3AFIA

Crystal structure of dbja (his-dbja)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
308
structure length
301
Chain Sequence
IRRAPVLGSSMAYRETGAQDAPVVLFLHGNPTSSHIWRNILPLVSPVAHCIAPDLIGFGQSGKPDIAYRFFDHVRYLDAFIEQRGVTSAYLVAQDWGTALAFHLAARRPDFVRGLAFMEFIRPMPTWQDFHHTEVAEEQDHAEAARAVFRKFRTPGEGEAMILEANAFVERVLPGGIVRKLGDEEMAPYRTPFPTPESRRPVLAFPRELPIAGEPADVYEALQSAHAALAASSYPKLLFTGEPGALVSPEFAERFAASLTRCALIRLGAGLHYLQEDHADAIGRSVAGWIAGIEAVRPHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloalkane dehalogenase
publication title Enantioselectivity of haloalkane dehalogenases and its modulation by surface loop engineering
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Hydrolase
total genus 107
structure length 301
sequence length 308
chains with identical sequence B, E, F
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2010-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3afiA00
3JWEA 2PPLA 1HKHA 1DTEA 2WU4A 4P93A 4BVLA 5C8ZA 4ARBA 4LHEA 3WKEA 4LYDA 3UMJA 4FTWA 5EHZA 5E2IA 2Y1KA 5ESRA 2XI4A 1J2EA 3RK4A 3G9UA 1UK6A 3WL8A 5K3AA 1VA4A 2QTBA 3ESCA 4BRSA 4E14A 2PSDA 3I6ZA 1W76A 5AK4A 1P0PA 4CCYB 1DWQA 3VJKA 1IZ8A 4B0OA 4U2EA 5LZ9A 1DINA 2VJAA 2J4FA 4ROTA 3PDCA 4U2CA 1CUCA 1M33A 3WKAA 1R9NA 2HA7A 1UK9A 3I1IA 3F8SA 1W75A 5AKKA 4TGLA 3GELA 4NZZA 3I6MA 5LIPA 3W2TA 4HRXA 5AM5A 4BP8A 2Z8ZA 3N2ZB 2VATA 3SWWA 1N5MA 1FFAA 2ZJFA 5ALIA 5JATA 1ZIYA 4D9JA 5JD6A 4ZI5A 3V1KA 4DMFA 4AB1A 1QO7A 5JANA 2CJPA 5BWBA 1CEXA 1VKHA 4EBBA 4ZV9A 2AJDA 3B3QA 1MAAA 4X91A 1JU4A 1XZLA 3E4DA 3DLTA 1T4MA 5A62A 2QZPA 2XUFA 2PM8A 3G0GA 3T52A 1QGED 1ZJ5A 5E4TA 4KJXA 2CUTA 3WK6A 3I2JA 2D0DA 4Y2XA 4G4JA 5K3CA 4C87A 5KWJA 4G4IA 1MNAA 4LYEA 1R3DA 5I8PA 3D5EA 2B4KA 1JI3A 3KDAA 5I9IA 1IZ7A 4C89A 1BN7A 4HS9A 1TKRA 2NW6A 4DMHA 2WLSA 4RE5A 5CMLA 4DNQA 4UBMA 2O2IA 3UUEA 1LPSA 4H77A 5ALNA 1QIGA 4M0MA 4WJLA 3R3ZA 3C6XA 1H2ZA 1CUHA 1GXSA 4U2GA 1CLEA 4J0CA 3W9BA 4JYMA 4BZWA 2VQ6A 3CCBA 1XZCA 4PSDA 3S8YA 3QMVA 1WHTA 1RYYA 2EDAA 1WPXA 4X71A 3L1IA 5JARA 3HRHA 3GUUA 2XMSA 3H1BA 4RPCA 1E8NA 1QZ3A 3ZWQA 4J0JA 2RAUA 1Y37A 1N5RA 2ACKA 4CCYA 1U8EA 3QYJA 3R0VA 3MUOA 3STTA 2VT6A 4HXEB 1XZJA 3D59A 1XZMA 1YAJA 5HK8A 1H2YA 2IIVA 3DOIA 3AILA 2ZYSA 3Q8WA 5C81A 1H2XA 5CRIA 2YH2A 3PFBA 1K6EA 4WDQA 1S8OA 3W9UA 5AKYA 4BVJA 4BVKA 4G8BA 3LS2A 1YS1X 4K2AA 1TRHA 4P08A 3F9CA 5ALRA 4ETWA 3WL6A 4K6KA 2GBCA 2GBIA 2JGFA 2ECFA 4UFNA 4K5QA 5FKJA 4FFWA 2C5GA 4C6HA 3I2FA 1AMNA 2Y2VA 3H17A 3QMMA 2HDWA 5AI4A 3DYVA 1DX4A 5AH0A 5ALSA 4Z49A 2I78A 4Y2PA 3NOXA 5AM1A 1ZOIA 2BUCA 5LZ7A 3H2JA 1BEEA 5DTJA 1PJAA 4GWLA 2JGIA 4DSAA 3A6ZA 5BOVA 2HU7A 4HTAA 3WYDA 5C7YA 5A7FA 1O6GA 1SC9A 4WFKA 5IVKA 1FFBA 1Y7HA 1L7RA 2WHQA 5FXMA 5AKHA 4J7AA 5FPQA 4HAIA 4AZ3A 1IMJA 1AKNA 4OPMA 1LLFA 4YX9A 1UZAA 1TCCA 1XZHA 3AZOA 2XMGA 2WIFA 4GI1A 2QXTA 3DD5A 2XUHA 3I2GA 3KSRA 3CN7A 1CUEA 5EHNA 5DYTA 3V48A 1EI9A 4NS4A 2RGUA 4HVTA 3SK0A 3N0TA 4P9NA 3FYUC 4DIUA 4M0EA 1AURA 5SYMA 1EHYA 2HM7A 5CH5A 3AUKA 2WTMA 4GXNA 5JZBA 1EB9A 4B83A 2PU7A 1CUUA 3ZLUA 2PKYX 4OYYA 1A8UA 1N8SA 1CUJA 2DHCA 3HACA 3DQZA 4CG2A 5E4YA 1XQVA 1FSSA 2WIKA 4BTLA 2B20A 4ARAA 3O4IA 1QIJA 4Y2TA 1OXMA 2UZ0A 4UBKA 2OGZA 4ZRDA 3ICWA 3BIWA 5AOAA 4OSEA 3ED1A 4BB0A 3ESDA 4JH0A 3H1AA 1YB7A 1W1IA 2WFMA 3L1HA 3W04A 1GKLA 5JZSA 1H22A 4MWTA 1CRLA 3HABA 5ALTA 3WWDA 4J0GA 1SCQA 3WK4A 1R9MA 4OD0A 1SOMA 5KBYA 4RE6A 1CUGA 1F0PA 2J3QA 4G4GA 4ZWNA 3T4UA 4K6HA 4QDZA 3PICA 4FBMA 4WCVA 3LLCA 2BAGA 1B41A 1ZI6A 5EFZA 2OPHA 2ROQA 3QVMA 4UFPA 2W22A 1C7IA 3ILSA 2DQZA 1DQYA 2VJDA 3AIMA 4X97A 2QXUA 1LNSA 2WG1A 3O4HA 2GYWA 3R3UA 2Z5GA 4X90A 3STWA 2HA5A 2ZVDA 4HXFB 3VXKA 2OLEA 4GECA 5BV7A 4DSZA 1XRMA 4NMWA 5J3JA 3UUFA 1CUDA 2OAEA 4EB0A 1XRNA 2HADA 1JT2A 2HHAA 4FNGA 1P0QA 3DKRA 5D6OA 3A70A 4BE9A 3IUMA 1JJBA 4DNPA 4UFOA 5IVDA 2WFLB 4CFSA 5AI5A 4EUSA 4H7EA 3R40A 1AC5A 1C4XA 1E8MA 3A2LA 5ALZA 3NGMA 3FVTA 5CW2A 3STUA 1IUNA 1KU6A 1MX1A 4CG1A 3EQ9A 3C6YA 2WIDA 3FCYA 4TVKA 1EINA 3FWHA 5AIBA 4DNOA 4X94A 4AN1A 5LZ4A 4JYPA 5LZ2A 2JGJA 5CT4A 5ALGA 3WK9A 4CG3A 4FLMA 3BJMA 3WJ1A 1ZD3A 4N8EA 2H9YA 5AIAA 4WDRA 1ODCA 2O2GA 5AI6A 3DS8A 2WHPA 5KWIA 4MEBA 5CT9A 1TIBA 4JEIA 4X85A 3AIOA 1XZDA 5HKBA 2XUJA 3U0VA 3C5WP 3ZI7A 1JJIA 4H7KA 1MNQA 2Z3ZA 5ALOA 3WMRA 1SFRA 1E8DA 2HA4A 5AP9A 1QLWA 4J3JA 1EVEA 2V98A 3O4JA 2R8BA 3WWPA 4EZIA 2XUOA 2I3ZA 2PX6A 1MTZA 2WFZA 4QZVA 1R4ZA 3WKBA 2K2QB 2BFNA 3EQ8A 4BCCA 2B61A 4Y2QA 3ICVA 5AM2A 4CIAA 5ALPA 4MJ3A 2VT7A 4OYLA 4W63A 1RWQA 4B0PA 1GGVA 4X95A 1WPRA 5F4ZA 5LP1A 1N1MA 4QEKA 5EGNA 2HRQA 1MO2A 1HPLA 5HK9A 1R1DA 3MUNA 5AKEA 3H04A 4PSUA 1GPNA 4U2FA 3FSGA 4FMPA 2LIPA 3G9XA 1SCKA 3WIBA 1YASA 2WFLA 3WQHA 1WB6A 3I2KA 1WOMA 4B81A 1CUWA 3FLEA 4OUKX 1HDEA 1A8SA 4FBLA 3FBWA 1U65A 4PW0A 4XJVA 2WU3A 5AM3A 4B6GA 2CBGA 1LPPA 2AXEA 1AUOA 5D3KA 5IKXA 1E66A 3QPAA 3VDXA 1CUFA 2C0QA 3WL5A 4UHDA 5EI5A 4BAZA 2Z3WA 5HF6A 2WUGA 2VF2A 2PSFA 4IQ4A 4PO3X 3TEJA 4FOLA 3KWJA 1VE7A 3CXUA 5JZ9A 4BAGA 3STYA 4G5XA 3NUZA 1E3QA 1DU4A 4IH9A 2BKLA 5A2GA 1Y7IA 3D3NA 4J03A 4QA9A 4XWGA 4C4XA 4QE3A 4ZREA 1TQHA 3WK8A 2E3JA 4W1RA 4KACA 2YYSA 4AZ0A 1H23A 4L0CA 1UK7A 3I28A 3DDUA 2QUBA 3C45A 1XQXA 3U1TA 2WILA 5A7GA 2OCKA 5LKAA 2O7VA 3FYUB 1X2EA 1EXWA 1QTIA 2XUPA 1LGYA 3DYIA 3C70A 1BE0A 4UHFA 2ZJ6A 4CI9A 5ALHA 2WUDA 4BCBA 3GZJA 2PU5A 3PE6A 3C8HA 3OTQA 3D0KA 2DHEA 3AZPA 4L72A 4OU4A 5ALVA 4QDUA 3QBJA 2QVBA 2DCMA 3C6ZA 1BROA 4BDSA 1Q0RA 2XQGA 3QITA 2FX5A 4WFIA 5JD5A 1E89A 2BGNA 5LZ5A 3PFCA 3GROA 4LXIA 4PF1A 2ZJ7A 5JASA 2P8SA 2GBFA 3I6YA 1QIIA 1CPYA 4UBIA 4BTVA 4QNNA 1QIHA 2VEOA 3A2NA 4I3FA 4KE8A 3V9AA 5ALEA 4AN0A 4BP9A 1VXRA 3Q0TA 4KE6A 5ALFA 1UFOA 3WL7A 3WWOA 2XLCA 1KU0A 1F6WA 3QPCA 3B12A 1CUBA 1VA5A 2XMRA 5H3HA 4Y9SA 3JW8A 5AI9A 4MQLA 2FJ0A 5K3FA 3O0DA 1GPLA 2O7RA 1DWPA 3WYNA 4UHHA 3PI6A 1CQZA 6YASA 4H0CA 1QFSA 1BS9A 2AJCA 1WB4A 1UK8A 1MJ5A 2D5LA 3F98A 2WG2A 2VJCA 4QWMA 1EDBA 3R3XA 4HXGA 4O08A 1X2BA 4OB7A 1FJ2A 3OM8A 4INZA 4H7FA 2WJ3A 3FLBA 4CCWA 4S0XA 1THGA 3MVEA 3G02A 1ODSA 5FPPA 3TGLA 5JIBA 3ZLTA 4MYDA 4AO7A 1EVQA 2XLBA 4JUIA 1MT3A 5A7HA 1K4YA 3FYUA 5AK5A 4IH4A 4FNMA 2XUIA 2AJLI 5JAUA 1F8UA 1F0NA 1MX5A 4G1FA 1OCEA 2HFKA 1H2WA 4X93A 1XRLA 3H2IA 5CT8A 5C8XA 1B6GA 1J07A 3WKCA 3SC2A 5DNWA 1Q84A 1QIDA 4KR0A 4AO8A 1ISPA 2QT9A 1LPOA 3LCRA 4CIBA 4IHAA 1MPXA 3RLIA 4A16A 1XZGA 5DYWA 3PF9A 4LKOA 2EEPA 3BL8A 3QM1A 5JALA 4YK7A 4AQDA 3V1MA 2OQVA 3G0DA 1CUIA 5K3EA 3IBTA 3H2KA 1FFEA 3BE8A 3AZQA 1UWCA 3ESAA 4W1SA 2PBLA 4B7ZA 3F96A 2WIJA 1YR2A 4QLOA 3P2MA 1L7QA 4KRYA 4C4ZA 4WFJA 4MEAA 1QIEA 2BCEA 4PNZA 1AQLA 4GHWA 2HU5A 2HL6A 4UHBA 5CT6A 2HRRA 2PUHA 3BWXA 1XZFA 4J0HA 2ZYIA 1XLWA 3LIPA 4GBGA 3ANSA 3SX4A 2G5PA 1XLVA 4YASA 2W6CX 2JEYA 4Y2VA 3WK5A 5AICA 1UOPA 4KAAA 2XMCA 1AZWA 5D3ZA 2BUBA 2WHPB 2BUAA 4BBZA 4BC0A 4BRZA 5ALDA 7YASA 5AK3A 3GA7A 1C7JA 4IH1A 3KOOA 3G0BA 4BZZA 5AKLA 2V9ZA 5FP0A 5EIAA 3AFIA 3LP5A 4AO6A 2ES4A 5HFAA 2CZQA 2XUDA 1BCSA 5AO9A 3CN9A 1ZI8A 4UBLA 1AGYA 2GYUA 3OPMA 4OCZA 1YA4A 5HCUA 3MGAA 4X3CA 2IITA 2XQKA 1K5PA 2WM2A 4B9AA 1QE3A 5CH3A 4J0KA 1VJ5A 3BDVA 2Z8XA 4UHCA 1LZLA 1UT6A 1THTA 2DR0A 4MWSA 1FFDA 3BF7A 1XZAA 2BGRA 4FKBA 2WSLA 1MX9A 3H19A 4QDTA 5ALJA 3IUQA 2C4HA 4H7JA 4AX4A 3DEAA 1G4HA 1QO9A 3VKFA 1EK2A 4I4CA 2H7XA 4X6YA 1WM1A 1AX9A 5ISMA 3DL4A 5CXXA 2ZSHA 4H7HA 2WKWA 2I03A 2GZSA 2WUEA 1BU8A 4EY7A 2PSJA 2Y6UA 2EDCA 3OOSA 4PQEA 1ACLA 4XIIA 3OG9A 2XUAA 1SCIA 3VVLA 4OB8A 3RKSA 5HKAA 4H7IA 5AM4A 4OU5A 4GEGA 2OCIA 3BXPA 1ZGBA 1XRQA 1XRPA 4BC1A 4YPVA 2G5TA 1GQSA 1TCAA 2VA9A 1J1IA 1NU6A 4UBJA 1WCYA 5JD4A 1DX6A 1GKKA 3JYHA 3E1GA 2JGEA 3STVA 5ALMA 2YXPX 2IX9A 4AXBA 2YASA 1W6RA 3KD2A 5ALQA 4EY6A 2G63A 5JAOA 2QJRA 4DLNA 5AKXA 1VOTA 5JADA 5DJ5A 3WZLA 3D2AA 3ESBA 3HZOA 3DNMA 4H35A 2Y2UA 3HLKA 2WJ4A 2WUFA 1XZIA 3M3DA 4U2DA 2WG0A 4I19A 5AKIA 4N5IX 2C5FA 1EK1A 3C6BA 2QMQA 5JYCA 3FNBA 1CFJA 5DYYA 3O9MA 3FVRA 3W06A 1ETHA 4Q3OA 2VAXA 1LPAB 5ALXA 1YS2X 3H18A 3R3VA 5EIEA 5AM0A 1XFDA 4Q3LA 4LIPD 5CH8A 3M82A 1NX9A 1CVLA 4GLBA 1DT5A 4G9EA 3R3WA 3G8YA 5IH7A 1T2NA 4QLAA 1HQDA 4Y2YA 1QTRA 1JFRA 1YAHA 5IVIA 1QIFA 5HF9A 5K3FB 4Y7DA 1DT3A 1A7UA 3H2HA 5T4EA 4L9AA 3FYTA 2CMFA 1MAHA 2CB9A 2Q0XA 1ORWA 5DNUA 1ZD5A 2OGTA 4A5SA 1U4NA 3F97A 4L3WA 4QDXA 4U2BA 4E46A 3HI4A 1XZEA 2O2HA 2QM0A 4KEAA 2OCGA 2JGLA 2X5XA 5T4HA 1J06A 2QRUA 2C58A 2WIGA 4Q82A 1HBJA 5AI8A 3NWOA 1XLUA 4X6UA 3M83A 1HL7A 2OXEA 4UPDA 2JF0A 2RI6A 5AKJA 2JGKA 1TK3A 1QIKA 5ALUA 1A88A 5HF5A 2VTVA 1BEZA 2HA0A 4Q34A 2XDWA 3S2ZA 5FRDA 4Q05A 1OILA 2QKYA 4G8DA 3KWFA 1K8QA 4W1PA 5CBKA 1MN6A 3BDIA 2X76A 2OCLA 2XMZA 1CUXA 5LLSA 1ZI9A 3WZMA 5AOBA 3KXPA 1UKBA 5HQ3A 2QR5A 2RONA 1LBTA 3B5EA 2BJHA 1UKCA 3IUNA 2JEZA 3D2BA 3BF8A 4MQMA 4PSCA 3O4GA 4GDMA 4MYSA 3L1JA 3IULA 4JNCA 1FFCA 2ZSIA 5A6VA 4F0JA 3DCNA 3FOBA 2V96A 1BRTA 1LBSA 4Q1VA 5AI0A 5ALKA 1IUOA 5FOQA 4F60A 1GPKA 1ZD4A 2C7BA 3BIXA 3AJAA 1UKAA 1ZGCA 3R3YA 2HFJA 3BJRA 4C01A 4H18A 3WKDA 2I3DA 3PUHA 1YSCA 3PUIA 4ZGBA 1EDEA 1G66A 4N8DA 1JU3A 3FAKA 2H7YA 1QFMA 3ANTA 5DTIA 4AMYA 2J4CA 2XUGA 2QJWA 4X7BA 3GFFA 2RHTA 5DWDA 4RNCA 4KYVA 3X3HA 4GW3A 1EA5A 4EA6A 1CUZA 2AJBA 1DWOA 3I1YA 4XVCA 3IUJA 2HA6A 4BAUA 5AKGA 5T4FA 3RM3A 5HFNA 2OAGA 1WHSA 4G9GA 3WIOA 5D7BA 2B9VA 4WY5A 4C4YA 3ZPXA 3EIOA 5JAPA 1BN6A 2FJPA 1JJFA 4PV7A 4ZV7A 4MXDA 2OQIA 3V1LA 4K6GA 5FUMA 3DJYA 3WK7A 3WI7A 4AMZA 3HEAA 3EF3A 4DMCA 5E4JA 3ZV7A 2PSEA 4ZXFA 4DYHA 3HSSA 1VZ2A 1XZBA 1QONA 2RIPA 5AOCA 4EY5A 4UBOA 4RGYA 5CTAA 1VLQA 2AJ8A 2XMQA 2X8BA 3IA2A 5T4BA 3I2HA 4DM7A 2CKMA 5ALLA 5A71A 5C8VA 4QWWA 3I2IA 2ACEA 4Y2JA 4N8SA 4KRXA 1P0IA 1GQRA 2ZYHA 2XUKA 2XUQA 3C87A 2XB6A 4WY8A 2V97A 4UUQA 1XZKA 1LZKA 4Y2SA 2C0PA 4LXHA 2CEKA 3QZUA 3WA6A 2HA2A 2WJ6A 4BYMA 4QDOA 2XT0A 4Y2UA 5AJHA 3K2IA 5JAHA 4H7DA 1YB6A 1G5FA 1XKTA 2Y6VA 4X00A 5AHXA 1CR6A 2FUKA 4W9RA 1YA8A 1XRRA 3EQ7A 1IVYA 3M81A 1LPBB 2XMBA 4EHBA 3K9BA 1L7AA 3YASA 2PUJA 1QIMA 2JBWA 1EDDA 5K3DA 3QH4A 4NVRA 4B82A 4EY4A 1O6FA 3D4LA 3IDAA 4TPKA 1JMKC 2DFPA 1CUSA 1ZD2P 2OGSA 1I6WA 4A23A 1A8QA 3R41A 3IB3A 1XKLA 1EX9A 3E3AA 5SYNA 1PV1A 4B85A 1ZIXA 2HIHA 4BCDA 4F5ZA 3D2CA 1ZICA 3IIIA 3O9VA 3E0XA 2WHRA 5KREA 2JGMA 2R11A 2ORYA 1CQWA 1EH5A 1VZ3A 4ITVA 3H0CA 3PF8A 2JIDA 2HU8A 5AK6A 4UHEA 4KAJA 5K3BA 1BCRA 1XQYA 1Z68A 4LXGA 3WWCA 5LYYA 3C8DA 4M0FA 4X92A 1GZ7A 5AKZA 3VJLA 2PVSA 3ZLVA 1QOZA 3EBLA 3OURA 1UXOA 4KE7A 1VXOA 3IVMA 3FCXA 1YCDA 5IVHA 3G7NA 1W4LA 4X6XA 1ZJ4A 4BDTA 2DHDA 1D07A 1JMYA 1WB5A 3K6KA 4F21A 5ALWA 4DNFA 1CUVA 3G0CA 3TJMA 1RP1A 3TRDA 2HA3A 2QOEA 4FHZA 1CUAA 3DOHA 4UBNA 3RARA 2VSQA 2WTNA 2VAVA 5YASA 3G9TA 4E11A 1MU0A 2QS9A 2PSHA 5CXUA 3STXA 1LPMA 1TCBA 3G0IA 1KEZA 3VJMA 3CCCA 1G42A 3O95A 3DL7A 4DTCA 1PFQA 1U2EA 4FWBA 1QJ4A 5DLPA 3IURA 1NU8A 4J0IA 5CURA 1ODTC 4BATA 5FV4A 4IO0A 1IUPA 2QUAA 3WJ2A 2GYVA 1XQWA 1ACJA 3AINA 1Q83A 1TAHA 3G9ZA 4E15A 1CUYA 3W05A 2DQYA 4KE9A 3C5VA 1W52X 4XX1A 3HXKA 2DSNA 3DKKA 2ZYRA 4FFVA 1R50A 5LKRA 2G4LA 3WA7A 2WQZA 3C43A 3FLAA 1DQZA 4HZGA 4EY8A 3HC7A 5FDFA 1EB8A 2GBGA 3HYSA 4G8CA 4B9EA 2OG1A 3V1NA 4P92A 1K63A 5I7UA 5EIHA 4N5HX 2ONCA 3HJUA 3FSGD 5CT5A 4FDMA 5FLKA 2PL5A 2XQIA 2H7CA 5EHQA 4DGQA 3VISA 1ORVA 1XROA 3GBSA 2XQJA 4C88A 2J3DA 4V2IA 5BWCA 3H2GA 2XMDA 2XQFA 4Y2RA 3F67A 5EHXA 3WWEA 4Q3KA 1X70A 1UOOA 3AIKA 4FLFA 1GT6A 3OC0A 5DNVA 2RHWA 2VJBA 3D7RA 1P0MA 4B80A 4HRYA 5ALYA 2H1IA 5HF8A 3LIIA 1USWA 1R88A 1CV2A 3QPDA 1Q0ZA 4OB6A 1VE6A 3A2MA 1UOQA 5K5EA 3VVMA 3WLAA 4B84A 4FLEA 4J0DA 4DMKA 1HLGA 3QMWA 5HQ3B 4BE4A 2GZRA 1JKMA 4KAFA 1E5TA 2XE4A 1CIJA 5LZ8A 5HZGA 1LPNA 4W1QA
chains in the Genus database with same CATH superfamily
4MQFB 1EK6A 1M0SA 4FKMA 1Z47A 4LNUB 4IWXA 3QNMA 3H0EA 5DXAA 3RSGA 2D1QA 3M0EA 4AJ9A 4XDHA 1C80A 5GP1A 1JGTA 2WU4A 2Z6QA 7ADHA 1Y1RA 2IHZA 3G7SA 1TD1A 2WD7B 2B4RO 2HRCA 1ESDA 1NUAA 2GVDC 1EDZA 4FQ7A 2CLFB 3ILVA 2R9VA 2IGTA 3NTVA 3I04M 2GF2A 1UFQA 2IZ6A 4TWAA 2W6MA 3QVTA 4LYDA 1FFXB 1K5DA 3UMJA 4FTWA 3W6OA 4BB5A 4D74A 1VHLA 1GTSA 2G04A 1NOIA 4KQJA 1RMYA 1HQCA 2Y1KA 5AVYA 2JGDB 2NQ2C 2PMFA 1MEOA 2ZIWB 3JR3A 4CNBA 2XIJA 3CVWA 4YYZA 3ZVMA 4DQVA 3K5WA 1RADA 1YQ9A 3S1AB 3DE3X 4WOPA 3HDQA 5COAA 4DT1A 4UXJA 3GRUA 2PGJA 1N0VC 1RJGA 3H13A 2V6MA 3N8HA 2IZ5A 4CLRB 3PCTA 2WA2A 3A4NA 4ECEA 5K6AA 4GPEA 1QCZA 2CDNA 2WSBA 3ZHXA 1NJ5A 5TGDA 1IZ8A 3JD0A 1VCIA 3NBAA 1ZCJA 1RWXA 1ZU5A 2C78A 4B0OA 3U7FB 1G5HA 2J4FA 5E7JA 5BSWA 3SXJA 1DC4A 4NBRA 1WCXA 2FZKA 3T7RA 1ECFA 2H5JA 1KWKA 1GDTA 1D2AA 1HL3A 1QDLB 2ZULA 3AGQA 3H3FA 4XQ9A 1M76A 1M33A 2PZFA 4AJIA 4B17A 4PZUA 1ISRA 4Z4IA 3I1IA 3OPYA 5BQ5A 1IXRC 2I65A 3F8SA 1AY0A 4UTZA 2ZVPX 5AKKA 1AQJA 1Z0AA 4NZZA 2WNIA 2H2WA 3TLZA 5KIAA 3IOMA 4XQEA 5AM5A 5EINA 4LQCA 4C0JA 3EXAA 1E3JA 3QA3E 4PSAA 4BP8A 4W5NA 2FUG1 1TQ4A 2G4VA 1WHSB 3U26A 3ZTWA 4Q93A 3WBKA 4HO1X 5BR1A 2K87A 1N5MA 1G41A 1UZUA 2YWRA 3TKYA 4MUFA 1UM9B 4NJEA 2ZJFA 4IV8A 5E7QA 5ALIA 5TE9A 1G5PA 1MVOA 1M2NA 1X7YA 4F56A 4OMCA 2GXSA 1ZIYA 2GCPA 1Y8QB 2VDPB 4X8HA 5ENDA 3DBRB 3QOFA 1J20A 4HLNA 4IMJB 1MG5A 1V4VA 3O93A 5EZ6B 1EHIA 4E2WA 3WIEA 5JS1A 4JU9A 2ODEA 5I48A 3V4LA 1TAGA 1QF9A 1QFXA 1Y5LA 1XVIA 3L43A 3NJ8A 3V1KA 4MGKR 2PUDA 1U7TA 1JIKA 4AMBA 2EX0A 4Q9KA 1QO7A 3V4ZA 3Q3JB 4IHQA 1DARA 2CJPA 4A73A 2XTZA 3KB8A 2GPNA 3M2PA 5BORA 1YKFA 2J5BA 4XXHA 3EX7C 4RPLA 1YVEI 3RVOA 3OESA 1T2UA 3SJ7A 3I23A 3GNLA 1NT2A 2GA9A 1MH1A 3SMQA 4MV4A 1KC1A 1E96A 3DBIA 1IB0A 2MTBA 3LT0A 4UHJA 3AUFA 2X13A 4EEXA 4HEHA 5A62A 3DBHA 2IXGA 2VPIA 4QJ5A 2IL1A 3NTRA 1KY4A 3OICA 2PM8A 4RVFA 1FNDA 3D6VA 3G0GA 3DAFA 2ZUEA 3KKLA 1ZJ5A 3DPUA 2NSDA 2P9YA 2R4QA 1WXDA 4ZCSA 5KSZA 2LZ0A 5A0TA 2E48A 3I2JA 3UN1A 3V33A 4ZK6A 1V41E 3GDGA 2FP3A 2OHXA 3D5QA 1QZUA 3I9V1 3C3MA 4G4IA 5D87A 5GJBA 3HPQA 3O7WA 4AULA 1LEHA 1A2KC 2ILVA 4ALNA 3KSUA 3HP7A 4WZZA 3GJ6A 1Q3TA 2HCTA 3P2KA 3IJ5A 4EI2A 5JQWA 3GEGA 2AQIA 3HV0A 4JOSA 2B4KA 3KDAA 3RRBA 4F5YA 2X8WA 2AXNA 5I9IA 3TECE 3UYLA 4C89A 1QGYA 4L0DA 4Z1OA 1BN7A 4JXJA 3R9WA 2YIMA 2H0QA 4OEHA 4Q9DA 1N75A 4DMHA 5JSQA 2P68A 1L7OA 3AJRA 3ZV5A 2GPJA 1IG0A 3OJFA 4M1OA 4DS3A 4PWZA 4CKWB 4DNQA 3CH7A 3PNKA 4CTNA 1K2VN 3AESA 3I09A 3ROTA 1RJ9B 3DOEA 2Z09A 2NSJA 3AV3A 4H08A 5HS4A 2BR3A 2O2IA 3B38A 5LQCA 1DBPA 1X8XA 1UEXC 4FHEA 4FHFA 2OO7A 1D2GA 4LY9A 4RVDA 3UUEA 1LPSA 2R68A 5ALNA 1QIGA 2H4XA 3MEQA 4LI0A 4XUCA 4CN8A 1Y8ZA 2J85A 3R3ZA 1H2ZA 3WVNA 3ZDZB 2E37A 1BXGA 3GK3A 3LPCA 1ODJA 3INGA 2VXYA 2W2XA 4RVCA 4I36A 3NS7A 3R5FA 3ICEA 3MILA 3UF0A 3L6UA 4JYMA 1GNLA 3IVGA 3K2EA 4QUGA 5IAOA 3FMPB 4WJKB 4BMPB 1UBUS 2O57A 3ADKA 1KIMA 4WKOA 1S89A 3GFBA 4YRTA 4ZAVA 1DDIA 5LQJA 4ZTZB 4YACA 2IHVA 5JO9A 3A36A 3QMVA 1HDGO 1JTEA 1X80A 1TUBB 2XITA 2V5AA 1EAYA 1KDPA 2F4NA 3IKMB 4X71A 4UZEA 5I9SA 3K6SB 4LPSA 3GLGB 2Q3CA 4B7AA 1QTQA 2Q2WA 4N3BA 1KQGA 4LZOA 4RPCA 4J07A 3E61A 1QZ3A 2JRLA 2ZJ3A 5JO0A 3G5AA 3R20A 4EPXA 3EOBI 3OQIB 1N5RA 1N7GA 2ACKA 1GZ3A 3K6RA 4CCYA 1R27A 4MW1A 4UMDA 3FFWA 3Q7PA 1G2OA 4YP7A 1C0KA 2Z2IA 2CNWD 1S2DA 1G1AA 2QZ9A 3FDZA 4TQUS 2FSVA 2JI6A 2HF7A 3IKJA 3I8XA 1QSGA 4MRSA 5E8RA 1V16A 2H92A 3M6IA 4Z4CA 3EMDA 2FN8A 2FZ4A 3FTNA 2A5LA 2J3MA 5KC8A 4QUEA 1H2YA 3EYWA 4G0MA 5HXAA 3C1TA 4MR7B 1BVYF 5LJLA 4S24A 1U1FA 4UM8B 5JSHA 3I45A 3NYWA 1WOYA 1XELA 4NR0A 4FC6A 1D6MA 5C51B 3LK6A 4MV7A 3A3OA 1S2MA 4MDEA 2FLKA 1DUIA 1QP7A 3RVPA 1UANA 1Z62A 2QVZX 1ZOPA 3L8CA 3F5MA 5IYZB 1E59A 4LCJA 2OILA 3CVVA 1R6XA 3PEYA 1CY4A 3LWBA 1S8OA 2GAIA 2GUWA 4TYMA 3DUFA 2I6SA 2REBA 3GFPA 3JXEA 4ZOLB 2A9OA 1N2ZA 4ZOAA 2GPTA 3LS2A 1PCXA 3INYA 4K86A 2IYFA 1LY1A 1TM2A 2CVFA 3V4VB 3EA5A 2I6TA 5E6SB 1H9CA 4N4AA 1XJ5A 1U3TA 4BEVA 2GM4A 3COWA 1FUIA 1G60A 1N0UA 3QY0A 4F1KA 2GPAA 5ALRA 3IQXA 5DRYA 3TZLA 2V7XA 1PFVA 2PLRA 1QH1B 5GQSA 4AJEA 1RR6A 3OF2A 1AJEA 3CNOA 2Y1CA 1QS0B 3A7DA 1A7KA 4LK3A 4D2IA 1QRTA 4DA0A 1HQYE 3DBOB 4PRZA 4AS2A 3AHHA 3HV2A 5CLQA 3IHWA 5KYYB 1TM7E 4RTJA 2ZM5A 1TL7C 1S2GA 2QGNA 4CMGA 4FFWA 1IM8A 2C5GA 1PJ4A 1Z8FA 1ZCFA 2ZIAA 3I2FA 1P1FA 3TIFA 3H16A 2Y2VA 1NIPA 1JJ7A 3H17A 4YONB 2W00A 3Q85A 4EB6A 1N32B 4N7RA 3DYVA 4NZPA 4JA2A 4L22A 1QG0A 2IHBA 1DSSG 2L0XA 5ALSA 3T38A 2FK7A 3VDQA 4Z49A 1J70A 2I78A 4XYBA 1R0KA 3MJVA 1NNI1 2KW5A 2NSLA 1KORA 1DKLA 2BUCA 2C2HA 4OQMA 4X3PA 5GPBA 3H2JA 3CKYA 2N3ZA 4MUXA 3ZJ5A 1BEEA 1T9ZA 2VHXA 1RXVA 2WBLC 3COZA 4LS3A 6ABPA 1TPZA 4HWPA 1S9DA 3DE7X 4GWLA 4QUHA 2VPWA 2D3TA 2ZB2A 1SKMA 1CTQA 1T1GA 2FVXA 2JGIA 3A6ZA 4JJFA 3MWGA 1FNCA 1TEHA 2HU7A 5BOVA 4D8YA 2QL9A 3P9CA 3VPDA 5C7YA 2NPIA 3VPHA 5A7FA 3TD9A 1KVUA 3L8ZA 4WFKA 1TYDE 4ZA2A 1HT1E 3D3QA 4GX5A 1JECA 4LCEA 4MUNA 2ZJBA 4DV4B 4AD8A 1XALA 3WLFA 4HDRB 5AVSA 3A6PC 5G1PA 4D8UA 5DH9A 3MQFA 3FCUB 4FKZA 3IEMA 4OMFG 5AKHA 4YV0A 2FW7A 1WUKS 4NOMA 4Q21A 4TL8A 4A3SA 1EWYA 4BMDA 1QHYA 2FFQA 4QODA 5B3JC 3ETCA 2FEKA 3OD1A 1T9AA 5FPQA 4AZ3A 4ZGGA 3I62A 4IHJF 3SFVA 1ULTA 4ER0A 2DFLA 4G37A 1T0IA 4L6AA 5LMCA 3PLNA 5C4MA 2ZYTX 1LLFA 5F4BA 4KVAA 1RAFA 2Y1GA 2DY1A 4E5DA 1P5FA 1GCOA 1X13A 2Q5OA 1XZHA 1WD7A 3L4JA 1L5MA 1FTYA 3Q5EA 1N0WA 2F59A 4O4IB 3UANA 1RC8A 4HI0E 2FW8A 3A1CA 3N1UA 4PO9A 1U0OC 3U16A 4FB5A 3F3YA 3EDMA 3PWSA 2X2OA 2YWJA 4JMPA 4OQFA 5BQPA 1XJ0A 3WTBA 2GR9A 1PG0A 4GI1A 2QW0X 3QPVA 4WVFA 3HHPA 4EATA 3MJSA 5G0WA 3Q9NA 3G2HA 4LAFA 3TLAA 1YULA 5EIFA 4DMRA 3A6JA 1F4PA 1STOA 1W4CA 2GCNA 1XL0A 4XARA 3CN7A 3EQ2A 3V48A 2QPLA 2CLEB 1Z73A 4RCYA 4Z53A 1K88A 3DMYA 1HXHA 4P4SB 3P9IA 4MGHA 5FORA 5IJAA 4DLLA 4NS4A 3H7IA 5ADUS 4HVTA 4YTEA 2VSNA 2F2TA 4DV5B 2CNDA 1T8TA 2B98A 4M1ZA 4CIWA 4O1MA 3AI3A 1H2RS 1TQ8A 1N4AA 1PL0A 4J3FA 4ZRNA 1KYQA 5C8YA 5HJ7A 4DIUA 1JDSA 3H83A 3L79A 4BVAA 4F3RA 1IBCA 4K2HA 2W6IA 3DV2A 4M0EA 5JTTA 3PCXA 1QVZA 2EQAA 3S1LA 1TYCA 3AUKA 1COWA 3U48A 2E4YA 1NLUA 4GXNA 2PA3A 5JZBA 3R75A 2D5IA 5D6NA 4DA9A 3UJHA 4ZRMA 5FPTA 1VB5A 3M6XA 1PR5A 2YN2A 1Q7TA 3AI1A 2QD5A 1QYCA 4H15A 4E2FA 1ZPDA 1E99A 1AKUA 1X7DA 2GFHA 2GRJA 3V8BA 4ZI7B 2H54A 4W8HA 5JXIA 1VYVA 4UM9D 4D3ZA 2DHCA 1KYTA 3DQZA 5FWNA 3V6LA 5LOVA 2G1JA 4BNFA 4C7KA 3BWMA 2NTEA 2NU8B 1XQVA 4OVKA 5HA5A 4IHKA 5IJ0A 5ESWA 2EZ9A 3CVOA 5WRFA 2KS6A 2LE0A 3BL5A 1DPFA 3KLOA 4G56A 5DNCA 5ITSA 4J43A 1O8CA 1XCLA 4YJ2F 3AO0B 521PA 1V11A 4JVNA 2IEAA 3C15C 3BMOA 4UBKA 3G2IA 3E3LA 1MC8A 4ZRDA 5F2OA 3RIEA 4DLZA 4ESVA 4EHLA 3ZVLA 4AJJA 1N6HA 1I0IA 2FZLA 3ICWA 4NBWA 4OIFA 3BIWA 3TIIA 3TNDA 2NUTB 1LBEA 1T2CA 3TBHA 3K0HA 5AOAA 3V5NA 4BU0A 2QR2A 4IVRA 3HKCA 4X1YB 1AV6A 3TR5A 5I5GA 1E60A 1P2FA 3P5BA 4WCFC 2A9QA 2IIBA 2P91A 3ESDA 3IMKA 4GQIA 1KSFX 5DHFA 1C0LA 1NOKA 4JH0A 2ZJ1A 3KQWA 3U3RA 3LH5A 1X7GA 2H9IA 3R7SA 3ZU2A 4BQFA 1W1IA 1PG2A 2PUWA 4ZPJA 4QOJA 3JQFA 3TTWA 2B2CA 2P69A 3GJRA 3OU7A 1GKLA 3T94A 3W04A 1H22A 3WLIA 3S1SA 5E2AA 1B76A 4EW3A 3JQ9C 4XVHA 4YMGA 3HABA 1CY2A 2FPPA 2C99A 2DC1A 1YL6A 2I8LA 2NU6A 2ZJOA 3BREA 1JXMA 3KSMA 4L9SA 2RGAA 4KV9A 1A50B 1YHZA 3F71A 3OEEA 3FNQA 4KXFB 4NENB 2ZI9A 4NEHB 4A6XA 4G4SO 1IY8A 1H2EA 3TTXA 3CLSC 3F2IA 3FB1A 1A4UA 1W1WA 4WOJA 3WK4A 1R8YA 3DEKA 4OD0A 1SOMA 1Z6TA 4G0UA 4TZ6A 2XEXA 2KX7A 1HA3A 2OZVA 1L8AA 4PPNA 3EZ2A 2X3YA 2XBUA 4RDIA 1WXHA 5LP6C 5ERXA 3DR3A 4ARSA 4YALA 5I8WA 4C2TA 1RQ2A 2C83A 3MLAA 2KMLA 4G4GA 3BHNA 3B52X 3T7AA 3VO2A 4CKZA 1GSOA 2ZJZA 4G9BA 3LLCA 5TQ2B 3EFOB 1ZR4A 5JD3A 3SHQA 2VYFA 1B41A 3AM4A 3PUJA 1ZI6A 4HDKB 1YRAA 5CA0B 5JSYA 4GI2A 5CB0A 1T3ZA 4BO4A 1O95D 4A5OA 3C48A 4GPIB 4TUYF 4DUGD 3EY9A 2C8LA 4HK4A 1A9XB 1ADJA 1P2DA 1TEVA 2W22A 1U3WA 1QCDA 3TCXB 1RRCA 4U3JB 2A4MA 2DQZA 2P7HA 1Y33E 2EW1A 3D8UA 3MSCA 4JBXA 2PL9A 4AN4A 3TB4A 2A5YB 4E7OA 1UDAA 5E7IA 1A72A 3HGMA 1WMSA 1JFSA 3R5SA 1ZH6A 4RH3A 1FNBA 4EJSB 3B13B 1YWGO 2GESA 4MA4A 1RXIA 4S1NA 1YNSA 5T5QA 4BFVA 3ZY2A 2I6UA 4X90A 3STWA 1UBTS 2IXEA 1SB8A 4DABA 2VDWB 4ZEXA 2LWIA 3I30X 3RIMA 1QH0A 3IT1A 2ACWA 1C9YA 5C3MA 3BCRA 5BV7A 1RIIA 3WAKA 1OV6A 1XRMA 1FS5A 2GOYA 3SZRA 5J3JA 2YZGA 4DQDA 5GAJA 3ILYA 2A0UA 2CMDA 4M9ZA 1ECJA 4YT5A 1CUDA 4C5CA 4EB0A 4LN1A 2OQRA 2GASA 3ASYA 3TIGA 4W5WA 1ENZA 2X5OA 1DBIA 1DBRA 3I4CA 3ETHA 1KEVA 2I8CA 1F9EA 1OGYA 2PWYA 1FW6A 1P4GA 2GCOA 3IUMA 3MWLA 1NTRA 4KN6A 1Z36A 4RFLA 8ABPA 3CTMA 2Z3VA 3MT8A 1HT3A 3A4MA 4UFOA 5AI5A 4EQ6A 1P2UA 4YO8A 4YRIA 2VZLA 3L0ZA 1ZRSA 5B57C 1AC5A 4A10A 3SP1A 3VR3A 2NTVA 3ZWDA 1SCJA 4E3ZA 1R5OA 3UMFA 1EE1A 3IIMA 4M55A 3CRNA 3MINA 1WZCA 5EP3A 2PRKA 2O50A 5CW2A 2ZVJA 1G8JA 1PJQA 2V1XA 4L27A 2QVYX 2IX3A 3B78A 1LTKA 1T6BY 1U0RA 2IBMA 5IJXA 3WGLA 4QOGA 2FA9A 1TYBE 1MX1A 2ZCVA 4IDGA 2WJYA 4L76A 4BN5A 4EG1A 4EJ2A 4PIPA 2HGSA 1MFZA 2A1TS 2XNKA 3LO8A 2FFRA 1P8JA 3LT4A 3EVDA 5IABA 1KY3A 1KMHB 3ELBA 4P98A 1GWNA 5L51A 2BC9A 3PFFA 4B34A 2JH3A 2G1AA 3D0OA 4QJ4A 1V5IA 3IBFA 2NYAA 1ZCBA 2YWHA 3FCYA 5JYEA 3JR7A 2JAXA 1CY7A 1WPGA 1P31A 5J59A 2VS1A 1PO7A 3I1FA 3QKSA 4OP2A 2IU3A 4TMKA 4U7FA 1F12A 3GT0A 3T1OA 3P9SA 3JQBC 1JBEA 2W48A 1AQNA 2R8OA 4Y6GB 2NT4A 5SY6A 5CT4A 2NPOA 1XHFA 3S5UA 2H5LA 2VHUA 2EFGA 3F5SA 4FLMA 5E8JA 2LXNA 1ADBA 4KMRA 4D82A 1RM5A 4EG8A 4N8EA 2FPWA 4KDCA 1RAAA 2REOA 4ZVMA 1J22A 1U5AA 2BZ0A 4YQEA 5T3UA 2PX0A 1M1YE 2O2GA 1QKIA 2XX3A 5AI6A 2AN9A 5IJ9A 3TJZA 4BLOA 3RS4A 5EYPA 1UPUA 1VBMA 5DPMA 5CT9A 2MYTA 3D02A 3NNSA 3AIOA 1XZDA 3QLUC 1CQJA 4O25A 2XYPA 3JASB 1YZ3A 2Q0SA 1YZGA 3DVRX 3U0VA 4DUYB 3AT1A 3TRFA 1EFRD 2CL6X 3B1JA 3CU5A 3C5WP 2GAJA 3KJEA 2OBXA 2RC5A 5DO9A 4UULA 4YJ3A 1AT1A 1C1YA 4XDGA 5FV7A 2IPAB 4KMOA 4IDQA 2JD1A 1ABBA 2D1YA 4PS1A 3U7RA 1MB9A 2Q3MA 1M2WA 5CCEA 1NVFA 4FR0A 5AP9A 1NN0A 1E5DA 4YR9A 5KEIA 1QYXA 2GXQA 2IP1A 3L6OO 4OHFA 3GEBA 1JR2A 1NYRA 1GL9B 2BFCA 1HOXA 1UINA 2XHZA 3IAEA 4FQ5A 2C29D 3NHSA 4J3JA 5FQOA 4DCPA 1OH8A 1NQOA 3LFHA 3QVUA 4EZIA 2LR0A 2PZBA 3SYNA 4BKPA 4M76B 4PX5A 1TF7A 4PHTA 2WFZA 1TA0A 3WKBA 5CVTA 1FXUA 2VTBA 1S7GA 1ST3A 2FEAA 5KNBA 4US0R 5MF6A 2BFNA 1AE1A 2J9RA 1FSZA 3EQ8A 1FNMA 1L1QA 3AM1A 2VQDA 1GNSA 4R41A 4X8MA 1QHFA 4Y2QA 2FNAA 4YRCA 4U7HA 3KCQA 3JCZA 1XWWA 2DTEA 4GPZA 4RANA 2UYCA 5KX5B 3FROA 3NM6B 4J2TA 3ECCA 5HEKA 2NIPA 5HIAA 4B0PA 1L5QA 4GC9A 1GGVA 5BSVA 4X95A 1V2GA 3Q1KA 4FYYA 4KQCA 4E5MA 4V1CA 3ZGNA 3GLFB 2FFHA 3HNOA 3Q2KA 3VAYA 4C05A 3KTOA 5A9SA 3I6IA 3FPCA 4PG5A 3I5UA 4YN3A 2IBSA 4M87A 4CL3A 1U2DA 4J76A 4M7PA 1XEFA 3PQEA 3GRVA 3RAPR 1HPLA 3K1JA 1HTBA 2P1ZA 3OOWA 4RY0A 3P4UA 1XQ6A 3LUKA 5D5HA 5JNRA 5JUWA 1AK2A 4AMUA 2QRVA 1RYNA 3MUNA 3H04A 4PG4A 1L8XA 4PXYA 1S3FA 4CQJA 5EFOA 4E5UA 4QM6A 1QTNA 2FN7A 2XVYA 2WKQA 3Q2IA 4MJLA 3SQDA 4US2R 4IZ6A 1LJUA 1ZS9A 2IEZA 3R5HA 1J7KA 5HTKA 1XKQA 4DQ0A 3FSGA 2X40A 3U3XA 3E5RA 1HDOA 3V4SA 1M6VB 1YBMA 4U7JA 3EXHC 4RA9A 2UUCB 2EIHA 1NVBA 1W0CA 2O2YA 2NGRA 4LFCB 3V8NA 4ZJZA 1SVNA 1IPFA 2B8NA 4G41A 5BNIA 1G55A 2J6CA 2WFLA 4JLUA 3WDKA 5A5FA 4R1MA 4I1VA 4JBNA 4NCHA 3I2KA 3WQHA 4B43A 1WOMA 4FFOA 1IN4A 3P0EA 4OUKX 1IEWA 3IH5A 3K0CA 4Q03A 2G0NA 3DFFA 3TTVA 1A8SA 4FBLA 3FBWA 3HWRA 4BNIA 1U28C 4X92A 4CUZA 5C46F 4Y9RA 1J0XO 2BYTA 3RC7A 1R37A 5ENZA 2NTNA 3IQEA 4O29A 1Z4QA 4QAQA 1GUDA 1BE8A 3DP9A 4KRGA 3A9WA 4DC9A 1C1XA 2H0AA 4R3UC 1LPPA 5D3KA 2ZP1A 2LDBA 3FTPA 4HFNA 1AXGA 2F3TA 3L1UA 4XPIB 5T67A 2DMRA 3OE4A 1E66A 3O2JA 4HLUA 4Q12A 5E6RA 4UC0A 2CYBA 4KJZA 4D9BA 2C7PA 1ECPA 5ARDA 1C9NA 3VU3A 2L69A 3UTDA 4S04A 1M72A 4MITA 4LC1A 5KVAA 1H9AA 3ZGYA 3N8IA 2YC2C 1C8VB 1JJAA 2AZMA 2RAPA 2H3EA 3D1LA 3LY5A 3Q87B 1QE0A 3Q3IA 2VUSA 4IQ4A 3HJTA 3PKJA 4Z0PA 1B8OA 1P1CA 1XIVA 4JJ6A 4CMEC 3OT5A 3SFTA 3PX7A 4NABA 2I99A 3MAJA 1SKYB 3ZQUA 3WGYA 2AEEA 5BPHA 3RYHA 2B6HA 1XXHA 4KQXA 4EPYA 1GVHA 2POQX 3PNPA 2HMVA 4B73A 1R66A 4PPGA 3SZ3A 4HNVA 1P9LA 4BAGA 4C5BA 3KZOA 1AIPA 1E3QA 2BTOA 2EARA 2JGNA 4BO2A 2BP7A 1KAEA 3CZCA 2BCJQ 3K1YA 5JROA 3U9TA 1KR2A 3AR4A 1M34E 1N1GA 1RKXA 3PNSA 5A0FA 3AYZB 5A2GA 1TTPB 4ZVVA 4BNLA 5FNVA 3N2KB 4EKEA 1PNVA 4MLDA 5DNDA 2BKVA 3LF2A 3QVXA 4IVPA 2WP0A 4ODIA 3QKWA 4YRFA 4MWBA 3ANMA 1B8NA 1KRXA 2PYIA 2FEXA 1TQHA 4RS4A 3R7BA 2O8CB 4R9NA 5HMLA 4F84A 4J1TA 4W1RA 3SXUB 3W0LB 3OP4A 3Q72A 1TT7A 3ESXA 5H5JA 1T5TA 4BO9A 4CUJA 2KWIA 2JAHA 1DB3A 4Q1AA 5A06A 4BXOA 2YYSA 5JECA 1H23A 3M4JA 4L0CA 2FGJA 1U7UA 2PJDA 2UZIR 3KWLA 2XCRB 4ZDKA 2AX4A 4TRNA 1Y6QA 1OWOA 1XRSB 2R48A 4HJXA 4R2HA 1GDDA 4WLNA 5A7GA 1W581 1P7YA 4D8WA 1YDEA 1G7SA 1Y1PA 4GGPA 3QE0A 3FMFA 3AJDA 4PEVA 3C8ZA 2XOXA 1C7EA 1EXWA 1QTIA 3BRWA 4Z51A 1X19A 1T13A 5J2TB 2XD4A 1CBUA 1T9HA 3CONA 3FE2A 1BE0A 1Z37A 4HB3A 1UZNA 2HJHA 5AVOA 3VTZA 3WYEA 2IH5A 3PWKA 4AKHA 3ZWBA 1IQRA 2FEPA 1BD3A 2YOHA 1P1BA 4V0SA 1I1OA 5ALHA 1VPVA 3QEOA 4M9QA 4RSMA 4WBSA 4B09A 2BHRA 2CXQA 3RNLA 1Z38A 3NDJA 4RK7A 1QH8B 4A0HA 1LU9A 721PA 3DYBA 3LMKA 5B1IA 3AVYA 1KI6A 1DC8A 5EWJA 1V8ZA 3OU6A 1Z3CA 1K5GA 1IMOA 3HN7A 2AOVA 2IUUA 3W2HA 4R1OA 2IHUA 5K3OA 2IT1A 4E12A 4HUTA 2I4TA 2B8TA 2PFSA 4QDUA 2ZLBA 2YZ2A 1WSAA 3IRVA 4GR4A 1GQFA 2PH7A 2NAPA 2BN4A 3F5DA 1E2KA 2DCMA 3ZX4A 3ANXA 3T7EA 4IMRA 5AHKA 4BDSA 3VKUA 1R3UA 3KZCA 2VR1A 3DLAA 4HF7A 4PBTA 4TS1A 1MQAA 2P9ZA 2PO7A 1EUDB 1Z0UA 1YZQA 2ZROA 3R0XA 4HDMA 4DA6A 3H11A 4YP1A 3N5CA 3ZZUA 1UPAA 1SOWA 1LSUA 1W5AA 3PPVA 1H8HA 3CE9A 4M1MA 4Q24A 5LZ5A 3HVHA 4RIEA 3ZLJA 1QC5A 4PF1A 5JASA 2XDYA 4IDDA 1EVLA 4MQ6A 4RA6A 1ZN7A 2WTXA 3RSZA 5C7IO 3ITKA 2NO1A 4P7BA 4QEZA 1OYYA 4HZUB 2X2PA 2REQA 3MOGA 1QIIA 1CPYA 3E0QA 3QENA 4U5QA 4UBIA 5DU2A 3F78A 1QIHA 2W98A 1YJBA 3ZBUA 4I3FA 4M9UA 4NLLA 3V9AA 3M9WA 4OQYA 3AK4A 3HCNA 4LY0A 5H3LA 3TXXA 2X3UA 1RFGE 4Q3EA 4Q7LA 1CQXA 3AP1A 4MI6A 4BHTA 2IZ0A 1NUPA 2IYUA 4S0ZA 4NWIA 3WWOA 3KB6A 3CSUA 5CD1A 3B12A 1GQYA 2O7NA 1DDOA 1CG6A 2JZNA 4L2IA 1SCUA 1XC7A 1HE5A 1VA5A 3BPSA 3DMNA 4YWJA 4DMLA 4GWGA 1U7ZA 4KLRA 5K3FA 1AQUA 2V6BA 2H5IA 1YFKA 3QX9A 4QNRA 4BMNA 2Z6AA 1P2GA 3I5AA 1B0UA 2VTEA 5IX8A 3B7WA 3ON5A 5LBIA 1DWPA 5IKOA 2ZEJA 5HX7A 2QAJA 3PI6A 2ZIZA 1CQZA 1JLKA 3QOWA 5HS6A 2YV3A 1T0BA 1E3EA 1ODKA 5EE0A 5HJ5A 3H8SA 5F35A 2J87A 1HO3A 3LAWA 2GNPA 1FQKA 5AJWA 1U2GA 1J5EB 2JAOA 4JJEA 4EA9A 2QAGB 1MRZA 4KIGA 2D5LA 3QE4A 3EIHA 5F9HA 1K6IA 3DOOA 3K9QO 3S81A 3LI2A 3R3XA 2BKAA 3G23A 3HGQA 4YJKA 1OR8A 1JNYA 2HSWA 3OQHA 4C14A 5EJGA 1TLLA 4D0RA 4YRQA 1H69A 2QSYA 3HBAA 2BVNA 4XFDA 3SF8A 1PR3A 3GJ5A 3IALA 1SKQA 4OBXA 1KJQA 5KYUA 4NAVA 1SR8A 1ZMTA 2CUNA 5JR3A 3UPTA 3CKLA 2FFAA 5DB4A 5DISB 5CFOA 2REXB 1CQIA 3Q9LA 4NYJQ 2GXUA 5LXTA 1U0HC 4QGSA 1HKUA 2WJ3A 3VZQA 4B3CA 4CCWA 1FSFA 1I1NA 1X9IA 2W6ID 1JEYA 1E3MA 1O9HA 1MO6A 1PK7A 4NU0A 3A05A 3QI7A 3G02A 4I6JA 4DJAA 3IXLA 2JEOA 5T57A 4DJJA 5KYVA 3VSEA 4C3ZA 4B8ZA 1ZH0A 1ODSA 2NNWB 1COWD 1E3WB 1N2BA 2B2XA 3QRWA 4M88A 4URZR 1I80A 4P4NA 1G6Q1 2H7VA 2ZVQX 1KAMA 4JL5A 4PLCA 5EWMB 1SG0A 1EFPA 4F4HA 2W70A 5IJZA 4B6SA 3NKFA 1DBVO 2A9KA 2CVHA 2FZ5A 2C2KA 4L4YA 4PC3A 5JIBA 4CEJB 4H3KB 1JQBA 4MYDA 4TKVA 1U3FA 1B8VA 2ZRCA 1U99A 4LF6B 1JEQB 3KVYA 1FTQA 3UHPA 1IWOA 4DUZB 2GNOA 2WIAA 1CR2A 3A4VA 1YZNA 3FCEA 1K75A 4XI9A 4CI0B 3KV3O 1Q7EA 1OBVA 5A7HA 4TZ0A 2C8VA 5AMXA 4TVSA 4EMBA 3C3EA 3PWTA 4GPD1 4IH4A 4F72A 2QTZA 3IKVA 2GJ9A 3QSYA 2J5XA 4OATA 1N33B 1VMIA 3MPUA 3IR7A 3THXA 4CLEA 4EFLA 1T5HX 4FNMA 4ZCIA 2YYZA 3Q8LA 2O8EB 1PR9A 2HPHA 4F4UA 2J31A 1WLSA 4U00A 2VA8A 3WRYA 2X1MA 5JAUA 5IEJA 3PQFA 5IKPA 1FRFS 3CLTD 1TM1E 1WCV1 2X58A 3AWIA 4Y0VA 2GHQA 5KCMA 1OCEA 1Z33A 2HFKA 3AHJA 1LBQA 2FWAA 1XRLA 2QTFA 1ZISA 3AF5A 2UV8A 5KKAA 4BB6A 4CIYA 2G4CA 4N82A 4LXUA 2VP5A 5CFMA 4UDXX 1SU8A 3SC2A 4ZQCB 4E70A 4DLRA 5DNWA 1ORDA 1MOPA 1D8TA 1U0GA 2I4MA 4UNPA 2YWEA 1ISPA 4AO8A 1RYEA 2HRZA 4A36A 3GGGA 1B26A 3G0OA 4KI7A 4B7CA 1LPOA 4KPYA 3LCRA 2OSVA 4IHAA 4IY1A 3DV9A 5DYWA 3OEED 4PM4A 4YRKA 5C8YF 3PF9A 4LKOA 2B30A 3CEHA 4ISBA 2EEPA 3O8QA 3NP9A 5G0TA 1U5BA 4F46A 3CF6R 4YK7A 2VIIA 3KQSA 3ZI0A 4FN4A 2BM9A 2OO5A 4MW4A 4CETA 3EDQA 4JV5B 2OQVA 4PAQA 2OXCA 1DXHA 1UKEA 3RGGA 2B8JA 1NI5A 4RHUA 3ODPA 1RI2A 1UWVA 3TJRA 1N78A 1M6NA 4AL4A 2J0UB 3DO8A 3ESAA 1XD2B 3OO0A 4AG5A 4BLSA 3E53A 1NVVR 2HPAA 4W1SA 2ZM6B 1KZ4A 4YP6A 2IA5A 2ODNA 3O26A 4UCWA 4B7ZA 4B3HA 4MQBA 4N3GA 4QATA 2BT4A 2AGVA 5KNCA 1P1IA 1T8WA 1ZN2A 2AR9A 4GI7A 2IOYA 1G63A 4HZIA 1V71A 1J2RA 4QLOA 1KH1A 1BO6A 3BERA 5IW8A 1WW3A 3B2NA 4MMYB 4JB8A 4DDWA 2Z43A 2J9GA 1L7QA 1NP7A 4A4DA 2ZE5A 3LRPA 4C4ZA 3B2QA 4GR5A 4D5EA 2BM1A 1ODIA 5AJYA 3CH5A 2HY7A 3MGKA 1A04A 2P9HA 3WRVA 4GVLA 3PNOA 1DGQA 1QIEA 2XVAA 1QV9A 4BJHB 5E38A 2BCEA 3GLIB 1H1LA 5ICGA 4GPBA 3I01M 4ER5A 1Q0LA 3AUJB 2H2GA 3IXQA 3LTNC 3AVXA 2OLJA 4S1OA 1U0NA 1V37A 5ICFA 3L7CA 1YFJA 4WXMA 3PKZA 2HRRA 2C4MA 3BD9A 4KR7A 2P4UA 3AERB 1RLJA 4EW1A 1FS4A 3DTYA 3HVJA 4FE7A 5B4UA 4JOQA 3RVLA 1Y4ZA 3L0IB 3D8BA 2VBGA 3OQVA 2BJWA 5KDOA 4C7XA 2WTUA 3I5YA 2P4QA 3IJEB 4UKDA 4KGDA 4HMOA 2X5NA 2G5PA 3L8FA 5DTRA 1A7JA 1K3TA 2XDAA 2H1RA 2W6CX 1OV4A 1QRDA 3HO6A 1HGXA 16PKA 4TL6A 4Y2VA 3M4YA 5DFAA 2AR0A 4TLAA 5AICA 4KAAA 5DEOA 2HHHB 1XAJA 3B7GA 1CR4A 3EGOA 3GLQA 5CDUA 3GOQA 4F6RA 1GG9A 4HC4A 4HH4A 1L4BA 3SKVA 4CFYA 5F64A 3RJMA 1WZUA 3VR3D 3WJAA 4Y6OA 2H63A 1DTSA 1ZESA 1DOZA 4QRDA 2PGLA 1NBWB 3WQRA 4BYGA 3AONB 4L5AA 1REQB 3TOZA 1JDNA 2ZBDA 3RG8A 5K0EA 2QLMA 5BRJA 2IPLA 4DBVO 3WLTA 5KVQA 5DM60 2A5JA 5GGYA 2IOQA 1UM8A 3BD7A 3L7LA 1D9XA 3SC6A 4X62B 1KMNA 4L5JA 4JELA 1YGPA 2ZPAA 3NT5A 1RTTA 1JQJC 2PO5A 1P44A 4IOJA 3QU7A 1PX0A 2APJA 1SULA 4XX0B 1E92A 3FWYA 2V9ZA 5AKLA 3KQMA 2QQFA 2Q2VA 5FP0A 2OO3A 1RXUA 1LUAA 2WOOA 1E7WA 2ID4A 1F1JA 1EFCA 1A2QA 3OKPA 3D4BA 4K9KA 3AFIA 2BGLA 4GYKA 4F2WA 3NMUF 3SYMA 2H59A 2YICA 2I8AA 3FY4A 3LP5A 4E2YA 4DXDA 1FU7A 3E7XA 1CF4A 3AHGA 5FBRB 2WKPA 5TIIA 1EG7A 3Q7QA 2CZQA 1X1BA 4UE3S 3IUEA 2JHPA 3DAYA 2GMWA 1Q1EA 1BCSA 2QMEA 3BXXA 2F3UA 3PZRA 3QSGA 4CL0A 3LQFA 3KOYA 2C3OA 5AO9A 5AXCA 4UREA 4A1OA 4X44A 1H3NA 1FDTA 4X3OA 3RYFA 2HD4A 5ES4B 5JBNA 4YT2A 2GYUA 2VJYA 5EUBA 5U4XA 2FPMA 3A1WA 1RLOA 2NO0A 2W11A 4RZXA 3G7UA 3CZPA 3PEFA 1FVFA 4MS3B 2PJRA 1CEEA 3F9IA 4Y30A 2P9CA 4OI4A 3COVA 4ENQA 4B6RA 2EBHX 1ELOA 1CE8A 4INAA 2WM2A 2YXEA 3UWOA 2SHKA 4B9AA 2C57A 1CK4A 3IP1A 3DEIA 1L1EA 2HNAA 2CMKA 3LYAA 1FOEB 1JHYA 1JZQA 5EKSA 1ECBA 3HXPA 1PWEA 3IQIX 3HBNA 1NBIA 3HN2A 4OGFA 2FRDC 3KKKA 4MS1B 4CGZA 4I3GA 3L07A 4UHCA 3L0YA 4I9NA 2ZUSA 1RLUA 3C41J 1THTA 2Q45A 3OZBA 1EM8A 1EWRA 3CNNA 4FCVA 4YRGA 4HNAA 2X8JA 1FFDA 3QE3A 4AT1A 2ZAGA 2CLSA 3EUEA 1ONBA 4TOIA 2JASA 4FKBA 3ETDA 1BXRA 5JWOA 3CNBA 3NFYA 4MV5A 5KNBD 5I8ZA 1MX9A 1E7YA 2QIOA 1MHTA 1XDWA 1T4GA 5AW4A 5I7WA 4O59O 3RTBA 5JATA 3I0ZA 4CDGA 4JIMA 1T8RA 4C7VA 1T5OA 1B4DA 1HRDA 4Y1EA 1FFGA 1BGXT 3PQ3A 2F64A 5EJ2A 4JJ8A 3PBKA 1GNQA 1ISMA 4GS5A 5DCUA 3ZH9B 3UGQA 2BPOA 2EKPA 3H0KA 5DBEX 4M21A 1EG2A 1EBFA 4I4CA 4LHVA 2C3YA 1RYDA 5M29A 1PT8A 4KIFA 4EA8A 2ARKA 1AX9A 1RXCA 4EK9A 5ISMA 5KSWB 2HW8A 3PRYA 3VOSA 2Q27A 1PS8A 2Q3EA 1R6BX 2UUPA 3A14A 1PW7A 2BEJA 3ML1A 3NIWA 4H7HA 4KDRA 4LZAA 1XZ8A 1E79A 1EX6A 4UVGA 1H3EA 5KJCA 3N86A 3PFIA 1GPBA 3NHYA 4O4HA 3RFCA 4EY7A 1A1VA 5BW4A 1V1MA 2I4LA 4I9FA 2B0JA 2Y6UA 1RAHA 4OHRA 5KNLA 3LWNA 5T8KA 2ZUBA 4R31A 3PYMA 4UEQA 4XIIA 1Y9EA 2ECPA 3NBYC 2ZJAA 5EY5B 1SCIA 2O7QA 2P2NA 1MB0A 2Y0DA 1U9YA 3KYCB 2WQ7A 3C5EA 4FYWA 1BJRE 4YJ3F 1P9OA 3QPBA 4BMXA 3EDRA 3CFYA 5BUCA 5LIRA 4MMZB 4UARA 1X7ZB 1C3OB 2ILTA 3M5PA 3HQ4O 5AM4A 2X6QA 3BWYA 4OU5A 1GNRA 2GK6A 5HSGA 4LFBB 2JARA 4NNOA 3CKKA 5FFMA 4C2AA 1SKBA 3KJNA 4KL8S 1GEEA 3P52A 5IT9A 4RYDA 1VDMA 3BXPA 4IOKA 5KPJA 2O0HA 5A4MS 1J00A 1OF1A 4F3CA 1OOEA 2V3VA 4RDCA 1F60A 4D9EA 4XDZA 2FR8C 1E6MA 3SZLA 1KI4A 3FXAA 4RIFA 3OZUA 5H9VA 3KKOA 4R2XA 3TGWA 1ZK4A 2I7TA 5JD4A 4JYZA 1NNEA 1XA4A 2IXAA 4P1ZA 4AQ7A 2Q0QA 3EVEA 3CO0S 4AZVA 5I9LA 4RJLA 3E1GA 5K8VA 1QYDA 5AYVA 2FWIA 5IK2A 4QG7A 8MHTA 2NUPA 1ZGZA 1KP3A 2Z95A 3RTGA 2YXPX 1M2EA 2JKVA 2A0FA 2GSWA 4YRPA 4RTKA 2FN4A 2YASA 3HBMA 3P0FA 3I3SR 3KL4A 3DMGA 4ZT6A 1U2ZA 1ML4A 4DSNA 5THXA 5A03A 4UAVA 5HUJA 1K86A 4E1BA 2CY0A 1UBRS 1T4CB 1X1TA 3O0TA 1VE1A 2OKCA 4Q1EA 4DLNA 5GOZA 2VJQA 1V4NA 1S2LA 3ZK9A 1JLMA 3TR6A 1ZOLA 3WE7A 3G49A 3QJYA 5CJJA 5TARA 3D2AA 1U94A 3O8DA 4O2AB 1IRXA 2BONA 3WZLA 2HAEA 1ZHFA 3DKPA 1KEEB 2UYQA 3IDFA 2J1LA 4HDSA 2ODBA 5PGMA 3TNFA 4D97A 1YJQA 1CJMA 2C96A 4BPRA 2ID9A 1ZAKA 2O2SA 3AEKA 1M54A 2B35A 3OQJA 3II6X 4LBVA 3LQ1A 2FSHA 3N0VA 2WJ4A 1V9SA 1A4RA 1WVGA 3F6BX 1U2PA 3E4CA 3UK7A 1RWOA 3K5PA 2FHSA 3NEPX 3ZWXA 5EXTA 1A5BB 4XYLA 1JPNA 2WG0A 4MYRA 4R51A 3CGWA 4L75A 1YQEA 2I6GA 4I19A 4UU7A 4YMVA 1BA2A 3WLLA 5LLTA 2C5FA 5LYJB 3Q3GE 4P4UA 4YDRA 2P11A 3RWMB 3BE6A 3C1AA 4MP6A 1LV7A 4AKGA 2VPQA 1O95C 4XVQA 2ATEA 2C9BA 4HSEA 5K0NA 3HUFA 1AF4A 5TGTA 2IYVA 3REFA 5J9FA 1YBVA 3BHIA 2I4IA 4M83A 4N6GA 1H2HA 2OORA 2Q6KA 1Y8CA 3CRMA 3FVRA 1DADA 4KXNA 4OGKA 3KJZA 5TSDA 2FQWA 2VDKB 3L8HA 1YOVB 2ZWAA 4IQ8A 1Z7GA 4NTZA 4AICA 2OBFA 4NARA 3BRWD 4LHXA 1DAKA 3FDXA 3WL4A 3EEIA 4FYJA 1QRAA 5EIEA 1CNFA 2HQOA 3F6RA 4PRLA 1XFDA 2F1IA 1B42A 4NZYA 5IUNC 5B2FA 4LIPD 4ICIA 3GY0A 4CTOA 1YKGA 4GLBA 1NR7A 3PXCX 5J2UB 2PZJA 4M8LA 3OCXA 1TJ3A 2BKXA 1ZJ6A 2BDEA 2QI9C 2Q5QA 1X9HA 3L7JA 1GU0A 3B6MA 4C0QC 4IO1A 1U0BB 1NZJA 1T2NA 3KPVA 1V8OA 1B0ZA 1HQDA 1RHKA 2CF6A 2H2FA 1NXTA 3C3WA 3I76A 4HB2A 1GVNB 1YAHA 1Y8RA 1HNXB 3KD3A 3BXEA 5HF9A 4OLFA 2AF4C 2X19A 1ZEJA 1USIA 4HLQB 1LDMA 2YX1A 1BVHA 2OV2A 5C7OO 2P1RA 4YO7A 3UT6A 2BEUA 3H2HA 5AD1A 2YVAA 3ADCA 9MHTA 4TTQA 3B7PA 3LCUA 5CPFA 3UCFA 2X0JA 1G17A 1KJYA 1E4YA 1T4BA 3C85A 1W34A 3HB4X 4MPPA 3ETGA 1OREA 4LNAA 5LU8A 2Q0XA 2JFUA 4ENPA 4D8TA 5FNVF 4TXLA 1SXGA 4A5SA 1H8HD 2NM0A 1ZX1A 3F97A 1NIJA 1AXEA 1EUQA 1USVA 1EZ1A 4GNKA 4E46A 1XZEA 3IEVA 3AEQA 1TUIA 2QM0A 3MQ2A 3PRJA 2OCGA 4M8KA 1IK4A 3TZQA 4KFCA 1J06A 5L3RA 4QXPA 1DLJA 4EGFA 4JEHA 3UAYA 4MGEA 4WTOA 1R0YA 5KOIA 3G17A 2IHTA 1BH2A 3RSHA 1HBJA 2JFOA 2YYAA 3GLHA 3RFUA 3UK2A 3FRIA 4PCAA 2ISCA 3EXEA 1A2BA 4GT1A 4OGLA 1ECGA 3AR3A 3ZIDA 2QENA 5ICCA 1HL7A 2ZREA 2GN9A 3VKHA 4QKQA 3BZBA 4N49A 4J75A 2Q1TA 2R6AA 5JNWA 1QM5A 2JBAA 2QVCA 2B83A 1JALA 3IOBA 3PDUA 1WY5A 1DV1A 3T0FA 5HF5A 1UQRA 3EIWA 2AN1A 1NOJA 3ZV3A 1V45E 2QG9A 3KOWA 3HR4A 2V6JA 3OT4A 4FS3A 4TWZA 4ZO9A 2ZRQA 1UT8A 2GXAA 3FYDA 2PX3A 2IZZA 4H3HB 2C4TA 3CWZA 4WPGA 4OHKA 2XDWA 5E3JA 2PUGA 3S2ZA 1ZW6A 5FRDA 5K6AC 5KTPA 2YWGA 2JPDA 3K8YA 4WD3A 1JBKA 3PA8A 3VUFA 1U8UA 4UASA 1KQ3A 2HLHA 5TF0A 1ZOSA 4Z8YA 3TFWA 3FI9A 3I9KA 5K6TA 3K70D 2JNWA 4TRRA 4X20A 4AG6A 2Q5HA 4W1PA 3DNPA 2NU9A 2CXTA 3PUVA 5GZ3A 2X76A 4D9FA 4FZVA 3LXUX 4U7GA 1PU2A 2XMZA 4V0KA 2FW1A 5FTNA 3FCCA 2BFBA 5HPYB 1ZI9A 4UQLA 1M2VA 1FNSA 4Z0TA 3HXTA 3LBYA 4Y2HA 3I9FA 5AOBA 5F73A 3WLEA 4RTLA 5FBVB 3SVLA 5LNK6 3JS5A 5L6LB 1E4EA 2CCGA 1W2HA 5CJPA 2E6UX 1IC6A 1UKBA 2CLOB 4KWIA 2VJMB 1V26A 2VP3A 2ZWPA 2JKYA 4L5BA 2QR5A 1XCPA 2RONA 2A30A 5TQVA 3SIRA 1S7CA 2GPWA 2BJHA 1PSWA 2OY0A 2ZR0A 3OE7A 4QBFA 4I1PA 4Q1CA 3L92A 3JATB 2CK3A 4FI3F 1E1LA 2QT0A 4YCNA 4NXNB 1DWUA 4MYCA 2JFWA 3FZEA 3QWIA 3RSOA 1A76A 1LJ8A 2VNKA 3N05A 3BF8A 1LWOA 5FYQA 4HDAA 3UC5A 4N5DA 5FOTA 4KKXB 4MQMA 1BFDA 1HX7A 4BRUA 1RCUA 2INGX 2IW3A 4FZ5A 4GP9A 5I9MA 3T9DA 4RF3A 4DJ5X 4EG6A 5EJ8A 2FMKA 4HEA1 4O4LF 2PMEA 2IYRA 4F0JA 2AG8A 2NNLD 5EIWA 1IQUA 5AQ1A 5JVDA 2R751 1ZM7A 3KU1A 3PB3A 3RVRA 3BGWA 1ZSNA 3IESA 2X9GA 5AI0A 1ZXLA 3OSUA 4XTCS 1XN1A 2XE8A 3KR2A 4ZAGA 1CU1A 3MB5A 3R6DA 4JJZA 3I04A 2M9MA 1IUOA 4Q16A 1SWWA 1Z0DA 2X1LA 1WP9A 3ENVA 3UCXA 2C7BA 4XUEA 4G1VA 5BN3A 1FUEA 1VDZA 4LZWA 3U5TA 1N0IA 1M34B 2HJGA 1JSRA 2QM8A 3E5NA 3LLVA 4L0MA 4EF5A 1ZK0A 1ZNYA 5K3SA 5J4YA 5GJVC 4G0XA 1JR3A 4A6PA 3R3YA 3WB1A 1VL6A 3B1ZA 1ZC3A 3E35A 1AHNA 4C01A 1JKFA 2B8EA 1V35A 2NXJA 4M1SA 1F2TA 5GZ6A 1E69A 1WXFA 1TF5A 4LZZA 4GZ6A 3WGZA 4AJKA 2AV6A 1EK5A 4S2UA 4YFVA 1U6IA 2JVIA 2MSKA 3PA6A 3ZKWB 1R4NA 2O48X 1A77A 2O1EA 4AY4A 1NGSA 1DELA 1C9DB 1KI7A 4FGLA 4R8VA 2DOKA 1E58A 2XUGA 1OD6A 3IDSA 4X7BA 3SZMA 4MAFA 5EJMA 1P19A 2FMHA 2VDUE 2JLXA 2WP8J 3AUYA 4P32A 4HFRA 4Y7CA 1PL6A 5A3VA 5LXTF 4GW3A 1EA5A 5LQMA 4DADA 1DWOA 1YHNA 3IUJA 4BAUA 1OXVA 3OEHA 5AKGA 1WXIA 2PCLA 5DK6A 5HZMA 4DSTA 1GITA 1CY1A 1DBQA 2GRAA 4P5EA 3GFTA 2AMJA 2OXIA 5AW7A 1R0SA 1RABA 2FXIA 2QD4A 2XKBA 4HXYA 2V59A 2WSMA 4KBYA 4KO4S 4Q4JA 5D7BA 2B9VA 3DTVA 1PRYA 5H02A 4YC7A 1UPBA 3ICCA 1RPZA 8LDHA 2W4QA 2FJPA 3ETLA 1QB8A 3P71T 3QEKA 3QKRB 5JBIA 3X44A 1E2MA 4LZPA 5KNCD 2G70A 1M6WA 5B58T 3MIIA 4E5SA 3KB2A 2G8NA 2J3KA 2OQIA 3QLTA 3HYNA 3MAGA 3MA0A 3NAGA 3PD1A 5I9BA 4K6GA 3ENNA 4B8WA 5JLAA 3WK7A 3BK1A 3EYAA 2Z98A 4K6OA 2RB4A 1RXEA 4KDFA 2HK9A 2POCA 3EASA 1Q6ZA 3O94A 4AQYB 5C34B 1GTG1 3GP5A 4QPCA 5I5EA 1OE0A 1WEKA 2PKXA 4WZBE 4MKRA 2CKDA 2PSEA 4FUTA 2JHGA 3VR5D 1FCJA 1YR7A 3D6MA 3DXXA 1VZ2A 4HTFA 3SYTA 3V8QA 4ZCMA 2P62A 3DE5X 2E49A 2FWRA 4IGAA 1MAUA 4M37A 1YC2A 3LC1O 4EDHA 3ZG6A 4EY5A 1KARA 4BTEA 3SJUA 4OLAA 5CTAA 3NXSA 2PGIA 1YQGA 3GN2A 1KO5A 3H5NA 1DRVA 2XMQA 4DCTA 2FXVA 3NWPA 1TK9A 2FSVC 1T25A 3JVDA 4I2VA 4U39A 1VCHA 4Q4DA 5G02A 2ZXUA 3HWX1 4YP0A 4Z5XA 1HZJA 4FW8A 4R5MA 3PHGA 3U7HB 4R8KA 4DLPA 3ZXYA 5EJ6A 4O1IA 5ALLA 3EZFA 4OM8A 4ZARA 2BEWB 4M7RA 3DWIA 2I34A 2JI4A 4Q4AB 2ORIA 3FNGA 2CW5A 1E0JA 1P5JA 1CRZA 3D3KA 4QWWA 1H8ED 5G41A 5L9AA 4PZ9A 1IHUA 2J0VA 3M6AA 2ACEA 4IOLA 4U6NA 5EJEA 1O96B 3C24A 1E0KA 4N8SA 4RAQA 3U3KA 1IVSA 5KNDA 2HBZA 1GQRA 2I2DA 4R1UA 1B16A 1LRJA 2PS0A 1GSAA 2XUQA 3GRPA 1I4OA 4XVRA 5AHRA 2CVOA 3C87A 1EX7A 2XB6A 1QHEA 4RFSA 1L2TA 1L4YA 2QVXX 4H16A 4M1WA 3OJXA 4KPUA 1FLNA 4TVOA 3ZU5A 3DCYA 1R5JA 1SWVA 1UBEA 1F17A 4UJ3A 4Q9IA 1ZMXA 5H83A 3W5IA 4BFZA 3TTYA 3IUBA 4ZO6A 1V47A 4ZTBA 2OUKA 3MS7A 2C0PA 1VMDA 1Y6RA 4LXHA 1E2UA 3BXZA 4RY8A 3WXBA 4LI3X 1F8GA 2HA2A 2WJ6A 5DN9A 2Q46A 1HMPA 3KTAB 3TNLA 1SKAA 3D3JA 4QDOA 3UJDA 1TMYA 2E4XA 1EJ0A 4JJIA 1EHCA 4O2BA 5BMOA 1U2SA 3RK1A 4AF7A 3PXBA 2NMVA 5JJ5A 2IPMA 1YB6A 3IAS6 2Q4BA 2V9PA 4FFPA 4HJRA 5TY0A 4CTJA 2DJIA 3T3IA 1MAVA 1NW6A 2JIPA 3PFGA 3WGNA 2DFVA 2HCRA 2WV7A 1U2RA 3TLMA 1QHXA 3JQ7B 5JY6A 4KI0A 5J5AA 5KOJB 2KHZA 4W9RA 3R7LA 2CXHA 1YA8A 4D4JA 1TZKA 9ATCA 4LF5B 1CJKC 2PX5A 9LDTA 4K05A 4RDXA 1MQ8B 3M81A 1CQPA 1N2SA 5JJBA 1OWLA 1LPBB 2V3CC 1L5YA 3RRNA 2GDZA 2XMBA 2CXOA 3UGKA 3EGWA 4YGXB 3CLRD 1Z4IA 3R8FA 3QPWA 3Q3VA 5C18A 3YASA 3GMSA 2RGRA 1KYYA 1L4NA 1QIMA 1RTKA 2AFHB 3OQPA 4PZDA 5CGQB 2WE7A 4GI5A 4CLHA 3SDBA 5K3DA 3DZJA 3GAMA 2NT3A 1GRVA 2XDQB 2Z57A 2I1VB 3F7OA 3NOOA 3GJTA 1O6FA 4PC7A 4ZVRA 1DKNA 3IDAA 4MV9A 3INRA 4D4HA 5BVGA 3ONEA 3UV3A 3I83A 3U31A 3CISA 1ZD2P 2W6NA 3MGGA 1PV2A 3R5JA 3LA6A 2BFFB 2CJWA 2R5FA 3DWFA 5JH7B 4B5LA 1BU5A 1P4SA 1ZGHA 2O20A 3LUGA 1E1RA 1I5EA 1SQSA 1YT5A 2ZB8A 3LC7O 3LX4A 5LJIA 2DQ4A 4LDAA 2JLCA 3F7MA 5K8CA 1WV0A 3JYNA 4HWRA 1A0OA 1EX9A 5D1NA 2RGYA 5DBHX 1H6DA 4Q3AA 1HFJA 1U7DA 4OQXA 5DHUA 3RVNA 4F5ZA 5E7MA 2JFHA 4DANA 2PV7A 1YQTA 2RBGA 3D2CA 1ZKMA 1NC3A 2A1UB 3AFMA 4DDVA 2EFYA 3B60A 1JG4A 3IIIA 4GQBA 2PH5A 3T7CA 4P3OA 2CXSA 3I42A 3MSXA 2XNJA 4QELA 4WASA 3E0XA 1UXIA 1D6SA 5IM5A 2R11A 1GTVA 2A0XA 3SZGA 4E07A 1CQWA 4IW3B 1FVXA 4X6LA 3K1AA 3W1EA 4ITVA 4A7PA 2G9ZA 2QW8A 1OLSA 3LPLA 1U1CA 1GGKA 4REQA 3KKMA 5HIKA 4DCJA 2GKOA 1RJFA 1WXEA 3OJEA 4INJA 2PKRA 4G86A 2YWBA 4X84A 5CB8A 4XIFA 4IOMA 2O0KA 1RKUA 3QX8A 4DR4B 3WB0A 4CM5A 4PPQA 1ZUHA 1P73A 3RVDA 4LTNA 3KT0A 4KAJA 4UHEA 1D5WA 1BCRA 2F3RA 3EC1A 4L07A 3KEGA 4LXGA 3NHRA 4OAOA 1PW5A 1II8B 2VJOA 3TS1A 1PLJA 3N2LA 3T7KA 3BGIA 4A9AA 3BA6A 3MTQA 3KT6A 1J23A 5EJAA 4CMIA 4Y0NA 1OPRA 5B2ZA 2BV3A 5AKZA 1N6KA 1NATA 2BBOA 3ER9A 3MRTA 4L9RA 4M0PA 1PD0A 2EL7A 3R5XA 3ZLVA 5KYXB 2IE8A 2XZTA 2BISA 3ZEIA 3TE7A 4DQUA 3L7YA 4GGOA 1KQNA 1UXOA 3TLBA 3T3NA 2C3PA 3A7EA 2IDZA 1EJ2A 2OBNA 2WINI 4QTUB 1E79D 3PVCA 1Y1TA 3O3MB 4PYJA 1NBOA 1DTWA 4QU8A 3CNHA 2ENWA 2NO7A 421PA 2GTIA 1NPYA 3TSAA 5LOVB 5IT5A 2VDLB 3QELA 3OAAA 1P72A 4JUBA 1ZJ4A 4QARA 4X6XA 4ZAXA 5EMJA 3ZNPA 4GMGA 4BDTA 1K7SN 1TLTA 3EFHA 2B5WA 4UTPA 2OCXA 5FF9A 3L4EA 4QPZA 3GAFA 4TRJA 3TPZA 3NHBA 4ZQFA 5I7AA 3KP1A 1Y1LA 2CCKA 3JRNA 4I8DA 1U98A 5REQA 4C3VA 5ALWA 5KDLA 3ZXIA 3C16C 4IIDA 1CUVA 4DNFA 1JDJA 4MAMA 2P9GA 3TJMA 4CV2A 1RP1A 1JMVA 4UEKA 1X7WB 4M9XA 3IE1A 1UJMA 3EEFA 3QX7A 2CL0X 4BLPA 3AU9A 2KBFA 1T43A 5L40A 2FTKE 3H4VA 2FPRA 3JQ8B 1O57A 1CUAA 1E7SA 2NAFA 3BGDA 4TSKA 4WQMA 3RARA 3RAEC 3I8OA 3MXOA 4LUCA 3U44B 4OX9Y 1T35A 2WZBA 2JCGA 1JHZA 1ZH4A 5D7NA 3VNQA 4DN6A 7GPBA 4OHWA 5KOHB 2G25A 4E11A 1DRJA 1MU0A 2PSHA 1B43A 1FMCA 2FX3A 2JFPA 5CXUA 1PKXA 1V3TA 3GX1A 4ME6A 4N6NA 4DV3B 3EOZA 1G20B 3G0IA 4ZC1A 4Y6RA 5TPWA 3DLPX 5E1BA 1WRBA 3CLTC 3H1PA 1F6DA 5CYPA 1DIOB 1OFGA 1UMCA 4GSYA 1DRKA 4JIGA 2K5UA 5KWEA 4LG1A 3H9UA 1Y3AA 4J2OA 1VPLA 1ARZA 4DTCA 3OEWA 4NU8X 4OFZA 1PFQA 3CNLA 1S4QA 2V5UA 4BNXA 5I7HA 1DCFA 4WEQA 3K9CA 4V0LA 2P79A 4ZVUA 4PQRA 4JYBA 3JQFC 3KR9A 4J0IA 2AW3A 3BCUA 5FV4A 3QF4B 5GZ1A 1SCDA 3PKIA 4MVJM 2FPSA 5TQ0B 3MCUA 2A1IA 4RZUA 3N9IA 1FFHA 5BRNA 3VO1A 4URHA 3WJ2A 3K8QA 3PC8A 2PGDA 1OC4A 4O4HF 3L6BA 4CLRA 4YCLA 3SBDA 2CLKB 1Q83A 4GX0A 4WNAB 4E15A 4GOND 3PVZA 2UVPB 1YR1A 3OWXA 4KH1A 1UJNA 2DQYA 4IR7A 5A3QA 2EFHB 4BS9A 3U4MA 3EQZA 1W52X 2XADA 3H4MA 5HDBB 2IYOA 2DSNA 2FFJA 3T34A 1XPJA 1MIOA 4C43A 1RE1A 4E94A 4FFVA 3EA0A 1Z2AA 3EIUA 8AT1A 4S1TA 3DE4X 5EPUA 4YLYA 5JI3E 2AUMA 1JSXA 4GOJA 1DQZA 3E2IA 1NWCA 2WAYA 5ADHA 4RQUA 3E8MA 3ABSB 4BV2A 2PJUA 2GBGA 2QTMA 3HYSA 1Y9DA 2OG1A 1HSZA 4MWCA 2HXSA 4YQZA 5FBWB 3R74A 4I1YA 5LQDA 4REMA 3KLMX 1KXJA 1QLHA 1RM3A 5D85A 5HGXA 3I9LA 3O03A 3BMQA 1K63A 3FSRA 3G6KA 3RSCA 4WBNF 5FR1A 4XDYA 4NECA 5EEHA 2Z9BA 1V25A 5IUKC 3HJUA 3FUVA 1COZA 3O1HB 1M1NA 5IEBA 3RRYA 4IDOA 1LBHA 1Z22A 4MV0A 2GAOA 1SZDA 1EWKA 2PZGA 2YHSA 3ZOZA 5KC9A 3L8MA 2DWQA 3DGEC 4QU9A 2ZI5A 3IEXA 1ZW1A 1JWLA 4BQPA 4DGQA 4QGHA 1XROA 3ZHBA 1EWTA 2WJZB 5C5EA 5M2QA 2VSFA 1JR4A 3L0PA 1POWA 2J3DA 4V2IA 3N3AC 4ARAA 2XMDA 1FTNA 3L5KA 4LWPA 1Z4OA 4K6MA 4G0ZA 1YC5A 3F67A 5AJTA 1I6KA 3WX0A 3WWEA 3VNAA 1SG9A 2G9VA 5I4IA