA 2O0JA 3HG7A 3MHPA 4PYNA 4NKRA 1MR3F 3MXOA 1Q11A 5KYYA 4ES6A 5CG1A 4EL0A 4GPTA 3K0AB 3ESXA 6REQA 4UTRA 2HSJA 4GRIA 3MTEA 3SQMA 1NE7A 4V02A 1IN4A 2I3GA 1U6KA 2OOSA 5HKAA 3E5HA 3SDSA 4FUTA 4HLDA 3NT4A 4DQXA 1OROA 2WG2A 2WIFA 2YZKA 4RGYA 3BCHA 2YWXA 5K03A 1GSAA 4MUHA 4MWTA 3I53A 2BKLA 2RGXA 1TU3A 4MPRA 1Z5WA 4PTZA 1ZRHA 2O3TA 3LHFA 4LGVA 5IU6A 4RK4A 4C7BA 2I9KA 4UPDA 3W5IA 4CKWB 1HYHA 1QWOA 1LZLA 3ZIDA 3A37A 4C21A 4WPGA 1EWVA 1KEEA 1LGYA 1CU1A 1GU1A 1ZN8A 4REOA 4MDHA 4RTMA 4EKYA 2O6HA 1DTSA 1MJFA 5CURA 4KDFA 2ZVPX 5FHRA 3MRXA 1ODTC 4JGBA 1KZ4A 2F3UA 3ZCQA 2CF6A 4E94A 1HNXB 4AMUA 2XGMA 3U3MA 2QLMA 2E82A 1MNAA 1GR0A 1U0HC 4YWJA 1D2MA 4D4MA 3PLRA 3HB1A 3SXJA 2HD4A 1P9RA 3ESQA 3LC1O 4XX0A 3C4VA 4E6PA 1IHPA 3EGVA 7GPBA 2QZPA 1NF9A 4WADA 2YYYA 4INJA 1RFGE 4MB2A 1NI4A 1J21A 5K3BA 2CB9A 1CDEA 3FUCA 3ZLBA 3WGYA 1J0DA 2WKWA 3ZCSA 3OD1A 5JAHA 4DN6A 1C4WA 2TMGA 5LXTF 1XTTA 3K0CA 4TQ9A 5JLAA 1BXRA 2BPOA 5C1BA 2P79A 5FH9A 1Q0TA 3IPRA 5HA5A 1EFRA 1SUIA 3OPVA 3R5FA 3ZN2A 5HDQA 2R5WA 1NW9B 2DPYA 1LBSA 1XB2A 2XYVA 1XRJA 2HK6A 4F3TA 2OOKA 3BEDA 3WGZA 2IBMA 5IM5A 3KV3O 3JRNA 1HX7A 1QQ6A 1XDZA 2V58A 1VZ3A 3RC3A 2PT7A 2AR7A 3KXLA 1X9GA 1KIFA 2JFOA 4UTNA 4II3A 4HNAB 1SHLA 2X6TA 5GGYA 3ORQA 4IMRA 4YP6A 2BTQB 3FPAA 2F6RA 1CNMA 3GK3A 3ZCTA 3Q0EA 5EINA 2VUUA 1YVRA 1VPTA 4GYKA 3OIWA 4YRMA 3OZUA 4UUBA 2C9ZA 3K70B 2HT1A 1N2GA 1U2DC 4DG5A 2H63A 3OHPA 1E3JA 4N82A 1EG7A 3M2PA 2QMUA 1BEUB 3RV4A 1M83A 3DZHA 1XXLA 3C14C 4XM0A 3K35A 1PG5A 3KOOA 4NX2A 5DEIA 5ESXA 1ZN2A 1KK0A 4BJ6A 3FRIA 5C7OO 2I7XA 2D8AA 5LUAA 2CNWA 2FR8C 1DAPA 3U37A 1NVUQ 1W5BA 4GX0A 2BR3A 3UT5B 1ODSA 3WIBA 4BV3A 4AY5A 2J0SA 4PY2A 4CM9A 1GZVA 1QOQB 1XZHA 5J47A 5KOJA 1Z4KA 3PCRB 3RVMA 4J29A 4OJTA 1KFBB 1NXTA 3AEYA 4BO6A 1DBRA 1V11B 3W3AD 2I7TA 1WDWB 2GJKA 5AVKA 3DOIA 4XJTA 1PL0A 1RIIA 3DXZA 1Z13A 4QBFA 3D2AA 3BMNA 3RRZA 1FU7A 4PYKA 2ZIZA 1EFLA 1ENZA 1H1TA 4CEJB 2C4UA 4CM8B 2YH2A 5BW8A 3S2SA 1I2MA 6PFKA 3CX8A 5CNMA 1JRLA 1A8IA 2NP6A 2D54A 1W94A 5F35A 4KFCA 4MYRA 1GUZA 4G84A 1WOMA 2B69A 4DZZA 5CYGA 4WK6A 3T5MA 2Z8YM 1T5TA 1FOEB 4B6PA 4LK2A 4REQA 4XB6B 4Y7DA 2JGAA 4GVPA 4AC9A 1EXNA 3UA3A 1MB0A 4D26A 4M99A 1SUEA 3IUNA 1UPFA 2IVFA 1WA5A 3RBVA 3E22B 1B23P 1PR5A 2AXEA 1ZWKA 3LE8A 2EEZA 2N75A 2OAQ1 2YWDA 3L7LA 3LY7A 3NH6A 4RELA 5GZ1A 5ELXA 1JSRA 4X71A 5G4LA 1JLSA 1NYTA 2DT8A 1THTA 5DGHA 1VMAA 3CUKA 1NNLA 3RHTA 1ESZA 4XVCA 3G8YA 5DCWA 4TZ6A 4Y1GA 3AR9A 1C81A 2VRNA 1QIMA 1MT3A 2F7SA 1LS1A 3FLBA 1KBQA 4CIDA 3MGCA 4G24A 4CKWA 1TU0A 2H0AA 3MT7A 1GKKA 2B4RO 2O7VA 4LY9A 2ZUDA 2XE6A 1PKXA 5CLLA 1PR4A 4QFBA 2GASA 5AIBA 1JZQA 3GLQA 3MILA 1BH6A 1ZOIA 2OVBA 1ZLYA 3A6EA 1TM3E 2XZPA 1Y89A 1C4OA 5MDHA 1V2GA 1NNI1 3EB9A 3LDGA 1NMSA 4HXFB 4PRKA 1N34B 2IBTA 4FINA 4KE9A 3U60B 1KRHA 1NW3A 3ROTA 4QDJA 1GL7A 3OFKA 5H80A 5EIEA 1I30A 2G09A 4ZXFA 1HDIA 3LTNC 4ZO4A 4LFBB 1B43A 1TAUA 1JA9A 2ZUUA 1Q1GA 3T61A 4CRWB 4PS0A 4AJNA 1YJ5A 1C0IA 3TM4A 2XD9A 5ICGA 1PGNA 5JC8A 1W46A 3B7PA 1Y3AA 4FDAA 2GRAA 3FKJA 3GLUA 4H7FA 1H8HA 4ZC8A 2J0EA 4MKIA 3NAZA 1QYIA 4Q3NA 1XAHA 4EX6A 1OX6A 4ILKA 4YBRA 4YWHA 2VEOA 2FI1A 1G7SA 3R44A 4QUHA 2OK8A 4N7MA 3TL3A 4E2YA 1XE3A 1Y6GA 4M1WA 5TNXA 2W7TA 3UXEA 3AUKA 1QHNA 2HA4A 2PS9A 2RHRA 3EZXA 1GCAA 1T8YA 4TV8B 5DKFA 3NHKA 5FLYA 4C30A 3RU2A 4BMPB 4ZTBA 3RROA 1M2EA 5JDIC 3A1EA 3EMVA 3CVXA 2V1UA 5HK8A 3V97A 4C6TB 1JKJB 4B3BA 1M0SA 2ACVA 5IH7A 1Y3IA 5B58C 3NGMA 1BFUA 1MB4A 3IUJA 1M74A 1OY1A 3O8OB 4D4KA 4C3VA 2P0AA 5BWCA 3ORSA 3E5RA 4MYSA 4XM2A 1MABB 5E6RA 3IOBA 4XAQA 4QQNA 2NVWA 3ENZA 3SS9X 1SCIA 3MTBA 3R20A 5CH8A 1XZAA 4OH7A 4TS9A 2CC2A 5D5HA 2HU7A 2I8CA 1RI4A 5CJPA 3V7WA 4EG1A 1N6PA 4FB4A 1B26A 3X1JA 2FW7A 3LPCA 3F90A 4TX1A 2QKYA 3TSWA 1FLDA 4EHAA 3QI2A 1QK5A 2VPQA 4O2BA 2EJWA 2P4SA 5HBGA 1E2MA 1FYEA 2FFJA 3I28A 1DKLA 4KLAA 4K7JA 4B6SA 1Y82A 2VN8A 4YY3B 2R48A 1NNEA 1SZDA 4O63O 1CP2A 2GDJA 2P0EA 5L8VA 3NR2A 5BR1A 3IMFA 4O33A 3WJAA 1IAQA 1X7ZB 1G3IA 1YU9A 3SYKA 4DT1A 3AKDA 3W8NA 1ADJA 2R68A 1GCIA 4HQLA 1YIOA 1XRNA 2YXEA 5K0LA 4PSVA 2CF5A 1OVGA 1A5SB 1LI4A 2WMOB 1JVNA 3BTOA 4COOA 3GLFE 5CM8B 4DRXB 4REQB 1JXOA 4R8VA 2GEKA 1QCCA 1ZIPA 1QCZA 2J85A 2A7XA 3TQSA 4WKPA 2ERXA 1YK1A 5LQCA 1GSHA 1Q15A 1USUA 2P3QA 1UF9A 1C9YA 2ETVA 3LF2A 1L5HA 2CFTA 4ZHSA 3RF7A 3KLMX 3P96A 2JD2A 4RTLA 4XWYA 1A71A 5IM4F 2ZRFA 4KQCA 3H1FA 1JIVA 2FMXA 1A04A 2IY7A 2ODQA 5AM1A 2QW8A 3VR4H 1NWCA 1EX6A 3G9QA 3JQPA 5EJMA 5IP5A 1N5JA 3F6BX 4X60A 3F7OA 4M0UA 5JZBA 4MR7B 3GVHA 3A31A 1N5MA 4GR9A 4UEKA 3WLFA 1PP4A 2VT7A 3TB6A 1LC3A 2CMFA 1RZRD 3SHQA 1EGQA 1SM4A 2DU8A 3HI4A 1NQWA 1Q0PA 2CCGA 1R16A 3D4NA 3NTQA 1GAWA 4EY8A 1SWVA 2HJSA 5FWYA 3TLZA 3OLVA 1H9CA 4BVAA 3RADC 1VYVA 1C0LA 2GZDA 3O4JA 3H9JA 4CCYA 2BSAA 3UG7A 5CGZA 5KNCA 3QE2A 1UBSB 3I62A 1XUOA 2VUIB 3HADA 2PGJA 3CTMA 1WL8A 2WJHA 5EE5B 1EM8A 2V97A 2MYTA 4RJLA 1IULA 1VECA 1XYYA 1E9BA 1WQ4A 1N25A 1Z45A 4HQ0A 4D3ZA 2JC3A 3EK2A 1GGKA 3P1JA 5K0FA 4EFNA 2QY6A 1DXQA 2NYVA 2JI9A 5GADl 2IRWA 2RHGB 4Q6BA 1GUDA 5F12A 3E82A 4R2JA 3HY3A 2VJNA 4NBKA 2CXRA 3OU2A 3W6OA 4BPBA 1CLEA 2B1RA 3GT4A 1QO7A 1X8KA 4MAAA 5CU7A 3V42A 3I64A 3H3FA 1GWNA 2XMCA 4XI9A 3KEFA 3USES 3EG5A 4CHTA 3ZVNA 5CXSA 1KBZA 3Q5EA 1DCFA 1MXFA 3HXMA 5IBPA 1WDTA 3CS3A 1PX2A 3D6NB 2H0QA 3NTRA 2XA1A 4A8PA 4OCZA 4EFLA 2QTHA 2W71A 1A96A 4G23A 5JE8A 3KFVA 2PBFA 4PX9A 3QOXA 2L69A 5BSTA 3L6BA 4IIYA 1T2VA 1N2CA 3T7IA 3L6DA 2A86A 3I92A 3TZBA 2V6GA 2ATVA 1VJGA 2NYUA 3BXPA 3K0HA 2JD1A 3L8EA 3KLOA 3CG4A 2DR0A 5AK4A 2F59A 2HLPA 1RWOA 3BWXA 1MU0A 2WF9A 3DG9A 3MWGA 3JZIA 2Y1WA 3H2YA 4HWPA 4AZSA 1KJNA 4LKOA 4IZHA 3TLYA 3GLIA 1XA0A 2ID4A 4F3RA 5EYPB 4U6NA 3AJEA 1CP3A 4HKTA 2V7XA 5HBRA 1NL3A 5IJXA 3KYDA 1ID1A 5AKHA 3TRIA 1NUUA 2YHBA 2AF3C 3KD3A 3U4QB 1GZHB 1VHQA 2J3LA 3D3JA 5FPSA 1DO0A 3VC1A 3EXFA 1TT5B 2R8XA 1XVVA 2VHCA 3GZJA 3NXSA 1OCEA 1U8XX 4JLUA 4WBXC 3IJRA 5ALGA 3RIYA 5CVCA 3U3XA 1E6EA 4BGVA 2GUWA 2IHTA 4YAWA 3PG5A 3L8HA 2BF7A 1WD5A 3SE0A 3RKSA 2EZUA 3Q1KA 4WLEA 5AVVA 2RHCA 1ZOOA 4DB2A 2I2CA 1NVEA 3VDRA 3PE6A 4W9RA 1KNQA 2PY6A 2ZDHA 4NIMA 1TK3A 3GJ0A 4S12A 4EVQA 1W36C 1H1DA 2Y1OA 3O3MB 3G79A 1KZGB 3G9ZA 4J9VA 2P2LA 1F8XA 4KZKA 2PBZA 4TZTA 4B3CA 4BV2A 4HDRB 4B48A 2QTLA 5ALOA 2N42A 3CSUA 1S8NA 1WCIA 3RVRA 4DC0A 1KZ1A 3INNA 4R9SA 4XVQA 4EFDA 1J07A 1BE1A 1EA5A 3NHJA 3OQ6A 4RTNA 2PQMA 3EN0A 4FBGA 4M36A 5C2JB 2Z8ZA 1UBLS 2ILVA 6ADHA 3AHFA 3HDQA 2R66A 3B6ZA 1E5QA 4CE6A 3BFKA 4DVJA 1YH3A 1YDGA 1JA0A 2W11A 3DWEX 4LRWA 2AN4A 2C5HA 1BJTA 5EE9A 4CLHA 4D3FA 4ZV4A 4NLLA 5EQJB 4LN1A 1U11A 2QYSA 3SC3A 4PNEA 5LP6A 1Z2OX 4D92A 4CQMD 2YW2A 4N0EA 4R31A 5IN4A 2GNAA 2FPPB 1X7XA 3PRHA 4LRQA 3ROPA 3TMKA 3LSTA 5K3AA 3IT1A 2EGGA 4OHVA 4QASA 5JZ9A 1KR5A 3INYA 4PX3A 2PX6A 3RS9A 3ZCVA 1P7VA 1Z75A 2QXYA 3G0IA 4ZOBA 1U3TA 3ISTA 4ZO9A 5B2FA 1RHKA 1U0GA 3HB7A 5LN1A 1KOJA 3PE3A 2DG2A 5JADA 1I7LA 1XTVA 5KNDH 2H2IA 1VIAA 2IEBA 5AFSA 3BEOA 2Q1XA 3IT3A 1Z3CA 2P1ZA 1MOZA 4ZZ3A 1MJHA 1OKKD 2QQ5A 1F14A 1HQDA 3N70A 2DYKA 4S2EA 4XWOA 1ENPA 4Y98A 5FF9A 5LJIA 3ENQA 4J2OA 2JAWA 4EMUA 1XGKA 4OP2A 2VPXA 3OJEA 1OQAA 4S0XA 3H9EO 3OECA 1C7EA 3OY7A 3O3OB 1VJ0A 4PG5A 2HA5A 1BQEA 4V3CA 4OOEA 4WZBA 3BSFA 1IJKA 2Q0SA 1T13A 2I1WA 4R84A 4XM1A 4QTTB 2P2GA 2AMJA 2I66A 4BQEA 1M2FA 1P91A 4GKVA 4B0PA 5CD9A 3SN6A 4F6RB 2D2EA 1RQ7A 1YDEA 4B4KA 5EIBD 1IC6A 5IDWA 4GIBA 4E7OA 2AC4A 1JR3E 4GDMA 3EUEA 2Z1MA 2JEZA 3QBVA 4X1OA 5DK4A 4JKYA 1W88A 1YB1A 4WCFA 1WB5A 3NTVA 3EVBA 1E9RA 3IODA 3TEJA 3ZV7A 2PS0A 2YXPX 4WXHA 4CM6A 2O8BA 5K3SA 1WHTB 1E9EA 1ST3A 2C7BA 2WDZA 3UK1A 4YCJA 4AIRA 1CEYA 2Q9AA 4MH0R 4IILA 4W8HA 5B6PA 1SO8A 5BO5A 1F9EA 4YX9A 3JQ8A 2PSDA 4JI0B 1Q77A 1LA2A 1VL5A 1LDBA 3EPKA 3EJ6A 4GRDA 1WRBA 1CC1S 2Y1GA 2RDMA 4HOYA 4URZR 2WICA 1WB4A 4YGYA 4A8JC 4A5SA 2CL5A 1GOTA 2O2EA 2NYAA 4LK3A 2B99A 2Z5GA 1EUDA 3ECSA 3R5SA 4HDNA 4TOIA 4UZEA 3TVDA 4DV2B 4PN3A 3AF0A 5KSWB 3FAKA 3O82A 3AXSA 2BV3A 2ZULA 3C7DB 4CKEB 4NDZA 2YJGA 3CW8X 5JWOA 2E0IA 3U0BA 1T8TA 2JGLA 3BD8A 1YKSA 4G0WA 1LK0A 3ORRA 4O25A 3OPYA 4BRSA 3LBIA 4BQFA 1TQ6A 2YMPA 4JC0A 4YRPA 2PMDA 2UV8A 1URPA 4BL5A 1NF3A 4HDSA 5H16A 5LC1A 3RS0A 3CEAA 1IL0A 1SG6A 4HG2A 1AK2A 4TM7A 2FQQA 3COZA 5FXMA 3U0VA 3QVXA 5TQ0B 3SIPA 2OXEA 1PD0A 1QWSA 4R3WA 5DM60 1U2EA 5KEIA 2AOTB 2O3SA 2OCGA 1JE1A 4QU0A 1RZ3A 2QPTA 4ND1A 5KAPA 5LQNA 4X44A 1PD1A 1SB9A 2QNRA 3LUDA 2CLIB 3K6KA 4HAIA 2OXCA 4EEKA 5CB8A 5IAKA 1HT1E 4EITA 5CLJA 4KQGA 2PMKA 2BUCA 1I33A 5F73A 3QLUC 4M21A 4LDNA 1HK7A 1W85A 2G0TA 4EHFA 2XVYA 4JUIA 4QFDA 1NTOA 5CEFA 5JXGA 2QQGA 3WMRA 4AYTA 3BXOA 3I9JA 4YRLA 2XODA 2D59A 2JI6A 2OYCA 1L4KA 3QNUA 1DJNA 3U26A 3VR5H 3H8JA 4ZAWA 3CWQA 3TLGB 4YIHA 1MOPA 3K53A 4EEXA 1TEXA 4XUGB 4G0XA 4C7MA 3VR2A 2HQSA 3GFQA 4Y2HA 4L6CA 2IX3A 3DCYA 4PHFA 4JYMA 1GPKA 2AOWA 5DN6D 2PBRA 5JEDA 1CY4A 2ZM6B 2PUWA 4CUZA 2R60A 4AWAA 1P7YA 3RRYA 4DZRA 4PN7A 3RSSA 5AESA 1JEYA 5GZ6A 1Q84A 1A98A 4WKOA 4IXNA 4Z99A 1I7SB 2EGUA 1P4RA 3GAMA 4FYVA 4CCSA 2X5NA 2P9ZA 1T4GA 4PXYA 1CUFA 4B4VA 4CGYA 1XU9A 5DHFA 3D3EA 4ZCPA 3S29A 2CXHA 3V4PB 3JARB 2WOOA 2BN4A 2CNKA 4NCNA 5CCEA 1RRGA 4E7PA 2PKRA 2FETA 2YCBA 3T5CA 2BGJA 3IP3A 3RQSA 2H4JA 4DSUA 1C0EA 5JMOA 1NJ2A 2C7QA 1B14A 2HYDA 1E1CA 2FSVC 1YC2A 4CQMB 1CG6A 1YA6A 3DMDA 5CW2A 4UULA 1QJ4A 4LQDA 1J0EA 3OZAA 1K3UB 1Z37A 5F77A 1KMQA 4HI0E 3MCVA 4MRAA 2ERCA 4HWSA 3DFIA 1QAOA 2QRGA 2ZEJA 2R7NA 3FVVA 4A27A 2J41A 5IZCC 2DWPA 3VNAA 4W5RA 1ZRNA 2VTDA 2P1RA 3D9QX 1VBFA 2Y2UA 3ND9A 4WK0B 2R11A 3OKCA 3RC2A 1BW9B 1JJ7A 2ZJ3A 4ASUA 4CLRB 3M0EA 2VF7A 5LBIA 1Z8NA 3ELWA 4R6XA 2NU7B 1KJZA 5B1EA 3IJPA 1MGPA 3OSUA 4IQFA 2Q62A 3ZKWB 1VJCA 3A2KA 4ZCQA 3VXKA 5JY6A 1Q7CA 1OLUA 2GGSA 3OZRA 4KVAA 3TJZA 1T4CB 2NVOA 3OQIB 3CRZA 2XOKA 1EXDA 3AETB 3TMAA 2P5YA 5DRYA 5CD1A 2QD5A 4RTPA 2P69A 2ZRQA 3O5AA 4QRDA 2HREA 3K1AA 2RMKA 1V11A 2QS9A 3AY7A 1HI9A 3E9MA 2X0IA 3N2LA 4FIDA 4M1SA 5JSKA 1OOEA 2QTTA 3MS7A 3NAQA 3GL9A 4DTIA 4EGCB 2JS7A 5TGTA 3UMCA 3ZLVA 1T6NA 3ZUPA 4GQAA 1C9DB 1FRNA 3DCIA 1Q5PA 4CYMA 5EFOA 1D4AA 4CMHA 1Z47A 4TLEA 3A06A 4D8YA 4LPKA 2R47A 2WRZA 1XAIA 1V95A 4FU0A 5ALIA 2GFHA 2PGNA 1CW2B 1Q19A 4E2WA 4JA2A 2YV1A 2DAPA 4KO4S 2BTOA 2Z57A 3SF8B 2VH5R 4HB2A 2EF0A 1WPQA 4IFIA 1Y6FA 1T5HX 1L1FA 4EDHA 1CBUA 1FVXA 4O3FA 1EFRD 1NLUA 5H5JA 3DEAA 4I55A 2JHFA 3GFRA 3UC5A 4QUIA 2BRUC 2CVHA 2HMYB 1C7FA 2YNMA 3K73O 4K9KA 1HQKA 2AJ8A 5GOTA 1EGHA 4BVEA 2EFCB 3CO5A 1GD1O 1TE2A 1U5AA 2BZ1A 3BSWA 2IEAA 2AFHB 4LNUA 3K9GA 2I5PO 4P3PA 4YLGA 3C1TA 5BQPA 5EJ6A 1U0BB 1K8XB 3BE4A 3FR8A 4K9DA 3G9XA 3BWMA 3KOYA 4KQXA 5ICCA 1Y4SA 2A5FA 3BMQB 4Q34A 1FDUA 2YWFA 4O8ZA 1NYLA 1K2WA 4GU5A 5FA6A 3VC3A 4WASA 4X3PA 1A8UA 1E9AA 2VIIA 4WECA 4EI2A 1QH9A 2YIMA 3QPBA 1GNQA 4EY4A 3WK9A 3UJ7A 5TQ2B 4L8GA 5IX8A 1Z18A 4R69A 1C1HA 1G19A 1ZONA 4Q3DA 5FUWA 3TX6A 4C4XA 2QT0A 4JZKA 2H08A 4NULA 1TU4A 2G0NA 4XQ0A 2WUFA 5BOVA 3T41A 1J24A 3W05A 1ICIA 1Z6ZA 2EZ4A 4GH5A 2NN3C 2IIQA 3GJ6A 4LVOA 1RSZA 2A84A 4YNBA 4E5PA 2BM9A 3PHHA 1MPTA 1MO6A 3EY9A 3ZXXA 3SBEA 5KVCA 2E18A 2DFKB 1H93A 3LCMA 4CDGA 1R0BA 3IEKA 2DUJA 3K9WA 4MWGA 1I4EB 1X8LA 3CUSA 1J2JA 4NJMA 3COJA 4Y1RA 3BUSA 5I5EA 4I1SA 1QH0A 2GZ2A 4PCAA 4UBNA 3ASZA 3ZDCA 3ZHYA 1GCUA 3FYSA 4K87A 4LGYA 2O8NA 2JG3A 1ZAKA 2YFHA 2OSBA 2WKRA 1MIOA 3L7NA 1PHPA 4MVJF 4NYMQ 4U7HA 5LZ4A 3U2QA 5FUMA 3WAJA 1I7NA 1RACA 4UE2A 4Z7JA 3TR6A 1OT3A 4YQYA 4M7WA 5M7EA 3HDYA 1BE0A 5KYUA 3WYCA 4DRZA 1FQKA 4LNUB 4V0SA 1QGOA 5B3JA 3PTAA 5E7JA 2HDOA 1G7CA 1HL7A 1TVMA 2Y1EA 2IPAB 5D7BA 3AIMA 5A02A 4PHTA 1II8B 3F73A 1ZR4A 1T26A 2J6CA 1T43A 1MH9A 5BSRA 3SHTA 1FP2A 1D5WA 2QLLA 3TD9A 1DOHA 4H1HA 3BD6A 2X9NA 2AT1A 3EZ9A 1SG9A 2Q4EA 3CLTD 4KVZA 2HSWA 3T9BA 4G26A 4PZEA 4XSGA 4GL2A 1P75A 3BWCA 3PHGA 2NUTB 4GKJB 5JJCA 1CZOA 3H5IA 4BNHA 1K5DA 3JQBA 1M6VB 5CB4F 1ADYA 5EJ5A 1KHHA 2QD1A 3M7IA 3N39C 3P2KA 1RTKA 4TKUA 4XIFA 3O8NA 2YV3A 1PJBA 3BWBA 1ACJA 1E69A 3F0TA 1SC3A 2RI6A 3HKBA 3MWEB 1UDCA 3LCJA 3UCXA 4ZALA 4C87A 1JDTA 4D4IA 2W5UA 3NC1C 3TZLA 2AF4C 1LS6A 5C8YB 3WDMA 3HL4A 1GV1A 2A9FA 3A26A 4E1VA 5IASA 1TQHA 3HNPA 4YJKA 3Q2OA 2QMQA 4I1OA 2V8BA 1B8PA 5A4IS 2OECA 3GROA 4OO3A 4B3MB 4H0FA 4Q1EA 5JZMA 4GVLA 3RS7A 1Q7BA 4NPCA 1MT0A 5EI5A 5F2EA 3L07A 3T38A 4YT4A 2VVTA 4O1HA 3VPSA 3KVYA 2G4LA 4AG3A 5HRAA 4BIMA 4GPAA 3TDMA 2E9SA 1EP2B 3TE6A 1USWA 2CGEA 5L4NA 4OXRA 2I54A 2OG2A 4WFIA 4E2FA 4JLPA 3H7AA 4Z4CA 1FSZA 3MBOA 4JWKA 1HFKA 2ZIVB 3HVIA 1C30A 2JARA 3E7FA 4XJVA 2YFYA 3PFCA 3DW3X 1QG6A 2JL1A 4UU8A 1VKHA 2DH5A 3RVKA 2XMQA 4O2BF 3UAGA 1WW8A 4EATA 5KYGA 3GJSA 3QFSA 2WHEA 3HYLA 1YL6A 4D45A 3KFLA 2P11A 3SK0A 1AQNA 1KETA 1T8PA 3TMYA 1H4QA 2HBYA 1QFZA 4KRGA 1DX9A 2X7XA 2A0YA 1KSHA 4FUQA 1N0VC 1XTIA 1GL9B 4ILEA 4E5SA 1BMDA 1HL3A 2BBOA 4IJKA 3HKDB 3BB1A 4NICA 5FUXA 2X8LA 2C2HA 2KJQA 3A8TA 5IH3A 1RAIA 3JW8A 4MW0A 1WDKA 4OHPA 4B46A 1IWOA 4MR8B 1J8DA 2D0PB 3TUJC 3PQFA 1NFQA 4CNBA 1JF8A 4L3VA 4QYTA 3U39A 3V6MA 4GMFA 4Q21A 1SVMA 3PDJA 5JO0A 4MWCA 1QKIA 1F0KA 4HNSA 4QSHA 1G8FA 3W9BA 4J16A 1XL1A 5I9LA 4NZPA 3L1HA 1DARA 1PJ3A 3A4IA 4EPTA 4NOJA 4AICA 3C1OA 3M49A 2RD2A 4B84A 2BFCB 4JXKA 1E7SA 4KLZA 2BAGA 4MS3B 3UHAA 1UC4B 3P26A 3K20A 2I80A 2ZE6A 4QUJA 1YQ9A 2ZQYA 3EWIA 2C7OA 4QXRA 1T9BA 3DQPA 4YJHA 2O05A 4NZNA 4Y9RA 1A9TA 4LW8A 1YVDA 4L5BA 1J0CA 2RH4A 3DHEA 4BBZA 1J8FA 4MP3A 2QN9A 3NTUA 1GUAA 4R9UC 3PHBE 5AR1A 1L5WA 1UJ5A 5IKPA 5FOSA 5EVCA 1U0SY 3P0JA 2I6UA 3I73A 4WGFA 4JENA 1QQTA 3UUWA 4C78A 3HYCA 1LPPA 2CNLA 3RU3A 1V1MB 1T1RA 2PM8A 4KQ2A 5BQ5A 1THMA 4RE6A 1X7XB 3WAGA 2J1LA 2AOXA 4MA5A 2UZIR 4HUQA 2HDNB 4HWGA 3TRDA 1J0BA 3KAQA 3AFIA 5F64A 5A9SA 5L3VA 4Y9SA 3L6OO 4CU5A 1DWQA 4L9RA 1CHNA 4P84A 2ZVQX 1Y42X 1QONA 5JNLA 3H84A 3Q85A 5F2OA 1L5MA 2JFVA 2YVAA 3KFXA 1PNQA 3GT7A 1KEEB 4H77A 5IW8A 2MCFA 3ZGXA 3UENA 3OJFA 3RR2A 2JIBA 2R1TA 5I7UA 2Z0MA 1ZSNA 2ACEA 1J6UA 3H97A 1N0UA 1CRPA 4I9UA 1AXRA 2W8ZA 4PAQA 4ZVLA 3SY8A 1E4EB 2GRUA 3PPVA 3KSMA 4BTEA 4R98A 4ETMA 5C81A 5JTTA 1ESEA 1XI2A 3OU7A 3INTA 4TV8F 2TS1A 3WGNA 2YWBA 1G5FA 1PVVA 2JAOA 2QR3A 3QLVC 2X0NA 5JVDF 3ZG6A 1O4WA 2UUOA 4QDKA 5ELMA 1IN1A 3M1IA 2H65A 2PV0A 3ESBA 1LD3A 3AP1A 4AFNA 2W2KB 2XE7A 1XNRB 4RHUA 4B9AA 4NZ9A 5A5GA 3TQTA 1N9ZA 4D41A 1Y7HA 1Q57A 5FFFA 4ZZIA 1FUKA 4HGZA 2B98A 1IWPB 5MGBA 4DNQA 2IZ7A 2I6TA 1G21E 3KKMA 3TLMA 1XOIA 3EXHB 1EAYA 1G5TA 5L4SA 3RSZA 4B34A 2HCRA 1ZVKA 3BULA 4MS1B 1G2OA 1O54A 2EARA 3H86A 4U9UA 3MD9A 3LS2A 3THOA 1YZGA 4PFJA 4F3YA 4G86A 1R0CA 1XVAA 2HJ9A 5AJTA 2NQTA 2FRXA 4A23A 1HM5A 4I5EA 4A8HA 4FEAA 1HRDA 4OMUA 2IH4A 1J00A 4P3OA 2XDWA 2BGKA 1PNRA 3UMGA 1T9HA 4LZJA 2FMUA 4IJVA 1D4ZA 1P4AA 4WESA 5ECYA 3V32A 1H69A 4NYIQ 1FFBA 1I3LA 3VYVA 1JG6A 3TKYA 3DYBA 2W6OA 2ZBDA 3ETGA 3KV1A 2ALJA 1WABA 1KO8A 5CMLA 2VH1A 1AT1A 5FO1A 1QIHA 1BTOA 4OQFA 1IY2A 2P67A 3JZMA 4FC7A 1YI1A 3LC0A 3OF2A 1CVIA 4US2R 2MR6A 3N5KA 4H16A 5EPOA 4KSBA 1RXVA 4ZOLB 1X2BA 2PPVA 1ZJ5A 1XLWA 3BGOS 4EJSB 3PKIA 1G3UA 3IKTA 3QHPA 2W2TA 4X64B 1V4BA 5HCIA 3RS2A 4ABTA 1QS0A 4DIEA 2RAVA 1GPUA 1LLFA 1K0FA 1A1VA 3VNBA 3BMXA 3PWSA 4KX5A 5C3MA 5KMGB 1OZHA 3KUCA 3Q12A 2IH2A 3MTIA 1JNXX 3P0FA 3KJEA 4WI1A 2OC9A 3VUFA 2ZJ4A 3LFUA 4FFNA 1CY7A 4WN3A 3JQ8B 1YZUA 3TSYA 2JBAB 2NV6A 1NX6A 2VWPA 2H11A 2QMZA 3OE1A 3C5VA 3IHTA 3L93A 4JVMA 2WG0A 4OFWA 2QPAA 1TCUA 2C2KA 3AERA 3OETA 4ZO8A 4CI0B 4P33A 4BS9A 1LH0A 2JCXA 2PKXA 4FFOA