3AFIA

Crystal structure of dbja (his-dbja)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
308
structure length
301
Chain Sequence
IRRAPVLGSSMAYRETGAQDAPVVLFLHGNPTSSHIWRNILPLVSPVAHCIAPDLIGFGQSGKPDIAYRFFDHVRYLDAFIEQRGVTSAYLVAQDWGTALAFHLAARRPDFVRGLAFMEFIRPMPTWQDFHHTEVAEEQDHAEAARAVFRKFRTPGEGEAMILEANAFVERVLPGGIVRKLGDEEMAPYRTPFPTPESRRPVLAFPRELPIAGEPADVYEALQSAHAALAASSYPKLLFTGEPGALVSPEFAERFAASLTRCALIRLGAGLHYLQEDHADAIGRSVAGWIAGIEAVRPHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloalkane dehalogenase
publication title Enantioselectivity of haloalkane dehalogenases and its modulation by surface loop engineering
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Hydrolase
total genus 107
structure length 301
sequence length 308
chains with identical sequence B, E, F
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2010-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3afiA00
2Y6UA 4B7ZA 2G5TA 1IUPA 1LPOA 3R3XA 3DKRA 3G9XA 1EX9A 5AH0A 5AM2A 3FVRA 2RGUA 3WJ2A 5FKJA 2XQKA 2BGNA 2WU4A 2CEKA 1YR2A 3LLCA 4L9AA 5HFAA 5LLSA 1XRNA 1XZJA 4HRXA 5ALTA 1W6RA 3GROA 4QDTA 4BAGA 4MWSA 3I1YA 4Y2VA 4DMFA 3ZV7A 3CXUA 1LPMA 3G0DA 4BC1A 3AJAA 2J4CA 3ZLUA 1ODCA 4BATA 4I3FA 4J3JA 2Z3ZA 3F98A 2XMDA 5CXUA 4BVLA 1DWOA 2QMQA 3WZLA 5BWBA 2HM7A 4Y2YA 2XUPA 5FPQA 3ZPXA 2C5FA 3FCYA 3E3AA 4N5HX 4QWMA 2H7XA 3DD5A 3I6MA 3PE6A 3BE8A 1CVLA 4HAIA 3V9AA 4BP9A 5AI8A 1MN6A 3QVMA 5JAOA 3LS2A 2XMSA 1XRPA 2HRQA 4UUQA 1W75A 3DS8A 3C70A 3G0BA 4HVTA 2XUGA 2GZRA 5AM3A 3RK4A 1UK8A 1QIJA 2D5LA 3L1IA 3R40A 4WFIA 4PW0A 1A88A 2CBGA 1G42A 5ALFA 3V48A 1YAHA 2PUJA 2WHPB 2HL6A 1F8UA 4BAUA 2LIPA 4IH9A 3SC2A 1NU8A 3E4DA 4UFNA 2WUFA 3STUA 2HRRA 5HF5A 4LXGA 4LIPD 1MX5A 2BAGA 1R1DA 2WHRA 4G4JA 2X5XA 3LCRA 1U2EA 4C4YA 3WKAA 4GI1A 1WHSA 1MU0A 3I6YA 2BJHA 2HU8A 3G0IA 3WWPA 5JADA 2JIDA 2ZSIA 1ETHA 3G7NA 3C6BA 2WIGA 3ICVA 3VDXA 4YPVA 2BGRA 4BB0A 1JI3A 2IITA 2WHPA 4H0CA 3DDUA 4X85A 4AQDA 3EIOA 1WPRA 1X2EA 4BDTA 5DLPA 3FYUB 4H7DA 1MAAA 3C45A 5BWCA 2ZYIA 4FBMA 1ZJ5A 4G8DA 4C87A 4F60A 2ZYHA 3HABA 3TEJA 3VJLA 3HYSA 1BE0A 4EZIA 4I4CA 3H2GA 4AN1A 1TQHA 4TPKA 5AM1A 4BAZA 1YA8A 1CUGA 4UBNA 2RI6A 4H7EA 4N8DA 1QIMA 1P0QA 3A6ZA 4U2BA 5CRIA 1KEZA 4UHCA 5HF9A 4FOLA 2QUAA 1H22A 3IDAA 1Y37A 4QLAA 3FYUA 1GXSA 3AZQA 1LPNA 4OPMA 1AURA 4Y2RA 2ORYA 2DQYA 3G9TA 4Y2QA 3F97A 1K8QA 1BROA 1WOMA 1MT3A 2WIDA 4EB0A 1QO7A 1UK7A 2E3JA 4BZZA 5ALNA 4C6HA 2X8BA 5HKAA 3ZLVA 5FV4A 2DHDA 3G0GA 5FP0A 1XKLA 3WL5A 5KREA 3A70A 5K3DA 4K6KA 2YXPX 1VXOA 3IUJA 3E0XA 2HA6A 1QIEA 1QIKA 3A2NA 2RAUA 1CRLA 2WLSA 4XX1A 1EHYA 2DSNA 4W63A 2QT9A 1J06A 5T4EA 4AO7A 3QYJA 1N1MA 4XIIA 3QM1A 5JZBA 4DNPA 3ANTA 4OYLA 4HZGA 3WZMA 1K6EA 1RYYA 2WILA 1CR6A 3TRDA 2PU7A 5CT8A 3QMVA 1WB5A 3WWCA 2QTBA 1QTRA 4GEGA 2WQZA 5A7GA 5LKAA 5ALHA 5DNVA 5JASA 4BRZA 2XUQA 5CT5A 1WM1A 4B84A 2QUBA 3DLTA 3RLIA 4TGLA 3WK5A 3C6XA 1ZD2P 1FFAA 3KWFA 5CT4A 2VSQA 1FJ2A 1ORWA 1WB6A 1JKMA 3BL8A 1OCEA 4DSAA 5JAUA 2XUDA 2QS9A 4LKOA 3O95A 1VA5A 2C4HA 4M0EA 1CUVA 2WG0A 2C0QA 3F9CA 4WY8A 1DT5A 1P0IA 3I2GA 3QPAA 3GELA 1H2ZA 1XQXA 3FNBA 5ALDA 1HL7A 3IA2A 4X6UA 2HDWA 5IH7A 4ZREA 4UBKA 3AUKA 3FAKA 3W04A 1A7UA 1QIDA 1Q83A 5F4ZA 3GFFA 1E5TA 5CW2A 1YSCA 2XUAA 4OB7A 3W05A 3F8SA 5JZ9A 3C8DA 5JANA 4G8BA 1IUOA 4UBMA 5CBKA 3FWHA 4B85A 5E4YA 1XZAA 2XMRA 3D59A 4FHZA 2XMQA 5LZ8A 3V1KA 1R88A 1T2NA 4U2CA 1XLUA 4G4GA 5ALLA 4JEIA 2XQIA 4P93A 3WKDA 6YASA 3V1MA 3UMJA 3WMRA 3V1NA 5CH3A 5DTIA 2VT7A 4KAJA 1F0PA 3QH4A 1CLEA 4CG1A 4Q1VA 3IUMA 1BRTA 3VISA 4GXNA 3ZI7A 2HA2A 3AFIA 1NU6A 1SCKA 1J1IA 1JJFA 2HA5A 3FLAA 4MEBA 2W6CX 4BTVA 3R3UA 2JGIA 5LKRA 2AXEA 4PQEA 4KYVA 5HK8A 3NOXA 2GBGA 1W76A 4CFSA 1ZI8A 3S2ZA 2ZJ6A 3ANSA 1K4YA 4W9RA 2DR0A 1UWCA 1UZAA 3FYUC 1YAJA 2OPHA 1EXWA 3I2IA 2C58A 2ZJFA 4FLEA 2R11A 5C81A 3LP5A 4O08A 1AKNA 1FFCA 2PL5A 3HC7A 3DCNA 5HK9A 1CUCA 3B3QA 1MX1A 3O9VA 3B5EA 1VLQA 1XQVA 2PSJA 4KE6A 3DKKA 3QBJA 4CG2A 1VA4A 1R50A 4A5SA 5FUMA 4U2FA 1I6WA 3ZWQA 2I3DA 1DWPA 5BV7A 4B82A 1HBJA 4Y2SA 3C5WP 1BCSA 3H2KA 4UBOA 4AX4A 4J0JA 2C5GA 3WQHA 2HA0A 3WWEA 2HADA 3O0DA 1IZ7A 1DU4A 1XZBA 3HZOA 1CV2A 3WJ1A 3WA6A 2VJAA 2GBCA 3D5EA 2B61A 3DYVA 1ACLA 4FFVA 1J07A 4S0XA 4OUKX 1MJ5A 1X2BA 5AI9A 5AK6A 3DQZA 4Y2TA 3AILA 1QFMA 3L1HA 1UOOA 4KE9A 2H7CA 4OB6A 4J0CA 5LIPA 2WTMA 1CUDA 1ISPA 2GYUA 2BFNA 1X70A 3I2HA 1HQDA 2CUTA 1ZGBA 2JGFA 5AOAA 4G8CA 1J2EA 4J0IA 2WJ6A 3DL4A 1LGYA 4OU5A 5ALSA 3Q0TA 5ALJA 2BUAA 1SC9A 5JZSA 1ORVA 4PSDA 4ZWNA 3STVA 2ZVDA 4KACA 4IHAA 2JGMA 2PVSA 4BE4A 5JYCA 1MPXA 5AI4A 1CUHA 3OOSA 5CH8A 4A16A 1JMKC 3QZUA 4FLFA 3WIOA 1AUOA 4BC0A 1QIIA 5A2GA 2Y6VA 1U4NA 1JJIA 2AJCA 5LZ5A 3RARA 2VJBA 3MGAA 3SX4A 4BCCA 2WG1A 2GYVA 3I28A 2P8SA 4X71A 4G4IA 3UUFA 4ZI5A 4DNQA 2YASA 5IKXA 2J3DA 1QE3A 5ALPA 1XZGA 3M82A 5I7UA 2W22A 5ALYA 5T4BA 4F21A 1TCCA 3A2MA 4KRXA 3KSRA 5FOQA 1XZIA 2JGKA 4H35A 1XRLA 5AK5A 4AZ3A 3R3VA 4AN0A 1A8UA 5ISMA 5EIHA 4EHBA 4J7AA 1QJ4A 3K9BA 2HA7A 1R4ZA 4X7BA 1EDDA 2O7RA 3O4IA 5I8PA 3G8YA 4LXIA 3WWDA 3CCCA 5EHQA 5ALOA 3GUUA 1BN7A 4K2AA 3DL7A 3ESCA 1UOQA 3U0VA 1MX9A 1ZGCA 5JD4A 3I2JA 5H3HA 3FYTA 1AMNA 4N5IX 1Q0RA 4L3WA 3QPDA 5ALQA 3FLBA 2XUFA 4B9EA 4DSZA 5ALEA 5YASA 3R41A 2JGJA 3ZLTA 5HCUA 1XFDA 4CIBA 1LZLA 4ARAA 1VKHA 2WG2A 1EDBA 4NVRA 5A7HA 1WHTA 1NX9A 4H7KA 4IO0A 1YASA 3KD2A 1GPLA 4JNCA 5JD6A 2D0DA 4RPCA 4CCWA 5EGNA 4ZGBA 1GKLA 5LZ7A 2H1IA 3HSSA 4UHBA 5AKLA 5ALWA 3GBSA 1QIFA 5SYNA 4D9JA 4J0GA 1M33A 5CT6A 1GZ7A 2C0PA 1BU8A 3OC0A 2WUDA 3OTQA 4CG3A 4TVKA 4E14A 4FFWA 5AI0A 3BWXA 3KXPA 2OG1A 2RIPA 3O9MA 3W2TA 3WL8A 5FPPA 2UZ0A 3H17A 4WDRA 5ALRA 1E66A 2WUEA 2CMFA 3IB3A 3EQ7A 2QKYA 4BVKA 3AIOA 1B41A 3PFCA 4WFKA 3BDVA 4DTCA 1LBTA 2J4FA 2WIFA 5DYYA 1AZWA 4ITVA 5LZ4A 1JFRA 2VT6A 3OM8A 4EY7A 4H7HA 5D6OA 2Z8XA 1E8NA 4UPDA 2OCKA 3BDIA 4B0PA 2VF2A 1ZJ4A 1CUSA 4UFPA 5HFNA 4C01A 2BCEA 3FLEA 4AB1A 2XE4A 2V9ZA 3I6ZA 4LYDA 5AKIA 2XUOA 4DYHA 1E3QA 1XZLA 1EB8A 1T4MA 3D2CA 4FWBA 2I03A 4ROTA 1QIHA 1EI9A 1ZI6A 3IBTA 1GT6A 2B9VA 5C7YA 3FSGA 4UBJA 2EEPA 5DNUA 2G4LA 5JAPA 5AKJA 4UHEA 3VVLA 4X91A 1XQWA 4MQLA 4GHWA 1MNAA 3C6YA 3U1TA 4OD0A 3BXPA 3KDAA 3BIWA 4AMYA 4X6XA 4LHEA 4ARBA 2OCIA 4WFJA 3FBWA 4X97A 1EK2A 5JALA 1XRQA 3DEAA 4A23A 4KE7A 4J0KA 2VA9A 3T52A 5AHXA 2WM2A 4FMPA 2X76A 1ZI9A 4NS4A 3STYA 5AKXA 1KU0A 5CXXA 4G9GA 1ZD3A 7YASA 3HXKA 4Z49A 1DX6A 2VTVA 2HA4A 3BJMA 4WDQA 2DQZA 1A8QA 3HEAA 4E46A 5EHNA 4W1QA 4HXGA 3CN7A 2XQFA 1C4XA 5EIEA 3DOHA 4B6GA 2JEYA 4UBLA 1H23A 2QRUA 3R0VA 4YASA 1CFJA 1E89A 1CUWA 1F0NA 2BKLA 3FCXA 1Z68A 5FDFA 3IIIA 4MWTA 5HKBA 2OGSA 5FRDA 3VKFA 1LBSA 3W06A 3H0CA 5AK4A 4AO6A 3HRHA 4X00A 1XRRA 4QNNA 2XMCA 4Q82A 5EIAA 3WKBA 2ZYSA 5AJHA 3GZJA 1GPKA 3WWOA 4ZV9A 1W52X 2VQ6A 5JD5A 4ZRDA 4QE3A 1LPBB 3I1IA 4YX9A 5LZ2A 4IQ4A 4OSEA 3T4UA 2O2GA 4RGYA 3N2ZB 4YK7A 4KJXA 3PDCA 5AKGA 4HXEB 1B6GA 3N0TA 2WIKA 1JU3A 5ALMA 1WPXA 1FSSA 1JT2A 1VJ5A 1O6GA 3PFBA 2QXUA 4BTLA 4FKBA 2WFZA 3L1JA 5IVHA 1CUIA 1QOZA 3F67A 1GKKA 2XT0A 5HF6A 1K63A 5IVIA 3D4LA 1EINA 2HIHA 5IVDA 2OCGA 1CEXA 3V1LA 4P08A 5HZGA 4DLNA 2WU3A 3STXA 1TRHA 1TKRA 2PUHA 2WUGA 1SCIA 3W9BA 3ESBA 5K3CA 1MTZA 3NGMA 4MJ3A 4Q3OA 1N5RA 4Y7DA 5AM4A 1BCRA 3P2MA 2VAXA 2EDCA 2YH2A 1ACJA 4FNGA 2I78A 2WFLB 4GBGA 2ECFA 2AJLI 1PV1A 3MUOA 2Z3WA 1ODTC 5CT9A 1G5FA 2FJ0A 4WCVA 2XMZA 1UK6A 5AICA 4QDUA 2XUJA 3EQ9A 5A6VA 5KBYA 2ZSHA 5AOBA 2WTNA 2I3ZA 3OG9A 4B80A 3ED1A 1PFQA 2AJ8A 4GECA 5DJ5A 3IURA 5DNWA 1TCBA 1CUJA 4RE6A 1P0MA 1UXOA 3G9UA 3D2BA 3VJMA 1XQYA 1RWQA 2IIVA 3R3ZA 2WFLA 4UHHA 4V2IA 1S8OA 5ALIA 3C6ZA 3BIXA 3MVEA 2JGEA 2ZJ7A 5I9IA 5JAHA 2CZQA 3SK0A 1CQZA 2WSLA 2Y1KA 4BCBA 1QZ3A 1N8SA 3PF8A 1CUZA 4EBBA 5D3KA 2Z5GA 2JGLA 3ESAA 4K5QA 2DCMA 1DTEA 2HFKA 2HFJA 2BUCA 3IUQA 4Q05A 4MXDA 5ALVA 1QIGA 5E2IA 2WKWA 3CCBA 4B81A 4QDXA 4UHFA 1C7IA 3WL7A 1CIJA 4BRSA 2QZPA 5CMLA 4UHDA 4GDMA 1DQZA 1JU4A 5K5EA 3E1GA 3HACA 4MQMA 2PU5A 4B9AA 4U2EA 1JJBA 3C87A 3M81A 3PI6A 5JIBA 2V97A 4L0CA 3WI7A 5T4FA 1IUNA 4DMHA 1ZIXA 1SCQA 4J0DA 4GLBA 4CIAA 5LZ9A 3I2KA 4Y9SA 2HU7A 4Q3KA 1KU6A 5EFZA 3AZOA 1CUEA 3W9UA 4HTAA 4AXBA 2CB9A 2FJPA 5KWJA 3STTA 1CPYA 2WJ4A 5K3AA 4WJLA 3TJMA 5FLKA 1DINA 3YASA 5EHXA 1BEZA 4X93A 3ICWA 4XJVA 4PF1A 2OAGA 1BEEA 3R3WA 1LZKA 4JYPA 5C8ZA 4AMZA 1UKBA 3QMWA 1LPSA 2XDWA 5E4JA 4UFOA 3FSGD 1WB4A 4OCZA 1GGVA 4NZZA 1XRMA 3TGLA 4OU4A 2VAVA 2PM8A 4E15A 4KR0A 1L7QA 1TK3A 1R9NA 1TIBA 4G9EA 5KWIA 2ACEA 4Q34A 4IH1A 4QLOA 1CUUA 3GA7A 4FLMA 1BN6A 4IH4A 3VJKA 4BZWA 4OB8A 1E8MA 1AGYA 3WLAA 5AKKA 1MO2A 3KOOA 5C8XA 4XWGA 3DOIA 2XUHA 2PSEA 4RE5A 5EHZA 1UOPA 2QJWA 3NUZA 3STWA 1ZD4A 1IZ8A 4QEKA 4M0MA 4BYMA 4ETWA 3O4GA 5BOVA 2XMBA 2XQGA 3DNMA 1G66A 4C4ZA 5AM0A 1LPAB 1UT6A 1Q0ZA 3QITA 1SFRA 3AINA 1QONA 1DX4A 2H9YA 2RHWA 1QLWA 2QVBA 1LNSA 3R3YA 3H18A 5CH5A 2RONA 3H04A 3A2LA 2QXTA 1U8EA 2QR5A 5SYMA 4DMCA 3C5VA 1CUBA 4HRYA 2GYWA 3RKSA 1QO9A 5DWDA 4K6HA 5A71A 3WK6A 1XZFA 3F96A 4W1PA 4MYSA 3FVTA 4W1SA 2ONCA 2PPLA 4X95A 1VZ2A 3O4HA 5AKYA 2Y2UA 4MYDA 1HDEA 2JBWA 1YS2X 1XROA 2G63A 4BP8A 1XZDA 2C7BA 4DMKA 5HF8A 3C43A 1O6FA 1MAHA 1UKCA 3BF8A 4DM7A 1YS1X 4H77A 4KAFA 3AIMA 1RP1A 3ILSA 1L7RA 4X3CA 1TAHA 4WY5A 3H2HA 3SWWA 2ES4A 1DQYA 2QJRA 4DNOA 3PUIA 3WYDA 2QM0A 3BF7A 1AX9A 1C7JA 5AM5A 1EH5A 1N5MA 1E8DA 1QTIA 1ZOIA 1GQSA 3D2AA 3C8HA 2PBLA 3LIPA 2VEOA 1EDEA 3EF3A 5AKHA 1H2XA 2AJBA 2WIJA 3H19A 2HU5A 2ZYRA 4FDMA 3DJYA 2OQIA 4B83A 5AIBA 4LXHA 3LIIA 5JARA 1P0PA 3H2IA 2WFMA 1XZCA 3D0KA 1BS9A 2DHEA 1ZICA 3CN9A 1VOTA 5AI5A 3AIKA 3KWJA 4EY5A 1F6WA 3MUNA 5T4HA 2BUBA 4H7FA 1UKAA 1XKTA 3HJUA 2PX6A 2XLBA 2IX9A 4I19A 4G1FA 2YYSA 5ESRA 3IUNA 2XB6A 1QFSA 2O2HA 4H7JA 3WKEA 4KAAA 3H1AA 5A7FA 1ODSA 4NMWA 3QMMA 1W4LA 1QGED 4Y2XA 3WL6A 5K3EA 2GBIA 2EDAA 3M3DA 5AKZA 5AI6A 2WJ3A 3O4JA 3M83A 2VATA 4INZA 4Y2JA 3WYNA 5FXMA 2OGTA 2PSDA 4AZ0A 3PICA 2XMGA 4N8SA 1ZIYA 1THTA 3VVMA 2Z8ZA 3G02A 4KE8A 2K2QB 3H1BA 1W1IA 1VE6A 1TCAA 4X92A 4Y2UA 1D07A 2DHCA 4M0FA 2CKMA 3UUEA 5AK3A 4BBZA 2RHTA 3NWOA 2B4KA 5D7BA 4X90A 2O7VA 4U2DA 5JATA 1CUYA 4JUIA 2ROQA 4EY4A 4PNZA 4B0OA 4QWWA 3PF9A 1L7AA 1CUFA 1HPLA 4H7IA 2PSFA 4G5XA 4QDOA 2OXEA 1EVQA 1U65A 4BVJA 1UK9A 4P92A 4FTWA 1H2YA 2PKYX 1AC5A 5K3FB 3X3HA 1DWQA 4BDSA 2XI4A 2H7YA 3WK4A 4X6YA 1PJAA 1AQLA 1Y7IA 1SOMA 2JF0A 3IVMA 2GBFA 1DT3A 4Q3LA 3JWEA 3JYHA 4W1RA 4DIUA 2PSHA 4F0JA 5E4TA 3G0CA 4KRYA 1YA4A 2J3QA 4UBIA 1OILA 1XZEA 2DFPA 4QZVA 5DYTA 4RNCA 1THGA 2OLEA 3I2FA 3WK9A 3WK8A 4ZV7A 2AJDA 1LLFA 3K2IA 2XUKA 1H2WA 4PO3X 4EA6A 5K3FA 5CURA 2OGZA 3H2JA 3WK7A 2R8BA 1EB9A 1XLVA 5ALUA 3BJRA 1Y7HA 4X94A 5AO9A 1EA5A 4E11A 1R3DA 5ALXA 1FFDA 1XZHA 5D3ZA 3WIBA 2VJDA 4AO8A 1UFOA 2O2IA 4F5ZA 2QOEA 4ZXFA 4DGQA 4PSUA 3ESDA 1HLGA 3IULA 3D3NA 5LYYA 1CQWA 1VXRA 5A62A 1JMYA 5DYWA 4K6GA 2B20A 4XVCA 4LYEA 3OPMA 4J0HA 3K6KA 1Q84A 3PUHA 4OYYA 1YCDA 2OAEA 2WHQA 3DYIA 4C88A 4JYMA 5AP9A 2V98A 4CI9A 5AKEA 1HKHA 2V96A 4EUSA 2XLCA 3HLKA 3Q8WA 1R9MA 2JEZA 3RM3A 3VXKA 5EI5A 1IVYA 4HXFB 3WKCA 4J03A 4CCYB 5AIAA 5LP1A 2OCLA 3D7RA 4BE9A 2XQJA 5C8VA 3FOBA 2HA3A 2NW6A 3AZPA 5ALKA 2G5PA 4EY6A 1A8SA 1VE7A 4EY8A 5AOCA 4FBLA 1GPNA 2OQVA 4C89A 3B12A 4MEAA 4H18A 4C4XA 1FFEA 3OURA 5ALGA 3EBLA 2FUKA 1YB6A 4P9NA 1YB7A 2ACKA 3G9ZA 1CUXA 1GQRA 1XZMA 1WCYA 1OXMA 4PSCA 2CJPA 1EVEA 1USWA 5HQ3B 5DTJA 4CCYA 5CTAA 2Y2VA 4BCDA 3EQ8A 4Y2PA 1XLWA 5ALZA 4U2GA 4FNMA 2Q0XA 1FFBA 1LPPA 5J3JA 1VZ3A 2VJCA 1EK1A 4GW3A 4L72A 4N8EA 3JW8A 3S8YA 3HI4A 3WA7A 4KEAA 3QPCA 4QDZA 4QA9A 4HS9A 1MNQA 5HQ3A 4DNFA 2GZSA 1ZD5A 2HHAA 2FX5A 1CUAA 5K3BA 1IMJA 1XZKA 4PV7A 1G4HA 4GWLA 4JH0A 1K5PA 5IVKA 2XUIA
chains in the Genus database with same CATH superfamily
1PQPA 2OVFA 1I7LA 3KETA 3WYAA 4E4TA 1ZUD1 5FOWA 2C54A 4BJ5A 5INTA 3OMXA 4V0KA 3Q12A 2P6MA 1LPOA 2TYSB 3DKRA 3R3XA 4JS0A 3NHYA 1JIXA 1NRWA 5PGMA 5A5FA 3CX3A 4X45A 1SXJB 2HLDA 3L4BA 3A32A 4I8DA 5FKJA 5ILOA 1RC8A 1X74A 4MGKR 4ND5A 3F8WA 2WU4A 4IM7A 1EP1B 3BSWA 2FH5B 2W58A 5LLSA 4LJ4A 4NAUA 5F2EA 4CKZA 1I9CA 1AGXA 3QUAA 3B9RA 1VG9B 1SKBA 1IH8A 4POAA 5K4AA 1WV0A 4LMRA 4HRXA 4AY2A 3KHUA 2A8YA 2Z4TA 5ALTA 4WXEA 1YE5A 1F17A 4LNAA 1N9KA 3GROA 2ONZA 3OWHA 2BE9A 1OV6A 4LRTB 4RD3A 1WCIA 1YQEA 3WBFA 2XZOA 1NVDA 1R0XA 1RVV1 3OHSX 3VNVA 1EFDN 3I1YA 4X3OA 3ZWXA 2F8TA 2BMWA 3ZV7A 2ZUBA 3KVOA 4AP6A 3GUVA 4Q5IA 4N0PA 5C8YB 3O90A 1BFKA 2GARA 1Z6PA 4WKCA 3LDUA 5JDCA 1KVTA 1F0YA 3DKPA 3GHHA 2X8JA 4L75A 4QBGB 2BEKA 3ZDRA 5DE3A 2P67A 2HDHA 2DERA 1NP7A 1Z5NA 2CLHB 2W2VA 4JJEA 5DHSA 1TVKA 2J5RA 2NTEA 3VC7A 5HZMA 4TMZA 3JQFA 3RRXA 1YDEA 1G3RA 1YI1A 5KYVA 2D0PB 4YRSA 3PUVA 5CXUA 2DBQA 1KWKA 4EVQA 1WKBA 3HHPA 1JA0A 3OTIA 2VUIB 4JVMA 2Q5EA 4WV3A 3WZLA 1SXJA 1UKVY 4YCBA 3NGXA 2HLPA 2QMUA 3S2EA 4EHKA 1IHDA 1M8PA 2J85A 1L8XA 1Z6ZA 3EARA 3LC1O 4JK3A 5IKMA 4CNBA 1MCZA 3ILHA 3PR2B 1V43A 4F6LA 5LUBA 4QWMA 3V1TC 2H7XA 3X1KA 1LS6A 5C0OE 1DV1A 1ENOA 3JARB 1CVLA 4JP3A 4EFNA 3R9KA 1MAUA 4BX2A 4C0HA 4I08A 2XGJA 2NXNA 5DKFA 2RH9B 2Q7XA 3SS8A 2LDBA 4GE0A 4HAIA 4KFSA 4LJAA 1I0ZA 4RJIA 3V9AA 4EG7A 1Q0LA 2C98A 5LNK6 2W6JD 4KO8A 5AI8A 1TJPB 2JJMA 2VSYA 2XF2A 4FGWA 1FSZA 1SU4A 4E5VA 5A4IS 1NM5A 3D7KA 4ZT7A 3BKWA 3BQMB 2W48A 1DDOA 1Y8CA 1R18A 1KS9A 1ZC4A 4UJ3A 3MQFA 4YRRA 3SC2B 3DC2A 1S7GA 2F43A 3REOA 5IN5A 5CA1A 3U7HB 4QOIA 1XRPA 3FGOA 5L40A 4BFVA 3E3LA 3UMYA 4Q4HB 2Y92A 2BHLA 3EXFB 5IT4A 4QHSA 1KK3A 3HCRA 3KV1A 3C70A 3LQKA 4D6XA 2CF5A 4XZ3A 4J94A 3HYCA 1F9EA 2JBAB 4HVTA 1QTNA 1RWKA 1TLLA 3GLUA 2ZIAA 3PR3A 2DQKA 2GZRA 4FEGA 3DZDA 1FRNA 4B6RA 1WHSB 5AM3A 3CB4A 1UK8A 3AUSA 4QJ5A 3L1IA 4LRQA 3MOGA 4KRGA 3KJZA 1A88A 4MV1A 1U7XA 3GUCA 1G17A 1T9HA 5C8YA 5LFAA 1MD9A 2IU3A 2FZ4A 3CWQA 4GICA 2F59A 3A6HA 3KEFA 4W7HA 4LA4A 2OD7A 2ZATA 3OAAA 3D8BA 2A86A 3FUWA 3JARA 3ENZA 3DWGA 3R7LA 3BBLA 1RKUA 2YIVX 2HNKA 3EHEA 4NONA 1GPMA 4RK1A 2Z2KA 4A4DA 4B79A 3RAJA 1DC7A 5BNWA 2HWKA 2OL4A 1TKAA 1B2RA 4O4IB 2PL1A 1H5UA 3H99A 4AP9A 1KEEB 3REQB 2JANA 1P7ZA 2WHPB 4N9WA 2HL6A 3N6VA 1SXIA 1ZSVA 2P5SA 1LJUA 1U7ZA 4LEIA 2RGRA 4B7CA 1TF7A 3T5CA 3UXYA 3L8YA 2ZGVA 3VZQA 5IZ4A 4G0UA 3QKWA 3GJ6A 3IE0A 3SC2A 1NU8A 3ZGNA 2DXIA 2J3KA 2E0IA 2P0YA 2Y8EA 3KPVA 3NATA 3HCFA 2JK0A 1CY1A 1IZ0A 4Q4HA 4JEUA 3HJGA 4IWXA 3JD2A 5CB4F 5CLGA 1OXSC 1O57A 2YC4C 3I09A 3LX5A 3QVWA 3UWMA 3ZE1B 4E51A 4RULA 2UYQA 3WLHA 1KL7A 4G4JA 1PBNA 2JBAA 3H9GA 1OX4A 1L4GA 2X5XA 4NBRA 5EWJB 3EEQA 5TMEA 4LMPA 2GKSA 4HNHA 2IKSA 4TXMA 5B7QA 5JQGB 3O7WA 3OJLA 1D1SA 4GI1A 4B44A 1IB6A 4DUGA 1WHSA 4RCYA 1XDSA 1KOGA 3I6YA 1X1TA 3T3MB 3ZJUA 1M2KA 5GONB 3WWPA 5JADA 2H63A 1WQ4A 1YS4A 3E7XA 4FYMA 4MDYA 4B7UA 1QORA 1M5UA 1ZD8A 3C6BA 5E7QA 2V7XA 5HMLA 2W43A 3ER6A 4BWGA 1C0IA 2WKQA 1II0A 3AI2A 1I2MA 3ZWCA 2ZKLA 1OB5A 4PRYA 1LV8A 3A28A 3OZCA 2QYHA 4P54A 4W7IA 2BGRA 3KQMA 2VDMB 1QZZA 1I33A 3PPYA 3PUXA 4O4IA 4HLUC 4I36A 4MRSA 2HMTA 2IITA 2WHPA 3REQA 2VG8A 5DN9A 5J59A 4E2WA 4EBFA 3F3KA 1E20A 4NYIR 4QVKA 4PXSA 1HRKA 1XTIA 3Q0EA 3ZEIA 2EFHB 4OH7A 3EIOA 1WPRA 4TWZA 5CD9A 5DLPA 3JAMA 1AKEA 3BM5A 1IVNA 4OJNA 4PFKA 1O58A 3P7MA 1K3UB 3JVDA 2XHEA 4BNMA 1HL3A 1PVOA 1JQ5A 2IP2A 1YT5A 2VUTA 1TM4E 1UPTA 3TRHA 4AG3A 4EYOA 5MFPA 3G2QA 4C87A 1QV9A 3ADPA 2ZYHA 3DBHB 3ETLA 4TT3D 5CXSA 2KBFA 1J22A 1ZH8A 3KR1A 3TEJA 1F2VA 2D7CA 5EWJA 5AVVA 2QTCA 1VJTA 1JWLA 4XLZA 1E2MA 2OYRA 1VI2A 1O9HA 4MO2A 4FP9A 2P7IA 2FKAA 1T9AA 3SJUA 2WUWE 1GTZA 2Q5IA 2JK1A 1DKRA 3BL5A 2ZWOA 3CGGA 4LTDA 4MUBA 3PXDA 5AM1A 3SGLA 4XD7D 1Z7BA 4ZCRA 4D4JA 1D9XA 1T8YA 5GONA 1TW2A 2IY9A 1XTVA 1Q11A 2NVOA 4EJ0A 2W93A 4TLLB 2PMDA 4BTEA 4EPWA 2VZ8A 1MB9A 3OQNA 1K6JA 1S3GA 5EP1A 1X1EA 3GCWA 4H7EA 4GMHA 5DEOA 2QSJA 1TQ2A 3UMRA 4GX2A 4AN4A 5K99A 1WLSA 2P9GA 4LWPA 4OHOA 3L8HA 4BWVA 3RS2A 1C30B 4F92B 1VJCA 1N2SA 3HO8A 4W99A 5CRIA 1JFVA 2HDOA 4AWAA 4NH4A 2H0QA 5HF9A 2GR9A 2PWZA 1ZCZA 1KKUA 5KSWB 2VPXA 3PRKE 4MQ5A 1UMCB 2VBIA 3AG6A 1X8XA 2IHUA 3H5IA 1U2TA 2B0CA 3IAM6 4BEWA 4L76A 3F6BX 4N0QA 4OJQA 4FHDA 3RQIA 3G2PA 1F0KA 3BCRA 4GZ5A 5ECGC 3G79A 3CE6A 3SP1A 1QGOA 2GPYA 1MVLA 3I52A 4GP9A 1W581 5FO0A 1QO0A 3ZCTA 2DQYA 2IYXA 3G9TA 2O7SA 3DBHA 1Q0UA 1RD4A 3AU9A 3F97A 4Y2QA 4DEVA 3HGQA 1RQPA 4QQRA 1MV5A 1OIWA 1RJFA 4XB1A 1BROA 3LX6A 1ZKMA 4BFSA 4EYSA 2J0QA 3SC3A 2I1VB 2IVZA 3F2IA 4BLUA 5CB6A 4F4FA 1ZL0A 3EF0A 4X8LA 1QO7A 1FMCA 1UK7A 4KUGA 3RRMA 4NCXA 1BVHA 3DM9B 4GKBA 5HGXA 4DR3B 4BZZA 3ADKA 2VPQA 2ZRMA 5CP8A 1PHPA 4MPDA 1E2EA 5ALNA 1BXZA 3ZY5A 1AHIA 4Z7OB 1EUDB 3WAJA 2C5SA 2ZUWA 3EMBA 2VQFB 3ZLVA 1UBRS 4C7KA 5CDSA 2A5GA 5IFLA 5KREA 1PSDA 3P0HA 3BQ9A 1C4KA 3GH3A 1TMKA 3PSHA 4M9QA 1T2FA 5CDYA 4BRWA 2GHTA 2B98A 3IBFA 3OLXA 4XPZA 3F7NA 2VYVD 1Q95A 2YXPX 3W9SA 1JG2A 1GADO 3I04M 4KFRA 3AI3A 1ZH4A 3AFGA 2M6KA 1SXGA 1ZVMA 1E2PA 4Z3DA 1SBZA 2PMWB 1HYBA 3K4HA 2A5FA 2A9QA 2J7PD 4TRJA 4XW2A 2HA6A 1WCXA 3OLQA 1VIAA 4BHTA 3T12A 2W42A 3BRWA 3H9JA 4NZPA 1R15A 2AWOA 2O0HA 1SK9A 1DEAA 3FI9A 3GNTA 1NQWA 4F3NA 5HRCA 2RG7A 1Z62A 1K4MA 2ECQA 1CC1S 2OM6A 2VHUA 4NOJA 4B3XA 4C0LA 2Q6LA 3HLYA 4W63A 1ADBA 8ATCA 3MJTA 4TRMA 2WTEA 1I5EA 5T4EA 3ONWA 3KP1A 3PSAA 5GAJA 2VHXA 1SKYE 3AUYA 4FQ8A 4JQCA 4B5KA 2EQ5A 1W88B 3OZAA 2JGNA 4PTYA 5I5GA 5JCJA 2ZYDA 3EA0A 4U7JA 1EUDA 5JZBA 3NBMA 4BO4A 1ST2A 3ANTA 5K0TA 4R05A 3UNXA 2QMYA 4Y1GA 4HV4A 2RFLA 3O4VA 4IS3A 1I3CA 4P4LA 1DKUA 3LY5A 4D8WA 4EPYA 1K6EA 1R0WA 3H3FA 4QEDA 5JPDA 1HDYA 3GNQA 3TIVA 1RYYA 2XEXA 4WEQA 1B6TA 2WILA 5L95A 2CJWB 1BFUA 2JD2A 1A27A 3I72A 5J4VA 1UPFA 3KS9A 1LX7A 1UAGA 1WUTA 1VYUA 1WW2A 2PY6A 4PLWA 5L9AA 4ZVQA 1QGYA 3KLMX 3S29A 1TUIA 3RREA 4CDRA 3WWCA 1RXUA 3AB7A 3LUGA 4XGKA 2NO9A 4BMXA 2YRXA 4D5GA 4DLZA 2QMEA 2WT4A 3D4IA 3TOSA 3WWYA 5K05A 3ZJVA 4E31A 4W9NA 2AEJA 4O3MA 1GSAA 4J4TA 1JVNA 5GINE 3B1YA 2IZ7A 2A67A 1WO8A 1VBKA 3CLSC 4RTQA 1X7GA 4BRZA 5DTMA 2XUQA 2KHZA 5B6JA 3PFIA 4MWDA 1E9FA 3DLTA 3F9RA 4LV6A 3RLIA 1T2UA 3O3NB 2CUKA 2FHPA 1W88A 3E05A 2QM7A 3KWFA 4E5PA 1A1SA 5CT4A 1JHAA 1G7TA 1PJ4A 1O94C 5I45A 4Q48A 4WPGA 3JD1A 1NULA 4H4DA 4G1EB 2UZAA 3VHLB 4C3ZA 4I6JA 2HRBA 4JOCA 1JKMA 4ALIA 3BL8A 3C6QA 3L01A 1HC7A 3PWKA 5JFGA 2Q0SA 3UT5B 3TLJA 4HX9A 3RG2A 2PZLA 1JLHA 2EF1A 4JJ7A 5HGJA 1VA5A 4L4SA 2E4ZA 5B2FA 2B8NA 2CJWA 4M0EA 4RA6B 3HY6A 4MW6A 1TYZA 2Q4RA 1HFWA 2BTQB 2E4UA 2WG0A 1Z4KA 3A14A 4GGMX 2VNKA 4LGCA 2NO7A 4IGFA 5CW1A 2QDXA 2GPWA 3LKDA 4XWTA 4RFVA 3TTSA 1OYYA 1P2UA 5BT9A 5SZJA 2CL5A 4BMPB 2IS2A 2XNCA 3N5CA 1P0IA 3P9RA 4O29A 3BQNB 1DWUA 4OH1A 4QFBA 2C2ZA 2ZYVX 3I5UA 3CG4A 3DJFA 5JH7F 1U02A 1UZLA 2DG2A 1T43A 2ESRA 1VL5A 5BMVB 1HG1A 3AFHA 1WMBA 3CWCA 3IA2A 4J0EA 1G4AE 2NAPA 2HDWA 4X6UA 1Y6GA 4X6LA 1ADFA 4OQDA 4QTUB 1ECJA 1IHYA 3NDBB 4E21A 5I5EA 1D2RA 3HUUA 4UBKA 4E5UA 3KL4A 1E5DA 3FAKA 4QYXA 2WE8A 1H66A 1DTSA 4YGXB 5D85A 1QP7A 3WAKA 4Q9LA 3HV0A 3LT5A 1TO6A 3R3SA 1Q83A 2ZSAA 2DY0A 5FUBA 2ORED 3KSBC 2CSUA 2YYZA 1E5TA 1QVVA 2Q2VA 2VOJA 1T5OA 1Y3DE 1H3FA 3BGOS 3QU9A 3W3AA 4H3HB 4OB7A 1E6CA 5JZ9A 2AL7A 4J16C 4TYMA 5COAA 3PU6A 1NLZA 1DEHA 3Q3JB 3WADA 1JTVA 1Z5ZA 1P1HA 4CFZA 4YDSA 1SUDA 3PRHA 5CBKA 5A06A 3FWHA 2GKOA 3KFXA 3KR0A 4RA6A 1RLUA 2BTQA 4F8YA 3I39X 2OSVA 3RR2A 3IDOA 2XMQA 3RFFA 3V1KA 1TE2A 1KS2A 2DF8A 3I0ZA 1KI6B 1Y6ZA 1NVMB 1T25A 4G4GA 1RE0A 1G7RA 1UMDB 2AXNA 3SXPA 3QX9A 5BMVA 4P93A 2QRLA 3WZ2A 2CUNA 2PE5A 1JIIA 4O2BF 4O4JF 5TS2A 3LGXA 2ORVA 3OE7A 3AO0B 3WLOA 4BX3A 4DE5A 5DLDA 3NHFA 4KU4A 4GP6A 4YP6A 3SF0A 4QYTA 2VT7A 2IOFA 2YJ5A 1U11A 1F0PA 4HDKB 1PP4A 1CLEA 1RKBA 2GVDC 3QXXA 1GT91 2GEBA 2HSEA 4NZYA 2FEWB 2O3UA 5IRCD 3KXIA 2ZI6A 4CJXA 3VPDA 4OQQA 4HGRA 4PAWA 3VI4B 1Q50A 1ZYUA 3T38A 1FW6A 3VISA 4LHYA 1LUAA 2HRDA 3ZI7A 2HJWA 3CMMA 2QVZX 1J1IA 2RGYA 4MGYR 1TMGE 4LPKA 1Y4DE 1JJFA 3WGOA 5LQRA 4MEBA 2W6CX 3V8QA 4UTZA 2JGIA 4GM0A 1E7SA 3QOWA 3ZU2A 4UE3S 2QSYA 5F3WB 2IT1A 4C7OB 4RGBA 4MQ6A 3U7JA 4BQSA 2A9PA 4WOBA 1QUEA 4EKEA 3CEAA 2GZ3A 3EFOB 4ZODA 1M6VB 1ZA2A 2GBGA 4GOMD 3N2LA 1W76A 1AT1A 1JRLA 1L5WA 2AFHB 3FBTA 2Y1EA 3KCQA 4WI1A 2HJVA 3S2ZA 2CEAA 1KI6A 3HP1A 1L4YA 2H3EA 3NBXX 1K4YA 4YRMA 2IH4A 1M7BA 1UMDA 1TEXA 3L4JA 4FOSA 3PNPA 4K9PA 1H85A 3KPWA 4KO4S 3K1YA 1YAJA 3BTVA 1EXWA 2G1KA 2EBWA 3AOEA 4HCJA 1ZBQA 2JARA 3GBPA 4L02A 4Z1MA 3UXEA 2BEJA 4FLEA 3U9TA 4OQMA 5C81A 4AI6A 1PJQA 2WHYA 3LP5A 1M1YE 4RVSA 4HNRA 4TTIA 4X7MA 1EFVB 3QNMA 2BT4A 4R68A 1V5EA 1PN3A 3TW8B 3W4JA 5EE0A 4HS4A 2WMYA 1KAHA 2LCFA 3MHTA 5DYGA 1ADJA 3DF7A 2I6GA 1CRWG 2P30A 5HK9A 1NSFA 5EY5B 1LQUA 4BNZA 5GVRA 3AP1A 4Q3NA 2AE2A 3KK0A 3DXXA 4D7AA 4RZUA 3NRCA 1RKVA 2HWUA 2WVGA 3T7SA 2HIAA 2C4UA 1B0AA 6REQB 1VLQA 1WNTA 5IF3A 4B46A 3AJRA 1WXHA 3UVEA 1ZHOA 4KE6A 2VRNA 3DKKA 3QBJA 4PZCA 4CG2A 1W7AA 1RHUA 3UUGA 4YMTA 1SVIA 1M2NA 1R50A 1V95A 4HSGA 2O9JA 1WMFA 5EIFA 4ZC8A 1M6VA 4WOJA 1KGSA 2FN3A 4TWRA 3TQQA 5LU8A 4U2FA 1I6WA 1VL0A 2AFHA 2Y1GA 5B37A 1VHJA 4XGQA 1NAIA 2ZIUB 5DEIA 3ZGVA 1K6XA 1T1JA 2OENG 3EXAA 4HWOA 2ZRNA 4JLJA 2M2IA 5JE8A 5BV7A 1KTIA 3SM9A 4Y2SA 4KSBA 1W36B 4NBLA 5JSQA 2E82A 3HKCB 3IOBA 1ISHA 3M0EA 1MHPA 2R5FA 2PT7A 4QO8A 4R69A 1J8MF 2C5GA 2H31A 1Q21A 1ZUWA 4MA0A 5JD3A 2ZUTA 2PKQP 3DZGA 3WQHA 3E58A 3DBRA 5HM8A 3EW9A 3O0DA 4R8KA 1BGWA 3P4UA 4OBBA 1OOEA 1SCNE 4ZAXA 1GU0A 4G09A 2VJLA 2WZCA 3AP3A 3DAYA 3L8DA 1EFVA 1NBAA 4O8CA 1X19A 4PHCA 1IZ7A 4OAOA 3IO3A 1DU4A 5K8TA 3TXAA 3HZOA 2C31A 4REQB 3WG9A 3DXYA 1P1JA 3ROZA 4DIEA 2OG2A 4JJ4A 4LBYA 1KQFA 2FSVA 3DYVA 1VFPA 1LA2A 2PSSA 1GZSA 2PYIA 2Z43A 4YJGB 4FFVA 6REQA 4ID3A 5TEVA 2H2AA 2R8PA 1J8VA 2VA8A 3H2BA 5EJ9A 1YJBA 1RBZA 3ADOA 3E5MA 1TD9A 3EULA 4N54A 2EKBA 3DQZA 3IKMB 1ND6A 1W59A 1H3NA 1TI7A 3IQIX 3MCUA 5EPOA 3AILA 3K72B 3Q9NA 4DCNA 1FLDA 1QFMA 1GPDG 1UOOA 1E2FA 4JL6A 4WN3A 3IT0A 1IHOA 1FCJA 1Z37A 4J0CA 3UZUA 4WJKB 3ITEA 2YJGA 2YINC 1IG0A 1Q14A 1M8GA 1FFHA 1MC5A 2LIVA 3E48A 3P9ZA 4YMLA 2IS6A 2VWGA 4WNAB 3W8DA 1E1NA 1BTOA 3JRXA 1OAOC 1BVUA 2GYUA 4L9WA 3O8QB 4IDAA 5CLJA 4LJ6A 4KGVA 2GZDA 3HKCA 3JZMA 2VYNA 3LCJA 3R5XA 5F7JA 3VPFA 4C21A 2DR2A 2H52A 3OJFA 1ZGBA 4C4RA 3ENNA 5AOAA 1S3IA 2EP5A 1K08A 1ZK1A 221PA 2C3MA 4LCJA 2OYSA 4LY3A 1XHEA 3DL4A 4S0ZA 2ZE5A 3WBJA 1VCOA 4OU5A 4CEHB 1N0WA 4CBVA 2CNOA 2D5CA 4A2CA 3A9TA 3HK2A 1XF1A 2EXXA 4BUZA 5ALJA 4FFPA 4MUXA 1SCAA 1MH9A 1J8FA 2XWQA 4RUKA 4REQA 2L0XA 5IANA 3TR0A 1UBSB 4YEDA 5LVAA 2DWPA 1XTSA 4KQGA 3EVEA 4EEXA 3B2NA 3D4OA 4TT8A 3KB1A 4YJGA 1GDTA 2MYPA 3GB9A 1YB5A 5EWLB 4EGQA 2PMEA 1OI3A 1G1MA 5DSZA 4JQOA 5AQEA 4CGZA 1B23P 1VBFA 4UM8B 1OI2A 5JCOA 3LNCA 1MPXA 2QLFA 3MILA 1NBIA 1T8TA 2QW1A 4EPVA 4G0NA 1B73A 1KFBB 5ADUS 3EOBI 2IYTA 1S2OA 4HH0A 3V4PB 5JS8A 1FFXB 4C5AA 2FSHA 2NZUG 3LL4A 2C4NA 2LVBA 4C6SA 1P4GA 2H2HA 4UVEA 3D6NB 4RLQA 1QIIA 4ZQGA 5A2GA 1L4FA 4X0EA 1YRYE 2QAJA 1M1XB 3GHYA 3G2LA 4IOKA 2AF4C 5KKAA 5M3BA 4DSOA 4BMDA 1I0IA 5KWVA 4ID9A 1NJGA 1NPTO 2C9CA 2ERXA 2ZJAA 2GEKA 3IAEA 4HNQA 4BN4A 4GPAA 1TOAA 4B17A 4DPKA 3NT2A 4PONA 2C78A 4YMSA 5ENZA 4DJFC 2J46A 2YWGA 4RZ2A 4CEHA 1WV1A 2WG1A 1OGJA 3S55A 2ZXUA 1U3FA 3WSTA 1VPLA 2ZWMA 3DBIA 2GPSA 4YRCA 4YI3A 3Q4GA 3VR2A 4F5DA 2NYVA 3HCCA 2QTRA 4G4IA 1DRVA 4DNQA 4YUAA 3VZBA 4BMYA 2J3DA 3HU1A 1U2GA 1VTKA 1PT5A 5ALPA 4FCTA 1PW5A 4JA0A 2FWMX 5EWLA 1WY5A 3O2JA 2CMDA 3A4TA 3L46A 1NNSA 3OCCA 4TV8B 1I4EB 4I50A 2HF8A 3ZXIA 3P96A 3T4PA 1PJ3A 4KRXA 3A6FA 2HD4A 3KSRA 3COJA 1UC5B 1BDBA 1P3DA 3KZXA 1JR6A 1E3LA 3KBBA 4H35A 5ADWA 3PC3A 2NACA 4KX5A 3TBKA 1GFWA 1QOPB 5HDBB 1FFXA 1WAMA 5AK5A 1WP4A 3R3VA 5EXSA 1TAQA 3UKOA 5G0VA 3IE1A 4FMBB 4Q7JB 2FZLA 1QJ4A 2GEUA 4GKJB 5DGDA 5KKCA 2WM9B 1O0SA 4YT5A 3GLHE 1CY4A 2XNHA 2F6RA 4CM7A 1KJNA 1U3GA 3THXB 3K0CA 3PVCA 2WAOA 4PG8A 5CVUA 1SCBA 3AYZB 4CTNA 2O7RA 2H1OA 1O6BA 4M7RA 4FDTA 4YVFA 1DE0A 3O4IA 1P4JA 4BFXA 1QX4A 1GNRA 2Q28A 3JWJA 5I8PA 2D1FA 3IMEA 4RMJA 4QHTA 4XOIA 3T7IA 4OX9Y 1ZD1A 4EKDA 1SZDA 1BN7A 4JJ8A 1E69A 3ASUA 4NHOA 5IK2A 3CVYA 4JLWA 3QFCA 1MX9A 7ADHA 2RARA 4L6AA 5EPEA 5H3HA 5JD4A 2P2YA 3WHPA 5KIAA 2Q2WA 2IQ5A 3LPNA 1EWKA 5JR3A 5GZ1A 2XYGA 3LO8A 4JYAB 1N4DA 1OXBB 1N6PA 1E61A 2YX1A 5C4MA 4PC3A 2HDNB 3T9FA 3C1AA 3PHGA 1GUFA 2C7GA 1KMHB 2C92A 3CEPB 1TC2A 4EARA 1YFKA 2JIBA 2DUUA 4CM6A 3ZLTA 5HCUA 1CB0A 1U5BA 3MD0A 3QHQA 5KOHA 2PGNA 4G5OA 4ARAA 1Q44A 3O73A 4M0PA 1W0CA 3ZHCA 2ZIZA 3HR4A 3TSAA 2A0KA 2VO1A 3TM4A 4YJ2F 2W8BB 3Q3VA 2OT3B 2MWMA 1ECGA 4G3XA 1JXAA 2YVUA 1ADCA 4RHEA 4RWEA 3R7WB 3T35A 3W5SA 2DFNA 3RO7A 2V8OA 3NOQA 4IILA 4P4SA 2P2ZA 2GAIA 1YU9A 2RMKA 4EQ6B 4RD6A 2N47A 1MOZA 5D7NA 5CK5A 2XYPA 1PR0A 4EFKA 4C0KA 2NPFA 3OZGA 2HKIA 3WNDA 5JD6A 3DHEA 3VU9B 2O6LA 1W2GA 2D0DA 3HZRA 4Q4AB 5CVTA 3UJ8A 3O8OA 5EGNA 5KNCA 4M22A 3BXHA 5GJCA 2HBQA 5CG1A 5D5PA 4GOLD 3WGJA 3T5TA 2QTNA 2B7CA 2WYVA 2H1IA 4M9RA 5BXQC 2RK3A 3G0OA 4DV7B 3H87A 2IXBA 1W9MA 2VNIA 3J81k 5SYNA 4YYZA 1X1QA 5GOTA 4DMGA 5A9SB 4F2HA 1F06A 2YV1A 2M6LA 1A8HA 1NUUA 3SHWA 3RBVA 3TNDA 2JIZD 1CY2A 1X77A 4IEEA 1KMHA 4LE0A 3ZCQA 1V39A 3TCKA 2P91A 4D9KA 2H65A 5MN6A 2CYAA 2G70A 2XSZA 3HL0A 5FL7D 2R0QC 2HGZA 2Y4OA 3P5BA 2ZI5A 4EUNA 2PD6A 1TF2A 3V4FA 2HBYA 1Q7GA 3JWIA 4MRVA 3TZKA 4E14A 3D54D 1Z5OA 1IPFA 2VIIA 4FFWA 2VRBA 1GGMA 3CYFA 4XCXA 4F5WA 5CFQA 1E9AA 2PFKA 2W8BA 3QFFA 4PINA 1S2GA 4HTFB 3RU3A 3KZCA 4ZT2A 2RIPA 3U9SA 2WUVA 2WKPA 3BPSA 3JATA 3E9MA 3W2TA 3MWDA 2VPTA 3AHHA 1RXSA 2WF6A 1X3LA 3OD1A 3WL8A 4PLCA 4XSGA 4DWOA 4EQ6A 1O0CA 1NOJA 2C2YA 1N3YA 4WDRA 4Q93A 4HPXB 5FUQA 2RGBA 3GT0A 3VU9A 3GJQA 2D4AA 3SSOA 4Q4AA 2ZAMA 1L6RA 4RIHA 4Z8XA 5HX7A 5A6SB 1ENPA 3ZQ4A 5AJUA 1YBAA 3FZGA 2PTGA 3GJRA 4DIBA 3NBAA 1RP7A 3AIOA 3PFCA 1VPVA 2QLLA 2Q5FA 2AD5A 4L5JA 1Z88A 2D54A 5ER6A 5AVXA 5EJ7A 5K4HA 1LBTA 2PFGA 2WIFA 3PG5A 4UATA 4A1OA 2XOXA 2DUJA 3NT4A 1M73E 2YFYA 4EUHA 1L1QA 1GILA 1L1RA 4E94A 4Q19A 1JFRA 1HEIA 1S1CA 5IS2A 4H7HA 2OHIA 4BGVA 3OZ7A 2GEJA 1E8NA 1XMSA 2NO6A 2OCKA 4I7EA 4L6CA 3COSA 1OLXB 4B7AA 2RC5A 3E15A 3V4VB 1HNNA 1ZJ4A 5FNVA 5LU9A 4WXRA 3V4RA 5TPWB 1M10A 4OXIA 3ZDZB 1RR6A 3R5JA 1ISRA 1R2QA 1H9CA 1PX2A 1XEWY 2PZMA 2RGNC 4QXOA 1QDEA 4AB1A 4TVOA 1KETA 4WUVA 2NVWA 3U4IA 4MHTA 1VCHA 2Z09A 2QI9C 2FPPA 5AKIA 4PGAA 4KV9A 4DYHA 1E3QA 1RMYA 1XZLA 2Z9BA 5HIJA 4FWBA 1M1UA 5B1IA 4OBEA 4EG0A 1ZI6A 1EGVB 1GT6A 4QNMA 4AJKA 5EJAA 2WVAA 2FMFA 1F8XA 3QFSA 3WLTA 5A6SA 1FXUA 5T57A 3ZZNA 4YRLA 4Z9YA 2PGJA 2P1DA 2H00A 1Q91A 3P45A 4MAFA 5CEFA 1ZNXA 1EVZA 3B5JA 3DMTC 1ZITA 4IIDA 4JU8A 1HDRA 5H7XA 1CR2A 2HH9A 5EIXA 4EP1A 5E7MA 1EXNA 4R9SA 4KRFA 4NARA 4OQ4A 4TX1A 4I1YA 1K5GA 1XQWA 5LDGA 1MMFB 1JWAB 4PYJA 1CD5A 3IAHA 2NSLA 2ACVA 4UVGA 2VLBA 3HDVA 4MHSA 4HN2A 1OLXA 3SYTA 2ZB7A 2FI1A 3UPTA 4RH1A 1MNAA 2H11A 2OV6A 1KZGB 4CDNA 3QVLA 4JR2A 5TPWA 3U1TA 1YZVA 3BXPA 3HP7A 4PYNA 4DF3A 5KKNB 2BY4A 1Y5RA 4AMYA 1Q7EA 2VLIA 3CO0S 1V5IA 1TJ5A 1N0IA 3ZWWA 3PFHA 2QL9A 1D4ZA 2N0SA 1NC1A 4MWZA 4ARBA 3M4ZA 4DUYB 3GPBA 2BGLA 1Z0DA 2JC3A 3KCNA 4OM8A 2OCIA 1MO4A 4TLEA 4U7DA 2J5KA 4D2IA 1OI4A 2CNWA 3OCYA 4MUMA 3U09A 4LZLA 4WTOA 2BCGY 5KVCA 2VXYA 4QOGA 2OK7A 4LWQA 3I76A 1DRUA 3UAOA 2Q8NA 2P9BA 2O23A 1IN1A 2W11A 4DLPA 5EZ6B 5EVCA 5DHFA 1RLMA 5AHXA 5KSPA 3LHFA 5FB3A 4GC9A 1QUFA 1YNOA 4M46A 1VLJA 2NZYA 1ENYA 2YQZA 3CEJA 4X9XA 2YWDA 3RVDA 4KDRA 3VUEA 3WNVA 5C80A 1TK9A 1C9YA 4NU8X 5D6NA 2WWRA 4R8LA 2B1IA 2FPSA 1GN9A 2JGDB 1NW5A 4MDHA 2FX2A 4P5PA 1KU0A 4UD6A 5AKXA 2R7MA 3E0QA 3IDFA 4GWKA 3VTFA 1GTMA 1GZ6A 2ASVA 2PO7A 4L27A 1UKZA 1ZAKA 5HOEA 1B00A 3BH7A 3HFRA 3F1KA 5KNDH 1C3OB 3P2KA 3QU2A 3SZLA 1FSGA 4EAQA 1EBFA 1Y1PA 2HA4A 3BJMA 3DDSA 3EUWA 4WDQA 4C22A 2FZEA 3F46A 3WQSB 1SELA 3SI7A 1BC5A 2GLUA 2IOQA 1ABFA 3HEAA 3GN2A 4EOGA 1HF3A 4LZWA 4YUVA 4B2YA 2JGRA 2APJA 1GRNA 3WO1A 4YRKA 2E37A 3KXKA 5CEEA 3JTMA 4ZVSA 3AEQB 4XM0A 1VE5A 2RB5A 1NM5C 3A4YA 3MWFA 3ONNA 2P2GA 4M7WA 4PM4A 1D04A 1W35A 2REXB 4F3KA 1GZVA 3IYLW 2OC4A 2OEPA 4RK0A 1C4XA 2XADA 2O48X 3QFHA 5ILQA 4G6ZA 3RIGA 2JEYA 3QKUA 4B6GA 2HK6A 4LXYA 3TR5A 3VZDA 1ONNA 3TE6A 2QWXA 4RVOA 2CLFB 1T9ZA 5JYBA 4KITB 3B3AA 5TMBA 2Q1XA 3T7CA 2BKLA 2BZGA 1TM5E 4QUKA 3FCXA 1Z68A 2ZRFA 2XCQA 1KJWA 3KJQA 3AY0A 2W2NA 5EGSA 2DCUA 3IIIA 3H5TA 3G49A 1NVXQ 4UZEA 4WXPA 3WYGA 4GFDA 6ABPA 3UJNA 4HDAA 3ZEAA 3JQDA 3TFOA 5FRDA 1ZESA 3EUFA 5J63A 4N48A 1LBSA 3OZVA 3K09C 4S1NA 3H0CA 1U1CA 4OP2A 1Z4QA 4IIEA 2AMVA 2CHEA 2VT3A 4X00A 4R71A 1TQ4A 4CLOA 3FRJA 1CJTC 3DEYX 4BBPA 1EVYA 3AR3A 2AHRA 3ROEA 1KNQA 4FEAA 4HGQA 5A4AA 1C3OA 1MVNA 4MULA 5DX8A 3EX7C 5AVTA 3GZJA 3L0DA 4Z0HO 3WWOA 3GUZA 4Z2AA 3M6FA 3FPEA 2VQ6A 2ZZKA 3SS9X 4AJ9A 5JD5A 3IT1A 2GPJA 4N65A 4OG2A 1RIFA 3K5PA 3U3DA 3V46A 4FZ5A 4L07A 1QKIA 3AEQA 1PR3A 3AFMA 5KNBH 4EZEA 5A5VA 5JROA 2RG1A 5KSZA 4A9AA 3KL2A 1U0LA 4ZK2A 1ID8A 5G53C 4JBLA 2JLXA 1KKLA 3BCUA 3E61A 3LYLA 1L4MA 4V0MA 2O19A 2QG4A 4JEMA 4NCAA 4WOCA 3BD9A 4YK7A 1H69A 4BO9A 3DBOB 3PKIA 4RIEA 5M34A 5L3SB 3JPYA 4MW1A 2D13A 1SKMA 1Z2CA 3PB3A 4BU1A 4Q02A 3IUEA 1JEOA 4G5YA 2UYOA 5DGCA 1TKBA 3E27A 3ZXUB 5ALMA 5L3QB 3VKUA 1QS0B 1YJXA 3NX4A 3U4HA 1Y1SA 2QTLA 3C3YA 4PGMA 2QU8A 2VHWA 2MT9A 5K8CA 3A4NA 1BCRB 2Z57A 5IHPA 4PC6A 3QUCA 1PV2A 2HCRA 2QXUA 1WW3A 4KIFA 2POQX 2VP0A 3L06A 4FKBA 4KI7A 1MQ8B 1XALA 1E1DA 4R8VA 4K6OA 3OEWA 3OQBA 1Q7CA 1H6AA 1D2HA 1NXWA 1UBJS 4BMNA 4YUZA 1S2IA 1VSUA 1QOZA 3F67A 3AVPA 3QVGB 4HFNA 3P20A 3HB1A 5AW5A 2XKKA 3K5IA 1RADA 1GKKA 3AF4A 5KQLA 1YR6A 5KYGA 2HGSA 4DV3B 3I3OA 1KPIA 1T3TA 2E5WA 1FDOA 3B9PA 1QBGA 3EQ2A 3JSAA 1ML3A 1MEEA 4Y98A 3T7TA 1QFJA 4EKNB 2JLCA 1KAQA 3D6FA 2NT3A 3L5OA 2WLTA 4TKVB 4AZWA 3ZW9A 4JP1A 5JPCA 4B3SB 2WYWA 1ZSNA 3PLAE 4MKIA 4S2UA 4L8YA 1KI8A 4NECA 5DCWA 1JQEA 2BBWA 2OCGA 3BL6A 3FR7A 3V1LA 3ZNNA 1MKYA 4RPKA 1IQUA 1Y0BA 1CY0A 2FSUA 4B3HA 5HIIA 4LCEA 1PBTA 4DY4A 1VKJA 5HMMA 4B34A 2I6SA 4JC0A 3LO5A 2BFBB 5HZGA 5L3SA 3IVXA 3KZ1E 3N75A 2BKXA 5EHGA 5CLFA 1IJEA 1LBHA 4JXKA 4BNLA 4IPTA 2PUHA 1ZNZA 1LTKA 2WUGA 2IZOA 3HKBB 4Z6KA 3QG1A 1QS0A 4PZLA 5L3QA 3LUKA 5KAPA 1FPMA 2VNSA 3NGMA 3DEIA 3HYLA 4MJ3A 4Y7DA 1P4SA 5CYOA 1BCRA 4HNAB 4ZOAA 3ELDA 1KZ9A 3HA2A 3A05A 4HYYA 3DAFA 2PNJA 1YZLA 4TZ6A 1M6EX 3L6RA 2F3QA 2WFLB 1E0KA 1NVBA 1ECFA 2A1TS 2ISQA 3NR2A 4GXQA 5EE5B 5IBPA 3TBHA 5LD2C 3DHWC 3L7KA 3IQDB 1P5HA 2IHVA 3QVGA 3T0IA 4ZDWA 4ZZ0A 3AV3A 2H48A 4AWBA 3PV0A 2QVGA 3WXBA 1CSEE 1K8ZB 3H97A 3PC2A 4ND4A 2MSCB 1P80A 3ZGXA 3L4SO 3IVGA 4D41A 3KSAC 2EAUA 2Q6VA 4C29A 4F6RB 5D51S 4TKVA 1ZW6A 4GOXA 5TGDA 2XDAA 3CNLA 5BNIA 3RS0A 5C35A 4KTTE 1Z17A 1MW9X 5E9JA 1EZ4A 3ORRA 1PR4A 4ERNA 5KWEA 4RWZA 2ZSHA 4UM7A 5IKPA 3W5AA 2ZWVA 4LRXA 4IF6A 2QD1A 2F64A 4NV0A 2R7LA 1TNDA 5JLAA 1YI8A 3ZZ1A 3H5WA 2F62A 1Z6YA 2G4VA 2I3ZA 4MRMA 2VK1A 4MKFA 1Q7TA 4YXFA 3ED1A 2ALJA 3QA9A 3HZZA 5DJ5A 5CBPB 4R1UA 3HKBA 5HSGA 1P0MA 1U5CA 3AVTA 3GI1A 1NQ5A 1QK3A 2ZJ2A 4R40A 1T5TA 3K92A 4MROA 2J5QA 2ZJ1A 4OXKA 4QU9A 1G8AA 4HNAA 5IWCA 3G9UA 2IY7A 3DE1X 1RYEA 3FPKA 1MO3A 3JS5A 3BERA 4BU0A 1XQYA 1QB8A 2G07A 4KL8S 3F6CA 4YRGA 4ZGGA 1Z22A 1DEXA 3FDFA 1FLVA 3AVVA 1EWRA 3EJWA 2WFLA 1PR9A 4J29A 2I22A 4Y2GA 3ZHQA 4O25A 5A4KA 1UL1X 4UMEA 2EKLA 3PZRA 4QRHA 2FLKA 4G0PA 1CRPA 3MWKA 4N7BA 3U6KA 5P8WA 5E2AA 1QRDA 1VGQA 5TLSA 5ELXA 3ML1A 4L0QA 1MH1A 5JAHA 1K7SN 3TTYA 1AY0A 4HB3A 3W9YA 1S89A 1VECA 2YWCA 2WSLA 3UK7A 4F6RA 1C2TA 4DR7B 3C6MA 2J4DA 2SECE 4BCBA 4FX2A 3ZWKA 3SLRA 3EIEA 1FYEA 1V9LA 4DC0A 1QZ3A 5IAEA 4ABTA 3PX3A 5C1BA 3HLTA 2VP5A 4QL3A 3WL7A 1SVLA 2XCIA 3PF8A 3THOA 1MG5A 2AI2A 2LKCA 2JGLA 3KPUA 1G3UA 1JECA 2GNAA 4K3UA 4JOBA 4KXLA 2GZ1A 3RUEA 4G23A 1VPEA 3IKTA 3AVWA 1NW6A 5CBPA 4Z4IA 2IZZA 3AY3A 2GXSA 4FDLA 3NIWA 4GE3A 3HKEB 2BBTA 1OGIA 4A0RA 3B48A 2OA0A 5E2IA 2BOVA 1U9CA 2QTVA 1BDMA 4EX6A 4ZDJA 3FPFA 4QDXA 1GGHA 3FWPA 4W4TA 4WVLA 2EQBA 3WIDA 3W1VA 4UHFA 5LQCA 3BS4A 3AUJB 3H0EA 3ZQJA 1C7IA 1N9ZA 1UXGA 2QAGC 2YUTA 5FEMA 2CW5A 2PT5A 1VRWA 4M0DA 4NH0A 1XV5A 5IXJA 3UHOA 1JU4A 5K5EA 1JI0A 1CTQA 1YDWA 4OLJA 4B9AA 2PU5A 5FCDA 3U2QA 1SUWA 4H1UA 4U2EA 3E9QA 5EIBC 1EM8B 1RHRA 1WXFA 2QL5A 4G0ZA 1GARA 4AJ1A 2GNPA 2B4RO 3IUYA 4HJRA 1XLTC 2GN8A 4Q1BA 4QUAA 1Y8AA 5T4FA 4V0OA 1RSZA 4J4BA 1EFRA 2WSIA 4FUTA 4MDEA 1FS4A 2OLKA 2H92A 4JIMA 2O6HA 1Q0SA 4W9NC 4ZRNA 3NHJA 2B0JA 3EDYA 1Q1AA 2A0XA 1NW9B 2AW3A 4DFDA 3DMFA 3MYRA 2VAMA 3S8MA 2N1MA 4F2GA 1LF5A 1KU6A 1L5SA 3Q7IA 4ZAWA 1A9QA 1DLIA 2DT5A 3E35A 2IA5A 5LA6F 1CUEA 3HKEA 2HWXA 5EL0A 2H5IA 3LF1A 2QN6A 4ZVNA 3T0FA 3NTVA 3JD4A 4II2A 1NKTA 4BNJA 4CU2A 2A5JA 4NAHA 2F9FA 5HFJA 2PD4A 2Q3JA 5JY6A 2FMKA 4K28A 3WX0A 3HJFA 3JQEA 3FMGA 1JR3E 1M66A 4O63O 3TJMA 2YHIA 4KN5A 1Z8HA 4MKHA 3W5HA 4ETNA 1IBKB 3AEKB 2G1AA 3JASB 4UVIA 1BW9B 5FLKA 3M6VA 3B1VA 4FDVA 2RJNA 2RC6A 3FCAA 3NBKA 4AAYA 3OX1A 4MR7B 1GYQA 4CUKA 2ZRIA 1LVUA 4V24A 3IALA 1TX4B 3HJCA 3UMMA 5F2NA 2IYEA 2BI8A 1V47A 2OKCA 2QD2A 3R3WA 2V6JA 4TLCA 1EAMA 1B43A 3LT2A 4IIJB 5FI5A 5ESWA 4DXDA 1ESZA 1H8HD 1IM2A 4AMZA 3MCZA 3SZOA 1D0VA 2B1QA 5F7OA 1KZYC 1BS1A 4DCOA 1GQ2A 5C1OA 3AGPA 5EKDA 4EDFA 3K3PA 2BF7A 3IQEA 3P9KA 3ZGOA 1CR4A 3F47A 1FRQA 2J0VA 1WB4A 2J0UB 1E32A 4TSKA 1XRMA 2O2JA 4ZEMA 9ABPA 4JDPA 2AMFA 4OU4A 4BJ3A 1SRRA 2PM8A 4U8GA 5JW6A 1OREA 4IJQA 2H4HA 3RYFA 2JCVA 1QQBA 2R6DA 3OTHA 1KZ4A 2G77B 3RSZA 1G59A 4Q34A 3LWDA 4K26A 1KWGA 2I7XA 2IU6A 2ODEA 4R2XA 2VF8A 3HJBA 3HDJA 2XYRA 2JA1A 3HSKA 4OM7A 4EY3A 3Q3HA 1GU1A 2AUTA 3TSOA 2WNSA 3FMVA 4NY1A 5F4BA 4BZWA 4ZD6A 4BB9A 5FWXB 3JASA 3MRSA 1GUDA 4HHEA 4PAOA 4YC7A 1MRNA 4FT2A 2C0CA 3PD1A 4UOQA 3EIUA 3Q41A 2FSIA 1AGYA 1L8AA 1B1AA 3SZMA 3G2OA 4EYQA 2KJQA 4MR7A 4LUCA 2B37A 3C5HA 4IG4A 1B3RA 3U48A 1WMAA 4J49A 3W6OA 2VSNA 1QCCA 1J9ZA 3AYXB 4G01B 4JL5A 4AL4A 4DLSA 4FYJA 2H06A 5FWNA 1J5XA 1C14A 2A0FA 3MCAA 4IIJA 4K2HA 4B8WA 3JQ8B 2XUHA 4DSNA 2GXUA 1W0KA 3A1FA 3EA4A 3OHMA 3IXLA 1IJBA 3EVBA 4MS1B 1MRSA 4RE5A 4C4AA 4NQZA 6LDHA 3UH0A 5CYGA 3NUZA 1XEWX 1NKVA 1IZ8A 1WSAA 1ZU4A 5DI3B 1DCKA 3KTFA 3VUFA 1EWVA 1U3CA 2J0UA 2ZRAA 1FBNA 4OMDA 5CITA 5JWRA 4GLFA 2Q5CA 2WWVD 4BYMA 1ZJJA 2QVLA 2R85A 3IPCA 2Q3DA 2P9TA 3WFJA 4ETWA 4QX6A 2XMBA 2XQGA 4YJHB 2AZMA 1JAIA 3PKZA 1ID1A 4G24A 4HFMA 5AM0A 3TKLA 3RU7A 1LPAB 2Q5LA 3HV2A 4A27A 1RQ7A 1YZ3A 1CRZA 3DONA 3KUDA 3SQLA 5B3LA 1I36A 1Q0ZA 1YMQA 5FWXA 5EFOA 4DC9A 3FD8A 3PHLA 3MRVA 1R37A 1SFRA 1OYOA 1HFJA 1V1MB 2O5VA 4AJ4A 4WD3A 1CJCA 3AEUB 1JP7A 3NC4A 3U49A 2BFFB 5LQMA 3R3YA 2ZUEA 1T0PA 3H18A 2V5AA 2JAOA 4L50A 5F7ZA 4D3FA 3K0SA 2L18A 3QY0A 4TMYA 2DFTA 1GZ4A 3H04A 4XIYA 2PH1A 3OP4A 2Q9AA 1MXHA 1V6AA 3A2LA 3RTGA 1XR3A 2WF9A 5MN4A 1U8EA 1EZZA 2QA5A 3OZDA 1NLMA 3MWLA 3R3JA 4K6CA 1PIWA 3G1UA 3JQ8A 4JKOA 4XCVA 5DLQC 4KGDA 1NRXA 3E3NA 5I3CA 1U9YA 3WIEA 1Y7PA 2IY8A 2BFPA 5DWDA 1OKKA 3NBYC 4K6HA 5B2EA 2D5AA 2X9VA 5A71A 1GFSA 4WT7A 1V48A 2WF5A 4ZOLF 4PLZA 5CNKA 3VFDA 5IDXA 4L4UA 4U7FA 4PICA 4W1PA 1LLCA 3CUTA 3IVCA 3CW2A 3OPVA 1I94B 4GKKB 2AC2A 3IP3A 4P80A 3AOEC 2BN4A 1XPRA 2Q0HA 2OHHA 3MBOA 3VSDA 3OKCA 1J2UA 4TWJA 5B3KA 2C3OA 5CDHA 1J8YF 5EXTA 1KORA 3TE7A 1K2VN 3CUSA 3Q85A 3FSEA 4O1IA 4CEJA 4CUZA 1ZGJA 4LJYA 4OKSA 5AKYA 2Y2UA 4C2UA 2JBWA 1BA3A 1Q0PA 1U0EA 4S3MA 1R6VA 4JI1B 4BV2A 2KS6A 3PXBA 3NEPX 2QI9F 2COKA 4JLPA 4NFYA 1U8CB 1T1GA 1V1MA 1XZDA 4GI5A 2YWFA 3BH6A 4HY3A 4KPGA 4QFMA 3TFQA 3UPDA 2BFFA 4DMKA 4UTPA 1CLUA 3CBQA 3P9QA 1QV7A 1SC6A 2OBXA 3C43A 3CURA 3FPGA 1MAHA 3B6EA 1FC0A 1EWTA 1ZZGA 2X22A 3OX4A 4HLQB 3BF8A 4KMSA 3TQCA 1JEYB 2XE6A 1N1DA 1NXSA 3RIYA 3KV3O 1QFXA 2FRVA 1IONA 4H77A 4KAFA 2QX8A 4OGLA 4WK2B 4Y9DA 3REFA 1UPBA 3T3GA 3WLFA 3C0KA 5K6AC 1R0KA 1BKDR 2BDTA 2OVBA 2ZPUA 2LRHA 4OATA 1B8PA 3P94A 4GQAA 4UUNA 4CMJA 3OY2A 4X3CA 1P7CA 2JD1A 3SWWA 2ES4A 4XEUA 1DQYA 2J33A 2QJRA 3FSJX 2WVJA 3KRTA 3R6LA 1EG7A 1IHXA 5J2TF 4DNOA 4ZV4A 1K9VF 1VPTA 1I7SB 3I5XA 1WQ1R 3CZ9A 5JJIA 3ON5A 3ABQB 1Z5GA 2QM0A 4HJXA 4QPCA 4BNDA 5LXTB 4AVYA 1AX9A 3WYEA 3OECA 2P6RA 2P6OA 3QF4B 2W6NA 3HRKA 4RK7A 4V2UA 2UUAB 1DAMA 3GLSA 4QAQA 1QTIA 4GYYA 4MK4A 5A4FS 3HTXA 2QEQA 4LKRA 5BN5B 2X5JO 4Q6WA 4R6XA 2ZCVA 3HFSA 3HGMA 4KN6A 3V8PA 4CL2A 4QM6A 1SKUA 2WYOA 2L17A 2VEOA 4O0MA 1YQUA 5DRTA 1J5PA 1YZYA 3ZWVA 2G9VA 1MA3A 4AG6A 4PLFA 4OJMX 4DCJA 3BD8A 4BL5A 1C0KA 3ILXA 3L8CA 3QPVA 1W34A 1GHTA 4MEJA 2Y67A 2IPLA 4ZU6X 5TMPA 2DPYA 3T3NA 3IEVA 2X5OA 2PUGA 4RC9A 5JCXA 4Q3CA 2CLKB 1OLSB 5BV8A 2PYZA 2VHZA 4JENA 2FN4A 2QTHA 1KYIA 1AV6A 1TJ3A 4J6EA 1HXHA 1GGNA 4MI1A 1YK1A 3WGIA 1NIJA 3CR8A 1IAQA 1NWHA 3AV0B 3R6DA 4HDRB 4K7JA 2E9SA 5AMXA 5J40A 3CE9A 5BR1A 2B1RA 1JZTA 4B6QA 3H2IA 4N01A 2H07A 3WVNA 1M5RA 1EGAA 4Q7MB 4FYXA 1LB1B 3U5ZB 4LGVA 1BS9A 3QF4A 3VHQA 2J0SA 1P61B 5BNTA 3A26A 4JJFA 4TQAA 1CDZA 5KQMA 5E6SA 3QVSA 1RJDA 1CJUC 3KWJA 1R10A 1F6WA 5ENVA 4C2AA 4EY5A 5HJ5A 2ACWA 4F3TA 4L8FA 5BN5A 3FMPB 4XI9A 1BKYA 1XVTA 3BD6A 4AZ0B 2TECE 5ITZB 2JH3A 1XKTA 4RMIA 4CT0A 4M8KA 4DDUA 4G85A 5CA1F 3FVVA 3H5AA 4YCSA 3H8SA 2MDTA 2I71A 4YBZA 2GO1A 2W90A 4MI3A 3VSCA 2VH2A 1Y3HA 2V55B 3QU5A 1D2AA 5DNAA 3S27A 2WPDD 3C15C 3UM9A 3M6XA 4H7JA 1IDN1 3NEYA 1RCFA 4N6NA 3K9WA 3LMKA 2UU9B 1OLSA 3ETHA 2EWVA 1HM5A 1ODSA 2MTBA 3N87A 4R1OA 4BVAA 1FUUA 3EZGA 1Z2PX 5JWOA 1J42A 3AR6A 3Q11A 4J2OA 1QHYA 2JZOA 1M83A 5C8YF 3QEKA 2H6EA 3LDFA 3MNFA 1UBEA 2RKBA 4HDRA 3AR4A 4Y2XA 3GFQA 3WL6A 5EMMA 1O96B 3PC7A 3E22B 5CFLA 3EGDB 2F1JA 4ZOQI 2GK4A 3NHMA 2GBIA 2W6JA 4MARA 5K3EA 1UBMS 1YTLA 2PVPA 2YJ3A 3DMPA 4RD0A 2K2WA 2ZEJA 3HH8A 3UW1A 5TB5A 3OFSA 2W6ID 2R00A 3CLRD 5I6DA 1HZZC 1ZIOA 2XA2A 2DLNA 3LC2O 3BFKA 1J99A 1Y42X 4Y2JA 5FXMA 3TLBA 1IM5A 2D1RA 1SC3A 5TMDA 1R9JA 5KI6A 2OFXA 2VCEA 3FMFA 3BJEA 4TSFD 2PSDA 3DTVD 4QQKA 3KQPA 1BYIA 2NUTA 3ZYZA 2FOXA 2O2SA 1QDUA 3L84A 4XRRA 4AZ0A 3WGMA 4BASA 5BSWA 1HE8B 4LFAB 2C9YA 2XMGA 1OV4A 4UAUA 3R24A 1M2HA 4CV3A 3N8DA 1KJIA 1L4HA 2B3DA 4LRSB 3R8CA 1NN5A 1NSTA 2BM9A 2WZBA 1I4WA 1TADA 4WZAE 5IAAA 4D44A 4LF5B 4ZA2A 3OOEA 3MRTA 2GH1A 2FUG1 2Q3MA 2NP7A 1CEEA 3R6TA 4XB6B 3GGDA 4PZ9A 3H1BA 3VA7A 1W1IA 3L6CA 2ZT6A 4LY0A 1PUJA 3P9IA 4RTKA 3AHGA 1NN1A 3VBEA 2WNIA 4RM2A 4Y2UA 2D4HA 1D07A 4YB8A 5F52A 3WICA 4MOWA 2CKMA 4BBZA 1JR4A 1E99A 1KK0A 2RHTA 3T5DA 1E7YA 3WMEA 3EVCA 2DWOA 3KOUA 3UMCA 1CCWA 3ESXA 3EMDA 4JUIA 1SBTA 3NVKI 3OUUA 4D26A 3EGDA 2I62A 4B0OA 4M87A 3QLUA 1L1EA 2GEFA 3T7DA 1FFYA 3D81A 2B4QA 4AW9A 1L7AA 1Z15A 3GLQA 2PWBA 1WDTA 3HU2A 1ZJZA 3QU7A 4O4IF 1K5DA 2AJTA 1C8BA 1UBNA 2E7ZA 1Y7TA 2NPOA 5J1TB 4LZPA 1Y9AA 2YRFA 4OXXA 4QDOA 4ZEXA 2PGOA 1IYZA 2QRPA 4RH3A 1FUEA 4OFXA 4HQLA 4DRYA 1G55A 1Y3BE 4R84A 2GXQA 2Z04A 2PKYX 4IRMA 3PK0A 1AC5A 2I2AA 3AL0C 4HMPA 4LF8B 3LX4A 4G97A 3X3HA 4ZZ1A 2QPOA 2X0JA 3IXQA 4J3NA 1P6XA 1UF9A 2XI4A 3OLCX 1BG6A 3L7BA 3QE4A 4YR9A 2O59A 1WVIA 1NNUA 3ORSA 2OWDA 2A92A 2SCUB 1R0CA 3O8NA 2X2FA 1ECCA 2R68A 1AQLA 4YIHA 2PS0A 2I87A 5K20A 3U31A 1CP2A 2ZREA 1SOMA 1QQAA 3FTFA 1R8YA 2O07A 2JF0A 2BFDB 2FRXA 3P0JA 3V8NA 1HKUA 2NXWA 3LWNA 2O2DA 5FFMA 5H83A 3AUXA 5GONF 2A0WA 2V74B 1EXVA 3N76A 3BGVA 3QA3E 2PSHA 1KI9A 4UUBA 1QHGA 3TGWA 4IFTA 5GJBA 5DMHA 2BFWA 1DG9A 1DEOA 2J3QA 3RD5A 5TVKA 1D6JA 1OILA 1XZEA 2PZFA 3FJOA 2OFFA 4YV0A 1KERA 2O0KA 3GP3A 3GVHA 4H1VA 4Y30A 3I73A 4M1MA 3F6EX 3HBNA 1ZVJA 1B76A 5B58T 5CIYA 1OSNA 2P2DA 4C20A 4HR7A 2YWXA 2I8AA 3H1FA 1THGA 4DT1B 2GPTA 1E4EA 1RDFA 4G81A 3VI3B 3GGGA 2WDPA 3IIEA 3PP8A 5BYJA 3GP8A 1LLFA 3K2IA 4OI0A 2H5LA 2QROA 2AQKA 4EW1A 5AWFC 3LE8A 4TT3A 1HOXA 3ELBA 4DQKA 3SEQA 2HR1A 1H2WA 3GT3A 4FGSA 4PO3X 3PWSA 2Z95A 7ABPA 4U7PB 3H9BA 4Y1FA 3H6KA 3IEKA 4FB5A 2H51A 3E8XA 3OIYA 5IAKA 3OCUA 2XBMA 4EJSB 2VPYA 4G07A 2O8FB 5BNZA 1U81A 4IVNA 3ZNOA 2DBYA 4DSTA 4ETMA 4R0NA 2V59A 4JDUA 4X24A 4XD7A 1MGPA 4JSYA 3FH0A 4X94A 1XAGA 1EA5A 4QJ4A 1U28A 4RO0A 4GMDA 4Q4JB 5IC6A 5ALXA 1FFDA 1PJCA 2BFDA 2DY1A 2JJ1D 5D3ZA 2O7NA 3OPYI 4C7XA 2PZEA 2VJDA 3IODA 3AF3A 4AO8A 4I1PA 2PZKA 4L22A 4RZSA 3AHEA 4RVDA 1RQGA 5EE1A 4TV9A 4DDMA 5TARA 1Z8DA 4UPEA 3RVMA 1K3TA 3DTNA 3FCSB 3FOFC 1CB7A 4E12A 1W96A 1M6NA 4TM7A 1ZJWA 1SULA 3U7EB 1XL0A 3AM1A 2QW0X 1PK7A 2RI0A 1INLA 4Y6LA 1HLGA 2QIPA 3IULA 1ESNA 2GM9A 5U4QA 1IBSA 1CQWA 1VYHA 3USZA 1ZK2A 1VXRA 4MMYB 2C2BA 1ZQ1A 3TN7A 2I6UA 4H3SA 3OJWA 5LMZA 1WU8A 1MT0A 2C2KA 4KXFB 4PQGA 1FVHA 3G85A 4YLGA 3UAXA 1SUEA 3A04A 4LHXA 4KQ2A 4C5CA 2JLVA 2ZB2A 5B1SA 1XQ9A 4DPLA 5C2JB 2PHZA 2PX5A 1JBKA 4KO1S 2X7XA 3CV3A 2RHOA 3ZZTA 2C4TA 1DXQA 4ZU3A 2O2YA 4QPPA 1IHUA 4EJSA 1BQEA 4PS1A 1T0IA 2WHQA 2QLMA 1OAKA 3K0HA 3IKJA 3QFRA 2O8FA 1UBTS 3GDHA 5BSVA 4JYMA 2E6UX 3KKKA 4NMXB 3S2FA 2WD7B 3B6ZA 3GLIE 4AJEA 1DO0A 1GO2A 4Q4JA 5DTQA 4Z3KA 1U7PA 4CI9A 3ENVA 4BQOA 2J9YB 2AMYA 1HKHA 2WWIA 4QARA 2XLCA 3G2MA 3HLKA 4G0WA 3ROXA 4BNGA 1LNQA 1X7XB 4PYLA 4EI8A 1M2VB 4Y6QA 4D57A 3D3JA 3V5NA 1N3BA 5CFOA 4WBSA 2HIGA 5SY6A 3RM3A 3VXKA 4V1CI 4B4OA 2X5NA 4EVSA 2FW9A 2X9QA 5EP4A 1Z13A 4ZEWA 4EJFA 5K1ZA 2XB9A 4OREX 1FTNA 1N2IA 2VYVA 3EVTA 1GN8A 5C5DA 2HHHB 2X0EA 3Q5EA 5AIAA 5FJIA 5FJJA 3VPAA 4F56A 1LBEA 4BE9A 2GF2A 2XQJA 3RLFA 4XTRA 1DJMA 1Q7RA 2NW6A 3LPCA 3ROPA 1ZSYA 3MW8A 3PRYA 4YDQA 1RXIA 1Y9JA 3HHEA 1ZM9A 2G5PA 3QLEA 4LFCB 5KNDD 1GV0A 2J7PA 3EIXA 1V5WA 1ZN7A 2G36A 2VTDA 3T7KA 2ERYA 4ZVPA 3W79A 5BSRA 4QGSA 5AOCA 1RLIA 1E7RA 4UNPA 2EG5A 3LECA 4O3FA 3OEYA 4EX7A 5BOSB 3B12A 5AW8A 2KBEA 1NURA 4I55F 4YCDA 1CJSA 4CKBB 1CIVA 1Z0KA 1ODJA 2YV5A 4CNQA 2GTPA 2H1SA 5ALGA 1HRDA 4F7DA 3MTJA 821PA 1A50B 4D9IA 2JDID 3G5TA 1SEPA 4P9NA 2CBXA 5CK4A 4RQBA 2PUWA 4R1NA 5DHTA 3RHZA 2PJDA 1GQRA 4FFBB 3S4YA 3T06B 3TUZC 1P8JA 3U3JA 4U00A 2G1UA 1X7XA 3CZMA 3TGPA 1RHMA 3WS7A 1PTKA 3AW8A 1E6LA 4PSCA 4WK4B 2RH5A 5EZ5A 3E9CA 3LOQA 3FFBA 3IAFA 1KQ3A 1Y6QA 4ITUA 3K9NA 4KVFA 5FX2A 1J0DA 1N0VC 2HJSA 3IO5A 2RBKA 3TJRA 4U02A 1OASA 4E22A 4ZI7B 1GCIA 1VIDA 2PBZA 4JYBA 1JKXA 5H82A 3N9IA 3FHTA 3ONVA 3BE4A 3KC2A 4HDNB 3PNSA 1QX3A 2ZRCA 2WV7A 3HWWA 1TM2A 3MWEA 4QUIA 4ZVOA 3CG0A 2IUUA 1M8FA 2NWQA 3TYXA 3ZDYB 4BNWA 4U2GA 4A5OA 3LAWA 1XQ6A 2RAVA 3ZW7A 1OA0A 1RPTA 4PYRA 3E81A 1OXVA 1YUMA