3C85A

Crystal structure of trka domain of putative glutathione-regulated potassium-efflux kefb from vibrio parahaemolyticus
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
150
structure length
150
Chain Sequence
QLINPGHAQVLILGMGRIGTGAYDELRARYGKISLGIEIREEAAQQHRSEGRNVISGDATDPDFWERILDTGHVKLVLLAMPHHQGNQTALEQLQRRNYKGQIAAIAEYPDQLEGLLESGVDAAFNIYSEAGSGFARHVCKQLEPQFTSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative glutathione-regulated potassium-efflux system prote
publication title The crystal structure of TrkA domain of putative glutathione-regulated potassium-efflux KefB from Vibrio parahaemolyticus.
rcsb
source organism Vibrio parahaemolyticus rimd 2210633
molecule tags Transport protein
total genus 53
structure length 150
sequence length 150
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02254 TrkA_N TrkA-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3c85A00
1CQIA 3QLJA 5F5NA 4TROA 5L4NA 1B8UA 2O3QA 3FNHA 3HUDA 2Q46A 1XQ1A 2JCVA 4KWIA 3R1IA 1BG6A 3BMQB 4UVIA 4R69A 2PGJA 4W82A 4KTVE 4RVDA 2ZCUA 3A1NA 5L9AA 3GHYA 3D3EA 1MG0A 2EP7A 3C1TA 3G1TA 1DB3A 2HDHA 5KJ1A 3NT2A 1XSEA 4DLBA 3E03A 1EVYA 4J0EA 3W4IA 3BIOA 2C2YA 4UAGA 1IUKA 3MJVA 5L3ZA 4Q9NA 1O95A 2GN4A 4BGUA 1GCUA 1Q0QA 2WSBA 4BO7A 4HKTA 4J9UE 1JAXA 1E0DA 1L7DA 3VPFA 2OORA 3WYCA 3WGGA 3ENNA 3Q9NA 3W1VA 4DIOA 1P1JA 5JY1A 1YOVA 1PU2A 2GN6A 1HDOA 5JDIA 2GN9A 4YB8A 1UP7A 3TL3A 3P19A 5DP1A 4PLTA 3NTQA 1ZW1A 5A5EA 2V65A 3VDRA 4J7XA 1DFGA 3KETA 2VT2A 1PJTA 2ZTLA 2ZYGA 2AE2A 4ALMA 4GSKA 5KWEA 1P74A 4R51A 1DC5A 4FS3A 3TFQA 1KY4A 4YR9A 3GDOA 1GZ3A 2Q4EA 1FDSA 3OMLA 3D5TA 2A92A 1MFPA 3HG7A 1KEVA 1GD1O 4RF4A 5B37A 1AHIA 5FI3A 5ER6A 1ISGA 4AL4A 5G0TA 3RBXA 3VVBA 4BMVA 4XCVA 1BRMA 2Q1TA 4RPKA 4RPJA 1LEHA 4B3HA 2HMVA 3WNVA 2Y66A 1WZEA 3DZGA 1MG5A 4A27A 1D4FA 4B7CA 4BNIA 2NSDA 3GMSA 4IJKA 3PHJA 3D5QA 4Q3DA 2EP5A 4ALKA 3U62A 4E12A 5JYDA 1P1IA 2TMGA 1C1DB 4WPGA 2DLDA 1EVJA 4XGNA 4E5MA 2DBVO 1NWHA 3G3EA 1OFGA 3JQBC 2I67A 2ZYAA 3H3JA 4WNIA 2EIHA 4D3DA 5AOVA 3WQSB 3GDGA 1EEHA 3ZCXA 4BNJA 4CR6A 1R66A 4EUEA 1WLYA 2EERA 3OBBA 1PL8A 3PWSA 5I9NA 4ZGWA 2DKNA 4WLOA 3RASA 4ND5A 3WS7A 3K6JA 1M66A 3GF4A 1HRDA 1B15A 4E2ZA 5IJZA 4BO4A 1NYTA 1ZVMA 5IDYA 1DPGA 2D5AA 4OKIA 1KYQA 3VTZA 1PTJA 1C0LA 1P31A 3K73O 1WMBA 3BHMA 5JS6A 4TWRA 2X22A 3RBZA 1MP0A 1ENPA 1DC3A 2O3SA 1E77A 3OJFA 1GQ2A 4D41A 5FEUA 1YBAA 3GEMA 4B3JA 1SBYA 3DEYX 4XYGA 2QRJA 5CHEA 1HWYA 4JX8A 4I9UA 1PWZA 3PDJA 1IHYA 3WJ7A 4IXTA 2JHGA 2YV2A 1U4SA 4IZIA 3WWZA 3RC9A 1E7WA 1NBOA 2I9PA 1LDYA 4MVJF 1U3TA 4CUZA 1B3RA 1O9BA 4KZPA 4CM3A 1PS0A 2W98A 3IAHA 1NFQA 5KNLA 1M6HA 3NJ4A 4IMPA 3GFGA 1PSDA 3KO8A 5ITVA 3GFBA 3ZNOA 1KETA 3DBHB 4CM8B 4GPD1 3V1UA 2A4KA 5B1YA 2YHUA 3NTOA 3VH4A 2H9IA 1EDZA 1HDZA 3CZRA 3FNEA 1E1MA 1HLPA 2QIOA 3HN7A 1Z7EA 4XIJA 2Q99A 3RIHA 4YAIA 2B35A 2C7VA 4OXYA 5IN4A 3JQDA 2Y05A 3RSHA 4RQTA 3R6DA 1T2DA 2GLXA 4MP8A 4P38A 1TT5B 2YFQA 2IEDA 2Q1SA 3C3XA 1WMAA 2VOEA 2VT3A 3IOYA 2D5CA 3TSCA 3GPDG 4XR9A 1MX3A 4FFPA 4ZRNA 4FJ0A 2GASA 4K6CA 4OO3A 1WZIA 4PLPA 1YDEA 5JMPA 2CUKA 4L4RA 2CF6A 3JYLA 1E1LA 1Y8RB 4DWVA 3BMNA 2E49A 4HFJA 5U4QA 2AQHA 4XB2A 4ALJA 2ZB8A 3UN1A 1JAYA 2PR2A 3WLEA 5C7OO 3H9EO 3DQPA 3IKVA 2Q45A 2RHCA 1XIVA 2GRAA 1KVRA 1U8FO 4HWKA 5JO0A 2P5YA 1AHHA 3DAFA 1PS8A 3IUPA 4XR4A 1TB4A 2Z95A 1E7YA 3D4OA 1H5QA 3BTVA 1IYZA 3EDMA 3GAZA 3FPLA 4M89A 5EMHA 4YXFA 4Y9DA 3JYPA 5JCJA 3ROMA 3AI1A 4JNKA 2DPGA 1D7OA 1EVIA 3KUXA 1D1TA 4WCFC 1AE1A 4K28A 2OXIA 1LC3A 3GNQA 3VAZA 4QX6A 3TN7A 3VKVA 5JCXA 5A03A 4X54A 3LDHA 3UAGA 4ALNA 1UZNA 4Z0PA 4J1NA 4BNHA 2HK8A 1DIBA 4NBWA 4FOOA 1NTOA 8LDHA 4IJWA 4D42A 5K6AA 2IYPA 3KVOA 4IJUA 3B1FA 3PYXA 3KSZO 5F1OA 3WQRA 1K89A 1PJSA 3ZWYA 1YWGO 5TT1A 4XYEA 3H9GA 3UKOA 1LTHR 5JNLA 1GU7A 4E5KA 2JKVA 4YQZA 2DTEA 3TDKA 2CF5A 3JQFA 4R54A 3GEDA 3WICA 1E5LA 2ZIZA 3OJLA 2VZ9A 3ZWXA 4WCFB 4BO1A 3HDHA 1A9ZA 1DLIA 1O8CA 1EK6A 3ADOA 4KDFA 3GH3A 3MJSA 3RFXA 1B26A 3F47A 3LF2A 2P2SA 2IRWA 2UVDA 5TRTA 3ZU4A 3JQ7B 2CDCA 4DYVA 4H7PA 1C1XB 2GGSA 3MJEA 3ZV5A 1UUFA 2VNSA 3A28A 4L0QA 1B16A 3DZIA 1T26A 5DF1A 5JXWA 4J6FA 3UF0A 1ISMA 3WIEA 2X5KO 3CTMA 1IY8A 3BYZA 4F45A 1ZSVA 4IY1A 3UICA 3VZSA 1T4DA 1TT7A 4HUJA 3JQ8A 5TQVA 5AXBA 4EW6A 4TMFA 1U7HA 3EZLA 3H9UA 3PK0A 3ZHZA 4OYRA 1A71A 3FI9A 5A05A 1BVRA 5JAZA 1PJBA 2WTBA 4BHTA 1P1HA 4YT4A 3UCXA 2GERA 3EZYA 1HE2A 2Y1FA 2ZCVA 3BTUA 3E5RA 5L40A 2QRLA 4QO7A 1LDGA 4BKPA 4XYLA 1PWXA 3JQ6A 1XG5A 2OBNA 1HTBA 3ITKA 4UVEA 3OA0A 1HT0A 1NWCA 4RF5A 4CR8A 4DC0A 3DONA 4TVBA 3DFUA 2RH4A 1EFKA 3WDSA 4RVSA 2VTDA 1GCOA 3UFXA 3RQSA 3RVDA 3ZH2A 1OOEA 3PYLA 4FJ2A 4AJIA 1U3VA 4PN3A 1KIFA 2X58A 2J5RA 4WUVA 3DZHA 4XRRA 3QW2A 5DCUA 1CIVA 1G0NA 1ZFNA 1B8VA 2BGMA 3Q11A 2PZMA 3QRWA 3WJAA 4YAJA 3N74A 3FSRA 1E3WA 2EKLA 2PZJA 1QORA 1AN9A 1EBFA 4B4VA 1ZXBA 3V1TC 1N9GB 3X2FA 4O5OA 2OGUA 3VC7A 1ZCJA 1NFRA 3LVFO 1YJQA 1X7GA 5KTKA 1RPNA 4FC7A 1VPDA 3I6QA 4H3VA 4XYBA 5COAA 3JQGB 2Y1GA 5K9ZA 2SCUA 4N18A 1W6UA 3GZNB 2PNFA 2PH5A 4TRRA 2GYYA 2BFMA 1J5PA 1HLDA 4Z9YA 3IS3A 3A4VA 4R16A 3I4CA 4H15A 3AOEA 1BXGB 1XGKA 1RM0A 1D1SA 4N7RA 1U8XX 3WBBA 1ZK0A 1QYVA 4LRTB 2C7GA 4PRLA 4YJFB 1K2WA 1XWFA 5BR7A 2I3GA 1E7QA 2UDPA 3EAGA 1O0SA 5T6BA 5TNXA 2RHRA 1SOWA 5F5LA 4DPKA 4JJIA 3NX4A 3TRIA 3WR5A 1HDXA 1YVEI 3DHYA 3F4LA 1X7HA 3L4BA 2JD2A 4M87A 1MFZA 3JQ9C 4KUEA 1H6DA 1LQTA 1SO8A 2C5AA 4HXYA 4CMKA 1DIGA 3OIGA 3ORFA 1Y8QB 4ND3A 3RKRA 2EGHA 4WOJA 1I33A 1GL3A 4BKUA 4L8VA 2H6EA 1WVGA 2UYYA 2X0IA 2YYYA 4YYZA 4ILKA 3SX2A 2J3HA 1HYGA 1PGPA 3E8XA 3RUDA 3VZQA 5ICSA 3I1JA 3NDIA 3OQBA 3D64A 2QQ5A 4PLWA 4L75A 3SXPA 4PVDA 3INTA 3T4XA 4TSKA 3VH3A 4R3WA 4XEHA 2HO5A 4BMSA 2CDAA 2CVZA 2DFDA 2PK3A 2W2KB 3PHIA 5BSFA 1Y1PA 1DRVA 4JQCA 4CJXA 4DIFA 5DOVA 4BVAA 3P2YA 4B4UA 4IJVA 3CMMA 1KOLA 3AU9A 3U5TA 3NT5A 4G5HA 3WGQA 5ENDA 4KP7A 3FTPA 5JDCA 3E48A 4BO8A 5IG2A 2QX7A 1ADBA 3VZRA 4AVYA 3WG9A 3DZBA 4WK6A 5T64A 3RFVA 2AQ8A 2QG4A 1NPTO 2Q1WA 1EK5A 2FZEA 5FFFA 3SJ7A 3HHPA 1JKFA 1GYRA 2HU2A 3D4PA 4OIMA 5MDHA 5A1TA 2VQ3A 3LT1A 1QV7A 4TRNA 5BQFA 2HJSA 3H65A 4NU5A 3LT0A 5ER9A 1DAOA 3FRJA 1CQJA 2WDZA 2J6IA 3V8BA 2VTEA 3WGHA 2A9FA 1MUUA 3FD8A 1LU9A 2YDYA 4TRJA 1NAIA 3FR8A 3QIVA 4R68A 1BXZA 2VWHA 3KYCB 1DLJA 1HSZA 3WTCA 4WLUA 3SBOA 4BQPA 1N1GA 3JD1A 1OI7A 3MTGA 4DUPA 1NQOA 4D0SA 3ZU5A 3K92A 1SPXA 3MWDB 1T25A 4YRAA 3PTZA 5TGDA 3RUAA 4CLRA 1B0AA 4E30A 3QWAA 5C3MA 4AJ2A 2NWQA 2C2XA 3FR7A 4I08A 4CLOA 5EESA 2YHIA 1PZEA 3S55A 4YQYA 5DCWA 1KC1A 2RAFA 1VL0A 4QUKA 1QP8A 4E4YA 2F00A 2PY6A 1AGNA 1R4NB 3B20A 4WLFA 2V6MA 1QXSA 3MJ4A 1I3NA 1YL6A 4HBGA 4MIYA 3OICA 1NHGA 2YZ7A 4XJSA 2CMDA 3PJDA 2HUNA 1JLLA 3DL2A 3I9NA 2NNLD 3O03A 4W7HA 3DDNA 4PZCA 1HETA 4NFSA 1PQUA 4II2A 3I3OA 1PIWA 4XX0A 3WNQA 1XHLA 3KRTA 1GEEA 1K3TA 4J1QA 3SC4A 2YFHA 4CMAA 3DMYA 3R3SA 4IIUA 4XGIA 3EVNA 3K31A 1AXGA 3ZN2A 5KOIA 2C54A 2WYWA 2Y93A 4DPLA 4GKBA 1NP3A 1DXYA 4QXMA 2IXAA 1EQ2A 4FFRA 4BL5A 2AHRA 1F8GA 3UXYA 5A3JA 4EEZA 5KJCA 3NKLA 1PS9A 4I5EA 3UCFA 3Q2IA 3TFOA 4Y6RA 4OH1A 3WX0A 4B4OA 2ET6A 2WYVA 3QP9A 4BNGA 4UULA 3ZV6A 2D0IA 3U4IA 3D4NA 3JD2A 1DO8A 1XKQA 2QYTA 1Y5RA 2X86A 1P33A 1VC2A 4JN6B 1ENYA 3HNPA 4PLVA 3N7UA 2I3AA 3NDJA 4FIZA 3O8QA 5IXYA 4Y98A 3JSAA 1P1FA 4RPLA 5DCYA 5DOZA 4U5QA 3W4JA 3H3FA 5HS4A 2CSUA 4GLLA 2VRBA 2GZ3A 3BTOA 2O7SA 3K30A 4J9VA 1LSUA 3WGZA 1WDMA 1X14A 3AM4A 3KSUA 4ESOA 3FCOA 3MOGA 2VWPA 3ST7A 3PYMA 1E1NA 4IDAA 3GN1A 4BO2A 5ENVA 2HRBA 2Z1NA 1T1RA 5CDYA 4YA6A 3ONDA 2GPTA 4C7JA 3GK3A 3DHNA 2Q4BA 4GWKA 1WWKA 4JLWA 1ONPA 3F3SA 2WWRA 2FRDA 4KTTE 2R00A 4LN1A 4MIOA 3C1AA 1GAEO 3KYDA 2PWZA 4NK4A 1ENZA 4FFOA 4N54A 4YCAA 4G2NA 4YEDA 5T67A 4BNKA 1NR1A 1YJ8A 3KEQA 1OC2A 2EG9A 4R1SA 4JP3A 4M49A 2W8ZA 5C5IA 5IFLA 2C20A 4D3FA 5TLSA 1PQPA 1I2ZA 3FNFA 3HFGA 4LVCA 1C14A 3WFIA 1H9AA 2EW2A 4BNWA 1Q7CA 3GVPA 2C29D 3DZJA 1MC4A 2IZ0A 2OZPA 1YH3A 2I6TA 3AI2A 4BUCA 2Y1CA 3EY4A 5DULA 2TMDA 2ZYDA 4PLZA 5KVCA 5A02A 1UR5A 4XA8A 2NACA 1F06A 1R6DA 1ADCA 1DFIA 1HL3A 3F6YA 1UXHA 2WD8A 2RH8A 1A4UA 8ADHA 3H5AA 3PPIA 2O23A 5TC4A 4KOAA 1EUCA 5JYEA 3GUCA 3HB5X 1DHTA 1S6YA 2WD7B 1HDCA 3PLRA 5FWNA 1GV1A 1ENOA 2JD1A 2VHWA 5GY7A 5BSEA 2B0JA 2GCGA 2I5PO 4A26A 3PDUA 5G4KA 3ANLA 1LXCA 1U5CA 2B4RO 4FCCA 4OL9A 3PIIA 4HNHA 3E9NA 4CM7A 2Q3EA 2RCYA 4BS9A 4E13A 4GKVA 1XU7A 2FSSA 4PLCA 1NM5A 1CRWG 3LZ6A 3DMTC 5U9CA 2UV8A 4URFA 1LSOA 4PZEA 1H9BA 4L73A 4S1VA 2DFVA 4G65A 1A7AA 5FF9A 3VZPA 3S2IA 5IF3A 1LI4A 1Z6ZA 2DT5A 3HJAA 3PHHA 1E92A 2EF1A 1VKNA 2PV7A 1TEHA 1SEPA 2DTDA 3WBFA 1LC0A 2IZZA 3G1UA 4Q3NA 4JJGA 4Y6PA 4XQCA 3ZHYA 3H5NA 1E6UA 1QYWA 2Z1MA 4PGFA 3ZWMA 4JXKA 1NHWA 5T57A 4PLHA 3LF1A 2BGKA 5A04A 1HDGO 1MB4A 9LDBA 4GSLA 3OA2A 2X9VA 3TOXA 2ZQYA 3FWNA 3G79A 3INGA 2B69A 3QQPA 1ISIA 4ND2A 1YB1A 2YV1A 3UVEA 1HE5A 3SVTA 4NJMB 3UUWA 1U2DA 1I36A 1ZMTA 3H7AA 1T2AA 1CJCA 4UEOA 4FR5A 3I52A 4N5NA 1RM3A 1ZEMA 5A9SA 3C8MA 2DPHA 1Y5MA 4BNLA 1BW9A 2C0CA 4NFYA 1E7MA 3H9JA 3K9QO 2OP1A 3EYWA 1C0IA 1WDKA 4PLFA 4YRDA 4Z0HO 1SMKA 5CDTA 3X2EA 3KBOA 2GR9A 3E6AA 4ZA2A 2GZ2A 2CVQA 4PG7A 4U0KA 1ZSNA 3CEAA 3F46A 4TVOA 4YTEA 2X5JO 3N58A 4BV9A 5L95A 2Y67A 3FBTA 1PGNA 4JGBA 4JK3A 4AJ1A 4MVJG 3DC2A 3BMQA 5CPFA 1YQDA 3IKTA 1N1EA 3BMOA 3HADA 1NVTA 4ZD6A 2EKPA 4Z9XA 3S1LA 5CEEA 2NVUB 3S2EA 3IC5A 4MIEA 5ICMA 3PJEA 1ADGA 5T8KA 1CF2O 1CWUA 5KJEA 5T5QA 4HFRA 2YDXA 1W4ZA 2VRCD 4NFHA 5GZ6A 3HDQA 1OZAA 3L0DA 2X23A 2Y1OA 2NLOA 4YJGB 4CMIA 4RZHA 1E3SA 2NTVA 1LDNA 4EBFA 3QWHA 4P22A 1RWBA 4YJDA 5KKCA 6ADHA 4GWGA 1P9LA 3SLKA 1PX0A 3GG9A 1VL6A 3JQFC 4IQ0A 3UW3A 2O7QA 4OXKA 1NXQA 2O4UX 1XYGA 3PQEA 2DBRA 5CG2A 4GVXA 5KJFA 4Y8VA 3TNLA 4D45A 4E5PA 3HDJA 2QYSA 4BNNA 4FDAA 4XWYA 4QTZA 2X7HA 3ZWVA 4NPCA 1YB4A 3QHAA 3F1KA 3G0OA 1LNQA 1EUZA 1E7SA 3DBLA 2BFOA 4ZVVA 3OEWA 3KXDA 1T4BA 1ZO8A 2HLPA 2YV3A 1DSSG 1NQTA 1O6ZA 1YQGA 1HDYA 4L4SA 4UUPA 4I1IA 5AYVA 4J90A 1DJNA 4IINA 2JAHA 4BNYA 4RPHA 4YAEA 1F17A 3GQVA 4PVCA 1H6CA 3ETGA 4DREA 5I7EA 4OQYA 3O26A 4J1TA 2ZTVA 2AG5A 3G17A 4OOFA 1BXKA 3AU8A 3DXFA 4INAA 1HXHA 4MO2A 2PTGA 2QZZA 2YUTA 5CPBA 2NUAA 5L4LA 3I23A 3AM3A 1VSVA 4FSHA 3PZBA 4OJNA 4XYMA 5G0VA 1JN0A 1RYEA 1KEPA 1VM6A 4MKXA 4LK3A 3PFFA 1Z74A 4AICA 1AXEA 3PXXA 4P4GA 4Z9FA 5KVSA 1KVQA 2Y1DA 1LBEA 2NVBA 4D46A 2XPCA 1LUAA 4HV4A 3QVOA 1KEWA 2FMUA 4R01A 3STHA 4WECA 2LDXA 4OGWA 1GZ6A 2XF8A 4RVHA 2O50A 4PLYA 3EGOA 3EHEA 5CDSA 1EZ4A 1PL6A 1FDWA 5EN4A 3DOOA 4PZDA 3SJUA 1VJ1A 4F6LA 2D3TA 1ZK1A 5J23A 4J2HA 4MP3A 1CETA 7ADHA 3GT0A 4R1NA 3I6IA 4I8XA 4IXWA 3P7MA 3OJOA 3CXRA 4KQXA 4UEKA 5ES3A 2J3KA 3F5SA 3MWEB 1N5DA 2EWMA 5F3RA 3ULKA 3C24A 1E6WA 1HE3A 4MINA 3F1LA 4J1SA 4RF2A 4RVFA 2HK7A 3DO5A 4B8ZA 1SAYA 4ZQGA 4J7CA 4IDCA 4F46A 3LT4A 1Q1NA 4O6VA 2QZ9A 3KYBA 4WOKA 4BNMA 5TJHA 5TF4A 3BAZA 4DRYA 2EKQA 1RM5A 4EYEA 4ZQEA 3DBHA 4JP2A 1PJQA 3GC6A 1X1EA 2DUUA 1HSOA 3DBRB 1E3WB 4ND1A 5CEJA 1ADFA 3I9OA 4J3FA 3IJRA 1P0CA 4AJKA 1NQ5A 1UDAA 1LRLA 1B3BA 4UUOA 1YXMA 4GBJA 1J0XO 2RBEA 2PH3A 1GY8A 4KWHA 1DC6A 3LLSA 3S2FA 3V1YA 3ZWNA 1ZK2A 2I65A 3DHEA 1GZ4A 1UP4A 4R5HA 3FBGA 3L4BC 4KUGA 4DYDA 3RKUA 4E32A 1LRKA 2QW8A 1E6EA 2XXJA 1J49A 3ZZNA 1IE3A 2CFCA 2Y68A 4CMEC 2NADA 3E18A 4FD3A 1I3LA 1JQBA 1M2WA 2IE0A 4OXNA 3D3WA 3ROQA 3GOHA 1SNYA 4GLOA 1Y8RA 2AXQA 4RPGA 4UUMA 4R3NA 4BIIA 4CUJA 4E0BA 4W9NA 4DLAA 5JC1A 1XCBA 2C59A 2FN7A 2VRCA 3EVTA 5CEFA 1BVUA 3WWYA 1EVZA 3K2EA 2AQKA 3ZI0A 3ZW9A 1YS4A 3IMFA 1PGOA 1YL5A 1ORRA 4JCOA 4QECA 4DQVA 4FGSA 4R9RA 2GSDA 1ZIDA 3TWOA 4P4NA 2BRUA 5FYDA 5JDCC 1U2GA 4Q39A 1X7DA 2C82A 1DOHA 1Q0HA 2AG8A 3LC2O 5EERA 3SLGA 4YT5A 4LCJA 2Q1UA 1SCUA 4PFJA 3PHGA 5G0SA 1QLJA 3GPIA 2Y1EA 3JYNA 1GUFA 4HNGA 1NPDA 1XR3A 3GVXA 4IS2A 1H93A 2O4CA 1HZZA 3KB6A 1DIRA 3KEOA 3M2TA 4Z3KA 2NVWA 1QLHA 2AA3A 4GQAA 2WJPA 2VUTA 4M1QA 2GO1A 4GMFA 3E9MA 1SZJG 4Z0TA 4CM9D 3I9KA 3W8FA 4ZRMA 2FPIA 3VPGA 2D2IA 2RIRA 3LYLA 3RJ9A 3CH6A 3PGXA 3GGPA 3H2ZA 4GAEA 3UH1A 5BNTA 4OSPA 5L53A 3C7AA 3GAFA 4E31A 5TIIA 3JQ7A 4F6CA 3WTBA 1C1XA 1DIHA 1Z75A 5IDWA 3AI3A 4U7WA 1HZJA 2ZK7A 2BH9A 2O3UA 4CPDA 1DAPA 4YVFA 3JQAD 1UJMA 2EV9A 3ABIA 3IQDB 5BSHA 1QYCA 3O9ZA 4GH5A 3Q2KA 4KMSA 4RF3A 2P9GA 3KM0A 1C3VA 1RKXA 4AJJA 3UOGA 1B2LA 2I99A 5MGBA 5COBA 1LQUA 1KBZA 2FY8A 3A9WA 4G81A 4DMMA 4A03A 4J2OA 3L07A 4CMBA 2P68A 5JBIA 4YACA 5ILOA 1R37A 3PGJA 4CLRB 1V3VA 3JV7A 4CMCA 1WP4A 2Y0EA 1LDBA 1EE2A 2AE1A 4CLOB 1U28A 2JCXA 2G82A 2YHIB 3WGIA 3KZVA 1A7KA 3DAGA 4B3IA 4GVLA 3LC1O 4OMUA 5A9TA 4E6PA 3LQFA 1LA2A 1X15A 1PQWA 2HMTA 4CQMB 4K1LA 1P44A 2ZJ0A 4DMLA 2NTJA 1Y81A 1YKFA 2ZB4A 4XD2A 4BOYA 4NK5A 2PLAA 4H16A 3TZKA 4U6SA 3MEQA 2Y0CA 3RC1A 5ITWA 2X9GA 1I2CA 1UZMA 3I5MA 1T2FA 1ZJYA 5H81A 5JW6A 1Q7GA 2VZ0A 3VPHA 4CLDA 5CDGA 4WE3A 1IB6A 1YONA 2OP0A 3OM9A 1X13A 5I7VA 3F9IA 2GN8A 3I4FA 4K26A 4EZBA 1QMGA 2HMSA 2J5QA 1I30A 3QV1A 3JYOA 1N9GA 5F1KA 4BB5A 1A4IA 4D7AA 4LISA 3TZCA 1YB5A 4AJNA 1E5QA 4GX2A 1JDJA 2FZWA 4UVDA 4CUKA 4ZJUA 2D4AA 3H2SA 2PGDA 3GZNA 2AEJA 5L51A 3VTFA 1Y6JA 3GVCA 4FC6A 1DBVO 3PQFA 2P91A 3VKUA 1H2BA 2BHLA 4ID9A 4YWJA 3WGYA 4M8SA 3RCBA 5LCXA 4J4BA 4IUYA 1BXGA 1T2EA 5IXSA 4R4JA 2UUOA 2R00C 2OUIA 2D59A 2HQ1A 3OIFA 1GFSA 3U4HA 1LLDA 3A14A 4UREA 2QRKA 6LDHA 3O8QB 3ZWCA 2BFPA 3ANNA 4ZQFA 2VHZA 3AUAA 4IPTA 4QSMA 2B5VA 1CERA 1PZHA 4EJ0A 5EQFA 1EMDA 2OBYA 4NJOA 4FOSA 2NV6A 1VKOA 4TRMA 3IJPA 4ITUA 2HK9A 1KERA 1FDVA 2HMUA 1SB9A 4R5MA 4WLNA 5DBIA 3U9LA 3HB4X 2GZ1A 2PD6A 4OAQA 4YJHB 3T7EA 2ZKLA 4MJLA 1P1RA 1UXIA 5B4UA 3JQCA 3PJFA 1DIAA 4L4XA 2J8ZA 3QVSA 4D44A 2P9CA 1SB8A 5B4VA 3L9WA 1UDBA 2FR0A 4J4TA 4JBHA 1LRJA 4MKZA 4N5MA 3UCEA 3V2HA 1YL7A 5JLAA 5I7SA 1TI7A 5HRUA 4DA9A 4J7UA 3ITDA 3SC6A 3RU7A 3V2GA 3NEPX 3RBVA 1G6KA 4MVJI 5A5FA 4NBUA 2GUGA 2JFHA 5ILGA 3PFWO 5DNAA 1YBVA 2JJYA 2B4TO 1U3UA 2D1YA 3PIDA 3T7CA 4CM9A 3M2PA 3NDRA 4Y6SA 3OH8A 2EXXA 1B7GO 3TZHA 1EUDA 1HDRA 1O89A 3VDQA 3VOSA 3WOHA 2P5UA 1I24A 3NJ8A 5JPIA 3ETDA 1WNTA 1DFHA 4CM4A 1I5RA 1DC4A 5IZ4A 1JW9B 1VRWA 2I66A 4FFNA 1GADO 3DTTA 4ZHSA 2O3JA 4RJTA 2IEBA 1DEHA 3NV9A 3K96A 3EMKA 5JDIC 3GZ4A 1E3LA 2JFGA 3AFMA 2CNBA 3JQAA 1PR3A 3ICPA 3PJGA 1EE9A 1R16A 3Q3CA 3Q1LA 4RLHA 4IDFA 3U4CA 3WGOA 3EW7A 4J0FA 4RVGA 1GR0A 3RROA 2O48X 5G4KB 3WSWA 2DU8A 3WGTA 5HBRA 2OHXA 2ZATA 1VLLA 3KHUA 1YDWA 3QWBA 4NHEA 1VJTA 1ZXLA 4O59O 3S2GA 3VVCA 3AUSA 4ZICA 5AVOA 2LDBA 4EI2A 2G1UA 2NQ8A 1YQXA 3B1KA 4RDIA 4JBGA 3H9QA 3OJEA 1M6WA 5CAEA 1MLDA 4QO8A 1YOVB 4JJFA 1G1AA 2IDZA 3RWBA 3R0IA 1R4MA 3CZMA 4BNUA 4FQ8A 1GUZA 5C7IO 3L6OO 1UAGA 1RJWA 3PZRA 4NBVA 3DZFA 3Q6IA 4EDFA 4RL6A 2WE7A 2DC1A 3GY0A 4NBRA 3ZWPA 5DBFA 4AJHA 1R4NA 3VPXA 2DTXA 2FR8A 3DOCA 3CKYA 3VH1A 2VCYA 1KVTA 5AXCA 5KKAA 1ZEJA 3I9MA 1WW8A 1BWSA 3OETA 3ROPA 4OM8A 1B14A 1DJQA 1R0SA 4O0LA 1IPFA 5EL0A 4FPXA 4WCDA 5JC8A 4RORA 2WM3A 1YBMA 1ZK4A 4C7KA 4WGGA 3HN2A 4D79A 2P4QA 3RUCA 2IYOA 3QE3A 4CMHA 1K0UA 4D43A 3Q9UA 4QT0A 1BW9B 3GVHA 3JCZA 3GLQA 3B6ZA 5IZCA 2VWGA 4IBOA 5DN9A 4GX0A 5T8KC 1A27A 2AW5A 3ZHBA 1Y9AA 3OSUA 5CDUA 3QWIA 2X0JA 4CM6A 1W0CA 4YT8A 4CM5A 4XGKA 2HMWA 1MXHA 3DTYA 1PJCA 2XXBA 3K8ZA 2CD9A 1BHSA 1DRWA 2I76A 3BMCA 4RCVA 1U5AA 2O2YA 5AXDA 5C37A 1UP6A 1YO6A 1PZFA 3ZWOA 4ALIA 2PZLA 4J49A 2W4QA 4IDEA 2HJRA 1QR6A 2V7PA 1K6IA 4II3A 2BI7A 4PG6A 2E4AA 3BMOB 4EUFA 4DXHA 1J6UA 2CZCA 1AUPA 1G0OA 3AFNA 5A9RA 1BMDA 3RFTA 1HE4A 1TVEA 4YAKA 1ULSA 3P2OA 1V8BA 4DQXA 4AJEA 1GUYA 3W6UA 4A2CA 4NU6A 4FW8A 5CFZA 3O38A 3VHRA 3RU9A 3QY9A 1L1FA 2YJZA 2AEFA 4CMIB 1LLQA 1WAMA 5B12A 4B4WA 2PFGA 2G0TA 3QWFA 3GVIA 1D8AA 1OBFO 4CMGA 3MJTA 3ZNNA 2UUPA 1F12A 3GRPA 3ZDFA 5JCJD 4J43A 4CQLA 4CV2A 2FHSA 4FJ1A 4AG3A 5LDGA 5JMWA 2GF2A 3G49A 1MV8A 1I10A 4IGFA 3DWFA 1YGYA 3BA1A 3OHSX 4Q3AA 5A4DA 1LDEA 4BO0A 4ZN6A 2ILTA 3AW9A 2J3JA 4AJLA 3PI7A 3F5QA 4GMGA 1UZLA 3DFZA 3ZHXA 5JSFA 3DBLB 1LSJA 3WFJA 1SEVA 2VUSA 3OF2A 1K6JA 1T24A 3WYEA 4MVJP 4PG4A 2HAEA 4XKJA 1U4OA 1A5ZA 5JY6A 4Q3BA 4PLGA 4L74A 2V6BA 3KTDA 2JL1A 3GGOA 3GR6A 3QVTA 4MVJE 1FDUA 2NQTA 3RUEA 3TQHA 1GQQA 5TX7A 5GZ1A 2VZ8A 4D0RA 3OP4A 4UEJA 1E3JA 3U0BA 5TSDA 2WD7A 4CODB 1DHRA 2J5KA 4Y67A 4BO3A 1YRLA 2H1SA 1DDOA 3JTMA 5AQ1A 2PGLA 3BMNB 1U7TA 4LSMA 1X0VA 4RZIA 4BNVA 4XQ9A 1MGOA 1P45A 5GMOA 2Q2VA 4GX5A 3ZU2A 1XLTA 2EJVA 4P4LA 4MVJH 5K6AC 3D7LA 3CIFA 2AEMA 4B8WA 1IOLA 1JVSA 1Q2XA 2BI8A 2UAGA 4LSWA 4RVUA 3RUFA 1SC6A 1PGQA 1R0LA 2NM0A 1ZKMA 3ASVA 4LMPA 2E37A 4AJOA 4DTIA 1JWBB 3HWRA 2Z5LA 5IDXA 3VH2A 3ENKA 2WEKA 5IDQA 2O3RA 4R9SA 3A06A 2BFAA 4ND4A 4QFCA 4I9HA 9LDTA 4W4TA 2VYVD 1BGVA 2OOSA 2E82A 2NU7A 2W90A 4ZQBA 5L7WA 1V35A 3AUTA 3IP1A 2G5CA 5LDHA 4E33A 1QG6A 2B36A 2F1KA 2FPGA 2ZTUA 1EBUA 5GZ3A 1EDOA 1KVUA 3L6DA 1P0FA 5FI5A 3NYWA 3DMTA 1WDLA 5F21A 1V3TA 2DBQA 1L7EA 4HX5A 4E2XA 1R12A 3JD4A 5BSGA 5THKA 3JD0A 1TA4A 2VYND 4U6QA 5H82A 1PL7A 5G0UA 4MVJM 3UHAA 4NJMA 2G17A 1H94A 4D3SA 2NU8A 3HZZA 1ZMOA 2X9NA 3ASUA 4KDEA 1XEAA 1FXSA 1FK8A 1WXDA 4FN4A 3WLFA 5JE8A 4W9NC 1CEQA 4JIGA 3KV3O 4LRSB 4LMRA 4NIMA 1C1DA 2H5LA 4QFDA 3GNSA 3ZWAA 5U1PA 3S8MA 4CLHA 1CDOA 3WSVA 4GGPA 3D0OA 3INRA 3NAQA 4XDYA 4LCEA 4OSOA 3HFSA 4JROA 2FOIA 1ZK3A 2PKQP 3JQ8B 4UVGA 4WLEA 4L9RA 3RAJA 3C7DB 3IIEA 4QEDA 4E3ZA 1IPEA 3KLMX 1E3EA 2W2LD 3DB2A 1X0XA 4Q3CA 3MZ0A 1FF9A 1H2HA 3D3WB 1N7GA 2BF7A 4J4HA 3GDFA 3M1LA 3ZU3A 2XAAA 2FSVA 1EQUA 4EUHA 2NVUA 1KC3A 3PWZA 1Y9EA 3WB9A 3WQQA 2POQX 1O94A 4DLLA 1ZUD1 4I5DA 3QJ5A 3U4DA 1NX6A 3E1KA 1XU9A 3DR3A 4PIVA 2CVOA 2FP4A 3SEFA 3JQBA 1NAHA 3AY6A 4YJGA 5IN5A 2GNAA 1I8TA 1UXKA 2WE8A 2R6JA 1W8DA 4KUHA 3IDSA 5JO9A 1Q7BA 3BTSA 2Y0DA 3EK2A 1GV0A 2H63A 4UUNA 3GN2A 4ZU3A 5AXAA 1PJ4A 4S3MA 3ZV3A 1N7HA 1ZZEA 4BNFA 2NU9A 5COQA 3IUSA 3PRJA 1I32A 3FHLA 4R1UA 1JKIA 3TF5A 2B4QA 3ADPA 2VHVA 1GTMA 3BXXA 4W7IA 1RYDA 4CM8A 2HSDA 3AOEC 3CINA 1IHXA 3ZWBA 1MA0A 1C0PA 4IGEA 3R3JA 4B7XA 1GYPA 4RLSA 4W6ZA 3H6KA 1HKUA 3GGGA 4JBIA 5KJ6A 1CYDA 3O4RA 3L6EA 3V5NA 3KSDO 3TL2A 1IZ9A 2ZB3A 1PJ3A 5I8ZA 1HYHA 4KQWA 1ZNQO 2D8AA 2OO5A 3PWKA 2BELA 3QVXA 1TT5A 4EGFA 1BDBA 3ONFA 1ML3A 5JAMA 3NTRA 3AM5A 2VNAA 5KCZA 1QSGA 4GL4A 3W4KA 4EITA 1LX6A 3C1OA 2AMFA 4CV3A 4A7PA 1B8PA 3L9XA 3MJCA 3ON5A 1JU9A 3WYBA 1V9LA 4XB1A 1QYDA 3DZKA 3K2BA 4NBTA 1VL8A 2HRZA 3TZ6A 2VHXA 2E48A 1QKIA 3E9QA 4NZ9A 3CMCO 1NR7A 1ISJA 4J16A 1QRRA 4TZKA 1GYQA 4Z6KA 1D3AA 3OQ6A 1TLTA 4W99A 3IP3A 3OEYA 2ZJ1A 1A72A 4GI2A 1NQAO 5CP8A 4DVJA 1S7CA 2PD4A 3LC7O 1GPJA 3KOUA 4NG5A 4FFMA 3L4SO 1FDTA 1NFFA 3AUUA 1N92A 3I9JA 3COSA 3PVZA 4ONEA 4MVJD 1V3UA 2B37A 5BNFA 4NH4A 2GDZA 1NNUA 2X8LA 3PP8A 4O1MA 1JVBA 5BT9A 4F3YA 1ZSYA 1Z73A 2VYVA 1IZ0A 3RJ5A 3GRKA 3I83A 3CSDA 4XQGA 1M75A 4ZQHA 5I7FA 4WASA 3BZUA 1BTOA 3BHJA 3HDYA 2PKRA 1XDWA 2YQ5A 1VI2A 4HY3A 1NVMB 3C85A 2IXBA 2PA3A 4M55A 2JHFA 4WJZA 4QQRA 5DP2A 4BKOA 4CQMD 5JFOA 4DL9A 2VOJA 2VYNA 4TKLA 2V6GA 1UXGA 3EUWA 1DRUA 3CPSA 2X6TA 1PR9A 4BO5A 1KY5A 2WMDA 3T4EA 4LGVA 3ICCA 4E2YA 3GA0A 4WCFA 5DDIP 4BV8A 1IL0A 3IL2A 3TZQA 2BLLA 2PZKA 3DBRA 1XQ6A 3W8EA 4E21A 2X0RA 2A35A 2EJWA 3LU1A 1I3KA 1ULUA 4TQGA 4ROSA 5THQA 5K0ZA 3AWDA 3U09A 4BGVA 3PLNA 1XA0A 3LSYA 4FGWA 4IIVA 1GQYA 3E82A 3GHHA 1GDHA 1GEGA 2X4GA 2CY0A 1M76A 1ZH8A 3AY7A 4RGBA 5TT0A 4E5NA 1I0ZA 2OL4A 4MDHA 5F1PA 4YRBA 3JQEA 4NDNE 4OKNA 1VSUA 4WEOA 1PJLA 3OJ0A 1BSVA 3W8DA 3FTNA 3EC7A 3DOJA 3UGKA 4ALLA 3NUGA 2W2LA 3U3XA 1O5IA 3ANMA 1EFLA 4AFNA 4AJ4A 5A3VA 2X5OA 4A73A 4BB6A 3JYQA 2PKQO 4M54A 3RUHA 7MDHA 4C4OA 2A94A 1ONNA 1F0YA 2DQ4A 2ZTMA 4I5GA 1I2BA 2BKAA 3TPCA 4BO6A 1KS9A 2DVMA 3K5PA 1C0KA 2C07A 3WMXA 4RV9A 3M1AA 4WKGA 2OFPA 4M86A 4OHUA 2J3IA 5EIOA 1E3IA 2B5WA 3BHIA 2JFFA 3LT2A 4HFNA 2G76A 3JD3A 4A0SA 5JAIA 2WYUA 1GPDG 5B4TA 2VN8A 2B83A 3M6IA 3QSGA 1J4AA 4L76A 1QYXA 4UVHA 4Z3DA 1UH5A 3CE6A 2YY7A 2VWQA 1Z45A 3KLPX 1U1IA 1JKJA 4CMEA 5TS3A 4A5OA 2IZ1A 4XJTA 4NR0A 2JD0A 4GGOA 1XELA 1ZJZA 4AJPA 3LK7A 2Y99A 2DUWA 2BD0A 1U9JA 2HCTA 4PCVA 3ONEA 1BDMA 1HEUA 2VUUA 4IQGA 3H4VA 4CL3A 4DQUA 1NPYA 4BKRA 2FPPA 2Q49A 3I9LA 5IAAA 2PD3A 2JCYA 1LDMA 3RI3A 3RC2A 3H8VA 5G4LA 4HADA 5HM8A 1P77A 3JQGA 1KVSA 4IDBA 5ADHA 2JAPA 5L45A 4K6FA 2X1HA 3QVWA 3WMWA 5C7LO 4WLVA 3E5MA 4E5YA 4CM1A 4FBGA 5EJ2A 1H6AA 1IULA 4N5LA 4CM4B 4XZ3A 1RM4A 1U3WA 3H5RA 5G2OA 1QV6A 5JAQA 3NGLA 3GG2A 1K5HA 4P8RA 2NTNA 5BNIA 1NASA 3PHLA 2BGLA 3PQDA 2FWMX 3FPCA 3GNTA 3JQAB 3HQ4O 1T1SA 2C5EA 1ISFA 1OAAA 1PJ2A 4YJFA 5H83A 3ROKA 4BGEA 3DAPA 2GD1O 2IODA 4DIBA 1UAYA 3MOIA 3FF4A 1ONOA 2P4HX 3LLVA 1Q0LA 2DM6A 3ZGYA 1I3MA 1E7RA 1LLCA 4MVJA 3VPSA 1KEUA 1I01A 4TKMA 1W73A 2HKIA 1JA9A 4DPMA 4YPOA 1Y8QA 2ZQZA 5HS6A 4BGIA 2DAPA 3HE3A 1LLUA 4OOEA 1T2CA 4YAGA 2AQIA 4TZTA 4XQEA 3WXBA 4BNXA 3FWZA 2ZB7A 1V0JA 3KYDB 4FFLA 1R4MB 2EEZA 3B1JA 4WEQA 1H0KA 1P1KA 4YBZA 3F4BA 1HF3A 4O63O 3ZV4A 1N8KA 4BO9A 2W2KA 2Q50A 4I9NA 5IZCC 1FMCA 2BMAA 4CQMA 1MC5A 1R15A 3DBVO 4NQZA 5KIAA 3Q0EA 4NMHA 4NNJA 4HP8A 3JQ9A 1WPQA 4OQZA 3OECA 4B7UA 4MKRA 4FB5A 1E1KA 4RO0A 1PEDA 3MCVA 4IM7A 4EJ6A 4R41A 2EHDA 2OMEA 1MXFA 1V6AA 5I8WA 5DT9A 3OIDA 1P3DA 1VJ0A 3W6ZA 4BNZA 4PG8A 3GEGA 3RUIA 1VE9A 3GMDA 4RDHA 3WIDA 3FN4A 4CLXA 2X0NA 1LSSA 4CLEA 1ISHA 2XOXA 1R0KA 1Y7TA 1F14A 5HWSA 1ZBQA 5HA5A 1F8FA 2NU6A 2V6FA 1JWAB 4WNCA 5L7TA 1JTVA 1Z7BA 1OMOA 1H6BA 4HFMA 4RQUA 3TJRA 4B79A 2R2GA 4CMJA 1A9YA 1YE3A 2YW9A 4U0JA 3KYCA 1SOVA 1ARZA 4CR7A 3TOZA 3BMCB 5CG1A 1OC4A 4PG5A 4XIYA 1UDCA 3AOGA 3HSKA 4YT2A 3AJRA 4Q3EA 4DBZA 1PGJA 4DBVO 1NVGA 4BMNA 4IDDA 5DZSA 5L4SA 1LJ8A 3L77A 3AY3A 4DC1A 1ID1A 3D1LA 3U49A 4YDRA 5HTOA 3PEFA 2EW8A 2FR1A 4MPDA 3QA9A 3OFSA 4IDGA 1FJHA 4A10A 5LC1A 3NT4A 3B70A 4EEXA 3ZW8A 2Q2WA 5KVQA 5I9LA 3ZNQA 4E2WA 4PRKA 3ZNPA 2VHYA 2QHXA 1Z82A 3GUYA 5EQDA 4YJHA 4XRGA 4LVUA 5KVVA 5EPOA 4BNTA 3MTJA 3NRCA 4CQLB 4DGSA 5EINA 4GX1A 3NGXA 3CUKA 2P9EA 5G0WA 3V2UA 4MP6A 4BQRA 3FNGA 1X1TA 3P5SA 4IQ8A 3RC7A 2YQ4A 4J91A 5A06A 4BKQA 2E6UX 2Q2QA 5A9SB 4CV1A 4IMRA 3ETEA 1K6XA 4K9DA 4CV0A 5TJ9A 4IZHA 4MOWA 4XDZA 4IS3A 1HYEA 2EGGA 2O2SA 1TXGA 4R1TA 5L7YA 3RD5A 3OQ1A 4I5FA 5DBGA 3AK4A 1N2SA 2O3TA 2CDBA 2DBZA 4LW8A 1M67A 1UXJA 4U8GA 3ZWWA 4CL8A 4EJMA 4NI5A 3C7CB 5I9MA 1PZGA
chains in the Genus database with same CATH superfamily
2RAPA 2V7EA 3QLJA 5F5NA 2ZBVA 2O3QA 3NHKA 4M0CA 3NTUA 4BYGA 1H4QA 5FORA 1XQ1A 2RD2A 1L5GB 5B7QA 2P0EA 3R1IA 3UWSA 4A0GA 3RS3A 2OKGA 2XGGA 3N2LA 4B74A 1YR6A 3VR1A 4UVIA 2G4VA 2AR0A 1N3IA 1ATZA 4PRZA 4W82A 4PN7A 3E9RA 1J8QA 2YHBA 3A1FA 1RMTA 3EZGA 5L9AA 3ONNA 3D3EA 1DU4A 3C1TA 4XLLA 1DB3A 1RZRA 4PHTA 3OT4A 3ZJVA 3FFBA 2FFAA 5DNYB 4W5WA 2APJA 3R0QA 1J9GA 4L5CA 2GJ8A 5DFAA 3C5HA 3GFSA 4UAGA 1IUKA 1TGYA 2G9RA 2D8MA 2VZLA 3MJVA 1ZOSA 3LW7A 3W0LB 3WKAA 3V4OA 1G8YA 1GCUA 1WQ4A 1CIJA 1Q21A 1MJFA 2W22A 4JJEA 3UUFA 1XFDA 4DIKA 4K3UA 5EY5B 4BO2A 3P0EA 1AQNA 1BQ4A 3R7BA 1VL2A 2VTBB 4JLMA 5IS2A 4HRVA 5SY4A 2DWQA 4DZRA 3EXG1 3Q9NA 3OZWA 4XTRA 1P1JA 4HNTA 2GN6A 3Q9SA 1D04A 1DT3A 1HDIA 2AX3A 4H35A 2FB9A 4D99A 1RI3A 2WIGA 5BQ5A 3NTQA 1DL5A 3BDVA 1SD1A 3FCXA 2H9YA 2V65A 1C8BA 1EXVA 4FUTA 3TOSA 3TTWA 2B8EA 1G291 1M8JA 1X6VA 2ZYGA 3PR1A 4GSKA 4I7EA 4Q4LA 4TMZA 5CXXA 4KITB 4PTZA 4FNGA 1VB5A 5J9FA 5FYQA 4J6EA 4BN4A 4W1PA 5IABA 3AHJA 2HLDA 3B2EA 1H8ED 1KY4A 2P6NA 3OM0A 2IYQA 4JYPA 2CFIA 5JECA 4L7VA 1GZ3A 4Y3UA 3H2JA 2BGRA 4PCLA 4MHSA 3DTVD 1YKGA 2NSLA 3D5TA 3TK1A 2IYTA 1K7EB 4C0QC 3TS1A 1AHIA 2OCGA 4LY9A 1W2WB 4I3FA 5G0TA 3RBXA 2JI8A 3KKNA 2OFWA 4Q48A 3SI7A 4AL4A 4EFLA 3QXSA 3Q8MA 5JUWA 3WIBA 1LEHA 4D3XA 4ZYLA 2VKTA 4B3HA 2WPDD 2CHGA 3E22A 4G8BA 5DHAA 1WZEA 3WNVA 4EPRA 2B94A 2QZPA 1JHOA 4BNIA 1WS6A 2GYVA 2ZBGA 5DHRA 1W0KD 4RIIA 1Q3HA 4EGAA 3G9TA 2NSDA 3AF1A 4CL2A 1E2BA 4IJKA 2GXAA 3AVPA 3VOBA 1F5SA 3PHJA 4YRSA 3TUZC 4Y7DA 1JG2A 4Y1FA 3U62A 2W2XA 4E12A 3R77A 3OVMA 3ETNA 4WPGA 2YYAA 3D0QA 5ICFA 4ZCRA 4BVKA 2JFQA 3CTPA 4CIAA 3SEZA 1F4PA 5BN4A 3F6PA 3EXFA 1YT5A 4RXTA 1YJBA 1I2DA 2EIHA 4EF4A 3SWWA 3QLTA 4LJ5A 5J2UB 3O2JA 1PHRA 3V4VB 1QR2A 4HQOA 1SUFA 3MIIA 1VB3A 2JVIA 3L6RA 4MQ6A 1FNSA 3RASA 2VT6A 4GBED 4ND5A 1XTZA 4YROA 1RTKA 2WA1A 1R2QA 5EWMB 3WS7A 3DDSA 3GF4A 4PHHA 3FMOB 1XROA 3D6AA 4W9MC 1DPGA 3LPAA 1YIAA 2BGJA 1RMYA 4TL9A 1EWKA 2H1LA 1MRSA 1PTJA 2O54A 4C7XA 1QQ7A 5CBKA 3IAM6 4POOA 2CXSA 4M38A 1JIUA 4YUYA 4ZO6A 1M83A 2B2CA 2QGFA 2X22A 2W6PA 3TEJA 2OPBA 3OKCA 4B44A 1O0BA 4N7JA 1BH2A 1UOEA 1WNFA 1GGFA 2O3SA 2P77A 4OQEA 3C39A 1YASA 3AEUB 4ZT2A 3SY8A 2ODBA 3CBGA 3CGWA 3UXHA 4B3JA 1QVAA 3TSYA 1GFWA 1DQNA 4OBEA 4JX8A 3V1MA 1S2NA 2A67A 2WTEA 4PO9A 3RIGA 4RTRA 2JEZA 1S1CA 1CJUC 2JHGA 3RC9A 1E7WA 5EQTA 4MYDA 1QFJA 3AERA 3EEIA 5A3QA 2XB4A 2C4VA 5HFJA 5HILA 3U3MA 2XTJA 4CM3A 5A4FS 1FMFA 4TXNA 2Y2UA 3ZZ1A 2DECA 1OFUA 4FBMA 1WQ1R 2RGBA 1TEVA 5IBRA 1SBQA 3GFBA 3IAM1 3DCYA 4QM6A 1T13A 1XJ5A 3QUCA 3EIHA 4CM8B 3R9XA 3L92A 5KYNA 1BEUB 5KQMA 3PLAE 1KJWA 1G3IA 4U2FA 2JJMA 4JR2A 1UWCA 4LK2A 3Q7SA 4P7GA 4WA7A 3LHIA 2GN0A 1TJ3A 2E1PA 4YAIA 2EP8A 1IY0A 1YZKA 2C7VA 2X77A 3LQQA 5IN4A 3RS4A 2OCKA 2O8FA 3RSHA 5HOEA 2HB6A 1AO0A 4QUBA 1LBTA 3CR8A 1XEXA 1XDSA 5HUQA 2ECKA 3EFBA 2KQUA 1MQSA 5IJ9B 4TGLA 2Q1SA 2QD5A 3C3XA 4QOIA 1VE5A 1M0TA 1X87A 2VOEA 1IY1A 3T95A 5LSAA 2Z0MA 4XR9A 4K03A 5C1OA 2XNDD 3I2JA 1RU3A 1JDSA 4FFPA 4ZRNA 3I58A 4QHYA 4BFZA 3WLTA 1QTRA 1Q19A 3KZOA 1YZLA 1QDUA 3RYHA 1COZA 2GJSA 4ZJYA 4BRSA 5K0GA 1E6CA 1EZ1A 3OOSA 2FEKA 1E1LA 5KZMB 1AT1A 4IWYA 4F5YA 1Y8RB 3JZIA 3BMNA 1XHEA 5U4QA 3TLEA 4FLMA 2E5WA 3FVTA 4XB2A 4RIFA 4KQIA 5CH3A 1JAYA 5AM5A 2XTMA 5TGTA 3UN1A 3WLEA 3DQPA 4C4TA 5C7OO 4GKJB 4ZKDA 1A3CA 2G9VA 1BE0A 1ZCAA 2Q45A 2ZBPA 4B09A 1XIVA 2GRAA 1NI5A 1KVRA 1RT9A 1U8FO 1X8JA 3Q7PA 5IBQA 5HIAA 4PNHA 4M9CA 2ZYRA 4G5QA 4EJFA 4XR4A 2P3LA 3LBAA 4FFWA 3QVGB 3LMKA 5AJZA 4BFUA 3EDMA 4X8OA 4YXFA 5EMHA 3NYQA 4OAOA 4FS8A 5EJEA 5AH0A 5SV2A 4KAFA 3TW0A 2M1ZA 3DC7A 4XVRA 3R7NA 3ROMA 1V2HE 2C8LA 3KUXA 4RTNA 1B6RA 4WCFC 4Y6GB 2DWOA 2GBIA 4MPPA 2QVXX 4I50B 1SCUB 7AT1A 1LFDB 4BLWA 4LQCA 3SHWA 4TLCA 4W5OA 1QF9A 4UHBA 1YK1A 3TN7A 4S35A 2H2WA 3CEMA 1MAHA 3HJBA 1TIKA 2IQIA 1U9IA 3EZ6A 4FFDA 3R4CA 1J70A 1IXKA 1ZD3A 2G36A 4H08A 4B87A 4NBWA 1GPLA 1H22A 1RRVA 2XDQB 4TV8B 5GP1A 2FH5B 2QMQA 4JGIA 2IYPA 6REQB 1X39A 2HFKA 4JI5B 4QDUA 5JPCA 1OXVA 3OT1B 1BFUA 2IC5A 1K89A 2ZI5A 3BWXA 4JHXA 2OPHA 3ZWYA 5TT1A 2H2AA 2QXTA 2RHDA 3H9GA 3EIEA 4M8NE 1TEZA 3AVXA 4E5KA 4ZGBA 3IKLA 4FINA 1E5XA 2DTEA 4RH3A 1C30B 3AKZA 2O0HA 3M3DA 1EEXB 1QS0A 3WICA 1GPWB 2P41A 2CK3A 4F86A 3TLCA 3ZWXA 4WCFB 2WF5A 3HDHA 3GIDA 4KK3A 4UFOA 1Q16A 4ICIA 4O3FA 5HTKA 3R7FA 2IV3A 3GH3A 5CA0F 1TF7A 1B26A 4FYKA 4YMIA 3JQ7B 4TLEA 5A4IS 2CDCA 4H7PA 1C1XB 2GGSA 3MJEA 1M2VA 4AKSA 1XZKA 3A28A 1S96A 3SZOA 3WK6A 2F3PA 2O52A 2JIOA 3AKEA 2CW5A 3DZIA 4UCWA 3TAXA 1ODSA 2HBZA 3B6IA 4MICA 1P3JA 3UF0A 3FH0A 1HOXA 1W48A 2XD9A 5FL7D 3I4LA 1PFKA 3MELA 4FOLA 3BHNA 3BYZA 3HB7A 1JYSA 3SSNA 2FPSA 3FHJA 3ESBA 3I6ZA 1DAEA 1QOPB 2FP3A 4RCZA 1E20A 4UTOA 4ZV9A 3T5MA 4EW6A 4ZOLA 3E5HA 4D80A 1FQKA 1XPRA 1YFZA 3U3JA 2YN0A 4TMFA 5D8DA 1BQEA 2Q41A 1IZ8A 1LVHA 1Z29A 2FNAA 2R25B 1O0CA 2OGZA 3CT6A 4NV0A 1R3UA 4P0TA 4MVWA 4BHTA 1P1HA 2RI6A 4EUNA 4F85A 3QYAA 4YT4A 4CXMA 4LFAB 2FZKA 4LBVA 1RXCA 2XITA 3EZYA 4CEJA 2FK7A 2ORWA 5AR1A 4A23A 3BTUA 5L40A 5LZ9A 1G3RA 3EN0A 2W48A 3R6LA 4QO7A 4DDWA 4H59A 2PN1A 3D8NA 1V37A 5DRTA 5B55A 1ESMA 4NG4A 1LBHA 2NNWB 1BWPA 1O2DA 2GPSA 2OBNA 3S99A 2A4MA 4TWAA 2NZ8A 1GGJA 1NWCA 4RF5A 2BSQA 1XNQB 1QOZA 4URZR 1T0UA 2G07A 2PGOA 3ELUA 4AWBA 4YO7A 2ZR9A 2C5LA 2QX4A 3AHFA 2V7UA 4LDQA 4TVBA 2PX8A 1NW7A 1Z33A 3FLAA 4FHEA 3I32A 5BXQC 4AKHA 1DKNA 2BGIA 2F7SA 3WDSA 4L8LA 1O97C 2J0UA 3QU9A 2VTDA 1L5VA 4UCXA 4YLGA 2PL9A 1GCOA 2F43B 4PZYA 4NSNA 3BXGA 2WVAA 5EFOA 2A7XA 1R9MA 2ORYA 3DS8A 3GJ8A 4QXPA 5IAEA 1U3VA 3ZGNA 3O7MA 5HKLA 4OI1A 4WUVA 4J0QA 4FCTA 1UMDB 3DZHA 5KDDA 2RAUA 5UKDA 4MMYB 1G0NA 1XQVA 2BGMA 1B8VA 1SKYB 2WAXA 1GLNA 4YCJA 3HKEB 1DAFA 1E3WA 3OEEA 2AMYA 2EKLA 3LLMA 1QORA 1BXRA 4B2PA 4B4VA 2B1IA 1ZXBA 2J0QA 1VOTA 1Z7WA 2V1UA 1JNXX 1E4OA 1N2BA 1TADA 2OGUA 3PC7A 4HI0E 1ZCJA 3VC7A 4P93A 4M1ZA 1DOZA 3LVFO 1X7GA 2C4HA 4X0EA 1N0VC 1KJJA 4LGMA 1GLGA 4KLZA 1RPNA 3PD1A 4XYBA 5F2OA 1UPTA 2VEDA 2H3HA 3HC7A 5A6SB 3MUFA 3NDBB 3N05A 3NONA 4PWYA 3EGEA 1OZGA 4IOKA 3M6UA 1ZRHA 3NATA 1UBRS 1KDTA 2HLHA 3D1JA 4IGIA 1NXVA 3FCUB 4ETMA 1G5HA 2CNWD 2P3OA 2QI9C 1BCSA 1RQNA 3IE1A 1H3FA 3AO0B 4FCWA 4H15A 4EG7A 5KYWA 4BFYA 1MJNA 3IR7A 1XGKA 5IM4F 1EFHA 4I6GA 2CT8A 3DXZA 2HMAA 4U1RA 5TVKA 3S1AB 1ZK0A 3DGEC 4LRTB 2CFRA 4Q1AA 1K2WA 2O2IA 2VLBA 3BCSA 1DXHA 1QONA 1WXFA 2ZJ4A 2J33A 4NTZA 4EG4A 5TNXA 2IGBA 4I1PA 4DPKA 4QTYA 2JIRA 4HSEA 2AN1A 3ICWA 2QT0A 3RU3A 1NURA 1D6SA 1HDXA 4XVHA 2UZIR 2FMKA 3DFFA 1GVNB 2UZ4A 1NOKA 3L4BA 4M87A 1LQTA 1SO8A 5BNWA 2XNCA 2GHQA 3ZHOA 3ORFA 1Y8QB 5DM70 3L7KA 4FTWA 4JX9A 4BKUA 2WUWE 2X0IA 2UYYA 4YYZA 2A8YA 2SHKA 4PS0A 1FX0A 4WERA 4CCWA 3ND7A 3HUEA 2ODTX 3I09A 3THWB 3LO8A 3E8XA 5BN5A 4ZHQB 3NAGA 3T52A 1GG5A 1MB0A 3I1JA 4HS9A 1JTFA 3D64A 5ESWA 3G89A 4PLWA 2Q4RA 3HXTA 4V2UA 2B4KA 1K1EA 1VLMA 2F1IA 4LOHA 1UBCA 4TSKA 4RD6A 4R3WA 4XEHA 2HO5A 5M3BA 3UG7A 4BMSA 2CDAA 1WHSB 3GGDA 2W2KB 4WXPA 1Y6ZA 2JGKA 4JQCA 2PKCA 4H7FA 1WEHA 3IQEA 4L1KA 4MROA 3O3MB 4B4UA 4IJVA 3CMMA 3RS0A 1IONA 1D07A 2VDQB 3EXHC 3I2HA 3OZDA 1ZQ1A 3HV2A 3WO1A 1CYEA 2WJZB 1U2TA 3LKVA 2H1WA 1Z2NX 3E48A 2QX7A 1ADBA 3EUEA 1XDZA 4ZZ0A 1XNGA 1ZESA 4LXQA 3DZBA 1EVLA 3RFVA 2YIMA 2ZRIA 4U7JA 5BV0A 5EMLA 3HBFA 2Q1WA 1L5ZA 4TPKA 4F2HA 2KJQA 5P21A 5CLLA 1WL8A 1ZDMA 1K27A 5FFFA 3UJCA 2K7FA 1UMCA 3D4PA 2HU2A 1L5NA 1VMAA 1F8YA 2JATA 1VIYA 1KOGA 2C9DA 1X7WA 1YUNA 1QV7A 4TRNA 5DTIA 1LV7A 3HVUA 4NU5A 1G60A 5ER9A 4LZAA 2FPKA 4GQIA 2J6IA 4HQLA 3EQ7A 1IN1A 1SRRA 4L5IA 1UADA 2WU3A 1LU9A 3OQIA 4TTSA 4TRJA 3SP1A 1NAIA 3EXHB 2UVQA 1TAHA 1ZUWA 1ZX1A 1BXZA 1QIHA 3WTCA 4LWPA 4WLUA 1M8FA 3SBOA 1U2RA 2CCGA 4BQPA 3DOUA 3RRZA 1N1GA 2PT6A 2WZCA 1A9SA 5KTOA 3WYFA 4DUPA 2CYAA 1F51E 1FYVA 2GB4A 3Q8XB 1DCFA 4LJYA 4OA8A 3KSRA 3PTZA 4N01A 3SIPA 4YRAA 1VQ1A 4IV5A 4LE0A 1KU6A 4LJ7A 4OGKA 1TA0A 2LIPA 2AJLI 4LGCA 3FOAA 1O4VA 3DO6A 5CA1F 2C2XA 2D54A 2EJCA 4AWXA 5HKBA 5FPQA 5BMVB 3FYCA 4PIPA 2H54A 1IQPA 3QEBZ 1QHSA 2QMUA 3A37A 3NDPA 4IWXA 1KC1A 2B6NA 1CR6A 3P9NA 4HGRA 4Y1RA 5CMLA 4QUKA 2VAXA 2YMMA 3PPYA 1V8FA 4JS0A 3L6BA 5GONB 4YPVA 4A26A 4AZ3A 2V1XA 2O57A 2F00A 1AGNA 1LJUA 1UBLS 3G2JA 2EBWA 3NHSA 4IIDA 3AR9A 4XCXA 1OASA 1R4NB 3AEXA 1FDIA 3PEVA 4IUBS 2ZUBA 1SQ0A 1JIJA 4MRRA 5LKRA 1SHZA 4Z51A 5JAPA 3MD9A 2I34A 2XZTA 5JSKA 1KWGA 3R9XB 2CLEB 4YP7A 2AC2A 1QM5A 2G8LA 3I9NA 4HTAA 3UJHA 4FEGA 4E3WA 2W6ID 3E81A 4C76A 1XTKA 1PQUA 2WMNB 3QOWA 4II2A 3E2IA 5KQPA 3NFYA 2QE7D 4XX0A 4INJA 3RIYA 5C7YA 1GEEA 1XN1A 3TEMA 3CWQA 4S0XA 1T6BY 4JT2A 5ESXA 3IPRA 3STWA 3DMYA 3R3SA 3KJQA 5TF0A 4D8XA 2ADFA 3KALA 5J63A 1G64A 4F72A 3EVNA 1V11B 2VP0A 3Q6MA 1J8YF 1AXGA 5KOIA 2AC7A 5JV5A 3HA2A 1HRKA 2A33A 5ALDA 5EZYA 5LYJA 5IVIA 4FFRA 4YP5A 1CLUA 1Y5IA 1F8GA 2XKAA 3IVRA 3E7FA 2Q3MA 1Z8HA 1XCGB 1U0JA 4HHEA 4Q7LA 5FTJA 4EEZA 2IPNA 1JAZA 3Q2IA 1OUMA 4UNPA 2PMWB 4Y6RA 1BKDR 2O2GA 2Y76A 3V7YA 2Z5FA 5GVSA 1QP0A 3RUPA 1GA1A 5FA6A 2ASEA 4KQ1A 5F7XA 2ZJ8A 1E5VA 1GNSA 1OGYA 2BDEA 3DHWC 5H3CA 5HX7A 1W36D 5AOAA 4ZZ3A 2REQB 3MMZA 2CXXA 1VC2A 4OLHA 2A1TR 4PLVA 2OZEA 3HNPA 4BQNA 3KR1A 6GPBA 3KAKA 5CW1A 1BJTA 2JLYA 3EGWA 4Y98A 4ZT3A 1NVWQ 2DSTA 1Z0FA 3LC0A 5DOZA 3W4JA 2ZUWA 1JLHA 4IIYA 2FEWB 2WU0A 3ISVA 2VRBA 2GZ3A 1TCVA 2VPXA 2BVNA 3BTOA 3IDAA 3Q41A 1V4BA 1J2YA 3AM4A 4K86A 1XL1A 3FCOA 4GC5A 4B83A 3N3BC 4FMCF 5I5EA 3FFXA 1E1NA 3E58A 3GJQA 4IDAA 2I6SA 4TKVB 4UJ3A 5CVDA 1T1RA 1EFRD 1XLWA 3T38A 4X62B 3UV3A 1KMNA 3H2KA 3OCJA 2OB2A 3N6RA 1KSJA 2Q4BA 1AK2A 2IU3A 1ZCBA 2RGXA 3C3DA 1YAJA 4LOLA 1WWKA 3IPAA 2FRDA 2Z4SA 2VATA 2JK1A 4MIOA 1UFVA 4DCGA 4AP6A 1GAEO 3H5OA 5JVDA 2O8CA 1Q3KA 4OGGA 2RK3A 3DDUA 2VJMB 4M7WA 4N54A 5T67A 2CCKA 1NR1A 5JTUA 4JYMA 3ZGLA 4TM7A 1L3BA 2QN3A 4WZBB 3QUTA 1QO0D 4M49A 3UC9A 2W8ZA 1CNFA 3ITNA 2QTWB 2UXDB 4YMSA 1C81A 5DISB 1PQPA 5A71A 3FNFA 1ZU4A 2XQIA 3N1UA 3TTYA 2EW2A 2IHYA 3BGSA 4K6GA 3CRVA 1ESCA 4RWEA 5EKSA 2BWJA 4EHDA 1M6VA 4UXJA 5JNWA 3G82C 1LPNA 2ASVA 2O7VA 2WKWA 1YH3A 4PO8A 3L8YA 4YRMA 1Z83A 5F9MA 3AI2A 2C2GA 5FCDA 2JG3A 4Z8YA 1IY2A 3ADKA 3EY4A 4KYVA 3OQJA 2ZYDA 4PLZA 1PJZA 4D0GA 5A02A 5EJ4A 4XA8A 4GXTA 5FFNA 5KVCA 2RHWA 1ZYUA 1ADCA 4ZI7B 2QRZA 2ZJ2A 1RIIA 3F6YA 1IUPA 1KA9H 2CJXA 4MJXA 2RH8A 1A4UA 3E8MA 3SR0A 3MJHA 1CF4A 1D2EA 3M4NA 2WJIA 1A95A 4KCGA 1EUCA 1K5DA 1F1BA 4UMVA 5TC4A 3HB5X 4B47A 1IBCA 5KU7A 3OC0A 2HNBA 1OBCA 2WD7B 4MYUA 1XRRA 2FPWA 3GAMA 1VKRA 1JQDA 2VJLA 3C3MA 1ENOA 1XNJA 3PLRA 4P6VF 5C8XA 2JD1A 3TSWA 5GY7A 2F55A 4DKXA 2G7MC 4DG5A 2BMFA 5AM2A 3U1VA 2N75A 1RWMA 3L7AA 1HR0B 3A05A 3GPCA 4G01B 2RCYA 4BN5A 1F7VA 5AHWA 3I42A 5CLGA 2YS7A 3O90A 2V74B 2BFBA 4PLCA 1HEYA 5JSZA 5U9CA 1KE2A 1NNSA 4UNRA 2OK7A 3P97A 3ZTWA 2G4LA 4C01A 1H8HD 1GKYA 1GTVA 3O1HB 2Z2XA 2FUEA 3TRFA 5AM3A 1I80A 2FVXA 2CFSA 1TKRA 4BVFA 4DBLC 4K0RA 3S2IA 3LQRA 4MPRA 1RQXA 2X76A 3CSUA 3HJAA 4N40A 4ZTBA 3WLMA 2EF1A 4HYTA 4LYFA 1NJSA 4EZIA 2PV7A 1T91A 1EH5A 1NUPA 3IPYA 4I81A 4PYKA 1SEPA 1YBFA 1MABB 1HKHA 2K87A 3ECSA 3WBFA 3QNWA 5JCPA 1VIVA 4Q3NA 1JBKA 2NU7B 1SKYE 3O4VA 3AV3A 1C0EA 3EQ9A 3PEEA 5F2EA 1QHGA 1T4MA 4RSRA 2IHJA 4UM8B 1GDTA 1T1EA 4HDMA 4PLHA 1D2RA 2GZSA 4AIIA 4Q18A 3OA2A 1NMSA 5BQPA 2X9VA 3I53A 3Q3EA 5MHTA 3VV2A 3FWNA 4R7GA 3EXEB 4G56A 1T34A 3QYJA 3U4QA 3FZQA 4UUBA 4YRJA 2FLVA 1F2UB 1K8RA 1U2DA 1ZMTA 1T2AA 2HRQA 2OVFA 1CJCA 3QKRB 3NZEA 3KYIB 1RM3A 1ZEMA 1ODLA 1UF9A 4WKPA 1E6MA 5AJXA 2WTUA 3UWMA 2C92A 2DE0X 3D3NA 4XPIA 3U7JA 4JAVC 5F2KA 4BNLA 5EJMA 5TMEA 1KP2A 1EJ0A 1QVWA 2OP1A 2XZPA 3K9QO 3LDGA 3V3KA 3A1SA 3CVJA 2CXNA 2J4DA 1NUUA 1SMKA 1CUXA 2KMLA 1NVXQ 1AIPA 1R7RA 1QZ3A 1Z7YA 2D13A 2P2LA 3R44A 4OEHA 5FOVA 5REQA 3D3QA 4QLOA 4IXDA 3EJ6A 3E6AA 3GJ4A 4ZA2A 1JEDA 4ACBA 2CVQA 4CI9A 1UZAA 4PG7A 4AX4A 1EK2A 5J4VA 3NM5A 1ZSNA 4ZVNA 4EKDA 3CEAA 2ZROA 1WZCA 2H0AA 2EBFX 2BM1A 4JZKA 4NYJQ 3VR3A 1PGNA 2WZDA 4JGBA 5AI6A 3GFPA 3SEAA 4LEIA 1KI9A 4AJ1A 4CKWB 5J5CA 3ODGA 1YQDA 3L7JA 3TZBA 2VP9A 2XGMA 4D2IA 2WIBA 4DNOA 3HADA 2CJYA 2R7KA 1E18A 3MXOA 4ZD6A 2VHJA 3IOBA 3H2HA 4B9AA 2Y2VA 5CEEA 4MB0A 1DUIA 3IC5A 4MIEA 4NOKA 5C4IA 1E3QA 1D03A 1TIBA 5B3JC 2B34A 2Q2OA 2TMYA 4AQ7A 5T5QA 5K3CA 1W4ZA 1OYOA 1VA4A 4PAWA 3ORQA 1GKIA 5K1ZA 4KO2S 3HDQA 2P7HA 3AUXA 4DIDA 4D5EA 4V38A 5AVZA 3LZDA 3K1AA 1PQYA 1FFBA 2J0SA 1E3SA 1FMJA 4ZIRB 2GI4A 2CKDA 1RZVA 4P22A 1BOOA 2VSYA 3V4SA 2VTBA 5ALOA 3E15A 3L02A 1PX0A 4K2HA 4MRVA 2EZ8A 3KV1A 2O5VA 1EDDA 4OXKA 3K9NA 3NASA 3BF8A 3O93A 3M6XA 1JUDA 1U2QA 3OUUA 1SHTX 3HA3A 4B75A 1VLVA 1SUIA 5BWOA 2GT1A 3TRKA 2RSLA 2DBRA 5KJFA 4A92A 3TNLA 1TU0A 3G2QA 2BGNA 2F59A 3HDJA 1MTOA 2D0DA 2Z83A 4LVOA 4E5VA 2V7QA 2C2MA 1UBHS 4QTZA 4XWYA 2NZXA 1ZR4A 1IK4A 1JQEA 1YB4A 2VCHA 1C9DB 4N3CA 1OTYA 5FIUA 1YZYA 1E7SA 1I14A 4FK8A 3RODA 4CUJA 3SBEA 4JJ7A 1G59A 2UYQA 4CTNA 1P5ZB 2A0YA 1X9HA 2BFOA 2H51A 4PC3A 5FPSA 1T9AA 4HDQB 1DS6A 3ZYZA 4FYJA 1NQTA 1O6ZA 1YQGA 3T9BA 4UUPA 3MUNA 4I1IA 3BREA 2PS0A 2YVKA 4XIIA 1O7JA 1JIXA 1WY5A 1ZOLA 3DSRA 3LA6A 1HTTA 3O0TA 4FLEA 4V1CA 1G38A 3WBJA 2E89A 4XH9B 1MQAA 2Q6KA 4AMUA 4LF9B 1FZQA 5I7EA 3ETGA 2FW0A 4TTVA 4RS3A 4C3OB 1U63A 4J1TA 2R44A 3IAUA 4XM2A 3SS7X 2R1UA 3WQRA 4IDNA 4U63A 3C48A 5AM4A 1W88B 1P7VA 2YUTA 2ZIEA 3ND6A 2FEAA 4UARA 3FOZA 4TXHA 1FS6A 2PS1A 2QJFA 3BBPA 5L4LA 5AW4A 3WRXA 2VYCA 5TPZA 3ZU6A 4BVEA 1VSVA 3IAS6 4GW3A 5AVQA 1I7NA 3PZBA 4OJNA 5A7FA 2N9UA 1KEPA 3DFMA 3EVEA 1X3SA 3EDOA 4HB2A 4RYDA 3OIUA 3PFFA 1YMVA 1K06A 1NZJA 2QQGA 1SIUA 1ZGBA 3DEJA 1RZUA 1ZMXA 5J2UA 1NG9A 1C50A 2M98A 2QN2A 1C7QA 2ZIWB 2Y1DA 5EMMA 4D46A 1UKZA 3JZFA 4L2IB 2FMUA 2N47A 3STHA 5E1BA 4WECA 2OG1A 4NYIR 1FXWF 2WABA 3Q3VA 3TQCA 4OGWA 2R6GA 1W87A 4UEWA 4Y0NA 1EZ4A 1Y4AE 5KSOA 3BE4A 5H8WA 3SJUA 4QPCA 1N2OA 5B3AA 4B33A 5HUHA 3VR2D 1MO6A 4HDKA 3RT7A 3LKDA 4Z86A 2WR8A 2QY9A 2XX3A 7ADHA 3SJBA 2BSXA 3IAS1 2Q3DA 1Z2CA 1SFRA 4UEKA 4W63A 2UZAA 1K7FB 3CXRA 4KQXA 3B51X 3KQNA 4L27A 5ES3A 3AEUA 2ZI7A 5FWAA 4BCDA 3EPPA 4MWZA 3MWEB 3IRVA 1OYWA 3PQ3A 5F3RA 2H1HA 5CB6A 2IUFA 3EOBI 1B00A 2QUJA 3OG9A 5EJFA 4Y6LA 5CB4F 1U31A 3MINB 2ACEA 1H23A 2HK7A 3TXYA 3FPFA 4X24A 1SAYA 3KHTA 2HGSA 4CF6A 1Q1NA 3GUUA 4I4NA 4WJKB 3KYBA 1V41E 4WOKA 4FSDA 3DE6X 4X41A 4EMSA 1H4VB 5KPDA 4HVAA 1YI1A 4RULA 1JIVA 5CLIA 3H4IA 3EGVA 4Y9RA 3RIEA 1JR3D 3PB3A 4JP2A 3K70D 1GRRA 2I9KA 1X1EA 3ZD8A 2DUUA 1HSOA 2VP2A 3DBRB 4ND1A 5LDDC 3FSGD 4NPAA 3IJRA 4MV6A 4LBWA 2ODAA 3ZLBA 5EIHA 1B3BA 4NYIQ 4UUOA 3BDIA 4FLFA 2LV8A 3IUMA 1YXMA 2CFTA 3IHKA 1GY8A 1Y8AA 4X61A 4YECA 3I2FA 1JXAA 3S2FA 3QKUA 2I65A 5AW0A 3CC8A 4G0MA 2E4UA 3KJXA 5IJ9A 3ZS9A 3U7GA 5B53A 4JFAA 3OCWA 4JBLA 4KUGA 5B7NA 1XNRB 4KR6A 3OQHA 1RLJA 2DQSA 2I1QA 2RJOA 1O3YA 3KJEA 5THXA 3A6DA 5BNZA 2QV7A 3KQTA 1CZHA 4D92A 1UL1X 5K7SA 1D5CA 1G66A 3PR3A 1XTIA 4I4LA 1KDZA 2CB9A 5B2ZA 1K8ZB 2I3BA 3FWKA 4I6JA 8ABPA 2Y68A 4CMEC 4DUGA 4TWZA 1S2LA 4AY2A 4NEQA 5DWQA 4M0LA 1ZITA 4P4SB 4P84A 1W2GA 1EDEA 2WJHA 1Y8RA 3CO5A 1Q0PA 3EEBA 4RPGA 1W5EA 1N2XA 5DHTA 4DIUA 1KJIA 1P80A 4TKUB 4DLAA 1C4WA 2HN9A 4TVKA 4YDQA 2AUTA 4IUDS 1RI5A 2VRCA 3L4JA 3L43A 1UEJA 3MM4A 3AT1A 5D00A 3WKBA 2C4KA 5KO2A 4Z4GA 1V5GA 3CLSC 1BN6A 3LDFA 4YGYA 5IAGA 1MO4A 3UMCA 3KOYA 1BJKA 4KDRA 1CUCA 2YNMC 4WZBE 4DSNA 2YINC 5JWHA 1ORRA 4JCOA 1GUAA 5E0OA 1FFHA 1S2DA 4R9RA 2E4YA 2GSDA 5K2OA 2PGNA 3KD3A 3OQNA 4HNAB 5JDCC 1KDVA 4RTSA 5T3YA 2B21A 3DYBA 3LC2O 3SLGA 1UQUA 1JKJB 1NXOA 1CVLA 1KIAA 3GUHA 4XWKA 4WMLA 3PFKA 3VO8A 1QQAA 4YI3A 4B0PA 1SCUA 2Q0HA 4KR2A 3PHGA 2VAMA 1U2SA 1VLZA 3AR8A 2VHTA 1GUFA 1ZCZA 3DCIA 4DNPA 3ZX4A 1SXIA 2F1RA 2QVGA 2WU8A 3IT0A 1XR3A 3G5LA 3GVXA 2HDNB 4WACA 2IV2X 4Z1OA 3AVQA 1OXSC 3BB3A 3BL5A 4DIMA 2QMYA 4MR9B 4PFSA 4KV7A 2I22A 2GBCA 5LWQA 1FQJA 6REQA 3N53A 4C03A 4Z3KA 2O59A 5JXHA 1PVVA 3BRCA 5AHXA 4RTQA 1TYZA 2NVWA 4ZXPA 2VXOA 2BI4A 2AA3A 2F3TA 2I6XA 2QRVB 1W0JA 4Q47A 2A9PA 3HJFA 1XCMA 2AKAB 1AGRA 1CR4A 1KYYA 2R5FA 2GO1A 1XAHA 3AUJB 3QF7A 4A6EA 3MBOA 3OPYA 1C30A 3E9MA 4LKRA 4Z5XA 3I9KA 4X20A 4EHHA 2MIIA 4ZRMA 2QS9A 3VPGA 1W25A 2D2IA 2IL1A 1ZHFA 2P9YA 1CVRA 1FZTA 3K2IA 1DNPA 1VL5A 3PGXA 3KZXA 3QYFA 4V3CA 3RJ9A 5FV4A 4OSPA 4RQBA 3JQ7A 4ZEOA 3LYHA 2Z2KA 1AUOA 1C80A 1C1XA 1XPJA 1Z75A 2Z3VA 3ABZA 3EG9B 4KFUA 3RRNA 5CXQA 4UAVA 2N42A 4U7WA 3SIWA 5LD2C 2PVSA 2B4YA 1RLUA 2ZK7A 3HCCA 2BH9A 5LBUA 4IIJB 4CPDA 4WAUA 5EGSA 2PEYA 5HJ5A 5K51A 1FDRA 4M46A 4UDNA 2PFKA 5HF8A 3M6LA 3JQAD 1UJMA 1IH8A 2IHUA 4H7JA 2WIJA 2P4EA 3HABA 2IWHA 3VVMA 2W43A 5BR8B 4P58A 3Q2KA 3CH7A 4RIEA 3BK2A 6Q21A 4MUAA 3ESRA 2JGIA 4U39A 3GQBA 1Y8ZA 1K97A 2I99A 5LA6B 3W2EA 2FY8A 4G81A 3MBKA 3NM6B 4FHFA 1RIFA 1L4YA 1BWRA 1L6IA 1T8TA 2XYHA 4GR4A 5EHGA 3A1CA 5ILQA 5G53C 4G0UA 3PGJA 1MQ9A 1J1IA 3O1IC 3WL8A 5HNKA 2JH3A 1M34A 1QH1B 2GWRA 2YHAA 4XD7A 1U6JA 5CUQA 5AI9A 1YZFA 1NSYA 1YZ3A 5LD2B 2AE1A 2OV3A 4A0RA 4D4IA 2ONKA 2JCXA 2X41A 3K0CC 4DBLE 4QZVA 2YHIB 1D6JA 3EQ6A 3HA7A 1A7KA 4YRTA 3OESA 3TRJA 2IYAA 2JVKA 5IK2A 1OHHD 3MWFA 1D6MA 4GVLA 4OMUA 2IHTA 5AI8A 5E2BA 4HLQB 2R8PA 4BLVA 3EPLA 1Y4DE 2OC4A 2YJ5A 1JDBC 4PSVA 3TIIA 3TX6A 5B5SA 1LA2A 2N0SA 4W5QA 5FBWB 3WIOA 3MGAA 1MF7A 1QZTA 3MQ2A 1Y81A 3TLMA 1XRPA 4KMMA 1FBTA 5J1TB 3WGLA 5ITWA 3CVUA 1I3OA 3OWOA 2IZ5A 4MEAA 1U0LA 2QK4A 5AM1A 4RJ2A 1ZJYA 1UMDA 4NCAA 1Q7GA 4Y1GA 2J59A 2B82A 2R6R1 4EVIA 2HZ7A 4HNRA 4K05A 3EPHA 5CDGA 3BQMB 1IB6A 4OL0A 2W8BB 2YCLA 3F9IA 3CU5A 3HKEA 1OW3B 1NC3A 2GN8A 4MZXA 3TQSA 5LKAA 2GEFA 2ZS9A 3QV1A 3MWLA 3ZCVA 4BB5A 4EG8A 3P0HA 1G8JA 2IPAB 4RZQA 4TUYF 1EG2A 1MHPA 2FGJA 3QEOA 1S2IA 4PHGA 1JDBB 1CS0B 3PUKA 1YB7A 4UVDA 5ESDA 1KPIA 2Z4TA 5KEIA 3CPEA 4MHTA 4JI2B 1G8HA 4N3NA 3S7TA 2ZZMA 2AEJA 1JQAA 1KIMA 4X1IA 2QBYB 1Y6JA 3W7AA 4P2BA 1XMPA 2J4FA 4FC6A 3PQFA 4MW9A 4WQMA 2QD3A 3DOIA 2ADMA 3E9YA 4UZEA 3SR4A 4EFMA 4QOHA 4M8SA 3N6XA 3P9CA 2PH1A 1X7XA 3PUIA 1EQAA 1RP1A 3B85A 4F3KA 2UUOA 2R00C 2O2HA 2WJ4A 3TBKA 3L84A 4GOOD 3ZG6A 2HU5A 3T34A 3MA0A 2BHRA 2COKA 4O4IA 1NJFA 3QUAA 5IKPA 4UREA 1TZKA 2ZP1A 5IT5A 4JITA 3JRXA 3ZWCA 1MKYA 1OWLA 5B58C 3AUAA 4IPTA 2VIIA 3S40A 4HEJA 4QSMA 1WB6A 4UM9B 3EPRA 4MUJA 1DKRA 1A5BB 1MOSA 4Z9BA 3LRTA 3HK2A 1JR2A 1OWMA 4EJ0A 1OI3A 1EMDA 1UM9B 3U26A 4NJOA 5B2FA 3C3AA 3SC2A 4QJ3A 4MRPA 4TRMA 1UK7A 4ITUA 3SHQA 2LTAA 2H48A 4LHXA 4R5MA 4YRGA 4EGJA 2PAAA 9ABPA 3T3MB 3HB4X 3T7EA 3MAGA 3ZLVA 5AFSA 2ZKLA 3P45A 4MJLA 1E99A 5LZ7A 3IXMA 3PJFA 3DZCA 2YX1A 1ZJWA 3BXOA 1W5TA 1CB7A 2PGIA 3SK0A 2QTTA 5BQXA 4ZHQA 4GI3A 5EIBD 2AYZA 1DJOA 3CX4A 2PYZA 2VK1A 1L9XA 3A3OA 1PUJA 3V2HA 5JS1A 5JLAA 2AZTA 2I6QA 1QFZA 1TI7A 2X6QA 1B0UA 3BWVA 3CJTA 1WPGA 4UZFA 1WHSA 3V2GA 2XCSB 3ECCA 1BDHA 1I9CA 4YHHB 3L0YA 1G6KA 4FQ5A 1E2UA 2YV4A 3DL0A 2GUGA 4NBUA 5CT6A 4RX1A 1HI9A 4JA2A 5ILGA 3VNAA 3EEQA 2JJYA 1U3UA 2D1YA 2WP0A 3T7CA 3NDRA 1EP2B 1I2AA 1RI1A 3OH8A 3DEAA 2EXXA 4Q1DA 3OE1A 4GLBA 2ACVA 3DNMA 4FWBA 3TZHA 2YTZA 3NS7A 1H2FA 5DTRA 3VDQA 4HMOA 3FSJX 3VZBA 4U6NA 1WKCA 3NJ8A 1XQ9A 3CRW1 3ETDA 1WNTA 1H2AS 5JPIA 1C4KA 1ULBA 4QEKA 4WZZA 1CQIB 1I5RA 1DC4A 1OIVA 4HH4A 2OORC 4TQ9A 3SYRA 4ZHSA 4XGRA 4IZOA 1XZFA 1SUSA 3LQ2A 4DMKA 2B8TA 4RJTA 2IEBA 4QPJC 1DC8A 4S12A 1RKQA 3AKCA 5BV8A 3N86A 3O84A 1SIBE 3WGOA 3W7VA 3U4CA 2WAMA 1P0MA 1T0JB 3EW7A 2R65A 2IXEA 2C7RA 1XA4A 1NQUA 3BE8A 4GFDA 2BE9A 4I36A 4I4TA 4M8IA 4R1QA 4U8HA 2GEKA 4Q1VA 3NKFA 2O48X 4URYR 5FLKA 4DLTA 5LOVF 2LR0A 3N3AC 3WGTA 4YASA 3RVKA 1Q0ZA 3H99A 2FE1A 4YR7A 4ZV4A 4IXNA 3UYLA 1VLLA 3HVHA 3V9PA 4HDCA 2O8VA 1UT5A 1QGAA 1ZXLA 1SBTA 3AUSA 1ZI6A 3LPMA 5HFNA 4MGIR 3OWXA 2P8JA 3GDWA 1RJ9A 4LG1A 5JISA 2C31A 2HQOA 2FDRA 1OTXA 3PX3A 5K03A 1U81A 3RS8A 1P2UA 3OJEA 3T4PA