2VP2A

Structural studies of nucleoside analog and feedback inhibitor binding to drosophila melanogaster multisubstrate deoxyribonucleoside kinase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
198
structure length
198
Chain Sequence
TKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQRRPQSCKVLVLDADL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DEOXYNUCLEOSIDE KINASE
publication title Structural Studies of Nucleoside Analog and Feedback Inhibitor Binding to Drosophila Melanogaster Multisubstrate Deoxyribonucleoside Kinase.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 72
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 2.7.1.145: Deoxynucleoside kinase.
pdb deposition date 2008-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2vp2A00
2NZ8A 2BV3A 1E2KA 3GCGA 5E95A 1OF1A 1E2JA 4H1UA 4JBXA 4NE2A 4TLAA 1L2TA 5F9HA 3JVVA 1SXJA 2GXUA 3B9QA 2PBRA 2RB4A 2VHJA 1NMYA 1W0KA 3IEUA 2RGBA 4EPXA 2P6NA 5EE3A 1WRBA 4H1VA 4LI0A 3RS5A 4ARZB 4CT4B 1UADA 5FL7A 3RC3A 4OQXA 1N0UA 1ZC3A 3LBNA 4W5HA 2XOKD 1OH6A 4BFYA 2NO6A 5H8WA 4IDQA 2FSGA 1BS1A 1RKBA 2D4HA 4DLRA 2VP5A 1HURA 4JVSB 1RVDA 2KJQA 1W4AA 2VP9A 2JLYA 1NVXQ 1ZM9A 4M2LA 1E6CA 1FP6A 2DFNA 3FKSD 5FTLA 1IJFA 1CR2A 4IDNA 4YXWD 1VKJA 4K81B 5BW8A 4TLEA 2JIZA 2P67A 5B30A 2WTUA 3B1XA 3U6KA 4AYXA 2GKSA 1S0UA 4MKHA 4RD1A 4BLOA 2PLFA 1NN3A 5JHHB 4Q1EA 1ZAKA 3AM1A 2IC5A 2W83A 4MGIR 5LBIA 4EQ6B 2F55A 2YNMA 4Q4AB 2AKYA 3LW8A 3RRZA 1AM4D 1QF9A 1UM8A 2H1LA 2RH5A 2XB2A 3WP1B 2FEMA 1NIPA 2VHQA 3GP8A 4URYR 1TU3A 4MRVA 4GPTA 2CK3D 5KSPA 3QY0A 1Z29A 2VSXA 3RS2A 5J47A 4DCVA 1J99A 2PT7A 4OQLA 3TQFA 4Q7MB 4ZV4A 4MKFA 3RWOA 3P4YA 2B7BA 1XMJA 3CO5A 4GNKA 5IDVA 2BBSA 4FMCF 3AVXA 4MRSA 1TF5A 4QBFA 2EFEB 1TUIA 3X1XA 2IS6A 2XX3A 3P20A 2AWOA 5FTJA 3RS4A 4EJSC 2Q9AA 4PHGA 4O3MA 1T4GA 2ZRIA 4M9ZA 1F6BA 1X8JA 1Q0UA 3CX6A 5HKKD 3ZZUA 1Z63A 3FWYA 2ATVA 2QBYA 1KNQA 3MAAC 4G3XA 3TUZC 2FOLA 2IYLD 5JWHA 2FG5A 3SZRA 4D81A 3CF0A 3IKJA 2O0HA 4V03A 1E1QA 4F4JA 1DBSA 2J87A 1GITA 2ZR0A 3AP1A 5KNBA 5KU1A 4A0RA 4GSYA 2QT0A 3IO5A 3FPAA 5AJWA 2GJKA 3CX7A 2ZI9A 4OYHA 4TL9A 1R7RA 1VCNA 3ZVNA 3K9GA 2PX3A 4PAQA 4L15A 1YR6A 2QENA 4JLMA 1EFUA 3WHLA 2OAQ1 3TR0A 3KXIA 1BMFA 2ORIA 4D82A 1QG2A 3NBYC 3CPHA 4TT3A 3KX2A 2ZXUA 1TQDA 2CHVA 3BXZA 2QTVB 3ADKA 1CJTC 1G20E 3T5DA 1E1RA 1ZIPA 3BIFA 5TXGA 2C96A 5SZHB 1GFIA 2GCNA 4AKGA 1ZCAA 3QENA 4DRZA 3TMKA 3A1UA 2E9SA 2VTKA 3UATA 5JJIA 3U4QB 4MUBA 4F93B 1KY2A 3F8TA 4YONB 4FMDF 1D2EA 2MMGA 3KQKA 5SZIA 4LGMA 5E4FA 2WICA 2X8AA 4DVGA 4Z1MD 5EJEA 1WB9A 3QPUA 4UQOA 4TMVA 2NGRA 1NVUQ 5FUYA 6Q21A 4V0NA 1N2CE 4W5WA 3O8BA 3IQWA 3A1TA 1OYYA 3I1FA 1IN6A 3QXCA 1MO3A 5CYOA 3Q3JB 3V9PA 1JPNA 4MDEA 2JATA 3W8NA 4ZDIA 3HU3A 3V00A 1E3MA 4R7ZA 2CXXA 1JR3E 2YYZA 5JRZA 2W00A 4Z8XA 4UXIA 1SXJC 3PEUA 3UANA 1KZGB 1F48A 1NVVQ 2B8WA 4TYWA 2QPOA 2ZJ8A 2AFHE 4A82A 2QGNA 1E69A 1OKKD 2GTPA 1YZGA 2WZQA 5GJWC 3OFNA 2NO0A 1D2NA 3A1SA 1UBGA 1Z0AA 3C16C 2I3BA 4B3CA 2XAUA 1J70A 1Z6YA 2BC9A 3S1AA 3WNBA 3H2YA 1QHHB 3TSZA 3A8TA 3GMTA 5EP1A 2ZRAA 2F43B 4I4LA 4DLVA 4OBEA 3AGQA 3I72A 4URVR 2HF9A 5JWRA 2IWRA 4OI0A 2JEOA 1AK2A 1Z6AA 4QGAA 2CVHA 2FNAA 1Q1QA 1RPZA 1GL6A 3SJCA 1JR3D 5FPHA 4ASUA 1VECA 1YZLA 3K70B 2J0QA 4A0GA 1XEXB 3RLFA 1YR9A 3FE2A 3MMPA 3EAQA 3FMIA 3LLMA 4FW9A 5UKDA 3RABA 2BHRA 2GJ9A 1S3SA 4CF7A 2F9MA 1R0ZA 2QGZA 3FYHA 4KFTA 4JL8A 1OXTA 5FBRB 1QVRA 3GEEA 1M8PA 1U8YA 1ZUIA 1II8B 1R5BA 3NXSA 2P5SA 4PZZA 2ZR7A 3EXAA 3K0AA 3RS7A 5B2ZA 2GCOB 2W6JA 1OSNA 3OEHD 4QGFA 3KQNA 1R5OA 1W5TA 1F2TA 2N46A 2QTHA 2RMKA 1HV8A 5IRCD 4RD3A 1G17A 1TMKA 3RS3A 2QORA 4X8HA 2J0SA 5A5GA 4KV9A 2P65A 3ZVRA 2OFXA 1S8FA 4TYYA 4BGDA 1B0UA 2VP6A 2L0XA 4US0R 4TSFD 1XFAA 1JB1A 3R8CA 4B3BA 3KQHA 2V3CC 2ZRGA 1KI6A 1RJ9A 1NN5A 1P62B 4C0LA 1Q21A 4U02A 2QMUA 4RFVA 1EX6A 1SVSA 3LX5A 4ILEA 4IDHA 4D80A 4PC7A 3D8BA 3TUJC 3RSLA 3IHWA 3ZGXA 1G64A 1SVLA 3GLHA 1W1WA 1EFRA 1KO5A 4C30A 4LY6A 5G3ZA 4CRWB 1S1MA 5B57C 3MJHA 1NL3A 2OCAA 4MKGA 3HU2A 3B8HA 3DZDA 3NHBA 5AUQA 5AK0A 3TW8B 1WBBA 2XGJA 3TBKA 4QM6A 1NN1A 3L82B 1JBKA 2P6UA 4OQMA 4TYQA 3K70D 5EP4A 1XTQA 4XH9B 3B1ZA 3I73A 3ADBA 2ZROA 4Q01A 1W47A 2RKOA 1ANKA 5EUMA 3L0SA 2CCKA 3THWB 1COWA 2E1RA 3CZQA 4DDWA 2NQ2C 1ZU4A 4A36A 4RD0A 4HAXA 2FF7A 4V0ME 2ZITA 4AIIA 3HYTA 4C3ZA 3QUSA 4DC9A 3GLIB 2XJ4A 4MRRA 2NMVA 1T91A 2BJVA 2Z5FA 1W5SA 1GDDA 1P6XA 3K0CA 1VMAA 1HE1C 3WBJA 4IKEA 4LC0A 3MRSA 4BLRA 1E9CA 2PZFA 4PAMA 2WVJA 1ONBA 1ETUA 1E2FA 2D7DA 3OEEA 2YC4C 2VLIA 2JLSA 4IVRA 3K9LA 4QRHA 2QN6A 3QXHA 4BZQA 4XVQA 1G16A 5LB4A 3JZAA 3QIAA 1LFDB 2J0UA 1KZ7B 2QE7D 3KTAA 4FXPA 5JWOA 1XP8A 4FCTA 4U5XA 4GOJA 4DUGA 4EAQA 1YZQA 3ZIAD 1G8YA 4Q9JA 1XCPA 5J4YA 5LD2B 5AWFC 5CDFE 3QKRB 4ZIRA 1GKUB 4RJLA 4TN1A 2RCNA 3TUIC 4IVPA 2ZANA 3ZYCA 2VBCA 1OJLA 1HE8B 4R98A 2C5LA 3U61B 1WBDA 3BFXA 3GLIE 2BBWA 1E2LA 1SVIA 4RY2A 2H8KA 2IEZA 3R7WA 3FHCB 1E2QA 3THOA 3LWNA 4PTLA 2DR3A 2AK2A 2Z4SA 4R9UC 1US8A 2H16A 2IXEA 4A2WA 4B2PA 5L3QA 4LYHA 3AVTA 2ODEA 3WNDA 4Q4JA 2H92A 2VEDA 2P6RA 4JLPA 3ND9A 3QVUA 4MYHA 3OZXA 3RAPR 1ZNXA 4IDPA 3EZ2A 3SS8A 4ESHA 4MYCA 3HDTA 4E5UA 3SR0A 3TH5A 2JJ2D 3HPRA 4QGHA 3CX8A 4OK3A 1Z06A 4QGGA 4M1SA 4HZUB 4Q9KA 3RHFA 4LPSA 2A3RA 2JLUA 3ZQ6A 4BFTA 5EP2A 1NMZA 1E9FA 3E5HA 3L2OB 1FX0B 1XNJA 2ZI5A 4BLQA 3NHAA 4EFMA 3EPLA 2C9OA 1N0VC 2ZRBA 4LSGA 4OI2A 2ZRFA 3BB3A 4HSEA 3K0SA 3TGPA 2ZI4A 3BORA 1AJEA 2YOHA 5AJVB 1NMXA 1J2JA 1BO6A 3NKVA 1E2IA 2UZ3A 2R6CA 2QZ4A 4N0EA 5DH9A 5BQ5A 1N6HA 3HU1A 4P32A 3BOSA 4UXJA 3THYA 2ZJBA 5EZ5A 4LJ4A 4DLTA 3HJNA 1G7TA 1ZD8A 1CR4A 1OXXK 1KI1A 1NVWQ 2QMHA 1RFLA 2IXGA 1XTRA 1D9ZA 1OHHA 2QUZA 3DKVA 2O8BB 2PEYA 3LRPA 2R6AA 4DSTA 1KK1A 3WMFA 5CM8B 1T8UA 2OBMA 1DTSA 2OLJA 3EZ9A 2PLRA 1EWQA 3U3OA 1UKYA 2BM1A 5EE0A 3SJBA 2A5JA 1G8FA 4HUQB 1QHXA 2HXSA 4ZCIA 1LF0A 1F2UB 2HLDD 3BAFA 3QPVA 3I3SR 4MGYR 4YMVA 1E9AA 2KBFA 3VR6A 2WIAA 1Q20A 5G40A 2HV8A 1NI3A 1JAIA 1N5KA 2O8FB 2YOGA 1TU4A 2FSIA 4DLSA 1H8HA 4HAUA 5FPSA 1NSFA 3TAUA 5CM9C 2JLWA 3DEFA 2A5YB 1FZQA 4LYFA 1GIAA 5DYIA 3G82C 3U3RA 3T1TA 1TNDA 4MDFA 3RYTC 2A5FA 1G4UR 2WMOB 1P5ZB 2EFGA 2CE2X 2ZJOA 4KXFB 1AZTA 2HYDA 3NBFA 2IXFA 2ZS9A 4Q48A 1RW4A 2P5TB 3K0CC 4XSGA 4C0HA 2GCPA 4DBLC 1G3UA 5AUPB 3THXA 4A6XA 1U9IA 2QAGA 2GBLA 2OT3B 5CB6A 4J0QA 3O8RA 4MQBA 3SBDA 4QFMA 3BB4A 2R8RA 2XEXA 4P0TA 5F98A 4A4DA 1YKSA 2XB4A 4QBGB 4A8JA 3MWJA 3ONWA 1G18A 2DWQA 3BRWD 4OL0A 3VNVA 1DE0A 2H57A 3C7KA 4NONA 1R0WA 1E79A 1OFHA 3KQUA 2WJYA 3M4YA 4WA7A 5L8VA 1DELA 1JQJC 3EIEA 2HCJB 4Q7KA 1AA9A 2V9PA 1DAKA 5KDOA 2EWWA 4O0MA 3A36A 3MCAA 1MV5A 5FPKA 5L3VA 1W2GA 2P3SA 1W49A 2O8EA 4W5JA 3SYLA 5JEDA 1Z0FA 2E87A 3SI7A 1BH2A 3LV8A 2BCGY 2IYRA 2N1BA 1GNQA 2Y8EA 2HCBA 3B1WA 4C7OB 5FOWA 1UKZA 2FGJA 4KCGA 3RANA 1A4RA 3MSXA 1GL7A 4B3FX 2IBMA 1R10A 1JEEA 3AF2A 2OCPA 2WWWA 1OIVA 3B13B 4FI3C 3NWJA 1RRFA 2AXPA 2OSBA 1YZTA 3GQBA 4Q47A 4D25A 3PG5A 1P2SA 3ZD7A 4UNPA 3CBQA 4N3NA 3A6PC 1P60A 4IVQA 5C2JB 1HY3A 3WXMA 1AIPA 3VR5A 2YV5A 2R44A 4ZDKA 3VX3A 3EZFA 2DFTA 4X8MA 4NHOA 4NYMR 2VP0A 5KYKA 1KI3A 5KNDA 1PLKA 4B71A 4PQRA 3CH4B 3U7EB 4M22A 2GEUA 4C0KA 2ONKA 1WP9A 1JJ7A 1YJ5A 3QJYA 3U5ZB 1XF9A 1CBUA 5JS7A 2YKGA 4E07A 4LJYA 1FMJA 5JCZA 4XWKA 5C1BA 3R20A 4KFUA 3AGPA 2V7QA 5HTKA 5J5CA 1X1SA 5CIQA 4NCHA 4I99A 3TVDA 5KPJA 4RZUA 1YRBA 1IHUA 1II9A 2IT1A 1CF4A 3O8CA 3ETLA 1Z5ZA 1E0JA 3DM5A 3CKLA 2CJWB 4YC7A 2BMDA 4A15A 5AR1A 3NBZC 2D3WA 1OW3B 4ZI2A 4JIMA 3TW4A 4LBVA 4JSYA 3K0FB 2BOVA 1E2GA 2JLVA 5HKKA 4IOMA 3NIBA 2GZHA 3Q5DA 5FOTA 1E9DA 4KO8A 1IM2A 1FL9A 3OESA 1CJVC 4DLWA 1VG0B 4LUCA 4RZXA 4EFLA 2IYSA 3K1JA 3QI2A 3X1YA 3LQQA 4ARZA 1SGWA 1E96A 3GLFB 2OXCA 2X2FA 3QXXA 3IUYA 4AK9A 2ZS8A 1D6JA 1OFIA 3ASYA 4JL5A 2PX0A 4JJKA 2BIFA 2G6BA 2J41A 4DB4A 4KYIB 4NYIR 2WSSD 3KKOA 5DO9A 3SJAA 3X1ZA 1B23P 2QEQA 2AK3A 2W6ID 4JVNA 1ZINA 1XTKA 3BK7A 1P9RA 2VQSA 1L7VC 4LHXA 4TTPA 3ZS9A 4A2QA 4O2RA 2CLDX 1E0AA 1R8SA 5KNCA 4I1OA 2PCLA 2FJUA 2VHTA 4I1VA 3T1VA 1SKQA 4DEYA 1A2KC 2NO1A 2I4IA 1TAGA 4IEIA 3LVRE 4CIDA 4ZO4A 1SZPA 4EQ6A 4XD7D 2OEPA 1OV4A 1Z22A 3GJ8A 1IXSB 4Q4AA 4NH0A 4PZYA 1R0YA 1Z07A 3TJZA 4KITB 2JLXA 1BIFA 1UBCA 1T9HA 1W0JD 3KUCA 3Q5EA 1U9IC 4GMDA 1KDRA 1L4YA 2Q3MA 2GBLC 1W7AA 2ANCA 4ACBA 2PH1A 3GLFE 3CRQA 1E9EA 1AKYA 1XEWX 1GRNA 4RCZA 4PQYA 2C03A 2IYYA 4UJ5A 4B34A 5JBQA 2IYXA 2J3EA 3SC3A 3I92A 3NDPA 2Z6VA 4Q1CA 5EXPA 3KJHA 1UEIA 4HDOB 1VPLA 5IHPA 1I2MA 3OAAA 3LAWA 5FI0B 2BVNA 1XPOA 1HQCA 3H0KA 4II7A 4DIDA 2J7PD 2QPTA 4DWJA 1W44A 3O8DA 1Z0JA 3CR7A 1KIMA 1W4RA 3GLGA 3CPEA 1OKKA 1ELOA 1TEVA 1JXMA 2IA5A 2PMKA 2GILA 1DG1G 2UVQA 5DI9A 1N5LA 1E2DA 2IYTA 1TX4B 3BWDD 3G0HA 3DL0A 3SQWA 1XCGB 3AQ4A 5LDDC 2ERYA 3CONA 4F4IA 2R65A 4QL3A 1R0XA 5L3RA 2GZDA 2H18A 2WKPA 1P2VA 1VYVA 1SHKA 3EC2A 5FPTA 1CKEA 1ZMXA 3IIKA 4M0LA 4NTZA 5IF9A 1ZM3A 1ZP6A 3MWLA 4RKFA 3FVQA 1I4DD 4Y0AA 4EJSB 1KO8A 4JLVA 3GJ5A 1LNZA 4Q4LA 4EUNA 4B3DA 2WJGA 4NCKA 4BRUA 2A30A 2FEOA 5A4JA 2B92A 1DOAA 2C04A 4A2PA 3LH5A 2XNDA 1U8ZA 4LC1A 3IILA 3D3QA 2BEKA 3Q7PA 2MSDB 3SQXA 2YWEA 1A5TA 4DSUA 1T6NA 1E9SA 3U4QA 3AKDA 1XD8A 4CEHB 1JECA 1W4BA 1V43A 2KB0A 1GKYA 4FCWA 4M9QA 2QMEA 4R71A 3FHOA 3OE7D 3DVLA 1I2DA 4TL6A 3QKUA 1VHTA 4HAWA 2JJ8A 1N5IA 2VRWA 1G3MA 5K8IA 4LBYA 3PVSA 2BMFA 2EWVA 2ERXA 1SQ5A 3AF0A 3KKQA 2NOAA 4Q5IA 4W7SA 1Z28A 2MSEB 2AR7A 4TSFA 3RNLA 2QT1A 2FPKA 3J81k 3OF5A 1OH5A 4CYMA 4W9MC 3NTUA 4C2UA 5EP3A 2OFOA 3EC1A 2ZJ2A 1MT0A 2PEZA 4DDVA 3ECCA 2K5UA 1XJQA 3E70C 4PO9A 4BFWA 3AB3A 5JI3E 1G7SA 2PCJA 1T5LA 3FTQA 2WBLC 3M0EA 4FMCB 3UG7A 4BFVA 4CGZA 1G8PA 2JJ1D 1KI8A 1NLFA 2GEDA 4QJ3A 4F4CA 2RGDA 1XXHB 1G9XA 3U7GA 4GZMA 1E2EA 4YDHB 2CNWD 2O0JA 2X2EA 1T3SA 2F43A 2PT5A 4JYBA 2V1XA 3TKLA 4DB2A 3VR2A 5LPNA 5HZKA 4ESVA 5DI3B 2HUPA 4I1SA 3AVYA 2J46A 1O87A 3CH5A 4UJ3A 2B7CA 1TEXA 2KBEA 2J0VA 1XEXA 1NG1A 4N0DA 4NZYA 1KAGA 1CJKC 2ZREA 2AWNA 1CU1A 2IL1A 5FOUA 5P21A 4PPFA 4B48A 5IK2A 1VHLA 2XSZA 1TADA 3H86A 2BCJQ 5FOSA 4DSNA 1M7HA 3B9PA 1G21E 1Z6GA 4HEJA 4PC6A 3ZD6A 3EPHA 3LD9A 2MSCB 4C2TA 1II8A 2AFIE 4WW0A 1N0WA 1UBFA 3OIVA 3VU9B 1RRCA 4ABYA 4H9GA 1OB2A 1N6KA 2GCOA 2DWPA 3PUVA 1XXHE 4NYJR 4M21A 3OIWA 3KKNA 2IUSA 4GP7A 2OCYC 1ZU5A 2ZRDA 5K8LA 1AQUA 2QP4A 1R8QA 5DN6D 3SYKA 4KVAA 1G8HA 3LBIA 4CEIB 2MMCA 2ZE6A 2NZJA 1SXJE 2XTZA 4JLNA 4MA4A 1NP6A 2QE7A 3KB2A 4FMDB 5FOXA 1XTIA 2XNSA 4DDTA 1G6HA 3EX7C 1M2OB 2PZGA 3LBHA 2EVWX 1NSTA 3OIUA 3DOFA 3TAHA 1NY5A 4FMBB 4A92A 2W0SA 4V0MA 3QG1A 4EPTA 5JLJA 4NYMQ 3TR5A 4HLDA 5KDLA 2CHQA 4HAVA 4GBMA 4TL8A 4QOSA 2ZM5A 3I61A 3FHTA 4FWIB 1ZD9A 3IBYA 4ZDJA 1G4AE 1DAGA 1YZKA 5L3SB 2ZVQX 5M04A 1IN4A 2YHSA 1KSFX 1T5IA 1W36C 1WA5A 2FU5C 1KO1A 1F5NA 2LWIA 4JBYA 4Q9HA 1NIJA 2R6DA 2ZETA 3RRMA 2X1VA 3GPLA 1LS6A 2IWHA 2OFWA 1SXJD 5BWMA 2WJJA 5DHFA 1W0KD 3RRYA 2JJ2A 3UMSA 2YC2C 1G5RA 2X19A 4MITA 4PX9A 4BECA 2WWIA 1E99A 5FL7D 2C99A 3THWA 2KWIA 2GK6A 2ZE5A 5GJBA 2CLSA 3KDSE 1Q57A 1ZW6A 4XTCS 2WJHA 3MJRA 1DADA 4IFBA 1P7CA 3LNCA 3AVUA 3GEHA 3P27A 4JLKA 2J59A 4L9SA 4OK5A 2YWGA 2J9RA 4RZ2A 4WIAA 2ZI6A 1SKYE 2JIZD 1NBMA 1HQYE 4BWYA 5J40A 4HB4A 3EARA 4YDSA 1ZD1A 2XJ9A 4NYIQ 1NKTA 3AVPA 3X1DA 1JR6A 4WXRA 1UFQA 2I1VB 4EPRA 4DDUA 1BOFA 1FUKA 2UKDA 4E09A 1TTTA 2IYWA 4WVFA 4QNRA 4QM7A 3DDCA 3N70A 5GJCA 2OHFA 1JXOA 3DO6A 3H84A 4M8NE 2HYIC 3SE0A 5KO2A 2GHIA 2F7SA 4MRPA 2HDNB 4PO1A 1U8AA 2ZRHA 3QKRA 4KU4A 2H17A 3BFVA 2GK7A 3SN6A 1OFUX 3IDQA 3QXSA 1QVAA 4LCBA 5IT5A 4BFSA 4S2EA 4IJMA 2KE5A 2XTMA 1XU4A 3W6NA 1KSHA 2ZSBA 2DYKA 3JZMA 2VP4A 3PITA 5EUQB 2A7QA 5H1YA 2G9NA 1RZ3A 4TWZA 3QF7A 4CZ2A 2W2XA 1AZSC 4C0BA 4R2IA 2QMOA 2GRJA 4ERNA 3A1VA 3D31A 5H68A 1N6NA 4Q21A 4Z54A 1WDTA 1ZM7A 3BE4A 1E2HA 1FNNA 1XX6A 4KFSA 5D3MB 4LK2A 1FW6A 1ZNZA 1Q1EA 2O8DB 3AF4A 2UZIR 1DO2A 1U2RA 2FE4A 4G5QA 4HZUA 3NVAA 2GNOA 2Q6TA 3AVQA 3ZDQA 5EXXA 2IUTA 2AD5A 3M6AA 3ND8A 3QEOA 1G19A 4G5RA 1FPMA 2QQEA 5KHOC 4P3YA 1BMFD 3Q8XB 3BH0A 5JSZB 4TT3D 1NG9A 4GMXA 3PEVA 1KK2A 3B60A 4Z8YA 4F91B 2WWHA 3BBPA 5C4MA 1TQ4A 1M6NA 2FZ4A 3TSWA 2WAYA 4TZ0A 1E1RD 1G3QA 1UF9A 3WYAA 5TMPA 4U7DA 2RGEA 4GI7A 4GRAA 4QJ4A 5G3YA 1R5NA 3CRMA 3UXMA 4Q4HB 3TNFA 3KFXA 3UK6A 3T61A 4AWXA 4TYNA 1Q22A 1Z2CA 1JJVA 3SEAA 3W3ZB 4PHHA 1GUAA 1IAQA 1RRGA 2R6FA 3MD0A 4LPKA 4WZAE 4OJKA 5LB2A 2V8OA 3L8YA 4JLBA 2O8BA 1H8ED 3NH6A 3NEJA 2CBZA 5CB8A 1RE0A 2XTNA 4Q19A 1RYFA 1DPFA 3NC0C 1N25A 4OQNA 2CE7A 2IS2A 3WY9A 3K09A 4Q1BA 1RYHA 4HUQA 5FBQB 4PC2A 4QNMA 1F2UA 4HYYA 3FOZA 1MKYA 1Y63A 1CR1A 1G291 221PA 1CP2A 1D2MA 4LJ8A 1Q1BA 2IYQA 2O8FA 3RDPA 3VR1A 3EPKA 1KI6B 3EWAA 2VSFA 1M74A 1JAHA 3CRVA 2A2ZA 3AP2A 3VKGA 1CEEA 1IN8A 1NJGA 2FFHA 2YVUA 1MABA 4B33A 4AURA 5SZKB 4X8OA 4DJTA 2FFBA 3UMRA 3N2IA 1H65A 3OIYA 2FSHA 2DBYA 3SNHA 2VSOA 4B76A 5JFGA 4KYUA 4D26A 2DFKB 1QHSA 1YQTA 1QRAA 1D9XA 2GA8A 2KSQA 4HDQB 2F3TA 3U2QA 3AUYA 4G01B 4TLBA 2REOA 1BYUA 1XZPA 4NPHA 3LFUA 3QSYA 2ZRMA 2P2LA 821PA 2ZIAA 1QHGA 5E7MA 4BZPA 3GEIA 4PSAA 2D06A 4TQAA 2VHCA 4L9WA 3T1OA 4OHXA 4Q7JB 2D7CA 4G5SA 3U44A 3PJRA 1HTWA 3AUXA 2NPFA 4PFSA 1VDZA 1ZNWA 2C2HA 1X86B 3LDAA 3QBTA 4BQSA 1KYIA 1X8LA 3QNUA 1GNPA 5BN4A 4UXHA 2F1JA 8OHMA 4EDHA 1JQLB 1T3LA 1KNXA 2WJVA 4JLOA 1P3JA 3EIHA 4YMWA 3GFTA 2RGCA 5F3WB 4C7OA 4C0QC 2JDID 2WSSA 1XBTA 2V54A 4ZDWA 1YRAA 2QNRA 4ON9A 1EWRA 4BFUA 2W6IA 4FIDA 4RD6A 2QAJA 4PXAA 4TTQA 1YZUA 1GVNB 3M1IA 4NYJQ 1HYQA 1N6RA 4OI4A 3KTAB 4LBWA 1XCMA 4GFDA 1Z0KA 2CL0X 3QKSB 1U94A 5F2EA 5KDDA 2XZLA 1KKMA 3U7HB 2ECKA 2Z43A 5HCIA 3PEWA 4XD7A 4P31A 3IEVA 1FQJA 3ADDA 3FFAA 2O8CB 3RVBA 2QSZA 3DOEA 4PC3A 1DVRA 2F1HA 2WV9A 4TTRA 4HLUA 4D4JA 5GADl 2BM0A 2FSFA 2Z0MA 2PZEA 2ZRPA 3BB1A 1N6OA 1EFRD 1P72A 3CF2A 2F3RA 1LTQA 2ZYWX 5TY0A 3WRXC 4GDFA 1S4QA 1Z0IA 1PLJA 2ZS7A 1US8B 3QPWA 2ZAOA 4M1OA 4TZ6A 3VAAA 3LXRA 3AEZA 3WBKA 4M4SA 2ANBA 4US1R 3IPYA 5F9FA 2EYQA 2D62A 4K8OA 4D4KA 3LQRA 4F38A 1GP2A 2J7PA 1NKSA 2CJWA 3DMDA 3PV0A 3V4FA 3VX4A 2RGNA 2AN9A 521PA 2A5DA 4URUR 1MOZA 3AV0B 2DY1A 1WXQA 1NF3A 4IOLA 2GETA 3UPUA 2HEIA 3P4XA 1IY2A 3L43A 4IXMA 2OM2A 4NDZA 4AYWA 2Q3HA 3MUFA 721PA 4PO8A 2IEYA 4Q7LA 1VYTA 1II0A 1U81A 4RFSB 3GLFA 4HATA 3IIJA 1OH7A 3ZS8A 5FUVA 2XOKA 4ACAA 2QA5A 5EZ6B 1S9HA 1UPTA 1WQ1R 3OEED 1E2MA 1DG3A 2D74A 2OBLA 1MRSA 2CMKA 2ZUDA 4Q9IA 4Q9LA 3TLXA 1PUIA 2H5EA 3R9IA 3FKSA 1Z3IX 2FGKA 4IHQA 1G5TA 5JECA 4YXWA 1GNRA 1KMHB 2ZVPX 3FKQA 3OHMA 1DARA 5DLQC 3PUYA 1XMVA 1PZNA 4DUGD 1SVOA 1OIXA 3HPQA 3LW7A 1XD2B 4PZLA 2EFHB 3T06B 2C9CA 1U0HC 5FR1A 1GG2A 1V5WA 1GTVA 3RS0A 2R6GA 3MG9A 2G3YA 2AHOA 3K0EA 2VYFA 1JNYA 4UNSA 3SOPA 3SFVA 2IF2A 2WOOA 5C4GB 4DCSA 1A1VA 5B64A 2GXSA 1YU9A 3PQCA 4P4SB 3ASZA 4AG6A 2CK3A 4TMKA 1MO6A 4G1UC 4CEJB 3CNOA 1WCV1 4A1FA 4OJQA 4BE7B 3OE7A 2ZTSA 4IW3B 1Q12A 4OHVA 1W4CA 2JGNA 2NTYC 5DGXA 2ZRNA 1VG1A 1M34E 2KI5A 1CRQA 4LOAA 2HT1A 4LYJA 2LCFA 1KSGA 1XJCA 2JAQA 1KTVA 1DAEA 3V4RA 2LKCA 4PSVA 3QKTA 3CRW1 4PSKA 2FFQA 2QP9X 3SU8A 1K5GA 1KI9A 1AS3A 1C1YA 2IHYA 2QY9A 5TVKA 3VHLB 3W5IA 3W8RA 4C0JA 3THXB 4OQFA 3LO5A 3VR4A 4QHSA 2P0EA 4POAA 2DCUA 4KBGA 4F7WA 5J4KA 5DYGA 3W34A 1DEKA 3GFOA 1K5DA 5KSYA 2G0TA 2CNWA 5FH9A 2WM9B 3U3MA 4RZ3A 3C5CA 3IGFA 3KKMA 4TMXA 1W2HA 2C78A 1A82A 2ZU0C 3VNUA 4HB3A 2DWOA 3UWOA 1GM5A 2WWGA 2WWYA 2C98A 2V55B 4HDCA 3SHFA 1CJMA 1T3HA 1TF2A 4M1YA 1VYUA 1ZIOA 3ZJYA 1X1RA 2AKAB 3PENA 4EJSA 3UIEA 1TUEA 1KDPA 3C15C 3FFBA 2EU8A 4LJ7A 4TLCA 5FI1B 3R7WB 2IF0A 2OESA 2OLKA 2FN4A 1FTSA 1P2TA 3GD7A 3HP1A 4HLUC 2G0NA 1G7RA 2R62A 1DAFA 4DCUA 3L0OA 5CYPA 3O47A 5BN5A 1KMQA 4MYUA 2ZJZA 3PUZA 1UKEA 5KOYA 1QZXA 3DHWC 3TRFA 1Q44A 2QAGC 4CEHA 1OB5A 2G83A 4AI6A 3AKCA 3KUDA 2V6IA 2IUUA 1QHIA 4Z1MA 3U6BA 2HJGA 3QBVA 4DLUA 3AH8A 3CLVA 1OLOA 5CLLA 1ZVQA 1JPJA 2ZYUX 2WWXA 4A8JC 3FB4A 1UBEA 4MYTA 1QHYA 4CW7A 5BYKA 4QBHA 4LJAA 1D8TA 2GJAA 4DCNA 3CNNA 2BEJA 3KZ1E 2ATXA 1CR0A 5H70A 4RKEA 1NN0A 2F6RA 4BFXA 4GL2A 2CL7X 1NY6A 2EW1A 4MGKR 1L4UA 1WMSA 2GF0A 1OT3A 5K8TA 4B3XA 4TMTA 2WJIA 3R9XA 2REBA 1S2MA 4M9SA 1P9WA 1Z8FA 4YMSA 2IS1A 1DO0A 1JEDA 2ORVA 1P9NA 4PPGA 1HT1E 1OIWA 2Q9CA 5AUNB 1XXHA 3KXLA 3ICEA 3AKEA 1SULA 3K53A 1J8MF 1G41A 2PMDA 2ZI7A 3PR1A 4GP6A 4WAUA 5DE3A 4Q1AA 2O5VA 1G7CA 3A4LA 1E94E 5DI3A 4M1KA 1E79D 3I8SA 1QBKC 2JLQA 1LY1A 2QROA 3B78A 1QG4A 1C4OA 1AS0A 2IHBA 2WOJA 3IPXA 5JS8A 3PIRA 2W2TA 2ZPTX 3T34A 1JR3A 3IQXA 2IW3A 1N6PA 5FTNA 1YR8A 2X77A 4ZI3A 2CEAA 5SZJA 1S3GA 2NG1A 4PANA 5DSZA 1M7GA 2OG2A 3EASA 3UG6A 3Q72A 4QG7A 1FFHA 3SHWA 3ZQJA 4XSHA 1VCMA 4B3GA 4PPNA 3ZLJA 5KSZA 2W2VA 3GJ6A 2GJ8A 3C4JA 3X1WA 4EPWA 5EQTA 1IN5A 2WPDD 5DHAA 121PA 4LJ6A 2GAAA 3VFDA 2W0MA 4WOPA 4HLCA 4RCYA 1Z6XA 4FD2A 3VU9A 4PC1A 3QF4B 3CPJB 2NIPA 4NCJA 1XJ0A 2GEVA 1N6IA 1T0HB 2YWHA 1YVDA 2FH5B 3MWYW 3OEHA 4LBZA 3REGA 1LV7A 1Z83A 4LHZA 1ZRHA 4JT4A 3WYGA 5G53C 1FQKA 2XXAB 1XMIA 1SVWA 5DISB 1UDWA 4FINA 5CJPA 3TK1A 3AVOA 4TQUS 1EXMA 4DIEA 4CEIA 3LY5A 2VIIA 4LHVA 4BPBA 4DT1B 1UDXA 3FDIA 3IHLA 4HB0A 4B47A 3W6OA 1O3YA 3AVWA 2QRZA 1GAJA 2ZRLA 3PXGA 1FMLA 2ZSFA 4G5GA 2PJZA 1ZJ6A 4OI1A 4D4LA 1IQPA 2OO7A 5JCPA 3FMPB 2IYUA 3CR8A 2V7QD 3QG5A 4AY2A 3Q85A 4C9BA 1TPZA 5JEEA 4B6EA 4OHWA 1FNMA 1K8RA 1UJ2A 1LF5A 4PR0A 1T0JB 2WAXA 1QHHA 4E03A 1SVMA 2QQ0A 4HZIA 4ITRC 5L3SA 4DKXA 3BC1A 4PHFA 3VTKA 3ADCA 3W6PA 4Z51A 2ZRKA 4BLSA 3CM0A 4C0SA 1X6VA 2QU8A 5FBWB 2ORWA 2V1UA 1TL7C 2B6HA 4QHTA 3GLGB 1GWNA 4B6FA 2JLRA 1Q1ZA 2A78A 2FX3A 1F3OA 4V0KA 4NL4H 1SXJB 2ZYVX 1YE8A 1MO5A 2N42A 1IONA 1KK3A 3KB1A 3BH7A 1J8YF 3LX8A 5BN3A 2OZEA 1XZQA 4NU0A 1XTSA 2EFDB 2GDJA 4GT1A 4LYAA 3UWKA 4KBFA 4B43A 3BH6A 1DAMA 1CTQA 4O2LA 5TB5A 4YLGA 3I62A 3LLUA 4EIWA 2BWJA 3I32A 4HUTA 4Q02A 4TLDA 2JA1A 2DFLA 4P33A 1HA3A 5FL3A 1CULC 3TE6A 1W36B 5FTMA 3LA6A 1M7BA 3W9YA 5AUOB 4BLPA 5FFMA 4EKDA 3C14C 4XWOA 2PJRA 1A2BA 2CCJA 1EX7A 5JJKA 3GLGE 4D2IA 2J5XA 5J4VA 1MRNA 5JHGB 1PVOA 3VKHA 1KO7A 1HH4A 5FPYA 3TIFA 1CLUA 1Y3AA 2QPAA 2ZSEA 3QOFA 4QXAA 5AJYA 3MFYA 3LXXA 1H8EA 1R6BX 4JMPA 3ZIAA 2C8VA 4L4UA 2G1JA 2ODWA 3B7GA 4OK6A 3BS4A 2JLZA 3ICQB 2LKDA 5BXQC 2OUKA 1KAOA 4NP6A 1L8QA 1I4LD 3OAAD 1VTKA 3WRYC 3UKDA 1U0JA 3GJ0A 1P73A 4D6PA 4LHWA 1SKYB 2RAPA 2I1QA 2VF8A 1RC8A 4B32A 3P32A 1U90A 3U7FB 3DPUA 4Y0VA 4FN5A 3MGCA 1PJRA 2XZPA 4HI0E 4RD4A 3AP3A 3I5XA 4D4MA 1OXVA 2H7VA 3QXJA 2QBYB 5E7IA 2RGGA 4XOIA 1XEFA 4B74A 4S35A 5D3MA 4O25A 3HR8A 2O8DA 1OPXA 3Q7QA 2QRNA 3CNLA 4FWTA 4OHYA 2D2EA 1S9DA 3VKWA 4B44A 5CDFA 1ESMA 2RGAA 3DM9B 1SHZA 1ZM4A 4B73A 3SFZA 4AKHA 1A7JA 1X8KA 4N1AA 3BGWA 3GLIA 3MLEA 4F92B 1GL9B 4TMZA 1TF7A 3T1QA 1G6OA 5CIWA 3DZ8A 5JSZA 3G5UA 3NG1A 4U00A 1W36D 4WBSA 5C18A 5TV2A 4Q00A 1IXRC 4BLTA 1DAIA 1Q3HA 3RSOA 4YMUA 2NO7A 5EE1A 1ESNA 1IN7A 3BD9A 2XNDD 4NKRA 1N6LA 5G41A 4Q4HA 1E98A 4PAOA 3ZZTA 4P4TA 4AYTA 2V4ZA 1EFCA 4I1UA 4JKYA 4MKIA 5JZVA 5TARA 1KJYA 421PA 3TQCA 2A5GA 5KUTA 4LJ9A 3EZ6A 5AJZA 4JL6A 2VP2A 3IO3A 3VR3A 5KPDA 4LRWA 2YINC 2WIBA 3EZ7A 2ZEJA 3W5JA 5JI2E 2ONJA 4Q66C 4M1TA 2JDIA 1E0KA 4KAXA 5FBLB 3U60B 2AXNA 5J4LA 2HLDA 2ZR9A 3I5YA 4JS0A 2CHGA 5HE8A 5BYJA 1GKIA 5EE9A 1E4YA 3K70C 4MGZR 4M1WA 4XTRA 1DS6A 1VCIA 5JMTA 1ZUNB 3C5HA 3NBXX 3T5GA 3TSOA 2GJSA 2XZOA 5D3QA 4LX0A 3ZVMA 2ZRCA 3RC8A 2C95A 4AG5A 4DXAA 3AKYA 3BFKA 4Q1DA 4NMMA 4D0LB 1OH8A 2ZYTX 2WKRA 3T15A 3SBEA 4XVUA 3S1AB 1E1QD 3EPJA 4A0FA 5C46F 4A0HA 5J4HA 2CLCX 5GVRA 2BKUA 3IBGA 4DEXA 3TVTA 5FBVB 2FPMA 2R2AA 1OE0A 1FX0A 1S1CA 2ZJ5A 3K9NA 1CJUC 2CCGA 5CK5A 3DKPA 2YJTD 3QVVA 3RRNA 3UMFA 4Q18A 4V0LA 1R4AA 4V02A 3W3AA 3BERA 5FOVA 4WZ6A 3NC1C 3N2EA 1LVGA 4QKQA 1XTJA 3HWSA 2IK8A 1NJFA 4ZCLA 5HR5A 5IK2D 1XDBA 4JYCA 2XSZD 1XPUA 2IYVA 3PCRB 1JALA 1T8TA 2GWHA 4TYPA 4JLDA 2JASA 4LV5B 3D6TB 3H4MA 2BJWA 4YMTA 1XD9A 2Q9BA 3WYFA 3R8FA 4JJZA 2C9YA 3GJ7A 1EK0A 1E0SA 5AJXA 3FGNA 3K0AB 2G1KA 4HAYA 4AC9A 3CRRA 1S96A 1IBRA 2F1IA 3MWKA 4G0NA 2AX4A 4BEBA 3KXKA 2ASEA 5CITA 5GVSA 1F2TB 2RHDA 1NLZA 1GRQA 1Z6TA 4EFNA 2IS4A 3F3YA 2VH5R 3U3KA 3NH9A 1AGPA 2DPXA 5E7JA 1G8GA 4L5BA 1C9KA 2VO1A 4BRWA 1NLYA 3B2EA 1NRJB 2FFAA 4KSBA 4I81A 1XMSA 3I4LA 3B85A 1R2QA 4KODA 3GFPA 2ZE7A 3QKSA 3KJIA 1RJ9B 2OILA 2OCBA 2GVZC 3OFND 4QHYA 2ZRJA 3BJIC 1PUJA 1Z08A 4JZKA 2ZAMA 5HZHA 3EWSA 2O8CA 2XITA 1HUQA 2VPPA 1IY1A 3ZVLA 4M53A 3GLHB 4UNRA 1PV4A 3QE0A 1KSJA 2R9VA 3CIOA 2ZI3A 1NBME 2Z4RA 5HE9A 3SDZA 2BKEA 1KI2A 4LHYA 2J45A 1M1YE 3B6EA 1WE2A 1VCOA 2SHKA 4ASUD 1NNEA 1PLLA 2J1LA 3GJ3A 3R9WA 1ZNYA 5A0FA 2ZUCA 1FUUA 2WSMA 3KJEA 3QQ5A 4V0OA 4DZZA 2GESA 3ZH9B 3VQTA 5EE5B 5ELXA 2F1RA 2GVDC 3I8XA 2BBOA 1Z2AA 2FDCA 2RHMA 3CWZA 1W48A 5ANRB 3N5CA 5LD2C 1KGDA 4IEEA 2F9LA 1ZYUA 4P4UA 1P2UA 3PUWA 4PPQA 4AKIA 2NO9A 3A58B 4R2HA 1KHTA 2W6JD 1AKEA 1QHNA 3GLHE 4RFSA 1AN0A 4LV8B 1TQ2A 1NBMD 1G5PA 2ZE8A 1ZC4A 3Q9LA 2WKQA 5FR2A 2QI9C 3C41J 1EG7A 2Q21A 4WXPA 3X2SA 4AKEA 4GOXA 1EFTA 5KTYA 1P4SA 4B75A 4GZLA 2TMKA 2FA9A 3AVVA 3SYNA 2CL6X 1GZSA 3WP0A 1LB1B 4JSTA 4FCVA 2J0UB 1KMHA 3B82A 3REFA 1GOTA 2ZQ5A 4BZXA 2JCSA 2QM7A 2GF9A 4IXNA 4A6PA 1XWIA 3LVQE 4QBIA 4DHEA 4B2LA 3KFVA 1CXZA 1XD2A 4ZPXA 3VMFA 4DSOA 5JJLA 3IIMA 3QEJA 4ZIRB 4JVMA 4DCTA 2ODBA 1N5JA 3F5FA 1VG9B 3P26A 4US2R 1F60A 2FV8A 1IJEA 1W0JA 3L0PA 1I4TD 2QL6A 3NDBB 1YZNA 4P4SA 1MR3F 4XJXA 3KKPA 2HXYA 2OV2A 4PHTA 5L3QB 4CEJA 4OKSA 3T35A 3B1VA 2BMEA 1E2PA 1GSIA 4Q4JB 2YZ2A 4CT5A 3K8YA 3CB4A 4L8GA 4DLZA 2QTFA 1OXSC 2FWRA 2YWFA 3WHKA 4G5OA 621PA 3EW9A 4URZR 3GJXC 1Z0DA 4XVRA 3T12A 1MABB 2REXB 1KI4A 2AD1A 4KSCA 2D2FA 1KDTA 1UKVY 1COWD 3RWMB 4ZKEA 3K0FA 4HB2A 1GILA 2BDTA 2EQBA 3L8ZA 4M9XA 1XPRA 2VHUA 4LJ5A 4MRNA 1AS2A 1RIFA 1KJZA 1U99A 1EGAA 5HCNA 2VF7A 1U0LA 1VIYA 3K09C 2CDNA 4YQFA 3VHXA 4BEJA 1OYWA 4LV6A 3THYB 4IRUB 4L16A 1JI0A 1G3RA 1SVKA 4DLYA 3U44B 5E3HA 3WMEA 4A9AA 2HF8A 1XB2A 5CLQA 2IYZA 4EPVA 3B1YA 3CW2A 4HAZA 2V6JA 1MO4A 3C8UA 4RD2A 4TL7A 2ZSAA 4URWR 4CDGA 3JVUA 3U3JA 2OAP1 2B21A 5EXTA 1FTNA 4D0GA 4WZBE 2CVFA 3E1SA 1E9BA 1E32A 4RSGA 3K9HA 1KOFA 5TDHA 1BYIA 4TMWA 2O52A 2WPDA 1K6MA 2HT6A 3SJZA 4D0NA 5B58C 5K8UA 2W58A 1J90A 2GXQA 1ODFA 3H1TA 4JVLA 1VG8A 2PL3A 4M1MA 4B35A 1DAHA 1N3BA 1P75A 4BFZA 2ZU6A 4LZZA 1NVVR 1WF3A 1ZM2A 4IFEA 2VL7A 3D7MA 2ZUBA 4IOJA 1UAAA 2DB3A 1CRPA 2WMNB 4NCNA 1XRJA 1ZCBA 3AF3A 4TQ9A 2GZAA 3KJGA 2QM8A 1E2NA 4IDOA 2QP3A 1IY0A 3CWQA 4UKDA 1AGRA 1YR7A 2GAOA 4LWZA 5FUWA 3AF1A 5HPYB 1P61B 1E9RA 3WNCA 1ZUHA 4B2IA 4NCIA 4JT2A 2QSYA 5JRJA 1VIAA 2BBTA 4KLZA 3A4NA 2QAGB 5KSOA 1CS4C 2JJ1A 4QJ5A 2IX3A 4HLQB 4XWAA 1LS1A 3PFIA 1U98A 2G88A 2RGXA 1W46A 1D5CA 1FOEB 4UNQA 4A8JB 1KI7A 4PQFA 2FPLA 3CZPA 3L0IB 1EFHA 2C77A 4JLAA 4BUJA 4CVNA 2ZSDA 3NEYA 3WMGA 2J7KA 3KL4A 3A1WA 4OHZA 3CF6R 4C4PA 4JKIA 2FZLA 5FUXA 1BKDR 1TQ6A 1OHHD 4KLNA 5GJVC 2O8EB 1KO4A 4BASA 3FMFA 1MH1A 2A9KA 2GXAA 5CJ2A 4AD8A 4JBWA 2O0KA 2DHRA 1Z47A 4XIGS 5DIFA 1KJWA 1AQYA 2VA8A 1KY3A 3A37A 3EIQA 1OXUA 2ZJYA 4C0AC 1XEWY 2OXRA 2ZJAA 4ZKDA 1G1MA 3P1JA 1Q3TA 3PUXA 1YHNA 3HR7A 3EA0A 2NPIA 4KI0A 5CK4A 2Q0HA 3KQLA 3QF4A 3GJ4A 4URXR 1FP7A 2YOFA 3HYRA 2ODNA 2Q3FA 1H8HD 2BMJA 2WHXA 1IXZA 2XXAA 1HEIA 2RGNC 4MH0R 4RVCA 3ZZ0A 4E22A 1LW7A 4Q03A 2EFCB 2AL7A 5DN6A 5EXSA 1G3IA 1CIPA 4KHZA 4DLXA 5DNYB 1GRRA 4KFRA 4Q1FA 1QDEA 4KVGA 4DT1A 1RRPA 3A4MA 4QC2A 1ZBDA 1HT2E 1IOZA 2QG6A 4IOKA 2B8TA 1E4VA 5FTKA 4EPYA 3EA5A 1OFTA 3EG5A 2OE2A 2HJVA 4X8LA 3PEYA 1X3SA 4LDJA 2FMXA 1KK0A 2EYUA 3B5JA 4JLJA 3FMOB 3E2IA 4ZCMA 2OBNA 1J7KA 4MUAA 4NBSA 4UNNA 3W90A 3CUEF 4KJZA 1KKLA 2G77B 3DMNA 1EESA 2WWFA 4GOKA 2Z83A 1KDOA 3F0TA 4K46A 1UEJA
chains in the Genus database with same CATH superfamily
2Y1LA 1KGSA 2ZZMA 3OG9A 3ENKA 2VSNA 1A4UA 4MPDA 3T9BA 4LF7B 1U3FA 1SXJA 4CN9A 3AEKB 2X7JA 5I9TA 2PMWB 1RC0A 1NMYA 3WYCA 1AHHA 4PG7A 1ZPDA 2P6NA 2W70A 4EPXA 1QLWA 1PTJA 4CMBA 4AZ0A 3H0CA 5TGTA 2PX6A 2X4LA 1CEQA 4OQXA 3NANA 4RACA 4H35A 3RC3A 2XOKD 2ZUFA 2DM6A 5H8WA 2HHLA 1RKBA 4CUKA 2JIQA 3INGA 1KRXA 1U5AA 2FOIA 2COEA 1OLUA 1OXKB 1ZM9A 1F2DA 3A9TA 3LHDA 2ST1A 2OB1A 1M8JA 2R5WA 1KHHA 2NYUA 4MV0A 1CR2A 4YXWD 5K8VA 1Q95A 2OM6A 4K81B 5BW8A 2WTUA 2Q1SA 5ALNA 1ZSVA 2PU7A 4EKYA 1QB7A 1S0UA 1WHTA 2BPOA 1NYQA 3C4VA 4FYWA 4J2TA 4MB2A 1L5OA 4X9XA 5U4XA 4ER3A 1J0AA 5B3JC 1U4SA 4Q4CA 2J5RA 2IC5A 3CLUC 2VDWA 4CNQA 4MGIR 5DTQA 3MPUA 5LBIA 2F55A 3G02A 2YNMA 1JH8A 4Q4AB 5JALA 3A2KA 3LW8A 1YDGA 4YXFA 1Y7HA 3QEMB 4KQ2A 1RM5A 2H1LA 3U62A 5CA0B 5JZSA 4BEVA 4INZA 1M2OA 4V2UA 4XB6B 4IWNA 2VHQA 5BW5A 4I8XA 1TU3A 2FMHA 3JQ9A 4GPTA 1IM8A 4MIOA 1CVLA 4RH0A 1MMFB 4DBVO 5J47A 4AJ2A 3QPDA 2UZ4A 1XQ1A 3TQFA 1U7XA 3A2LA 2P1RA 1ADFA 4PIPA 4LFAB 3RWOA 3IP8A 3P4YA 1O2DA 1PR0A 2NWQA 3MEQA 3F5SA 1XMJA 1EK5A 3CO5A 1CEYA 3IRUA 2R48A 3EOZA 3X1XA 2EFEB 1TUIA 4WCVA 1PT5A 2IS6A 3KBOA 1ECBA 3DE6X 3P20A 2DTDA 3REQB 3DFZA 3RS4A 2B99A 4G6ZA 3V34A 5A9SB 2I4LA 1P4HA 4O3MA 1T4GA 2FFRA 1U80A 2CBXA 4S0ZA 4XR9A 3KAJA 4AMGA 2BGUA 2QTTA 1WLYA 4CXMA 1RJDA 2ZVDA 3NM4A 4HVAA 1BDJA 5HKKD 1NWHA 1GSHA 3BE6A 1Z63A 2PSSA 1NPTO 1ZRNA 3C1TA 1LA2A 1U8CB 3ELBA 1SC9A 2FOLA 1JUDA 2IYLD 5JWHA 5JDIA 2XMCA 4UEWA 4F4JA 3IL2A 1E1QA 3IJRA 4F8YA 1GITA 2IE8A 5KNBA 5C32A 4OGKA 1YA6A 4GSYA 1D4OA 2QT0A 3M6MD 5AJWA 1DQRA 2WTXA 2I2FA 2GJKA 5AXDA 2ZI9A 5REQA 5C7IO 1QP7A 4ARAA 2ZQYA 4XYEA 4UDNA 3K9GA 1GGMA 4ZC8A 3BWXA 2AF4C 5MF6A 4DPMA 1I3LA 1Y4DE 1IZ7A 2QENA 5L4LA 2Y0CA 1DMSA 3HVKA 3KXIA 5IT4A 4D82A 5ES4B 3DLCA 2YRFA 4EG7A 4TT3A 5KNCD 1C2YA 1TQDA 1I7LA 2FW7A 2OP0A 3PZRA 1J25A 2QTVB 1TMOA 4JIGA 5AM1A 5TQVA 3TOSA 3VOBA 5AVVA 1EP3B 2AFHB 1UMDA 3OTWA 3LQFA 2CJPA 5LU8A 3TFQA 3DC2A 3QYPA 1ZN8A 2GCNA 2I4TA 1M2VA 2JEZA 3BYZA 3R24A 4DRZA 3TMKA 3CCFA 3BCHA 4FSXA 5JJIA 4GRIA 3P2IA 4YGYA 2UUBB 1KY2A 3DKKA 3BKWA 4X7PA 4YROA 2G1UA 5E4FA 4U2CA 2IEDA 3L1KA 2WICA 3GLRA 1SCAA 3X2EA 1GCOA 1R74A 1H22A 3AFOA 3I01A 2HMWA 3QPUA 1NVUQ 1QYXA 4FDLA 1SUWA 1KJ8A 4HMPA 4JEUA 4TMVA 4DE5A 1TEZA 4H0CA 4X7MA 3A1TA 3TZLA 4EW1A 3I1FA 1IN6A 3LJKA 3VNQA 4GU5A 4NF2A 1JPNA 4J75A 4MDEA 2FPPA 3HU3A 1PYGA 3QGMA 1N3YA 2O2XA 2YTZA 4BB9A 1A9PA 1CUYA 2X8LA 2COKA 2X86A 3QMMA 2OVBA 4TTVA 2XYRA 1F48A 1NVVQ 1P3Y1 2XCUA 3K4PA 4WKGA 3RYIA 4AMZA 2WLTA 3TZBA 4TYWA 1ZUNA 1UC5B 2ZJ8A 3OPXA 1K7YA 2OZLB 3QBEA 3ZWNA 2QNBA 2ID9A 1YZGA 2OK7A 2P5YA 2WZQA 2O2GA 1AGYA 1BU5A 1T3GA 3DJFA 2NO0A 1SXHA 1REQB 3A1SA 1Z0AA 3C16C 2I3BA 3FH0A 3M3PA 5FLYA 4OXQA 1Z5PA 3HVRA 4B1FA 1JBEA 2X76A 1U0NA 1X7ZA 5ITVA 3SS7X 2C1ZA 3A26A 2Y3IA 5J43A 1XALA 2LPMA 1GEGA 3GMTA 5EP1A 2FQYA 4X95A 1CUWA 3V7WA 4J49A 1TXGA 3S8MA 2DETA 3UFXB 5FNVB 2QR2A 2JJQA 5JTTA 2UUCB 2HF9A 4GIBA 3E3OA 1Z6AA 3VR5A 4IJKA 2A86A 4MWBA 4ALJA 3AR4A 2FNAA 2ILTA 3PUHA 1RPZA 3STUA 4F96A 4A3SA 2P8JA 1JR3D 1Q0PA 4OP3A 1FE8A 3PI6A 2F1OA 1ABFA 3E3LA 4JBGA 5LLSA 5A3JA 2Z09A 4NBNA 1VJCA 3LKVA 1T1IA 1LDEA 1YQEA 4BN4A 2NUPA 1AQ6A 2VUUA 3NTVA 1MJGM 3GVHA 3RIGA 2PH5A 3OX3A 2QIOA 1M8PA 4UTXA 1U8YA 5ADWA 3BK2A 3FYUC 3NXSA 4PIVA 4E5KA 3DXZA 1U31A 1NAIA 2QV0A 2VH1A 4PZZA 4GYWA 4OFBA 3RS7A 3T52A 4DLLA 4WADA 5HQ3A 3WGYA 1J0EA 2W6JA 3L0YA 1JDUA 4PW0A 1YASA 4KWHA 2HDHA 2DWUA 1W5TA 2ODTX 3MQ2A 1YDEA 3PEFA 3E9NA 2HDWA 4GVPA 1J2EA 4OBWA 1M1YA 2GZ1A 3V55A 3C48A 4AVYA 1WEKA 3HUTA 3IBTA 2BONA 1PSZA 2BEWB 3GZJA 3T95A 2J0SA 1YNSA 5AVXA 3ZVRA 1F8XA 1XU9A 4E5SA 1KJ9A 5CFOA 3E82A 1O54A 2VP6A 3F6SA 4US0R 4TSFD 1VRCA 1P19A 5J1TB 4BO2A 4RNCA 1ZO8A 4DYVA 2CV1A 5H4HA 2V3CC 4AP9A 1JAYA 1RJ9A 4L5CA 1FSZA 2HPZA 1VMIA 4N8SA 1XMQB 4BUCA 1MC5A 4YYZA 2IBSA 1RJGA 2VDMB 1KR5A 1EX6A 1UBOS 4ILEA 1DWPA 2QD5A 4MGHA 5IPFA 4BRZA 5LDHA 3TL6A 4GOND 2W8BB 1D2AA 3TUJC 3RSLA 3CUKA 4ND7A 4MKXA 1V1RA 3A6ZA 3GLHA 4FZ3A 4PRZA 2VYCA 1YGYA 1GTJ1 5FO1A 4BYGA 4YLYA 3FFWA 2XYVA 4II3A 2RJ3A 2IXTA 4KE7A 1C3XA 1RJFA 3EZGA 4CRWB 5AW7A 4DAOA 3EGWA 1NL3A 2YWRA 3PDIB 3QYJA 3TW8B 3NHBA 1W5BA 1DUIA 3TBKA 1ZR4A 3WGTA 3R1IA 3L82B 1JBKA 4IIGA 4N5IX 3G6KA 3ZQUA 3LKBA 1FP4A 3CVYA 1YJXA 3DYIA 3I73A 2AXEA 1V8DA 2ZROA 3ADBA 1U3CA 3CC8A 3QWIA 5BQ3A 4R41A 3QFTA 4BEWA 1RI2A 1CV2A 2BMWA 2FWJA 1COWA 4CV2A 3PGXA 1VPDA 4RS3A 2BGNA 4ZOCA 4DDWA 3AYZB 1B14A 5K0FA 2HB6A 2NXCA 5JU6A 4A36A 3LUAA 4HAXA 4XQCA 4JUAA 4PZPA 5CFLA 3WOVA 4TXLA 2WFMA 3RYHB 3T5TA 1SCKA 1VA4A 4H7IA 4R7TA 4MRRA 1JHMA 1T91A 3R3XA 1JMKC 1GDDA 1W5SA 3K0CA 1O95A 4L57A 1BFKA 2NUBA 3MRSA 4KACA 3TRHA 1WD7A 2WTMA 1QFZA 3O84A 3AKZA 4WE3A 1SOUA 1ETUA 3OP1A 5HF8A 3OEEA 4U9UA 3I83A 2ZYSA 1MGOA 3CKKA 5AXBA 5FPPA 5IM4F 3I39X 3QXHA 3T5CA 1G16A 3JZAA 3QIAA 2I7VA 4D41A 2CXPA 2J0UA 4L5AA 4RENA 1VA5A 3U31A 3LBAA 1SUIA 4FXPA 3O94A 4UHEA 2EHDA 1W88A 4OM7A 1V3QE 3ITKA 4DUGA 4O2BA 1SU8A 2R751 3HM2A 2RG7A 1BHQ1 3HY6A 3IDOA 3QKRB 4N3GA 1DP4A 3RG2A 4ALKA 4ZYUA 4IVPA 1JLMA 2ZANA 5DNDA 3ZYCA 4IQ8A 4Z3KA 5TMBA 3U61B 1WBDA 3NOOA 3ZWAA 3HCCA 3KZNA 1IVNA 1E2LA 3SK0A 3SSNA 3S28A 2H8KA 2JJYA 3GG2A 3P94A 3ZEAA 2NZXA 3QFRA 2CYCA 3THOA 1OI3A 4QLAA 2GYVA 1NXQA 2HU8A 2X13A 1US8A 1G8MA 1OLXA 5ISMA 1GLGA 3BIXA 4RL6A 3IR6A 4G0XA 4Q4JA 1GZ7A 5GPBA 4JLPA 5LM3A 3QVUA 2JAXA 2WU0A 4AY3A 2R86A 1HEYA 3WV4A 4GG1A 1CE8A 3EZ2A 1XG5A 2FRDA 1Z2OX 3E84A 4BQEA 3IKLA 1GUZA 2IOQA 3ESCA 3BBLA 3LRXA 3QLVC 3E9EA 5HIKA 3D8UA 4OK3A 1Z06A 4PO3X 3UENA 4Q9KA 1ULBA 3JWJA 1GG5A 5LA6F 1DQYA 1NXXA 1ZJYA 4Q9NA 5EP2A 2YVQA 1NMZA 3SIWA 3L2OB 1LLFA 3B3FA 2QVZX 4GQAA 4B4UA 4YAKA 4LDPA 3UN1A 2WTNA 3I76A 3OU7A 4IIDA 2FAXA 4ND8A 4Q3LA 4BLQA 4EFMA 1YAHA 2D13A 2PX4A 3BB3A 3HB9A 2G04A 4MA5A 2C4TA 3LCJA 4JT8A 5BP7A 2FB9A 4RVSA 1AJEA 2V6GA 4N0QA 3K5PA 1NMXA 2P68A 3L7AA 4JUCA 5KVSA 1BO6A 1E1NA 2XQVA 3DC7A 2GO1A 2HQ1A 4MHSA 1QZ3A 2WMDA 4OVKA 1VL0A 3PTZA 2GUWA 5F1OA 4P4LA 2XMZA 2WIGA 3HBJA 4DQKA 4PN7A 3ZE8A 3ZK8A 2F3SA 3GGDA 4J7UA 5BNIA 5EZ5A 3KHSA 4GE3A 2IHUA 4E4RA 3BSYA 2ZIXB 3H65A 3NTOA 1G5QA 1KI1A 1OXXK 4QU0A 3Q7TA 2KQUA 2IXGA 4LJRA 3DOOA 4F6LA 1RD4A 4O4LB 2O8BB 3KUXA 2R1VB 1N0IA 3BCSA 1W6RA 4DUPA 1IBSA 3T3EA 1ORRA 1T8UA 2PS3A 1NV8A 3O7WA 2GD6A 1MAVA 2GCEA 3EZ9A 3KYDB 3LDHA 4HEHA 4RZHA 3RSFA 4BDSA 4HNAA 4C4AA 3MJCA 2EGHA 3PFWO 4FYHA 1U9YA 4G0ZA 1UDRA 3AXSA 3ETHA 5L51A 4W5RA 1F14A 2A5JA 4HUQB 2WG0A 2HXSA 3IUNA 3N0TA 4FW8A 4WD3A 3WGJA 4CCSA 4CLHA 3GVCA 3QPVA 2IPAB 5JV5A 1IU9A 1VLHA 3KLBA 3LUBA 4MGYR 1DKNA 2I87A 3QFHA 5G40A 5JSUA 2Y76A 1YD7A 4PRKA 4RW0A 3CMMA 3KDPA 3ZNQA 1WP4A 4Z9FA 1JQ5A 4DLSA 3F3KA 4HAUA 4ZEWA 2RGUA 1NSFA 3OFJA 4KWIA 5AKXA 4EG4A 1U7ZA 4YV2A 1Z5VA 2FHSA 1FZQA 2Y2UA 4I3HA 5EIAA 4GR9A 5FP0A 3U3RA 1ZH8A 4LXUA 4MDFA 3ZU4A 3N2GB 2A5FA 1EQAA 2XD9A 4ZEVA 4IUBS 1FNBA 3KLNA 2Q6VA 3QLTA 4TS4A 3TNDA 4WOBA 4P98A 3HA2A 1TCVA 3UC5A 2XF8A 1HDRA 2N0SA 4F6CA 4MV4A 2AVDA 2XYGA 4DBLC 3H2JA 1I4OA 4CTNA 3OI7A 4PSDA 3BPSA 3GHHA 2WJ3A 2UUOA 3BZUA 3CEMA 4R05A 5EUCA 4A6XA 1Q5PA 2B36A 1X9IA 5IDXA 2AFRA 3T7SA 3BXFA 3UK2A 4IXDA 3SXUB 5G4KB 5ILGA 2DU8A 1S8NA 3BB4A 3CYFA 4RIFA 4EELA 4FJ2A 4M86A 1WOMA 2V7BA 4A4DA 1YKSA 4RJTA 4MI6A 5JI2E 3AR5A 2K4MA 2V96A 4M8KA 4BBZA 1R0WA 2ECFA 2EV9A 3L49A 3M5DA 3BXEA 3SGLA 3BK1A 3EIXA 4OQYA 4HNUA 3N8HA 3IFSA 5T57A 1JQJC 3ER8A 3PQEA 2PYIA 1TM5E 3HJHA 1V96A 4R84A 1B0AA 2EWWA 5K3CA 1ZMRA 1T2FA 3A36A 3MCAA 2FPWA 3OZEA 5BN4B 3S6JA 5L3VA 3MRXA 1XDZA 4FEGA 1Y1QA 1RACA 4MKZA 1MUUA 1TVEA 2BCGY 3C43A 4EGAA 3ONEA 2Y8EA 2W71A 4MWCA 3B1WA 4UMDA 5I45A 2BRUA 1X80B 1YO6A 3OZWA 4CHGA 4HH4A 2WAOA 1N77A 1KVSA 4GPBA 4K26A 3UBMA 4CKEA 4B3FX 7ABPA 4F46A 4RIHA 5JARA 1WO8A 3K35A 3ZYZA 1MG0A 4KE6A 1JEEA 2B0JA 4TVKA 3I6YA 1L9KA 5KTKA 4RWZA 3LP5A 3NVKI 4LE2A 3NWJA 3W5BA 1P5HA 3EUAA 2AXPA 4FJ1A 3WJAA 3PG5A 4ND1A 1SB9A 2PMBA 3HJBA 4N3NA 4OMCA 3KKKA 2PBFA 4P34A 4UNPA 1PJ4A 5LOVB 3A6PC 1S6YA 1Z4IA 2XY4A 3GA5A 1UJ4A 2Z2XA 3NT5A 3PTLA 2GPJA 1NVMB 1YQ9A 2QNIA 5F51A 3EHEA 3EZFA 1I7NA 2DFTA 4X8MA 5F1YA 3UC9A 4NHOA 5HIMA 2VP0A 2AC4A 4REMA 3WB9A 1DKUA 4UPDA 4GH5A 1PNQA 3S2YA 1ISRA 1UAGA 3VPCA 3U7EB 1PJ2A 3OLXA 2I1WA 2I9PA 4MOWA 4ZRMA 2H0AA 4BNUA 1WB6A 3I1JA 3PX2A 1JJ7A 3FBGA 4LX8A 4BV9A 3LF1A 4KXLA 4CCYB 4RVOA 4DXHA 4MS4A 3BTOA 3FIJA 2GZ3A 2JKVA 4ZHQF 1U0BB 5CLHA 3R20A 4CE6A 3AGPA 3NBQA 2H9YA 5HTKA 4BYMA 4ECEA 3ISVA 4YT8A 1TYEB 4GF5A 1M1NB 1OZAA 4RZUA 4GXTA 3ZY4A 3I3OA 1II9A 4CETA 4QWWA 3QEKA 4XARA 1SEPA 2PWYA 4MROA 1CF4A 5D6OA 3DONA 4NX2A 3CKLA 3NYWA 5ESRA 2BMDA 3LL7A 4LYEA 4ZQEA 3U9SA 2OBFA 3G9QA 5B37A 3WGNA 4JIMA 3TW4A 4OHOA 1ISIA 4JSYA 2HSDA 1PE0A 2BOVA 4KR2A 3LK7A 1E2GA 5E9WA 5DYYA 4L78A 2O1SA 2X4IA 3N86A 3NIBA 1EK2A 5FOTA 5M3BA 1E9DA 5CCBA 4ZCTA 4PQEA 5EKDA 3OESA 3RHTA 3GK3A 5JYCA 1VG0B 4RZXA 3IMEA 3QI2A 1HFJA 2DPMA 2PWBA 4JD5A 1T8WA 5CPBA 2X2FA 3CW9A 4MYSA 3SHVA 5GZ1A 3HH8A 1ODKA 1J7JA 4GE0A 4JR0A 2WF7A 1CEXA 2HJSA 4JJKA 4P53A 5TF4A 2X1MA 3ZV6A 4EYGA 3PUJA 3EH2A 1GVHA 4KIFA 1Y3FE 2GCIA 4MR7A 4NYIR 3WE7A 5KKCA 2H48A 4KX3A 3PNPA 4ZYLA 3MS7A 5ER6A 4CUJA 4H1WA 4OAQA 4TTPA 4KQCA 3GOQA 5B4UA 3CLSC 1E0AA 1I2AA 5MDHA 1U9JA 2PFSA 4JEHA 2P27A 2PCLA 2HK7A 1VGQA 3H9UA 3DEZA 2OV6A 1JU4A 2GTHA 4IEIA 2I4IA 1TAGA 3QJ5A 4HR7A 3WIDA 3LVRE 3IPLA 4CIDA 5LP6B 1ZRMA 4EQ6A 2OEPA 1OV4A 4K28A 3PXAA 3AILA 5IG2A 2D1FA 1JX6A 4KIUA 1T36B 4NFSA 4QYIB 3WNZA 1NJ8A 1PGPA 3BJEA 1U5BA 4KITB 1W0JD 1U9IC 4GMDA 3C70A 1KDRA 2VP3A 2ANCA 4IHAA 3GLFE 2HIMA 1LBTA 1M0SA 3NUGA 1DAPA 5TJHA 4BO3A 1XEWX 1IEXA 3UV6A 3L4SO 4A23A 5K3OA 1BG6A 2DMRA 1NW3A 2J3EA 1JTEA 3KUKA 4Q1CA 5EXPA 1GTL1 4D9CA 1YCGA 2RJNA 4KNVA 3L01A 1I2MA 3V42A 4G5FA 4ONEA 4GNRA 3WRWA 4C7XA 3W3AH 3PP8A 4M89A 5CRIA 5BYAA 1C30B 1ORHA 3ORQA 1O9HA 3IVMA 2IEAA 1QRRA 1VLZA 2ZIZA 2F8MA 1XVVA 4RGQA 4UHFA 1UR5A 4YVFA 1IOWA 2Z8ZA 4UU8A 3WIEA 2E2WA 2EKLA 3K1AB 3F96A 3O8DA 3FSGD 3QLUC 3CR7A 4Q15A 2I3DA 1FJGB 2VBFA 4R8VA 3GPBA 3FBWA 3GLGA 1OKKA 1TEVA 1XQYA 1BE8A 2PYDA 3AWDA 3GUUA 2PMKA 2GILA 2RIRA 4ZXPA 2EBUA 2PSJA 3VJMA 2WUEA 4UOZA 4XX1A 4ECAA 2G28A 1PEAA 1TJPB 5DI9A 1MJ5A 1RKVA 4GGOA 4GL4A 2IYTA 5IMBA 3PHJA 1OX5A 3DL0A 4ZFNA 3DHYA 4CMIB 1ZKDA 4N6NA 5SYMA 4Z5XA 2UYQA 1ECGA 1Y1PA 2REQB 4YP6A 5F77A 4CLRA 1PT6A 5FORA 5L3RA 4GP9A 4QXMA 4BB0A 3I2IA 2PRIA 2AMLA 5FQOA 1ZMXA 4NTZA 1CUAA 2XT6A 5DT2A 5IF9A 1XELA 1EUDB 4U0JA 2VCEA 1I4DD 3QWHA 1KO8A 1KZ1A 2GZSA 4MS3A 1ZGHA 2QW1A 4JKOA 3QU5A 1L4KA 3E2MA 2A30A 4BRUA 5K0JA 2FEOA 4CDRA 3B53X 2F3PA 3CGWA 5EESA 3E7DA 1IWPB 3RSSA 1GCIA 4OD0A 5K1ZA 4TN5A 4YWHA 4O4HA 4LC1A 3EVFA 3IILA 1USIA 1PZMA 2BFPA 3UY4A 1C0IA 1Z5UA 2YWEA 3DB1A 1I14A 3NHPA 4RTJA 1QR2A 1T6NA 1E9SA 3DE1X 3AKDA 3IQHX 1EM6A 3O9VA 3PFKA 4QEZA 1JG4A 1W9HA 1JECA 1DU4A 1QH0A 3GB9A 3N5KA 4LQDA 4CEHB 1E2UA 3CSSA 3DEHA 2AR0A 2UZ1B 5JZMA 2LDXA 1UJ6A 3BMQB 3T0IA 4ZTBA 2WV7A 2JVIA 4J2OA 4PSCA 3GVPA 2W2LD 3EDCA 4G8DA 2UYGA 1XEAA 1KBQA 4H31A 5JRDS 1ML3A 4UASA 2QUHA 3QKUA 2O19A 5F52A 2VPQA 3RARA 1N5IA 1TCBA 3W77A 4D79A 2O6LA 3CSDA 4TXNA 3AF6A 1W0CA 1Z8NA 3PVSA 2HMVA 2UU9B 2C5BA 4G2TA 3KKQA 5IS2A 3GIWA 2JGKA 2NOAA 2VXBA 5CB0A 3NGLA 5KTNA 1QRDA 3IIEA 1XZNA 2YXBA 4QUKA 3VBCA 3S2EA 5C4IA 1GSOA 3Q8MA 4C2UA 1BJKA 4BVEA 5BSMA 1FNDA 1F0KA 2JBWA 3EC1A 2ZJ2A 1MT0A 1P29A 1TQ8A 3AYXB 3ECCA 3E70C 1XJQA 3O9ZA 4PO9A 4DDVA 5JI3E 5D3ZA 3N07A 2B34A 1PK9A 1EYZA 4R9RA 1IHYA 3PR3A 4YECA 1U11A 2Z57A 3UG7A 3ZK9A 4BFVA 2VQFB 2VATA 1WU8A 3PBKA 3LQ4A 3U7QB 4BNTA 2R8EA 1ZRSA 1G9XA 3TW6A 4DWOA 2OFFA 4YDHB 2X2EA 1G8AA 2APJA 4JYBA 1DBPA 4I4IA 3RGGA 3FA2A 3ZDYB 4AWAA 1LGYA 4OXRA 3PLAE 5DI3B 1E7RA 3GUYA 4I1SA 1KRHA 3OCCA 3AVYA 1O87A 2VZ0A 3KQMA 3CH5A 1ZIDA 3UHOA 4UJ3A 3IAM1 4HKTA 1TEXA 2JFWA 2KBEA 5IEBA 4MVJM 1DHRA 2EARA 2F8LA 4OB6A 4UTVA 5HIAA 1XCLA 2W6OA 1CU1A 5FOUA 4WJZA 4PPFA 1L4NA 5CLJA 4KR3A 5DGHA 2BUAA 1X70A 1YVEI 2GPSA 3LPMA 4Z2YA 3FSJX 2QW8A 3MGKA 4BRSA 3HYLA 1M7HA 1RAEA 1H3NA 2LP4Y 1E6UA 5KVVA 5DBFA 3V48A 3DL4A 1X2EA 5CA1A 2ZIVB 4MEJA 3L46A 4HDKA 4O5OA 3D2AA 4QODA 2FW0A 3DFFA 2HHAA 3HKEB 3H5NA 4WW0A 3M1AA 1RAHA 3L02A 1UBFA 1APBA 3H2HA 1PR5A 4RAQA 2GO7A 3ESRA 2SNIE 3S7ZA 1OB2A 2GCOA 1SOAA 2DWPA 1FQOA 1XXHE 4NYJR 1J0CA 5K0EA 2BISA 3KKNA 3MJVA 1QH8B 4YTEA 4D8TA 5BUCA 3CNEA 2OCYC 1U4OA 1GFZA 2V6FA 4GP7A 1ZU5A 3ML1A 4K9DA 1K6XA 1AQUA 4G0PA 4QPZA 5K8LA 1QV9A 4X65B 1DT5A 2W43A 2QRMA 3F9CA 1E1DA 4KVAA 4RVNA 5GQSA 1NJ1A 1T13A 3LY8A 1W75A 4MP6A 2MMCA 2VWQA 4QA9A 3NHKA 1TK3A 1B0PA 1U0OC 2P4QA 3HGQA 3KB2A 3I2FA 5FOXA 1CUBA 4W9RA 4DDTA 3L7LA 4CN8A 4YAUA 3EX7C 1M2OB 2PZGA 3DWFA 3FBTA 3LBHA 3PPYA 4KZKA 3C8MA 2OBYA 5A4MS 1S5PA 3MWEA 5A7FA 4HGZA 5AXAA 2W0SA 3RSHA 1Z4OA 2FZKA 5K3FB 4WERA 2VYVD 2R4UA 4IIJA 4HLDA 3V8QA 2AHRA 3JAKA 4HAVA 3I9MA 4BO7A 2ZM5A 5I7RA 5BRJA 1EDOA 1WY5A 2PL1A 4MV6A 1SU7A 3IV6A 1G4AE 4ZDJA 1UXOA 2DY0A 2FUG6 1DAGA 1YZKA 1R4NA 3E7PA 3UHFA 4PLPA 1IN4A 3ZWOA 1RU3A 4KQMA 4XRGA 2ZYGA 1XFDA 3HLYA 3N74A 2LWIA 4JBYA 3NMUF 2P91A 4Q9HA 1Z6QA 5AW0A 2R6DA 2EEZA 2OFWA 1SXJD 2AG5A 1D6SA 1NKVA 3RRYA 4BGIA 3ZC3A 6CHYA 3TG8A 4ERXA 3CISA 3OWXA 4KNWA 3G49A 4ZZ1A 1W7AA 4MITA 3KYCA 1E99A 2BUCA 3THWA 1ZOPA 2AUNA 2KWIA 1FS6A 1O8CA 2GK6A 2JVKA 2ZE5A 3U17A 1E7MA 2WHEA 3IKVA 3QH4A 1Q57A 2V7WA 4K40A 5BV8A 1J0XO 1DADA 4IFBA 1YRYE 1K0UA 4K9NA 1GT6A 5CA1F 3RKUA 3F78A 4D9JA 3B1JA 3ZWQA 4D3YA 1V11A 1VB5A 4L7VA 5I01A 2B4QA 1L7NA 1NLMA 4OK5A 4II2A 1K2WA 1SBCA 2YWGA 3DUWA 2VBGA 3UT6A 4F72A 2JFNA 2ZI6A 3K20A 4IDFA 4BHTA 1AN9A 1K1EA 3WLEA 3B9BA 1K5HA 4C7BA 4DQ0A 4G0UA 5CGZA 2RFLA 1TYBE 2CFIA 4FT4A 1UWVA 2G9ZA 2G9VA 4GR4A 4S1WA 4YDSA 2XJ9A 1BWRA 1XTVA 1L7BA 1BDBA 2O3TA 1SUEA 2E4UA 2X8WA 4F8JA 1ZI6A 2C7VA 3D1LA 2UKDA 5ILOA 4MHOA 2NQ8A 2IYWA 4RTKA 3T94A 3RUHA 4OM8A 1A4XA 1QHEA 4NPAA 4EOGA 1JKMA 1RMTA 2HBZA 1VPEA 1IHPA 3BL8A 1OTXA 3D7LA 4ZVRA 1JXOA 5HFAA 3DO6A 3SYRA 3SE0A 3Q9SA 4OXKA 3Q7EA 2FR1A 2X4DA 4X3PA 5ICFA 2GHIA 3K8OE 1CY2A 4MRPA 1XVAA 4PO1A 2Z98A 4FR2A 4PTZA 3WLLA 3HY3A 4YWJA 4KU4A 4CQMB 2H17A 1FJ2A 5AK6A 3ORRA 1VXOA 3FOEC 1G5HA 1OFUX 4XUDA 5A05A 2ZKIA 3C39A 4D45A 1QVAA 2WWVD 4Y6QA 2QRUA 1WULS 3IAS6 4L8VA 4TXMA 2Z04A 3BDIA 4XAQA 3Q5GA 1XU4A 2GGSA 2QRLA 6ABPA 1NM5A 1XAGA 3DBIA 2O1EA 1KSHA 3PITA 5KOHA 4M8SA 3RRXA 2G09A 1PFVA 4U7JA 3TTXA 1G5FA 1VSUA 4J9UE 4YBRA 3WMRA 4YDQA 1GTG1 3LECA 3U1BA 4ERNA 3RAGA 2SCUA 2FPGB 4MRMB 1WDTA 5LWQA 4KDRA 1OI7A 4QXQA 4ZCQA 1E2HA 1XX6A 1JA9A 2JZOA 3P5BA 1ZNZA 3CINA 1N4DA 4LRYA 2NYVA 3AF4A 2WZCA 4E4TA 1FFXB 4IGIA 4G0OA 2C3MA 5KNBD 1SBQA 1DRJA 4CMKA 1KZYC 3WWDA 2HQBA 3ND8A 1RBMA 1YTLA 2P2GA 1P2GA 2ZWVA 1WZCA 4HH3C 4RAOA 4IMRA 4BUZA 8LDHA 1N9KA 3H5AA 1N7HA 1TT5A 2D1RA 3ZQ4A 1QGOA 1R64A 1USVA 1X7GA 1ZGCA 3A9VA 4TWJA 3Q8XB 4CTJA 4EO7A 3BH0A 2QR3A 1NG9A 4TT3D 1OWLA 4PNZA 3B60A 4RGBA 1SD5A 4CKBA 1PWHA 4DOMA 3BBPA 3ZV5A 5C4MA 3FD8A 2FR0A 1TQ4A 2FZ4A 1CY0A 3BIJA 1NWCA 1N5DA 1UF9A 3WYAA 1ZVMA 2NUPB 3SC6A 5HZGA 5TMPA 1NASA 3GJSA 3WK6A 4U7DA 1FRFS 1GXSA 2RGEA 3IB6A 1BSVA 1P18A 4KWCA 4YCLA 3OZAA 1AV7A 1SBNE 1P3DA 2UV8A 4FS8A 4HAOA 1SB8A 3B1KA 4LW8A 3ZLBA 5TLSA 3UBTA 3U49A 4CMAA 1GUDA 1ADBA 1QGDA 3DFMA 2RK3A 1KAMA 1RRGA 1T9AA 2DBRA 1MAUA 4OJKA 3CTPA 1Y89A 5LB2A 3V1KA 5IC4A 1HZZC 1EWKA 1M2NA 1XWFA 3DD1A 4JB8A 4DRXA 4YCNA 2O05A 4F2GA 1OROA 4CQMD 1N25A 4WVLA 1XAIA 4LWOA 4OX9Y 3VSCA 3DW3X 1QRSA 5EJAA 2V9CA 4RH1A 1NMQA 1VP3A 2WR8A 4WBNA 2FN7A 2JGRA 5AKEA 1OFVA 2Q46A 3Q8KA 4JEIA 3OOJA 2FEPA 5C8VA 2XUKA 3ODGA 1U3GA 4K7JA 1Q1BA 2IYQA 4HQ6A 3K5IA 3RVKA 3VR1A 4F21A 4R0NA 2VPTA 1M74A 3W7BA 2OL4A 4P3NA 3PB3A 1IN8A 1J42A 1JE0A 4LRQA 1KYXA 2OXFA 1UQTA 2WNHA 1Q92A 4R16A 2ZYAA 3U4CA 4UPEA 2YICA 5DTRA 2Q6LA 2N1MA 2OMEA 4X8OA 1RYZA 2BHLA 1OAOC 2FSHA 2QR5A 3OIYA 2VSOA 3HXOA 1VBMA 5JFGA 3VMMA 5DWQA 4CIVA 3TQHA 5AQEA 3RUIA 1M2WA 3IDZA 2KSQA 1M2JA 3KDAA 1UK9A 3EAGA 2F3TA 5B5SA 2B4KA 3EZYA 2A0UA 2O6HA 2OFPA 2NSHA 3AUYA 2HMSA 3URKA 3CN9A 4I9GA 2OUIA 4J7AA 5CH5A 4NPHA 1TKBA 3QSYA 3JWGA 2ZRMA 3GT3A 1RI3A 2YVAA 2ZIAA 4YV7A 1HGXA 4RJJA 4L75A 4I5IA 2I6GA 3RPEA 2D06A 1RS0A 2G71A 5LA6B 1J21A 2AMYA 2Q2VA 4D4GA 4YR9A 2C2MA 3V4ZA 4L95C 1DRWA 3LPCA 3M5PA 3A06A 4PFSA 1BU8A 3QBTA 4MQEA 4RABA 1X86B 4CMEA 4BQSA 5CNIA 2HFJA 3QNUA 4N5DA 4A03A 5EIBD 4B31A 5DBOA 3KJZA 3VPAA 3ODPA 3DWEX 4WLVA 1PKEA 1MBZA 4XEUA 3TEFA 2FPUA 3HSYA 3K16A 5LYJA 3VR3D 1W34A 1P3JA 2G17A 3SPXA 2C1EA 4RLFA 3WGOA 1IXYA 3GFTA 5C51B 5F3WB 3T3OA 4X24A 3SR3A 3W79A 4FLEA 1ZS9A 2JDID 2H9AA 3BGVA 1XYVA 1XBTA 2V54A 3BZWA 1YRAA 2QNRA 2C3YA 3OZGA 4ON9A 4C7JA 3UAYA 3K2IA 3HJAA 4FIDA 2IBTA 2QUIA 1JT2A 1BE6A 1YZUA 4H59A 4YAOA 2JKYA 3NNDA 4KB5A 4IIUA 4OI4A 5DKFA 1RAIA 3ZE0B 2QVXX 3N7UA 1XCMA 4KG7A 1I01A 2PVPA 4MQFA 1I80A 1V37A 3QKSB 2YFYA 2AS0A 2P9ZA 4MV7A 1EI9A 1TIBA 3RQIA 4J0DA 4HAIA 3RHSA 1XJWA 1NUPA 4F60A 4CF3A 2WSLA 3CUTA 3DLHA 4XD7A 1EQUA 1TUBA 2FXVA 3UUGA 4P31A 3HS3A 2AZ4A 1FQJA 1L7MA 3IEVA 3AMVA 3PJGA 2O8CB 5AK4A 2QSZA 5ENZA 5BSWA 1DC7A 2WV9A 4D4JA 2MYPA 4U4AA 1YS6A 3U0VA 2PKWA 3ZCUA 2Z0MA 1ND5A 1ZESA 2L19A 2ZRPA 4IJQA 2WABA 3CF2A 2F3RA 4JH0A 4NBTA 3L6EA 3TEMA 5IN4A 3IA7A 2FX2A 5K05A 5FHRA 3B3AA 3HTXA 1LQ2A 2JFVA 1IZYA 5CVTA 1US8B 2YIDA 1OLXB 2ZAOA 3BE5A 4RPGA 5JE8A 2H1SA 3VAAA 1ZJ4A 1PNRA 4GX1A 1MOSA 2W93A 3AEZA 4KMSA 3WBKA 3K94A 4E5YA 2ANBA 5EINA 1CNMA 3CZ5A 1CB0A 3WGMA 1T5TA 1CE8B 2D62A 3E22A 4YRGA 1F8YA 1U7TA 2ZCVA 3LQRA 3QHPA 4L28A 3E4CA 4WKPA 4JI0B 3I09A 2JA2A 4FYPA 4JXXA 5GP1A 1SK8A 2NQTA 5TPWB 4LCJA 5A2GA 2AN9A 3UAWA 3ZY6A 4DIOA 1LDBA 3HXKA 1KH1A 1E1YA 1HRKA 5JXWA 1R3DA 1BW9B 1F4PA 1WXQA 4IOLA 2HEIA 3P4XA 1Z7GA 3GUZA 2CGEA 3V4SA 4YRKA 2QQGA 3OX2A 4HQOA 3W4JA 2IEYA 4JC5A 1VYTA 1B6RA 4B46A 3GLFA 3UJ3X 2Q4RA 3IIJA 1Z2NX 1OH7A 4L6CA 1QH9A 5FAXA 4RLSA 3ZTWA 1Q1NA 3AZQA 4B8ZA 1N8NA 5EZ6B 6REQB 4QUJA 2I4RA 3OEED 4LC9A 5EMNA 4WY2A 2OBLA 3D6FA 3T8YA 4F4FA 4HO1X 4ZK2A 1Y4SA 2CMKA 3UAZA 1O5IA 4MQ5A 4PLYA 4Q9LA 4CG2A 4EYQA 2D3TA 1MP0A 2IYNA 3VTFA 4MLCA 1TJYA 3KPJA 4RTNA 1G5TA 4I5DA 4DV6B 5G0SA 3ORSA 4BP1A 1KMHB 1RZUA 1VI2A 3A6JA 3R6DA 1D07A 1HTBA 3MJFA 3OHMA 1DARA