3C85A

Crystal structure of trka domain of putative glutathione-regulated potassium-efflux kefb from vibrio parahaemolyticus
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
150
structure length
150
Chain Sequence
QLINPGHAQVLILGMGRIGTGAYDELRARYGKISLGIEIREEAAQQHRSEGRNVISGDATDPDFWERILDTGHVKLVLLAMPHHQGNQTALEQLQRRNYKGQIAAIAEYPDQLEGLLESGVDAAFNIYSEAGSGFARHVCKQLEPQFTSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of TrkA domain of putative glutathione-regulated potassium-efflux KefB from Vibrio parahaemolyticus.
rcsb
source organism Vibrio parahaemolyticus rimd 2210633
molecule tags Transport protein
molecule keywords Putative glutathione-regulated potassium-efflux system prote
total genus 53
structure length 150
sequence length 150
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02254 TrkA_N TrkA-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3c85A00
4LSWA 5TNXA 2BGMA 5CG1A 2LDXA 1BVUA 1UUFA 5CDYA 1X0VA 1KERA 1T2AA 1A4IA 5A03A 4TROA 4FQ8A 5L4NA 4WEQA 2OHXA 1OC2A 2DLDA 2J5QA 4CJXA 4IDCA 4B8ZA 4RPGA 3RBZA 1DIAA 1X7HA 3U4DA 4QO8A 5ER9A 3RU7A 4KWIA 3O03A 3LC1O 4ZRNA 3AUTA 1C1DB 5L9AA 4RLSA 1P1FA 2G76A 3NDIA 3MJCA 4IZHA 4FOOA 2OBYA 3WYEA 5A9RA 1C14A 4L74A 1VL8A 4PLYA 3PJGA 4CM4B 1LSJA 3SLGA 3DR3A 3MCVA 2AEFA 4MDHA 5K9ZA 3JYLA 3NDRA 5TT1A 1X14A 1HDYA 3BTVA 2VUUA 3F4BA 3TWOA 4JK3A 4D79A 2X7HA 5ILOA 2EV9A 3NTRA 4K28A 2ZTUA 5JSFA 2HSDA 3I4CA 4BO2A 2PD3A 4FGWA 3JCZA 5AYVA 3TN7A 4M49A 1GL3A 3M2PA 4IBOA 1UXIA 3R3SA 4W9NA 2YHIA 3KYCB 5CG2A 4CM3A 1BGVA 4W9NC 2BH9A 4FJ1A 3VVCA 3GHYA 1I3KA 2O3TA 1PJ3A 3I1JA 1Q1NA 2I66A 4UVHA 3PK0A 2HMSA 1BXZA 3TL3A 1G0NA 1O8CA 2E48A 3QJ5A 1LJ8A 2WD7A 5EINA 1JKIA 1TT5B 3WWYA 3BTUA 5B1YA 1WXDA 1C0PA 4JCOA 5EN4A 2J5RA 1VE9A 4E5KA 4CMEA 1WZIA 2PZLA 2W2KA 1JN0A 4O0LA 3DBVO 4PLCA 4NBRA 2FR1A 5FF9A 3RC1A 1PJQA 2DBRA 7MDHA 2CD9A 2GN4A 3ON5A 3ZWAA 3EZLA 5TIIA 2PGLA 4XRRA 2HJRA 4AJOA 1MG5A 4FSHA 4JJGA 4PZEA 3AOEC 3JD2A 2Y05A 3BTSA 1PZFA 2VHXA 1EBFA 4JXKA 5TRTA 3AOEA 3AI1A 1HSZA 2AE2A 3QE3A 3DBHA 4IIVA 2YW9A 1ADGA 2OORA 4RJTA 2D0IA 1M67A 1F8FA 3LLVA 1QSGA 2A35A 1O5IA 4CLHA 1NQ5A 3AUAA 2FOIA 3RUIA 1HDOA 3GC6A 3GRPA 1DIHA 1LDYA 1O94A 3B1JA 4GX5A 4IS2A 4PGFA 5JW6A 4I9NA 2ZYAA 1LX6A 1T4BA 1CQJA 4R5MA 5AXBA 3NV9A 2QHXA 2EIHA 3DZFA 3NJ8A 4AG3A 1RM0A 4CMIA 2VYNA 1ZFNA 1NTOA 3I3OA 4RVFA 1J49A 3IIEA 4I08A 4Y67A 5T5QA 4N7RA 3C1OA 4NI5A 4BKOA 3GEDA 4D41A 4RL6A 4PLHA 5BSEA 1C1XB 5IXYA 2OP0A 5F1OA 4JIGA 1ARZA 4PG7A 4D0RA 2NV6A 3F5SA 3D4OA 4J16A 4KUHA 3KO8A 4HFMA 4XD2A 3JQAA 2HQ1A 3JQ8A 2AMFA 4UUMA 4B3HA 1GR0A 3W4JA 4BKQA 4BGIA 3GMSA 4NNJA 3WB9A 1Z6ZA 2O2SA 3OQ6A 1UP7A 5HRUA 4HXYA 1E77A 2AHRA 1SC6A 4FS3A 3MWEB 5FI3A 3S8MA 1EK6A 1ZJYA 2GASA 5K0ZA 5KJ1A 1JW9B 1VJ0A 2BGLA 4R69A 3S2IA 3WIEA 1ZK2A 5F3RA 3TFOA 5G0UA 4DC1A 3PIIA 1CWUA 1CF2O 5KJ6A 1DPGA 4J1NA 1D1SA 4OQZA 1BW9A 3BMQB 3IP1A 4DQVA 4YCAA 3GDFA 1LSUA 2CMDA 4QFCA 9LDBA 1K6IA 4KTTE 3ZV4A 1UP4A 3RIHA 4S3MA 4FBGA 5FFFA 4Z0TA 3DAGA 1R4NA 3O8QB 3OJEA 1YS4A 1W0CA 1ZEJA 2O3JA 2CFCA 3UKOA 5GZ3A 1DXYA 4WNCA 2P91A 3T7EA 3HB5X 1MB4A 3WTBA 2DAPA 5JAMA 3FCOA 3HE3A 1QORA 1B3BA 5MDHA 2TMGA 1O0SA 3PZRA 2NWQA 1GZ3A 3F1KA 4A0SA 2OGUA 3GR6A 3K5PA 3I9OA 5ER6A 2EJWA 2O50A 3AY3A 4NU6A 4IM7A 2Z95A 2W2LD 3MJVA 2ZKLA 3OIDA 4FD3A 2GN8A 2X9GA 3KV3O 1Y9EA 1B26A 5A05A 1DDOA 5JNLA 5JYEA 1TB4A 3IUSA 3WSVA 3QWHA 1I2CA 3RWBA 4JBIA 1Y8QA 3EUWA 2WE8A 1XU9A 1M66A 4YAIA 4DQUA 4TMFA 3KB6A 2VZ0A 5A9TA 3RBVA 2ZYDA 2EG9A 2C7GA 4J2HA 3VDRA 4ALMA 3KSDO 2QG4A 3PVZA 4WKGA 5TF4A 4BNYA 4EUFA 3H5NA 3VKVA 3JYNA 4HP8A 5CDTA 1ZXBA 1ISMA 1LA2A 1MXFA 2BI7A 4BO1A 4BMNA 4R1TA 3AUUA 3D0OA 1UAYA 4W99A 1M6WA 5HS6A 1IOLA 4YT8A 1KVUA 2Q46A 5AXDA 2P2SA 3VH1A 4WECA 4PLWA 4DIFA 2ZQZA 2QZ9A 4EI2A 5JPIA 2YV2A 5JY1A 1B16A 3FR7A 4YAEA 3C3XA 5FEUA 3EC7A 3P2OA 4OOEA 4UUPA 4BOYA 4YWJA 4TWRA 4FOSA 3DFZA 3AFMA 3I5MA 4KUEA 3ZH2A 4RDHA 5A02A 3WQRA 2IDZA 5IFLA 4M8SA 4B4UA 4GMGA 2D8AA 1N8KA 2AQKA 3ZI0A 3KM0A 1YJ8A 3L77A 4UVIA 1PL6A 1E6WA 3H6KA 4OH1A 4MP6A 3FPLA 1HLPA 4IDBA 1JWAB 4A2CA 2GD1O 3GPIA 4ZGWA 4DMMA 3Q9NA 1A7AA 2J8ZA 3ZN2A 2Y1CA 2GPTA 2VHZA 4NPCA 4C4OA 3CTMA 3HN7A 2Q1SA 2JHGA 5IDWA 5JCJA 4WOKA 4Q9NA 4B7CA 3FTPA 2RCYA 1CEQA 1ID1A 1Q7GA 2QZZA 3JQDA 2BKAA 3SJUA 4NR0A 4CL8A 4ALLA 4RCVA 2Z5LA 3TOZA 2HLPA 3TPCA 4XR9A 5EL0A 1HWYA 2VYVD 1NQOA 3B70A 3K2BA 4UEKA 1A5ZA 1TXGA 3DHEA 3DO5A 3HN2A 3V8BA 3ZU4A 3GN2A 4U0KA 2ZATA 5BSGA 1E1LA 4NHEA 1SOVA 4RVDA 4LRSB 3L4BC 3OJOA 2DTDA 2IZ0A 3HZZA 4FFOA 2CY0A 4HV4A 4CMAA 5DCUA 1PGQA 4K9DA 3GVHA 1KOLA 4KP7A 3JYPA 1DC5A 4CLXA 3ASUA 4G2NA 1SEVA 3E6AA 2I9PA 4ND3A 5JXWA 1LDBA 4NZ9A 5A3JA 1T1SA 4DQXA 4RQTA 3KRTA 3PFWO 1YRLA 4HKTA 4MVJI 5L53A 4F46A 3BZUA 1OFGA 3Q11A 4EEXA 1QV7A 3RKRA 3VKUA 1RJWA 1U7TA 3ZHXA 4BO8A 3SC6A 4AJ2A 3I9LA 2Q1TA 2GYYA 1SNYA 3NGXA 4CQLA 5HM8A 1YKFA 1YBMA 3N7UA 3PIDA 4AJKA 3C7CB 5LDGA 1PGNA 5DBIA 5IDQA 4DUPA 3UGKA 4GMFA 3HDHA 4IXTA 1D8AA 4CM1A 2DBVO 1EVIA 4OIMA 4CLOA 2BD0A 5DNAA 2G5CA 4RGBA 3OEWA 3LT4A 4TSKA 1MV8A 1LXCA 3L6OO 4JX8A 1XG5A 1UDBA 5U4QA 2VCYA 1B3RA 1KY5A 3H4VA 5IDXA 3BIOA 3WGHA 2X9VA 4LCJA 3KXDA 1UDCA 4RPHA 3EDMA 4BO0A 1Q7CA 2FPIA 2D3TA 5ENDA 4IQ8A 4XYMA 2ET6A 4BL5A 5BSFA 4BNMA 1L7DA 1E1NA 2DT5A 3OH8A 4GX0A 4IMPA 2JAPA 5JDCC 4BB6A 1NFFA 2FR0A 3PFFA 4Q3DA 3PTZA 2IZZA 3QSGA 2FRDA 4G5HA 3UAGA 3ZDFA 4IZIA 5KVQA 4DIOA 4UVEA 4OXKA 4E2ZA 2ZJ1A 3ITKA 2BRUA 2O3SA 4YJHB 4PG5A 3GY0A 5T64A 3AK4A 1F8GA 1H5QA 1N5DA 3UCEA 4F6LA 5C7OO 1DRWA 4FB5A 1TEHA 5T6BA 3I4FA 3WJAA 4QSMA 4AL4A 5ADHA 2E49A 3PHJA 3RJ5A 4DREA 2BFOA 2O7QA 4DTIA 4YAKA 2YYYA 1GQ2A 1AHIA 1I8TA 5KJFA 2B83A 1H2HA 2EKPA 4MVJH 3W1VA 2A4KA 2YHIB 3KYCA 3V1UA 2PZJA 3RUCA 1O95A 1P0FA 1YL7A 4IDFA 3IS3A 2E37A 4GI2A 4XX0A 4HFRA 2QYSA 1LC3A 4EJMA 3EGOA 3SLKA 1R4MA 3JQGA 1WDLA 4HFNA 2G82A 5L51A 1HRDA 4I1IA 4TVOA 3PYMA 2VZ8A 1KEVA 4DXHA 3WBFA 3B1FA 3U4CA 1QR6A 3CUKA 3OSUA 1U3UA 2EGGA 4IJKA 2WEKA 1W4ZA 2Y93A 4EDFA 2DUUA 2RHRA 4H15A 1NR7A 4NBVA 1JAXA 1R0SA 2F00A 3S2FA 3GNSA 4CQMA 3ONDA 2YZ7A 4CM8A 2DPHA 1XQ1A 1YOVA 1Y9AA 2Q49A 3OA0A 5KNLA 4RLHA 5EESA 4YEDA 4II2A 1ENZA 2NLOA 3OJLA 4DPMA 1H9AA 1I3LA 3F47A 2H1SA 3R0IA 5MGBA 3I9NA 4IDDA 1NX6A 2NU7A 5C37A 3VPHA 4PLGA 4Z0PA 1AXGA 4UVDA 2FZEA 3ROQA 4GAEA 5DBFA 1QYWA 3JV7A 3VZRA 2JFFA 1MFPA 1P77A 1DAOA 2EJVA 2Q3EA 1TLTA 3CZMA 4CL3A 3VPXA 1R66A 3T4XA 3PGJA 3HJAA 3BHMA 1A72A 2FWMX 2XXJA 3DHYA 1Z73A 3PQEA 5T8KC 1XIVA 4R41A 3VTZA 3FNHA 1EBUA 3JQ7A 1IB6A 3ITDA 3PWZA 2EGHA 4E2WA 1WPQA 3RUFA 2B4TO 3A9WA 4K6FA 4BGEA 4D46A 4MINA 4L4SA 5IG2A 1NNUA 3WICA 7ADHA 1T25A 4DC0A 4ESOA 1DRUA 1TI7A 4YQYA 5I7EA 5COQA 4DIBA 1DHTA 3DEYX 4LN1A 4W6ZA 3QQPA 4FFMA 2CF6A 1ADBA 3PDJA 1IZ9A 1ORRA 3EMKA 2PD4A 4BB5A 5TQVA 3TDKA 3OECA 4CUJA 1B2LA 2YJZA 1QYDA 1KIFA 2YY7A 3IUPA 1KVTA 1ONPA 3I9KA 4BMSA 4ZU3A 4DLAA 1K6XA 1PJSA 1PJCA 3GAFA 4XKJA 4AJ1A 4N5LA 4D42A 5JLAA 5LC1A 3MOIA 1U4SA 2UUOA 2VWQA 3C85A 1DC6A 3EAGA 4OL9A 2CZCA 3E5MA 5AXCA 3VZQA 3WMWA 4DYDA 3JQ8B 5GZ6A 2HRBA 2C59A 2G17A 3A28A 3AI3A 1I32A 5K6AC 2D5CA 2RBEA 2H63A 3GEGA 2WJPA 3NTQA 1GAEO 4JJIA 2NTJA 1GQQA 1EUZA 4CM9D 3RUAA 1UH5A 2UVDA 2P68A 1UAGA 4OAQA 5G0SA 4FCCA 1UXHA 4E3ZA 1AHHA 5T57A 1B14A 1D4FA 3IC5A 3LC7O 4J91A 4YJFB 3KHUA 4YJGB 3VOSA 2WYVA 3DXFA 2OOSA 4AJ4A 1EK5A 1HE3A 1SB8A 1DFGA 3ETGA 4GVXA 4E5YA 2Y0EA 4YRBA 5TLSA 3N58A 1MC4A 1BXGA 3W6UA 3ZWPA 1ISIA 4INAA 1R4NB 1UJMA 3UICA 4B4OA 1SZJG 4DGSA 1NXQA 1XHLA 4W7HA 3CZRA 4IDAA 4BO3A 1K6JA 2HJSA 2QW8A 2AEJA 1C1DA 4BNLA 1X0XA 1U3TA 1KEUA 3WOHA 3MTJA 2GDZA 3ZU3A 1E3SA 4D43A 1WNTA 2OP1A 5THQA 1NWCA 3ZHZA 5F5NA 5FWNA 4AJHA 1ADCA 2PGDA 4CMGA 1ZCJA 3PYXA 2J5KA 3EW7A 5TC4A 4W7IA 4OGWA 5EQFA 3P2YA 1NHGA 1MP0A 2B36A 4Q3AA 3D3WA 5A4DA 5BR7A 3ONEA 3OICA 3OMLA 4Q3CA 4D3FA 2EW8A 2IODA 6ADHA 1HF3A 3WGYA 2C82A 3L4SO 3DAPA 2Q4BA 2VOEA 1DJNA 4O63O 1FJHA 3K31A 3BYZA 4AJPA 1ZVMA 4XIJA 4E31A 1Y8RA 1PWXA 1DBVO 3GOHA 1OBFO 3GQVA 1A7KA 4WCFB 1PQWA 1ZXLA 5DOZA 2V6GA 4NBUA 1R0LA 3A14A 1DIGA 4B7XA 3GGPA 1SCUA 1R15A 3KOUA 4IPTA 1E92A 2GN9A 1O9BA 4GX2A 4MIEA 4Q39A 4PCVA 1TT5A 5DP2A 3RFXA 1SO8A 4U6SA 3WYBA 2XPCA 1AN9A 2JCVA 1ZW1A 4FFRA 2Q2QA 4Y6PA 1JKJA 3A06A 3P19A 2GNAA 4XYLA 1I2BA 2PK3A 3PLNA 2AG5A 3FTNA 4GBJA 2LDBA 2CNBA 3AUSA 3FI9A 4XYGA 1UXKA 3AW9A 5CPFA 3I23A 2VTDA 3VC7A 3VPGA 2R2GA 4RVGA 1RWBA 3KTDA 3FNFA 3VVBA 1PGOA 1LDMA 3FNGA 1V3UA 3RUHA 3JQFC 1NQTA 4B3IA 3RBXA 3K96A 4MKXA 1Y81A 4FPXA 4GKBA 3TF5A 1DB3A 1PGPA 3INTA 4XB1A 2DVMA 2NM0A 1E3EA 4H3VA 2ZCUA 1P1RA 3NT2A 3F4LA 4HNHA 4HNGA 1Y7TA 3O4RA 2BLLA 1I30A 2Q1WA 4MVJD 2OO5A 1FK8A 2B69A 4QT0A 1LU9A 2IRWA 4I5DA 4XB2A 1I2ZA 1S7CA 3TOXA 3V2HA 3X2FA 1HSOA 5L45A 1JU9A 5DCWA 4J9VA 3UW3A 1U8XX 1WWKA 4XDYA 5ITWA 5CDUA 4XGIA 3PXXA 3NX4A 1PIWA 4J9UE 1FDTA 1NYTA 4O1MA 4XQCA 4CUKA 4E12A 4RZIA 2Z1NA 3AU8A 2PV7A 4HFJA 4UAGA 1SOWA 3OJFA 4HX5A 3RC2A 2H9IA 1Q7BA 2A92A 2X9NA 4I5GA 3ZNNA 1ONOA 2NNLD 2X22A 4JBHA 3QY9A 3CMCO 2DBQA 4LCEA 3ZV3A 2GO1A 3NYWA 1OOEA 1L7EA 3QVOA 3ENNA 3HDQA 3VAZA 4BGVA 1MUUA 3OIGA 4IXWA 4PFJA 4ZQFA 1GTMA 5BSHA 4E13A 2Y1OA 3WBBA 3VZPA 4AJLA 3I6IA 4BNKA 1U3VA 2IYPA 4XWYA 2JCYA 1PR9A 3ZW8A 2Q99A 3JD0A 4A5OA 3GVIA 5JCXA 2VHVA 4CLRB 1BW9B 4OM8A 3O38A 4YT5A 3JQEA 3DOJA 3LF2A 3DAFA 3VZSA 4RV9A 1JDJA 2HUNA 1Y5RA 1YH3A 3GEMA 5TJHA 1PJ4A 1B0AA 3DBRA 4CLOB 1UR5A 2AW5A 1XGKA 4KDEA 5ENVA 1ZUD1 3LT2A 5GZ1A 1ZH8A 2J3KA 3ZWYA 1V0JA 3N74A 2FSSA 2O23A 3DWFA 4AJIA 4BKPA 3GZNA 3UF0A 4JP3A 1LLDA 4BV8A 3NKLA 1IPEA 3UCFA 5C7IO 3L9XA 2IXBA 2OL4A 1VJTA 3U0BA 3HFGA 1CERA 3U49A 5JDCA 2B37A 3RSHA 2P9EA 4RVSA 4YACA 3ANMA 2BHLA 1WMAA 3D4NA 1U7HA 3WLFA 1M2WA 1ZZEA 1UZMA 5J23A 3WIDA 3ENKA 1PR3A 1PWZA 1U5CA 5FYDA 4N54A 2H5LA 5CDSA 3TFQA 2Y66A 4BVAA 4R9SA 1HDXA 4QO7A 2NU8A 4MKZA 2AG8A 2IEDA 2RAFA 5JDIC 3K9QO 1ONNA 4CPDA 3G0OA 4XQGA 3GVPA 4YJHA 3QW2A 1ULSA 2PKQO 2Y1FA 3UN1A 3VDQA 4QEDA 2I65A 3KSZO 3BMOB 1XDWA 1KEWA 3OA2A 4BNWA 2AEMA 1LDNA 4QTZA 2W4QA 4J4HA 3K30A 3Q9UA 3UFXA 3DTTA 2C07A 3C1AA 4D7AA 5ILGA 1GYRA 3SX2A 2YV1A 1X1EA 2AQHA 3GNTA 2CDAA 1YBVA 2C20A 2DM6A 2XAAA 4J7XA 4JQCA 5ICMA 2JD0A 3OETA 2VOJA 1NR1A 3G49A 3L6DA 2UUPA 1Y6JA 1XEAA 1J6UA 1YB5A 2ZB4A 3DZHA 1E1KA 1NASA 4FGSA 4ND5A 4Z0HO 1U3WA 3LYLA 2OFPA 2X0JA 3RVDA 5DDIP 4CR7A 1BRMA 3B20A 4BO9A 1YVEI 1PX0A 2EP7A 5DP1A 4IMRA 3F6YA 1H94A 2VN8A 4PVCA 4GH5A 4XGNA 4JJFA 1F17A 1ZBQA 1E6EA 3JQFA 2D1YA 3D3EA 4N5MA 3BXXA 1J0XO 4CM8B 1VL0A 1YQDA 4LISA 1BDMA 3QP9A 2PGJA 2IEBA 4OKIA 1GYPA 3JQ9A 4CM5A 3ZWCA 1GUFA 2JD1A 5A3VA 3JQ9C 1CDOA 2CVOA 1YB4A 1YDEA 1U2GA 2WYUA 3ZU2A 3OEYA 3COSA 1GEEA 4CUZA 1U4OA 3L0DA 1ZO8A 3QVSA 1QG6A 1EDZA 1OAAA 4FJ2A 4IGFA 4WOJA 4DBZA 3ABIA 2VZ9A 2ZB8A 1DC3A 3E48A 4NQZA 5A1TA 3M1LA 3FBGA 1HE4A 1LRKA 3RC9A 4M87A 1ZSVA 3JYOA 2AA3A 4PZDA 4WGGA 4YPOA 1OC4A 2PH3A 1QMGA 1PS8A 2EF1A 4BS9A 3AM5A 4EZBA 2WMDA 4TRRA 3HUDA 4C7JA 2WD7B 1E7MA 1GUYA 1EVZA 5ITVA 1TT7A 3WGOA 3DBLA 1ZK3A 4YTEA 1PS9A 3RD5A 2I3GA 2W2KB 1ISJA 1FF9A 1E3JA 2GR9A 2NUAA 4AJEA 3C8MA 3P7MA 4TQGA 2BMAA 2WM3A 3E18A 4HUJA 3TSCA 4GQAA 2B5VA 4XGKA 1BG6A 4A7PA 2VRCA 1LDEA 1HDZA 4GPD1 4ND4A 2HRZA 1JLLA 2W8ZA 1QLJA 5KVSA 2I67A 2X8LA 2GF2A 2OBNA 3JTMA 1E6UA 1R12A 2O3QA 3F9IA 2A94A 2E82A 1NPTO 2CUKA 1UXGA 1BSVA 3KEQA 3TZQA 4EITA 1VSUA 4RVHA 1KC1A 2Y68A 4WLNA 2VTEA 1N9GB 2HKIA 2DKNA 5EPOA 4NFSA 1H6BA 1ISGA 4L75A 3INRA 2DTEA 2C7VA 3H5RA 1GFSA 3INGA 3M1AA 4NU5A 4E6PA 3WGGA 2O3UA 3BHIA 3ULKA 4YB8A 4E5PA 5JC8A 3D5QA 1XSEA 3SC4A 1DAPA 3KLPX 4GVLA 3SVTA 2NVUA 4JN6B 1E7QA 2P5UA 3RFVA 3S1LA 4WE3A 1BXGB 1WLYA 4MVJE 1RM5A 4R4JA 1YGYA 3LLSA 2P4HX 5IXSA 3ZW9A 1A9ZA 1IY8A 1QYVA 5KTKA 2X58A 4XQEA 2UYYA 4CMIB 4BQRA 2XXBA 3DMYA 4J0EA 3H65A 4K1LA 4P4GA 3SBOA 1LC0A 4ALNA 4MVJA 3SXPA 3V2GA 1JA9A 5CPBA 4E21A 4F3YA 2D2IA 1V8BA 1D1TA 4OKNA 4J4TA 2PA3A 5KKAA 3MJEA 4Y9DA 2QRLA 2V65A 1HETA 3OIFA 1Z7BA 2NADA 3SEFA 2PKRA 4WLOA 2E6UX 3OM9A 4ALJA 2GSDA 2VT2A 1T2EA 3NTOA 1HDCA 4R51A 3ZU5A 1GPDG 4A03A 3NAQA 3ORFA 3E9QA 4D3DA 4EYEA 3DFUA 4J0FA 3B6ZA 4BO6A 4U5QA 3LVFO 2IXAA 1VI2A 5JFOA 4TRJA 2HMTA 1A4UA 1P3DA 3JQBC 3KYDA 1GQYA 4XIYA 4ALKA 2GN6A 3H9EO 3E03A 3WFIA 1X7DA 5C7LO 5CDGA 2J3JA 3ZWXA 4XA8A 4GX1A 1LEHA 3U9LA 3WWZA 1LQUA 2P9CA 3LC2O 3GZ4A 4CMEC 1PQUA 4S1VA 4YA6A 1GDHA 3AY7A 4AICA 1DLJA 1NM5A 1TA4A 2QRKA 4IINA 5IJZA 2C0CA 2EXXA 4LK3A 2O4UX 2FP4A 4XDZA 3ZWWA 2V6BA 2GZ3A 1G0OA 4CLEA 4CODB 2ZB7A 1XELA 3EK2A 1E3LA 2TMDA 4LVCA 1BMDA 4ID9A 4BNHA 2VNSA 3RUEA 1LNQA 1T1RA 5BNTA 1YO6A 1XWFA 2ZK7A 5GMOA 4EW6A 1C0LA 3GUYA 3M6IA 3I83A 3UCXA 1FXSA 3JD1A 2ZB3A 3HDYA 4CM4A 1JVBA 2DBZA 3ETEA 3GG9A 3P5SA 1XLTA 2PKQP 2VYND 2HMUA 4J1QA 1I33A 4NJOA 4OYRA 1RYEA 2PWZA 2EERA 3FD8A 3GLQA 4E30A 1EVJA 2C54A 4R68A 1DEHA 2AQ8A 4LMPA 2X5JO 2HDHA 3ZZNA 3FWZA 4FFNA 4MIYA 2DUWA 4ILKA 1GCOA 4MIOA 4QQRA 3TJRA 1NBOA 4P4NA 1P1JA 2JFGA 3PPIA 5LCXA 4F6CA 5IZ4A 3FRJA 5L7YA 1C0KA 3ZWOA 4DVJA 4GLOA 1YBAA 3B1KA 1VKNA 1PZEA 4MP3A 3NGLA 2SCUA 4WASA 3WQQA 1LUAA 1DO8A 1QYCA 1ZK1A 3U5TA 1NAHA 1XR3A 2OXIA 2VT3A 3HADA 1PU2A 1ZJZA 1E7RA 4UUOA 2JCXA 4CV1A 4U8GA 1F0YA 3CINA 1PEDA 1GZ6A 1NFRA 2VWPA 5FI5A 2PLAA 3E1KA 2PZMA 4BNUA 3GFGA 3QHAA 3PEFA 2C5AA 2X0NA 1CRWG 1JWBB 4XQ9A 1LDGA 4M89A 4CV0A 3AY6A 3JSAA 1K0UA 1KYQA 4M54A 4JBGA 5L40A 3I52A 1EE9A 1B8VA 3TRIA 2FHSA 4PN3A 4BNZA 4JNKA 2WTBA 1BHSA 3V1YA 3JQ6A 3MEQA 1E1MA 4YRAA 3E9NA 5K6AA 2PFGA 3V5NA 1O6ZA 5DCYA 3W8DA 1R37A 3WR5A 4PVDA 5F1KA 5DULA 3FBTA 2FSVA 4TZKA 1X13A 5F5LA 3MWDB 1P31A 3ROMA 5H83A 3RROA 5A04A 1MC5A 1NHWA 3BMQA 2IE0A 3NEPX 4OSPA 4PRLA 1ZSYA 1LLQA 1YE3A 1B8PA 3H9JA 3DBRB 1NVMB 3IMFA 3QV1A 5KVVA 1UXJA 2PTGA 1EFLA 2YFHA 2VRBA 5IN4A 1L1FA 5CEFA 1NWHA 1OMOA 1NAIA 4J2OA 1WZEA 3TZKA 1KS9A 4PIVA 5HBRA 1P0CA 1UDAA 2YQ4A 4OQYA 4KTVE 2BF7A 2WD8A 2VWHA 3DTYA 4WK6A 5I7SA 3VPSA 4II3A 1NFQA 3OF2A 3PLRA 3JQAB 2VUSA 3WGQA 3LZ6A 1DHRA 3VH4A 1K3TA 4J3FA 1YONA 4BKRA 1CQIA 3O26A 3WS7A 1G6KA 3LF1A 2ZIZA 3PJEA 1M6HA 4FN4A 4WCDA 1Y8QB 3Q0EA 4LRTB 5H82A 2HK8A 1GYQA 4JP2A 2DTXA 4TZTA 4DPKA 1H2BA 1E7YA 1GV1A 3GMDA 1D7OA 2PY6A 5I8ZA 2HMWA 3BMOA 1RM4A 5DT9A 4AVYA 1EVYA 5CEEA 4HWKA 5AQ1A 3JQBA 4CQLB 5TX7A 3KVOA 4NMHA 4PG6A 1ULUA 1KVSA 4EEZA 3GK3A 1EQUA 3QWFA 4LSMA 1KY4A 4P8RA 4NK4A 4UVGA 3DMTA 2Y0CA 1HXHA 3E8XA 2J6IA 1S6YA 1DLIA 3Q1LA 1E3IA 1P1KA 3Q3CA 4P38A 2C5EA 4J43A 3TL2A 5LDHA 2R6JA 5A06A 4G81A 3WXBA 4ONEA 4TRMA 2Q45A 3PDUA 4Y98A 1P44A 3C24A 2I3AA 3S55A 2B0JA 3NT4A 5I7VA 3V1TC 4KWHA 2HMVA 3GNQA 8LDHA 5JYDA 4HY3A 3DBHB 2I99A 4ZVVA 3WX0A 3V2UA 1T2DA 4WEOA 3BMCB 1FDVA 4Y6SA 4FR5A 1MFZA 4R5HA 4E5NA 3NRCA 1JAYA 3RQSA 3GDOA 4B3JA 4A26A 1M75A 2VQ3A 2HAEA 3R1IA 4PLVA 4BIIA 1VLLA 1E7WA 5F1PA 3TQHA 4CV3A 2P9GA 1IL0A 1KETA 2EEZA 2G1UA 4X54A 2BGKA 2B4RO 1C3VA 4ND1A 1T2FA 3L07A 4NBWA 1X1TA 1HYHA 1QRRA 3HQ4O 3W4KA 1U28A 4IQGA 4OO3A 2O2YA 2O3RA 3RASA 3HNPA 1WAMA 1C0IA 2GERA 5HTOA 3RKUA 1R4MB 2GZ1A 3NT5A 4OHUA 4UEOA 2D5AA 2DU8A 1OZAA 2Q1UA 3C7DB 2FN7A 3U62A 1U1IA 4U7WA 5KIAA 2BFAA 4JLWA 2NU9A 5DF1A 5IN5A 4YYZA 1EDOA 4BV9A 1YQXA 4LVUA 1I01A 1SEPA 4KQWA 1HYEA 3VH2A 3QA9A 2Y67A 4NIMA 1WP4A 3H2ZA 4FDAA 3LT1A 3ZV5A 4B7UA 5KVCA 4FFLA 2Q4EA 1A27A 4ND2A 4YXFA 4UREA 5G0TA 2ZTMA 3ADOA 4MVJG 1J5PA 2HK9A 1QYXA 3G3EA 4Z9FA 1KBZA 4KMSA 4QFDA 4R9RA 2Y99A 4D3SA 1FDSA 4NFHA 2P5YA 4DPLA 3LK7A 2P4QA 5KCZA 2OUIA 4OMUA 5JAIA 1V3VA 3OFSA 1GD1O 5JE8A 3ZCXA 1IE3A 3CEAA 4YVFA 1H93A 2B4QA 2BI8A 1RKXA 4KQXA 2V6FA 4KUGA 4BQPA 3EVNA 4IY1A 4OXNA 3OHSX 1MA0A 3T4EA 2VHYA 3CMMA 2PD6A 2ZCVA 1LLCA 1YJQA 4PLTA 3FWNA 3RUDA 1VRWA 4DLLA 1GU7A 4BNTA 4DYVA 1VSVA 4NFYA 1JVSA 4R1NA 4B8WA 1W6UA 3BAZA 5ICSA 2NVUB 3M2TA 5TSDA 4YR9A 2GUGA 4IQ0A 5U9CA 3GPDG 1ZSNA 5ES3A 3ZGYA 3FF4A 2EKLA 1IUKA 4LGVA 5KJEA 5I9LA 4CV2A 3KETA 4R1SA 3ZWBA 1HL3A 4U0JA 1ENOA 5I9NA 1YDWA 3EVTA 3ETDA 3TZHA 3WGIA 4DBVO 3GT0A 4URFA 3BHJA 1RM3A 4J1TA 1LRJA 3ZNQA 5A9SA 1P45A 1AUPA 3GG2A 4QXMA 3D64A 5HA5A 4CMHA 3DZIA 4UULA 1SAYA 4E32A 2NQ8A 4R1UA 2YHUA 1BVRA 4E0BA 3CXRA 3QWAA 1CETA 3PZBA 4CQMD 3U3XA 3WGTA 1I3MA 4OJNA 1X15A 4MVJM 5EMHA 3KYDB 2BFMA 1MG0A 4YJFA 4Z3KA 1HZJA 1N7HA 3G1TA 4PZCA 4YJGA 3EY4A 3TZ6A 3AOGA 1I36A 4KOAA 4WJZA 5BNIA 4EBFA 4PLZA 1ML3A 3NUGA 2W90A 3EHEA 3CSDA 3MTGA 4UEJA 1K89A 1Y5MA 4R3NA 3MJTA 1Z82A 3K92A 4A73A 3Q2IA 4NDNE 2VHWA 2C2YA 2QYTA 1Q0HA 2H6EA 2UV8A 3I9MA 1N2SA 2Y1GA 4B4WA 3LSYA 3IKVA 3D7LA 3EZYA 4I9HA 4CLDA 3ASVA 3HG7A 4RVUA 3DHNA 5EIOA 1E5QA 2W2LA 3PWSA 3BMNB 1GADO 1VJ1A 5L7TA 1SB9A 4HBGA 4XYBA 2JAHA 1PS0A 1P1IA 1GPJA 3DB2A 4RDIA 2A9FA 4PG8A 3W6ZA 5H81A 3ANLA 4XR4A 3W4IA 3ZWVA 4AJJA 1ZMOA 5GY7A 4H7PA 3PGXA 2CSUA 4ROSA 4FFPA 3KEOA 2Q2VA 4CR6A 1K2WA 4YAJA 4M86A 1XA0A 5DOVA 5KJCA 1E3WB 5G4KA 5L3ZA 3RC7A 1Y8RB 2CVZA 5JY6A 3LDHA 3KUXA 1NPDA 1LLUA 2B5WA 2FY8A 3AJRA 2OZPA 3G79A 3JD3A 4ZD6A 4BNXA 4XCVA 1YQGA 3JQGB 4BGUA 3LQFA 1V9LA 1MLDA 5I7FA 1V6AA 3FR8A 2DFDA 3F3SA 3PWKA 3DZGA 4DWVA 2FPPA 2BELA 4TKLA 2WE7A 4L76A 3DONA 4IDEA 3G1UA 3IQDB 1ISHA 2QX7A 4L4XA 3HSKA 2Y0DA 4J1SA 3H8VA 4ZQHA 5A5FA 4L0QA 3TZCA 4AJNA 1IULA 3GFBA 3E82A 2ZTVA 3HHPA 5THKA 4CQMB 2O7SA 3UUWA 3SJ7A 3WSWA 3PHHA 1DIBA 1MGOA 3IDSA 3WYCA 1UZLA 1YL5A 1HDGO 4I9UA 1HT0A 1Z75A 1FDUA 3QVTA 4FJ0A 3L6EA 4CM9A 3K6JA 4GLLA 1O89A 5B37A 1EUCA 2NSDA 5C3MA 4MPDA 1LI4A 1T2CA 1E0DA 4WLUA 2OMEA 2X5KO 1Q0LA 2FMUA 3ZWMA 4GKVA 3QLJA 4OXYA 3T7CA 4DRYA 1F12A 3AU9A 2X4GA 3WNQA 2C29D 1Q0QA 3H9QA 2JFHA 1SBYA 3QVWA 3KLMX 1HEUA 1I0ZA 1M76A 3GDGA 1LSOA 4PG4A 3ZNPA 1AGNA 4RF4A 4QECA 3DC2A 5C5IA 1PGJA 2BFPA 3VPFA 4A10A 4WLVA 4WUVA 4P22A 3OQBA 4QX6A 2AXQA 4ZRMA 4IGEA 4E4YA 2QIOA 2I76A 1IYZA 2RHCA 3DQPA 3R6DA 1ZK0A 4NJMB 2RIRA 5TJ9A 4CMCA 5I9MA 1VC2A 3FSRA 4MO2A 4R54A 3AFNA 4J7UA 4ITUA 1I3NA 3RJ9A 1Y1PA 1EQ2A 1HDRA 5AOVA 5B4VA 1B15A 3KZVA 4TRNA 2RH4A 5JS6A 3R3JA 3VTFA 2IZ1A 3RI3A 1G1AA 1C1XA 5JCJD 1GUZA 3PHGA 5BQFA 4I5EA 1F06A 2X86A 3WQSB 4TVBA 4J6FA 5JDIA 4IJUA 4EGFA 4EUEA 4ZICA 4JGBA 3GGGA 1DJQA 3IAHA 2QQ5A 3HFSA 5COAA 3F5QA 2CVQA 3O9ZA 4MP8A 1XU7A 3D3WB 1D3AA 2JJYA 3W8EA 1AXEA 3MOGA 5TS3A 1WW8A 2Q2WA 4J7CA 4RPJA 3WG9A 3GHHA 1DFIA 2EKQA 3UXYA 3H9UA 3AI2A 1P1HA 1KVRA 4CR8A 3ZHYA 3GRKA 4LMRA 2O4CA 3PHLA 3OP4A 4BHTA 3QIVA 4M1QA 1MX3A 3KYBA 4XJTA 2WSBA 4L9RA 2Y1DA 5T67A 1KVQA 3FN4A 3DMTC 4WCFC 2GGSA 2V6MA 4EUHA 1EZ4A 1U8FO 5CAEA 3S2GA 4Z6KA 4C7KA 2ZTLA 4FW8A 3H2SA 4IJWA 3UOGA 5JMWA 2PNFA 3AM3A 2X6TA 4GSLA 4DA9A 2PZKA 1FMCA 4ZJUA 1DOHA 4YQZA 1F14A 4YAGA 1H6CA 2X5OA 3H3FA 1ADFA 4WLEA 1PTJA 4XRGA 5L4SA 5TT0A 4YT4A 2PH5A 1IZ0A 1YOVB 3GUCA 5F21A 1FDWA 3WGZA 5L7WA 3ST7A 3GVCA 1Z45A 5EQDA 5G4LA 1PJLA 1Z74A 3WFJA 3PQFA 1HLDA 3ICCA 5U1PA 2VNAA 4BUCA 5EERA 4YDRA 3QWIA 4O5OA 5DN9A 1QV6A 5B12A 2ZJ0A 1H6AA 4A27A 2X0RA 1QP8A 4L8VA 5G0VA 1H0KA 3BMCA 2EW2A 5BT9A 4Z3DA 4BNFA 5KKCA 2O48X 3GN1A 5B4UA 4DLBA 2XOXA 1CIVA 2AQIA 3ADPA 4BNVA 3PQDA 4NG5A 3IOYA 1NVGA 3JQ7B 4Z9YA 2HU2A 1TVEA 3CE6A 1XYGA 2JD2A 1GV0A 3K2EA 1VPDA 2NTNA 3OBBA 1V3TA 4KDFA 3CKYA 1QKIA 4RO0A 4E2YA 4GWKA 1T26A 4F45A 4UUNA 1T24A 2W98A 1U2DA 1K5HA 3TNLA 2CF5A 2J3IA 4N5NA 1XQ6A 3H3JA 4R16A 1NQAO 2QRJA 3ONFA 6LDHA 1YL6A 3PJDA 1UP6A 1CJCA 3Q2KA 3H5AA 1ZIDA 1RPNA 4CMKA 2UAGA 2GLXA 1HZZA 1VL6A 1DFHA 1DC4A 4BO4A 2YDXA 5IDYA 4BO5A 5TGDA 4RPKA 4GGOA 3IJPA 5HWSA 3G17A 1I10A 4QUKA 3EYWA 2EHDA 3GH3A 3H9GA 3IL2A 4RQUA 4NH4A 4B4VA 4OSOA 1Z7EA 3QRWA 3PYLA 2Z1MA 1AE1A 2ZQYA 4ZA2A 4YT2A 4NBTA 5L95A 5AXAA 3AWDA 2DC1A 1PZHA 2Y1EA 3FNEA 4RPLA 4CLRA 1N1GA 4BO7A 3PI7A 3RU9A 3E5RA 3JD4A 4PRKA 1P9LA 1HKUA 4K6CA 4FC7A 4I5FA 4ZQBA 5EJ2A 4N18A 1XCBA 1ENPA 1ZKMA 2NQTA 2XF8A 3GZNB 3BTOA 4RORA 2FPGA 4RZHA 1PSDA 3MJSA 3MZ0A 1N92A 4GL4A 1DRVA 2NTVA 5IZCA 1LQTA 4ZQEA 1PZGA 3KBOA 4E33A 3ANNA 5IZCC 2WYWA 4WNIA 3UVEA 1WVGA 2C2XA 3F1LA 4O6VA 3DBLB 1WMBA 1U9JA 4IDGA 3WLEA 2EWMA 3CIFA 4Q3EA 4BNNA 3D4PA 2GRAA 4ZHSA 3ZWNA 1GCUA 2VWGA 4CM7A 1NVTA 2GCGA 4DMLA 2POQX 5JC1A 4M55A 2YV3A 4IUYA 2E4AA 1UZNA 3ROPA 4MKRA 1PJTA 4WLFA 1PJBA 3A4VA 3DZKA 9LDTA 3IP3A 3WNVA 1E5LA 1A9YA 1EEHA 1PJ2A 3PRJA 3D1LA 2J3HA 2Q50A 5CHEA 5DZSA 5JAZA 1DIRA 1EUDA 1RYDA 2NACA 1HE2A 4WCFA 3E9MA 5HS4A 3NDJA 4CMJA 2WWRA 1NPYA 1ZK4A 3GGOA 4XEHA 5BNFA 1IHXA 4XJSA 1I5RA 3I9JA 4E2XA 3WMXA 2FZWA 3DZBA 4FC6A 3O8QA 2ZYGA 1N1EA 2DFVA 2X0IA 4BNJA 2AE1A 1VKOA 5KWEA 2JHFA 2RH8A 1ISFA 1ZNQO 2I6TA 3WTCA 1P74A 1P33A 1JQBA 3GA0A 3IJRA 2EP5A 1WDKA 4Y8VA 2V7PA 1SMKA 2HO5A 3HDJA 2DPGA 1LSSA 1EE2A 1V35A 3D5TA 5A5EA 1PL7A 4BMVA 4R01A 4J49A 5CFZA 4K26A 5AVOA 1R6DA 4PLPA 2HCTA 4KZPA 4IIUA 1A71A 3C7AA 2FR8A 5IF3A 1NP3A 1GY8A 3VHRA 4BNGA 3BA1A 2DQ4A 2YFQA 4Z9XA 5IAAA 1VM6A 2VYVA 3PP8A 4MJLA 3Q6IA 5CEJA 1DSSG 4WPGA 1GZ4A 3HWRA 4D45A 3STHA 2I5PO 1LRLA 2NVBA 3BMNA 5G0WA 3NJ4A 4GWGA 3CPSA 3OJ0A 4CMBA 2HK7A 2JL1A 4ZQGA 3KSUA 2WDZA 3K8ZA 3CH6A 4OOFA 3JQAD 1N7GA 3ZV6A 5JBIA 4EJ6A 1YWGO 1PQPA 3WDSA 3ROKA 1E3WA 5JO0A 3HB4X 5G2OA 5G4KB 1H6DA 1SPXA 3U4HA 3UHAA 1B7GO 2D4AA 3ZNOA 1E7SA 4AFNA 1H9BA 3FHLA 2NU6A 1PL8A 3H7AA 4R3WA 3DL2A 1YB1A 1EMDA 2JKVA 4RF3A 1ENYA 3AM4A 3MJ4A 4ALIA 4HADA 2VRCD 5JAQA 5COBA 4W82A 4XZ3A 1HYGA 2ILTA 2F1KA 2B35A 3UH1A 2R00C 3W8FA 1XKQA 4MVJF 1W73A 2R00A 4I8XA 3DOCA 3GAZA 4BKUA 2D59A 3DOOA 4GGPA 2NVWA 4RF2A 3LT0A 4MVJP 3I6QA 1JKFA 4Y6RA 4B79A 4J4BA 5KOIA 4O59O 1QLHA 4NK5A 3L9WA 3ZHBA 1T4DA 3JQCA 3PHIA 4YJDA 1QXSA 4IS3A 1W8DA 3IKTA 3A1NA 8ADHA 4XYEA 1Q2XA 5B4TA 1B8UA 3F46A 3ICPA 3RFTA 3DDNA 1ZEMA 5T8KA 3RCBA 1EFKA 1WDMA 3FPCA 4G65A 3DZJA 4BNIA 2VUTA 1ZMTA 5DBGA 2X1HA 5JO9A 3X2EA 3U09A 2UDPA 4IJVA 4YRDA 1IPFA 3QWBA 1GEGA 4FIZA 1KEPA 4W4TA 3K73O 3GVXA 1U5AA 4E5MA 5L4LA 1JTVA 4NJMA 2CDCA 4YBZA 4J90A 1HE5A 3PJFA 3VH3A 3WJ7A 4GSKA 4U6QA 1J4AA 2YQ5A 1X7GA 2GZ2A 4RF5A 3L4BA 3C1TA 1BDBA 1MXHA 4Q3NA 2PR2A 2X23A 5A9SB 4DL9A 4EJ0A 1BXKA 1BWSA 3U4IA 3JYQA 4Q3BA 1CYDA 3GF4A 4L73A 4TKMA 1KC3A 1LTHR 4JROA 5JMPA 1HTBA 4D44A 1YXMA 4LW8A 2YDYA 1R16A 2IYOA 4ZN6A 3QVXA 3LU1A 4P4LA 1BTOA 1OI7A 2YUTA 4D0SA 4PLFA 3OQ1A 4CM6A 4H16A 1I24A 1LBEA 1R0KA 1N9GA 2CDBA 2G0TA 1IHYA 5I8WA 4L4RA 5CP8A 3RAJA 3S2EA 4MOWA
chains in the Genus database with same CATH superfamily
3KT8A 4O2LA 1YI8A 3QEBZ 2P6RA 3WLAA 2BGMA 1ZOPA 1Z4JA 5CDYA 3C4VA 3KJXA 1Q50A 4JP8A 2HBYA 5MFZA 2NQ2C 3PC6A 5FI0B 3I4LA 1C7QA 5FUVA 3GIWA 1E3QA 3AILA 5L4NA 4WEQA 3RVKA 3WFZA 2LKDA 1V37A 3D0KA 3OKFA 4IDCA 3NG1A 2H0AA 1PYOA 1OFIA 4JP5A 4QO8A 4BX2A 4WY2A 4CIVA 3LC1O 1IUOA 3R0QA 3U7FB 3KBBA 1XXHB 1AIPA 5T4EA 5LMZA 1JFLA 1XPUA 1K06A 4KO4S 1C1DB 3U7QA 4RLSA 4FWTA 1P1FA 4LRQA 5FD8A 3MJCA 1SVKA 2ABWA 1E58A 2O0LA 2O0HA 2AI3A 1O8BA 2ZW9A 3MTEA 2VBFA 2OBYA 2OFWA 4FOOA 4RANA 4L74A 1YASA 1VL8A 1UBSB 4CI9A 4MV3A 5A9RA 2GF9A 4JFAA 3MCAA 2O8EB 1SK8A 3ILSA 5DCLA 2AEFA 3KQKA 1Z4NA 3JYLA 2DQKA 5TT1A 4R7ZA 5KTRA 1C3OB 4EA6A 4UUAA 1J7KA 4DQDA 3MCUA 3DMFA 4JK3A 4OAPA 5ANRB 4YMTA 2EV9A 4G3XA 2ZTUA 2AK3A 5JSFA 4UCXA 3BK2A 2GD6A 3E5HA 3MHPA 4Q1BA 2ZI4A 4M49A 5AYVA 1J1ZA 4IBOA 4D6XA 1UXIA 1P6XA 3KYCB 5CG2A 3F9RA 2ZKIA 1ZWLA 1US8B 4C3VA 4OU5A 2QXUA 5JD5A 1JIKA 4UU1A 2BDUA 2O3TA 5LA6F 1PJ3A 1RHUA 3AIKA 3B6KA 4P3YA 4B6EA 3N53A 1IWOA 2I66A 1VCMA 3A2MA 3PK0A 2ERYA 2XHZA 2UYCA 2RD2A 3DMPA 3T1QA 3HRIA 2FN9A 3ESCA 3WNZA 4EG7A 4K9SA 3QJ5A 1WZCA 4Y2RA 2FW8A 1U0GA 3G2OA 1T1IA 3HYNA 4IIXA 4XLTA 3HU2A 4YJKA 2GEJA 5EJIA 3U80A 3QJGA 4I1RA 3RRYA 5CJ2A 1NC3A 2V4ZA 4XIFA 4CMEA 4KCGA 1WZIA 2PZLA 3EZ2A 2ZITA 1CJKC 1JN0A 4O0LA 1KTIA 4NBRA 2FR1A 1NZJA 1CUBA 4HWSA 5E6SB 2WSYB 4MEAA 1BYIA 1MGPA 4L5IA 4YAUA 2HW8A 5DNWA 2C5LA 3OIWA 3ZKWA 4M53A 4B45A 7MDHA 3AVQA 4HDSB 1GARA 5EVCA 2J7KA 2PDAA 1CFZA 2H7VA 3EZLA 4JR2A 4UD6A 3RTBA 4EFKA 2WJ3A 3MYRA 4WIAA 2CXSA 1IXZA 3MTAA 4TLBA 4FSHA 4JJGA 2C2GA 3S27A 4KWTA 1VCNA 3C41J 4JXKA 1M83A 4QNNA 5TRTA 3EWSA 1HSZA 2B9VA 2BFFB 1EM8A 1G5RA 2D2EA 4CF3A 1ADGA 3LYAA 3QEMA 2CXTA 3L41A 1BD4A 1K8QA 1KI6A 1F8FA 2HNKA 1L4EA 1XL1A 1O5IA 2JLYA 4CLHA 4B6JA 1Q1ZA 2WQ7A 2QNBA 1QE0A 3E61A 4PR3A 4H60A 2I33A 1V5WA 2HLDD 3PUZA 4LY9A 4I66A 1YUMA 1G7SA 1LW7A 4XPIB 2NZWA 4UTPA 1DIHA 1MOQA 1S3FA 3SQNA 4YQFA 4UNQA 4ZKEA 4OJKA 3CZAA 3BRWA 4I9NA 4ZOBA 1HNZB 4IVRA 1JJFA 1MKYA 4N03A 5HE9A 3KZ1E 3IMKA 3KR1A 2CNOA 1N3LA 1VIYA 4QYWA 4ZYYA 1N2BA 1CQJA 1PFVA 3DWGA 4UC0A 1KKMA 3W2EA 2ZE8A 4D3ZA 1T9DA 1Q3KA 2I7DA 1XLUA 3DZFA 4LC9A 4NVRA 4NOMA 2ATXA 2GAAA 1RM0A 4QU9A 2VYNA 4W7SA 5DHUA 1MU0A 1ZFNA 2FPGB 3S1AA 6GPBA 3X43A 1AXRA 4I08A 1KQNA 4EENA 3N2KB 1UBNA 1XVTA 3Q5EA 4MLDA 4L16A 1IIBA 3X1XA 4JYZA 1JSLA 3DOEA 3U3DA 5CITA 1RAIA 4P35A 4D9IA 5IXYA 2G36A 2OP0A 4GL2A 5AVSA 2WTMA 4PG7A 1VJ5A 2NV6A 2OV8A 2ZAGA 2CVFA 1YULA 2FPRA 1S5PA 2JLBA 1Z16A 2W6QA 3W4JA 4ZO8A 4BKQA 4IOJA 3ZXIA 2FW1A 1AUQA 2JC3A 3MS2A 3OKAA 3AB7A 3V80A 1G9TA 4BQEA 3MFYA 2WHRA 4KLZA 4HXYA 1E77A 2C0PA 2G9ZA 4ETMA 3G7UA 2Z8YA 2GASA 1OGJA 1Z5OA 1VJ0A 1TZCA 3CNHA 3IKLA 3K0FA 3S2IA 4C0LA 4IZ6A 2E85A 3WIEA 1ZK2A 2OD2A 5BUCA 2GF0A 1XRSB 2BGRA 5F3RA 1L5ZA 5F3DA 3TFOA 2H4WA 2G4LA 2P5TB 5HSGA 1MIOB 2BFDA 4J1NA 1D1SA 5AW5A 1ECLA 2PBZA 3BXGA 1D0IA 1XKXA 3FTFA 5CBPB 4OU4A 5HKAA 2W2XA 1Q91A 3R09A 4H6PA 4DQVA 5C52B 2GTIA 1Z6GA 2H0RA 1V16A 4PZ0A 4XTRA 1GXSB 3ZY5A 2HHHB 5E7QA 3ZV4A 1IU9A 1Y8AA 4BDTA 1BWQA 3ZCRA 3DAGA 4BLRA 4I6EA 2Q2OA 1WCIA 3O8QB 4UATA 3C3JA 1JLHA 3DEHA 3VJLA 4ARVA 4ZK6A 3SYLA 1ZEJA 3AHHA 5GZ3A 2Q6KA 4NRDA 2OXCA 2GZDA 3V33A 4EHDA 4PX5A 3WTBA 4K7JA 2I71A 3SZRA 4EATA 2D54A 2JH9A 4FSDA 3K5HA 1IONA 2TMGA 5UKDA 3F1KA 5DW0A 2Z9DA 1U0LA 2W6PA 1YU6A 4K8OA 4EY6A 2EU8A 5BWNA 4LJSA 2ZJ4A 1YSCA 2JGLA 3AKEA 4FN5A 5FLEX 2IX9A 1ODFA 4B2IA 1UKEA 3IAM6 1U0JA 1ULAA 1G6OA 2LWIA 2XYQA 3H18A 2GN8A 3HUFA 3QPDA 4FD3A 4RSRA 3GXBA 2PX2A 3IAAA 3K0BA 5A05A 3IJEB 1Y5NA 4F21A 2JVIA 2P2LA 3ID6C 2OBBA 4BC1A 1LBTA 3IUSA 4RJJA 3WSVA 3QWHA 2D7DA 1I2CA 3K6KA 3CN7A 5EZQA 5FFMA 4NMWA 3KQSA 1FFXA 1RPAA 3JR3A 4HXEB 1XQ9A 2ZU0C 2ZJFA 4O8CA 3W8RA 1MORA 1L3CA 5IPFA 2WBLC 3KB6A 4TMFA 4UU7A 3AG6A 2VZ0A 2YWXA 3UGJA 2EG9A 3UFXB 1F51E 4J2HA 3WNCA 5TR9A 3DW1X 3VDRA 4BLPA 3KSDO 1T5DX 2QG4A 3FMOB 4EUFA 1TMYA 4QBTA 5J3JA 1N77A 1LGYA 5JZMA 3VKVA 3ECCA 1ZXBA 2C5HA 1ISMA 1MXFA 1B1AA 3ESYA 4OQFA 3BGDA 4W5RA 4BMNA 3JPWA 1U7ZA 4WJKB 4BEBA 1UAYA 1W9HA 3QNMA 4YHBA 1IOLA 1O6GA 1XU4A 2IXTA 3TBHA 4YT8A 3VH1A 1DTWA 2P2SA 4UUQA 3UAXA 3ZQUA 5HKKD 2CUTA 3NUZA 2QZ9A 3L8CA 2H4JA 3RREA 3ZZUA 4WKOA 5JPIA 4EI2A 1VHJA 1F6DA 3FW1A 2XNDD 3EVAA 4PNPA 3ZVRA 1DQPA 1UIRA 3S2YA 3RR2A 4YAEA 1E2IA 4EYKA 3AF4A 3OPYB 4ZZ0A 2R66A 3ZS8A 1FYVA 5D1HA 4BOYA 2WFZA 5IABA 5M7EA 1X2BA 3EFHA 4YH1A 5LYJB 3VU0A 2ZI6A 3BERA 1WB9A 2BH2A 4FOSA 3DFZA 1SIBE 3AFMA 4EBBA 3I04M 2I1LA 2QQGA 3H1AA 1RMYA 2WG1A 4X1KB 1R18A 2OA0A 2IDZA 5K8VA 5IFLA 1COZA 4MA4A 4Q12A 3DCNA 2H11A 4BMXA 2XMZA 1NJSA 4V39A 3U44B 2OHGA 3P0RA 5BWCA 3WO1A 3ZI0A 4RJKA 3IBFA 3KM0A 4UVIA 2H3EA 3DWEX 1W36B 4XE5A 3VC1A 1XLVA 1X86B 1HLPA 1XQYA 3N2ZB 1KS2A 2WICA 4XWGA 2QMYA 4L3WA 4A2CA 2RGRA 4IGIA 4MMZB 5AVYA 4QOEA 3BSWA 4DSNA 1U63A 1NSTA 3F8TA 4UJ3A 4YMLA 1Z0DA 4RH3A 2RI6A 2VHZA 3EDRA 5KYYB 4TQUS 3DUFA 1QUEA 4GNKA 5IDWA 5JCJA 3OOEA 3M3PA 4ZMRA 2FEWB 1DNPA 1NY5A 4B7CA 3JQDA 1AQIA 3GUHA 3L7MA 4NR0A 3AKYA 4IV8A 4N7MA 5JASA 1OFHA 3Q9SA 3TPCA 3I61A 4H3HB 4XR9A 2XNKA 4ZI2A 1HWYA 3B70A 2C2MA 2X6QA 3DE6X 1G4AE 4E5UA 4L1KA 1TXGA 1T8UA 2AZTA 5AJXA 4UNRA 1XZCA 3HN2A 2N0SA 4N12A 2ZDQA 4FNGA 4WESB 4U0KA 3IE2A 2BM1A 2CLOB 4INZA 3LECA 4FK8A 2YMPA 4KQKA 5BSGA 4UNNA 5L3QB 2WPDD 4NYMQ 5EUCA 2PXHA 3H11A 1SOVA 4NEHB 4RD1A 4RVDA 3L4BC 1W29A 3UHFA 2GEDA 3PF9A 4GMXA 4FDMA 4Y2QA 4C6RA 3P9YA 3G8DA 2ZAMA 1Y33E 4QPCA 5D01A 4EOGA 1UC8A 2HHLA 3I64A 3MVEA 1FSSA 2H1HA 4K9DA 1KDZA 1KOLA 4S24A 1WTCA 1DC5A 3CE9A 4Q03A 3UV3A 3OT4A 4DT1A 4G2NA 2W2NA 1F4LA 1YR9A 2WWWA 1EIZA 2ZBVA 3LBFA 4S1OA 1KF0A 2OXTA 5FUXA 4Z49A 4UCQA 1LDBA 4NZ9A 2QE6A 3R75A 1AQYA 1PE0A 3GQBB 4HKTA 1IM5A 5DGHA 3TUJC 2UZ4A 3FNBA 1G5TA 2ANBA 3BZUA 3GJQA 4C0BA 3VKUA 3ZHXA 3NBXX 4AJ2A 3OQHA 2Q1TA 1SNYA 3NGXA 1G66A 1YBMA 1ZUNA 3DKVA 4E88A 3LWZA 3PIRA 3OD1A 4DUPA 4HH1A 3FDXA 4I50A 5KOJA 4F3TA 2J09A 4CM1A 4DDUA 2AC4A 1NN1A 3JASB 4EY4A 1T9BA 4PRYA 1R9MA 2EQBA 2ISSD 2TYSB 3AKDA 3LE8A 4YDQA 2PT9A 1KY3A 1YMVA 1XG5A 3LUHA 5ETJA 2VCYA 1B3RA 4G85A 3G0HA 1KY5A 2QWXA 3A32A 2AWNA 3H4VA 3UG6A 4DNPA 4GMDA 3WLSA 2V6JA 4U7DA 5A0VA 1EI9A 1PL0A 2OWEA 2VAWA 4HS4A 5AJTA 4Y2JA 3TM4A 4B5LA 4BO0A 2OHJA 1Q7CA 3FMVA 3WKEA 1W36D 2HUPA 2MR6A 4X00A 4IQ8A 1V11B 1DRJA 4XYMA 3D1JA 2XQJA 1KOGA 2KB0A 1JT9A 4UBNA 2NV2B 3KJGA 3RS4A 3EPHA 3OH8A 5JDCC 2W58A 2CWDA 3IXQA 4HQRA 1K6EA 1VL5A 5I4BA 3RRBA 1QS0A 4Q3DA 2IZZA 3QSGA 1S2DA 2FRDA 5ALEA 2VI5A 4QDUA 5FNZA 3ESBA 4I8DA 4Q1EA 3GPCA 2ODEA 2AI2A 4L6IA 4RZQA 3WHPA 3ZDFA 3PUWA 2IZOA 3BWBA 4DIOA 4EB0A 2XRZA 4IGAA 5FOSA 4JHLA 4MS1B 2ZJ1A 2EFDB 2LW7A 5KTSA 2BRUA 1IY2A 1TIKA 4OMFG 4PGAA 5ADUS 3GY0A 3A1DA 5GTDA 2VZLA 1F8GA 2F2TA 1H5QA 5LUAA 1GO2A 1QZZA 1KJJA 1DRWA 3N2YA 3B7PA 3EWIA 4FB5A 1TEHA 1X7ZB 4ADSG 3A2LA 5M04A 3WJAA 1KI8A 3CZCA 4QSMA 4RMIA 3QG1A 1PI3A 2BCGY 3ZZMA 3GEIA 2AYYA 3A05A 4DREA 2R4TA 2O7QA 5JPDA 4DTIA 4R40A 1GQ2A 1VOTA 4RHXA 3KAPA 1H65A 2QSJA 1YRHA 1AUVA 3E53A 1CDEA 4RGQA 4REQA 2QUZA 2W8BA 4D0LB 5KJFA 2OECA 4V0RA 1GAWA 3A9CA 1S9HA 4DZRA 4JV5B 2MR5A 5ESXA 4DM3A 1VI6A 3KKLA 4GI2A 1OU0A 1NI5A 3O47A 4HFRA 4DG9A 4GKAA 4IOMA 4W5WA 3L6UA 1LC3A 5AK4A 1UFQA 4D9KA 3EGOA 4EJMA 5ELMA 3B5JA 1M2FA 1WDLA 1RZRA 1LPSA 5L51A 2P3QA 3NNSA 3O5AA 1AA6A 4D8YA 4ZTUB 4ZVMA 1KEVA 2Q07A 3C74A 2P40A 5CX1B 1WMSA 4UDNA 5IM5A 3B3FA 1QH0A 4MKHA 1PDWA 3DNMA 2TMKA 3OSUA 2XD9A 3B13B 2NPOA 5KU7A 1W4ZA 2XAUA 1NU6A 1JGTA 4QDTA 4UHJA 5E1DA 1JYSA 4N40A 2JLXA 2D2FA 3H2IA 2ZANA 4NBVA 1PEKE 1V9CA 5EXDA 1UCFA 3DS8A 5EKSA 2AR7A 4OHKA 1Q0TA 4H0NA 4XFDA 3RV3A 3GNSA 4TWZA 5A4KA 2ST1A 1NVFA 4MCAA 1Y9AA 4H7FA 2QD3A 3AEKB 4RLHA 3CVYA 1TMKA 3IUBA 1ENZA 3OJLA 3UJPA 3PU6A 4MA5A 4Q9LA 2Z5VA 3TJZA 2PO7A 1U6KA 1PK8A 3A1UA 1XDSA 3N0VA 4Z0PA 2G40A 1DCMA 2X15A 4B5KA 5BWOA 4GAEA 3H8SA 5DYNA 1EFPB 1NXWA 4N41A 1ODJA 2JFFA 1HMYA 3HL4A 3HP7A 3W9YA 1I1NA 2D13A 4ENPA 1TLTA 1SU4A 1XCOA 1DAEA 1NUHA 2GVZC 4TSFA 5GONF 4JS0A 3T4XA 2C2ZA 5CVVA 1FUEA 1A72A 3CXUA 1ZRMA 1YZGA 2XXJA 4M4SA 3L8YA 1RI2A 1IRXA 1WOMA 1T0JB 1W30A 4JJAA 4LQLA 5T8KC 5BN4A 4R41A 1GPH1 1Z63A 3A1SA 1N4AA 4YJ2F 1JQ3A 2JJMA 1S1MA 3NJRA 2EGHA 5J2UB 2Y8EA 4E2WA 4UHFA 4F97A 3QBTA 4PQGA 1JEAA 2MSNA 4DC0A 1QPZA 1DRUA 1H4TA 4KGDA 2IS1A 1X1RA 2P35A 1YBHA 4W6ZA 3QQPA 3P4XA 4PO9A 4WT7A 3I1FA 1T15A 4KQFA 1IZ9A 2DFLA 4A0GA 2PD4A 4BB5A 1IUNA 1XZAA 3H2BA 3VI4B 3R8FA 1OT3A 3B53X 2EZ4A 2CL5A 2KWIA 2YY7A 3II6X 4XGRA 5T41A 5IKOA 1CEEA 4BMSA 3ZDBA 3A37A 4ZU3A 3TLYA 2GK4A 1M10A 3HU3A 4B33A 4RH0A 1PJSA 1PJCA 3BS4A 2CLIB 2JLSA 1XZBA 3OLXA 5DNDA 4D42A 1SG6A 1RACA 1CIJA 4K6KA 4YP0A 4FYXA 3BIJA 4MUJA 4YRGA 3E3LA 1KZ6A 3KX2A 4IHJB 2WV9A 2F55A 2B4YA 3OPMA 3C6KA 3LKZA 2HRBA 1HBJA 2C59A 4V03A 5ALJA 1DBQA 1RJ9A 2NZUG 1Z28A 3LX5A 2QVYX 2ONCA 2WHPB 3S8YA 2CB9A 1TW3A 2UYOA 3GEGA 4YP7A 1KI3A 1GAEO 3H5TA 4EM6A 2QN3A 3IAS1 5C8YF 4EFMA 1O4VA 4CW7A 3G8YA 4ZWNA 1XZQA 2QRQA 1WO8A 2Y3IA 1UH5A 3RUAA 4L0DA 2H08A 2UVDA 3DF9A 3DZDA 4FNOA 4H9GA 4IMJB 4RVOA 4FZ5A 4X1YB 4BIMA 4MSUA 1T3TA 1AHHA 1JH9A 1DWUA 1B14A 3LC7O 3HKBA 2M6SA 5D7NA 1QIKA 3KHUA 1G8FA 2QN6A 1ZVVA 1F5SA 3VOSA 2QY9A 2VYCA 3TQFA 4AY5A 3E4CA 221PA 4PIMA 3TTYA 3WB1A 3ETGA 3M6WA 4XOUA 4P32A 1E5VA 3VNUA 5C34B 2CJWB 3BORA 3EVDA 1VTKA 1BXGA 4AQYB 4YAFA 4G1UC 4EB3A 2XCOA 4OBEA 4INAA 1TD9A 1R4NB 1L0BA 1UJMA 2AVDA 4NZZA 1K98A 4U7JA 3UICA 2W6JA 1V1JA 1UBFA 1XZGA 2CLFB 3COVA 4GLJA 1XHLA 4PXSA 4C07A 5H7XA 3CZRA 5HR5A 5H8WA 1ZBDA 3VVMA 1DKRA 4IDAA 3VRHA 4OMDA 4Q4JA 3GRAA 2HL6A 2QW8A 2HJSA 5DM1A 3DE7X 7REQA 1C1DA 1X0XA 1E2MA 1U3TA 2YYAA 3GA7A 3HFJA 3FNIA 3L0SA 5ALGA 5LN1A 1E2LA 1C80A 1WNTA 2D06A 2FJ0A 2H2AA 2X3YA 3UWOA 1JYFA 5CA0A 2P9TA 1K8RA 4ZT2A 2C94A 4N3AA 5ALDA 1NWCA 3ZHZA 3ZLUA 2VS1A 3MLEA 3VHXB 1ADCA 4AJHA 1ZCJA 5EJGA 1NJ5A 2J5KA 3FMPB 4OX9B 3GW8A 1G1MA 3EXG2 1HOTA 4C0XA 2PSJA 4P0PB 1RWOA 3NAMA 1PVDA 2BCJQ 3P2YA 4J0IA 4M0PA 3RWOA 1Z47A 2FGJA 3D3WA 4OAOA 3WMRA 1PVVA 4I7EA 4R1QA 4O33A 4D3FA 2EW8A 1Q0SA 3D2CA 3WGYA 3L4SO 3DAPA 1YAHA 4M1EA 1OPXA 1KA9H 2FPSA 4A1OA 1L4BA 2ODAA 4R1MA 1E79D 2V0CA 4O4IA 2QTWB 3R74A 4AJ9A 4AZ0B 4F60A 2RGYA 2FSIA 1Y4DE 2I87A 4CKBB 3GQVA 1XP8A 1QVVA 1WE2A 3ZVLA 2OAP1 5DOZA 4NBUA 1IJBA 4LECA 4C4ZA 4OI1A 2DH5A 4C78A 3GGPA 3FH0A 3JARA 4LBVA 5EUQB 3KOUA 3I92A 5DE3A 4Q39A 1JDBB 2CYBA 1J23A 5CAEB 3RFXA 1RYBA 3UMMA 4LC0A 3R7LA 1ZINA 2VHUA 2XI4A 3QGMA 2AN4A 1N5LA 3HSYA 3JVIA 4KYIB 1AN9A 1NF9A 2RHWA 5H1YA 1JEYA 3MFQA 3K94A 4NOJA 1ZW1A 3SS7X 3I28A 5CW2A 5FTWA 1EGQA 4Y6PA 2GNAA 1NBWB 3RVJA 1N2HA 4UQLA 1V5FA 2DRIA 1E4OA 2B2XA 3FTNA 3TSYA 3CFYA 4D26A 1BDIA 3AUSA 3P32A 3RRZA 4C4SA 1DKQA 1RC1A 1NMXA 4I0WB 4YCLA 4M1WA 3LUDA 5CXUA 4A2PA 1RKVA 2B8TA 4HATA 5CVTA 2XJ9A 5CPFA 4S12A 3NR2A 1U3FA 4KBFA 3LVQE 3C0KA 4TTTS 3VC7A 3VPGA 1T9AA 4RVGA 1AUXA 3FTCA 1PGOA 3U81A 1VJCA 3LUKA 1EIWA 2YWFA 1KI7A 3FNGA 2POCA 3JQFC 3T8YA 3ZBTA 1DX6A 3L0BA 4OJMX 2BFFA 3O9MA 1T8PA 1U2TA 4O0MA 4FPXA 3ZDEA 3AHCA 4GKBA 2HNBA 1DB3A 1T36A 3UGQA 4PM4A 1KI6B 2DVMA 2QN2A 4H3VA 1J09A 4FOTA 3CUTA 1QAOA 3F4LA 3NT2A 4YJ3F 4D4GA 4PZZA 1GTJ1 1Y7TA 1XNRB 2WWYA 2MYPA 5GWXA 3WHIA 1OXTA 3A4TA 1W87A 3TSOA 2IYNA 2WF5A 4XB2A 3T3IA 1I2ZA 2HEGA 3TOXA 4YUXA 1HSOA 4HL6A 3VMMA 3LV8A 2FJPA 3DT9A 3K0AB 2OSBA 1FP4A 3R6TA 1U8XX 3TIIA 2PBLA 5FBWB 1SKUA 5EOVA 2AFIB 5CDUA 1WKVA 2O52A 2HHJA 4MUFA 2OCKA 3R7NA 3LHKA 4GP9A 3TAHA 4NYJR 2OBFA 1FDTA 3PT5A 4O1MA 4OA5A 2PGXA 3TIXB 4O2BB 2AC2A 3MLAA 3NZEA 4P31A 4F12A 2FYTA 3L8GA 4HFJA 1C9YA 3L1VA 4LDJA 4XB6B 4KLNA 1AMOA 1N9KA 4V3BA 2ZBQA 3MINA 5E4FA 7YASA 1PVOA 4RHYA 2C97A 3DYVA 3OLCX 3MSCA 4MEBA 1E3TA 3RC2A 4FM9A 1GQFA 1Z35A 2ZRIA 4M0LA 4QUHA 3BIWA 4P83A 1HKHA 1ONOA 2NNLD 4AY6A 3PL1A 4FEYA 2AR9A 5ADWA 4WFJA 2DBQA 4G36A 4W8HA 2GO1A 2I4LA 3SN6A 3QVOA 3T7DA 1SD1A 2HTEA 4X3CA 1SPBS 2Y1WA 4FBMA 2RB4A 4PFJA 3SY8A 1IATA 1USWA 1XAGA 2B2NA 3N2GB 1CZOA 2E4WA 4YV0A 5JSYA 5DM60 5TQ0B 1POWA 3G5AA 3ZE6A 4B4DA 3WIVA 2W6ZA 1RBYA 3VR2A 1WB4A 4XLLA 5KU1A 1M1NA 4KQHA 3V9PA 4XWYA 5G3YA 3P26A 1K7EB 3E9RA 2OZLB 4DFDA 1NUPA 1XRNA 2Q99A 3Q8MA 4WOPA 2W6ID 1EGHA 1YZKA 3LF2A 3DAFA 1EK1A 3ZZ1A 1OLSA 3MJFA 2ZRHA 1JDJA 3OOJA 1V16B 1B42A 1YH3A 1YVDA 3DTNA 4WINA 1B0AA 5TJHA 5JRDS 4CLOB 1JR6A 1UR5A 4KDEA 5ENVA 5TMBA 2EL9A 5JLJA 3E9ZA 1ZH8A 3NWJA 1XN4A 1A95A 1MC8A 1V0JA 1VMKA 2WIGA 2Z8YM 2C4KA 4EFDA 2E21A 3DWFA 4AJIA 3IVAA 4JP3A 4NFLA 3HJRA 4BV8A 4CKEA 3NKLA 3FB4A 3FDFA 5C7IO 4U9IS 3L9XA 2OL4A 2FKNA 1P3JA 3HFGA 1J8QA 3U49A 5HP4A 3IJ5A 5KTPA 1JALA 4GPIB 1NNSA 4R9NA 4X85A 4X92A 4YACA 1MCZA 1QIHA 2RIPA 5H5JA 4CEHB 5KNDH 3KKMA 4U2CA 3PNSA 1CUXA 3W3ZB 1NLYA 1OBVA 3PNLA 5IWCA 3R9XB 3LQKA 5HCNA 1A8UA 2QVLA 3V32A 3F71A 1CQIB 1XC7A 1Q74A 1TZBA 3G82C 4BVFA 5CDSA 3CHYA 2FEMA 1FA9A 3CZ9A 2I7CA 4DSUA 4ODIA 5TMPA 1S0UA 3P52A 2IYFA 3ER9A 3SQWA 4KJXA 1L7XA 4HAZA 3C5WP 1EPUA 2ZIXA 3C3PA 2XDQA 3IXLA 1ONNA 3PXUA 2YNMC 5A1JA 1W75A 4YJHA 3QW2A 2MWMA 5CVDA 1PNQA 4S05A 1C7RA 3A25A 4JOBA 2AEMA 4QTZA 2JFPA 3SKVA 5A6VA 3PJRA 4R0NA 4TTPA 2QTLA 3AMVA 1P6QA 1O97D 2C07A 2OV1A 3W3AD 3W7AA 6Q21A 1Z08A 1TTQB 3DM5A 4DG5A 1RHRA 5ILGA 3SHOA 5EZ5A 1BVHA 3I05A 1X1EA 2CDAA 1E4YA 1XTRA 2IP4A 2XEXA 4MUNA 4LE1A 1U8ZA 4V2IA 1K4YA 1OAOC 3LHDA 3TLXA 3RK4A 4IUDS 1DEAA 4JT4A 1H1DA 2GB4A 4M2LA 2UUPA 5CJJA 1Y6JA 2OZKA 4DBLE 1J6UA 1RDFA 3D5EA 1RIFA 3A4YA 4P5PA 4FUQA 1H8HD 1UJCA 3LYLA 3PL5A 1WXHA 5KYUA 3RVDA 5DDIP 5IEJA 1FCJA 1NMYA 3OZFA 5KQPA 3UPUA 4BO9A 1BE6A 3UG7A 1VKHA 3TIFA 1PX0A 3H86A 5KWSA 2EP7A 2UYQA 2VSNA 3I45A 3I2IA 4J0JA 3FMGA 4LHSA 3F6YA 1H94A 1QGDA 4GBED 1XV5A 4XWAA 4ENRA 5EWLA 4DLWA 1OAKA 2XDAA 3LX8A 5KMGA 3R20A 1E6EA 3DLTA 2O59A 5K20A 5JRJA 3A6ZA 4M0CA 2B6HA 3VJKA 4ER6A 4MQLA 1UBGA 3D3EA 4HQFA 4ZOCA 5IF9A 4AF7A 4CM8B 1BDMA 3B5IA 4ZZ1A 1NURA 2WSLA 5FV7A 5A2GA 4CM5A 3M6UA 1GUFA 3E3NA 4NDZA 4NU8X 3RFCA 2UUBB 2XQIA 4GG1A 3UW1A 1YB4A 2B8EA 4YPVA 3KKEA 5DX8A 4Q4AA 3L7BA 4XW2A 4CUZA 1N3BA 1U4OA 1CUUA 3K5IA 3UWMA 3PGA1 4HQOA 4DDTA 1EDZA 4OY3A 2X19A 4EPVA 1VMAA 5C1OA 3ZTTA 4OX9Y 4UOEA 3HB1A 1PFWA 3ZX4A 4F4CA 4MQ6A 4TKVB 1GGKA 3WYDA 3M1LA 3UWPA 2FMKA 4B3DA 4BU1A 4JH0A 2AN9A 2VNHA 5JCPA 4M87A 3L6BA 5C4GB 1ZSVA 2PVSA 1KEEA 4PZDA 3OOHA 2H4HA 4WGGA 4J0GA 2Z30A 2PH3A 3FTQA 1QMGA 4L5JA 3M6FA 2EF1A 4ZCSA 1JU3A 2JF0A 3PQ8A 4N7JA 2OHOA 4MGEA 2BKXA 4R9VA 2GFHA 4MUMA 4RCZA 1R4ZA 4TRRA 1WHTB 3SSNA 4Z7OB 3GP8A 4WERA 1N0WA 1GUYA 1GG5A 2XTNA 4BP9A 5BQOA 3LKVA 5JAOA 4MWDA 2XMCA 4RHTA 5AR1A 1ZK3A 1R5BA 2DE0X 2Z9CA 5HYVA 3RTEA 2Q6OA 2W2KB 4KWEA 4DDWA 2H9YA 4JI1B 4G25A 5IAEA 2VATA 2JI4A 2BMAA 4RADA 4HUJA 3BWXA 4I2VA 4YK7A 4GQAA 1I4LD 2B5VA 4XGKA 4KRFA 2XE8A 2PSDA 3IALA 1U3GA 4HT3B 1HDZA 3LFTA 1M8KA 4GPD1 4PICA 5BSTA 5EIBC 2YOHA 2UXBB 1QLJA 2BY4A 1SKQA 2IWHA 3CM0A 2X8LA 3U56A 3DDZX 2GF2A 3DUWA 3GYGA 2OBNA 3MGKA 4ENUA 5JR3A 3JTMA 4HDNB 4Q00A 2O3QA 2A94A 5EQJB 2P4SA 2ZBFA 1NPTO 3N5CA 3P96A 1UXGA 1JIJA 2Q62A 3TZQA 4BN0A 4NTZA 1N0VC 3W78A 1SIUA 2Y68A 3H8JA 3SX0A 2O5VA 4WLNA 2HKIA 2DKNA 3IA7A 2H5EA 4R1PA 3LUFA 4E1VA 5E9JA 3PC7A 2BHTA 2RCNA 3H5RA 1K7SN 1GFSA 1NBAA 3I6ZA 2PMEA 2IYSA 1Z2EA 4NNOA 4PCUA 1JHDA 3DG9A 1GZUA 4U00A 1XSEA 5JAHA 3GFTA 1GTG1 2P77A 4RS3A 4Q4HB 1AF4A 2NYRA 2WOJA 3AQ4A 3B85A 1IN7A 4JN6B 3S1LA 4WE3A 4RTNA 2GYWA 2ZIVB 4R2XA 1VSTA 2XD4A 4TMWA 4DZZA 3F90A 2J9YB 4LI3X 2BBOA 1A9ZA 5LBIA 2J6CA 1XNHA 2Q3BA 3AFOA 4PS0A 5LMUB 1OTHA 3OZRA 2GLUA 3QHQA 1LC0A 1KK1A 2BMFA 3IESA 1S8OA 1VDMA 4MVJA 1NJ8A 4OK6A 3SXPA 1ZA1A 2V54A 3SBXA 2FX2A 4EY7A 2H65A 1KQ3A 4OJYA 5JMTA 1FXWA 2RGNA 3SHTA 4TL6A 3DD1A 5C8XA 2PA3A 2ZB2A 2CFRA 4GE0A 5J4YA 4Y9DA 1UMKA 2V65A 3EDOA 3OIFA 1DAKA 2IYEA 2ZBRA 4FDUA 4X5OA 2PKRA 5IARA 4WLOA 2E6UX 1OU4A 1EFDN 1SXJD 4OF4A 3NTOA 2JEOA 1BMFA 1NATA 4WX2B 5LOVB 3ORFA 4H7JA 4V0SA 4UD2A 1CVRA 2C4HA 4C6SA 2Q3LA 2IBSA 2EFCB 4D82A 1E1QA 4X6YA 4JBXA 2J3DA 3T9BA 3KR9A 3KEGA 5JOQA 4ISCA 2XZDA 1JSZA 1UFOA 2GN6A 4LMBA 2AW3A 3IHWA 4TLCA 1T2VA 3AEQB 5LLDA 1SHKA 4XA8A 4XX0B 3ZEAA 2Q5CA 3R40A 1UF9A 4OG2A 2RI1A 4S1VA 2AJCA 1GDHA 1U2SA 1U90A 3GFFA 1DLJA 3RVPA 5LQUA 2CFOA 2NAFA 2XTJA 1L5SA 3H9BA 3ZBUA 1KJWA 2EXXA 5H16A 1LS6A 1SIWA 1NVWQ 3FNQA 4KI0A 4TXHA 1XNJA 3QKIA 3M5DA 4JL6A 2SKEA 3G0CA 3RU3A 1S3SA 3O6VA 1Y89A 4CLEA 1JEQB 3QMPA 2OCXA 3FSJX 1XELA 5DGXA 1JKJB 2DF8A 1WVMA 3IOCA 5T3UA 5J4LA 5LNK1 1M54A 2JCGA 4R8SA 3ZK8A 4B6RA 3TD2A 2WIKA 4DWJA 1BMDA 1TECE 3STYA 3M4ZA 16PKA 2FPOA 2VPXA 3KOMA 3RUEA 2PLFA 1WXGA 5DTJA 1ZS9A 4EW6A 4NCJA 2A9JA 3I83A 4DMFA 3SVLA 3EGXA 3ZHRA 5AW0A 3WMGA 5DTEA 3S3TA 1JZQA 4DW8A 1XEXB 1QO0D 1P9NA 1XLTA 2PKQP 5BV1A 1WBJB 2X3UA 4K03A 4OYRA 3AFHA 2PWZA 3KJIA 3T1OA 4QVKA 3SDSA 4E30A 2C31A 2VHQA 4KIGA 2WIDA 2AOTB 5ELXA 2LVBA 3FCXA 4FKBA 4ILKA 2XW6A 1GCOA 3MWLA 4B3FX 4QQRA 4HH0A 1M2OA 4RBNA 1TL7C 1NBOA 3RHZA 1P1JA 3U7IA 3EEFA 3WK6A 5IZ4A 1XXHE 4LHVA 4NOKA 3QXXA 5IK2A 4GLOA 2RSLA 4YRQA 2EX0A 1E3MA 1PZEA 1YACA 4UAJA 4LZLA 3ZBPA 5J1SB 1TU3A 1JSXA 1DO8A 1ZK1A 1KAMA 1J9EA 3WZLA 5I4CA 4K0KB 3HADA 2OCGA 4RM3A 3EVBA 1B0UA 4D5GA 3U16A 4KXQA 2HX1A 3WRYC 1R8YA 4EF6A 4PW0A 4HUQA 3Q98A 3WLOA 1IFXA 4F3KA 1WV1A 2VWPA 1RWNA 5FI5A 3CUWA 3TVTA 2X5XA 3OCUA 2AMYA 3G7SA 3C16C 2BEWA 3OZEA 3VM6A 4JSYA 3QPVA 5LB4A 2R60A 3ZDCA 4B3RB 3LHIA 3FYTA 3AY6A 1OKKA 1SRQA 3NH6A 3K4PA 3S1SA 2FW6A 4ZP1A 5HHTA 2IDKA 3B82A 4IIYA 1EE9A 2ZUDA 1B8VA 4S0ZA 2QYHA 4U2KA 1NJFA 3TRIA 3QLVA 2IY7A 4RSHA 3N0XA 1RC0A 4JNKA 2GBGA 4DLPA 5CX4A 4YIKA 2E4XA 3JQQA 2PNJA 5T6MA 1YB7A 4UW9A 3UAWA 3V1YA 3ZJYA 4F11A 4YRAA 4MA0A 1OUMA 3T1TA 1W85B 2J4CA 2PFGA 3ZIAD 2ZSDA 1O6ZA 1CY7A 5F73A 4N48A 4TMKA 3W8DA 1VYVA 3E81A 3OAAD 4QJ4A 3RLIA 1R37A 4EW1A 1SCAA 1MB2A 2M1ZA 2XNHA 1SKBA 5A5VA 3TTTA 4K6OA 3C14C 2UZ1B 1CY4A 3KJEA 3UJ7A 1AZSC 2XRMA 2VEOA 3BMQA 1LI5A 1FS5A 4QTXA 3WB0A 3OTWA 3A4NA 2GA8A 3UOAB 1AZWA 1E2QA 3RDPA 3UUFA 1SD5A 1YE3A 3VYUB 2ZP1A 1B8PA 2D4HA 1JVNA 3ZG6A 3ZW7A 4EO4A 3QV1A 1H05A 2CJWA 3IMFA 1LV7A 4G8JA 4EA9A 5JH7F 1OFUX 3TD6A 2HT6A 3C3EA 4XWTA 2PTGA 5JO0A 1AMUA 1ND6A 3LFHA 2XBMA 1NONA 3OG9A 1R00A 3P2JA 3L8DA 1UAAA 2ZLBA 2M2IA 2BGIA 2C1XA 2REQB 3G2KA 3JZAA 1WZEA 3O4IA 5CB4A 5HBRA 4Q4JB 2A4MA 3MYYA 5TPZA 2FQXA 2JJ2A 4LJYA 2PSEA 2N3ZA 1L5YA 2ODBA 2FWAA 3GRCA 1OCEA 4US0R 3HK2A 4AI6A 4G0OA 2GS9A 4WK6A 5LU8A 5I7SA 4F6RA 2FZKA 1IK4A 3PDWA 3ROEA 3OF2A 2PS3A 8MHTA 1BQ4A 4X95A 2B1RA 3NHLA 1ZD8A 3JQAB 4OTZA 4RCYA 1YRYE 1V7QA 3LZ6A 1VG8A 3VH4A 4DCPA 2HF8A 3WS7A 4ZEWA 3GI1A 2L82A 4FKZA 3LF1A 2ZIZA 3PJEA 4GBGA 1EGMB 3QF4B 3Q0EA 4KODA 2NZ2A 2NSHA 2HK8A 1GYQA 1WY7A 5B6IA 4TZTA 3W5VA 5JZSA 2BTOA 1EAMA 4HB4A 2EG5A 5I8ZA 2HMWA 5CNIA 5DT9A 4YMHA 3RIMA 1EVYA 2GJKA 5F7OA 4B6FA 5CEEA 4URYR 1NXPA 1FXWF 5AQ1A 4XCQA 1RRCA 1XLWA 1TFUA 4CQLB 4MZDA 4G07A 5TX7A 4LFBB 2JGJA 3CEPB 3QOWA 1U81A 1X7XA 4LDNA 3PEEA 4PC6A 5CCDA 1OF1A 1IPHA 1EQUA 3FZGA 3TEFA 4HTAA 3UH0A 4CCSA 4LSMA 1NVEA 3PXCX 1OAOA 4TVSA 2E2WA 4DDVA 4F91B 3CB2A 3KQWA 3TQCA 4HCJA 1VE3A 4GMHA 4RE6A 2ODQA 1JMYA 1HT2E 3GLVA 1DLIA 1K0FA 1E3IA 5CLHA 3RAEC 1FUKA 1GA1A 5KC9A 3FHCB 2WOOA 1QTQA 3ONWA 5LDHA 4EJSC 2R6JA 3GFPA 1WP9A 3WKDA 1B8NA 2Q45A 1TAUA 2QJFA 3LBYA 2VLIA 2RBKA 5H68A 3QE0A 3PFHA 4QWMA 4G0QA 5I7VA 1AKYA 3V1TC 1WCYA 2GZMA 4UE2A 5FOXA 5IHXA 1M6YA 4LX8A 1W46A 5FO1A 4HY3A 4LQDA 1FDRA 1ACMA 2R1TA 1XBTA 2I99A 3BH7A 1WKCA 4QG7A 3V2UA 3VOAA 3DT8A 1NVAA 1T2DA 4L51A 3BMCB 4KAAA 2X8BA 1G16A 4YR7A 1QB7A 3NS7A 3F5DA 4LWQA 2R65A 1DAFA 4MWEA 4QLBA 2BI4A 2ZVDA 2UVPA 2JIQA 1JAYA 2JIDA 3RT7A 2FSGA 2IVZA 2ZULA 4NCIA 4LKOA 2GUWA 1M75A 5H4HA 2HAEA 4A26A 4KXNA 5DLPA 1IBKB 4BIIA 3L0IB 1VLLA 1UWVA 2E1RA 2YS7A 2W22A </