2VP2A

Structural studies of nucleoside analog and feedback inhibitor binding to drosophila melanogaster multisubstrate deoxyribonucleoside kinase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
198
structure length
198
Chain Sequence
TKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQRRPQSCKVLVLDADL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEOXYNUCLEOSIDE KINASE
publication title Structural Studies of Nucleoside Analog and Feedback Inhibitor Binding to Drosophila Melanogaster Multisubstrate Deoxyribonucleoside Kinase.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase
total genus 72
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 2.7.1.145: Deoxynucleoside kinase.
pdb deposition date 2008-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2vp2A00
2BWJA 2FA9A 2IS4A 1G291 2ZI6A 1VG8A 4L9WA 2ODNA 3ASZA 4V0LA 2QA5A 1ZW6A 2ANBA 1AQUA 4BRUA 4C0JA 4MDEA 4FWTA 1X1SA 1BIFA 4A0HA 1KI6B 3VTKA 1O87A 2ZSDA 3DKVA 2IA5A 3ZZTA 4NBSA 2N46A 1A2KC 3I8SA 4N0DA 3WP1B 4EQ6A 1I2MA 2EYQA 4LZZA 4AURA 4LYJA 5BN5A 2XZPA 1KO5A 1QVRA 3REGA 4GT1A 1KJWA 4US1R 1E2GA 3CNLA 4IXMA 2GAOA 3E1SA 3IILA 3G5UA 2H57A 2ZRHA 1TF2A 2QU8A 3AP2A 4ZPXA 3K0SA 2GXQA 4MA4A 1RJ9B 1X8JA 2JLSA 4DCVA 1FOEB 2ZPTX 1A5TA 4D26A 1E0SA 2YYZA 2X8AA 4PQYA 3WYGA 1XZPA 2ZREA 4KO8A 1FPMA 1XEWX 1H8ED 2ZETA 1G4AE 1Z07A 4BZXA 2R8RA 3ZJYA 1MO4A 1J99A 2VHUA 3F8TA 1KSJA 2XITA 1VYUA 2PT5A 1VG9B 2FPMA 2O8BB 1FMLA 1P2TA 2BVNA 1SGWA 1H65A 1NIJA 3IIJA 5CYOA 2ODWA 3BGWA 4B3FX 1G5RA 1S3SA 2Q9BA 2A5JA 4LPKA 4RJLA 2J59A 3F0TA 1OJLA 2VSFA 3D7MA 1AZSC 4TLBA 3K0CC 2NMVA 2C9YA 1I4LD 1LS1A 3QKRB 4LV6A 1AS3A 4FI3C 1SKQA 1COWD 2CCKA 2GTPA 3IPYA 4BLQA 3ZVNA 2XZOA 4EIWA 4WZAE 1ZVQA 1IM2A 2NO7A 2PEZA 3LBHA 3PUYA 1SXJE 2NPIA 3OEEA 1HUQA 2IXGA 5FOUA 5DI3A 1IONA 5BQ5A 1KK2A 1OH8A 3ZZ0A 2IYSA 1WB9A 4TYPA 2KBFA 1VKJA 2JDIA 3GFPA 4RKFA 3VR5A 3VHLB 1WRBA 1YZLA 1SXJD 3KJEA 2D06A 1US8A 1ANKA 4CT5A 1YVDA 2D4HA 4RVCA 5BWMA 3HU2A 4LJYA 3OF5A 4BFYA 2PT7A 2J87A 2XOKA 2Z5FA 3BERA 3U3MA 1GTVA 4QBFA 1E1QA 2B6HA 4JLDA 4D4LA 1J2JA 3P20A 4B75A 4NYMQ 5F98A 3SN6A 2GHIA 3IKJA 4GI7A 4KCGA 4MYUA 1Z0KA 4CYMA 4BZQA 3FMPB 1HH4A 3QPWA 4Q02A 1TUEA 2KB0A 3L43A 1FTNA 1P61B 3SYLA 3AF2A 4Q9KA 1SVKA 1G20E 2IUSA 2I1VB 2FN4A 3EIHA 4PTLA 4C4PA 5EZ6B 2ZI5A 1P9RA 2G88A 3QKSA 1F2UA 1NL3A 2A3RA 1KO7A 1W46A 1E2HA 3TMKA 3AF4A 2O8CB 4P4TA 4BFWA 1SQ5A 1G6OA 4LOAA 5J4KA 1JR3A 5KSOA 5K8LA 2P3SA 2WOOA 4PC2A 1OT3A 2PMDA 4G5SA 2HF8A 5EE3A 2WWFA 4OQLA 5EE1A 2XXAB 2ZSEA 4JLKA 2RB4A 4C0SA 1XNJA 3EZ9A 1Q12A 2QPTA 4L15A 5J40A 4PPGA 1YZGA 2WMOB 4EPWA 5KSYA 4HLUC 2WWWA 2XJ9A 1GNQA 2FFQA 3SJZA 3R20A 4EDHA 1VDZA 4CEJB 1L4YA 4JBXA 3FHCB 4GFDA 3L0SA 4OJKA 2ZJ8A 4G5RA 2Q3HA 4B3XA 3QKTA 1ZNWA 5EZ5A 2BBOA 1ZM3A 3QVUA 3GLGB 2FG5A 3K0AB 2KI5A 2Z83A 1P6XA 1QBKC 3LAWA 4Q4HB 3C4JA 3HR8A 4ACAA 2G3YA 2P5SA 3TQFA 4EPXA 2V9PA 1W0JA 3T06B 1P62B 1XMVA 2FFHA 5C46F 1E98A 2AXNA 1GL6A 4LY6A 4ITRC 1Z29A 3R7WB 5KSPA 3QJYA 4C0HA 1OV4A 2H7VA 1JBKA 4JSYA 2G0TA 3B9QA 2FOLA 4TQAA 3NBZC 3K70C 1W0KD 1XTJA 2BHRA 1Z22A 4RZ3A 2H18A 3CZPA 1U9IA 4MGKR 1HYQA 1IY2A 1SZPA 3DDCA 4H9GA 3CRVA 2KE5A 1OKKA 4NKRA 3MWLA 4QBGB 3BRWD 4WVFA 4ESVA 3LO5A 3IEVA 2O8DA 5JJKA 4L4UA 1EWRA 3BE4A 4MRNA 3ZS8A 1GL9B 1OW3B 1ZUNB 2IYXA 4JJZA 3T15A 2FPKA 3LLMA 521PA 2GWHA 3QXJA 3WRXC 4QGAA 3MCAA 4MKFA 2OUKA 1DAFA 3NIBA 4QJ3A 1L4UA 2AWOA 1U99A 1T6NA 1BMFA 1W4CA 4Z1MA 2GJ9A 5SZJA 3P4YA 5DE3A 1N6OA 3X1ZA 4QG7A 4A6XA 2ZRGA 1N5LA 2ZRFA 3GLIA 3OE7A 3IHLA 5L8VA 2B8WA 1C4OA 2GEUA 3KQLA 1PUJA 1U8ZA 2IK8A 1ZM2A 1EG7A 1KDRA 1CR1A 5JRZA 3UXMA 3CLVA 4JBYA 3Q5EA 1T3SA 2VHTA 2RGAA 1GRRA 4MRSA 1MRSA 3RNLA 3WBKA 1OFTA 4KYUA 2OESA 4Y0AA 4QHYA 3H86A 1IN6A 1FP6A 3VR4A 1OYYA 2JDID 4B47A 5FUWA 4CGZA 2BJWA 3KKNA 4V02A 4I1SA 1MH1A 3IO3A 5H68A 1NG1A 1P9NA 3CH4B 4B32A 2B7BA 1TQDA 1GL7A 2W0MA 2WBLC 2P0EA 3EPHA 4Q1AA 2DFTA 3AKEA 1NY6A 5FBLB 1S8FA 4I1OA 2HV8A 2JJ1A 3GQBA 4JT2A 4PR0A 4BE7B 2V4ZA 2ZS8A 3A4MA 721PA 2W2VA 2NIPA 4FCWA 2WWGA 5L3VA 2ZE5A 2IL1A 3THWB 1YE8A 3FDIA 4B73A 3TBKA 3ZYCA 1AKYA 3Q7QA 1IJEA 4YMUA 3BK7A 5FTNA 4PO9A 2ATVA 4D25A 4C30A 5CB8A 4PHTA 2WKPA 4C0AC 2QL6A 4PX9A 3QVVA 1UM8A 4S2EA 1SVSA 2GEVA 2PL3A 1KZ7B 2OCAA 1XWIA 4C3ZA 1XCGB 4II7A 2NZ8A 2RGNC 4IOJA 3B5JA 1JPNA 4HAZA 1D2NA 2EW1A 2IYWA 2FEOA 1TPZA 2IXEA 1Z6YA 1IQPA 3K09C 1J70A 1RZ3A 2CL0X 2QMOA 3H1TA 1MABB 4DCTA 1KSFX 1OYWA 3DEFA 3KTAB 3MGCA 3T35A 4GMDA 4IVRA 3NHBA 3JZAA 3CRRA 3K8YA 221PA 4GOKA 4TYNA 5TDHA 4O25A 2VRWA 1F3OA 3QXXA 3AGPA 4JYBA 4EUNA 4CEHB 2KBEA 1R5BA 2DFLA 3CRQA 3VKWA 2J0UB 3AVQA 3RABA 1X8LA 3W3AA 3R9IA 4URVR 3CPEA 1U0LA 4KFRA 2IS1A 3OIUA 4U7DA 4HAVA 3B1YA 4HUQB 4ASUA 2J9RA 1OFHA 1TQ4A 2VL7A 5FTKA 2X1VA 4IXNA 1FX0A 4M1MA 4A92A 4BQSA 1PLLA 2CJWB 3CIOA 1YR6A 4E5UA 1U90A 3QXCA 3H0KA 3QQ5A 1XD2B 1T9HA 5FPYA 4URYR 1W0JD 3OIWA 4B3CA 1JAHA 2YC2C 4U00A 4PSVA 1QG2A 1UJ2A 5JEDA 5AWFC 2RGDA 2ZJBA 5CK5A 2VP9A 4TTQA 3W6PA 1L7VC 1G7RA 4IEIA 4HDCA 5KO2A 1OHHA 4TMKA 3RC3A 4C0LA 2CHQA 3O47A 4Q47A 4DSOA 1UAAA 4BEBA 2UKDA 2WJJA 1E9DA 3DO6A 1G9XA 3ZVRA 2QP9X 1WMSA 3WBJA 3OEHA 2VP5A 4FMDF 3TKLA 3NXSA 2CK3A 4RZ2A 1DO0A 5HTKA 1N2CE 3SI7A 3W8RA 1E0JA 1VIAA 4MQBA 3A8TA 3B78A 2CLCX 3UG7A 2DB3A 3TVTA 1UFQA 1GDDA 2GJAA 2H92A 4MKHA 5G3YA 4X8OA 3PJRA 2FWRA 1K5DA 5HR5A 4US0R 3QG1A 5G53C 3EZ6A 5C18A 1E96A 4D4MA 2FE4A 3GLIE 3GEEA 5B57C 1QHIA 1BMFD 1E2DA 1Z3IX 2F3TA 1WCV1 3Q9LA 3GJ6A 4R2IA 4E09A 1CJUC 4Z1MD 3ADCA 2HDNB 4DSTA 1SXJC 3REFA 1CJTC 4MGZR 5TXGA 4D6PA 1CP2A 1ZUHA 2QPOA 4IVPA 1NJFA 4DBLC 4Q9JA 3K0FB 4A2QA 5EQTA 3PENA 4F38A 2BMJA 5JEEA 1CR4A 5JCZA 2DR3A 3SDZA 1AZTA 3Q7PA 5DIFA 3LVQE 4Q19A 2GZDA 2JLUA 4IKEA 1NNEA 1P72A 3QY0A 2ZYWX 2ZJ5A 2WWIA 2VO1A 1XMIA 4V0MA 2N42A 1XF9A 2IX3A 2HEIA 4O2RA 1KO1A 2OAQ1 2JLZA 3BWDD 3S1AA 3K0EA 1DBSA 4TLEA 3U7GA 1KDOA 3N70A 1E79A 4MH0R 2IEZA 5A0FA 5DSZA 3I73A 1MKYA 2JJ1D 5GJBA 2MSDB 1HA3A 4OQMA 1DAKA 1N6KA 4M53A 1TUIA 1ZYUA 1DS6A 2OCBA 4KODA 1KI3A 4HUTA 4GZMA 3GLHB 1DE0A 1IXZA 4IEEA 4JKIA 3TR0A 2Q9CA 3FKQA 5DNYB 5TV2A 1VPLA 1XEWY 2ZEJA 4GSYA 4LBYA 4P33A 2QAGC 3VU9A 1BO6A 2GDJA 3HYRA 2P6UA 3MWJA 3EAQA 5KNBA 1UEJA 3KZ1E 2FFBA 1BH2A 3FFBA 2B21A 3N2EA 3NKVA 3ZDQA 1XX6A 2WWXA 3TR5A 5AJVB 3I32A 1NIPA 3KKOA 3SZRA 2ZROA 2GNOA 1LY1A 4OK6A 4QHSA 1KI1A 4HB2A 4MGYR 5HZHA 2RHDA 3TSZA 4DUGA 1M7HA 2EFEB 2IHBA 4HYYA 2CCJA 4Q21A 3FTQA 3OZXA 3GLFB 4XSGA 1W2GA 4Q9HA 1IY0A 4HLQB 2OBLA 1JR6A 5EP1A 3FMOB 5FL7A 3RVBA 5K8IA 2QAGB 4NCIA 2R44A 3I72A 4D80A 3AQ4A 3L0OA 4AYWA 2XTMA 5TB5A 2ORIA 2OLJA 3QI2A 4XTRA 3M1IA 4OKSA 2GK6A 4MYTA 3ICEA 4HZIA 3TK1A 1RYHA 2BEJA 1Z0FA 4OL0A 1QDEA 3TSOA 4URXR 3B7GA 1JQLB 2QP4A 5IDVA 3DMNA 8OHMA 1Q3TA 1N3BA 1YZUA 1PV4A 4O3MA 3A37A 2GCOA 1FUUA 3QXHA 3T61A 5EP4A 2BBSA 2BBWA 1U0HC 4B2LA 3O8CA 421PA 4Z51A 3IQWA 2A7QA 2P5TB 3A1WA 4LI0A 4FMCF 1KK3A 1CR0A 1KAOA 3ZH9B 2K5UA 2WPDA 1VYTA 1DAIA 4DB2A 4EQ6B 4NPHA 2ZE7A 4RD1A 3CBQA 4MKGA 5C4MA 2BCGY 2BMDA 2FPLA 3LDAA 1OHHD 2B92A 3EZ2A 4Q7LA 2A5DA 1NVWQ 3HR7A 4MYHA 3TVDA 4ZI2A 2QMHA 3OEHD 4F4CA 2AR7A 4WBSA 2CK3D 5H8WA 2YV5A 2OG2A 3NWJA 4Q4AA 1N6RA 2DWOA 1G18A 2MMGA 4LJ8A 4BLRA 4XWOA 2VF8A 4TSFD 2Q3MA 5JMTA 4XWAA 3SQXA 2QM8A 1ESNA 3QIAA 1G64A 1KSGA 1IN5A 1N5KA 4AKEA 4F91B 2WVJA 4OQFA 1W36D 3KB2A 2ZITA 3TH5A 3UPUA 2X19A 4TQ9A 1KI9A 1QHNA 5DHFA 4ARZA 1ZM9A 1FW6A 4P4UA 4AI6A 5HE8A 3UKDA 3D31A 4W5HA 2WICA 1VHTA 2J0SA 1IXSB 5F9HA 4L9SA 3BS4A 1RE0A 4CEIA 3QBVA 3U3RA 1EESA 4KJZA 3KFXA 1FTSA 3ZVLA 1OH5A 1NMXA 4XTCS 2J5XA 3B1ZA 3J81k 3VKGA 4CDGA 3A1SA 1HT1E 2OFWA 4PXAA 4V0ME 2WTUA 2TMKA 3IIKA 4PFSA 1Z83A 3VX3A 4ESHA 1TX4B 3BIFA 1Q0UA 2VP2A 4C9BA 3IBYA 2O0JA 2XB4A 5TVKA 4M0LA 4HB0A 4TL7A 2ZI3A 3TSWA 1YRAA 2HJGA 1IN4A 4NZYA 1VG1A 1W5TA 4PHHA 3QNUA 1ZMXA 2QZ4A 3GJ8A 3TQCA 1Q57A 2WKQA 4I1UA 3P1JA 3T5DA 4BFXA 1KGDA 1AJEA 1HURA 1XXHE 1G8HA 1QG4A 1US8B 3TUIC 2ZTSA 4X8HA 621PA 1E79D 5AJZA 1OLOA 4A0FA 1DARA 5EXXA 4XWKA 3U7HB 4GMXA 1EFUA 4OHXA 2Q9AA 3WMEA 1Z0JA 3WXMA 3DZDA 1KOFA 3UMRA 3WHLA 1T8TA 1G21E 2WKRA 1DTSA 2H17A 3IBGA 3A6PC 4D4JA 1II8A 4EPYA 3TUZC 1RYFA 1T0JB 1XD9A 4TWZA 2IW3A 2GXSA 2UZIR 3I61A 3RSLA 2AK2A 4HDQB 2QE7A 4GNKA 4PC7A 2GVZC 5KNCA 4EJSA 5LDDC 1DAHA 3C41J 2OCPA 3UANA 1EFTA 1W0KA 1T4GA 2C03A 1D5CA 2PZFA 2QORA 2G1KA 4CZ2A 3EW9A 4LJ6A 4ZCLA 4YMSA 3AVYA 3W5JA 2FF7A 4C2TA 2REOA 3LV8A 4R7ZA 3NH9A 2GF9A 3ONWA 3K9NA 4OI4A 3KQUA 5GJCA 1XTQA 5DISB 2BC9A 5EE9A 2AL7A 4QXAA 1DEKA 4BZPA 4DUGD 1DG1G 5DI9A 2ZRMA 2VHJA 5CYPA 1OXVA 3CX8A 4DLSA 5E4FA 3NVAA 4CT4B 4DRZA 4QRHA 3VHXA 3UG6A 1G41A 1NG9A 5FL7D 1BOFA 1TMKA 3AEZA 2WSSA 1G8YA 2NTYC 2WV9A 2XEXA 3B1VA 4QBHA 4EFNA 3SNHA 3W90A 4AIIA 1XJCA 2X2EA 4ILEA 1NSFA 3NEJA 4A2WA 3NBYC 3LQQA 3BH6A 4KSBA 1NF3A 4QNRA 2HUPA 2RMKA 4BEJA 4YQFA 1P2UA 1X86B 2OXRA 4GOJA 5AR1A 3RWOA 1G5TA 2V8OA 4FINA 1U9IC 1R0WA 1RIFA 2E1RA 1KI7A 3DM9B 4HEJA 3RS3A 4A0RA 2QQ0A 3OIVA 3BD9A 3IDQA 3F3YA 4OHZA 1EX6A 3WHKA 2C9OA 2QAJA 4XSHA 5JSZA 2ANCA 3SBDA 1Z6GA 2IYZA 1MO3A 1HV8A 2WPDD 2WJGA 2F6RA 1QHYA 1U94A 1ZM4A 1OXXK 1E0AA 4M1YA 2PEYA 2PX0A 2Z6VA 2ZSBA 5J5CA 4I99A 3BORA 1NVXQ 3AP1A 2ERYA 3CW2A 1DPFA 4IDOA 4YDHB 2F9MA 3CZQA 3AF1A 2ZJZA 1JI0A 4I81A 1A2BA 3A4LA 2MMCA 1Q3HA 1Q1ZA 1GP2A 2FX3A 4BFVA 4DLUA 4UNRA 2F43B 1JQJC 2GVDC 2O5VA 1EGAA 4XVQA 5SZKB 2BOVA 5TMPA 4KLNA 2O8DB 1OSNA 1XEXA 4Q7JB 2PH1A 2WZQA 2A5YB 2JCSA 4P3YA 2FNAA 2V1XA 2W2TA 3THOA 2AN9A 5FI0B 4R98A 3IO5A 4PANA 3B1XA 2RAPA 1OB2A 3KJIA 5EE5B 4YMVA 4PZLA 1T5IA 1L8QA 5FUVA 1XP8A 2IYTA 4NE2A 5L3SA 1Z2AA 2ZRAA 3DZ8A 2V3CC 1XBTA 2HLDD 4DXAA 3MJHA 3PIRA 4QL3A 1Z6AA 2ZRPA 1A82A 4TLDA 4DWJA 5TY0A 3K9GA 2CDNA 1G8GA 1X6VA 1P75A 2DPXA 2FGJA 4HLCA 4B3DA 3B60A 4PAQA 4IJMA 4NMMA 2W0SA 1XPRA 2JJ2A 3FGNA 2W00A 5EXTA 4DDVA 4IDPA 3H4MA 3X1XA 5BW8A 4TLCA 1E9FA 1NVVQ 1ZAKA 1II9A 3ADBA 2PJRA 3FE2A 4IHQA 1V5WA 4OQXA 1KNQA 3MAAC 1E0KA 1N6PA 1E2LA 4FXPA 3RHFA 4LGMA 1I2DA 2IS2A 4D2IA 4ZIRA 2P2LA 5E7IA 4F92B 5DLQC 3CPJB 2ZVPX 1CJKC 1IAQA 3U44B 3KUDA 3LH5A 2G77B 2AD5A 3BH0A 4H1UA 2FV8A 2X77A 4XOIA 2N1BA 4IFEA 5FUYA 4BFSA 1NN1A 1NVUQ 3PXGA 5K8UA 1ZCBA 4YMTA 4JZKA 2ZVQX 1YR8A 3CWZA 1LFDB 4ZDJA 1W7AA 5ANRB 3O8DA 3ZS9A 4KXFB 3U61B 3A4NA 1CF4A 2DBYA 4JL6A 4DC9A 2QE7D 3ZVMA 5FL3A 4GP7A 4PAMA 1Z28A 4PZZA 2Z4SA 5LBIA 2GZAA 4DIDA 3QBTA 3CR8A 2ZU6A 5JHHB 1A4RA 1N6IA 3FHOA 1G19A 2XTNA 1ZD9A 2BBTA 3RYTC 1SHKA 3MWYW 4P0TA 4PO8A 4RCZA 4WA7A 1JPJA 2WMNB 2XTZA 1LV7A 2ORVA 1SVMA 2KWIA 3AVXA 2OLKA 1G7CA 5KTYA 4LRWA 4P4SB 3Q3JB 3OFND 2NO9A 4DDTA 4QJ4A 1WF3A 2OILA 3K70B 2WSSD 4FN5A 1ZBDA 1OIXA 3BB1A 2SHKA 2QM7A 5EP3A 3NDBB 3MFYA 2V1UA 2C5LA 3UWKA 2IYUA 1R6BX 1U8AA 4B6EA 4C0BA 5BYJA 1P60A 1NI3A 4GZLA 3B9PA 4UNSA 4UKDA 1WE2A 5GVRA 1NJGA 5JS7A 3CH5A 1CU1A 4M1KA 5A5GA 5E3HA 2NG1A 4TMTA 4N1AA 2VHQA 3KXKA 4W7SA 1KTVA 3PVSA 5BN4A 4HB4A 4RFSB 4XD7D 3M6AA 1WP9A 5JBQA 5L3QB 3G82C 2EYUA 4FCTA 1MOZA 2D62A 4G3XA 3QF4B 1ZNYA 2CVFA 3AVUA 1R7RA 4NCKA 2ZI9A 2EQBA 2HF9A 1RVDA 5BN3A 1XDBA 5CLLA 3VR3A 3TLXA 2OFXA 2ZRDA 1SKYE 4LYFA 1KDTA 2ZE6A 1IXRC 3P32A 3WNDA 1PZNA 2EFCB 1UKZA 1VYVA 4IDHA 4WIAA 5FPHA 1WBDA 1W36C 1EK0A 1UEIA 2GILA 1G3QA 1O3YA 1XMSA 2JIZA 2ZYVX 3FFAA 3LBIA 1XEFA 2W6ID 4OI1A 3T1QA 3TGPA 1X3SA 4JLMA 4ZCIA 2XZLA 3KKMA 3PUZA 1Z63A 5AUOB 1AGPA 1JJ7A 3VQTA 1CR2A 2F1HA 1MO6A 5FR2A 1CIPA 2BIFA 5KUTA 2IWHA 4GOXA 1KAGA 1N25A 4LC1A 1OXUA 3DOEA 2ZSAA 5AJWA 4GL2A 2FDCA 5D3MA 2ZS9A 3QEJA 1N5JA 2VQSA 3NEYA 1XU4A 4DCNA 5JHGB 1G3UA 4HI0E 3GLGA 3V4RA 4LJAA 4C2UA 1P2SA 2FSHA 3R9WA 2ZQ5A 3U3KA 4OI0A 4G0NA 3EA5A 4BWYA 1HT2E 3O8BA 4XH9B 2BEKA 4I4LA 2PZEA 1M7GA 2QBYA 2ONKA 2QT0A 1GVNB 2J0VA 3Q5DA 1ZM7A 3ADKA 3LBNA 3W9YA 4R71A 4UNQA 1NRJB 4LK2A 1AM4D 3HPRA 2GAAA 4DT1A 3QG5A 2ZUDA 2CMKA 4GBMA 2H1LA 1AQYA 4RD2A 3WNBA 5FOWA 3I92A 4UNPA 2JJ2D 2HXSA 2ZRCA 3IHWA 2IYQA 2FZ4A 4MYCA 4B34A 4NYJQ 2XGJA 2V54A 2OCYC 1ETUA 2YOHA 4CIDA 2PBRA 4ERNA 1FL9A 4BLSA 4DSNA 3AB3A 4QM6A 1A1VA 3SYKA 3ZIAD 2FSIA 2ECKA 1AIPA 1E2KA 3EC2A 3LRPA 4X8MA 3E2IA 3EPJA 1GKUB 3KL4A 3S1AB 3TRFA 2O8FB 1KMQA 4FCVA 4PPQA 4A15A 3QE0A 4B71A 2PJZA 4AK9A 2W6JA 5CB6A 4LUCA 2O8EA 3M0EA 3RS2A 4RD4A 5D3QA 4ZI3A 1RFLA 2EFGA 1LW7A 1QF9A 1DAMA 1AK2A 4WZ6A 4XVRA 1G16A 3OAAD 4MUAA 3U4QA 1KZGB 4JKYA 2IS6A 1EWQA 4N3NA 5IRCD 1JECA 4JJKA 4K8OA 1P2VA 2J1LA 2AXPA 5L3RA 5P21A 4BFUA 3OESA 5FPTA 1H8HD 3RC8A 4NL4H 1IN7A 4QFMA 3EPKA 4AKGA 4KYIB 2HXYA 3FPAA 1KK0A 3PFIA 2ZU0C 3DL0A 121PA 4QOSA 3G0HA 2Z4RA 2Q0HA 4K46A 5HKKA 1R8QA 3CNNA 2RH5A 1XD8A 4QNMA 2IUUA 1U2RA 2EU8A 3RRMA 5KDDA 4LSGA 5DH9A 3CONA 2EFHB 5A4JA 3CWQA 4TSFA 2WJVA 3QXSA 4RZUA 1CJMA 2VA8A 2HT6A 1W1WA 3T1TA 4NP6A 4DHEA 3W3ZB 2H8KA 1KKLA 5KOYA 1E69A 3GCGA 2HYDA 2JASA 4URWR 3R8CA 5B30A 4HATA 3GFTA 4D4KA 4DDUA 1JXOA 1LB1B 4M1SA 4UXIA 3WRYC 4V0KA 4A9AA 2OBMA 4TTRA 3HWSA 2ERXA 1QHHA 1UADA 2Z43A 3U5ZB 2F55A 4TYYA 4W5WA 1E2PA 2RGEA 2EVWX 2W58A 3B82A 2J46A 4A2PA 1M74A 1UPTA 2RKOA 3EASA 4TT3D 4KHZA 3FHTA 1FUKA 4P31A 3GJ0A 2D7DA 3NC1C 4F4JA 4KU4A 3LFUA 3VR2A 3ZQ6A 4BLOA 2QSZA 4LHWA 4TMWA 1ZD8A 4IOLA 1OFIA 4TN1A 4OBEA 4WAUA 3ETLA 2GCOB 3K1JA 4JVSB 3CF2A 5FPKA 1G8FA 1NBME 1IOZA 2ZAMA 4V0OA 2R6CA 4LHYA 4LHXA 1HQYE 4M9SA 3KKQA 3LX8A 3CM0A 3HU1A 4FIDA 1ZNZA 2I3BA 4A36A 5J4YA 1N6LA 2A5FA 4Q03A 1SXJB 1NBMD 1UBGA 1R10A 3DHWC 4Q4JB 3CX7A 5FTLA 5EE0A 3UATA 2QSYA 2QT1A 1XTRA 4TL6A 1DG3A 4OHYA 1U0JA 2JLXA 4TQUS 1J8YF 1HQCA 2ODBA 1XXHA 2JIZD 4B43A 821PA 3O8RA 3TW8B 1ZRHA 2J0UA 3WNCA 2YC4C 3KQHA 4IFBA 3K9HA 1CXZA 1D2MA 4WOPA 3GLGE 1ZD1A 1TF5A 2GJ8A 3KXLA 1P3JA 1DAGA 2WJHA 3CRMA 2VEDA 5IK2D 2YWHA 1CBUA 2WSMA 2EFDB 1AA9A 1TADA 2ZE8A 4HUQA 4Q4AB 1AGRA 3PCRB 3NC0C 4EFLA 4QKQA 2C98A 5EXSA 3AP3A 4B35A 4HAXA 1OE0A 2R6FA 4Q18A 1E9AA 5HCIA 1CTQA 5CDFA 1GKIA 3GP8A 1EFRA 1ONBA 1P73A 2XJ4A 4G5QA 3THXA 1TQ6A 3LY5A 5IHPA 4DEXA 5AUPB 1XD2A 5KNDA 3BOSA 2CXXA 2ZR7A 2VP6A 5IF9A 3HU3A 4ZDWA 4ARZB 1SVOA 2GRJA 4LJ9A 3THYB 5LD2C 2JAQA 4Q00A 4BRWA 1M2OB 1VECA 4HZUA 4YLGA 2QG6A 3X1WA 1NN3A 5C2JB 2CLSA 3EC1A 3NDPA 1XPOA 4CEIB 4G1UC 3B8HA 2C9CA 3TNFA 2PLFA 1WDTA 4G01B 1EXMA 1KY2A 3RS4A 2NOAA 4UNNA 3ZD7A 4TMXA 3LW8A 4PPNA 4M22A 4LV5B 1N0VC 2RCNA 4JMPA 3EPLA 4LYHA 5AUNB 4TZ0A 2C99A 3N2IA 2QMUA 5B64A 2ZRJA 3ZD6A 4IOMA 3U2QA 4Q1CA 1KJYA 3RS0A 2CBZA 3RAPR 1F2TA 2J7KA 2C78A 4KLZA 4EJSC 3FYHA 4F93B 4TL9A 1EX7A 1NMYA 1D9XA 2FFAA 2H16A 4JLBA 1KI2A 2JLRA 3AGQA 3BFVA 1Q1BA 3KQKA 3MUFA 5DN6A 2VYFA 2W6JD 3QEOA 2ZJOA 4MITA 2AX4A 2J7PA 3DM5A 3C5HA 5G41A 2ZSFA 2GZHA 1CRQA 2H5EA 3I1FA 4AWXA 2JLWA 3GJ4A 1TQ2A 1Z0DA 1AN0A 4TLAA 1RRCA 3ICQB 1II8B 2WWHA 2ONJA 5CJ2A 3DMDA 3AF3A 3R9XA 4TL8A 3LNCA 4OK3A 1FP7A 4RZXA 3GPLA 5DYGA 4RY2A 4OK5A 1E2IA 3T1VA 4EJSB 4KV9A 3FKSA 3T1OA 4JBWA 4HAYA 1FZQA 2NQ2C 2FSFA 4RD3A 1FNNA 3LA6A 4PC1A 1ZU4A 3VNVA 5HKKD 3C7KA 4QHTA 5LPNA 5E7MA 3QPUA 1N6HA 2A5GA 2DYKA 2C77A 1E2FA 4WXPA 3SJAA 1UBEA 1K8RA 1B23P 4OI2A 1SVIA 1U81A 4J0QA 2A30A 4LWZA 4N0EA 5DYIA 1GZSA 2VP4A 4CVNA 5HE9A 1PLKA 1YZQA 1K6MA 2F9LA 1Q20A 3SFZA 2HLDA 5F3WB 3OHMA 3IEUA 1W48A 3KUCA 2XSZA 4JYCA 2RGGA 4FMBB 5KSZA 1TNDA 2OT3B 3GMTA 3BXZA 1AKEA 2QP3A 1G8PA 2W2XA 3GLHA 4Z8YA 1E9RA 3B85A 3L0IB 4NH0A 1LF5A 4PHGA 1KI8A 2Y8EA 2O52A 3FVQA 5IT5A 4IOKA 5E7JA 3ZZUA 4DLYA 1GRQA 4LBVA 5F9FA 1FQKA 2BCJQ 1NN5A 1LF0A 5DI3B 1JEEA 2UVQA 1S1CA 1UKEA 5HCNA 2KSQA 2YHSA 4LDJA 5JSZB 4Q48A 2YWEA 1HEIA 1MV5A 5KYKA 1IJFA 3RRNA 4LC0A 5HPYB 3GLFA 1W5SA 5FI1B 4B33A 1TAGA 2HJVA 1FNMA 4E07A 3EZFA 1ZJ6A 4JLOA 3TIFA 3U7EB 4NCHA 5BXQC 4Q1DA 4JLNA 1N0UA 4HB3A 3A1UA 4MUBA 1E3MA 2ATXA 3AVPA 3EA0A 1KNXA 2GCNA 1MRNA 5KPDA 1IN8A 1HE8B 2BJVA 5JWHA 2XNSA 3VR1A 2R6AA 4Q9IA 3NHAA 3SFVA 5CDFE 4DB4A 2HT1A 1XPUA 1VCOA 1OIWA 3N5CA 1Z08A 3V4FA 3VMFA 2VTKA 2I1QA 1F5NA 2ORWA 3MD0A 4B76A 3BB3A 4ZDKA 3CX6A 4YONB 4H1VA 1X1RA 3C8UA 1TU3A 3U3JA 4B3BA 2XNDA 1EFRD 3Q8XB 1KO8A 5LB4A 2P6RA 5L3SB 1YZNA 4F7WA 4ZDIA 5HZKA 1G3IA 3DOFA 3FMIA 3QKUA 4Q1EA 2X2FA 4BLTA 1OXTA 1F2UB 3CKLA 3QKSB 4RSGA 1Z6XA 5FBVB 1LVGA 1JB1A 4LCBA 2DCUA 3NG1A 2OZEA 2FU5C 4NYMR 2LWIA 2Q21A 2XX3A 2V6JA 2MSCB 2QY9A 1VTKA 4HSEA 2QN6A 4PC6A 5JLJA 3OFNA 1XB2A 4AYXA 1XJ0A 2OSBA 3NBXX 5JJLA 5JJIA 4M1TA 4JIMA 1J7KA 1ZIPA 1II0A 4YMWA 4B48A 4BPBA 4ZV4A 2O0HA 1ZC4A 4TZ6A 1G17A 4A8JA 3MWKA 4KITB 2PCLA 5J47A 1E9EA 1RRFA 1W49A 4QGHA 5JS8A 4ZIRB 1QHGA 4PSKA 5KHOC 4C7OA 1D2EA 4PHFA 1F6BA 2V7QD 1E9SA 1NP6A 1DADA 2REBA 3LQRA 2VBCA 1R0XA 3SC3A 5FFMA 2QQEA 3NTUA 3W6NA 2VP0A 2WJIA 4UXJA 5FOTA 2GK7A 2F7SA 1Q1QA 5FTJA 1YQTA 2FGKA 4PZYA 1E2EA 5F2EA 3EWSA 5DN6D 4D0LB 2BKEA 2J7PD 3OIYA 4XD7A 4OHVA 5H1YA 4NYIQ 1HY3A 3SQWA 2D2FA 1E6CA 1NVVR 3L82B 4LPSA 1HTWA 1MT0A 5JWRA 4LV8B 3CF6R 3CRW1 3PITA 5G3ZA 4O0MA 1FFHA 2PCJA 2ZRKA 4OYHA 2NO0A 3FKSD 3I3SR 2W6IA 4DLWA 1G1MA 1NSTA 3RANA 1W2HA 2QTVB 2JLYA 1M6NA 2YZ2A 5FBWB 1RPZA 1E99A 5DO9A 2RHMA 4R2HA 4Y0VA 1BYIA 2DFNA 5J4LA 1T5LA 4HAWA 1KMHA 1KKMA 1LS6A 3VNUA 3SHFA 1E4YA 1F60A 3B6EA 2JEOA 3AUYA 4L16A 5LB2A 3JZMA 3RS7A 3PEYA 2DWQA 1NLZA 2WM9B 1E2NA 2GCPA 3H2YA 1G4UR 1M34E 3ZGXA 1VCMA 3I5YA 1W4RA 2AHOA 3GJ3A 4R9UC 1XTSA 2J45A 4MRPA 2J3EA 4Q7KA 3GLHE 3B2EA 4C0KA 2ZM5A 1HE1C 2OEPA 2O0KA 2XSZD 2QENA 3B13B 1KI6A 3BB4A 1N5IA 2JLQA 1GRNA 4JLPA 2ZR9A 2DFKB 2OHFA 4DVGA 3GLIB 1T3HA 5CLQA 3TJZA 3AVWA 3LXXA 1Z0IA 1G5PA 4BECA 3MSXA 1BKDR 4PSAA 1Q1EA 4W9MC 1UF9A 5ELXA 1GIAA 2FSGA 2D74A 1R5OA 3SEAA 2AWNA 2B8TA 4RKEA 1RJ9A 2ZRLA 3GLFE 2WAXA 4WXRA 1OH6A 2I4IA 1Z0AA 1YJ5A 3ZIAA 1S9DA 2G6BA 1TF7A 4M8NE 1QRAA 4QJ5A 3W34A 5K8TA 1OXSC 3IGFA 2D3WA 2OM2A 1TU4A 4KBFA 1Z06A 5AJXA 4Q4LA 4GDFA 1P5ZB 3QENA 3MJRA 1E1RA 2O8BA 3HPQA 3LVRE 4NCJA 4GPTA 1P7CA 3DKPA 5B58C 1VCNA 1QHSA 2W83A 4XIGS 4JVLA 2QRNA 5SZIA 5FOVA 1JAIA 5FPSA 1XMJA 2IBMA 4JLAA 3MRSA 1JXMA 2IYYA 3U60B 2P67A 2QTFA 1RRGA 3OAAA 3QKRA 2HYIC 3VKHA 2ASEA 2OFOA 2EWWA 2RGXA 3WMFA 1R0YA 4ZKDA 2AKAB 3GEHA 3RWMB 2JGNA 4DLZA 1J8MF 5D3MB 5B2ZA 4EFMA 2ZRNA 2ZJ2A 3PUVA 1H8HA 1NN0A 3P26A 3GJ7A 1C9KA 1XRJA 4JSTA 1E94E 5CIQA 2C96A 4WW0A 2XNDD 2YNMA 3GJXC 4M4SA 3R8FA 2CNWA 3VFDA 4C0QC 2QBYB 3KQNA 4YDSA 2OBNA 2P6NA 3BC1A 4A1FA 5JWOA 2CVHA 3MMPA 4B2IA 1M8PA 4JLJA 1GNRA 1ZP6A 4MKIA 2IWRA 4DT1B 1NLYA 1S96A 2IUTA 1UBFA 2PZGA 2WJYA 3GFOA 1NKSA 1YZTA 4MDFA 5EP2A 3K0CA 3PR1A 1I4TD 3SYNA 3UIEA 1TEVA 1R2QA 4G5OA 1YR7A 2RGBA 2YKGA 2ZR0A 2GXAA 3CUEF 5DGXA 1GG2A 5J4HA 5KDOA 2FH5B 3ND8A 1QZXA 3IQXA 2VPPA 4FMDB 4S35A 2F43A 4EPRA 4DLXA 2JA1A 4TYQA 3SBEA 4QC2A 5CM8B 1OFUX 3LW7A 2OXCA 2F3RA 4FD2A 1SHZA 5CJPA 1PVOA 3BBPA 4TT3A 4AY2A 1R5NA 1VG0B 4RD0A 4TMVA 2WHXA 4I1VA 2REXB 2QMEA 2IYVA 4UQOA 2YOGA 4URUR 3I5XA 3L8ZA 4DKXA 1CEEA 1OF1A 1FX0B 2XAUA 1GUAA 4DJTA 1UDWA 1E4VA 2G0NA 4L8GA 1KJZA 2CE2X 3TE6A 2O8EB 2R62A 1KDPA 1RKBA 2YINC 4KVGA 4LBZA 5FBQB 4NYJR 3LD9A 2O8CA 3PUXA 1NBMA 5EUQB 3U6BA 3B1WA 1NY5A 3ZLJA 2JATA 4NCNA 4OHWA 1EFCA 3VX4A 3U4QB 2JLVA 4E22A 1GITA 1RW4A 3BFKA 4OJQA 4IDNA 4ABYA 4AG5A 3UMSA 1YU9A 2G1JA 2NGRA 4U02A 3L0PA 1S3GA 1YRBA 2XXAA 5DHAA 4AKIA 1UBCA 4NONA 5FH9A 3OEED 3IPXA 4CRWB 1G3MA 3EG5A 1Y3AA 1W47A 2QPAA 3RRYA 1Z6TA 2XB2A 2ODEA 4Q66C 5FR1A 4MRRA 2BMFA 4CEJA 1KSHA 4M9QA 1RRPA 5IK2A 1PJRA 2VSXA 2KJQA 3JVVA 1A7JA 5EXPA 1UDXA 4CF7A 3U44A 1LTQA 2AFIE 4DSUA 3K0AA 1M1YE 2XOKD 3GJ5A 4Q4HA 1E1QD 2PLRA 1W36B 1JNYA 3C15C 3QUSA 3Q72A 3C5CA 2ZUBA 1KI4A 1XZQA 4BFZA 4IVQA 1QHHB 4EPTA 5EUMA 4QM7A 4PQRA 2CHVA 3FMFA 3R7WA 4B44A 1KY3A 1W4BA 4HLUA 4FW9A 2IHYA 4D0GA 4TMZA 2FMXA 2ZJAA 3BFXA 2A78A 4LBWA 4DDWA 1E2QA 1F48A 5AUQA 4PPFA 4DIEA 4HDOB 4JS0A 3A1TA 3EARA 3PUWA 1CKEA 3EIQA 2ZJYA 3NBFA 4P32A 3WY9A 4LHZA 1W4AA 3HDTA 4DCUA 4KBGA 4A6PA 4M21A 1JR3E 1WBBA 2HCJB 1XJQA 2MSEB 1D6JA 3AM1A 3LXRA 1E32A 1YKSA 3SJCA 2ZS7A 3I8XA 4YXWA 4DLVA 5GVSA 4P4SA 1D9ZA 1TTTA 1E9CA 1E2JA 1JR3D 3AUXA 1Z2CA 3CNOA 1ZC3A 2Z0MA 4D81A 1E1RD 1XCMA 5BYKA 3RLFA 2QI9C 1Y63A 4KFUA 4U5XA 1XXHB 3SJBA 4ZO4A 3BAFA 3C14C 4JLVA 3D8BA 1LNZA 3Q85A 3W6OA 4D82A 1NMZA 2CL6X 3BJIC 5GADl 1ZUIA 1D8TA 2AD1A 4XJXA 3ND9A 5C4GB 4DEYA 5FUXA 5FTMA 2QNRA 2NZJA 5M04A 2QGZA 3T34A 3HP1A 3QPVA 1YHNA 3M4YA 2GEDA 3VU9B 1T0HB 2GBLC 2B7CA 3RRZA 5CIWA 2IC5A 2ZRIA 4Q1BA 4US2R 3THXB 2NPFA 2GJKA 3TAHA 1VHLA 2CNWD 4RFSA 3W5IA 1KK1A 5L3QA 4BGDA 3EWAA 1YR9A 4FMCB 5C1BA 2OE2A 3QF4A 3MG9A 4D0NA 3EXAA 2WOJA 4PC3A 4JVMA 4HZUB 4Q7MB 1N6NA 4JL8A 5FBRB 2CCGA 3PEVA 4NDZA 4DLTA 4AG6A 1ODFA 1Q22A 2WAYA 2DWPA 3AVVA 1G6HA 3T5GA 1DOAA 5CITA 3PEUA 3SR0A 4Q1FA 4B6FA 4EAQA 1PLJA 3GEIA 2R2AA 1OKKD 3KX2A 3DPUA 3THWA 3FWYA 3K53A 3EX7C 2RGCA 1BYUA 2J0QA 2BM1A 4E03A 4W5JA 3U6KA 1F2TB 4IW3B 4HAUA 3A36A 2OAP1 2ZRBA 5AJYA 1M7BA 3AKYA 3VR6A 3U7FB 4X8LA 3UK6A 5EJEA 5FOXA 4Q5IA 2YWFA 4PQFA 4AC9A 3SOPA 4UJ5A 2PX3A 1YZKA 2FJUA 3A58B 2YJTD 1KO4A 4KSCA 1AS2A 3IUYA 2Q3FA 3WYAA 3OE7D 1CRPA 4QGGA 2IYRA 1MABA 1UKYA 2QRZA 3CF0A 3KTAA 4MGIR 3I62A 4A4DA 2IXFA 3KKPA 1WA5A 4UXHA 2IYLD 5CK4A 2G9NA 2AKYA 2V55B 3PV0A 3PQCA 1U8YA 1XTKA 3BH7A 2ZYUX 1KIMA 3KXIA 2GA8A 1ZNXA 1Z5ZA 2F1IA 4ON9A 4AYTA 4CEHA 2VHCA 2EWVA 1GKYA 1VCIA 2CLDX 2R6GA 1BS1A 4F4IA 4Z8XA 1S4QA 1ELOA 2VH5R 1JJVA 1KHTA 1SVWA 4RFVA 2LKDA 2OV2A 2RGNA 1R0ZA 2A2ZA 4QBIA 4UJ3A 1OIVA 5JFGA 1IHUA 3D3QA 1T91A 3UMFA 1MO5A 3K09A 2YWGA 3QSYA 2O8FA 3SU8A 4LJ4A 3RSOA 5JECA 1S9HA 5J4VA 1NLFA 2CJWA 2GF0A 3C16C 2FEMA 2P65A 3PG5A 1PUIA 3KDSE 1S1MA 4KFTA 4TYWA 4GRAA 3HJNA 3SE0A 1R4AA 2HCBA 4M9ZA 4ZKEA 4JL5A 3AV0B 4BLPA 4OQNA 5KU1A 1GWNA 2ZI7A 3CPHA 3D6TB 5KPJA 1C1YA 2V6IA 1T3LA 4M1OA 1S0UA 1IY1A 2L0XA 1FQJA 3HYTA 4AKHA 4RD6A 3QF7A 5JI2E 3TUJC 3W8NA 3KJGA 1IBRA 2VLIA 4XVUA 3K9LA 4K81B 4QGFA 2GKSA 1J90A 1GSIA 2GETA 2JJ8A 6Q21A 2E9SA 2E87A 1CULC 1JALA 1OPXA 2ZIAA 3AKCA 4O2LA 4CW7A 2NO6A 2GBLA 4GP6A 4EPVA 2F1JA 3ZQJA 4B2PA 2IF2A 4NHOA 1XCPA 1P9WA 3FOZA 3RDPA 1CJVC 1DVRA 2C95A 2G83A 1DAEA 1GOTA 3CO5A 1Z8FA 2V7QA 2WIAA 3RS5A 4YXWD 1V43A 2QEQA 4LX0A 4LYAA 4PAOA 5LD2B 4JVNA 1H8EA 1GM5A 2DHRA 2C04A 2QUZA 1GAJA 5JI3E 3F5FA 3KFVA 3AKDA 2F1RA 4FWIB 1QHXA 4KI0A 2D2EA 1GNPA 3X1DA 1W44A 3K70D 4YC7A 3GD7A 1E9BA 4A82A 1WXQA 4JT4A 1ZU5A 5GJWC 2J41A 3A1VA 1AS0A 1MR3F 2YVUA 3K0FA 2BDTA 3P4XA 1E2MA 2CHGA 3U3OA 1VIYA 2NO1A 4ASUD 1COWA 2IT1A 3DVLA 4B3GA 2CE7A 3V00A 2C2HA 4HLDA 3H84A 4G5GA 4A8JC 3IIMA 1R8SA 4M2LA 1X8KA 2ZUCA 1B0UA 3UWOA 2BKUA 1L2TA 3KJHA 1U98A 2BMEA 1WQ1R 4L5BA 1QVAA 3AH8A 3WMGA 1P4SA 1ESMA 1SVLA 1SXJA 1XTIA 5FOSA 4BFTA 5E95A 1TEXA 1ZCAA 1DELA 2R6DA 2BM0A 4Q4JA 4BUJA 1GFIA 5JRJA 1KYIA 1OB5A 3P27A 1NKTA 2GXUA 4KVAA 4ACBA 3L8YA 2QROA 4A0GA 2LKCA 3WYFA 4ZCMA 1DO2A 2BV3A 1JEDA 2UZ3A 1EFHA 3EZ7A 4WZBE 4DZZA 3MLEA 3E5HA 3TW4A 3JVUA 4IRUB 2A9KA 4A8JB 1CLUA 3TAUA 4DCSA 3ADDA 4KAXA 2R9VA 1G7TA 3I4LA 5CM9C 4NTZA 3ASYA 2VIIA 2ZYTX 4C7OB 1UKVY 2QTHA 4LJ7A 2GJSA 5UKDA 2DY1A 4POAA 3E70C 4AD8A 3FB4A 1N0WA 3NH6A 1RC8A 2GESA 2C8VA 2IF0A 5JZVA 4LHVA 3SS8A 2VSOA 3T12A 4KFSA 4RCYA 3ECCA 2ZXUA 2Q6TA 2OO7A 3THYA 2PMKA 1I4DD 4NU0A 1K5GA 1Q21A 2FZLA 1FMJA 2R65A 4MRVA 4PO1A 4V03A 3VAAA 4URZR 2AFHE 4EKDA 2WIBA 4Z54A 5G40A 4DLRA 4V0NA 4M9XA 5AK0A 1VMAA 1TL7C 1XFAA 3QOFA 4LJ5A 2D7CA 1CS4C 1S2MA 4Q01A 3AVOA 3KB1A 2ZAOA 2IEYA 3L2OB 5H70A 4BASA 4B74A 1T8UA 5JCPA 3PEWA 2QAGA 2CEAA 2ZI4A 2CL7X 5KDLA 2ZANA 5GJVC 3CB4A 1OH7A 2AK3A 1ZINA 2LCFA 5SZHB 3AVTA 1SKYB 1Z47A 1Q44A 1ZIOA 3LX5A 3X2SA 4M1WA 2YOFA 3AF0A 1G7SA 3EIEA 3WP0A 1G3RA 1GILA 1XEXB 2QGNA 1KMHB 4IDQA 2VF7A 3LWNA 3V9PA 3SHWA 4NYIR 3CR7A 4Q9LA 5TARA 3X1YA 2WWYA 4TTPA 3LLUA 1SULA
chains in the Genus database with same CATH superfamily
5I8PA 2BWJA 4K6KA 3TL2A 2H3HA 1VG8A 3TSAA 3UZUA 4PU0A 4BVAA 9LDBA 4PICA 5E6UA 4IH1A 3T7IA 2GX6A 5L45A 4BRUA 1JIJA 1BH6A 2HCRA 3BMQA 1BIFA 3KQQA 2I6FA 1KI6B 1B7GO 2Y77A 3UTCA 3FSGD 2IA5A 5AICA 3OLXA 3TZEA 4DZRA 3ZHCA 4EUFA 3TNYA 2N46A 4QUHA 2DZDA 3I8SA 4CTKA 5LA6F 1HT3A 3UJDA 4DNXA 2O14A 5ISMA 4ZZ1A 4UBNA 3FCUB 1Z4QA 5GZ3A 1YNOA 3E5NA 2C3YA 5AIAA 1MTZA 4DNQA 3IKTA 4JQOA 4C04A 5E3IA 4E5DA 5KNBD 1IBMB 4GT1A 1KJWA 3EIFA 3CNLA 1YONA 1AHIA 1NU8A 1B8VA 2IP1A 2JLQA 1C3OB 2HSWA 2ZRHA 3E1SA 4J16C 2VA9A 4JX8A 3VR2D 3AP2A 4F0JA 1PGNA 3NNSA 1X8JA 5TRTA 4OQPA 4HNRA 2BAGA 3ZX4A 5B7PA 1W52X 2QR5A 4DCVA 5BUSA 4D26A 3C6YA 2X8AA 5F73A 3IEPA 3VUEA 3W4KA 1IEWA 3WYGA 5FX2A 3U19A 4KO8A 1PT8A 1H8ED 3RVOA 2P35A 4YJGA 2BH2A 4WGFA 3FYUB 3K8ZA 3ZJYA 1RQRA 3DBRA 2Y0DA 1RCTE 1PFWA 1V9SA 2AJ8A 4HYQA 1PX2A 1KSJA 5EWJA 1UBNA 5HFNA 5ITSA 2O8BB 1DKPA 1UM9B 2JFNA 2BVNA 3NT2A 4OLBA 1WQ4A 3BL6A 4DR4B 3MQ4A 4B3FX 4KXYA 3QX9A 3WWZA 4TXHA 2IZ1A 3B12A 3F0TA 2G67A 3B5EA 1OGIA 1SU8A 4QDTA 4TLBA 4I1YA 5BVGB 3QKRB 1LS1A 4QG3A 2JK1A 1NXQA 3CJRA 4LXIA 5CJJA 5AKLA 3K15A 1COWD 2CCKA 3IAUA 3IPYA 4ADSG 4BLQA 2XZOA 3ZVNA 4EIWA 2QW1A 3PHGA 4YRKA 1V4NA 1ZVQA 4L0DA 4YH1A 5K0CA 3U40A 3LBHA 4QO7A 1QTRA 1Z74A 3O9VA 3PX7A 5TR9A 1V7CA 3N6RA 2NPIA 5A7HA 3OEEA 1R74A 3Q12A 1C30A 5DI3A 1J97A 3ZHZA 2I2BA 5IH7A 4KQJA 1WB9A 3GFPA 2JDIA 3VR5A 3LI2A 1JWLA 4RF2A 1J39A 4DBLE 1YZLA 4OGFA 4N65A 3NWBA 4XYMA 2WIFA 4YX9A 2D06A 4YRZA 3F9IA 2GAIA 1ANKA 1R3DA 5LXTF 4CT5A 2ABWA 2Z8YM 4KLAA 4PM4A 4HVCA 1LV8A 3NUGA 1JHDA 4PINA 3HU2A 3HY3A 4EHFA 5JZ9A 1KEEA 1H3NA 2FPOA 3HHPA 2J87A 2XOKA 4NOMA 2JLAA 5CNIA 1GTVA 3U3MA 1U0GA 1Z6ZA 2Q5EA 4IPTA 5JD6A 3BVPA 2BFBA 3MT8A 1R9JA 5F98A 1GZ5A 5HILA 4GI7A 1H0RA 4HQNA 4RTSA 3NPMA 3I2GA 4FPXA 1NHGA 2BMAA 2R8ZA 1LUAA 1Z0KA 2BF7A 2INGX 3CO0S 3ESXA 4ND6A 2OOSA 1SHUX 4PNEA 4XUGB 5B6PA 4BZQA 3OOYA 2W22A 1I3OA 2GPYA 1TUEA 3IMFA 4HRXA 4DUPA 3NKFA 3GJRA 1P61B 4Q9KA 4DDHA 3GWZA 2Q1TA 4JXKA 1USUA 1M1UA 4LVUA 1PEAA 4EQZA 2ZI5A 3OE5A 2G88A 1TGVA 4MWEA 4WECA 4D97A 4OJNA 2IQIA 4QX6A 1A9ZA 3SHQA 1W46A 5M5BA 2JI8A 4UREA 5ARDA 4GGPA 4FGKA 1G5FA 2FMUA 4BLUA 4J75A 4WKOA 1ORWA 4XGKA 3PHHA 4DLKA 1PR4A 4AQYB 2PUEA 2WHPB 3K16A 4YBZA 2DLCX 1YZVA 1HT0A 1G6OA 2L19A 1FMTA 3HZZA 4AMVA 2QYHA 1WZ2A 1U65A 4N7BA 3O31A 2WOOA 4OP3A 1TM2A 1O0CA 2PMDA 2VHWA 2SKDA 4WFQA 3VH2A 4G97A 5LJLA 4BGVA 1KHHA 2I66A 4C0SA 1XNJA 3JWHA 4NNOA 4AN0A 1AT1A 4BO3A 4EPWA 1YZGA 2WMOB 4KXXA 5J2UF 3E4DA 5A05A 4HLUC 2XJ9A 4ZAZA 4LEIA 4ZVMA 2ZZNA 1D7AA 5U4QA 4OYRA 3SJZA 5DM1A 2PD6A 4CEJB 1YKFA 3KALA 1L4YA 2FRDC 1SOMA 3CUSA 4GFDA 4NEQA 2IHZA 3H5OA 4R1OA 4OJKA 3HZHA 4G5RA 2YVLA 3H9UA 1CUGA 3HVJA 2LP4Y 1WXEA 3GLGB 2QZZA 3EIUA 3K0AB 2OG1A 4IIHA 4MW0A 1XJ5A 3KLMX 4UEWA 4AZVA 2P40A 3RW9A 3ZNQA 5JZOA 4C3OB 1QBKC 3LAWA 4C1BA 1I9GA 3C4JA 2DH5A 4UM9B 1S8AA 2V9PA 1W0JA 4JGBA 5CB8A 3T9FA 5GM1A 1DHTA 2AXNA 4PCLA 4LY6A 3DEYX 4QPNA 1E3SA 1Z29A 3R7WB 3QVOA 5KSPA 2XXJA 5KCMA 1TYEB 3K4PA 2H7VA 1JBKA 2JK0A 4LN1A 3ZHTA 1U1CA 1VMDA 4TQAA 2VYQA 5JSQA 2ECFA 2K7ZA 4X6XA 1E4OA 4JODA 3WGUA 2C2MA 1PBTA 1Z22A 1QH8A 2YFYA 3WK9A 2C3PA 4LYYA 4OHBA 3F73A 1HYQA 4FGWA 1IY2A 1SZPA 5GGYA 5BWCA 2FUKA 1NUAA 1OLSA 3AIMA 3GUHA 4GEKA 4TS3A 3LO5A 4D5EA 1EWRA 2VK1A 4QULA 4ZD6A 1OW3B 1ZUNB 1WULS 3I6MA 3LLMA 3GFGA 3IT0A 4KDEA 3WRXC 1UMBB 2X1MA 3B3GA 4ZVNA 3ND7A 4KAAA 5BV1A 2AQKA 2PXXA 2H29A 2P9YA 4KWIA 1T2NA 4HH4A 3WQQA 2GFHA 5F76A 4R5MA 3S0JA 1L4UA 1YBFA 3LE8A 3MERA 5E0KB 1U99A 2QR3A 3TE7A 2QXUA 4ESEA 5L9AA 2D5CA 2V45A 4O29A 2Q5QA 5T64A 3VO1A 5SZJA 4L5YA 2DMRA 3O1IC 3DD5A 4JP5A 2PJUA 4QG7A 1ZRSA 3RI3A 4A6XA 2ECQA 2HU5A 4UMFA 3OE7A 3IB3A 1SBHA 1UBJS 2B20A 3R4VA 1WS6A 2GGSA 1C4OA 1JDJA 1UBLS 4ZZ3A 2VWGA 3GMDA 5CG1A 3ZCSA 3OM9A 2IK8A 5AI8A 1EG7A 4WUVA 2FEKA 4POOA 3CSUA 3O8NA 5JRZA 3OFJA 2I78A 2NP6A 2W2PA 4GI3A 3E7WA 4OB8A 2VHTA 3O92A 3UVEA 1UC5B 2VYCA 1MRSA 1L5OA 2GH1A 3RVKA 3SM9A 4MKZA 3Q87B 4KYUA 4L5IA 4R2JA 1PGJA 4N7RA 4P38A 2H52A 1RP1A 2CDRA 3INGA 5EIOA 3CJTA 2QPLA 3ONNA 4RGYA 4WBXC 5H81A 3E61A 2HSEA 3QE2A 3VR4A 3UMJA 3WBFA 4B47A 4CKWA 2PE5A 4HTFB 2BJWA 3G7NA 4P9NA 4J0JA 4KO1S 4I1PA 1Q15A 2JH8A 2G8NA 4U2GA 2B7BA 3HL4A 4CQLB 1YMQA 4QPZA 2P0EA 1NUSA 1VPDA 2ZVJA 2DFTA 3QEKA 1XROA 4PYIA 1HFEL 2OHGA 2SCUA 3FNRA 3IP8A 4ZOCA 5DTRA 5FBLB 2UUAB 4EGJA 4G0YA 3GB9A 4CMIB 1JU3A 2JJ1A 1TTPB 2C5FA 2RK6A 4JT2A 4AT1A 3ZW9A 5LSAA 3AR2A 3BIWA 4Y30A 1TTHA 4N03A 3MTEA 4RY0A 4OMCA 5KHLB 3FDIA 3P9IA 2WVGA 1OFGA 5F2NA 3ZV4A 3R3VA 4K9LA 2YZKA 3TBKA 4AN4A 4H7KA 1J42A 2X9GA 2FR8C 2WNIA 3B9RA 3COVA 3PPYA 5FTNA 3H19A 4ZAFA 3PDWA 3NHZA 4FLEA 3GZJA 3U5TA 4PHTA 1DI0A 4DREA 4EA6A 4MRMB 1YIDA 4MS4B 1SCQA 4TRRA 4PO3X 4UHHA 4TTJA 2HBYA 3O8LA 1KMIY 2XHEA 3C3KA 2I91A 3KOOA 1XWIA 1XCGB 2HQSA 4UZEA 4HVLA 3HCAA 2RGNC 4IOJA 5EMJA 1TJNA 2F2TA 1I5RA 1JPNA 4J6FA 2PU5A 4LDQA 2DBRA 2RHGB 2G5TA 1Z6YA 2O2EA 2VC2B 2WZBA 4G09A 1Z2PX 5CPBA 3H1TA 2RK4A 1PQYA 4DCTA 1KSFX 3DEFA 3BRQA 3K0BA 3OM1A 3PIDA 3HK2A 1CQJA 5BP7A 3NHBA 3OIGA 4BGIA 4EHNA 2XNCA 3CRRA 1ZR4A 3K8YA 4Q15A 1R6DA 1VIMA 3PWTA 4GP9A 3WLEA 4TYNA 1RJEA 3L0YA 3TZ6A 3R4CA 4OGGA 5JC8A 1WJGA 2JFPA 4CEHB 5I7FA 1DWOA 1BW9A 4IIYA 1PZFA 2DFLA 1XN4A 4O4JA 2V7EA 1NA5A 3H2IA 3O2SB 2J0UB 2P4HX 2NUPB 1R66A 4HWGA 3OIUA 4PIMA 4U7DA 4K9OA 4HAVA 2NXNA 5BW4A 4ASUA 4IIJB 2J9RA 4XZ3A 4EY3A 4HDNA 2EZ9A 3S6JA 1RR6A 5FTKA 2VL7A 5JQGF 3WOHA 2V03A 2Q3LA 2WIGA 3PDUA 4NK5A 5KOJA 2ZUSA 3BKWA 4IIFA 4M1MA 3V1YA 3N7AA 2C7PA 2HHHB 1YR6A 2PQMA 3QVSA 1QRUA 1N2ZA 3QXCA 3S1LA 4OOFA 4F56A 2BM8A 3T9AA 1XD2B 2Q2WA 2GO1A 2RIRA 1PJAA 3DCJA 5GWXA 1E7SA 2YC2C 3B51X 1EDZA 4XFDA 4GPEA 4PSVA 1KFBB 2QY6A 3EW7A 3FPHA 4BBZA 1E8MA 2NU6B 1UWCA 4O4LA 4MV8A 1UP7A 2B61A 5CVEA 2BDEA 3RR2A 5CK5A 1V25A 3TS1A 1L7VC 4GX0A 1G7RA 3ELUA 4LXGA 5KO2A 2F17A 3JYNA 5FBKA 1XZJA 1PHPA 4DZTA 4Q47A 3L7KA 4BEBA 1Z82A 4GRDA 4EARA 3DO6A 1K7XB 1G9XA 1SOWA 3ZVRA 4YCMA 5A4FS 2FK8A 4QYIA 3DZFA 3EH1A 4UPVA 3WBJA 2VLBA 2EZ8A 2AQHA 4FMDF 3VMMA 4A03A 2CK3A 2R1TB 2VSQA 3E3LA 4WLUA 1B41A 2HLPA 4NOLA 2PVCA 2D0PB 3A8TA 4H59A 4MPDA 3B78A 3MTJA 2CLCX 1AK9A 2NXEA 2Q4OA 1EHIA 3CY6A 4RMHA 2FWBA 3H05A 4ECAA 5ABPA 3LP6A 1UFQA 4LOHA 1YFKA 1Z0UA 2GMWA 5G3YA 3LYAA 3TL3A 2FVYA 3PJRA 3NOXA 4GI2A 5GGXA 4LZOA 3TQTA 1L5WA 2IW1A 1OJ7A 3ZXUB 1NT4A 1KORA 1JVBA 1YQGA 4FSDA 1UOPA 1D8AA 4H2DA 2PO7A 4IHJA 4WA8A 3M4XA 2FE4A 4ZRMA 1U2QA 1UPAA 5B57C 2MINA 3NMUF 1QKIA 3F7MA 1W35A 1WCV1 3MINB 3Q9LA 4IFTA 1PT7A 4E09A 2AXEA 2H51A 1YIAA 4U9IS 4JR2A 4K6FA 1E1NA 3MAJA 1CRWG 4B80A 3IPCA 2YRXA 4J07A 5CMLA 3OQIA 1ORHA 4ENWA 3MJTA 2O1XA 5DWVA 4CBVA 4DBLC 1WZIA 3UENA 2XBLA 3K0FB 1JE1A 3LL7A 3LUGA 1VA4A 4A2QA 4R8MA 5JPDA 4O2AA 1UXIA 2Z3VA 1CR4A 1USGA 1RXEA 1XDDA 2DR3A 3QPDA 2BI7A 4OFWA 5GTDA 5EC8A 3LS2A 5J5AA 3P9XA 1MQSA 1P74A 2GZDA 3QK7A 4Q7EA 4AMGA 1J8FA 4EUSA 4RHEA 2VFAA 1NNEA 1E3QA 2DH6A 1L1EA 1XZDA 2VDVE 5DLPA 4ZXFA 3UOAB 4EL5A 2EIHA 1HO3A 1GKLA 3QY0A 3N2NA 3QJGA 1P18A 2PYZA 4DE5A 1XMIA 3NHPA 1ND5A 5AI0A 2RH9B 3AEQA 3CZRA 4CDMA 2IDZA 4KJXA 2FUG6 1RWWA 4P82A 5B3KA 1YI1A 3KVYA 4J90A 1YS2X 1UPCA 4LZJA 3VC1A 4COOA 4E15A 3HVUA 1WOYA 1DC8A 2J9FB 1IB6A 3S1AA 3SDBA 5KTOA 1MEJA 3AWDA 5CD9A 3F6PA 3ML1A 4HNAB 4TLEA 3URMA 3K31A 4AF8A 4BO1A 2HI0A 5HIIA 3F1KA 5J2TA 1E79A 2HLNA 2IEZA 4MH0R 5LWQA 5A0FA 4INOA 3I73A 3A3OA 5EJ6A 3UYLA 3WA7A 5IZCA 4YP9A 3PDHA 3UKJA 1IQRA 1DAKA 2WHRA 3T9DA 3IR6A 1M34B 1EPUA 1OA1A 3MJ4A 4JJGA 4M53A 1TUIA 4BO5A 1X14A 4IUBS 3LU1A 1W4LA 4CFZA 1KI3A 3LT1A 1UK9A 3CINA 1OMOA 3FCOA 4K88A 5EZQA 1XKTA 4E5VA 3LT4A 3NQ41 3V1LA 3TR0A 3W78A 1U3CA 1KE2A 5KNDH 2NSDA 1GQFA 1I2ZA 1MPXA 1JSLA 3NYIA 1S89A 2ODQA 4NMWA 4CL3A 2HNAA 4QGBA 4XUCA 1PR1A 1NVGA 2EX1A 2GDJA 1RVV1 3HYRA 3MWJA 5KNBA 4IVNA 3QVTA 5DOZA 3NKVA 1T9GR 2B21A 2JD2A 4CMAA 4EECA 1KR2A 1KYTA 2Q2NA 2WWXA 5J5VA 1UXJA 4C4XA 5KVSA 1A9SA 1OR8A 1CJCA 4DILA 3L7JA 1XRRA 4MUGA 2ZROA 4OK6A 1KI1A 9GPBA 3K5PA 1X7YB 1AD2A 5LA6B 1K4YA 4ZGGA 5AVUA 4X66B 2XUHA 1M7HA 3IXMA 3OY2A 2EFEB 4D8VA 4NFHA 4Q21A 4MINA 3IPRA 1F51E 1T9DA 3EEQA 4EUKA 3DP9A 2X9LA 3TDKA 2ATEA 3H13A 2DWUA 3FMOB 4MP6A 1Z4PX 1ZA1A 4NCIA 3OCCA 3I72A 5K8IA 3IR7A 5GV8A 2DUJA 2B30A 3O93A 5TB5A 4FDLA 1NNLA 3C3CA 3QI2A 1JL3A 4XTRA 5HRUA 1ZXXA 4BNUA 1FDOA 4HZIA 4K9KA 1RBMA 2P2DA 1RYHA 3TK1A 1FK8A 1R16A 4MEAA 3ZWAA 1Y6GA 1YDWA 4WUTA 2HEGA 2I2XB 3WL4A 4DVJA 4URXR 3B7GA 4ZAGA 1JQLB 3R5TA 3P0FA 4LOKA 3W4IA 2H63A 1XZKA 1TIPA 1M75A 3CMMA 1OPRA 3T5BA 4MUIA 1IUKA 2WVHA 4KE9A 2IU3A 5TGDA 1U0TA 4JT8A 1COZA 2BBSA 4D9BA 3RH0A 1T2FA 3LLCA 3PGXA 1X7XA 4MHTA 1GTJ1 2W7TA 1V1MA 1KY5A 2BMWA 4AJHA 2A7QA 2P5TB 3BD7A 4BVHA 4E3WA 3BMNB 1QQBA 3O3OB 4LVCA 4OREX 2XCTB 2WTXA 2PKEA 5D5HA 3EVAA 1NBAA 1N3YA 1YBMA 3FZEA 4QPDA 3TEJA 2XI4A 5LQMA 3UJNA 3NAQA 2QNIA 3NIFB 3WQBA 4X60A 5C4MA 4CKXA 1SUFA 1RM0A 4B6JA 4GXRA 2Y99A 4QRDA 5CA0F 1P81A 3EXIA 4Q7LA 5IVDA 2ZUVA 1BA3A 4UEQA 4F8JA 3WQSB 2BTOA 3ED5A 4F4CA 4RPKA 2PUJA 2IE0A 3CR3C 1TCCA 2R6R1 2H2DA 1O1YA 3KEGA 5H8WA 2YV5A 4J8PA 1ODLA 3K92A 5T4HA 2HMUA 2J5BA 2HO5A 1C9EA 2A4KA 1LCIA 4Q4AA 4Z0NA 4LJ8A 1S2IA 3BQNB 4PLCA 3BWBA 3WIUA 4BLRA 3LDUA 5LXTB 4Y2TA 4TSFD 1CQIA 2C9MA 2Q3MA 4TKVB 3I1YA 2VTBB 1E6MA 2QM8A 2V5VA 1QGAA 2PG3A 4DLLA 3QLVA 1C1DB 1N5KA 1RWNA 1XTUA 1PAUA 2R6ZA 2Y1WA 2OFPA 4J0EA 4PONA 4KH1A 2R66A 1NZFA 4OQFA 2ZITA 1CQPA 5ALHA 1DXQA 5IHXA 2X19A 4TQ9A 2YWXA 1QHNA 2E4XA 3AQIA 3P2OA 3PLNA 4GWGA 2YL2A 3NHMA 5E2IA 3TTUA 6YASA 1L5SA 1Y5MA 2P2ZA 1M2OA 4G41A 3WLNA 3P9QA 1HDZA 2WICA 2H5JA 1VHTA 2ZULA 3KV3O 3TZBA 4CLOB 1IXSB 4E5NA 2ISCA 4E1BA 1ZDMA 3BS4A 5HP4A 1RE0A 1T8YA 1VPVA 2G28A 3QBVA 3D6JA 3UA4A 1EESA 1XRQA 3DO8A 1M76A 1QQTA 2JAWA 3EBOA 3IAM1 3KFXA 1JYFA 4IUCS 4U39A 5JZBA 1OH5A 1ZOLA 2XRFA 4MV5A 1NW7A 4DY4A 3VKGA 1F17A 1Y4UA 1H5QA 2AN5A 2LGJA 4J7XA 3BCUA 1V8PA 5EYPA 3IIKA 4AKSA 1F7UA 2CC2A 1TX4B 1AA6A 3ZWDA 2AR9A 2VP2A 4C9BA 4MR7B 3BZUA 3TJMA 2XB4A 5TVKA 4M0LA 4YO7A 2FMKA 4ARBA 3CVVA 1H23A 5ECDA 1ZCJA 3VDQA 1ZMXA 3I3OA 2QTWB 3EIWA 3ZY4A 4BCBA 1JFTA 1KGDA 5DHTA 1GYPA 1J0DA 4N3CA 4EKYA 4LYGA 5BMVB 1BMQA 1US8B 2ZTSA 1STOA 2I71A 3FNFA 4M8SA 4WNYA 5IKOA 3MIIA 4EELA 5KYUB 3BMCB 4AP9A 3LYLA 2IV3A 1EWVA 1QQAA 4XJVA 2QSUA 1HI9A 3P4UA 1DARA 2ZBEA 1MOPA 2FWAA 3SXJA 3WXMA 3TLGB 1MB4A 4U8GA 3UMRA 5J2UB 3WHLA 2WKRA 1NOKA 4I08A 3SQMA 1DTSA 1LPNA 4CM7A 3IBGA 1FVOA 2RAVA 1GZDA 2PRKA 3PNSA 1KQGA 1II8A 4EPYA 2P3QA 4PFQA 3WLQA 1XD9A 4YV1A 1NU6A 4IGEA 2IW3A 1RM4A 3AJRA 3Q11A 3I61A 2W37A 2G8LA 3RSLA 3R7FA 5C46F 3H9QA 1Q7GA 5GM2A 4QU0A 2VDKB 5KNCA 2AG6A 1DAHA 3UANA 5LDDC 4YUYA 2WYOA 3MTAA 5DMHA 1UANA 3ZUGA 1E6EA 2G1KA 3AXSA 4ZCLA 3V80A 3W5JA 1Y9AA 1BKYA 4WCFA 1Y8RA 2EBHX 2C0CA 5DEOA 4CU5A 2FXVA 3F97A 3LV8A 1VBMA 5LOVB 4R7ZA 1Q11A 1AU9A 4R9VA 1XNRB 3FWZA 3HBJA 2HIGA 5D3ZA 1JEYB 4LI3X 4L5JA 5GJCA 4RC9A 4QOJA 2VXOA 3KOXA 1DEKA 2ZTHA 3F46A 3OOEA 3F6EX 4YLEA 3ZK7A 4XJTA 2EAUA 5DI9A 1E64A 4XWYA 1LSOA 1LPOA 2BGMA 2WC1A 2Q4DA 1AF4A 3L46A 3NHLA 3H5TA 5F51A 3ZGNA 1JKMA 2OHHA 3CX8A 4HFRA 3C2QA 4HBGA 4ETNA 1HDYA 3UG6A 3RFXA 1G41A 5FL7D 4IDGA 4DNPA 1ZH4A 2IY8A 3QA3E 4EMUA 4RLHA 2GEBA 2PSJA 2WV9A 1R9NA 1NMEA 2XEXA 4KQ1A 4TTIA 5EWLA 1QK4A 3DDZX 4R0NA 4IS2A 3VYSB 1ZXBA 2X2EA 3QU9A 1CUDA 3PL1A 1IG0A 3LQQA 3DGFC 4GMFA 3L0BA 2HUPA 1E59A 4KYTA 9LDTA 1ESDA 3IDFA 1P2UA 1X86B 1O6BA 4MWSA 2B9EA 4UFOA 1ZOPA 5DBOA 1O0BA 3UAGA 4BO0A 4A73A 4FINA 2XCUA 3ZY6A 4HX5A 2GM3A 4HEJA 1ZIYA 2HDWA 4BRZA 2NYUA 1P5RA 3OIVA 2JVIA 3HJUA 4FSXA 4WWHA 4ZOBA 3TMAA 1J7JA 1KZ4A 1YJAA 4OHZA 2I2WA 3WHKA 3ZDEA 4JI4B 3ZWOA 4C6TB 3GRFA 1EVEA 4DV0B 1JHRA 1XZAA 1DU4A 1I6WA 3E22B 4LFAB 2ANCA 3SBDA 4R9RA 1UMCA 3DOHA 1HV8A 1QF6A 3UMBA 1T6YA 4REQA 4J2OA 1UDBA 2J30A 3MPUA 1SCNE 3H87A 3AEKB 1OXXK 1UJNA 3EXG1 4QLBA 5U9CA 1OFVA 3V1TC 2ERYA 5LNK1 4YDHB 1MA3A 4U5QA 2XWSA 2ZJZA 2BUAA 4X95A 2FX5A 4I81A 1A2BA 1GP2A 1RRMA 2GLTA 5DYYA 2O5VA 1MBZA 5SZKB 1JHUA 3PFNA 2O8DB 4FLMA 2BLNA 3H1EA 3NALA 1QCYA 5JXWA 1ZOIA 3TDMA 1HFWA 1WTCA 5LQNA 4TS4A 1QPBA 3RYFA 2IJGX 2P1ZA 1JHZA 2W2TA 5I6DA 2AN9A 5FI0B 4R98A 4ZANA 3IO5A 1C7IA 1OB2A 3KJIA 2YW9A 2Z8ZA 3I6ZA 5G1PA 1T25A 3WICA 3ZWQA 3T1HB 4LSZA 1WEHA 1T5IA 4OO3A 2NU7A 4L75A 1BROA 1NJSA 2I7DA 3I9FA 3LWBA 4KR3A 3EVBA 1ONSA 3AMVA 5C1PA 1DIAA 2GDZA 5KVAA 1J0EA 1XBTA 1G8SA 2J6IA 3ACCA 3MJHA 3BGOS 3LQYA 3PIRA 1QK3A 3OLQA 1KAHA 3EJ6A 4FQ5A 4GE3A 4G2TA 5TY0A 5HHTA 1U7UA 5HG0A 4YCJA 4F06A 4BTLA 4EG3A 2K2QB 1X6VA 2XE6A 2YBEA 4ZREA 4YGXB 4HLCA 1U02A 3B60A 1DRWA 4LZWA 4IJMA 1QH1B 2W0SA 1XPRA 4MW6A 4DIFA 3GEBA 5BV8A 2W00A 2PJDA 3ANYB 5AI5A 4IDPA 3X1XA 4WN9A 5BW8A 1E9FA 3JQ9A 1X38A 3VI4B 3TLJA 1TVEA 2Q28A 4B09A 4JI2B 2IHVA 2XYVA 1N6PA 4XVHA 3RHFA 3AFGA 4F46A 5EHXA 1YFLA 2JD0A 2CLEB 2ZWAA 4E6PA 1YS9A 2PD3A 3DBVO 2JJYA 4YJDA 2O4UX 3JQAD 4D45A 2X8JA 2ZVPX 4GI5A 2CHEA 2YV2A 3TQIA 1IAQA 3U44B 4UOQA 3LZ6A 3BH0A 4OBXA 4ZCPA 3T54A 1RZRD 2N1BA 5FUYA 1ZMRA 4BFSA 1DKLA 3HXPA 5JSFA 2EIXA 3D4LA 3F5DA 4X41A 5C5CA 4KW7A 4M0EA 1UCFA 3K20A 2JI7A 3OIFA 5IANA 4L07A 2Q1WA 3FZYA 1NURA 4D9IA 1O8BA 3JXEA 3O8DA 3ZS9A 9ATCA 3HXOA 4M0KA 4GR5A 1A2OA 3EFOA 2AUMA 2EQ5A 5GONA 1CLEA 3O4FA 4F4UA 5HQ3B 2VHYA 2X0JA 1P7WA 3ZVMA 1XCJA 5HJ5A 2XVYA 3E23A 1YBHA 4X20B 5KYYA 2XYPA 3GU3A 1Z28A 1P2FA 2VDPB 2D2VA 3G9XA 1AV7A 5HTOA 1JKXA 1GTG1 5LBIA 3QBTA 1EVLA 4QECA 2WWVD 3FAKA 3B3FA 4JB0A 3D54D 4NQRA 1N6IA 3FHOA 3P71T 3OH8A 2XTNA 2C59A 4RCZA 1RJWA 4U6SA 3EMBA 2OV4A 3DZGA 1UINA 4WA7A 1LV7A 1SUAA 4CV3A 4NI5A 4QL3A 2GO7A 4O0LA 5LVAA 1UXKA 4P84A 1V95A 2EARA 2GOYA 1TPYA 1GU0A 1R88A 3BGIA 1S8NA 3HCDA 4RLQA 4D74A 3CVWA 3GUUA 4HWKA 1U5AA 2W43A 3O4IA 4FE7A 1K8ZB 1A8UA 1DDIA 1WF3A 2J5QA 2JB9A 3P0JA 4LRYA 4QJ4A 5I4CA 3EVNA 3AR6A 1L5LA 3ONEA 2HA6A 2X41A 2ONCA 1QOQB 2A3NA 2YQ4A 4HEHA 1T9CA 2RAUA 4IINA 4KXWA 4WLNA 5AMXA 2VCEA 5E6SB 2C2WA 5FP0A 2QM7A 3LPNA 1A9QA 4OV6B 4AIRA 5EIFA 3JAKB 4CR7A 5CLJA 2EX4A 2I4OA 1EFDN 2CYAA 4CXMA 2IYUA 2VHVA 4CM9D 3GYBA 2P41A 3TIXB 4HGRA 4NSNA 3EISA 4OQYA 4OHOA 4PTYA 1NI3A 3WMWA 3O3NB 4UQLA 4YV7A 4UNSA 5LP6F 1JQEA 2AJBA 1H93A 3AY6A 1NJGA 5JS7A 4EO9A 3CH5A 5A5GA 2XWBF 1V4VA 3TLEA 3N6XA 2OCLA 4CU2A 1TZCA 1FDWA 4W7SA 1KTVA 3BXFA 4X63A 2JH9A 2XA1A 3ZU2A 4HB4A 3K2IA 2X7XA 3M6AA 3IRVA 2O06A 5IDWA 3R7AA 2QUJA 5IMSA 5L3QB 4G3XA 3EVFA 1WM1A 3H8WA 3PNBA 3N9IA 1N8KA 1Y7LA 1ZNYA 1G2QA 3U0BA 3QNMA 5LYJB 2Y05A 2W6QA 4GXQA 4N5NA 5FWXA 4F6CA 3WK5A 3LKDA 3OE4A 5AVRA 1XDBA 1I3CA 3E53A 4KXUA 4WKPA 1ZVJA 2AI3A 2XEDA 4LTNA 5CLLA 4M99A 4CQMA 4HO1X 1KDTA 4RS4A 4RPGA 1PZNA 4IDHA 4WIAA 2NVBA 1LI7A 1WBDA 1W36C 2CKMA 1B15A 1U5BB 1XTZA 2A9QA 1W19A 3BE6A 3DMHA 1O3YA 2ZYVX 2JIZA 1YRLA 3FFAA 3MJEA 4G8BA 2GCIA 3UW1A 3RCBA 1X3SA 4PBRA 1IRIA 3TGPA 4LFBB 3JRWA 4H7DA 1DG9A 5AUOB 5HUHA 2JAOA 2ZJ3A 3I45A 2X13A 4D9JA 1CR2A 3LK6A 5FR2A 2FJ0A 2BIFA 3JCZA 4ZZ0A 3GRRA 1Y5NA 1KAGA 1N25A 1PG0A 1VGVA 2X23A 4MAAA 1QYIA 3DOEA 2EP5A 7ADHA 2FDCA 4BATA 2NXWA 4OPMA 4K8RB 2H4JA 2EP7A 1N5JA 1U9JA 4I8DA 4MQFA 3KEQA 5IYZA 1SRQA 2YY7A 5CW2A 3H9JA 3ZDFA 2ZQ5A 3CS3A 4UTVA 1LTHR 5AKJA 5M3BA 5KTNA 1OWLA 2QD4A 1NWHA 2BEKA 1ISMA 1HSZA 4MO9A 2ONKA 2QT0A 2VTDA 1GVNB 5DT9A 4RA6B 3GFQA 4NZMA 3W9YA 1OC4A 2EW2A 2J8ZA 3LBNA 1LI4A 1VM6A 2R00A 4LK2A 3GCXA 5I5EA 3HPRA 2GAAA 3VYVA 4XRRA 2I87A 2ZUDA 3F78A 4EKGA 2JGRA 3C3JA 2HFJA 2H1LA 1AQYA 3KVNA 4RD2A 3WNBA 4YRIA 1A9XA 2X5OA 4JDPA 5IZCC 4O59O 3ZDAA 4GOOD 5DBHX 3IHWA 5L4SA 2FI1A 3PX2A 2YMMA 3EF0A 1MTOA 3DMYA 4NYJQ 4KEAA 3CVOA 4P35A 2F48A 5IJ0B 1NRXA 5CTAA 4DXAA 2GN4A 2NNLD 3ZWNA 4P58A 4CF5A 3JW8A 4G0PA 4K9DA 4PGMA 2DQZA 2FQWA 3T5CA 2IPOA 5BN1A 5CNKA 4B3MB 3OUZA 1NBEA 5JOQA 4MVYA 3C3DA 3G8BA 4L8FA 4L4RA 3BDAA 4F3CA 1ZH2A 3KL4A 4I5IA 2VUHB 3TRFA 4U2EA 2O8FB 4M0MA 4E30A 3T7CA 1ONPA 2QRPA 1IM8A 2W6JA 4LUCA 3I5AA 3RS2A 3ES9A 2YXDA 3GARA 4GOMD 1DDOA 3D7RA 4ZI3A 5FB3A 1LW7A 5DNDA 1QFZA 2W8BB 3BXEA 2ZJ7A 2Z30A 1OCEA 2GYWA 2C84A 5DYTA 1G16A 2AMLA 3AC0A 2IODA 1YRHA 1JPUA 2TYSB 3PEEA 4V1CA 4IDAA 5DHSA 1WD5A 2VQ6A 1L4LA 1R8XA 4R0MA 4JJKA 1JTEA 5L3RA 5IRCD 2CF5A 3UC9A 1XMQB 5JALA 2VJPA 1NBOA 3AIOA 5FPTA 5BY2A 3IAS1 2C3OA 4L7VA 3D5QA 3T1YB 1IL0A 4AKGA 2PT6A 3FPAA 2BFEA 3PFIA 4YR9A 4UPEA 3G0HA 1UFRA 4J7AA 4BJ6A 1VLQA 8LDHA 1ACLA 3QBJA 3VO9A 2PNFA 1XZIA 1V3VA 5HKKA 1IHOA 1JX6A 1VL0A 4QNMA 2IUUA 4XM2A 1XD8A 3EF3A 1ATIA 1U2RA 4TQGA 1NW5A 1E2BA 1YDGA 1QYRA 3TQQA 3VA7A 1IBLB 5A4JA 1CWUA 1NDUA 2XT0A 1N92A 4LRXA 3ZC3A 4CDNA 1E1MA 1MJHA 4TSFA 3QXSA 4FX5A 5JPCA 5AW8A 1DCMA 4RZUA 1W1WA 3DTTA 4DHEA 4K40A 4MJLA 1KKLA 5BSRA 1E69A 2NV6A 3JZIA 1SVNA 4URWR 3R8CA 5I7UA 2A8YA 3DQZA 4BIIA 1RAFA 3KJNA 4ZOLA 2DETA 4HAIA 2V6GA 4GKAA 4UXIA 4EM6A 4V0KA 3P0RA 4KWCA 3AUAA 2W6CX 4ZK2A 3IE0A 1DCKA 1LZKA 3GGGA 2GZ3A 2XYRA 4AAYA 5A3JA 2EX0A 3VR6H 4E2FA 2GZMA 5ALVA 4ZWNA 3C7DB 4PEVA 4AG3A 1E2PA 2JBAB 2RGEA 3CLRC 8ABPA 2J46A 4IP0A 1BVYF 1UPTA 2RKOA 3AL3A 3MCUA 4TT3D 4F97A 3GJ0A 1EB8A 3N75A 1HG0A 3COPA 1RYYA 4MICA 5IEBA 1N3LA 1XI2A 3AM5A 5K99A 1ZEMA 2QSZA 1U31A 5E7QA 2PUAA 3K7EA 3MXTA 4IOLA 1N9KA 3WQRA 3VPSA 3DXYA 4ZT4A 4W7HA 1NBME 3EODA 5I7HA 2QJRA 4V0OA 1LLDA 4IV5A 4B81A 2X14A 4M9SA 3CM0A 3BL8A 4WZAB 4UTNA 1OBCA 3QYFA 4GUDA 4BX3A 1WPXA 3A7EA 4FSHA 2HA2A 1N6LA 2C9DA 3F90A 3M5WA 2DHCA 4DC1A 5JATA 3IVRA 1W76A 1Z8HA 3QLVC 2K4MA 1FNCA 3SMQA 3NWOA 1SCDA 3Q9NA 1NOJA 3E81A 2I6GA 1XTRA 1N7GA 2HRQA 4PR3A 5CVCA 4TL6A 1DG3A 4RUKA 3DZCA 2QG9A 4X1KA 5AHXA 5E3JA 4C7VA 5JR3A 4JWKA 4OHYA 4N48A 5SY9A 4CCAA 3LM8A 1ZUD1 2ODBA 2QIPA 1V11B 4IL5A 1LNSA 5JROA 3TLAA 1ZRHA 2ICAA 2IZOA 2YC4C 3MN1A 5EAIA 3MWEB 3LL4A 3X44A 5JD5A 3HNPA 1Z3CA 5BOSB 3KXLA 5DXAA 3CRMA 3TTVA 1CBUA 1QU3A 1AA9A 2C07A 3S40A 4EYSA 1G21A 2D8AA 2IHTA 3A6KA 4GYKA 4X00A 3NC0C 2NPOA 4MO2A 4EFLA 4KKVA 3PPWA 4Q18A 3DAOA 1Z7GA 4BBJA 1YGYA 4IFIA 4PYLA 5HCIA 3W5VA 1U7DA 1Q77A 1Z6QA 4UAUA 3RBAA 2Y3IA 3DV9A 5DSTA 4KLRA 1KDYA 3TTXA 5BT8A 3S2IA 3IQIX 1DIOB 2XJ4A 4I5FA 3NWEA 4I4IA 4UM9D 5IHPA 5AUPB 1VRWA 3ZE6A 1D5WA 2W6NA 2VP6A 5IF9A 2Z98A 1BVHA 2O54A 5JPIA 3EAFA 4B82A 2GRJA 3HDGA 4JB2A 3OM8A 4ZVUA 3VZSA