3AFIA

Crystal structure of dbja (his-dbja)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
308
structure length
301
Chain Sequence
IRRAPVLGSSMAYRETGAQDAPVVLFLHGNPTSSHIWRNILPLVSPVAHCIAPDLIGFGQSGKPDIAYRFFDHVRYLDAFIEQRGVTSAYLVAQDWGTALAFHLAARRPDFVRGLAFMEFIRPMPTWQDFHHTEVAEEQDHAEAARAVFRKFRTPGEGEAMILEANAFVERVLPGGIVRKLGDEEMAPYRTPFPTPESRRPVLAFPRELPIAGEPADVYEALQSAHAALAASSYPKLLFTGEPGALVSPEFAERFAASLTRCALIRLGAGLHYLQEDHADAIGRSVAGWIAGIEAVRPHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase
publication title Enantioselectivity of haloalkane dehalogenases and its modulation by surface loop engineering
pubmed doi rcsb
source organism Bradyrhizobium japonicum
total genus 107
structure length 301
sequence length 308
chains with identical sequence B, E, F
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2010-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3afiA00
2XMSA 3F9CA 1P0IA 2PSJA 3H0CA 3SWWA 2WFLA 3ESDA 1XQWA 2WIFA 5AKLA 2OQIA 3BDIA 3G0BA 3RM3A 1LPAB 5CURA 3G7NA 2QT9A 3F8SA 1XLVA 4CFSA 4EBBA 3WKEA 1U2EA 2ROQA 2WHPB 3WWCA 3WA6A 5AKZA 5JD5A 3FWHA 3R3UA 4BCBA 4CG1A 2WFLB 3ZPXA 1VKHA 3F96A 4Q05A 3SX4A 3FYTA 1WB6A 4EY4A 2VJBA 2HADA 4W63A 1XZIA 1WHSA 4H7DA 4UBNA 2GBFA 3G0CA 4MWTA 3STVA 4QLAA 4IH1A 2G5PA 2OCIA 3A70A 4P92A 1ZJ4A 4Q3OA 4AQDA 2XMGA 4GW3A 2WG0A 1BN6A 2JGIA 3WK4A 5BOVA 2HIHA 2FUKA 5AO9A 4A16A 5ALSA 1E5TA 3STUA 5A7HA 3BWXA 2H7YA 3DKKA 5CTAA 3LLCA 4Y2PA 3EQ7A 3FSGA 4G4IA 2QM0A 1CIJA 5AIBA 2QVBA 2D5LA 2OGZA 5ALGA 2XUFA 3PUHA 2CUTA 2Y2VA 3JYHA 2ZYSA 1CUAA 4MQLA 3DL7A 2HA7A 2VAXA 4Y2VA 3DYVA 4A5SA 4HS9A 2XUJA 4K6HA 4G9EA 1TAHA 5KWIA 1CUZA 5AK6A 2BAGA 4I19A 3GA7A 2VEOA 5AKXA 3M81A 1L7AA 1UKBA 5CH5A 1EA5A 3G9XA 3I1YA 1R88A 1A8QA 1EDDA 2X5XA 1BROA 2FX5A 3ANTA 1QIMA 4KAFA 4JUIA 2VJCA 4NS4A 2CBGA 5ISMA 4K5QA 2Y6UA 4QWWA 4N5HX 5ALDA 4H7EA 2WU4A 2PSHA 5F4ZA 1E89A 2OCLA 1MX9A 3JW8A 2V96A 1MJ5A 3L1JA 4AZ0A 4FTWA 1P0MA 1EDEA 4MEAA 2PM8A 1H2ZA 2C0PA 2CJPA 1QIDA 1L7QA 1R4ZA 2QKYA 1Y7HA 4UUQA 4X94A 5K3FA 4G4GA 4LXHA 4ZGBA 2QJWA 4P93A 5LZ2A 4BTLA 4GEGA 3FAKA 4JYMA 4DMKA 2HFJA 5ALIA 1CQZA 4M0EA 4UHFA 2JIDA 4KE9A 1LGYA 2YYSA 4HTAA 1EDBA 3STWA 4TPKA 4UHBA 3EF3A 5JD4A 3WKCA 2O7RA 5D3ZA 1LBTA 5K3FB 2ECFA 4UBIA 5ALNA 1CFJA 1CUXA 3WWPA 2ZYHA 3LIIA 3WKAA 4D9JA 4Q82A 1ORWA 4LKOA 1XRNA 3W9UA 4L3WA 3E4DA 1IZ7A 1K4YA 3WLAA 5AM3A 3IUMA 1LPPA 1UWCA 2XMQA 3WWOA 4OUKX 1H2WA 5HK9A 5LKRA 3QBJA 2UZ0A 2YXPX 5ALHA 3C43A 3T52A 3VJLA 2PVSA 3R3XA 1JMYA 5LZ5A 3WK6A 1HPLA 2XE4A 1YR2A 4BZWA 4GHWA 2ACEA 4X95A 1J07A 4MJ3A 1QZ3A 2HU7A 2ZJFA 4N8SA 1QIHA 2V98A 2QMQA 3N0TA 4B9EA 5EI5A 5DLPA 1GZ7A 4LHEA 4FHZA 3F98A 4HXEB 2XMBA 1JJBA 1MAAA 2XUKA 1KU6A 4GLBA 2GZSA 1AKNA 2JEYA 3G9ZA 1HBJA 1AGYA 2I78A 5CT6A 2CZQA 3FCYA 1XZCA 2WTNA 1ZI8A 1SCKA 2HDWA 2HA4A 3IURA 5EGNA 2RHTA 1R3DA 4XX1A 1C4XA 3WK7A 3A2LA 4BE4A 4OB7A 3FYUA 3FLAA 2XUOA 4EY7A 4FKBA 2ACKA 1BU8A 1A88A 3TRDA 5D6OA 4AO6A 3ZI7A 1Q83A 2WFZA 5FRDA 3OG9A 5AHXA 2B61A 5AKHA 4X00A 2G63A 3CCBA 3WJ1A 1QE3A 3AIKA 2WUFA 1O6FA 1Y7IA 3FLEA 4M0FA 1THTA 1LLFA 3NUZA 2PSEA 1MX5A 3ICVA 2WJ6A 1HL7A 5ALPA 4F60A 3FYUB 1YASA 3CN7A 4X71A 1TKRA 5EHXA 4QDOA 3OURA 5HCUA 2OCKA 2G5TA 3C5VA 4OD0A 5IVHA 3STTA 2OG1A 1VLQA 4C01A 2WG1A 4AX4A 1CUGA 2C0QA 1HLGA 2WIDA 3O9MA 4G9GA 1QGED 5C8ZA 3D5EA 3QMMA 4DLNA 3O9VA 1BEEA 1T2NA 3WL8A 1TK3A 2IITA 4WDRA 4UHDA 3ZWQA 5AI8A 1L7RA 4X6XA 1JMKC 5A71A 1QIGA 4KR0A 1QIFA 2BFNA 1TQHA 2BUCA 4BDTA 1SFRA 1AUOA 4BC1A 1QIJA 4FLEA 4B80A 4C4YA 1QJ4A 4C87A 3WIOA 5ALOA 1MN6A 4WY8A 5FDFA 3FVRA 4DTCA 4F0JA 1EH5A 4HRYA 2RONA 4FFWA 2OAEA 2W22A 3K2IA 3GFFA 1QIIA 3PFCA 1B41A 1W1IA 1DTEA 4J03A 3HC7A 1NU6A 1CUUA 1GPNA 3BIXA 2XUPA 2W6CX 5DTJA 3M82A 3H17A 3STYA 4HVTA 4E14A 1CUDA 1VJ5A 4BCCA 4CI9A 3EBLA 5SYNA 3V1LA 5I7UA 2C7BA 5DTIA 2HU8A 3H2KA 4BAZA 5A7GA 5JADA 2CMFA 3D2BA 4FOLA 5EFZA 5FXMA 2R11A 2R8BA 2HL6A 1TCAA 4GXNA 3SC2A 4B82A 5AKIA 5K3BA 4KAAA 5AKEA 2H7CA 3ESBA 3MUNA 3VISA 1XZMA 2EDAA 5CT8A 1K8QA 4DNPA 2QZPA 4B84A 5SYMA 3DCNA 1QLWA 3C45A 5ALQA 5LP1A 3IDAA 1G42A 5A2GA 3K9BA 3SK0A 3L1IA 3WWEA 1XRPA 1UK7A 1R1DA 2VF2A 1I6WA 1BEZA 3ESAA 1EINA 4KYVA 1KU0A 3WWDA 3D4LA 4M0MA 5AI4A 1E8DA 2DQYA 1CUFA 4AO8A 3C6ZA 1ZGCA 1XRRA 4N5IX 5A6VA 5DYWA 1IVYA 3H1AA 1F8UA 2Q0XA 3FVTA 3WK9A 4EY8A 3OOSA 4JYPA 1E8NA 2PKYX 3R40A 2WIJA 1OILA 2GYVA 2AJ8A 3D7RA 1MAHA 3UUEA 5ALZA 3QZUA 3M3DA 4MYDA 3ILSA 4Q3LA 3QPDA 3WKBA 2GBIA 2WHQA 1B6GA 3H1BA 5H3HA 1DX6A 2PSFA 2O2HA 1CV2A 1CEXA 5A7FA 4W1RA 3G0GA 3QMWA 1ZD2P 1A8UA 4Y2SA 2XQGA 4BTVA 4UBKA 5AIAA 1W52X 1X70A 1DWQA 4JNCA 4ZV7A 2WHPA 4QLOA 4K6GA 2OGTA 2H1IA 4DGQA 3VJKA 2QUAA 2VAVA 3ESCA 2FJPA 1E8MA 4PQEA 1JJIA 2WQZA 1QO9A 3EIOA 2BJHA 1BS9A 4W9RA 5AM1A 5IVKA 2ONCA 1HQDA 1QIKA 4UHCA 3VVMA 1Z68A 5HF8A 2VATA 4V2IA 5EHQA 5AM2A 3HXKA 3W9BA 1P0QA 1RP1A 4WCVA 4JEIA 4QDZA 3DNMA 5JAPA 1ODSA 1QTRA 1S8OA 1ACLA 1FJ2A 1XZGA 5ALUA 1XQXA 3O4IA 3YASA 5JD6A 3WA7A 2Z3ZA 3GUUA 4WY5A 2Z3WA 4KE6A 1F6WA 4HAIA 4QDTA 4H7HA 2XQIA 3KSRA 5C8VA 4C4XA 2GBCA 5AI9A 2CB9A 2XLBA 5JIBA 2WILA 4J0HA 2C4HA 3FYUC 2I3DA 2XUQA 1CUIA 2WM2A 1R9MA 1JT2A 5IVIA 1NU8A 4EB0A 3G0IA 4J0KA 4DMHA 5HK8A 2XT0A 4KE7A 5K5EA 2JGLA 2DR0A 2BGRA 5D3KA 2C5FA 3HJUA 4A23A 2ZYRA 4DMFA 4Y9SA 3CN9A 4TVKA 5FPPA 2Z5GA 3NWOA 5IH7A 4DIUA 4QZVA 1FFBA 1N1MA 1XZKA 1AZWA 2XUDA 3S2ZA 5AI5A 1LPMA 3V1MA 3FBWA 4FWBA 4UHEA 5BWBA 5E2IA 2JBWA 1LZLA 4YK7A 3G9TA 3WI7A 1CVLA 4Y2QA 1WOMA 3AFIA 1DQYA 1ODTC 4QNNA 4J0DA 1J06A 3W2TA 3DJYA 1F0NA 4X90A 3AIOA 5I8PA 2DCMA 1F0PA 3HSSA 3PDCA 2DHDA 1ZI9A 1X2BA 2C5GA 3H19A 3WYNA 2J4CA 2GZRA 2D0DA 4QDUA 1DQZA 5DJ5A 5KWJA 2WSLA 1CUVA 3DKRA 2DQZA 5EIHA 4AMZA 4UBJA 4GDMA 3O95A 1FSSA 4MQMA 4WFJA 2WUGA 4OCZA 2WIGA 4X93A 4KJXA 3D2CA 4J0CA 3D0KA 2J3QA 3A2MA 4FNGA 4BB0A 3BJMA 2OQVA 5IKXA 3DL4A 1ZD4A 1VZ3A 2LIPA 3V1KA 1GPLA 1MO2A 5FOQA 1XZFA 2OPHA 5J3JA 1DU4A 1CR6A 3WL6A 3I2GA 1BE0A 1UXOA 1XFDA 4XWGA 2OXEA 1SC9A 1BCRA 3QVMA 5LYYA 4J3JA 5JAHA 4MYSA 2K2QB 1CPYA 1ZIXA 5K3AA 3DS8A 5CH8A 3DOIA 3VDXA 3WK5A 2WUDA 4H7IA 1QO7A 1PJAA 1E3QA 3QMVA 2O2GA 4C89A 2XMDA 3H2IA 4OYLA 4H18A 3QPAA 3ZLTA 4BATA 1DT5A 4OU5A 2ORYA 3H04A 1HKHA 1GGVA 4EZIA 3F67A 1G5FA 2OCGA 4B6GA 2WKWA 2B4KA 4DNOA 5LZ9A 3ICWA 3TJMA 3IVMA 3R41A 2XUAA 2HU5A 5ALVA 4CIBA 3R0VA 3BXPA 4U2GA 4IH9A 1UK8A 3EQ8A 3DYIA 5HF9A 3WKDA 3FOBA 4WJLA 3I2JA 4F21A 5JALA 4LXGA 4Z49A 1EX9A 4QDXA 3CXUA 1VXOA 4Y2RA 2ES4A 3BJRA 5EHZA 2Z8XA 5T4EA 2H7XA 3TEJA 1CUJA 1UOPA 3BE8A 1DINA 3B5EA 4Y2XA 3WL7A 3BDVA 4H7JA 2C58A 4BP9A 1RWQA 2ZJ7A 1Q0ZA 5C81A 4BYMA 3H18A 3OTQA 1XZHA 2PPLA 1VE7A 2DHEA 2XUGA 1CUCA 1W6RA 3R3WA 4H7FA 2XQKA 2QRUA 4J7AA 2YASA 1WPXA 3MUOA 1LPBB 4Y2JA 3L1HA 1IZ8A 5LZ8A 1QFMA 1H2XA 1M33A 5JZ9A 4CCWA 1EXWA 4K2AA 4RNCA 4BRZA 4OSEA 4WDQA 4OYYA 3I2IA 4OB6A 1ZI6A 5HQ3B 3I2KA 2PX6A 1ZOIA 5CT4A 1IUOA 4DM7A 1FFCA 1KEZA 1T4MA 4BE9A 1YAJA 4KRYA 5LLSA 5E4YA 3WZMA 5BV7A 4KRXA 5ALYA 1N8SA 5ALMA 4FBMA 3BIWA 2OLEA 1EVQA 3AJAA 2GYUA 4L72A 3RKSA 1WHTA 5AOBA 2PSDA 3E0XA 1D07A 5I9IA 1UK6A 4BZZA 5FLKA 4AN1A 2Y6VA 4GBGA 1ORVA 1XROA 2O2IA 5LKAA 1EB8A 4CIAA 5AICA 2RI6A 4G8DA 4YASA 5K3CA 3C6YA 4XVCA 2WFMA 4JH0A 1JJFA 1U8EA 3V9AA 1YS1X 3PF8A 1LNSA 2VT6A 1UKCA 5JZBA 2GYWA 4ROTA 4EHBA 3T4UA 1J2EA 3I28A 2JGKA 1Q84A 5CT5A 4PNZA 3G9UA 4ITVA 5CXUA 3KDAA 2J4FA 4BCDA 6YASA 4HXGA 1FFAA 3UMJA 4OPMA 4BVJA 2CKMA 5C8XA 4UBMA 1R9NA 5LZ4A 4H0CA 4W1PA 3S8YA 2HA6A 4W1SA 3R3YA 4UHHA 4FFVA 1JU3A 3KWJA 5A62A 4G1FA 5AI6A 4IH4A 1TCCA 1DT3A 3FLBA 2OGSA 4DSAA 1XLUA 2H9YA 1J1IA 4YX9A 2BCEA 2QOEA 3C70A 3D59A 3H2HA 2AXEA 1BRTA 5AOCA 4PO3X 3Q8WA 5AOAA 3DQZA 1XZDA 3TGLA 5FV4A 4X3CA 3AILA 4ZV9A 3STXA 3QPCA 4PSDA 4TGLA 2ZVDA 5EIAA 4GI1A 5ALKA 1G66A 4AXBA 3HYSA 4QEKA 4MWSA 4X6YA 3HI4A 3KWFA 5AJHA 5FKJA 3DEAA 2JEZA 3LIPA 4WFIA 3AIMA 3ED1A 4U2FA 4FBLA 3QITA 5AK4A 1CRLA 3N2ZB 1UOQA 3ZV7A 3AINA 1WCYA 2CEKA 3HACA 1XRLA 4H35A 1XZLA 2WIKA 4LXIA 5AK3A 5CRIA 1XZBA 1CUEA 2G4LA 5ALTA 2Y1KA 4FMPA 4XJVA 5CMLA 4ARBA 2VJDA 1LZKA 1ZJ5A 2BUAA 4J0IA 4K6KA 4AMYA 2DSNA 3ANSA 3LP5A 2QTBA 3O4JA 1CLEA 3NGMA 4B81A 1C7JA 4G8CA 3G0DA 5AKYA 2JGFA 2B20A 1WM1A 1AC5A 1THGA 3BF7A 4Q3KA 2XI4A 4O08A 1SOMA 1XRMA 4FLFA 3B12A 2YH2A 1AX9A 3LS2A 4H77A 1G4HA 3U1TA 5T4FA 5FUMA 3KXPA 4I4CA 2PL5A 5CXXA 5AM4A 1SCQA 1ETHA 5ALXA 2JGMA 1XLWA 3AZQA 4AN0A 3QYJA 1CUHA 5AI0A 5JASA 3ZLVA 2WLSA 4EY6A 3PF9A 4P9NA 2I03A 4G8BA 3OPMA 2QJRA 4L9AA 3UUFA 2PUJA 3I2HA 5DYYA 3DDUA 5AK5A 1CUBA 4HZGA 2WG2A 1MPXA 1MNAA 3GELA 4X7BA 3IUQA 5AM5A 2XDWA 5EIEA 1ODCA 4AO7A 2JGJA 2HHAA 4UFNA 2XUHA 4X92A 4E15A 1FFEA 2WHRA 3FCXA 1Y37A 3GBSA 3E3AA 2DHCA 5ALEA 5K3DA 4UPDA 2AJLI 4B0OA 1VOTA 5HFAA 1EI9A 4X91A 5JAOA 2XUIA 5JATA 4I3FA 4QA9A 1CUYA 1A7UA 4BDSA 2WUEA 1OCEA 4Y2UA 2HA0A 3X3HA 1ZD5A 4Q34A 1P0PA 3M83A 3WZLA 4AZ3A 3AZPA 5AKJA 1YB6A 3GZJA 1YCDA 2XMRA 4J0GA 4BVKA 4BC0A 3E1GA 1BN7A 3DLTA 4PW0A 1JU4A 2QR5A 4BVLA 4X6UA 4DNQA 2EEPA 4ZREA 1XQVA 2AJCA 3LCRA 3VJMA 1UT6A 2WTMA 1ZICA 1XZEA 2ZSIA 4Y2YA 3WIBA 2QXTA 1EHYA 3PUIA 2PBLA 5HF6A 4HXFB 2WJ3A 4ZWNA 1MNQA 5ALRA 4KAJA 3IA2A 4INZA 1UKAA 2VJAA 2ZJ6A 5K3EA 3HEAA 4G4JA 4N8EA 1AMNA 3C6BA 3G8YA 1GT6A 4KEAA 5CT9A 2AJDA 3K6KA 2NW6A 3WQHA 3C5WP 1LBSA 4U2DA 4U2CA 3MGAA 1EVEA 2PUHA 2VT7A 1LPOA 2AJBA 3HZOA 1DWOA 2JF0A 1ZGBA 1GPKA 4BP8A 3R3ZA 3WK8A 1WPRA 3W06A 4KE8A 3OC0A 3HRHA 3R3VA 4F5ZA 1XKTA 2HA5A 4EUSA 4Y7DA 4FDMA 5DYTA 3VXKA 4B0PA 3IBTA 1GXSA 4IO0A 2QUBA 1W76A 4GWLA 1OXMA 5HZGA 3KD2A 1H2YA 3PFBA 1LPSA 1QOZA 7YASA 3Q0TA 4UFPA 1DWPA 3WL5A 4BAUA 3FSGD 3I1IA 1CUSA 1UFOA 2IX9A 1CQWA 1TCBA 5HFNA 4C4ZA 3QH4A 3IB3A 3I6YA 1BCSA 2QXUA 4RPCA 2XMCA 4X85A 4PSCA 1N5RA 1YA4A 1QTIA 4C88A 4LIPD 4FLMA 4LYDA 1HDEA 2EDCA 3AZOA 4J0JA 4YPVA 1DX4A 5T4BA 1QONA 2BKLA 2B9VA 5BWCA 1TRHA 1EK2A 3HABA 4Y2TA 4NZZA 2HA3A 5DNWA 5DNUA 1H23A 3QM1A 3O0DA 4DMCA 2PU7A 1USWA 3IIIA 4DYHA 5FPQA 1EK1A 1R50A 1H22A 2IIVA 1ZD3A 4HRXA 2PU5A 5C7YA 1GQSA 1E66A 4NMWA 5ALWA 1W4LA 2X8BA 1WB5A 1VE6A 1K5PA 3VVLA 4GECA 2JGEA 5AP9A 4MEBA 1MX1A 1GKKA 3WYDA 4OB8A 4ZRDA 4E11A 1XZAA 1VA5A 1QFSA 1UOOA 5JAUA 2DFPA 3EQ9A 5HQ3A 5ALJA 4BRSA 3C6XA 1AQLA 1WB4A 1JKMA 3RK4A 3PE6A 1Q0RA 2WJ4A 3JWEA 3O4GA 1VZ2A 1ACJA 5YASA 3D2AA 5ALFA 4RE5A 4E46A 3PI6A 2HA2A 2Z8ZA 4B85A 2VQ6A 2RIPA 3I6ZA 4XIIA 1UK9A 4S0XA 2HRQA 1LPNA 3BF8A 5JYCA 4RGYA 5HKAA 1GQRA 5T4HA 2I3ZA 4NVRA 4CCYA 5DWDA 3FNBA 4ZXFA 3C8HA 2OAGA 1YSCA 5DNVA 5FP0A 3W04A 4L0CA 1PV1A 1XQYA 1K63A 5JZSA 5ESRA 4B9AA 2FJ0A 1CUWA 2XMZA 3C87A 3IULA 5IVDA 1YAHA 4PV7A 2V97A 5E4JA 4PSUA 4AB1A 4ZI5A 5HKBA 4KACA 1JFRA 4CCYB 1EB9A 1VA4A 4MXDA 4B7ZA 4DNFA 4X97A 1TIBA 3V1NA 3DOHA 1XRQA 4DSZA 4CG3A 3W05A 4B83A 1QIEA 2ZSHA 4U2EA 4IHAA 3A6ZA 2XQJA 2Y2UA 1JI3A 3H2JA 4P08A 2RHWA 2BGNA 4ARAA 3GROA 3P2MA 2VSQA 1U65A 1NX9A 5CBKA 2XQFA 4OU4A 4QWMA 1MTZA 1XZJA 3H2GA 1MU0A 2QS9A 2VA9A 1K6EA 3A2NA 2WU3A 1C7IA 3I6MA 5AKGA 4H7KA 1UZAA 3MVEA 3OM8A 1ZIYA 4U2BA 3AUKA 3ZLUA 5LIPA 1A8SA 2RGUA 3U0VA 3B3QA 2E3JA 3VKFA 4BAGA 3KOOA 4FNMA 3RARA 2RAUA 3IUJA 5KREA 5KBYA 3C8DA 3RLIA 3NOXA 1MT3A 3WJ2A 1FFDA 2P8SA 2VTVA 4G5XA 4EA6A 5JANA 1X2EA 1GKLA 5CH3A 3PICA 2HFKA 1IUNA 2O7VA 2GBGA 2X76A 2XB6A 5AM0A 5LZ7A 3CCCA 1U4NA 2HRRA 2V9ZA 5CW2A 4UBLA 1RYYA 4WFKA 5EHNA 3O4HA 5ALLA 2HM7A 4BBZA 3IUNA 4RE6A 1AURA 3DD5A 4UBOA 4ETWA 5D7BA 1VXRA 4N8DA 2XLCA 1YA8A 3V48A 4LYEA 4W1QA 1IMJA 4UFOA 2J3DA 5E4TA 1W75A 4Q1VA 1N5MA 4IQ4A 4QE3A 1PFQA 5AKKA 5HF5A 3F97A 1ISPA 2ZYIA 3HLKA 1O6GA 3BL8A 1IUPA 4CG2A 4PF1A 5AH0A 3G02A 3I2FA 4C6HA 1YB7A 5JARA 2BUBA 1SCIA 1YS2X 3WMRA 3D3NA 1XKLA 4EY5A
chains in the Genus database with same CATH superfamily
3MRVA 2ZYVX 1HE4A 1J0EA 1ZG3A 4HX5A 4IJVA 3AHHA 4KQXA 4KJZA 2FN8A 3CY6A 1KDYA 5JEDA 3F9CA 2HLNA 1NXPA 3PNSA 1P0IA 1VI6A 2RGGA 1Z0ZA 1EJ0A 1A9ZA 1QYCA 4DOMA 1H6AA 2VPWA 1BKSB 3ETLA 2WIFA 3KFVA 4G1MB 2EEZA 4P84A 2GN8A 4D6YA 1TIPA 4DYDA 1VPTA 2EWWA 2KWIA 2QL6A 2WPDD 3RM3A 4U7JA 4TS3A 5KU7A 3MLAA 5H3LA 5ICGA 4ZQGA 4TKUB 1ZUHA 1W5SA 3N2LA 5CURA 1OKKA 3G7NA 3RWMB 1QGOA 2JJ1A 2OHOA 3B2NA 3JARA 3BMQB 4C7MA 2NTYC 3DULA 3F5QA 2AFHE 1S89A 2OV6A 1CIVA 3M4XA 1BGWA 2GESA 3DAPA 3QKSB 3VKUA 3VZRA 5IK2A 3QE3A 1NVUQ 2O3JA 1R0KA 3KYJB 3TB6A 3AF0A 4OFWA 1S9DA 4F3TA 3OX4A 2GZ3A 4AXXA 5IWCA 1HNZB 4AC9A 3EZ6A 2P2NA 3BXEA 4KO4S 1JLSA 3CS3A 3MT0A 4M9RA 2BISA 4MP6A 3WA6A 3BMCA 3N1UA 1A9SA 1NF9A 3MBKA 1UXKA 1VIAA 4UDYX 4YRZA 4ZCQA 3U4QB 4GRIA 2EFHB 2FPLA 3B7GA 4RXTA 1FTWA 5DLQC 1UBMS 2COEA 5TX7A 3ZPXA 2RI0A 3F96A 2R8YA 1GQOA 1SXJA 3FYTA 2YHSA 5J43A 1XMXA 3GC6A 3OIGA 1LUAA 3G9QA 1R6VA 2HSJA 2BEVA 3AFMA 1TC1A 3BGOS 2HADA 3DEKA 3FX2A 4WACA 5JXIA 2OYSA 1YJBA 2FUG6 3I23A 4JAVC 5FLEX 1ZSVA 3R0QA 1QC5A 2F3QA 2XYHA 3IOYA 3QU2A 4F1WA 3OFNA 4H7DA 2GBFA 1YCFA 2VJMA 3FMFA 3KOXA 1V5IA 4UTRA 1ESMA 2IYVA 3C3WA 1NR7A 1ZISA 2PX4A 3HBLA 4G97A 4PM4A 3OF2A 4TQ9A 4YECA 4UAGA 3STVA 4UPVA 3HV2A 3HB7A 3PNMA 4IH1A 4BQFA 1HX7A 3ZTTA 3AFGA 4BO3A 4DBVO 3D7KA 3ZNQA 4S2EA 3ZBPA 4EHFA 4MKZA 5AVYA 2CHEA 2WZQA 2VYNA 3H42B 7MDHA 3CEMA 3KKLA 4BNHA 4Q3OA 4PC2A 3O0TA 3T9DA 2OG2A 3B3GA 3NHJA 2CK3D 3V8PA 2WG0A 1BN6A 1KQNA 5KYUB 1Y4DE 1A4RA 2ECQA 2OT3B 2ZRGA 3AM3A 3E1SA 1YJQA 4QYIB 5K0FA 4W5NA 3G82C 4JB8A 2YWGA 4X1IA 2BF7A 3HNRA 3EIXA 5ALSA 5A4FS 3STUA 1OIXA 2GB4A 3S4YA 3U3DA 3VR6H 1OAOA 1HUQA 3OQHA 2W8BA 2HT6A 3ROGA 1XAJA 2OZLB 1JA1A 1NQXA 2WYIA 4RGQA 5EINA 5DBGA 521PA 4YJHB 4OBEA 4PZDA 4ZEWA 1NW9B 4IHJF 3SQMA 3CW8X 3V6MA 4B35A 1HOTA 3MYYA 4OREX 3QPUA 3ROKA 1E1NA 2PUCA 3DKKA 1S96A 4Z1MD 4D0LB 1C3OB 1UBJS 2QT0A 4ZO4A 5CTAA 3UAWA 2BFOA 2GASA 1E9EA 3FSGA 3WB0A 5CFLA 1NYTA 3ZHZA 3KG2A 4LTNA 1W47A 3UMMA 5AIBA 1RC1A 3ASVA 3JVUA 4MPPA 2QVBA 4NE2A 1U2PA 3OM0A 5EJAA 4R1MA 4ZYVA 2EP7A 2Q3CA 3NEJA 3BSWA 3F6BX 4HWOA 5E2AA 1BMTA 4HD8A 3W4IA 3SHTA 1S2GA 4FYPA 4NZ9A 4O3FA 1XGKA 3Q40A 1RRFA 3JYHA 3OQMA 1ZM9A 1NXQA 2JFVA 2NZXA 1D6MA 2DPLA 2ZYSA 1SIOA 1XK6A 1JBEA 2OCAA 4LJ9A 4V24A 2MJLA 3USZA 4D3DA 2JHCA 3D0RA 1P3JA 3IE0A 4Y2VA 1ISJA 3DYVA 2Y0DA 3GLKA 4FINA 1KZ9A 4A5SA 4D9EA 3DLIA 1YDMA 3TNYA 3B9BA 4W9MC 1R5BA 2EERA 4AFNA 1JA9A 2OZKA 2Q4RA 4QAQA 2X8JB 1TAHA 4RJ2A 4REQB 4ETMA 1CUZA 2HW8A 1IHPA 1CWUA 1RYMA 2BAGA 2QSZA 3R5SA 4HNSA 5I3ZA 5ICCA 3ZHCA 1DXQA 1KFEB 3GA7A 2VEOA 3AY6A 3HZRA 3M81A 1UKBA 5IKMA 1S1MA 1R6XA 4ZT3A 2QRGA 4CTMA 3I1YA 1R88A 3NU1A 4P35A 5L95A 2CD7A 4O6VA 1EWVA 4TQUS 3AJEA 2VBCA 3FIJA 1LU9A 4KNYA 1L4HA 1LXCA 1G41A 1QIMA 1GPWB 3QUAA 1VLVA 5DYNA 3B38A 1WDMA 1U81A 3E58A 5J59A 1OXSC 4F8YA 2QG6A 2CBGA 3LHFA 5JC1A 1GPMA 4RVDA 1P7YA 3JQ8A 5CK4A 4JR2A 1WSBA 1F8YA 5DM1A 4G65A 3EGCA 3K32A 5ISMA 4EH1A 5KKNB 5H1YA 4G5HA 1W0KD 2OXRA 3UB2A 5I9NA 3KZOA 3V4OA 3I45A 4QWWA 4TV9A 1VG8A 1XEFA 2WU4A 2P2YA 2XVXA 3HYTA 3M9XA 3ZCQA 2PH1A 3JW8A 1QFJA 1UZNA 2B0JA 2ISQA 2JGDA 3SBXA 1IM5A 2XNDD 1R6BX 3HKEB 4GI5A 5IASA 5HRUA 4FTWA 4XUGB 3BXGA 1P0MA 1ST3A 1X1EA 2VWGA 3DLPX 1R6AA 2IOQA 3IUBA 4MEAA 3NEAA 4QYWA 1YGPA 3I1FA 4PX9A 1RYBA 3ZWMA 3CEPB 4H2DA 2QJOA 2QKYA 3KAKA 1XDDA 5DHUA 5EJ5A 2Q07A 4G4GA 3C97A 4P93A 5LZ2A 1XTBA 3THYB 3D4NA 2FTKE 1UIRA 2QLFA 1XXHB 5FUWA 4RACA 4WVLA 2VAWA 2Y1GA 4JYMA 2C7QA 4KVAA 2HFJA 2X1LA 1N6RA 4B33A 3RUIA 4BLSA 3H7IA 5SZHB 1GZDA 2OM6A 2WF6A 1ATZA 3L4EA 3R24A 5EPEA 2J7PD 3TZKA 2VXYA 4CPDA 4CF6A 5BVHB 5KYYB 3GRYA 4W82A 3TZQA 1RJDA 4B8WA 3HBMA 3IPRA 1CXZA 4M0EA 4QUKA 2W42A 1ZZGA 3A28A 1G6HA 2YS7A 1WMEA 2VUUA 3D6TB 3T9AA 3W78A 1E62A 3AVPA 5AVKA 3GLSA 2J9GA 4OQQA 1H93A 1P73A 1W0JA 5D5PA 4BNMA 4MV7A 4HLDA 3UK0A 3QU9A 4IEEA 4BWYA 3UEOA 4B2PA 2CMGA 4NYJR 3WKCA 1M1YE 2GEJA 1QKKA 1ZMBA 3LLSA 1F1JA 4GR5A 4LJ4A 1NTOA 1KEKA 1N3IA 4G26A 5CDGA 1PEDA 2PCJA 5B12A 3WHKA 3B7WA 5K8VA 1TMGE 3ORFA 2VDOB 5GIOE 3DD1A 3QBTA 2JAXA 3NAGA 2WKSA 4B3FX 4Q82A 3Q1KA 4OA5A 5K2OA 4YN3A 5BYJA 3C3MA 1SPBS 1W8DA 4LKOA 3WL3A 1D1PA 2ZULA 3W9UA 3E4DA 1RHKA 3O47A 4NV1A 4BNJA 2MYPA 2CLCX 5AM3A 1EIWA 2A0UA 1P6XA 1CP3A 4JLVA 1Z6XA 4GP7A 1A8PA 4AJ2A 1C0PA 1OQAA 2IXFA 2WJVA 4B46A 1AGXA 3GRKA 1H2WA 2GTIA 3HYCA 3ZUGA 4AT1A 3QBJA 1H1DA 2C2YA 4PSAA 2HLDA 4KQEA 4PCVA 4Q3AA 3VR6A 3VU0A 2NM0A 1N78A 3BFKA 2YXPX 1H4VB 2G71A 1E2PA 3VYTB 2Y0BA 3IYLW 1E5XA 2E6KA 3UXYA 2GCOB 1QCDA 5BQFA 4CKEA 2YRFA 3IUYA 4Q1AA 2CT8A 3NMUF 2ZIFA 5C1BA 3T52A 3ISTA 4KZKA 4W8HA 2VPXA 1K5DA 1E2LA 1ONNA 3A4YA 3VJLA 3H11A 4XM2A 5AXAA 1W7AA 3CQ9A 4L28A 1WR8A 3K2QA 1AG9A 1FQJA 1ZO8A 4GPAA 4P32A 4Q4LA 2HWWA 5LZ5A 3CFYA 3S55A 3WK6A 4MNTA 1KNQA 2RGXA 1YJAA 4TT3D 2WF8A 3M4ZA 3PCTA 3RSLA 1T6BY 3CE9A 1TJYA 2DECA 1PJ3A 3BTSA 4HJRA 4GHWA 4TWJA 5LXTA 3ORYA 3U7RA 1TL7C 2WWYA 4MKFA 4TV8A 1PZNA 4CYMA 3TLYA 2NU8A 2XCOA 3AEQA 2HI0A 4LI3X 2HU7A 2IE0A 4U5XA 1GGHA 3ABZA 1EFCA 5TRTA 4PHHA 2R4QA 3P1JA 1NLZA 3OBBA 3PKJA 1D2RA 3S28A 1V8BA 5DLPA 1SA0B 4QU0A 4NBUA 3P9RA 3ER6A 3HY4A 3WMGA 3I1JA 3KJFA 2XUKA 1R4NA 1VE5A 3B3AA 3E9RA 4IUDS 4QRHA 4IXTA 3DQPA 1ZX1A 4PG7A 3HUFA 4IIUA 4LUCA 1JDNA 1KOGA 2P68A 2WTAA 1BA3A 2V3VA 4OQ4A 1NZFA 2RGCA 3I8SA 1HBJA 3JY6A 3LPNA 4WCDA 1AGYA 2BSQA 2EU8A 3L1KA 1AHIA 1AXEA 2CZQA 4TSFD 3FCYA 2QL9A 5CT6A 4E08A 3OTOB 1O95D 1FK8A 2ADOA 1UJMA 3D8RA 4TYPA 4GYYA 1RC8A 2NSYA 2WTNA 3LUBA 5KOIA 1YHNA 1ZJZA 3IAS6 1BVRA 1ZI8A 1KPGA 1WEKA 3K0CC 1P33A 2ZJ4A 4MUEA 3C7AA 1NL3A 2HDWA 1Y8QB 2HA4A 3ML1A 3IURA 3QUSA 4WOJA 4AIIA 1U7TA 4NF2A 3MXOA 4UZEA 4ZOQI 4XX1A 2CBXA 1C81A 5BP7A 1M1XB 2FGKA 3INTA 3K0SA 4BE4A 1CRWG 1M0EA 4YQFA 3DWGA 2ATIA 3Q7PA 3RIYA 4CF4A 2G9VA 1G6Q1 2K87A 3N0XA 3WR5A 1A88A 5AVSA 4Q9LA 2DC1A 1V4NA 3HUEA 4BMCA 5EYPA 4XVHA 3D1VA 1T2VA 4KPEC 2G6BA 3QK7A 3K1JA 2ODEA 2QN9A 1LRJA 1QO0D 2WFZA 4MGEA 3IP5A 1UM9B 3ZH2A 2FW0A 5C5CA 1M8PA 5AKHA 3ORRA 4WE3A 2HWUA 3WQRA 3EWAA 4B5LA 3WJ1A 2A0KA 3H9BA 5EKXA 5IBQA 4MDHA 2PFKA 5KYXB 1NJGA 2ZI6A 4MW9A 1M72A 2HF9A 3QKRA 2JGRA 4HWSA 4UNPA 4D0GA 3A6DA 4RH1A 3FLEA 4GYKA 2VP6A 1LX7A 4M87A 3RC3A 4LHSA 5CHYA 3V1UA 3A4MA 1EFDN 4DXDA 3I8OA 2DPMA 2P2SA 1SRRA 4HXYA 1RYDA 2ZSKA 4M3NA 3O8BA 4DRZA 2QY6A 1OLXA 2WJ6A 4EJSB 1FLNA 2FMXA 2BZSA 3K92A 3EGDB 1IY0A 4RMNA 4FOPA 3FRHA 4D97A 1D1SA 3J81A 3AVWA 2AHOA 4X71A 4B17A 2WYHA 5AW1A 3NUQA 1MHPA 2C94A 3ZXYA 4QDOA 3G0HA 1QG6A 4TZ0A 3OURA 2OCKA 1L5RA 3H86A 1JHXA 2Q1XA 4OJKA 4TMFA 4HAXA 4XDHA 5EJ9A 3D0QA 3DDNA 1QS0B 2CVOA 2NWQA 2A35A 3NATA 2JI6A 1EUCA 3FJYA 4JIMA 2X0DA 2IV2X 2C0QA 2QJTA 2QR3A 4XYMA 4J94A 5GZ6A 4G1UC 4DADA 4G9GA 4IQ8A 1SAYA 1MG5A 4TSKA 2I2BA 5C8ZA 4P4SB 3D5EA 1W4AA 4JJ4A 4R31A 3U39A 4LF6B 2J46A 3KHSA 1PL0A 1BEEA 1JZTA 1O96A 4GYWA 1I1QB 3U17A 3ONEA 4IG4A 1LSJA 2O5VA 5EUBA 1PCXA 1G64A 2VHUA 2ZIXB 1G4AE 3KTFA 4LBYA 4XDZA 2Y1WA 4O1MA 4QYSA 5EQJB 3OLYA 4UMVA 1QVAA 1EJ2A 2VTEA 5FLXA 1E6KA 2ODQA 4WN9B 7MHTA 2Z8YM 2BPOA 2HXGA 3PIIA 4WDRA 5AOVA 5ECDA 5BYBA 2FPPB 2PTHA 1RXUA 5AI8A 1HMYA 2AA3A 4B4DA 1YUMA 5A71A 1PNRA 1QIGA 4KR0A 4OMUA 3QTBA 5H83A 2BUCA 3BRSA 4BU1A 3ED5A 1NLFA 4GLLA 1XL1A 3FHTA 1GAJA 5EZYA 3VR2D 4BO9A 3PX2A 3HDGA 1OLSA 1XTQA 4FLEA 5DM2A 1JQBA 1DADA 2O6LA 4TROA 5GONF 3S5JA 3RIGA 4J90A 4B80A 3VKGA 4JWKA 4MA0A 1FQOA 1V45E 2QTVB 5F3DA 3GZNB 4C87A 2FG7C 5EVJA 3ASZA 2DUUA 2QENA 1J49A 3OLWA 1NURA 2RG7A 1VL2A 5AMXA 5F1OA 1R8QA 5EPOA 4ACBA 3HVJA 4Z9XA 1LV8A 4IY1A 1BXGB 3L77A 4U8GA 3WL8A 1MN6A 4M7RA 3PEFA 4MV8A 3GAZA 4ZYWA 1QCCA 1AKMA 4F9GA 1QTQA 4HRYA 1DJNA 2ZUSA 2RONA 3LKBA 3AOGA 5LN1A 4HEA6 1W5FA 1JHUA 4EA7A 3I34X 4M0DA 5E3HA 3K2IA 4RLFA 3C24A 5DNUA 2ZRNA 3FPFA 3UK1A 1R8XA 2BFBB 3QFHA 4KIGA 3KJZA 3DFIA 2Q7XA 2YNMC 3KQTA 3PHJA 3HSKA 4GAEA 4RA6B 4BGEA 1KH2A 5DV9A 4Y0AA 2R8OA 4RFLA 2A9PA 3SIPA 5CVCA 3EX7C 1A9XA 2QV7A 2IHVA 4HPJB 5LBIA 2YHUA 1PIWA 1R2QA 3TQHA 4M1TA 5GM1A 4DQUA 3PHCA 2FX3A 1R66A 1NU6A 1VKJA 3PPYA 1ZH6A 4QUAA 4PYNA 4CLXA 2PEYA 4C0HA 3R0IA 2XUPA 5I4BA 3IBCA 2AKAB 5TPZD 4KQKA 2P5TB 4JEMA 3CXRA 4N7JA 2ZQ5A 3I9KA 3PTLA 2P6RA 1FJXA 4XYLA 3BWDD 3WNBA 2AHRA 1OH5A 1YR8A 3HBFA 3DZ8A 4PFJA 4X0EA 4F8EA 1QFXA 1UQTA 4JLJA 1QAQA 5LD2C 1M6HA 3N2EA 2ST1A 1GUFA 3MINB 2NUAB 3ZWBA 1Q3KA 1T4BA 3B3FA 1P2TA 2VUIB 5H5JA 1IN4A 1Z33A 2HU8A 1UBHS 4GZ3A 1DIAA 3HU2A 1KEVA 3K5HA 1ZNWA 5FA5A 4ZIRA 5A7GA 1ENZA 1B8VA 2EBWA 3LNCA 4K9KA 3U7EB 3ROQA 3FROA 4FOLA 4YDQA 5BN1A 1TAGA 1DIRA 3K4QA 1DC8A 2HL6A 1J24A 3WLTA 1E98A 1WS6A 1JB9A 2P7IA 1NAIA 4GXNA 3BMOB 4KVFA 4URUR 1JFTA 1ZEJA 3LZDA 2EJWA 4B82A 4LC9A 1RWKA 1U99A 4KAAA 4LPKA 2VDKB 3L7LA 4QJ4A 5K3BA 3TWOA 3LWBA 1VCNA 3M34A 3MUNA 3FBGA 4F4HA 2CHGA 3EMVA 1K8QA 5CT8A 4R16A 1HFWA 2GCGA 4G0OA 3UBMA 1IQ0A 5A9RA 1IXZA 4UTXA 3DCNA 2PUTA 3OEHA 5D6NA 1KEUA 1QLWA 1HEIA 1R18A 2YZ2A 2XYGA 1HQYE 2OB1A 3O4RA 1LVGA 4HB4A 3TE6A 3OETA 3KVVA 1E2QA 2FN4A 2LPMA 1RLUA 3E2PA 4D96A 3NFYA 4CF5A 1G42A 2NQ2C 3N0WA 5EXXA 3SJ7A 5J4VA 1NX6A 1A9YA 4MYTA 5A0FA 3T7AA 3W34A 1PV4A 2AOUA 1R1DA 5E3JA 3W2FA 3VDNB 4F5DA 1F0YA 2OZEA 4S1WA 5EKDA 1C0EA 1I6WA 1Y5NA 4GOLD 4V0LA 1Y1RA 4M98A 4RDHA 3RVMA 1EINA 3Q12A 4KYVA 4Q7QA 1KU0A 1UKZA 1XU7A 3WWDA 5KO2A 3GN1A 4ZGWA 2ATXA 3TTXA 1FFSA 1SOAA 1YC2A 3O8RA 3OKFA 1EXDA 4LVCA 3GT7A 1QV7A 1NVGA 1VKNA 1BX1A 1CUFA 3EXHB 4AO8A 4X6LA 3UK7A 5GZ3A 4NXNB 1RXIA 3EY4A 3A9UA 3CSUA 1ZGCA 5HUJA 4MRVA 5DN6D 5IDXA 5FCDA 4DJEC 4MRRA 1CVRA 4BEWA 4B79A 2AKYA 3H1AA 3VDRA 3WFZA 2Z0MA 4C3UA 1I6LA 3OE1A 3FVTA 1DP4A 2DWQA 3CPHA 2EQAA 2OPBA 3WK9A 1NV8A 4EG3A 1DDIA 4D9NA 4Z4FA 2I7DA 4UTPA 3VM6A 3AR2A 4ZVSA 3S40A 5A02A 4NHEA 1PYDA 2WTUA 1FDVA 1CS0A 2WIJA 2I4IA 5JPIA 3D7RA 2PLNA 3SCZA 4E4TA 5B37A 1PSWA 1THZA 4IZIA 1MAHA 3SKVA 3RC8A 5GJBA 1T5BA 3JQBC 2O8BB 3KL2A 3QZUA 1T8UA 1YZLA 3DLHA 2C31A 3IJ5A 4EEZA 3CEJA 1E2HA 2YJTD 3QPDA 1XC7A 3WKBA 2ZAOA 2NZYA 4IUYA 1B16A 2EBUA 2EZ4A 1MEEA 2I1QA 1B6GA 1CR4A 2FWAA 2PRZA 3OIYA 4XPIA 1DX6A 4Q12A 4ZEXA 5CDTA 2NO6A 4JQSA 4JL6A 4M1YA 1NJFA 1ZC3A 2JAPA 4W1RA 4JY7A 3G0GA 3GIWA 3O8NA 3QMWA 4FMDB 3T6KA 1A8UA 4AWAA 2PUAA 4BTVA 2ZWMA 2IOFA 4WLOA 4OGKA 5AIAA 2QVZX 1W52X 4ZVQA 3CRQA 4IQ0A 4DTIA 4JB3A 3CT4A 4C08A 3ZE8A 3CVJA 4OBWA 4X45A 2VH5R 4ND2A 4CV0A 3VR3D 5LQSA 3WGKA 1GU7A 2H1IA 1L7NA 2FRDA 4W6ZA 1I2DA 2BOVA 2DPXA 3B9PA 2PZJA 5ITVA 4B2YA 3P2JA 1V4BA 4IXMA 1E7YA 2W6PA 2HX1A 3EIEA 4OQZA 4QSMA 4ZRNA 2QIOA 1SHKA 4DCPA 4OIFA 3RS8A 2C2MA 4P7BA 3S1AB 3JTMA 3THSA 3TSCA 4A4DA 4BUZA 2QYTA 1OLUA 1NIPA 3P2YA 1UFRA 1NN5A 1HT3A 2QMUA 3T3IA 3B1VA 1T1SA 4EJ2A 1TJ4A 2JD2A 1BKDR 1Z2EA 2KHZA 1KDOA 3BCHA 3DT9A 4W9RA 5DCLA 5PGMA 2ZM6B 3ZDDA 1TW2A 4CT0A 3HYLA 4X66B 4DQ0A 1HQDA 4B7XA 4LSGA 2SHKA 3CZ4A 1KK0A 4JYAB 1RCTE 4R7GA 4US1R 3GXBA 1W88B 3K6SA 5AM2A 3HXKA 1XVUA 5EAIA 1QHNA 3OH8A 1JEAA 4XI9A 3KT6A 2GCIA 4K81B 1QFYA 2QB5A 1H6CA 2VPTA 3JAKB 1S8FA 2GEBA 3RFFA 4IOKA 4C0KA 1E5LA 1N5KA 1UKEA 3UWOA 4G0MA 5B3AA 2IEAA 4BQRA 1A72A 3OZWA 4ICIA 3HKCA 1TGVA 5LC1A 3TNJA 3L93A 2FPWA 4L08A 4DQVA 2F90A 3G2NA 1YE3A 3NBKA 2WJPA 3T4PA 3O4IA 3ZC3A 3ZNOA 2B1GA 1G21E 3L7IA 3ZKWA 2C3OA 3DVLA 4NMMA 4OY3A 3RVBA 5GTDA 3OWXA 2H63A 1TUIA 3P9QA 4RPLA 3QVSA 4ZCLA 3ZCXA 1AUVA 3SSMA 3DXZA 2V0NA 4QDTA 2QY9A 3WNQA 3AGQA 1SD5A 2W6JD 1YFZA 4AUNA 3FTQA 1L7MA 1X3LA 1SQ0A 4TXMA 4B7CA 3ZJUA 2C5LA 4EKDA 4C4XA 2OCBA 3LRTA 4GM0A 4BNXA 4D9MA 5JMTA 1H0HA 4DCUA 4B4UA 5JSZB 2I54A 2ODWA 4G23A 3BXFA 1WMDA 2OV8A 4P1ZA 1I5RA 2C4HA 4RD6A 2I3DA 2RHCA 1PP4A 2GGSA 2WM2A 3MWDA 1PRYA 2ZBEA 4N7BA 1R9MA 1MF7A 4KX5A 3T15A 2HXSA 3BREA 3FKJA 2PGNA 3KEQA 1JLKA 2YV3A 2VHXA 5IT4A 2GD2A 1NU8A 1ECBA 1II0A 4FQ7A 4DMHA 1Y6RA 2I4MA 1Y4ZA 1GR1A 3IQEA 3W5UA 3A37A 2XT0A 3DZHA 4KE7A 5CTJA 4TYQA 2JGLA 2YUTA 5EXTA 2XB4A 2DR0A 5D3KA 1UMKA 3HJUA 2X9GA 4LBVA 4RPIA 4LXUA 3C5CA 2CLKB 1G8PA 1N3LA 1SCBA 4ND1A 4ZRMA 2XTJA 3EA4A 5FO0A 5EIBC 4C30A 3SR4A 3MT7A 2CD9A 4HDSB 4MR9B 3REOA 3OZXA 5A1JA 3JR7A 1VGVA 4B3BA 5JHGB 3DCYA 1LBEA 5A3QA 4NCIA 1GDHA 1TYDE 3B1KA 2GPAA 4RM2A 3NPMA 5B53A 4RK1A 5JXJA 1E61A 3WNVA 3FDXA 4HQ6A 4J4HA 4YAKA 2XUDA 2ILTA 5GGYA 2IHZA 2EFJA 2I1LA 4MVJP 2BJWA 5DBFA 5AI5A 1LPMA 4DFDA 3V1MA 2BGIA 4MW4A 4C4OA 4OIMA 4AY3A 2O3QA 4UHEA 5DZSA 1VMAA 1PJSA 3DA8A 2ORIA 3NHKA 2JBWA 2EX0A 3K30A 4KIJA 4ZQHA 4BMSA 1LZLA 2P9YA 2PBZA 3VC7A 4F12A 1H2FA 2FOLA 2NN3C 2I33A 1M1NB 1X1BA 4D4MA 5L7WA 3G9TA 1UP7A 1YRYE 4NAVA 4LVOA 1WOMA 5DP2A 5GIPE 2A5DA 2C8VA 5J9FA 2FZCA 4LCJA 1PFKA 3RYTC 2AFIA 2NUTB 3A6FA 1DQYA 4URWR 5H02A 1E2KA 4A0QA 3UMFA 1ODTC 5LIRA 1E0AA 3SBEA 2UYGA 4MIYA 4X8HA 1IAQA 1SK9A 1LLUA 4B3DA 2VPQA 2ZI7A 5GGXA 3KYDA 1N6NA 4J0DA 1Z7YA 3KVOA 4KK3A 4OMFG 4UEOA 1NW5A 4WLFA 2H52A 1JDTA 1HV8A 3IPYA 5FUBA 2NU7B 4TL7A 2M1ZA 1F0NA 2QN8A 4ZYTA 3AIOA 1V1MA 2J9YB 4D02A 4O1HA 4A8JA 1V5GA 3OT1B 3DAHA 4L5JA 1UPCA 1WY5A 3T4XA 3HO1A 3H3XA 3B1FA 4Q4JB 2N9UA 4DZZA 2CEAA 2ONJA 1E3TA 1QNFA 2P2DA 4LW8A 2J5QA 3TJRA 1O9HA 1T3SA 3DG9A 3U56A 1JYSA 1YL5A 4RL6A 1UBUS 1YMUA 2R8EA 1EVIA 1PV2A 5CDYA 5AVUA 3I3OA 2FFQA 1HSOA 2FZWA 4QDUA 2Q0SA 5DO9A 3ZEIA 3SVLA 4FHGA 4RTPA 3U3MA 4M49A 1NBMA 1O6CA 3DKRA 4BZXA 4C7VA 4U7PB 3RRNA 5U9CA 1OT3A 1E77A 2HO4A 2P9ZA 4ZZ3A 3EVBA 4CKCA 2W6ID 2YY5A 2GN4A 3R76A 4BO4A 4UU0A 5HOQA 3AGPA 1UP6A 1R9JA 2PFSA 2V7PA 1EVZA 2VYFA 2WUGA 2ZRPA 2WIGA 2Z2KA 4G2TA 1M6VB 4HDMB 1IEXA 2Q8NA 4PS0A 1RQLA 2N42A 3D0KA 3EAFA 3A2MA 4NOLA 4FNGA 3GFPA 2P6NA 2WZBA 4EPVA 4WBNA 3BJMA 5C35A 3VSDA 3DFFA 1RYHA 2JZOA 2Y1LA 2CUZA 4F4CA 4HL6A 4MOWA 5EZQA 2O3TA 3FCOA 4KPYA 2LIPA 3GMSA 1QUFA 5TR9A 3PQFA 3VHQA 3EZ9A 1V3VA 4HZUA 4I81A 4JI6B 1GPLA 1BD3A 4ED9A 3PEEA 4C6RA 3WRYA 4KH0A 3HP1A 4JJKA 1PHRA 2AG1A 4K28A 4MTCA 2P30A 2DG2A 3O94A 3FNHA 3AK4A 5IBCA 4B73A 2YBDA 5IJ9A 1YJXA 4ARCA 3B8HA 3T7RA 1XXLA 3GEPA 4KXXA 4MKXA 2OPHA 4AN4A 4AG3A 1JSZA 2E49A 4R6XA 3IDSA 5LQUA 1UXOA 3EIFA 4QTZA 4AU1A 4BLUA 2JG3A 3NETA 3FUCA 3HR4A 2AWOA 1EQ2A 5FBLB 2GX6A 2FR0A 2RKWA 4S12A 1WQ3A 5IC4A 2J0QA 3NHBA 3Q10A 5ARBA 4I3HA 3QVOA 1RMYA 5B3LA 1A95A 4IW3B 2XB2A 3VTAA 3HVIA 3L6RA 2E0IA 1KKMA 1KRHA 4TX1A 3PUXA 2FQWA 4OQNA 3PQDA 1YIAA 1XVAA 3H5AA 2WTBA 1ZGZA 2OENG 5M5BA 1GAQA 4Y6LA 1PHPA 5LYYA 3BULA 3FKSD 1EE9A 3QUCA 4K9DA 4G0ZA 1A97A 2C9CA 3LT1A 2ZS8A 1Z0UA 2ZPAA 3PJDA 3PT9A 3DOIA 1FFGA 4G1VA 5IAJA 1J39A 1KI4A 1N6PA 3K0AB 4ZMSA 3PUYA 4H4DA 4MHTA 2P0EA 4CQLB 1FXSA 1ZGJA 2A84A 4BFYA 2WM3A 1QO7A 2IGTA 4K46A 2P77A 4TQGA 2D59A 1RLTA 3OLXA 1E3QA 3MCZA 3UUGA 4TTTS 3O9ZA 1KETA 4HDRB 4Q1CA 1ZIPA 5AYVA 3SGLA 1E0SA 3TRJA 1KH1A 3L4BA 5NLLA 3H2IA 3K0EA 1W85A 3QPAA 2JFHA 2MINB 4O2AB 1KMMA 1U4SA 1Q1NA 1ZM4A 2XEDA 4CTNA 4IV0A 1GZ3A 2NUBA 2FMUA 2QE7A 1T9BA 3P0FA 3I39X 3JAWB 5CNMA 2FW6A 1I6MA 3T7TA 4C0WA 2VTBA 1HNWB 4BQEA 3F67A 4ZZ0A 5LJIA 3L04A 1NUQA 3FIUA 2QVXX 4HI0E 3UMSA 1FBNA 3MWGA 4KMMA 3FHJA 5FWXB 1AK2A 4YJ2A 4IIHA 3GP3A 4AZWA 5M2QA 1NTRA 2TS1A 3LBYA 2RGAA 3GFRA 2QAIA 3CLKA 1GXSB 2XITA 4UMDA 5HIJA 3R41A 4AMVA 1EWTA 4DDHA 4WNIA 3RT9A 2QORA 1KMHB 4AJLA 1NQ5A 5KNDD 2A78A 5KX5A 1NLYA 2GNPA 1N6IA 2OOSA 5CFOA 3BXPA 3PHGA 2WOOA 1VMEA 5F1KA 1RWPA 3ZTYA 4I5IA 1QP8A 2KPOA 5A03A 3PA8A 4F8JA 1H6DA 2QTRA 5L3QA 1E3MA 1RPAA 2P91A 1J8DA 3DVRX 4CU5A 3I2JA 4F21A 2FUNB 4EPTA 4EO7A 3P94A 5FT9A 2P7HA 4OSOA 2Q4EA 3PXGA 5JALA 4KWTA 1Z63A 3OM1A 3LCJA 3NR2A 1RYNA 3SFVA 5AVTA 2W2XA 2YRWA 5JUWA 1YGYA 1M34B 2NP6A 1UXIA 1EX9A 1U0TA 1UWLA 3TO5A 1VXOA 1JAHA 1OXBB 2H6EA 2REXB 2ES4A 1MO3A 3BJRA 3KLMX 4ND8B 5EJ7A 5FEMA 5KHOC 4G5SA 1ILEA 4H1UA 3UV7A 3C1TA 1NATA 3CRRA 1JKIA 4I1IA 3NOQA 3ICOA 4MKRA 2PT9A 3D4PA 3IO5A 4XSGA 4FC6A 1KI8A 5TSDA 5GINE 1QQ6A 1ODIA 2CXOA 3KB6A 3VNQA 1PR5A 2O20A 1DINA 2F55A 2REQB 2R1ZA 5TEVA 5KNLA 1X9GA 2L69A 3IKLA 4RTLA 1ZOOA 2FRDC 3KJHA 1N7HA 3QXCA 5FBWB 2C58A 3PVZA 4NV3A 2VQDA 4XGNA 2BFCB 4RMHA 1Z8HA 3L0OA 4ZMRA 1QQ7A 3WLFA 5J47A 5DM70 3GRZA 4JJFA 3KZNA 5DCYA 4BLQA 3DOFA 5B3KA 2J7KA 9ABPA 1XZHA 2ZIAA 1C3JA 3IRUA 2CXXA 3CPJB 4ZOAA 2C95A 4OYRA 5LVAA 1C14A 3E27A 4XE5A 3AEUB 1ZXLA 4YR7A 1EFRD 2W2OA 3GDGA 2XUGA 1YQWA 4M0UA 4TVOA 4YPFA 1DS6A 2R7NA 1D2MA 4OAQA 2YASA 4HGYA 1WPXA 4R6WA 3U13A 1F3OA 1VJRA 4Y2JA 4G4SO 4IDAA 3SEFA 2GI4A 4GE3A 4DC9A 1IZ8A 1G2IA 3MWJA 4Z4CA 5FQOA 1MBZA 4EQ6A 3G2OA 1OAKA 4F2GA 5KB3A 4NYIR 4DG9A 1G55A 2EKBA 2PZMA 3ISJA 3MTEA 4K2AA 3R23A 1NF3A 4H27A 1Y4UA 3WB2A 3WJAA 3W77A 4RU1A 2O1SA 1T0JB 4BRZA 4C4AA 5LLDA 3PITA 4B3SB 3R0ZA 4Y1FA 2FMTA 2UZ4A 3GMIA 3IKVA 4OP3A 3WE7A 5D1HA 3M6VA 2BI4A 4YMGA 1NI4B 2NVUB 5IFKA 2PX6A 3ESQA 3LY7A 1J1UA 1JQJC 1P9NA 2ZVQX 3Q15C 4A1FA 2QZ4A 1ZJWA 2HCRA 1KEZA 3E3OA 4NULA 3DZKA 3PJEA 5DNYB 2P1DA 1T4MA 2VZEA 4PVDA 3CMCO 3GF4A 3O26A 3O8OB 4B6QA 5E4YA 3TIFA 5KWVA 3U9TA 1LDBA 1TTHA 3AI3A 2VZ9A 3VO9A 1N8SA 4YDHB 1MDBA 4LGVA 2ODBA 3A4VA 2NVOA 1XRJA 1FJGB 1G291 1J7JA 1E32A 2OLEA 2V3WA 4GM4A 4TT8A 3R7LA 1SEVA 2QIPA 1UQRA 5FOUA 1AO0A 3MIIA 1DO8A 3GLTA 4H1TA 4FMDF 1IZYA 1J99A 2Z4TA 4RAQA 3M5WA 3PC7A 3RR2A 3RROA 4ENSA 4TUYB 5MFPA 5C32A 5IANA 3PIDA 2PSDA 5AOBA 3E0XA 3NT4A 4J2TA 3AP1A 4MA4A 2JLUA 3AY0A 3KKOA 4DEXA 2YKGA 3LVBA 3SS9X 2G1UA 3K9WA 5C3MA 1T0IA 1ZK0A 2F62A 4MQBA 2DSTA 5DEOA 3RTAA 4JLBA 4F5WA 2JH8A 4LDZA 4TQAA 4CT5A 5SY9A 1VLLA 3VZCA 5LP6A 1TLLA 3O7WA 3TUJC 2I67A 4RLHA 4V3BA 2SCUB 4E5YA 4I08A 4FK8A 2DY1A 1YIDA 3SQWA 3L18A 3R20A 1F38A 2E1RA 1G8MA 3JQ6A 1AN9A 2Q1UA 4UULA 4WXEA 1AXRA 1ZCZA 2FMKA 2O3RA 1R5OA 2AE1A 3KQYA 4JR1A 1DKPA 3AVVA 5AR1A 3AETB 4KLNA 3B51X 4C3OB 4D82A 4MJ7A 3MELA 4N0EA 3C6YA 2WFMA 1I3NA 2ZBDA 1SHJA 1JUDA 3NBFA 2QRKA 4V38A 5JO0A 1JJFA 3Q2IA 4YCLA 3JATA 3V7NA 1BQEA 1MAUA 1Y9JA 2VHWA 5GY7A 3T7KA 3V9AA 2F1RA 2XA9A 2XBUA 3VUEA 1YR1A 5G1PA 4ZOCA 1TF5A 1SC6A 1HM5A 4BLPA 4OTZA 4YXWD 3HPRA 1VJTA 1YDEA 3T3NA 2IELA 2QLNA 3M9LA 4JITA 4NNPA 4ROTA 4XWAA 1DQPA 2HBQA 4EHBA 2CJWA 2XR1A 2BVNA 2HMTA 1BO6A 2VO1A 3DB1A 4MS4B 4XW2A 3WSVA 1DTSA 2KS6A 4AKTA 3T5AA 1T5SA 2ZB2A 5TGTA 4H3KB 4NQRA 1XCLA 3EEBA 4BBAA 1J2EA 2GZMA 4QYTA 4EJMA 5CLQA 1KGSA 4AUMA 1UMCA 3MJFA 1GPBA 5BQOA 4CMCA 1PFGA 2HEGA 2XCSB 1B43A 4DV2B 4YRAA 3BCSA 1JR3A 4BNYA 1D8AA 5BXYA 5I7RA 1OHHA 4ZPXA 4XUDA 1KMQA 4JBWA 4BCDA 3DBHB 1PTJC 3ZHVA 2QSUA 3DTVB 2RKBA 3ADDA 1W581 3ASUA 1V9LA 2P3OA 2XRMA 4B75A 1U1DA 3MMPA 4LYGA 1XWFA 2JFZA 1I5OA 3CWZA 2FDCA 3AEXA 2AMLA 4DT1A 1T8SA 4OPMA 1KZ1A 2R7LA 2H9AA 1ZKDA 2CFTA 3SIRA 2CMKA 3GCDA 4EABA 4CMAA 1G3IA 1N2CB 1QMPA 5LDGA 3E7WA 4MRAA 4Q1DA 4JEIA 3I83A 4R2KA 2G1PA 1XK7A 4KR3A 5IZCA 1JEEA 1XTKA 2OO7A 3RS7A 2I3GA 3LBIA 4GPIB 1H2BA 2O1WA 4BB9A 4PLYA 3TLMA 3I73A 3WLRA 5D84A 1Y1PA 4NCNA 2HWXA 1V8FA 4G0PA 3R3YA 1N2HA 2B8WA 3PKZA 4FFVA 4P0QB 1JHZA 1J56A 1J0XO 2SKCA 4MROA 2HQSA 3QE2A 4TOIA 4TZKA 4YREA 4IH4A 2LP4Y 1DT3A 3EE6A 1AGRA 2LZ0A 1CJKC 1ZGGA 4R8RA 3IIKA 5FNZA 2I9KA 1J1IA 3O03A 4A0RA 2C57A 1XDWA 4ER5A 3C70A 1FYWA 3Q7RA 3WLQA 3BBLA 3KKNA 2CVQA 3N2NA 3K4PA 3QFRA 2HK9A 4URHA 4Q7KA 2V5UA 2VJOA 2AXEA 2RHMA 1BRTA 2Q5LA 2WE8A 1T43A 4FHDA 4JLUA 5BWLA 1VKZA 2WJAA 4E70A 4UM9D 3NJ4A 1RR6A 3CRMA 1P5FA 4N6NA 5AOAA 3FTCA 3IVXA 3SFTA 1VI5A 1YULA 3WRYC 2XVAA 3TGLA 2H2AA 4WOBA 3PE4A 2BZGA 1C3VA 5E95A 3QPCA 4G63A 1RTTA 2ZTHA 4DR3B 3BA1A 1N0HA 2BKXA 2D2VA 2J85A 3RTGA 1E7RA 4MPDA 1DOZA 3R4VA 1G66A 2YHIA 4XIGS 2QTWB 4RQUA 4I1RA 1VG0B 2IPOA 1OJ7A 3HFRA 3KSAC 4P8RA 1QHEA 1X8XA 2VCYA 1N2JA 2FVYA 4TVBA 1SPXA 5FKJA 2A0FA 4P3XA 1XV5A 4MUNA 4D8UA 5F35A 4TZTA 4ESOA 2X8AA 2O52A 2OCYC 3OPYI 2QSJA 3QPBA 4WI1A 1R0BA 3AYXB 4DDWA 1S3SA 4FBLA 3C3CA 4I50A 4L8WB 4PIMA 1L4KA 5AXDA 3SZ3A 1K2VN 5HBRA 2Q9BA 2D74A 3VHXB 4J75A 2E2WA 4I8IA 1E6WA 4LWOA 1TAQA 1Z7WA 1ZN7A 2EOAA 1L3CA 2YOHA 3RBZA 2OUIA 4NMHA 5TPWA 3O5AA 4IX1A 1XVVA 2VK4A 4QEZA 1XRLA 1HI9A 2AZTA 1IVNA 3Q3EA 2B1RA 4KFRA 2QGFA 3I0NA 1JBKA 3I76A 4HVAA 1XZLA 2IL1A 4M1WA 1YNOA 2QZ9A 1XTIA 2R6CA 2WABA 4OH7A 5A9SB 1XTVA 5J2UB 4XIJA 3Q6NA 4LXIA 3MD0A 4R1PA 3SHOA 1QR2A 3KPWA 3KYCA 1Z0KA 4OQXA 4OXYA 4CM8A 4PQFA 3CM0A 3K70C 2IYEA 1KJZA 3WS7A 1E18A 2GJ9A 4KQFA 3N3AC 3ESXA 4DARA 1EUDB 3GFSA 3PA6A 3LECA 2YYYA 2Y1KA 4B76A 1Y3HA 1V96A 4GF5A 4ARBA 2BDTA 2OUKA 4O4JA 5P21A 4X62B 1YS6A 3QF4B 3Q8MA 4N76A 4KDCA 4XIYA 1TX4B 3OIUA 4G89A 4UUNA 4C0JA 2WSYB 1BWSA 1ZHHA 2PAAA 2WW8A 2QTNA 1EFKA 2DTDA 4W5TA 4KR2A 4DUZB 2FN7A 3EPPA 4OFZA 4K6KA 1G9SA 4AMYA 5A1TA 1G8AA 3DEIA 3ROTA 4YVFA 1X80A 2C3YA 3ZDEA 3QVWA 4N5NA 2R65A 2I1WA 2X2FA 1YRAA 3L06A 3L7JA 5DHTA 3W79A 5HYVA 2QTBA 2RD2A 1AXGA 4J1TA 2WM8A 1DUSA 3NGMA 5J40A 5E6RB 4Y9TA 2IA5A 1UF9A 3H6KA 4G8CA 4D57A 2OHVA 3G0DA 1CQJA 1P4SA 4W9NC 3AUYA 2VHTA 1H3FA 4Z3DA 4JOBA 2XZDA 4M7WA 2MSKA 1L5FA 2F7SA 2MWMA 2GYYA 3QQ5A 5HCIA 1I7SB 1OI4A 2XI4A 4EB6A 1M83A 4LXQA 3BXHA 2PKQO 3CISA 3HB0A 2YH2A 4DB2A 4GGMX 2HCJB 3NH6A 1G4HA 2BL4A 5AJTA 2H51A 4GLJA 1LLDA 3QFCA 2YVQA 5H3CA 3OESA 1TZ2A 2ZRAA 2W6NA 1LEHA 2CDNA 3I58A 1NXWA 4I4CA 1GTZA 3VZPA 1ADBA 3B3JA 4V0SA 1IRIA 2ID4A 5DBEX 5HRAA 1CJVC 1YBHA 4RV9A 1ZGHA 3WVNA 1ETHA 2Y1XA 4DDVA 2BFEB 1JJAA 5DH9A 3X0DA 1PJLA 1U6JA 2ODPA 2OXIA 2JGMA 5I3CA 1N77A 1XLWA 3AZQA 4KQGA 2IV3A 3SEAA 1CUHA 4INAA 4MAMA 3VDMA 4QUHA 5CR9A 3BH7A 4FXOA 1DAKA 3O2JA 4R8LA 3KKPA 3BHJA 4L78A 4L8FA 1GEGA 1OXKB 4EY6A 1E9SA 3HN6A 621PA 4P9NA 4BXOA 3VNVA 5BPHA 2ATVA 1N2SA 4G8BA 4HQFA 4JIGA 4R1SA 2VQFB 1IULA 5AHRA 1GZ4A 1BC5A 4C0LA 1QV6A 2CL0X 3OFKA 4URZR 1OTXA 1ZESA 2VPYA 1P0FA 3U49A 1P2SA 4LISA 3W8DA 5DYYA 4V0RA 4P33A 3QBDA 1U90A 4FFRA 1FU8A 1KOFA 1MPXA 2QTLA 3MJDA 3PR1A 3PXEA 2R85A 4TMKA 3SF8A 1MNAA 1VP3A 4AZVA 2C4UA 3RSGA 2BR4A 3GELA 2IBMA 1A8HA 3EZFA 1DHRA 3FZEA 4NS1A 3RGGA 3IUQA 5AM5A 1ZCFA 4ZOEA 3ZLBA 2B34A 2BHSA 2XWJI 4IBOA 3CNBA 1DG9A 4I6EA 4LDAA 3QI2A 1ODCA 2V5AA 3FBTA 1QBGA 3LQFA 5TXGA 1DDGA 2WWXA 3FCSB 4NU8X 4CM1A 5BW6B 5L9AA 3AKZA 3L8MA 4LPSA 4LJ6A 2J0SA 1W5AA 2Y0CA 4PSKA 4ENRA 2XUHA 3IEUA 4X92A 2C5EA 3WYAA 3JQAB 2HQRA 4CWAA 1NYLA 4J9UE 4O2AF 5ER9A 4CQMD 5KTYA 3TDMA 1SXJB 1OUMA 1Y37A 5A5FA 4Z7JA 5FULA 1CZOA 1SH7A 1EFPA 3N2KB 2C8JA 2BEVB 4HVCA 1TT5B 5K3DA 3HMQA 4UPDA 4MMYB 1Z35A 4B0OA 4QT0A 2YFQA 1V3UA 2WUVA 1QZTA 1Q1AA 2Q3LA 5JAOA 4FFPA 3E22A 5JATA 1XLTC 2OBYA 4RZSA 4P3PA 4F9EA 3CF2A 4OUDA 4CKBA 2GXQA 3VH2A 1IJBA 4E5KA 1LSOA 1G9XA 4BDSA 4Z5XA 5JH7A 2IK8A 1E1RD 3SD7A 1IHXA 1YZKA 4B5KA 2AQHA 1MQSA 2XNSA 1X19A 3WIEA 4KI7A 1QYWA 1C7RA 5ICEA 3U0BA 6REQA 3P9YA 1AKUA 4AWXA 4N01A 4RSGA 3OQBA 4Q34A 3WX0A 2B2CA 1X92A 3UHJA 4AZ0A 2ZJOA 3GJZA 4FIDA 4OJMX 4CV1A 3P2OA 5AWFC 5K6AA 4RIIA 2O5EA 1ZRMA 4M1QA 5JAPA 1E2IA 3KCNA 1Z39A 5AKJA 1KJ9A 1PNVA 4GKKB 3IT3A 2UVDA 2G36A 1V11A 2H8KA 3OLQA 4MW5A 1SUWA 5D87A 1ONOA 5DK4A 3TZEA 2W8BB 3UXEA 2POCA 4H3SA 4I1SA 4WESB 3VPAA 1TK2A 2OFXA 1OIVA 2I2DA 3DLTA 4OAPA 4BX8A 4CM7A 4F2PA 4IIDA 3FNIA 1NYQA 3S7TA 1I2AA 1Z6PA 3SXUB 1GKUB 3F6RA 2IVFA 4R1OA 3OMWA 3RRZA 1P4GA 2EEPA 3NYWA 4OK5A 2IH4A 5F5LA 3PZRA 2AJCA 1HEUA 2Q2OA 2AG5A 3NVMB 1C4WA 3JALA 5EESA 3DMHA 4N40A 2G4CA 5K01A 1JG6A 3FYCA 1T3HA 3RJZA 1WMBA 2C3MA 1OIWA 1YL6A 2JA1A 2W2MA 3K09A 2IH5A 4IR7A 4I9FA 2F00A 4DCMA 3KBBA 1EHYA 3PUIA 1XA4A 3OFVA 4EFNA 5A4KA 3G2LA 1RAHA 1VB5A 3BFPA 4HO1X 2GJ8A 3P2EA 4UC0A 1N25A 1ECCA 3U3KA 1VHWA 2PS3A 2DY0A 4ZWNA 1IY8A 4ML3A 4E4RA 1MO4A 1Y3DE 2VRWA 3CZCA 2JJMA 4X44A 2Q0QA 3IC5A 4YUZA 4NFSA 3S44A 4K26A 5IMBA 3IH5A 3NP7A 4S1TA 3IA2A 1V3QE 3EIWA 4INZA 3C8UA 1GQQA 1UKAA 1KJYA 2V03A 3E5RA 3JTEA 4NCJA 3M9WA 2DPHA 4REOA 4S1VA 4XOIA 4QGSA 1K89A 1WSDA 4HQLA 1J0BA 3PJFA 3V2HA 2PX5A 3GLUA 1K27A 2BT4A 3X1JA 4UNIA 2GM4A 5BNFA 4RK0A 5K3EA 5KNBA 1HDOA 3GDFA 4LOIA 4NZPA 1H8HD 2MR5A 2HSWA 4RD0A 2ZREA 3ZWKA 4PCLA 3V4RA 1A2QA 1QKIA 1DL5A 3EGXA 5FH9A 3R2JA 3ZIAA 3CLRD 2ECOA 4BB6A 1X8LA 3A26A 4N8EA 3BZWA 1C29B 4FFMA 2M6LA 1AMNA 2JAHA 3H8JA 2FXIA 4M21A 2HMWA 4P3NA 5CT9A 3D54D 5AK0A 5KYNA 2GJ4A 1YWGO 1E3JA 2NW6A 3WQHA 1JVNA 3WICA 2G0AA 1UDBA 1VHLA 2PKXA 1RZ3A 2VNIA 2Z1DA 4F71A 5DX0A 1EVEA 1D2HA 3OPXA 4Q7MB 3UXHA 2C3UA 2AJBA 3HZOA 2YZKA 3KOUA 5B3JA 3WYGA 1YBVA 1I9GA 2LIVA 4BP8A 3K9HA 2EJTA 5D85A 1AU9A 1WPRA 2DWPA 1KPHA 2C88A 2YV1A 5DASA 5THXA 3Q8LA 2QBYA 1WUKS 3K1AA 4OL9A 4CL8A 1O94D 2QP4A 1ZHFA 1OVGA 3OP4A 3RBVA 3VR1A 4YY3B 3AHJA 3OC0A 1IOWA 3DTNA 3VPFA 1OZGA 3GH3A 4KFUA 2N1MA 3HP4A 4QOJA 3VYSB 3HRHA 2IH2A 1J2JA 1VB3A 4JBIA 2FJUA 4YV1A 1NF8A 5EJ8A 4UQPA 1JIIA 1S1CA 3W2HA 2HA5A 1UJ4A 5JECA 4G5GA 3C3PA 1B00A 1O0BA 3BD7A 1MFZA 3VXKA 4IHJA 4DIBA 5IZCC 1BHQ1 3GWGA 5D2CA 1MRNA 2NT4A 1ZNQO 3GOHA 1JHQA 4P22A 4N18A 2WNSA 2YMPA 3DNPA 3EXIB 3GGDA 3N2GB 3EVAA 4PRYA 1HFEL 4GLFA 2OC4A 5EC8A 4TUYF 2X5OA 1T4CA 1UBLS 1CDZA 1C9EA 2A4KA 2ZAYA 1ORTA 2GXSA 3CRNA 3N7TA 3DDSA 3EGEA 3UHAA 2PJRA 2IF0A 1QOZA 4FFOA 3B6IA 1J23A 5IM5A 4O02B 3RJMA 3V8EA 3IAS1 3JYPA 4QBTA 4PIVA 1BA2A 1NVMB 4ER6A 5COAA 1PYGA 5KC8A 3GJQA 4IS3A 5ENZA 3A3PA 1VTKA 2IX9A 1EYZA 3BJZA 3OX1A 4FGSA 1TCBA 1UJ2A 3DE3X 2OL4A 4DANA 3IB3A 4L4UA 4WFQA 4CE6A 1N6KA 2C99A 1TO6A 3QPWA 4KOEC 2R6AA 2Q7OE 1KVQA 2QN3A 1QCYA 4AF7A 2PS9A 5GWXA 3PTAA 2WJWA 3WGYA 2XMCA 1TU4A 2B8NA 4BNWA 4V1CA 3U37A 4GICA 2RHRA 3RU9A 3CCFA 1E3WA 3CKYA 5IAKA 2HRZA 2Z08A 3KC2A 3PYXA 3BRQA 3KZCA 4EI9A 3ND6A 3SEQA 2HRDA 4BFCA 1U8UA 1QTIA 4MUKA 4YJGB 2UVQA 1HDCA 3PSAA 4LIPD 4YJFA 1HDEA 2FPIA 4L50A 3AZOA 1XMIA 2P11A 3FI9A 9LDTA 3NKLA 1V7PC 2L42A 5B6IA 4RMGA 1DX4A 4OGWA 2MT9A 4OQDA 3W7BA 1UBCA 3FZNA 2YVUA 2B9VA 4XFJA 4P7KA 1TRHA 4KUEA 2HDHA 4R0VA 3ZGOA 2RE8A 3RYFB 3D6FA 2YL2A 3TR6A 4DLUA 1DJPA 1E2NA 2C59A 4LX0A 4NZZA 4WIAA 5DNWA 3UQZA 4A0HA 1HMPA 1RIIA 2HJWA 2E18A 4ZQBA 5LCXA 2PBFA 4JQZA 3V9PA 1F2DA 2R5WA 4DMCA 2XA2A 3OCWA 5HP4A 3L46A 3OJWA 4IEFB 1NN1A 3IP8A 1BH6A 3ZVLA 4JWTA 4AP5A 4BGVA 4DYHA 5CX1B 2GM3A 2QYHA 4D43A 3PFFA 1EK1A 2GS9A 2ACWA 3DR3A 3TH5A 1R50A 4QUGA 4JZYA 1QYDA 4OATA 5ENDA 2BSAA 3VNAA 3I64A 4CKEB 2P9GA 3TZHA 3EXFA 3NM6B 5C7YA 2PU5A 1E2GA 3IRVA 2NO4A 3KQPA 4RD2A 1GQSA 4QLBA 2X0NA 3QWIA 4M8KA 1LA2A 3F6PA 1UMDB 2YWJA 2XB9A 3H11B 5TDHA 4OKIA 4ZQIA 4WXYB 5ALWA 3N3BC 1U8CB 3ETHA 1ZK1A 4ZZ2A 1X86B 1ISIA 2NLOA 4PNHA 2VEDA 3EEIA 4JFAA 4RZ3A 1GLVA 1N1DA 4RJLA 3GJ0A 3RTCA 2BELA 4MO2A 4RZXA 5FR1A 3ER8A 2A3NA 5CLGA 1KAGA 2RCYA 1HG0A 2Q6LA 3OJEA 4R8KA 3UJ9A 2A5YB 1L5HA 2B4YA 2HGZA 2WWFA 3AEQB 4BTEA 1VJ0A 4X1OA 4UU8A 1FRFS 1GKKA 4RF4A 1TYEB 1SHLA 3WYDA 4A2CA 4OB8A 4M9XA 4DLAA 1YZYA 4P31A 1NOKA 1VYTA 2H9IA 2P9TA 4BMPB 2V7QA 5A4JA 3EQ9A 3ZU2A 2FWNA 2PWAA 3U4IA 5HQ3A 1IZ9A 4PGHA 2XXJA 4RTQA 3K3PA 3PB3A 4D46A 4ZCMA 4NFLA 2Q5JA 1JDUA 2SICE 3DC2A 3G1WA 4XA8A 4J1TC 1PS0A 1JKMA 1NVWQ 1NBEA 3I61A 1Z07A 2A1TS 1IK6A 1K0UA 4HNHA 3PE6A 3O4GA 1T3GA 3UUWA 4PAQA 1C3XA 5NULA 2HCTA 2VHJA 2X19A 2HRBA 3K1YA 4R2MA 2GSWA 3FOWA 3GX1A 4B3HA 1WTCA 3PQ7A 4J16A 4QRDA 4TTPA 2G8NA 2MDTA 2RH4A 4Z99A 5FFMA 3TN7A 1RAIA 2O5RA 4JHLA 5F2KA 4KUGA 3D2AA 1JHAA 3IFSA 4MTLA 5ES3A 3PG5A 3IAFA 5F7OA 2JFPA 4TS1A 2A67A 4QO8A 1T26A 1HZZA 4MVWA 1VCIA 1DFGA 2WZCA 2YY7A 4KQMA 4MRNA 5EP4A 2Z6UA 4E46A 2HA2A 2O06A 3PFGA 4R01A 1AUPA 4AY4A 2QL5A 1YT5A 5B6PA 5BR4A 4E5SA 4GPEA 2CFIA 4B85A 4Q4CA 1WCWA 2VQ6A 3I6ZA 3RKUA 1DJLA 2JAQA 5E6SA 3WJ7A 4CHGA 3DE6X 1EWKA 4EB8A 5ICSA 3EEOA 2D1TA 2IHYA 4S0XA 4OEHA 1OTHA 2HRQA 3Q7QA 3S70A 1PSDA 3NBUA 2ERYA 3P97A 1L5YA 3I12A 5BN4B 2O1XA 3TRHA 4DM4A 5IHPA 4HMOA 3L8CA 16PKA 4AJJA 2XKBA 2ZBRA 4CM4B 3ABRB 2C2BA 3EC1A 4HDAA 4OAOA 5HDQA 4CCYA 4EW1A 1DJQA 1NHGA 3EXG2 3FCAA 3A11A 3O38A 4NQZA 5JYDA 1CJSA 2EGGA 3ET5A 3I6BA 3KJGA 5DNVA 3PS9A 1CNFA 1FL9A 1E2EA 2P5SA 2GVZC 4QXOA 3TRKA 1DCFA 2WE7A 4DIKA 4EMTA 4YRQA 1JHMA 1Q91A 3QKRB 4Y2HA 4XD7A 2XXBA 2ETVA 4UEJA 1JV2B 1X0XA 4B9AA 2A5GA 4HNRA 6GPBA 4KO8A 1ZR2A 2QYSA 3W4KA 5ULLA 3UGTA 4M4SA 4ER7A 4YRKA 4KHPB 3M3PA 2FJ0A 1UZMA 2NU6A 1K4MA 3G6KA 5J2UF 3C87A 1WZIA 1VBKA 1ESEA 4PV7A 1BVUA 5LWHA 3M33A 1WMAA 5ADVA 3EVCA 3I6IA 4UM9B 2FPUA 3OEYA 5JJIA 1PR2A 5KQLA 1GZVA 5HKBA 3P19A 4B48A 1E1CA 4RZUA 3CX6A 2X9QA 4KACA 1FP4A 3KALA 4H1HA 4R9SA 1WXIA 1EUCB 4EYKA 2BP7B 3A1CA 1SKAA 5CCDA 2J07A 4NL4H 3MWEB 2A33A 2W83A 2ASEA 5F98A 3ZX4A 4BIIA 5F23A 4CF3A 1VA4A 1Z29A 2XYQA 4YRGA 2DFTA 2JBHA 3W6NA 2NPIA 4WERA 4GMDA 4INJA 5FBZA 2OVFA 2BW0A 2JFOA 4C5BA 4P6VF 2PUEA 1JG4A 4LZZA 1CEEA 1GA1A 3W8EA 3AXTA 4YO8A 3W05A 3OKAA 4IHKA 5KJ6A 1YS4A 1SZPA 4Z1OA 4QC2A 2J0UB 4D3SA 2XQJA 2Y2UA 3AB8A 1JI3A 1MQAA 3HJNA 4ASUD 3RV3A 3H2JA 3D4OA 2H18A 3EFHA 2GUGA 3SX0A 3KHKA 4QODA 3RYHB 3G1TA 2W6ZA 4LDRA 3UZUA 4C22A 4XARA 2YC4C 1YK1A 1Z17A 3QEMA 4HTFA 3C39A 1Z28A 1UJ5A 1Z4PX 4ACAA 3NNSA 3P2MA 1R0LA 5EZYB 1VE3A 3UKOA 1NX9A 4QD3A 2OMEA 4MCJA 1UAGA 2X2OA 1LNZA 4UEWA 4EBFA 1NVAA 4ZV4A 1JQKA 2RBKA 1J5EB 1GGFA 4BLWA 1U1FA 5K8JB 3TIXB 4OU4A 4AKGA 4K8OA 4CMJA 5K6AC 2ZE7A 3QX3A 2DGDA 2F67A 3DP9A 4ZTZB 2BFAA 4IDDA 5JS6A 1D7AA 2X58A 1MU0A 1U28A 2M2IA 4FI3C 5LQCA 3IEVA 1TZJA 4H6PA 3RRXA 3H75A 4G85A 3TQTA 3SKXA 4B6PA 4YWJA 4CQJA 4EITA 3D3WA 1W36D 2CCKA 3CWCA 1I1HA 2GILA 4NOKA 3F3KA 2VSOA 2JIMA 1JDBB 1HRDA 4D98A 2IE8A 3EYWA 3I6MA 4BKMA 4DA8A 1N2ZA 5LOVF 3X1MA 2WV9A 4OHVA 2G82A 2P6UA 1MC5A 1NI5A 2C1XA 3UT5B 3R0JA 1SCJA 3RRBA 5B55A 3R5HA 1FW8A 2W2LA 1P1FA 4U2BA 3IOMA 1KWKA 2ZTSA 1RMTA 2DFNA 4XSVA 1NXVA 2RGUA 3I5XA 1G0NA 3EIQA 1NJ8A 4D5EA 3ABSB 1RYFA 2DFVA 2E3JA 2J3KA 3FNRA 3L8EA 3ZGLA 5BOSB 4CUKA 2JLBA 4UZSA 4LKRA 2EXXA 4F11A 3PNPA 2CXUA 4IF6A 1Z74A 3SM3A 1Y8AA 3GARA 3MF4A 4V0QA 1CE8A 4RKFA 13PKA 2BIFA 1E3SA 1Z73A 3GGGA 3OEED 5JVDB 4WKOA 5KREA 5KBYA 3IALA 4H6XA 1JBQA 4PZ9A 1G8YA 1JR2A 1D2NA 2BKAA 1FRVA 3LTEA 3D6MA 2FK7A 2IEYA 3SZRA 1NC1A 2Q6KA 5HIIA 1N7JA 5JJBA 3JWPA 4RMJA 1AS3A 5JANA 3PKIA 3LL4A 3QG5A 4DBLC 2WLTA 3GVIA 1JIJA 1LFDB 4NJOA 1QRUA 4Q3EA 5B1IA 1Y80A 3W6OA 1IUNA 5K8CA 2X76A 5CD9A 3ID6C 4ZVMA 3WSTA 1PD0A 2PO7A 3Q8KA 1O6BA 4ZDKA 1RXCA 4D0NA 1HQKA 3A4LA 3M1AA 4B4OA 1U4NA 2ZIUB 2V9ZA 2B9EA 2PLWA 1JDJA 1JHYA 3LM8A 3HN2A 3QY0A 4NBSA 5L53A 2HDOA 1SVIA 4CEHA 2GAOA 1HRKA 3O4HA 2UUPA 4LZOA 4HKTA 1TIKA 4X3OA 1MB3A 3IL2A 1AURA 3ENVA 2FKNA 3RS4A 3LC2O 4US0R 4ID9A 4LYHA 3LFHA 4ETWA 3DWIA 5BOSA 5D7BA 3U40A 4AD8A 3JZMA 1KAOA 2GT1A 2V4UA 2GPWA 4AYWA 3FHOA 5B3JC 4GRAA