3C85A

Crystal structure of trka domain of putative glutathione-regulated potassium-efflux kefb from vibrio parahaemolyticus
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
150
structure length
150
Chain Sequence
QLINPGHAQVLILGMGRIGTGAYDELRARYGKISLGIEIREEAAQQHRSEGRNVISGDATDPDFWERILDTGHVKLVLLAMPHHQGNQTALEQLQRRNYKGQIAAIAEYPDQLEGLLESGVDAAFNIYSEAGSGFARHVCKQLEPQFTSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative glutathione-regulated potassium-efflux system prote
publication title The crystal structure of TrkA domain of putative glutathione-regulated potassium-efflux KefB from Vibrio parahaemolyticus.
rcsb
source organism Vibrio parahaemolyticus rimd 2210633
molecule tags Transport protein
total genus 53
structure length 150
sequence length 150
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02254 TrkA_N TrkA-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3c85A00
1O9BA 4U7WA 2VHWA 1T2AA 1IULA 2BMAA 1HZZA 1MB4A 1ML3A 1U3VA 1LLCA 3F4LA 1R4NA 1HDYA 5GZ3A 2Y1GA 2P68A 4J4HA 1EDOA 4I5DA 3TZCA 4DXHA 4JJGA 1E7YA 3JQ9C 3JYNA 4R16A 1X7GA 2BFAA 2RCYA 1Z82A 3RQSA 4DQXA 2Q2QA 4BQRA 2O23A 2VUUA 2FZWA 2WEKA 4OGWA 3RU7A 3CINA 2AE2A 4E30A 3OJFA 4IQ0A 4ROSA 1SBYA 3KSZO 4WCFA 2VN8A 2J6IA 1Q7CA 5HS4A 1EMDA 3R3SA 3ZDFA 2EIHA 3ZU5A 4CR7A 2ZTMA 5LDGA 2NVUB 4LCEA 5IN5A 5JE8A 5JYEA 3CMCO 5ER6A 1I3KA 3AK4A 4E12A 3KB6A 3WMXA 4W9NC 5JYDA 1QYCA 4CMAA 4EJMA 4WLNA 1UAGA 4YJFA 1QXSA 3L6DA 4IDGA 2DVMA 1M75A 4LW8A 2I67A 3C85A 5L7WA 1LLUA 4YBZA 3WGGA 3FRJA 1YJQA 4UEJA 3M2PA 3DQPA 4ALLA 4YAEA 4F6LA 3L4BA 4B7UA 4F45A 1DAPA 4J91A 1QMGA 1GQQA 4ALKA 1BDBA 3GVHA 3CMMA 2PTGA 1A4IA 2DAPA 3BYZA 3PJFA 4GMGA 3ONEA 5KIAA 4UEKA 1DC6A 3BZUA 1DSSG 3F1KA 3SEFA 1XA0A 3EK2A 2UV8A 1LC0A 2VT3A 1Q2XA 2UAGA 1FDWA 2FWMX 4AG3A 1E5LA 3M6IA 4NFSA 4KWIA 2PD4A 3TZ6A 3OICA 2HLPA 3JQAB 2HDHA 2C5AA 3HN2A 3QP9A 3DR3A 4IQ8A 4GVLA 1PR3A 1JKFA 3TN7A 4YQZA 4F6CA 2XXJA 2AEJA 4NBUA 4NFYA 1P0FA 1R12A 1DXYA 2VUSA 1OFGA 2WDZA 3ANMA 5DCUA 3V2UA 3L0DA 3GZ4A 4ND4A 1HL3A 5HRUA 1A71A 1B7GO 2ZCVA 3DAFA 5B4TA 1V0JA 1N92A 4CMIA 3JQ7A 1AHIA 3JQCA 1GZ3A 3BMQB 4F3YA 4LK3A 4UVHA 1O95A 2C2XA 3L4SO 3L6EA 4R3NA 4WJZA 2VHZA 4WOKA 5ICSA 4EI2A 4MPDA 4YTEA 4BIIA 3TFQA 3T4XA 1Z7EA 3VC7A 3NTRA 3WGHA 4PLHA 1VPDA 3PZBA 4I5EA 3WYBA 1PTJA 3CPSA 4CMJA 4XDYA 3IJPA 1R4NB 1IHXA 1E77A 4ZJUA 1ZJZA 2G5CA 5TSDA 4TMFA 1KEVA 2C2YA 3PHLA 1B2LA 2HO5A 3JQEA 3RUHA 3AOGA 4O63O 1A72A 5F3RA 4U5QA 5L7YA 1EFLA 5DOVA 3R3JA 1UDAA 2QX7A 4CM8A 4YPOA 2B35A 1ADBA 2NU9A 4YT2A 1BW9B 4MVJH 3TOXA 1E92A 3NTQA 2CD9A 4WCFB 4JBHA 4Q39A 1NAHA 1YB5A 4DVJA 4D46A 9LDBA 4J43A 2OP0A 3VH2A 4BO4A 3ZWPA 3A4VA 2DM6A 1DC5A 1E1NA 2R2GA 4CM7A 1PL6A 3DL2A 3NX4A 4YJFB 1GQYA 3U5TA 1NAIA 4AJPA 2O48X 2PGDA 3OEYA 4KUEA 4D43A 2A9FA 1JVBA 2Q4BA 1ZZEA 1LUAA 1ZBQA 4WEQA 3ZWXA 1GUZA 1SAYA 1X7DA 2WD8A 3EUWA 4EEZA 4FN4A 3WIDA 1B16A 3OHSX 3VDRA 4CR6A 1JAYA 1OOEA 4KQWA 3LT2A 1VM6A 1KC1A 2Z1MA 2DT5A 5EL0A 4Z0TA 4MP3A 1R0SA 2G1UA 5K6AC 4WASA 4M54A 1LX6A 1HT0A 3D64A 3GNQA 3TFOA 1CQIA 3G1UA 1E3IA 2EV9A 4B7XA 3UICA 4OHUA 2DTXA 4TRMA 3SX2A 3ROQA 4IDCA 5FI3A 4Z3DA 2EERA 3KV3O 3S2IA 5JFOA 2GDZA 3CH6A 3GGPA 2I3GA 4E13A 4E0BA 1G1AA 4JIGA 4WECA 4IXWA 3RBZA 2H9IA 1LEHA 1QP8A 1QV7A 1AN9A 1M6WA 4CMGA 3PHGA 4PZCA 3AY6A 1T2DA 4UAGA 4O0LA 4PRLA 1M6HA 2O4CA 2O7QA 3RUDA 5CHEA 1IB6A 3HFSA 4NPCA 1JTVA 3WGIA 4TKMA 3DZBA 3ZWNA 3ZWWA 1I2BA 3JQ7B 4BV9A 1C14A 1W8DA 4FCCA 1FJHA 2Y93A 5HS6A 3ZWVA 2ET6A 2BLLA 2RAFA 2W2LD 3PP8A 4MP8A 5I7FA 3DEYX 3ASUA 1H6BA 3OFSA 3VVBA 3WR5A 1NQOA 2E37A 2GN8A 4XKJA 1PZEA 3IS3A 5KCZA 3RJ5A 2B36A 2X5KO 2XF8A 4YJDA 1GYPA 1HYGA 3ULKA 4GMFA 3GVCA 1C1DA 1N7GA 1Y8QA 4BB5A 1ISHA 5JCXA 4NJMA 4AJKA 4CUZA 2OUIA 4IINA 4RLHA 1ZH8A 2IYOA 4CM8B 3DAPA 3ICCA 1YOVB 1KBZA 2HJSA 1ZCJA 4BNIA 2FR1A 4MKXA 1DOHA 1KVTA 4QX6A 3NDIA 4TWRA 2AG8A 1PWXA 4UVIA 5A3VA 3E9NA 3W8FA 2ZYAA 4DGSA 4L73A 3W6UA 4WLUA 3VPSA 2ZQZA 5F1KA 1GPJA 1UAYA 1NPYA 1WLYA 2YFQA 5CFZA 1CEQA 3BMCB 3LSYA 2O4UX 3K6JA 2YV1A 4Q9NA 4N18A 1WPQA 1X14A 4DIOA 4YT5A 4CL3A 1E6EA 3V5NA 4NHEA 3JD4A 1IZ9A 4JBGA 4ZN6A 4ALJA 4DYDA 5B4VA 2X22A 3ORFA 4A2CA 3TWOA 2X5OA 2WTBA 1SZJG 1FXSA 2G82A 2IE0A 3M1AA 3GN2A 3IQDB 3ITDA 1PJLA 4BNHA 5B12A 4FOSA 3I5MA 3ZNQA 3D4PA 3EGOA 3ZGYA 1DIAA 5T8KA 1L7DA 4JCOA 1PZFA 3PIDA 1KEWA 3DZGA 4EDFA 3DOOA 3OM9A 3WXBA 1GQ2A 3BTVA 3WFIA 5JW6A 4D7AA 5IDWA 4D42A 2W8ZA 3I4FA 2Q1WA 1B8UA 4ALIA 2X5JO 4S3MA 2Y1CA 4RZIA 4RGBA 2NVWA 3TL3A 3WQSB 3E8XA 4R68A 1OZAA 4UVGA 5CDGA 3IP3A 4XX0A 2C20A 2BRUA 2O3RA 4CUKA 2HU2A 1G6KA 1Z75A 1CRWG 1F8GA 2A4KA 1B3BA 5ADHA 3QVWA 4M89A 1NHGA 5T67A 4DLAA 4A10A 2OGUA 2I6TA 4KTVE 1AXEA 2D5AA 4RORA 5COAA 1B14A 4UUOA 3FD8A 2GASA 2I76A 5FYDA 5H82A 3RROA 3I9MA 1GPDG 3P2YA 3FTPA 2LDXA 4DBVO 3CKYA 4EGFA 4Q3DA 3C1OA 3RAJA 2GERA 3D7LA 4PGFA 2GZ1A 3PQDA 4E21A 4QECA 3CE6A 1Y8QB 2JFGA 4RF2A 5KVQA 2PR2A 1E7WA 4NJMB 4R41A 2X1HA 1LDGA 5AQ1A 1R66A 1EFKA 3CEAA 4I1IA 4OQZA 3PVZA 1DHTA 2QYSA 3AWDA 4PG7A 3H9GA 2YDXA 3KXDA 4YQYA 3O26A 1PQPA 3H2ZA 4ZQHA 4U0KA 2Y1OA 3NEPX 4HP8A 5DP1A 3LC1O 3S2EA 4CMHA 3M2TA 4FBGA 1ZK4A 4KWHA 1DFGA 3CIFA 4ZICA 1ADGA 3AY3A 2EGGA 4YCAA 5I7VA 1VL8A 1J5PA 2E49A 2W2LA 2D5CA 3FI9A 2X9GA 3HDJA 4FSHA 1NWHA 4OIMA 1E3LA 1Q7BA 3CSDA 2ZJ0A 2CDCA 2H1SA 5JDCA 4ZD6A 4H7PA 4G81A 4G2NA 3I6QA 3G49A 3W8DA 3SXPA 4YJHA 5IF3A 3LVFO 4P4NA 1I10A 1ZMOA 4BNMA 4D3DA 1TLTA 4BQPA 5KVVA 3GA0A 4BNLA 3V1TC 2EWMA 1SEVA 3E03A 3I9JA 1A4UA 2VHVA 1DRVA 2EW8A 3AU8A 3OQBA 3C24A 3LT4A 4H15A 4DBZA 4IGFA 4RVHA 4BNUA 2EG9A 2NACA 4BGEA 3C1AA 1GYQA 2IRWA 5DOZA 1PL7A 3TNLA 4PLWA 1Y8RA 1YBAA 1GEEA 3K2BA 1X7HA 3V2GA 5EQDA 1QKIA 2FY8A 5JY6A 1UZMA 1YBMA 3I3OA 2X4GA 3HB4X 1P31A 3QHAA 1H93A 1WDKA 4GL4A 1LQTA 1DLIA 2NADA 2OP1A 3OA0A 3WGQA 5CDUA 5T5QA 5L4SA 2IXAA 3FBTA 4R01A 1K6XA 4WOJA 4ZA2A 2DTDA 1AUPA 1UXIA 1E0DA 4GPD1 3WMWA 4Z9FA 5MDHA 1VSUA 5IDXA 2I5PO 1JWAB 2J5KA 3VVCA 3U3XA 3OBBA 5BSFA 5CDTA 4PVDA 3WYEA 3OECA 1EE9A 3ENNA 3DZKA 3D3WA 2Y99A 3KYDA 4OH1A 2RBEA 4M1QA 3DBLA 3DTYA 4E2WA 1I24A 1SC6A 3WJ7A 1U5AA 1LXCA 2YDYA 4QSMA 4KDFA 4XR4A 3RVDA 3ST7A 4PLVA 3ZHZA 1WMAA 2PZJA 4AJEA 2C29D 4KDEA 1VJ0A 1DEHA 3QW2A 4PLGA 4MO2A 3TRIA 5AXDA 2OZPA 2CVQA 1DRWA 1L7EA 2OL4A 1D1SA 2FOIA 2Y0CA 3BTUA 5JO9A 4N5MA 4EEXA 5CG2A 4E2ZA 1DC4A 1UP6A 1VSVA 1ADFA 2HAEA 4DLLA 5DCWA 3VAZA 3JYOA 4NQZA 1IHYA 2VHXA 4ZQBA 1PS9A 1GV0A 5I7SA 2VRBA 3ZNOA 4FC7A 1IE3A 1U5CA 3D1LA 3NJ4A 3PJDA 3I6IA 2NLOA 2WWRA 3GVXA 1TEHA 2G0TA 1KVSA 2CUKA 3C3XA 3FNFA 2ILTA 3QIVA 2F00A 2IEBA 3GHHA 5ENVA 2ZYDA 4LRTB 3GDOA 3GR6A 3OIFA 1MC4A 2O3TA 4BOYA 2X8LA 4U8GA 1NFFA 3S2GA 1U9JA 4RVDA 1XSEA 3GF4A 1N7HA 3M1LA 4CV0A 1EUZA 3WWYA 1EVZA 1I8TA 1T2FA 1VL6A 2UUOA 3H3JA 4UREA 4XJSA 1YS4A 4AJNA 1MC5A 3JCZA 4J9UE 2Q45A 2P5UA 1DPGA 4WCDA 2VWHA 2PZKA 1LA2A 2GN4A 3VH1A 1H6AA 1Y8RB 2NSDA 5ER9A 3DBRA 5K0ZA 3VPHA 3HDYA 4WNIA 4N7RA 4XYLA 1H6CA 3MCVA 4BNFA 5I7EA 4BO7A 4UUMA 4RDHA 4TRJA 1BDMA 1IUKA 3GUCA 5JMWA 4Q3BA 2I9PA 1PU2A 1N8KA 1Q0QA 1ENPA 4TRNA 3JQGA 4DL9A 5JXWA 5JLAA 3E48A 4G5HA 3F5SA 3A1NA 1N9GA 1WWKA 3GNSA 1A9ZA 1C0LA 1I3NA 3GEGA 5BNIA 4OJNA 1WW8A 1ZO8A 4W9NA 1K6IA 2J5RA 3OEWA 1VE9A 3UUWA 3C7DB 1EK5A 1RM3A 2Q1TA 4IUYA 4DC0A 1H5QA 1NQTA 3I9NA 3Q3CA 3AFMA 4BL5A 5HTOA 3UXYA 1NNUA 1DFIA 1NVMB 5BNFA 4PIVA 4ND2A 1NR7A 1SCUA 2NNLD 3ZWMA 3KYDB 4XQ9A 3ZHBA 3JQFC 3DBLB 4J4BA 1U3UA 3TPCA 5T57A 4GLLA 3BA1A 1HLDA 1PJSA 1FK8A 4BVAA 4CQMD 1V3TA 1CERA 2Q49A 2A35A 1TI7A 1E5QA 1T4BA 3L6OO 1ZK2A 2VHYA 1SOVA 3I4CA 3GLQA 5ES3A 3L9WA 4YRAA 1H0KA 2BF7A 3KEOA 4EJ6A 3Q2KA 3VKVA 4ND5A 1JN0A 4Q3CA 4DUPA 3UW3A 4MVJE 4PLYA 4AFNA 1FF9A 2YV2A 4M86A 1XEAA 1KY4A 3O03A 2VRCA 4PLZA 1H9BA 1ZIDA 2Z95A 2VYND 3JQ6A 5DF1A 4TKLA 5A3JA 4S1VA 1V6AA 3P7MA 3ZWBA 4NDNE 4E32A 1NPDA 1KETA 4QFCA 4I5GA 4OKNA 3BTOA 1D8AA 2BKAA 2PH5A 1R4MB 2D2IA 3U4CA 3ONDA 4YJGA 1DIHA 2J3HA 1GY8A 5JCJD 3B1FA 4YWJA 3ROMA 1BXGA 1KS9A 1CWUA 3F1LA 2E82A 4NU6A 1U4SA 2CVZA 1EBUA 2GD1O 2Q46A 1PEDA 1PQUA 3JD1A 3IP1A 3WGOA 5CPFA 1ORRA 4M55A 1GUFA 1EZ4A 3F46A 3WICA 3P5SA 4IY1A 4C4OA 1ISMA 2FSSA 4EUFA 1T2CA 3WG9A 1DJNA 1MA0A 1FDTA 1JVSA 4E2XA 1GU7A 1XU9A 1UH5A 3JQBA 4GKVA 3DZHA 4W6ZA 2BGMA 4D3FA 3D3EA 3DBRB 1O8CA 1BVUA 2ZB3A 2ZB4A 5IXYA 4IGEA 2YYYA 2GN6A 1DAOA 4NK4A 4HFNA 3ETGA 1YB4A 1C0KA 1HRDA 1P33A 3ETDA 3JQGB 5CPBA 3BXXA 5TT0A 3JYLA 3QWHA 4EUEA 2QG4A 3DDNA 4R5MA 2DPHA 3JTMA 3LT1A 4K6CA 2JHFA 1VRWA 1D3AA 4DTIA 2E4AA 1Q0HA 4R1UA 4TQGA 1H2BA 2PKQO 1PX0A 4FQ8A 4MVJA 5IN4A 1GZ4A 3GEMA 4Y98A 3BAZA 4M8SA 5LDHA 2PH3A 2X23A 4E3ZA 1NX6A 5IJZA 3JV7A 4K1LA 4TRRA 5H83A 2ZB7A 3FNGA 1ZXBA 5LC1A 2YHIA 1WZEA 3PK0A 2YV3A 4RL6A 5F5NA 3Q9NA 4UULA 4OYRA 2UYYA 4DQUA 4BMNA 1EVIA 3STHA 2EW2A 3BHJA 2X9NA 3I9OA 3FSRA 1I3LA 4H16A 1GCUA 3OQ6A 4WPGA 4FJ2A 1BTOA 5FF9A 5K6AA 3HN7A 4CM9D 5CDSA 1EK6A 2FHSA 3DTTA 4CMEC 1KVUA 4XIYA 1O89A 3SC4A 4ALNA 2XXBA 2HMSA 4LMPA 3PEFA 1Y7TA 2NUAA 4ZGWA 3OQ1A 2PZMA 3R6DA 3ZNPA 3DHEA 3RUFA 4CLOA 3H2SA 2Q2WA 3PTZA 5A5EA 4J3FA 2FRDA 3H5RA 4BO3A 3D0OA 3ON5A 3VTFA 1B8VA 4AJLA 1DRUA 3UFXA 1VJTA 5EN4A 3I1JA 5L53A 2FR8A 1Y5MA 2DLDA 1PWZA 2FZEA 3KLMX 1NPTO 3JQBC 4XYMA 1LRKA 1XELA 4YJGB 1OI7A 2Y0EA 2AXQA 4DA9A 1B8PA 3PHHA 5THKA 3RSHA 1MV8A 1BXGB 1OC4A 2V65A 4FIZA 5EQFA 3DHNA 2AEFA 4RF3A 2H5LA 4ALMA 1K2WA 3H65A 4BO6A 3PDJA 5DNAA 1NHWA 1MFZA 1PZGA 1ZJYA 1NFQA 2IZ1A 4L0QA 3ZZNA 3VHRA 3L9XA 2J5QA 1YH3A 3LYLA 4D44A 2QHXA 1PQWA 1A27A 2I99A 5DULA 2HRBA 5CAEA 5U1PA 4J2OA 3MJEA 3R0IA 1I33A 4IIUA 3K8ZA 4LCJA 4U6QA 5BSGA 3GDGA 2VQ3A 1ZUD1 3GT0A 1YBVA 4IIVA 1Z7BA 3I9LA 1F8FA 1KEUA 3B70A 2GO1A 1DFHA 1X1TA 1YE3A 2ZTUA 4AICA 3W8EA 1TA4A 1Z74A 4R1NA 4BNJA 4MVJI 4BNWA 5KJFA 3UAGA 3PWSA 1QLJA 1PJTA 4XA8A 3FWNA 4K26A 3RJ9A 1CJCA 1JQBA 5CP8A 3U09A 2AQ8A 2D0IA 1ENYA 1UXHA 4L8VA 4BO1A 1UR5A 4CLEA 5A1TA 2X0NA 4FGSA 1ZW1A 3LLSA 2YHIB 4IMPA 2FSVA 3WS7A 5BSHA 1U2DA 1UDCA 3GPDG 3U4IA 5TGDA 5IAAA 4L4XA 3F4BA 4HNGA 5JS6A 1MLDA 3GG2A 5GZ1A 4O5OA 4IPTA 1W73A 2P9CA 2BGLA 3RU9A 3DAGA 1CYDA 1HDRA 2AHRA 1ZEMA 1GUYA 3RKRA 5JAIA 1J4AA 5DDIP 1XWFA 4CM1A 4CMIB 3A28A 2NU6A 3EVNA 1O0SA 1PSDA 5FI5A 2EJWA 5TJHA 3BMNA 2GUGA 4B3IA 4TROA 3WX0A 4I9NA 3NGLA 2Q50A 4LMRA 2JCYA 3LF2A 1K5HA 1U7TA 2UDPA 1T1SA 3FR8A 1YGYA 4ZQEA 2PA3A 2CNBA 4RVFA 5ICMA 5IXSA 4BNGA 4E5PA 4HNHA 4XGIA 1D4FA 3GNTA 2VZ9A 1E7RA 1HDGO 3VPXA 1RWBA 2O2SA 3EW7A 3MOIA 4NJOA 3ZWAA 4BB6A 3VOSA 3JSAA 3HB5X 1C0PA 1J6UA 4BKQA 5TS3A 1PGJA 3OP4A 4B7CA 4DLBA 4YYZA 1NXQA 1I2CA 3RUAA 1GCOA 3VZPA 4GGPA 1QG6A 4PG5A 1NQAO 3DWFA 4CLRA 3Q9UA 4A26A 1RYDA 4QTZA 3IMFA 2OHXA 3HJAA 1OBFO 1LTHR 4J1TA 3RBXA 4GI2A 4FB5A 5G2OA 3F47A 2JCXA 3E9MA 2AQIA 1Q0LA 1KIFA 4GX0A 2AMFA 4JNKA 4I8XA 5ENDA 3GGGA 3O9ZA 3IIEA 3RASA 2ZQYA 2Y66A 3TJRA 2CMDA 1YQDA 4O59O 3ZU4A 4B4WA 3OJLA 1ARZA 5AYVA 1IPEA 3BMOA 3ABIA 2IDZA 2AQHA 4L75A 5EMHA 3A14A 1P1RA 2P91A 3MEQA 1E6WA 1DIGA 5ILGA 4B3HA 1EVJA 5JAQA 2RH8A 3DMTA 1E3WA 3GGOA 4PVCA 3EZYA 4QFDA 2CFCA 8ADHA 1GADO 1LQUA 1R0LA 4BNZA 4XD2A 4PFJA 4INAA 3RCBA 1BXKA 1ZVMA 5EINA 1G0OA 4AJOA 3QVOA 1BVRA 3B20A 4W82A 4NBWA 5G0TA 3WTCA 4NFHA 2BGKA 1K89A 4CM3A 4FFRA 4GLOA 1ZNQO 2VWGA 1YWGO 5ITWA 3QVTA 4J7CA 1L1FA 4BS9A 1Y1PA 4A73A 2WYUA 3F9IA 4MKZA 2QW8A 1Q1NA 2D8AA 1I30A 2VZ0A 2CF5A 4JJFA 3NUGA 4KTTE 1E6UA 1P45A 2YY7A 1ULSA 3V1UA 5FWNA 2QYTA 3KYCA 2QQ5A 3BHIA 2FPPA 2YQ4A 4IZIA 3EAGA 2D1YA 4B4UA 3ENKA 3ZV5A 2DC1A 3FN4A 3K5PA 3GRPA 3GVIA 2P5YA 4AL4A 4XGKA 2Z5LA 1Z6ZA 5A03A 5DN9A 5EIOA 3WLEA 3DMYA 4E5NA 3UCEA 4IS2A 4F46A 2C59A 4YACA 3VDQA 1U7HA 2D3TA 1ISIA 2A94A 4I5FA 2CZCA 3QE3A 4KQXA 4EUHA 2JD1A 2CY0A 4I9HA 3QJ5A 3CTMA 3PGXA 3NT4A 5G0UA 2J3JA 3H9UA 4YB8A 4CQLA 4FFLA 4CL8A 2B83A 1TT5A 4FC6A 4YAGA 3WWZA 1C1DB 3DHYA 3H4VA 3ANLA 2FPIA 3KUXA 3UVEA 4BO9A 4MJLA 1XG5A 4IMRA 3EDMA 2SCUA 3MTGA 2JKVA 3OMLA 1JWBB 1JKJA 2V6BA 3E18A 4CLRB 1NASA 1T25A 1LSOA 1P0CA 1JA9A 4KOAA 4RPJA 3WSVA 4RF4A 4BNTA 3G3EA 2HKIA 2NTVA 3DMTC 2AQKA 2B5VA 3HSKA 1E3SA 4GX1A 3AM5A 1I32A 5L3ZA 3Q0EA 3NT2A 1NQ5A 3PLRA 3IJRA 4OXYA 3ZCXA 4PLPA 5TX7A 1LSJA 1YXMA 4DQVA 3HWRA 4ID9A 3GAZA 4GAEA 3PJEA 1ONOA 2PD3A 4AJ4A 5KJ1A 4Z9YA 1TT7A 4E5KA 3ICPA 4OM8A 5G0VA 2Q1SA 2JJYA 1X1EA 3PDUA 1P77A 1C0IA 2B4QA 4OAQA 5K9ZA 5CDYA 5J23A 2OBNA 4RDIA 2GLXA 4C7KA 4P38A 3IC5A 1NVTA 5L4LA 2PY6A 3LK7A 5A06A 4WLOA 3ZH2A 3NV9A 5JMPA 1U3WA 5IDQA 2FMUA 3GZNA 5A9RA 3MJ4A 5F5LA 3MTJA 5T64A 3AM4A 4OXKA 2DQ4A 3MOGA 1B15A 2IZZA 3GEDA 4YXFA 2FR0A 5JDIA 2AE1A 2Y1FA 3V1YA 3SJ7A 2DUWA 3Q2IA 1VC2A 4MDHA 3DZJA 1WP4A 3KYCB 5C7OO 2BH9A 1YKFA 3ONFA 4NBRA 4FW8A 1XDWA 7MDHA 1XCBA 1H2HA 5KTKA 1HWYA 3NT5A 1E7MA 3ZWOA 3JQAD 4NBVA 1A5ZA 1DIRA 3S55A 2ZTVA 4TZTA 5EERA 2Q1UA 2NWQA 4E33A 2C82A 4AJIA 5GMOA 4UUPA 4YAIA 4MINA 2F1KA 2I65A 3WBFA 3Q1LA 4ZRMA 2Y05A 1LDYA 1HDOA 4FOOA 4G65A 4XRRA 2QZZA 2YJZA 3GG9A 3ZNNA 1E7SA 7ADHA 1KC3A 4GX2A 4C7JA 4P4GA 5C7LO 2JD0A 4Z3KA 2HMUA 2WJPA 2Y1DA 2HMTA 5TRTA 4BMVA 4O1MA 1P1FA 3UH1A 1NR1A 1A7AA 2J3KA 4IDAA 1N1GA 2JAPA 3AI2A 2YFHA 3DBVO 4BGUA 3KSDO 1HF3A 2BFPA 3O4RA 3UCFA 1HE4A 4MKRA 2PKRA 2WYWA 4JX8A 1QORA 3VTZA 5HWSA 3HFGA 3I83A 2VCYA 3LU1A 2HK8A 4RCVA 4DMLA 3HQ4O 4OKIA 3F5QA 3KO8A 2G76A 5JAZA 2Q4EA 3B1KA 2VWPA 4PRKA 1LU9A 2OO5A 5IFLA 4R9RA 1F14A 1RM0A 1LDEA 3KRTA 4DRYA 3RFXA 3UCXA 3Q11A 3ZHYA 5HBRA 1YO6A 2DBZA 4A03A 3S2FA 4W7IA 3FNHA 5A9SA 2Y1EA 2DBRA 3DBHA 3F3SA 4BMSA 4EBFA 3JQFA 3AW9A 2I66A 3PXXA 3K92A 1M76A 3QVXA 5TLSA 5F1OA 2PLAA 2HUNA 2JFFA 5HM8A 2XPCA 1U2GA 1BMDA 1R37A 5DBFA 5CG1A 4DREA 1FDUA 1HE5A 3F6YA 4PLFA 4QEDA 2C7GA 2O50A 4Y9DA 1VL0A 5JDIC 2JL1A 4YJHB 3TL2A 4RQUA 2GPTA 1V3VA 1V3UA 2ZIZA 3EC7A 5BNTA 3DONA 4BNKA 1YL7A 3SBOA 4IZHA 4GWGA 1BHSA 2OXIA 5KJCA 4Z0PA 1AXGA 1I5RA 3GZNB 3H5NA 3ADPA 3ZU3A 1C1XA 3PGJA 5A4DA 1P1HA 3JD2A 3AOEC 4BNXA 5L9AA 1S7CA 4Y6SA 3DOJA 3MWEB 3WTBA 4ESOA 3N7UA 4YAJA 3OJOA 3PWZA 1PS8A 2FN7A 3PYXA 4WLFA 4XQGA 2AEMA 3T4EA 4BO8A 1RPNA 2FPGA 2AW5A 1IPFA 1PGNA 1EQUA 1ONPA 1VLLA 1UXKA 3ADOA 2VYVD 1X13A 4QT0A 3GH3A 4B79A 4JXKA 2EKQA 1BRMA 4R3WA 2LDBA 2ZK7A 1MUUA 2NVUA 3DFZA 3D5QA 3TOZA 1DIBA 1ZFNA 4RVGA 2BHLA 3K73O 2NQTA 3PWKA 1WDMA 3RC2A 5L4NA 5MGBA 4IDBA 9LDTA 4PG4A 3GN1A 1H6DA 1GYRA 3KHUA 5H81A 3DZFA 4AJJA 4J0EA 3FHLA 1ONNA 4GSLA 1LBEA 1GFSA 1ZMTA 4J7XA 3S8MA 3ZHXA 3QA9A 3FPCA 1XQ1A 3G79A 5TT1A 4XB2A 1UDBA 2CVOA 2RHRA 4GVXA 2CF6A 4TZKA 2PFGA 1RYEA 3C7CB 3HNPA 3KYBA 4R4JA 3WGZA 1P1JA 1HYEA 4JJIA 1PL8A 3D3WB 3AUTA 4M49A 5U4QA 4R54A 4HADA 4XQEA 4L4RA 1HE3A 4R5HA 1U28A 3KLPX 1Y6JA 3LDHA 4ZHSA 2D4AA 4R69A 1QYWA 4CPDA 3INTA 1PGOA 1KYQA 2BI7A 4CUJA 3KETA 4DPLA 4CMKA 6ADHA 2WYVA 4FJ1A 4X54A 3CXRA 4I9UA 4WE3A 5L95A 3KBOA 3JQAA 2HK9A 1ZEJA 3DOCA 2NU8A 1MFPA 4IJKA 1MG5A 3IUPA 4YRDA 4YA6A 4FPXA 4IDDA 1K3TA 3GMSA 1B0AA 4NG5A 1NWCA 2GRAA 2BELA 2Q99A 4LGVA 4FGWA 3W1VA 4CM6A 4JP3A 5TC4A 1F06A 4GKBA 3W4KA 3C1TA 3E6AA 3KTDA 4HXYA 2X0JA 3GUYA 2B4TO 4CMEA 4D45A 4AJ1A 2Q2VA 4TSKA 5F1PA 1M66A 3WNVA 4BV8A 2YHUA 1F0YA 1EBFA 1SEPA 2OBYA 3OA2A 4GX5A 3NTOA 1DC3A 4WKGA 4ZU3A 4LSWA 5C3MA 4QUKA 3ETEA 4RPKA 3NJ8A 2WMDA 1IYZA 5T6BA 6LDHA 5KVSA 3E82A 1C1XB 2WE7A 4IJVA 4LVUA 3N58A 4IBOA 4BO5A 2W90A 1EQ2A 3ASVA 3OH8A 4FFNA 1QYXA 4HBGA 3ZW9A 3H5AA 5KOIA 4LSMA 3QLJA 1HDCA 2X0RA 1QR6A 2HRZA 4CODB 2ZTLA 3SLKA 1W6UA 2EHDA 2VUTA 1BW9A 3NKLA 5G0WA 5A9TA 5IDYA 2Z1NA 3BIOA 3RC7A 4EW6A 3KEQA 2Q3EA 3PPIA 2O3UA 2UVDA 3WNQA 3U4DA 4HFMA 1I0ZA 3MJTA 5JBIA 2RIRA 3AM3A 2W2KA 2CDAA 5CEFA 4RF5A 1LLDA 2BI8A 1N9GB 1ISJA 1XLTA 2PKQP 3B6ZA 4IDFA 1V8BA 2PGJA 3N74A 4W7HA 1KVRA 4E31A 4DPMA 1S6YA 4JBIA 2VZ8A 3RC9A 2PV7A 3RKUA 4AJHA 1QYDA 2QRLA 4BNNA 1ID1A 1XGKA 4P8RA 3VZQA 3HDQA 3COSA 3H8VA 4CV1A 2GF2A 2DU8A 3U9LA 4P4LA 2GR9A 1N1EA 3JQ8A 1ISGA 2NTNA 4QXMA 4W4TA 2W98A 4DIFA 4RQTA 1LSUA 5FFFA 1M67A 4RPLA 1XHLA 5I8ZA 2YW9A 3RUCA 4J9VA 5EPOA 3RWBA 1UXGA 4BO0A 1U1IA 4OSOA 3GQVA 2VYVA 1DLJA 3NRCA 1U4OA 3RC1A 4TVBA 2VNSA 3PZRA 4YT8A 3PHJA 2HSDA 4E4YA 1PJBA 2VOEA 4QO8A 4OQYA 3TZKA 4AVYA 2X0IA 1T24A 4R51A 4LVCA 1B26A 4KZPA 5I9NA 3OJ0A 1YRLA 3HE3A 3VZRA 5I9MA 2GNAA 3IKTA 4AJ2A 3IUSA 3AUSA 2PZLA 4BNVA 1H94A 4XR9A 4UEOA 5TJ9A 1P9LA 1RJWA 4JLWA 4RV9A 1LNQA 3PFWO 3QV1A 4YEDA 1Z73A 2CSUA 4Y6PA 2RHCA 1NBOA 1VKNA 3PIIA 3TZQA 3LQFA 4WCFC 4XEHA 3KZVA 3K96A 5B37A 4A7PA 4Z0HO 4B8ZA 1QRRA 1K0UA 3MZ0A 3PYMA 1GR0A 2V6FA 4BKRA 1WAMA 4CLXA 3I52A 4CQMA 5G0SA 2ZYGA 1IZ0A 2DKNA 4NNJA 1QLHA 1BGVA 3AFNA 4RPHA 5JC8A 4NU5A 1YDWA 1P74A 3GHYA 1E3EA 3OJEA 5BT9A 2XAAA 3U4HA 4NK5A 3NDRA 1OAAA 2W4QA 3O8QA 5AXCA 3DZIA 1Z45A 1YOVA 2EP7A 4Q3AA 1EDZA 1LDMA 2PD6A 1E1MA 1VJ1A 4BNYA 4GGOA 1PJ2A 3L4BC 2VYNA 3PQEA 3JD0A 3O38A 3WQQA 1DB3A 5ITVA 4KP7A 2NU7A 2IXBA 3JYQA 4PG6A 4WEOA 4NMHA 2IEDA 2HQ1A 2W2KB 4Z6KA 2JCVA 2C0CA 4CR8A 5JAMA 4CV3A 3BMCA 4PZEA 1DO8A 4E2YA 4B4OA 1EUCA 2WSBA 1WDLA 5JCJA 4HY3A 2DBQA 4JK3A 4DC1A 3UF0A 1V9LA 1AE1A 4UVDA 4HKTA 5JNLA 1IOLA 4UUNA 2H6EA 4N5LA 3ROKA 1MP0A 4HV4A 2VTEA 4ND1A 1EEHA 1Q7GA 4HX5A 3SLGA 3AU9A 4J1SA 1U8FO 3JQ8B 3MJVA 2GGSA 4YDRA 1HE2A 2QZ9A 5JY1A 4Y6RA 3UOGA 4WGGA 1K6JA 3JD3A 4CJXA 1YL5A 3FCOA 4YT4A 2B69A 1SB8A 4URFA 2J3IA 4XDZA 1IY8A 2Y68A 3PRJA 4IQGA 2P2SA 1LSSA 5KNLA 3FPLA 4Z9XA 1TB4A 1Y81A 2B4RO 1I2ZA 3PI7A 3D4OA 3KVOA 5B4UA 3ZV3A 3B1JA 1O94A 4MVJP 5EESA 3RUEA 1GD1O 3QWIA 1R16A 1T4DA 4MP6A 1YJ8A 2V6GA 1GAEO 2OOSA 2TMDA 4UVEA 3X2FA 4CLOB 3QWBA 2X9VA 4GSKA 3SC6A 1BXZA 4DWVA 4ONEA 4L9RA 1HSZA 1X0VA 5AXAA 5THQA 4J1NA 3TZHA 3PJGA 3SJUA 1ENZA 5L40A 3TDKA 2BFMA 3ZU2A 4BUCA 3JQDA 2E48A 3E9QA 3ZWYA 4N54A 1B3RA 1ZK1A 4W99A 2ZATA 5AOVA 2WD7A 4FDAA 4IJWA 1FDSA 1NTOA 2DTEA 4GH5A 3IAHA 5DBGA 5A05A 4E5YA 4FS3A 5COQA 5AVOA 4CM9A 4CQMB 1GV1A 2GZ3A 4XIJA 4FJ0A 4BGIA 5DCYA 1O5IA 4RPGA 1LRJA 1LC3A 3GC6A 2PK3A 1E1LA 4B3JA 2C07A 5KWEA 2O3SA 1YVEI 3HADA 3NYWA 1LDNA 2ZB8A 2P9EA 4CLDA 3O8QB 3R1IA 1UZLA 4KUHA 5IZCA 3D4NA 3IL2A 2VT2A 3QVSA 2PWZA 4BKUA 2GCGA 2HMVA 3OETA 4MVJF 3A9WA 2J8ZA 1EUDA 3QY9A 4ITUA 4JROA 5A02A 1ADCA 2IZ0A 3AUUA 3ZW8A 2E6UX 2WE8A 3T7EA 2HJRA 5COBA 3ROPA 3BHMA 3HDHA 5G4KA 3WB9A 2EXXA 1PS0A 2DBVO 2ZJ1A 3LF1A 3L77A 3GVPA 4OL9A 4D0RA 3E5MA 3SVTA 5I9LA 3FNEA 1YB1A 4R1SA 3NAQA 4R1TA 1SB9A 3V8BA 4DYVA 1H9AA 4NZ9A 3LT0A 1XQ6A 2X58A 4FD3A 3EMKA 4ND3A 2QIOA 1YDEA 2G17A 4OMUA 3VZSA 1MG0A 4GBJA 2EP5A 2P4HX 1EE2A 1YQGA 2H63A 4IDEA 4XGNA 3QWFA 1XKQA 3T7CA 1DHRA 5DZSA 4E6PA 2O2YA 1HYHA 5IZ4A 4YAKA 2BD0A 2CDBA 4Q3NA 2GSDA 3VH4A 1MGOA 4XWYA 2P9GA 4MVJM 1ZKMA 2UUPA 4NIMA 5CEJA 1HKUA 3PFFA 1BSVA 4Y8VA 1WNTA 5KKCA 4E5MA 1SOWA 4B4VA 1HETA 1YL6A 2I3AA 3BMNB 3H9EO 3PHIA 1PJQA 4RO0A 5IG2A 5LCXA 4B8WA 1E1KA 2P4QA 1CIVA 1KY5A 3KM0A 4Y67A 3MWDB 2OMEA 4ILKA 3AI3A 1LRLA 1ZXLA 4A27A 5F21A 4MOWA 1U3TA 3VH3A 3WGYA 1WMBA 3H6KA 4FFPA 1E7QA 1JLLA 1PZHA 4A0SA 3U49A 4PZDA 3MJSA 5IZCC 3EVTA 4WLVA 4D3SA 5A5FA 4CMBA 4EZBA 2A92A 3C8MA 1OC2A 2WD7B 3K9QO 4J2HA 2GYYA 2HCTA 4OOFA 3UKOA 5CEEA 4OSPA 1KEPA 3KSUA 2WM3A 3GAFA 2O3QA 1RKXA 4J90A 1AHHA 5JO0A 4XB1A 3IOYA 4K28A 4K6FA 4J49A 4PN3A 5BQFA 4IXTA 1D1TA 4XYEA 2TMGA 3AJRA 1T1RA 3WIEA 3OF2A 3CZRA 1HZJA 4GQAA 3L07A 4BGVA 4NR0A 1LI4A 4BO2A 4CV2A 3FR7A 2C5EA 1DJQA 2Y67A 3G0OA 5BR7A 1NYTA 1PGQA 4LISA 3RD5A 3GFGA 3DFUA 3BMOB 2JFHA 3DB2A 5EJ2A 1Y5RA 2ZKLA 3UHAA 3W6ZA 3PLNA 5I8WA 1JKIA 4MIEA 3CUKA 4BKPA 2O7SA 4OXNA 3ZV6A 4D79A 3DC2A 2C54A 1A7KA 4JGBA 1W0CA 1E3WB 5TIIA 1AGNA 2AG5A 3EZLA 5G4KB 4FR5A 1RM4A 4ZVVA 1LDBA 1J0XO 2PGLA 5T8KC 3A06A 4H3VA 4U0JA 3DXFA 1G0NA 4LRSB 2JAHA 3WOHA 3PYLA 4J6FA 3WYCA 5KVCA 1VI2A 5JSFA 4WLEA 4J0FA 1CQJA 2EKLA 3JYPA 1ZK0A 5JC1A 2IYPA 3FBGA 4N5NA 2GN9A 3C7AA 1BWSA 1PJ3A 3GY0A 3LZ6A 3LLVA 4EYEA 3H9JA 4J16A 1ENOA 2EGHA 1QSGA 4FFOA 3RIHA 4D41A 1A9YA 4CMCA 4XCVA 4JP2A 1X15A 4XYGA 5C37A 4LN1A 2YUTA 1W4ZA 2YZ7A 1NVGA 4U6SA 1OMOA 1ISFA 2YQ5A 4RVSA 3U0BA 4YVFA 3AOEA 1JU9A 1P3DA 4BKOA 1CF2O 5BSEA 1QYVA 3LC7O 3WQRA 4FFMA 4RJTA 4ZQGA 4P22A 3KOUA 3HG7A 5JPIA 1XU7A 1N5DA 4I08A 1RM5A 2R6JA 1YQXA 1PR9A 2HK7A 1WZIA 1P1KA 5KJEA 3K30A 3NGXA 4MIYA 3WGTA 5C5IA 4L76A 2JD2A 4RZHA 1XYGA 4DIBA 3HUDA 4RLSA 3RFTA 1GL3A 2V6MA 3I23A 3MJCA 4M87A 3ZWCA 1V35A 4CQLB 1PJ4A 2DUUA 1I3MA 1TT5B 1ULUA 3PQFA 1ZSNA 3WBBA 5U9CA 4XRGA 1DBVO 1FMCA 3RI3A 3BTSA 3ZV4A 2VRCD 4R9SA 3W4IA 4L74A 1LLQA 2HMWA 1P1IA 1IL0A 4ZRNA 3NDJA 2ZCUA 1UZNA 4IS3A 4J4TA 5L51A 4D0SA 3LC2O 2QRJA 2JHGA 4QO7A 4XYBA 1TXGA 1UP7A 5KJ6A 3IKVA 1LJ8A 1C3VA 1PJCA 3OIGA 1UP4A 3OIDA 4CM4A 4MIOA 1T26A 1HTBA 2POQX 2VNAA 1JDJA 1E3JA 3RUIA 1F17A 3ANNA 1HDXA 1UUFA 4XZ3A 5TF4A 2X6TA 4TVOA 5JDCC 2EKPA 4RVUA 1FDVA 5A04A 1GZ6A 3TQHA 3AY7A 4PLCA 1SPXA 4NBTA 3EHEA 1HXHA 1UJMA 5AXBA 1JAXA 5FEUA 1DDOA 4PCVA 1HLPA 5DP2A 4DMMA 3GFBA 2RH4A 4XJTA 2VWQA 4EJ0A 2BFOA 3GDFA 3QRWA 8LDHA 1HSOA 1CDOA 1X0XA 2R00A 4HFJA 4JN6B 1PGPA 3VPGA 3I9KA 3CZMA 2NQ8A 4GWKA 1NM5A 1NP3A 4L4SA 3HZZA 4NI5A 3P2OA 4IM7A 1I01A 2OFPA 2EF1A 1O6ZA 2DFDA 1JW9B 4EITA 4MVJG 5B1YA 1GDHA 4WUVA 1HEUA 3OSUA 3UGKA 5C7IO 3GOHA 2OORA 1HDZA 3S1LA 3X2EA 4A5OA 1R4MA 4JQCA 4CLHA 3K31A 3WSWA 1BG6A 3FF4A 2PNFA 4MVJD 1GTMA 4WNCA 3H7AA 2XOXA 3RBVA 5DT9A 1SO8A 3WDSA 1I36A 2D59A 2DFVA 4J1QA 4PLTA 1J49A 1KVQA 4NH4A 3K2EA 1MX3A 3GRKA 1T2EA 1KERA 3E1KA 2B0JA 3JQ9A 4J7UA 3UN1A 4KMSA 4KUGA 3ZN2A 3IDSA 4YRBA 2DPGA 3FTNA 4HUJA 1EVYA 1VKOA 1WXDA 2QRKA 2X7HA 1Y9AA 1ZSYA 2VTDA 3E5RA 1R6DA 5KKAA 4K9DA 5DBIA 3WLFA 4OO3A 1P44A 3D5TA 4XQCA 1QV6A 1F12A 3DO5A 3V2HA 2IODA 3EYWA 2O3JA 3TF5A 1MXHA 3QQPA 1WVGA 4O6VA 1ZSVA 1U8XX 3VPFA 1CETA 2V7PA 3G17A 4QQRA 2B5WA 4II3A 5ILOA 5L45A 2X86A 3INRA 3FWZA 2AA3A 3GMDA 2EEZA 1NFRA 1Y9EA 3WFJA 4IJUA 3WJAA 4HWKA 5GZ6A 5L7TA 2NV6A 5TNXA 3QSGA 4ZQFA 5G4LA 3INGA 3U62A 1ZK3A 1R0KA 2C7VA 1YONA 2NM0A 2Y0DA 3ZI0A 1D7OA 4YR9A 1SNYA 2EJVA 2B37A 3G1TA 3P19A 4BHTA 4OOEA 3DBHB 3W4JA 5A9SB 4CM4B 2R00C 4II2A 3HHPA 1PIWA 1MXFA 2NVBA 3EY4A 3QWAA 3AUAA 4HFRA 4CM5A 3TSCA 1KOLA 1R15A 1XR3A 1SMKA 1TVEA 5HA5A 5TQVA 3H3FA 1M2WA 3Q6IA 2FP4A 2GZ2A 1N2SA 4DPKA 5GY7A 2NTJA 3AI1A 3H9QA 4WK6A 1GEGA 3BMQA 1UXJA 3GK3A 3RFVA 3ITKA 4PG8A 3VKUA 4Q3EA 3GPIA 1XIVA 2VOJA
chains in the Genus database with same CATH superfamily
4RIFA 4TLEA 4XD7A 3IMEA 4YMIA 4I55A 3QEMA 4Y2SA 2AG0A 1QAOA 4YRIA 5B6PA 1T10A 4EQ6B 3R75A 4M60A 4HDKB 4B6JA 2GMWA 2ZUCA 3O94A 1LLCA 2QDKA 1XQWA 3C2QA 5KSYA 3K0FB 1R4NA 5JNSA 3ICQB 3PNPA 4Q6WA 4YBRA 3MWKA 4N40A 5F33A 2RK6A 2WWGA 4P6VF 5GZ3A 2BH2A 3R9XA 4MI9A 4DXHA 3TZCA 2AX3A 3RS9A 1G3MA 2BFCA 4KK4A 1GG5A 2HF2A 4JJGA 4MR8A 1CY4A 5FWXA 1AO0A 3URKA 1Z82A 2P6RA 3BH7A 4BQRA 1YHYA 4L5CA 1FUUA 4RHTA 3E9EA 2WU8A 3W2FA 1QANA 5IJWA 1QVAA 2OZEA 3CINA 3KTOA 4FXPA 1AN0A 1EFHA 2W6OA 5C1DA 5F7OA 3DEAA 4M8KA 2H57A 1ZMXA 2V58A 3AQIA 2VN8A 2J6IA 1Q7CA 2BFNA 3H8WA 4NESA 5GONB 3VNRA 4ZTBA 3EWAA 2EIHA 1AK9A 5GQSA 4M7WA 4HMOA 5SZHB 2JLWA 5IN5A 4L95C 4TYYA 1GM5A 1L4KA 1SOUA 1TK2A 2I7VA 1FMJA 2CHGA 3WL3A 3VPBA 1SVNA 3T7SA 3AK4A 4X3PA 3WLQA 1G7SA 1QYCA 2DETA 2WG0A 4XVRA 4EJMA 1GNQA 4WJKB 2NN3C 3L6DA 4R71A 4IDGA 2DVMA 2D54A 3NTVA 3ADBA 1SVUA 3DWIA 5JAUA 3OQJA 5KC8A 1A4XA 3H4IA 3MELA 2WB2A 3DQPA 5E7JA 3MUNA 3VISA 5AVYA 5I4IA 5K5EA 1M2OB 4S2EA 4J91A 3TXYA 3DTVD 3NEJA 1W76A 3CMMA 4ETNA 1A4IA 3BYZA 5JJBA 1UBFA 3DMRA 4V0OA 2CFIA 4GMGA 3E7WA 2O5EA 1G7RA 1M9NA 1VJDA 5JHGB 1J8FA 4UEKA 1K8YB 3N0TA 1DC6A 5JI3E 1RE0A 4HGOA 3F1KA 5IKEA 1FFDA 1GUAA 4B4OA 1JAZA 1LC0A 2RB4A 1U0GA 3TI9A 3HP7A 1ZN7A 5K0SA 3F9RA 1FDWA 3Q72A 3WJ2A 2UZ1A 1E5LA 4AM8A 2AI1A 2UVPA 1M8KA 2PD4A 3CT4A 3QOYA 4Y3UA 1FYDA 5FBHA 5JSKA 5BURA 2WUVA 4P34A 3TZ6A 2ZRFA 3PTAA 1DUVG 3FB1A 5FOXA 5KYNA 4F96A 1NRXA 2QMEA 3HN2A 4H7JA 3L79A 4R3UC 1MRSA 2B20A 3OZBA 4FEEA 1TF7A 1E0JA 4MRMB 4MW6A 2EJBA 4YQZA 4B73A 3SFTA 4OXIA 1R12A 2VUSA 1OFGA 1N5KA 1PFGA 1SUSA 2M2IA 2X40A 2WU1A 1B6TA 3N8DA 1HFWA 1QC5B 2IELA 3GZ4A 2RHLA 2WA2A 5HRUA 2ZAMA 1B7GO 4YUVA 3KPJA 2H7CA 1Y5NA 2FP4B 1GWNA 3PV0A 1N92A 2PZFA 1NN5A 1CUGA 1AHIA 3SIXA 3B5JA 2GH1A 2GZAA 3QU7A 4R6WA 4ME6A 4UVHA 5ECWA 4FYYA 4WJZA 2VHZA 5DWQA 1N75A 3TXXA 3WMRA 2OG2A 1FUYB 4IIJA 3N3AC 1NLYA 1IIBA 1TFUA 4QHSA 3WGHA 1EVEA 4G5SA 3NTRA 2J9FB 2QZSA 1VPDA 1N6OA 2GXUA 4I5EA 4IP0A 4PLHA 3J81k 4CMJA 3LO8A 5K4AA 2GBPA 3JVEA 1IXYA 5SZIA 4EB8A 2ZIUB 4NDZA 5GONF 2G5CA 5TSDA 4FXOA 2BGIA 5AW5A 4TMFA 4X20A 1KEVA 2C2YA 5ALVA 5ADWA 1QVRA 1ESEA 2P7HA 2HO5A 1XZFA 4LPSA 4IIDA 1RNLA 2H1HA 1A72A 2X8BA 3G85A 3V80A 4BFLA 3WQBA 3H42B 1WSAA 2O0LA 4U5QA 2OFFA 5KZMB 1E9VA 5DOVA 3FIJA 2RHJA 4YPOA 1QIDA 3N76A 5ALJA 1ADBA 2HDWA 4YT2A 3ICOA 2XMRA 2Q28A 3TOXA 1PFKA 1BU5A 2JFBA 5AK5A 2CD9A 4QXPA 3UAXA 2HA5A 3DT8A 2FZKA 1NAHA 3SSOA 1JR3E 3GOQA 4KQJA 4N39A 5T7BA 4XJXA 1QU2A 1M7GA 3CHYA 4BP3A 1ZR2A 1H69A 2ZRKA 2NT3A 4AW9A 2A6PA 4G37A 621PA 5JLJA 4BO4A 3ZWPA 1DIOB 1R6UA 2XV1A 1JDBC 4D3ZA 4KSBA 4RA6A 4EYSA 3BQNB 3FTCA 3PFGA 4CM7A 3HMKA 2XTJA 5BW5A 1NVAA 5M04A 5DIFA 1NAIA 6PFKA 4F5ZA 1BEEA 3WHKA 3LQQA 4AJPA 3WLKX 3G8CA 2O48X 3E8MA 4MRRA 4B2YA 2X8WA 4MYHA 4LV8B 4JC5A 4WOBA 2Q4BA 1XEWX 1ZZEA 3G89A 3QLUC 1ZBQA 4WEQA 4YFVA 3UXMA 3ZWXA 1G5FA 1GUZA 1ODCA 1GIAA 1YQTA 2IYVA 3H2HA 3OURA 4LXQA 5DEIA 3WIOA 3CA8A 2ZM6B 3O90A 3OHSX 3ORHA 3ZZTA 3VDRA 4DQ0A 3O4HA 3U81A 2P41A 3A6FA 3LT2A 1C30A 3NGMA 4EP1A 4R8LA 3PNVA 4CEJA 3UM9A 1JKMA 2DT5A 2QMOA 4I6JA 4ASUA 2G1UA 3QU9A 4HDMB 2ORVA 5IX8A 1BNCA 1KRHA 2BISA 2Z9DA 3D64A 4QOGA 3UJ7A 1WKVA 4DDMA 1K1EA 1YB6A 3A2MA 3LQ2A 4DQLA 4NS4A 2PL9A 2FZ4A 1EH5A 3UICA 1V2GA 2H29A 1MX9A 2B92A 2O06A 2R86A 3RS3A 4MUJA 3RS2A 3WGUA 4OX9B 2EERA 1IRXA 3HXMA 4KH1A 2VRWA 3A4IA 1WPXA 4GLBA 5JFOA 1QZUA 2GDZA 2QT0A 3O9MA 2G1AA 4O4HB 2HA0A 4WECA 2AT1A 3RBZA 2GBGA 1FP4A 1M6WA 2Z1DA 4PZCA 3SJAA 3AY6A 4AP6A 4LTDA 1NMXA 1T2DA 4UAGA 2PDAA 3M6FA 4O0LA 3EPJA 1IJEA 2O4CA 2PJUA 4IRMA 2J87A 2PSHA 3B9PA 3IPAA 3D8NA 4I3FA 1ESCA 1JTVA 1USVA 2WMYA 3A58B 5CXSA 1V9SA 4YRFA 5JH7B 4BV9A 3WGIA 3ZVKA 1DOAA 4J0QA 1C14A 4MRVA 1WEKA 1PT6A 2GKSA 2C3MA 4HCJA 4UE2A 4BQOA 4WGFA 1B1CA 2W2LD 1N32B 3W3ZB 1PQ4A 2RI0A 2IS1A 3L40A 3DEYX 5EXDA 1U63A 1QQ5A 4UHFA 3VVBA 4WX2B 3D31A 1FOEB 3WR5A 3L7DA 2GN8A 5IK2A 1KJQA 3ETLA 3PQCA 4KGXA 4MITA 4PPQA 2XF8A 3NBYC 2ATCA 4DARA 5I4CA 4IGAA 1M0EA 1V2HE 1GA6A 4NEGA 4R1LA 5CGZA 3PXEA 4BJ1A 3R4VA 2HXSA 1C1HA 3B3FA 3EN0A 4KE7A 4NJMA 5F2OA 3W78A 2OUIA 4IINA 5JS1A 2H54A 3GRFA 4QYIA 2WHPB 4CIVA 4FOLA 4CM8B 1V45E 3GIDA 3SD7A 5C0OE 1HC7A 1A5BB 1NNLA 1ZCJA 1KJYA 5EIWA 3M33A 1Z39A 5DLEA 1PUIA 4X6LA 2PUDA 2G28A 3COPA 4MUKA 1I9GA 1BFUA 4HDRB 4ETIA 1M8FA 3MIZA 4L73A 2C7BA 3VPSA 3REQB 3UAYA 4C88A 5JJCA 1WLYA 1NPYA 4HYYA 5MN6A 1WUJS 2GZMA 1KARA 4GRIA 5DCLA 5JS2A 1CEQA 2QD2A 3K6JA 1U80A 3H7IA 4HDSA 3F90A 3SEZA 3MGAA 4N18A 3TTWA 1WPQA 1OIWA 2OHFA 4YT5A 4CL3A 1UFRA 3V5NA 3L6UA 3D2CA 2N9UA 4LJ7A 1OXBB 1Z63A 5B4VA 3JAKB 4ZN6A 4DYDA 4KQFA 1U2EA 2EGUA 2X22A 2C96A 3BXEA 3N53A 4EG6A 5IAJA 3TNDA 1U2DC 1SZJG 1FXSA 4G6ZA 4JVLA 2XVYA 3LOUA 3M1AA 2IUYA 3HU3A 3GN2A 3ITDA 1PJLA 2MU1A 4NYIQ 1C8KA 5I7WA 4MUGA 2XUDA 4UHKA 3OCUA 2BGGA 2GHRA 3ZGYA 1LPSA 3VC1A 3A2KA 2BGNA 3ZLVA 1VE3A 1WABA 2NW6A 1J5EB 4F21A 1S5PA 4U1RA 3G2HA 1OFIA 1JFFA 1OLSB 4K1XA 1L1RA 1JA1A 1L4BA 3DOOA 5AJVB 2HDNB 1T0HB 2R5FA 5KOJB 1CR6A 1XJWA 2BZGA 3JPWA 3WFIA 4C08A 3A36A 1N0UA 5BN4B 5JW6A 5IDWA 2FZ5A 1T2UA 2DKOA 3WI7A 2ZUSA 1A7JA 2CNLA 1EX9A 5JH7F 2Q1WA 3KQTA 4FWIB 3UJNA 3QE4A 3KQYA 2A0XA 5K3CA 1FFYA 3TL3A 3PXCX 3HN6A 4FR0A 3IP3A 4XFDA 2XYPA 3B6KA 2QN2A 3H99A 2O3RA 2DE0X 3AJ8A 4CUKA 4ESHA 2HU2A 1G6KA 1Z75A 1CRWG 1F8GA 5FBQB 4HD8A 1E4EA 3DEZA 2R11A 4PHHA 5B3AA 4DLAA 5T67A 5EJEA 1R5OA 2FK8A 4RJ2A 1Y7IA 3OI7A 1N3YA 1C9EA 4RHXA 1AXEA 2A0KA 3AX6A 5TMBA 3P5BA 4NCAA 3DBIA 1AG9A 3ZE6A 5SY9A 5COAA 2OHIA 2PYIA 1LV7A 1B14A 3HGTA 2IY8A 2I7CA 3L8YA 5MHTA 1M34B 5BUCA 3P9YA 1EP3B 2JIQA 4WW0A 4TS4A 1PFQA 5H82A 4ADSG 2BMEA 1B0UA 1PN3A 3MMSA 3V1NA 2Y2VA 3ORSA 2JFOA 2ZRPA 3CH5A 3TUJC 5KNBD 2FLWA 4XWWA 3VNUA 1Q1ZA 5CM8B 2CE2X 1FXUA 3DG9A 2O7VA 1XTRA 4ZGGA 5FR1A 5K09A 5K3OA 1V6SA 3EFEA 1KPGA 3M6AA 3CEPB 1SCIA 3AIIA 1CPYA 1A50B 2JFGA 4RF2A 5KVQA 1JLRA 4F3KA 2PR2A 1E7WA 4R41A 4AN1A 1JG1A 3VI4B 3NNDA 2LGJA 3M5CA 2JJQA 4I1IA 3CEAA 1ZMBA 5LQUA 1DHTA 1KZYC 1XU4A 4FKMA 1YKGA 3PRHA 5CXQA 3P0RA 3H2ZA 6REQB 3TJZA 5AW0A 4ZVQA 3NORA 1I9CA 3NEPX 4X7RA 5EJMA 5DP1A 3R4CA 2GLTA 3E2IA 1GPLA 3KZOA 3COVA 3OCVA 4CMHA 1R2QA 2RJNA 5K8TA 3ZLJA 1MB9A 1G9TA 4KWHA 1S2NA 2NO4A 2CVPA 3AY3A 2JGMA 5K8VA 4YCAA 4X5OA 3UAZA 1JSCA 2KHZA 2E49A 3MJDA 2H0AA 1F9EA 1KZ9A 3FI9A 4EUNA 3HDJA 1JJVA 3AINA 1QE0A 4FSHA 4KVZA 3THYA 4OIMA 2XQVA 3DEHA 5EE0A 2COKA 1Q7BA 3CSDA 3FPKA 2ZJ0A 2XUGA 1YS6A 4AKSA 4H7PA 3PTLA 2SBTA 4G2NA 1ADYA 4KL8S 2PE5A 4X1YB 4XSHA 2Z43A 5E6RB 3DKRA 5EMJA 3LVFO 2C5HA 4DMKA 1VI5A 1LPBB 3CLTD 2PUEA 2WAAA 4MWCA 4YI3A 2D13A 4EHIA 1L8OA 4Z53A 1UMBA 3O0DA 2FMXA 2KBFA 1JHAA 1QKKA 2OFWA 3CVJA 4Y2VA 4Y7CA 3N9IA 3E03A 3V1TC 4BNLA 5JAPA 4K2HA 1KZ6A 3V4SA 3LCVB 3AEUB 3DM5A 1M1YB 2LVBA 2H06A 3IT0A 2FSGA 2MINA 3N8HA 3C24A 4LXYA 5ANRB 4MROA 4KAJA 2ZIFA 1JX6A 4DBZA 1JXQA 3MWEA 1V11B 1IXSB 2FEAA 2EG9A 2GCOB 2IU4A 2FKAA 3IMKA 2JCSA 2XA2A 3DYIA 3NC0C 1I1NA 3TNLA 4B3BA 3LTNC 2CW5A 5LDDC 5BMVB 3K2BA 3AQ4A 3A1DA 3BK1A 1NJ6A 3V2GA 4X8MA 1A04A 4KGZA 4P3NA 4XX0B 2FNAA 3M5WA 4H4DA 2YYZA 4MV6A 1TFRA 2QS9A 1CZKA 3ID6C 4D57A 3BFJA 3MGCA 5G3YA 3TZEA 2X4GA 2VL7A 2K2QB 3EEQA 3HB4X 3HZHA 3QHAA 4K9RA 3E70C 3RS5A 1Y4UA 1B4DA 1VCOA 2OP1A 1ACJA 2IZ5A 2QK4A 3EPLA 1Z0ZA 3LA8A 3U48A 2ZSDA 2I34A 2DTDA 2HY7A 1E0DA 2QN9A 4GPD1 4FLMA 3ZGLA 1OPXA 3F6BX 3K6SB 2PMWB 3O3OB 4Z9FA 4QGFA 5BWCA 4ETMA 1E60A 2VEOA 3BERA 1E9CA 3EJ6A 3Q7SA 1G3UA 5L3QB 5H8WA 1DOZA 2IW1A 3IVCA 4KYTA 4Q7QA 4IDOA 3OBBA 5CDTA 3HYRA 4CNQA 3WYEA 1A5SB 3OECA 1ACMA 1EE9A 1N2EA 2IXFA 2VIIA 3T38A 1RRFA 3D3WA 4OH1A 1O6BA 1ORWA 2PFSA 3KYDA 3OE7A 4MS4A 4UQOA 3WOVA 1LK5A 2Q9BA 1MB3A 4M1QA 3DTYA 1FEZA 4IR7A 3ZE0B 4E2WA 1E96A 4P1ZA 1LXCA 1Q95A 3HJBA 2HZ7A 3U17A 2J1LA 4XR4A 4ZYYA 1P2BA 1C50A 4TWJA 5B1EA 2ZT5A 2NSLA 4LWPA 2PCLA 3LYAA 4PPYA 4RFVA 1W2GA 3AY0A 4KXQA 1REQB 1MPXA 2C29D 4AF8A 4N0EA 3K9LA 4JB2A 4MO2A 3TRIA 1YZGA 2QAJA 5AXDA 3WKAA 4ER5A 4NF2A 1D1SA 4TTSA 2X4LA 3ZYZA 3BTUA 1L8QA 1XDDA 2GRUA 3B89A 1QIMA 4N5MA 1DBQA 3RFUA 1L2TA 1UP6A 2C97A 2JLXA 1XZIA 1FDIA 4Y6LA 3JYOA 4NQZA 1SVIA 3CKMA 3DNMA 1PFUA 2ZVDA 1H5UA 2GZSA 2VHXA 4TL9A 3O73A 5K2OA 4KZKA 1PS9A 3PUYA 3DFIA 4KXFB 2JIPA 3O91A 1IEQA 3QX3A 2QPLA 1FVHA 3THWA 4GFDA 3LL4A 4FC7A 1IE3A 1FNMA 3D1LA 1RWMA 1XZKA 2XCUA 4GC9A 2WWIA 3NJ4A 4MLCA 4MWEA 2NLOA 2QW0X 3OFJA 5GVSA 2YWRA 2ZBUA 2AFIA 4HGQA 1Z7YA 4I50A 3QIVA 2H31A 4BVLA 2QTHA 5K0NA 4P33A 3GDOA 4MS1B 3GR6A 3LT5A 1CQPA 3GFSA 3DBOB 1QYIA 3MINA 5HZGA 4Z3OA 3L8CA 3NBKA 4RADA 1IOWA 1L5VA 2WIGA 3BKWA 3EDRA 4BOYA 3VDXA 5BMVF 5K6RA 2A0YA 3S2GA 1U9JA 4RVDA 2HA2A 3DO8A 3CEJA 3M1LA 1EUZA 3AHCA 1Z5UA 2UUOA 1VL6A 1ZL0A 3D2LA 4UREA 2WIKA 5T41A 1FLDA 1YS4A 2HRQA 2P5UA 4D96A 1DAKA 4WCDA 2VWHA 1VFNA 3KWFA 3ZGXA 4YP5A 5EZQA 2GN4A 5J59A 3ZBQA 5J43A 4P2BA 4C0JA 4M0KA 3DBRA 2ZU0C 4ML3A 3FETA 3ODPA 5EY5B 3VPHA 3HDYA 3W3AH 1G98A 4K5QA 5EMLA 3ZR4B 2HQSA 4L85A 1JG4A 3UMGA 2JKZA 3MTQA 3CUUA 4FFWA 3S2ZA 5JU6A 1IUKA 3GFQA 3IT2A 3MLBA 3SC3A 1NNI1 4TRNA 5KTOA 4AB1A 4G0XA 2LKDA 1N9KA 2G9NA 4AIIA 2I2WA 3DA8A 4BX0A 4G9GA 1RACA 2AB0A 1C0LA 1LVHA 5FCDA 2I62A 3IKLA 1K6IA 2W2MA 3PPXA 5TQJA 3ETHA 1QF9A 3R6LA 2JFWA 4EGAA 5C8YA 2Q1TA 4EG8A 2BFWA 4OI2A 4DC0A 4GS5A 3TDNA 1DBSA 2Y27A 1BGXT 3CJQA 3Q3CA 2PRYA 1RZ3A 1GO2A 1T1EA 4DMGA 5H9VA 3UXYA 5HTOA 1CRQA 1NVMB 1UBUS 2GJ8A 3DPUA 2IGBA 3GEEA 2QVLA 1C1YA 2ZYHA 3LBNA 3GMIA 4PNPA 5BWBA 4GMXA 3LZDA 4MB6A 4BASA 4XQ9A 4PZLA 1X3LA 4L22A 2NXJA 3PUXA 3KKKA 3TE6A 2H2AA 3DBLB 1LQ2A 1U3UA 5JAHA 2PSEA 5J9FA 2X3YA 3T7AA 1Z8HA 5FTJA 2ZREA 1YF3A 1CVLA 3BA1A 1HLDA 1MQ9A 1PJSA 4JJKA 4DMRA 5AW2A 2N47A 1FK8A 1RWXA 3LX8A 3P9RA 4ZXFA 4BVAA 4CQMD 2Y92A 2WR8A 1VGVA 5EPUA 2N1MA 4RQBA 2Q49A 1K63A 4B4DA 1Z4LA 3KPWA 1E5QA 2P75A 1L4NA 3FDFA 1TMYA 1JDPA 1NUAA 2XD9A 1QIHA 1WPRA 4LJRA 1OU0A 2XCIA 2X2EA 4ZVMA 3VSBA 2BMFA 1X1BA 3ZVMA 4LGMA 4TLBA 3MS4A 3NR2A 1FTWA 1OE0A 3ACBA 3DE7X 3NXSA 3Q2KA 3VKVA 2JLUA 1ZLXA 4HS9A 5ALDA 3KTAB 4HGYA 9ATCA 5KTMA 4H1UA 3MTBA 3A8TA 4X24A 1OXSC 1N5OX 2ODBA 1XEAA 4HAWA 1HDEA 4GLFA 4CVNA 5JMTA 1H9BA 4TKLA 3KQPA 1BD3A 2YIJA 4Z2AA 1WU8A 1MOQA 4QHYA 4S1VA 3S40A 4F6RB 4DJJA 1NOKA 3BS4A 1TC1A 4GMDA 4Y9RA 4NDNE 1GKUB 1P8JA 4KFRA 4C4YA 1VE5A 3A25A 3G0CA 3CVWA 2J08A 2QJFA 3LK6A 5CT4A 5ALUA 3VKFA 5UKDA 2OV1A 2FXIA 4YJGA 3GJQA 1Q44A 5JXHA 3B1VA 4HAUA 3T7RA 1X1QA 1KMQA 1GY8A 4UPEA 1QF6A 3B1FA 2VJPA 3D7KA 4LDAA 3ROMA 1BXGA 2BAGA 1KS9A 1CWUA 3F1LA 3TRKA 1X3SA 2E82A 2QVYX 4A91A 2PTHA 3DV0B 4HHEA 1PEAA 4AZ0B 4WESA 2Q46A 3H8JA 2JNWA 1PEDA 2ODTX 4L6AA 2HNBA 1YJBA 5CCBA 1GNLA 1ZM7A 3QU2A 4UD2A 3WGOA 1GUFA 2ZR7A 3F46A 4NABA 3DLHA 3WICA 2CJWB 2DJIA 3LUHA 3Q88A 1ISMA 4P53A 1C3JA 1RP7A 2FSSA 2PKYX 4EUFA 3W5VA 4JQSA 1X1SA 3ANTA 3G88A 3WG9A 3O2JA 4JBXA 1DQSA 1FDTA 1Z17A 4FP9A 1E0AA 2L82A 2WSLA 4H0NA 4E2XA 3EMBA 2WILA 4W6ZA 1E3QA 3RGGA 3QG5A 4RKRA 5DGXA 1EJBA 1U8YA 3V9AA 4D3FA 1JGTA 1BVUA 2ZB3A 1BQ3A 2ZB4A 3EZ6A 5CX1A 3W9SA 3KS9A 4TXJA 4B35A 1TMKA 4RABA 1DAOA 3EQZA 4BFTA 2H4HA 2ZIVB 1SXIA 1ZRHA 1YB4A 3ZJYA 3B78A 1C0KA 1QH8A 3C3AA 3LGXA 3FDJA 4HR7A 3MHTA 1NYQA 1E79A 1G3QA 1L7NA 5TT0A 5TXGA 4ARZB 1Q50A 2E4UA 3GRZA 4UDOA 3ZBTA 1D9XA 4EUEA 4MIKA 2LZ0A 1U28C 1Y8CA 4R5MA 3LT1A 4OLFA 1VRWA 1D3AA 3TR5A 4C03A 4DTIA 1GLNA 2ECPA 1RTKA 5AI6A 3W77A 3NBFA 4NDAA 2PKQO 3U7GA 4GOLD 1QYRA 4KQ1A 1USGA 3IEPA 3OCZA 1C9DB 1GZ4A 5EXXA 2QGFA 1C9MA 4GNRA 2RAUA 4EX6A 5IMBA 5AICA 3FRHA 5LDHA 2O5CA 1NX6A 3B1YA 5IC5A 2CC2A 1T5SA 1HG1A 2XIQA 2ZB7A 1M5UA 1L7PA 3HJGA 2YV3A 4OV6B 4CHGA 6CHYA 1NA5A 5B58C 3Q9NA 4UULA 3WGKA 2UYYA 3OOEA 3TEMA 2R47A 4W9MC 2YNMD 1PR4A 2ZI5A 4G89A 2X9NA 5KYYB 1TDJA 2CXTA 3I9OA 4JR0A 4H7FA 1I3LA 4H16A 4OQPA 2JG3A 4F06A 4WPGA 1L5GB 4C5AA 1BTOA 4ZAZA 3SX0A 1FX0B 1Y4AE 2ZZKA 1XD2B 4V0NA 2QE6A 3QEOA 4FDTA 2AR7A 1NYLA 3I12A 3GYBA 4OFWA 4XIYA 1Y7PA 2QX4A 2V5UA 1G64A 4JASB 2Z98A 3SC4A 2DPLA 5BRJA 3MMZA 3PEFA 3ZE1B 4ZGWA 3PRYA 1SQ0A 1N2GA 3OQ1A 4QJBA 2F43A 2PZMA 3R6DA 3A1UA 2E55A 3DHEA 3RBAA 2BTQA 3RUFA 2I91A 1UJ2A 1JBEA 4IO0A 1KO4A 2Q2WA 5DJ5A 1OB2A 3O1HB 1JALA 5EHXA 2Q9UA 4A0FA 2WWHA 3U7FB 3GB9A 2WIBA 3D0OA 1AHPA 3T54A 4ZHQB 1B8VA 5BQ5A 2K7FA 3K71B 4Q01A 3J80A 3KL2A 3F78A 4GZ5A 2BM9A 3ZGVA 1U2ZA 1WM1A 3I1JA 1GPMA 3IEKA 1PWZA 5FNZA 4KV7A 4YC7A 4EMUA 5AOBA 1HA3A 2ZRAA 5E6UB 3KLMX 4EX7A 2ETXA 3DJFA 4NV3A 3G13A 5FLYA 4XYMA 2CZQA 2CMFA 3V6LA 5DX0A 1U3DA 4D3YA 4ZJPA 2ATXA 3ZDBA 4MA4A 1XTIA 2G06A 5AHXA 1B8PA 3PHHA 2AOUB 3CLVA 4EG5A 1KQFA 1BX1A 4RQAA 1AUQA 4IV0A 1XC7A 2XYGA 3P0JA 2XWSA 3CNEA 1WSWA 4Q4LA 1CR0A 2P6NA 3ZU6A 1XWIA 3COJA 4PSUA 5AVZA 2CZGA 3PCRB 1N25A 2AEFA 8ABPA 2VPYA 3DZCA 2Z3WA 3WSTA 3P71T 1PJ8A 3C14C 3FGNA 5DNAA 4OI1A 3IA2A 1NFQA 3IUMA 4OUDA 3DEJA 3H11B 1IHPA 1YH3A 3UA3A 3UKDA 4GF5A 2WZCA 4RTRA 1UMCB 2P78A 3KP1A 1THGA 4X1IA 5U1PA 1YQUA 4V0MA 2LD4A 4KODA 1CEXA 1O6FA 3QE0A 3LBFA 4OQFA 2ZUBA 4AO6A 4WY8A 2XADA 1YZFA 4GI3A 7GPBA 1IHUA 2PGOA 2WT9A 3AB8A 1VMAA 3JASA 4HLQB 5HG0A 5LP6B 3FVVA 1ZUD1 3GT0A 3PGMA 4O2LA 4S1WA 4Q12A 5HRCA 3DH0A 4QDZA 2EC5A 3I9LA 2ZRLA 4WOPA 4L28A 3I2GA 1X1TA 3SX4A 4Z1OA 4B3RB 1XKXA 1Z74A 3DKPA 1G8FA 3OUZA 4OF4A 1QOQB 4R1NA 3NWPA 4Z1MA 1OXTA 4H60A 1QQAA 1N5RA 1QLJA 1Z0AA 3HI4A 4C1NA 3GLFA 2LW7A 3BFPA 3MMNA 1JQBA 1R6AA 1RYFA 4TMTA 4CCWA 1W36C 3U09A 2D0IA 2FMTA 2NT4A 2QRPA 4N5HX 2IDMA 5B2ZA 3SIPA 2AZMA 3B3QA 4PZUA 5JWRA 4RC9A 3WIVA 2X0NA 1NXOA 5FUYA 1OU4A 4FGSA 4IMPA 3DDSA 2R8OA 2YHIB 3LLSA 3AG5A 2V1UA 2I80A 3U4IA 4MTCA 1FU4A 3F4BA 2JIMA 2X1MA 3VSAA 4DW8A 2IUSA 2AFHA 2IZ6A 4HNRA 1C9KA 4IPTA 3W2EA 2C03A 1W73A 1KP9A 2C04A 2QUKA 3KYJB 2QAGB 2WVJA 3EG9B 4RFSA 3EEIA 2XCQA 4O0MA 2FW1A 4NFLA 2WM8A 2WJVA 4MUYA 2HSEA 4ZHQF 2AH5A 1RRPA 2G09A 3KJHA 1JIXA 4K6GA 4MVCA 5JH7A 1JPUA 5C5CA 2ZSFA 2WTUA 1O58A 3DTVA 1ODJA 2OENG 3EVNA 3QKWA 1O0SA 1PSDA 1RAIA 2EJWA 1Z29A 1VPLA 2BLNA 3GV0A 4TROA 4ZO4A 2NXEA 3WHLA 4I9NA 2VQFB 4C4TA 2G63A 4LMRA 5BYAA 3MWDA 4RK6A 4AY2A 1T1SA 4H7EA 4KAAA 1NATA 4RVFA 3EXEA 4ZT7A 5FPQA 2VEDA 3SJBA 3DKKA 5CUQA 3ILHA 4BNGA 4F3RA 3SMQA 5CVTA 1U2SA 2VZ9A 5JECA 2IPXA 3Q3IA 1TVCA 4U3JA 1QR2A 1TEXA 3MOIA 4EZIA 4Z4FA 2WP0A 1CY2A 3PCTA 5K0BA 1C0PA 2BE9A 5HW0A 3LVQE 1PGJA 5TS3A 3I5YA 1BDHA 5KSPA 1J97A 3LBYA 1WV0A 5B55A 1NXQA 1I2CA 4QTYA 5JANA 5H16A 4UNRA 1RADA 4L57A 1S3IA 3DWFA 2VF2A 3IPXA 1FUEA 3Q9UA 4HRXA 4V0SA 4QTZA 5F64A 5GJVC 4RHEA 1JG3A 4A26A 4DWJA 3NTUA 2H1CA 3HJAA 3K09A 4LJSA 1OLXB 1LTHR 2VNJA 4J1TA 3KG2A 2Z83A 4R8SA 1NLZA 2O0MA 1NW5A 4GI2A 4F4HA 5LP6F 1DARA 1DDIA 1L4YA 1RQ7A 2QKYA 4M1KA 3KSMA 3OKCA 5ENDA 3G0HA 3CLKA 5SZJA 1Q83A 2ZQYA 3MRXA 2HJ9A 3S81A 4JMPA 1MAHA 1KWKA 1E58A 1G7TA 4HMPA 4PYIA 1ARZA 1NC3A 3GNLA 3PUIA 5AYVA 4JXXA 5A0TA 4RTLA 1PK7A 2FEXA 4CKBB 4PCUA 4DV2B 4FBLA 5EMHA 3HZRA 3ONVA 4OU5A 5K3SA 1DJLA 1BEUB 3MEQA 2AKEA 1Z6QA 3EH2A 2NUPB 1XEXB 1H1LA 2IOFA 1DIGA 4B3HA 2AC4A 2TS1A 1USKA 5JAQA 3H2BA 4MV5A 2WIAA 2JKYA 4YJKA 5F73A 4B6EA 2QWXA 3FJYA 4MW4A 3EGXA 4QFDA 2CFCA 4B2LA 2PU7A 1RYZA 5A4JA 1GADO 2V03A 1NMSA 4CU2A 3FSGD 2RH9B 4H08A 4INAA 4PFJA 2IS4A 1BXKA 2FEMA 3EXIB 1G0OA 1ZOOA 1W44A 2AN1A 2BM8A 3HCPA 4C6RA 3V34A 4OQLA 3K5HA 5G0TA 3WTCA 1G21A 1ZI6A 3T6KA 1AKUA 3K9GA 2EX1A 3O21A 4RD0A 3ROTA 3WKCA 5ALHA 4CM3A 4FFRA 4IDNA 5GADl 2Q8QA 4EWLA 3L49A 4XI9A 2Q6VA 4MULA 3F9IA 1VKJA 1ZCBA 2QW8A 4L0MA 4YMTA 1AMUA 4BE7B 1GGMA 2ADOA 1O94C 4FR2A 4Q9HA 5B6JA 1TKBA 2O6LA 2ZRGA 5BNZA 5LOVA 2YY7A 3V1UA 2OQRA 3DW1X 4ZXPA 1GZ5A 1JYSA 4IZIA 1AIPA 3T0FA 3PNQA 1T36B 3HNRA 2HI0A 2Q5EA 5CX4A 4AZWA 3R76A 2Y2UA 3ENKA 4PWYA 3ZV5A 2Q29A 3R74A 5DSTA 3CRZA 1E4VA 3GRPA 5K01A 1TEVA 1XVAA 1L7QA 2P5YA 2LV8A 4C2BA 3NIWA 4M1ZA 2Z5LA 1WB9A 1ZD9A 1OWMA 4FWBA 2CVFA 1W59A 2HOQA 3ORRA 1SVOA 4IS2A 4E5NA 3CCCA 2HV9A 4KE9A 4YACA 3VDQA 4Q1VA 4BRWA 3Q2OA 4C0AC 3KIPA 1EGAA 1C5KA 3GRCA 1JJAA 1SZPA 1M6VA 3K09C 5FO0A 5I47A 1BMQA 1QGAA 4J1TC 4KQXA 4OCZA 1LTKA 4EUHA 3CB4A 2TMYA 4O4IA 2CGEA 4NYMR 5ECDA 2QU7A 2HXYA 2ZB2A 4FE4A 2AV6A 1KEZA 4IQFA 4KWTA 2J3JA 4L4UA 1F2UA 4EITA 4YB8A 5HR5A 1J56A 4B3CA 4E08A 2B83A 3IIIA 4YAGA 1BCSB 3WWZA 1C1DB 1HYBA 3DHYA 3E53A 3GRUA 3H4VA 4XVHA 2DWPA 3OZSA 4YMSA 4BO9A 4MJLA 4IMRA 2WWTA 5JVDB 4YRNA 4IH1A 3DNPA 5AKJA 2SCUA 1ZLYA 2IHJA 4QIHA 5BWLA 3OMLA 1JWBB 4YV2A 2V9ZA 2IU0A 1T8YA 2V6BA 1U7WA 2DF8A 1LX7A 4CLRB 4B3GA 3BK2A 5IS2A 3EVBA 5EWMB 1LSOA 3HKBB 3KWJA 4ND7A 3TD9A 1K75A 5LMNB 4GECA 3AHIA 4F3CA 1YJXA 3HRKA 4BNTA 4EHLA 5ADVA 1ZGJA 2AQKA 4PXSA 4ZO7A 2KLHA 2C3UA 3RVKA 3RJZA 4P7FA 1E3SA 4QLAA 3AM5A 4UTRA 3BH6A 2R6R1 3KKZA 5FQNA 1QGYA 3Q0EA 3PLRA 1DT3A 3A6PC 3IJRA 5M2QA 1V1JA 2GPJA 3ZCXA 3IVGA 1QNFA 5KHAA 2FYTA 4Y0VA 2J5XA 5J5AA 4DJTA 3N3BC 5D2CA 5B1DA 4RTQA 2I78A 1NQXA 1ONOA 2PD3A 2XRYA 3U7IA 4FK8A 3V32A 4AULA 3QEAZ 4I1RA 4Z9YA 3HCCA 3ICPA 5HCIA 3T4PA 1Y1RA 4HLCA 2Q1SA 2JJYA 2CHQA 2IXDA 4B81A 4JC0A 2DPYA 4E11A 1DV1A 4OAQA 1DNPA 1ZUNB 1LNZA 2XUAA 4YUXA 5CDYA 2OBNA 3C3CA 1KFEB 1KSFX 3RK1A 3U5ZB 4P38A 1KMIY 1ZQ1A 2VJQA 3HCAA 3IC5A 3BRQA 4OA5A 4UCQA 2C4KA 4WLOA 5AUQA 3ZC3A 5A06A 2BOVA 2HV8A 1U3WA 5JMPA 1M5RA 1C4KA 1TIPA 2BEWB 2FMUA 2XQJA 3ACDA 5DTQA 1S8FA 4U9IS 5A9RA 1ID8A 2GPSA 2KQUA 1UIRA 2REOA 3CBQA 4HATA 3MG9A 4UNQA 5F5LA 3Q8KA 1HNWB 1D1PA 3BWDD 4LXXA 2F90A 5TMDA 1C41A 3AHHA 4K9LA 4QYSA 3ET5A 1A9RA 5FLKA 3RTAA 5G1PA 1EEXB 3TLMA 4V1CB 2HWYA 4YXFA 2KMLA 4BIMA 4OTZA 4QOHA 5JDIA 4PM4A 1CQZA 2P1RA 2H2IA 2QTTA 3WWOA 3SJCA 3SJ7A 2PUWA 2E4YA 4MDHA 4X93A 2X9QA 3G9UA 3KYCB 1DRKA 1EDDA 1TE2A 3ONFA 2EZ8A 4DADA 4RESA 4WT7A 2ZRDA 1XCBA 1U1GA 2O54A 1DVRA 2XMSA 3IGFA 4XVCA 1O9HA 1FLAA 1NF3A 2GK4A 4H4EA 3S55A 2Q1UA 3OCJA 1TZ2A 1DC7A 4QPPA 4OMDA 1H8ED 1II8A 1N6RA 1RYHA 4AYXA 4YAIA 3QYAA 4MINA 2F1KA 1WXGA 2ZBGA 3DL7A 3Q1LA 4ZEXA 2Y05A 1K2VN 1M1UA 4G65A 4XRRA 4GUAA 5K4HA 3GG9A 3ZNNA 5JVDF 4Z51A 7ADHA 2MSEB 4C7JA 5C7LO 1KDZA 1NJFA 2HMUA 3IESA 1JQEA 4RXUA 2NYAA 4UM8B 8ATCA 2C9YA 4DR6B 2AEEA 5E7IA 3AI2A 1QHNA 1FA9A 3OG9A 2CN1A 2I03A 2M6RA 4S24A 4WHMA 1HE4A 4LZOA 2R751 4HDNB 4MKRA 3I73A 4JX8A 4MWSA 4MYTA 4D80A 1WXXA 1QORA 1U9IA 2MR6A 3IUYA 5HWSA 3GGCA 4TVKA 3LVBA 3HFGA 1R9GA 3NYIA 2GVDC 3FFAA 3OESA 4DLUA 4UBKA 5IAKA 2VCYA 1C3OB 3LU1A 3NATA 3QUAA 4RCVA 3U0VA 3QF4B 1DG9A 3KQSA 1GSOA 2ZIWB 4FYXA 4OKIA 4RWZA 3F5QA 3PE4A 4WXEA 2A9OA 3UUFA 4A82A 5JAZA 3B1KA 1AF4A 5D3MA 1Q1GA 1Z5VA 2B94A 4ZZ1A 4R9RA 1WVIA 3G0BA 1MQ8B 3OIUA 5IAEA 3F4KA 2YJTD 3KRTA 2IPNA 3W9YA 3UCXA 3Q11A 3JWIA 3E81A 4UMFA 1YO6A 4A03A 4CQNA 5HIAA 3ASZA 1YZVA 1ISPA 2VJKA 4W7IA 5JD5A 4QG3A 4ZOEA 4YNBA 1ORTA 1ST3A 1VHQA 2KX7A 2ZJOA 3AW9A 3QVGA 1U65A 2I66A 3FW1A 4G0ZA 1M76A 1RRKA 5AR1A 4BYGA 3VKHA 2X8JB 1WMEA 1F7UA 2YC4C 2PKXA 1EK1A 3M4XA 3DZ8A 5FX2A 1TQ8A 1ZWKA 1ZOPA 4GPBA 1BMDA 1MH9A 2VTVA 5KNBA 2C3YA 4DREA 4ERXA 1HE5A 4QEDA 3TX6A 1PFVA 2BGJA 2GZHA 4WXRA 5JDIC 3UAWA 1SC4A 1XEFA 2JL1A 4KQHA 3GLIA 2CL6X 2WD9A 3DUWA 3L7CA 4WQMA 4RQUA 3WHIA 3ELWA 4FLEA 1V3UA 5BR1A 1RBZA 3DONA 3P9IA 2AXEA 4ZK6A 5CBPB 4QOFA 3SBOA 2C4WA 3ABRB 3QFHA 3ROGA 3WE7A 1S7GA 1OA1A 2OXIA 1CVIA 4EGSA 1I5RA 5CFMA 1RXUA 3R7NA 3ZU3A 3PGJA 4NL4H 5A4DA 3VR0A 1TA0A 2MT9A 2HYDA 3KD3A 5KQMA 5EUMA 3UWMA 3EIHA 4DB4A 3WTBA 3MNFA 2ZBFA 1T8WA 2ZS8A 1RLTA 4TL7A 1KPHA 2KPOA 4YWHA 4MHTA 3CCFA 1VYTA 2GNPA 1QWSA 2ZPTX 3PYXA 4WLFA 2AEMA 1RPNA 1BOOA 2AW5A 3EPHA 1PGNA 4YJ2B 1EQUA 2YWJA 1YCDA 5K0LA 4YR7A 2OVBA 1NLMA 4RTJA 3ZJVA 2CXPA 3BZWA 2DMRA 4CN9A 2FPKA 5TVGA 3T9BA 2NVUA 1S2DA 4KRYA 5HFAA 3KAQA 3T5DA 2BHLA 2NQTA 3RC2A 4CDNA 5GIPE 3ILXA 4EW3A 5MGBA 4IDBA 5K99A 4ACBA 3OLWA 4ETWA 2Y1WA 2KLBA 2XVMA 3KHUA 4M0DA 4QICA