3C85A

Crystal structure of trka domain of putative glutathione-regulated potassium-efflux kefb from vibrio parahaemolyticus
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
150
structure length
150
Chain Sequence
QLINPGHAQVLILGMGRIGTGAYDELRARYGKISLGIEIREEAAQQHRSEGRNVISGDATDPDFWERILDTGHVKLVLLAMPHHQGNQTALEQLQRRNYKGQIAAIAEYPDQLEGLLESGVDAAFNIYSEAGSGFARHVCKQLEPQFTSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Putative glutathione-regulated potassium-efflux system prote
publication title The crystal structure of TrkA domain of putative glutathione-regulated potassium-efflux KefB from Vibrio parahaemolyticus.
rcsb
source organism Vibrio parahaemolyticus rimd 2210633
total genus 53
structure length 150
sequence length 150
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02254 TrkA_N TrkA-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3c85A00
1UXKA 3F9IA 5T6BA 2PD3A 5CDGA 1GUFA 5TJ9A 4DUPA 1VL8A 4FJ2A 4YDRA 2GGSA 1I3MA 3GEMA 4H16A 1YONA 1SC6A 2X22A 2NM0A 1TB4A 3KYCA 4CMBA 3H3JA 4LISA 4INAA 1HDXA 5G4KB 2PH5A 4IJUA 3LLSA 3KBOA 2RAFA 3PDUA 4Q9NA 4CM4B 4B79A 4UUNA 1T2DA 3F6YA 4QFDA 1A4UA 1PQPA 1RM0A 2VHYA 1SB9A 4M49A 1RJWA 3GEGA 4E3ZA 1ZSNA 1VC2A 4M8SA 1JWBB 2YZ7A 3OSUA 1BXGA 3FNHA 2CDBA 4NDNE 4NK4A 4PGFA 3CUKA 4JP2A 1QRRA 1Y1PA 3FPCA 1UDBA 3DAFA 3CMMA 3EY4A 2PZMA 1PGJA 2XF8A 1LEHA 1PJBA 4UUMA 4JJFA 5CP8A 4U0JA 1AUPA 3DBHB 2HJSA 1FXSA 4O5OA 1ADFA 1IOLA 4MPDA 1NAHA 4KDFA 3T4XA 2F1KA 1Z75A 4Y98A 1NFQA 3IP3A 4XR4A 1V3VA 3VZSA 1ADGA 3RVDA 4Z9FA 1DLIA 1L1FA 3TZCA 1NM5A 3ROQA 4ALLA 3WSVA 5EQFA 5C5IA 2WWRA 3D3WA 2ZTMA 3K30A 4BNVA 4PIVA 2VZ9A 4XYGA 3N58A 5EESA 3ZGYA 4UVEA 5T8KA 2OO5A 1XGKA 2FN7A 3JQ9C 2GLXA 4DREA 1E3WB 1N7HA 1NPTO 4TROA 1PJLA 2ZYDA 3DZGA 3WIDA 2WEKA 1GDHA 3PYMA 2PZLA 3NT4A 3BTSA 5TLSA 1JKIA 3I5MA 2IXBA 1P33A 3P19A 1O94A 4MIEA 1R4NB 4OGWA 3WYEA 5IDWA 4HFRA 3TN7A 2GNAA 3GVPA 5U4QA 4D7AA 3WGOA 3TZ6A 1I5RA 3ONFA 1W0CA 4IS2A 3ZWVA 1ML3A 4YAEA 1BVUA 2YV2A 2FMUA 1QSGA 3GVHA 4DPMA 4K9DA 3WMXA 5HRUA 3TF5A 2G1UA 3RUHA 3U3XA 1B2LA 2ZQZA 4AJJA 4XJTA 4CJXA 3LVFO 4WOJA 1ZK2A 3EAGA 1M2WA 1JQBA 1PL7A 4CMAA 2RBEA 4LCEA 4B4UA 3RUEA 4Q3CA 1H6CA 4JIGA 4BO2A 5A9SB 5IZCC 3GHYA 1EQUA 1VM6A 2Y1GA 1ZXBA 3MCVA 4RZHA 1O95A 4RO0A 4DA9A 3IOYA 4TRJA 4CLRA 1NPDA 1X1TA 4OAQA 2JD1A 5DNAA 3NDJA 3WB9A 3M2TA 3VTZA 1XR3A 4DLBA 3H5NA 4W82A 5TJHA 1E7MA 5A3JA 4J6FA 4KMSA 4MJLA 3ZZNA 1YS4A 3K31A 1UP4A 4OJNA 4QTZA 2J3IA 4TQGA 1VL0A 5DBGA 5ILGA 4YT4A 4CPDA 3EW7A 1OC4A 3SC6A 3V2UA 4XYEA 3GGPA 4AL4A 1PJ4A 3AK4A 1LLCA 3ZWAA 2WJPA 3FN4A 4EEZA 2JCXA 3P2YA 4W6ZA 5T5QA 4XD2A 4J4HA 4XQCA 2RH8A 4WNIA 2I3AA 4J1TA 4YRAA 3BA1A 3OQ6A 3BMQB 1M6HA 3HWRA 1JN0A 1L7EA 3V2GA 3WICA 4BO0A 3R1IA 2OP0A 1TT5A 3QWBA 3H9GA 4XQGA 5F5NA 2VHVA 4Y6SA 4OOFA 2I66A 3H8VA 4L4XA 1NQ5A 2VT3A 2Y0DA 3KYDB 3W6UA 3CZMA 4UAGA 1DIAA 4J7XA 4YAJA 4BNUA 3C7AA 3CZRA 2DBRA 3WS7A 4E2WA 5L40A 4L75A 4XQEA 3AY6A 3AUTA 4YAGA 4ZJUA 5FF9A 1WXDA 2IZZA 3ZNPA 4PLYA 2X7HA 1A9YA 2YQ5A 4EUEA 5DZSA 3PFFA 1LDGA 4PG4A 1HE4A 2EP5A 3I9LA 3PEFA 3JQFA 4PRKA 2CNBA 2DBVO 1GZ3A 3CTMA 2PTGA 1OMOA 4ND2A 4NJMA 1XYGA 2AMFA 1Y5RA 4FQ8A 2UDPA 4MIOA 1YKFA 1P74A 4IDGA 1CIVA 3GDFA 4TVOA 5BNIA 4IS3A 4R1TA 2C2YA 1DIGA 2Z5LA 3WGIA 3OBBA 3FD8A 1HRDA 1I2CA 1E6EA 1R15A 2Q1UA 3PHGA 5ITWA 4HWKA 3O26A 3GY0A 1LNQA 3OEWA 3PRJA 4MIYA 5IF3A 3JTMA 4CQLA 3JQ6A 3BAZA 2C0CA 1KVTA 4YT2A 5IG2A 3V5NA 1OI7A 2Q1WA 3V1UA 4A10A 5JO0A 4IQ0A 3L4BA 5EL0A 4YJDA 4BO9A 1E0DA 4XQ9A 5L3ZA 3GNSA 4J7CA 4I8XA 4IMRA 1H5QA 2OUIA 5HS6A 4IDBA 4I5FA 3EDMA 2FHSA 3BYZA 4IJVA 1A7KA 4FC7A 4QFCA 3K8ZA 4BGEA 4LSWA 5EN4A 5DF1A 4DMMA 2R6JA 1I3NA 3GDGA 2VUUA 3TOZA 3TSCA 1Q0QA 2ZTLA 5EQDA 3PJEA 3ZDFA 1C0IA 3PHJA 4ONEA 4XRGA 4R1NA 1PS8A 1FF9A 1MG5A 3IIEA 1DB3A 1P31A 3AOEC 3B1FA 2B36A 4RPHA 4J16A 4DIOA 5H83A 3VH1A 4R69A 4N5NA 3NEPX 1CF2O 2EEZA 1ZSYA 1D4FA 1P3DA 4BO1A 3ZN2A 3SC4A 2X5JO 4RQUA 2JFHA 4A73A 4KTVE 1YOVA 1MV8A 3A4VA 4A7PA 3QVOA 2BHLA 3E9QA 2BRUA 4E13A 2E37A 1OAAA 1O0SA 2DVMA 2GZ1A 1UAYA 2H9IA 3K6JA 4R1SA 2O23A 1M67A 2ZB8A 4BO4A 2B4RO 4D0SA 4ITUA 4F6LA 4GH5A 4NQZA 4D79A 3PJGA 5TT1A 1MFZA 1H2HA 3A9WA 2WMDA 1V8BA 3BMCB 3GNQA 4IDEA 3I9MA 4WEQA 3O38A 1V9LA 1DPGA 1XSEA 3V8BA 2NACA 2J5RA 3GGOA 1QKIA 3U49A 3ZWXA 4KUHA 1H6DA 4W7HA 4BMNA 3DXFA 4KUEA 5ITVA 4Z0TA 5THQA 1ZFNA 1BDMA 2EF1A 3PFWO 3KSUA 2FPIA 3TL2A 1F06A 2BF7A 2Q4BA 4H15A 2AA3A 2QX7A 1NQAO 1EEHA 2P9CA 2FR8A 3W8DA 2G17A 4K1LA 4CV0A 1U7TA 6LDHA 1YB1A 4YACA 3ZV5A 5EPOA 4KZPA 5KJ6A 4AFNA 3P5SA 3ITKA 1T26A 3LC1O 3S2EA 3FTPA 1U28A 3IS3A 3PWZA 1P1RA 5B12A 1QV6A 2HMUA 2VTEA 2CMDA 3Q6IA 2HUNA 2PZKA 1MB4A 5G0TA 1FDSA 2PGLA 5B4VA 2VHZA 4FFOA 1W8DA 1IHYA 1B3RA 4P4LA 1KETA 2O3UA 1KEUA 5CPBA 3RFXA 1CQIA 1OBFO 1U4OA 4CMIB 2EKPA 5COBA 5T64A 1A7AA 3HNPA 2FRDA 1QLJA 4CODB 2DPHA 4YR9A 5JMPA 4FOSA 2ILTA 4I1IA 1GYQA 4ZGWA 1DEHA 2J3HA 3LQFA 1BW9B 3PHIA 3AM4A 2VNSA 5F1PA 2CF6A 4RF3A 3RI3A 2UYYA 3RJ9A 3CEAA 5CDUA 1M66A 1HYEA 4R5MA 5IJZA 3SJ7A 3LSYA 1UAGA 1E5LA 2NWQA 2BD0A 4FFPA 1PZFA 2W8ZA 2VRBA 1U4SA 2HMTA 3LYLA 3AUUA 3O9ZA 2BLLA 1HYHA 4K28A 4N54A 4JROA 2FSVA 3VZPA 1N7GA 1HT0A 1HDOA 1HDRA 3K73O 2CD9A 2A94A 4PCVA 3DZKA 4TMFA 4TSKA 5IAAA 2Q2QA 1T2FA 1PS0A 1D7OA 3DFZA 3PZRA 1NVTA 2AQIA 2H6EA 3AFNA 4Z0HO 3OM9A 4U0KA 5T8KC 4JBGA 2AEFA 3C85A 2GN6A 4L0QA 3NKLA 1GQQA 2C82A 5JC1A 4BB6A 1IE3A 3DZJA 1EUDA 1C0LA 3JQEA 5IXSA 1XHLA 2UVDA 3U62A 3LC7O 4FPXA 1GY8A 4G65A 2O7SA 1FMCA 4GLLA 2VRCD 4QXMA 4DRYA 3CH6A 1Q0HA 4A27A 7MDHA 4DVJA 3MJ4A 4RJTA 1LSSA 2B0JA 1E3WA 3X2FA 2PNFA 2XXBA 2YY7A 1ISMA 4GSLA 1P1JA 3AY7A 2H63A 4E5NA 2VRCA 3ROPA 2WD7A 4DXHA 1R37A 5EJ2A 2VT2A 4OL9A 4HNGA 4AJ2A 3D7LA 4BNHA 1MUUA 4IJWA 3KM0A 2DAPA 2IXAA 4R01A 1FDTA 1PSDA 1HZJA 3HQ4O 5GZ1A 4MVJI 4MVJH 3OQBA 4W9NA 4LVCA 1YL5A 4NI5A 2IEBA 3NV9A 2Y1FA 3VH3A 3C1OA 4E5YA 3H5AA 3N74A 1XIVA 2O4CA 2Q99A 1GUYA 3FBTA 4QQRA 2Q46A 3WQSB 4OQYA 2PLAA 3QWFA 2ZTUA 3VPHA 4AJLA 1JU9A 3VPGA 4WCFA 3DR3A 2PK3A 4LRSB 3F4BA 5HM8A 3GNTA 3VZRA 4LCJA 1C0PA 3ZU5A 1EZ4A 2EKQA 2YW9A 3WWYA 1P44A 2EV9A 1SZJG 3ULKA 4M86A 2YHIB 4HFJA 3LF2A 1T2EA 1TVEA 3LU1A 4BL5A 2IODA 3RIHA 2ET6A 1NTOA 2PR2A 1U7HA 4IPTA 2W4QA 4E4YA 4DPKA 1ZIDA 2Q1TA 1R12A 3NTRA 5I9MA 5JY6A 1HLPA 2CFCA 5TSDA 3DHYA 2NNLD 2ZB7A 3LZ6A 4YAIA 8LDHA 2LDBA 3H65A 3DAGA 2V6MA 3PWKA 4Z0PA 1OOEA 4DLAA 2ZCVA 3FPLA 3ASUA 3KEOA 4GX1A 1MXHA 1UZMA 1I33A 4NU6A 4Q3EA 3WDSA 4BV8A 4LRTB 3DOOA 2QQ5A 4KP7A 4IIVA 1CEQA 1N2SA 2WSBA 2JFGA 4CR7A 3GVXA 4DL9A 3WBFA 4YCAA 4XYLA 1T4BA 4JNKA 5G0WA 2QHXA 4PLVA 4TZKA 3S1LA 4CQMD 3D5QA 5MDHA 2VWQA 3JQFC 4AJHA 4GVXA 1MGOA 3H2ZA 2YV3A 3LC2O 1LDEA 2HU2A 4CQMA 2CSUA 3RBXA 1PS9A 1R4MB 2GN9A 3B20A 3JD2A 3D4OA 5IZ4A 4I08A 5JYDA 1XA0A 4RZIA 2Y99A 1AHHA 3F3SA 3HB5X 4II3A 2VWPA 1T24A 4R9SA 1YRLA 4R3WA 2Q4EA 4HNHA 1ENZA 1EVZA 1CETA 2VYND 1UXJA 1QP8A 4K6CA 3OJFA 4BNXA 4HXYA 3IP1A 4I5GA 3PYXA 4D42A 5JDIA 1LDMA 3BHJA 5IDXA 1ORRA 2YUTA 5B4TA 2VYNA 3PP8A 3L4BC 3KSDO 4IM7A 2NTNA 3UAGA 1ULUA 5KVSA 1JAXA 2OBYA 1T25A 3LT1A 1YDWA 1I3KA 1JA9A 3GHHA 3VTFA 2C20A 1IL0A 3Q2KA 4RGBA 3WGYA 3RD5A 5DCUA 4PG6A 5HA5A 4KWIA 3V2HA 3SJUA 3WOHA 2A4KA 3GC6A 1LRLA 3QVTA 1U2GA 1U1IA 4OO3A 4D41A 3UICA 4K6FA 5IFLA 5KVCA 4NG5A 2AEMA 3EVNA 3ONEA 4I5DA 3SLKA 3SVTA 3VPXA 3WX0A 1NWHA 3HG7A 3WIEA 1SEVA 3OQ1A 1T4DA 2P5UA 2D0IA 3HE3A 4CLHA 3DO5A 4GKBA 1M76A 1P1HA 2XXJA 1UP7A 1PZEA 2D5AA 2DTEA 2J8ZA 3KLPX 3O8QB 1ZK4A 2X9VA 4BGUA 3DOCA 1Q1NA 3E48A 1NAIA 4DQUA 1DRWA 1R0KA 3AI2A 1GD1O 3PHLA 4RPLA 4EZBA 1IUKA 3GZNB 1WLYA 1UXGA 1FK8A 3GDOA 3AOGA 3AU9A 1DOHA 1RPNA 3VHRA 4RVSA 2NU7A 3OICA 3JYNA 4IZHA 4FJ1A 3RUIA 4FC6A 5A9RA 2Z1MA 2F00A 1YL7A 3DZIA 4J4BA 3VPSA 1EQ2A 3DZBA 4XKJA 4BKUA 1YWGO 2HK8A 3ZW9A 2PV7A 3FSRA 2B4QA 4KTTE 5BSFA 1Y8QB 1LLUA 2A92A 3FCOA 5AVOA 1I24A 1X1EA 3CINA 1B3BA 3TPCA 5U9CA 1EFKA 5ENDA 4BNWA 2R2GA 2D2IA 4B3IA 5HS4A 1WDKA 4L76A 2CVZA 2E6UX 3MZ0A 4GX5A 1DFGA 1CWUA 2J5KA 4WEOA 4RVUA 3UOGA 3ZWBA 3JD4A 3ZCXA 1BHSA 2I99A 3K2EA 3NRCA 5G0VA 2X9GA 5K9ZA 2Y67A 4NFSA 4ND4A 1HETA 1ZSVA 1MG0A 3ZV4A 1QV7A 3D64A 1ZEJA 3DDNA 1V3TA 2AQKA 1E3LA 4CM8B 2GCGA 4E2XA 4BB5A 4R51A 1PX0A 3RUDA 3HFSA 2E4AA 1X14A 3IJPA 2AQ8A 2VHXA 3MEQA 3PGJA 1LSOA 4GLOA 5HTOA 3CKYA 4AJNA 3I23A 5KJ1A 4GVLA 4HX5A 1EVYA 2BGMA 4CM1A 4G2NA 1PU2A 3ADPA 3T7EA 4CM6A 2X0NA 3JD3A 1XU9A 4YEDA 3C24A 1BMDA 1VJ0A 2C54A 3H9EO 5BNTA 1YQXA 1T2CA 4XGIA 1FDWA 4YA6A 5LDGA 3QA9A 4GGPA 4F46A 1DHRA 2D3TA 5IXYA 1ISIA 3JQAD 3Q0EA 1M6WA 3JQ8B 3UH1A 4BNLA 3GPDG 1D1TA 2Q50A 3GN2A 1RM3A 5ICMA 5L45A 1XQ6A 2BFMA 4HADA 4X54A 1DRVA 1I2BA 1ID1A 2AW5A 1YXMA 3JQ7A 3W4IA 3IKVA 4RF4A 5A04A 1ONOA 3C8MA 3JQAA 4PLFA 2QZZA 3VH2A 5I9NA 3PQFA 2O3RA 4RF5A 5JDCA 4EW6A 9LDBA 2ZJ1A 1QG6A 4GX2A 4B7CA 3DMTA 2I3GA 4GPD1 1GYPA 5EIOA 1PQUA 1P0CA 3OHSX 2Y1EA 2OL4A 4YRBA 4QECA 1PJ2A 3WR5A 3BMNA 1N9GB 3EMKA 1DLJA 3ZU2A 1C1XA 4NJOA 4BO3A 1Y81A 3NJ4A 3UCEA 4RVDA 3UCFA 4BNIA 2PH3A 2X5KO 1V3UA 3I9JA 4P4NA 3RC1A 3PK0A 1ZKMA 3L0DA 4RVGA 5DOVA 1B8UA 1LSUA 3AU8A 3BXXA 4YJGB 5G4LA 5BSHA 1F8GA 4J3FA 3ONDA 1C1DA 5ER9A 6ADHA 1KERA 1XU7A 4XX0A 2GRAA 4HFNA 1PJQA 4C4OA 3MJSA 1ONPA 4TKLA 4PN3A 5C7OO 3DTTA 1T1SA 1ZVMA 4CM5A 1SB8A 1E1KA 1WZEA 1ENOA 1E7QA 1ZBQA 1LLDA 1HTBA 2AQHA 2EIHA 4J0EA 2OBNA 1ARZA 1EUZA 2YHUA 4FBGA 4NBWA 4C7JA 4W99A 2HQ1A 2IYOA 4GMGA 4YQYA 4L8VA 1A9ZA 4W9NC 1GL3A 3GR6A 1DC6A 3ZWYA 3HJAA 1HYGA 3PYLA 4ROSA 1Z82A 3K5PA 3I9OA 1NASA 4IZIA 5LCXA 3ANMA 1DJQA 3DHEA 3C7CB 4OKNA 5KVQA 1BXKA 5DOZA 4IDDA 3EHEA 2IZ1A 1QYWA 2HAEA 4YTEA 3G79A 3N7UA 1LXCA 1SOWA 4E5MA 2AE1A 5L9AA 1MXFA 3FR8A 4XEHA 2EJWA 4D46A 3PLRA 4D43A 3TZQA 2VYVD 1DSSG 1SEPA 3H5RA 4M1QA 4RQTA 1OFGA 2DQ4A 1T1RA 5CG2A 4BQPA 4WCFC 3BZUA 3ZU4A 4IGEA 4TWRA 1T2AA 3KOUA 3MWDB 1PWZA 3UFXA 3GGGA 2X86A 3MTGA 5L7WA 2B4TO 2VYVA 4IINA 2O48X 2DUUA 2OHXA 3GAZA 4MKZA 4CLDA 3OH8A 4CMJA 3ZHYA 4ZN6A 1PGNA 1AE1A 2IE0A 3LLVA 4FW8A 3Q2IA 5HBRA 3A1NA 4BOYA 3JYOA 2H5LA 4AJEA 4JN6B 4MVJP 3DBLB 4YWJA 2JFFA 3TZKA 1VL6A 2FZWA 4JBHA 3NJ8A 1SAYA 1ADCA 2D5CA 4YJFA 2C7VA 1D8AA 2DUWA 4CLOB 4Q3NA 2V6BA 3F46A 3DTYA 1ZEMA 2IZ0A 2QRKA 4CM7A 3OEYA 5GZ3A 1EMDA 1P77A 3U9LA 1U3WA 2W2KA 2NQTA 1NFRA 2CDAA 3G0OA 5CDSA 1HKUA 2IYPA 3E1KA 4WOKA 2P2SA 3EYWA 3H9QA 4PG8A 4NK5A 2B83A 4JJIA 3IAHA 5BSEA 5KKCA 1IPEA 1DC4A 1KEPA 1OC2A 3F1LA 2HO5A 3ZNOA 3VVCA 3GUCA 2H1SA 2Y0CA 1X7DA 1E3EA 3QQPA 4NR0A 2ZJ0A 4L73A 3Q9NA 2SCUA 4FDAA 2QIOA 4OM8A 4J1SA 1X7HA 1ZJZA 3QY9A 5COQA 3UGKA 4TZTA 1YQGA 4RDHA 4UULA 4E30A 1GUZA 4AJOA 3G49A 5FWNA 3ZI0A 5JLAA 2BFPA 1CRWG 5A05A 2P68A 3ITDA 3JQGB 1NFFA 2FSSA 2D8AA 4R9RA 4XGNA 5DBIA 5JDIC 4FSHA 3EUWA 1UH5A 1F12A 1MC5A 5F5LA 3A06A 3R3JA 4EDFA 1EUCA 3VH4A 3FHLA 4IQGA 3I1JA 4UUPA 1J49A 3WGTA 3E5RA 3IDSA 4YVFA 2JAPA 1XG5A 1W73A 1VKOA 3R3SA 3PJFA 2VUTA 3ZWPA 5L7TA 4Y9DA 2NVWA 3AJRA 3CPSA 5IDQA 1HDYA 2JHFA 3NTQA 3MJCA 4PZDA 4II2A 3ZV6A 3OJ0A 5JAZA 3JQBA 1I0ZA 4D3DA 4ND5A 1IYZA 3D4PA 4RVHA 5ILOA 1LRKA 4RVFA 2Q2WA 1NYTA 2NVUA 2UUPA 3RJ5A 1YVEI 3L9WA 5AQ1A 1NNUA 2HKIA 1WWKA 1ZUD1 4BNMA 4RF2A 4IGFA 1C3VA 1ISJA 2PFGA 1DJNA 2VN8A 4G5HA 3UF0A 3S2GA 1NX6A 2FY8A 3DAPA 2P91A 5MGBA 4JX8A 4P38A 2ZB4A 5A3VA 3KHUA 3UKOA 1HDZA 4E31A 3W4JA 2OMEA 2NSDA 3FNFA 3RROA 5L4SA 4QX6A 4OXKA 3P2OA 1GQ2A 4U7WA 1C14A 5CAEA 2HCTA 2UV8A 5J23A 5DCWA 3STHA 4RLSA 1NHWA 1E3IA 3NAQA 1E1MA 2I6TA 4MDHA 1HZZA 1MLDA 4J7UA 5ER6A 3WLEA 1NR1A 4ZQBA 3F5SA 5U1PA 1I10A 1X15A 5F3RA 2LDXA 2R00A 4JBIA 5KKAA 3ZHXA 1GCUA 4EI2A 3GZNA 4PVCA 4MOWA 5GZ6A 3VPFA 4JK3A 2JD2A 3I9KA 3QJ5A 1Z7BA 4JXKA 3W8FA 4QT0A 4OHUA 1WZIA 1PTJA 3OP4A 5I8ZA 4E2ZA 2NVBA 1IULA 3OJLA 1JVSA 4PLGA 5B4UA 2Y1CA 2ZYAA 3PQEA 3EK2A 1BWSA 2J5QA 3WTBA 1H9AA 5I8WA 2QG4A 5G0UA 2NUAA 1WAMA 3K96A 1PIWA 3VKVA 2V7PA 3NGXA 1LBEA 3RBVA 4PZEA 3W6ZA 1UDAA 2OOSA 3BMOA 3C3XA 4OXYA 2CVQA 4H7PA 2JHGA 3IC5A 3HZZA 1WPQA 3QIVA 5KWEA 1YDEA 4E5KA 4KDEA 3KYCB 3GRPA 3WJAA 3AY3A 1KC3A 1JDJA 1S6YA 3PQDA 3VVBA 2EG9A 4W7IA 4FFNA 4WKGA 3PHHA 3H2SA 3PI7A 2C07A 4BKRA 1EK6A 4XJSA 3FI9A 5ADHA 1P1IA 2NU8A 3ZWNA 5G4KA 4XCVA 3WSWA 3MTJA 3NDIA 1NHGA 2C2XA 3KXDA 3NDRA 1GV1A 4J49A 1BXGB 4BNNA 4CM4A 2DTXA 4MVJF 4ESOA 3RC7A 1LJ8A 2YV1A 1Z73A 3JQCA 2XAAA 3MJVA 1O5IA 3OECA 2TMDA 3KYBA 3M2PA 4BKPA 3CXRA 5AOVA 3RU7A 3E5MA 4PZCA 4A03A 1BGVA 4LGVA 2CZCA 3F47A 5JNLA 2GPTA 1ZW1A 5JDCC 1G0OA 1PZHA 1I2ZA 1Y6JA 3DMTC 4M54A 2X5OA 1L7DA 3DBHA 3H3FA 1R16A 4QEDA 2NADA 2NTJA 1XQ1A 4YPOA 5CHEA 3D3WB 3VDQA 2FWMX 2AG5A 5KJEA 1K5HA 3MJTA 4WLFA 1KS9A 4GAEA 1NVGA 1U3UA 1WP4A 2PD6A 3FWNA 5TNXA 3UW3A 4B4OA 2FPGA 2XPCA 3IL2A 3KTDA 2AG8A 3W4KA 2HMSA 2WYVA 4Y67A 1ISFA 1WDMA 2YDXA 2J3KA 1DO8A 4BIIA 1Y9EA 1KVUA 3JQDA 1DFHA 1G0NA 1NXQA 1KVSA 5KJCA 1SMKA 1DBVO 2WDZA 4O1MA 4L9RA 4MKRA 4GQAA 5AXAA 3U4HA 2EW2A 1GZ4A 2NU9A 4BV9A 3GN1A 4CR6A 1R4NA 3OJOA 1EBFA 4ZQHA 5CG1A 1Y9AA 5IDYA 1Q7GA 2P9GA 4A5OA 2FR0A 5I7VA 3ZWMA 3WMWA 4IBOA 4FR5A 3GFBA 4M89A 1LSJA 3FBGA 4BGIA 5A06A 4DBZA 3DB2A 1WVGA 3L6EA 4NMHA 5JFOA 3JYLA 1DFIA 4DQVA 3RFVA 5HWSA 2Y66A 1PQWA 1H0KA 2X0RA 4CR8A 4CLRB 1IHXA 4HY3A 5GMOA 5L53A 3GUYA 5A9SA 3G17A 3RUFA 2PD4A 3HDQA 1O89A 2AXQA 1A4IA 1Z6ZA 3RAJA 3EZYA 3HDYA 2O3TA 3PZBA 3T4EA 4OOEA 4BNJA 3KEQA 3LT0A 3MJEA 1I32A 1NWCA 3MWEB 4NHEA 1Q0LA 1UZLA 1LI4A 1Y8RB 1DDOA 1LC0A 2O3QA 4Z3DA 4RL6A 3AFMA 4ZQFA 4DC1A 3QWIA 1BRMA 1PJCA 5DCYA 1BG6A 2VCYA 2ZYGA 4E12A 3R6DA 1P0FA 3KRTA 1J6UA 1AXEA 1KVRA 4P22A 1TT5B 3GH3A 3ZNQA 4B7XA 1KVQA 3HUDA 2QYTA 2OFPA 2QZ9A 1A72A 1ZCJA 3BMQA 4DYVA 1UUFA 1MX3A 2O2YA 4LMPA 2O50A 2VOEA 4O59O 1V35A 3ASVA 1D3AA 3BIOA 1ZK3A 3QRWA 4ZRMA 4AJ1A 1M75A 2PKQO 3ROKA 3KYDA 2O7QA 1QLHA 2YJZA 4DPLA 1GEGA 1UP6A 5BR7A 1HL3A 3D1LA 4J9VA 3WTCA 3AUAA 1VJTA 3RBZA 5JS6A 4GGOA 2CUKA 2Y93A 1KIFA 3E18A 3WGGA 3Q3CA 4J91A 4LW8A 4R1UA 2BGKA 4NJMB 1ISGA 2W2LD 3AUSA 1YH3A 4DQXA 4B4VA 2Y05A 3LDHA 1DAOA 4XB2A 2W2LA 3GRKA 2B37A 1DIBA 4NFYA 2WYUA 1KY5A 3COSA 3M1AA 2IEDA 4ND3A 4WLVA 3I4FA 5A5FA 4WLNA 2PZJA 4CQLB 2D4AA 1P1KA 5AXBA 2PGJA 5C3MA 3TZHA 2PKQP 1HEUA 3GPIA 4BNGA 1EE2A 4UVDA 1I36A 2QRJA 3HN7A 4YB8A 3ICCA 3B1KA 4FCCA 3D3EA 3HADA 5EINA 5A1TA 2Y0EA 4L74A 3CE6A 1HSZA 1ZK1A 1OZAA 1MFPA 3JQBC 3GLQA 4BUCA 4Z9XA 5CEEA 2WM3A 4TRRA 4B3HA 1UR5A 3U4IA 5ICSA 4BGVA 2BMAA 1HE3A 4ZD6A 2ZIZA 1CYDA 4BO7A 4OXNA 1TXGA 1S7CA 1B15A 1AN9A 4BO6A 3BTVA 4BKQA 4WNCA 3E9MA 4XGKA 2ZTVA 4WE3A 1TT7A 3OMLA 1YOVB 4E2YA 3QLJA 3S2IA 1O8CA 3TQHA 2RCYA 3OETA 4DC0A 1E5QA 4N5LA 3GK3A 3F1KA 4I9NA 3PIIA 1FDVA 3IUSA 3AI3A 1HDCA 3HDHA 4ZQEA 1E7SA 3DEYX 5KJFA 5BSGA 2HJRA 3H9UA 1HSOA 1PL8A 3DZFA 2BKAA 4E33A 3FRJA 1ONNA 2R00C 4R3NA 1NPYA 4XYBA 1B7GO 4D3FA 2JCYA 1E6UA 3GA0A 1F14A 3BMCA 5H81A 5JBIA 3V1YA 5BQFA 1ISHA 2XOXA 4URFA 2DTDA 4XIYA 3QHAA 2G5CA 1PWXA 3OIDA 3ZWCA 2VUSA 4OKIA 2FP4A 3WYCA 2ZCUA 3FWZA 3MOIA 2RHRA 4HKTA 3ROMA 4CMGA 4CUKA 4PLZA 5A9TA 1JKFA 1I3LA 3GF4A 1Y5MA 4DWVA 1A5ZA 2WD8A 3ANNA 4O63O 4DTIA 2NTVA 5JAIA 1PL6A 1E7RA 4WUVA 3IMFA 2E48A 1U8XX 2TMGA 5DP2A 4UEJA 4M55A 3E82A 5AXCA 4BNYA 1XDWA 1KY4A 4HBGA 3DFUA 4S1VA 2EERA 2X8LA 1EE9A 1LTHR 3E8XA 1CQJA 1KBZA 2BELA 1XEAA 3HB4X 4YQZA 1ZJYA 2DBQA 1HE5A 2GYYA 5DP1A 3RC2A 3ZNNA 4BNZA 4CMIA 1VJ1A 2ZQYA 3LK7A 1EVIA 3VZQA 1U2DA 5K6AA 4IDAA 3VDRA 4BVAA 4CMEA 1Q7BA 1C0KA 2EWMA 5G2OA 3RU9A 2D1YA 2GDZA 1BW9A 2WTBA 5CEFA 4ZVVA 2Z95A 4MKXA 3EZLA 4BNKA 3JD0A 4ID9A 4R41A 3ETGA 5TF4A 1N92A 3PLNA 3ENKA 4H3VA 1X13A 4W4TA 4UVIA 1B8PA 4HV4A 5I9LA 2OGUA 2QRLA 3S8MA 4GBJA 1UDCA 2I76A 1K3TA 2YYYA 2I67A 3GG2A 2W90A 1MC4A 3KLMX 3WGHA 4DMLA 4QUKA 4E0BA 4CM3A 2P5YA 3OIGA 1DIRA 1SCUA 2J6IA 3RSHA 5AYVA 3DQPA 1YO6A 3GQVA 3E9NA 3U4CA 4NIMA 5EMHA 4Y8VA 4EGFA 5TT0A 4ZU3A 1DIHA 4PVDA 3ABIA 3AI1A 4FJ0A 5JO9A 1P9LA 2W98A 5IN5A 1GADO 1TLTA 2JAHA 3ETDA 4B3JA 1TEHA 2B35A 3RC9A 4MVJG 1LUAA 2GO1A 1DC3A 3EGOA 3I3OA 3TFQA 4BS9A 2PWZA 5JXWA 2ZATA 5FI3A 5F1OA 3O03A 4I5EA 4N5MA 1QORA 2UAGA 2WD7B 3ADOA 3TOXA 3DBVO 4YYZA 3WNQA 4M87A 4UEOA 1V0JA 3OF2A 1K6IA 2HRZA 4FGSA 2HSDA 3JSAA 3WQQA 4WCDA 1O9BA 3RKRA 1ENPA 3K2BA 4XYMA 3GZ4A 4GI2A 4XZ3A 3QVSA 5TGDA 1NBOA 5L4LA 3SEFA 3U09A 7ADHA 3QVWA 4MP3A 1WW8A 4AJPA 5A03A 1HF3A 1QYCA 1K2WA 2JCVA 3D4NA 5JMWA 2C7GA 5CDTA 1LQTA 4EBFA 3B6ZA 3NUGA 3AM3A 4NFHA 4HUJA 4BQRA 1CDOA 2X6TA 2ZKLA 1J4AA 3DONA 1Y7TA 2X23A 1AXGA 2GD1O 4WECA 4UVGA 4AJ4A 2VZ0A 4WCFB 5DDIP 3TWOA 2GR9A 4PG5A 1FDUA 1GPDG 2EHDA 3G3EA 4NH4A 4CL3A 1BTOA 2NV6A 4E5PA 3S2FA 4LVUA 3ZH2A 3WBBA 1MA0A 3UVEA 4JGBA 3OFSA 2P4QA 4YXFA 4GWGA 3RKUA 4O6VA 1ZH8A 3T7CA 4GSKA 3ETEA 3FTNA 1I01A 3ENNA 2C5AA 2BI7A 2YHIA 4B8WA 1N5DA 4RORA 3P7MA 2A9FA 2PKRA 2EW8A 4YJHB 1Y8RA 4ND1A 3GVCA 1VSUA 3NX4A 1K6XA 3WWZA 4Q3DA 1JLLA 4R5HA 3RCBA 4OIMA 4E21A 5B1YA 1LLQA 5LDHA 1ZMTA 2Y1DA 3QWHA 5B37A 4A0SA 4IDCA 1BXZA 5JE8A 2B69A 1WMBA 3DC2A 3HHPA 1E7WA 1HLDA 1GR0A 3AWDA 3L77A 3PGXA 4QSMA 1EDOA 3KV3O 1HWYA 1PGQA 4FN4A 4YRDA 5ENVA 1NR7A 3VAZA 2CY0A 1LC3A 3CMCO 4IMPA 3NGLA 2G0TA 1E77A 5ES3A 2DLDA 4BMSA 3GG9A 2YFHA 8ADHA 5JY1A 4CQMB 3INRA 1YL6A 1LRJA 5JYEA 3ICPA 3ZWOA 4LSMA 2QW8A 2E49A 2OZPA 2BFAA 4DIFA 4A2CA 3V1TC 2VHWA 3D0OA 3IQDB 3IUPA 2DPGA 3KZVA 4FGWA 1R4MA 1K89A 2Q2VA 1PZGA 3DHNA 4J90A 5EERA 2J3JA 4GX0A 1DC5A 4CLEA 2HMVA 2X58A 2P9EA 2EGHA 3Q9UA 1XWFA 5A02A 4WASA 4MVJE 3DMYA 5DULA 2Z1NA 3I9NA 3UXYA 1YGYA 4QO7A 4MVJM 5JC8A 2DFDA 2DM6A 3S55A 4LMRA 4EEXA 5JPIA 3SX2A 1KEVA 1SOVA 2HK9A 1RKXA 3DBRB 1LU9A 2JJYA 4KQXA 3QVXA 1WNTA 4DYDA 1LX6A 2DC1A 5FYDA 1LDNA 1VE9A 4WLUA 4NU5A 3EVTA 2YQ4A 2BI8A 3PVZA 5JSFA 3QP9A 1X0VA 3QE3A 4RPKA 4YT5A 3PPIA 1U5AA 1RWBA 1KEWA 3I52A 5I7SA 2DFVA 1B26A 3CIFA 4R68A 4DLLA 4EITA 2G82A 1PEDA 4J0FA 4TKMA 4AJIA 1DRUA 3TNLA 4CUJA 1EBUA 1YQDA 4L4SA 3E03A 2G76A 1B14A 4NBVA 4PLWA 4S3MA 4ALNA 5KNLA 1MP0A 1RM4A 3FNGA 4GWKA 2GSDA 4J43A 2HRBA 1GZ6A 2IRWA 3ORFA 3ZV3A 5JCJD 1YB4A 3LT4A 3TL3A 1PJTA 1ADBA 4IJKA 4ALKA 4EJ6A 4IIUA 4RV9A 1QR6A 5TRTA 1IB6A 1QYVA 3O8QA 1ZXLA 4EUHA 5JCJA 1ULSA 2O3SA 4EJ0A 2EXXA 1IZ9A 5F1KA 2X1HA 4LK3A 4FFMA 4P8RA 2O4UX 2FOIA 4FFLA 2V6FA 4B4WA 1RYDA 2X0IA 2OORA 1H2BA 3A28A 3WXBA 3C7DB 1FJHA 2Q3EA 3GFGA 3GOHA 5CPFA 3WNVA 4MO2A 3KSZO 2I5PO 2O3JA 2Q45A 4Q39A 4XIJA 1Q2XA 1D1SA 3B1JA 3PJDA 1GEEA 4J2HA 5G0SA 1X0XA 4CV1A 2X0JA 3U5TA 1Y8QA 4CLXA 2HDHA 2JL1A 5TQVA 2HK7A 3M6IA 1BDBA 2GZ3A 4K26A 3QSGA 4R4JA 1W6UA 1VI2A 1Z7EA 1GAEO 4PG7A 1DHTA 1JTVA 3TJRA 4P4GA 1SO8A 1YBAA 1U3VA 3QW2A 4BNTA 1IPFA 3SBOA 3AM5A 2DKNA 1B0AA 4IUYA 4XDZA 1IZ0A 1JKJA 1YJQA 1NQTA 1HXHA 1UXIA 4OQZA 1NP3A 1BSVA 4J1NA 1YB5A 1E6WA 4J2OA 3GT0A 3Q1LA 4HP8A 4CM9D 4IDFA 4CM8A 5I7EA 1SBYA 2PGDA 3G1UA 2JKVA 4U6QA 4ZRNA 1G1AA 4IY1A 4D0RA 5T67A 2Y1OA 4FB5A 1F17A 4CM9A 1JVBA 1Z45A 4ZICA 4U6SA 4MINA 1GU7A 2DBZA 4PLPA 4QO8A 2RIRA 3NTOA 2E82A 4D45A 1JW9B 4EJMA 5K6AC 4CMEC 3RUCA 3ST7A 3K92A 3UHAA 2Y68A 2VQ3A 4ILKA 4GKVA 3JQ7B 4YT8A 1R0LA 3IJRA 4Y6PA 3JQAB 1Z74A 2DU8A 2B5WA 2RH4A 3JQ8A 1N8KA 4DGSA 1I8TA 1E3JA 1E7YA 4ZQGA 2GUGA 4WPGA 1H6BA 5L51A 3W1VA 1U5CA 3ON5A 4O0LA 3JYPA 3RQSA 4J9UE 3BTOA 3INTA 1A27A 1GFSA 1UJMA 1RYEA 4NBUA 4WLEA 3AW9A 1UZNA 4JLWA 1PJSA 4NPCA 4WGGA 3BMNB 3L07A 1GPJA 1RM5A 3I6QA 5DN9A 1A71A 5THKA 2FR1A 1U3TA 1C1XB 4CV2A 3KO8A 4LN1A 2WYWA 4YBZA 5H82A 4Z6KA 3OA0A 2EJVA 4KOAA 2JD0A 2O2SA 4HFMA 3QV1A 4PLCA 1N9GA 4CUZA 3OJEA 4BNFA 2B5VA 3JCZA 5COAA 1GYRA 3PXXA 1J0XO 1JAYA 3JQ9A 3NT5A 5C7LO 4ZHSA 5A4DA 1B8VA 1TI7A 1X7GA 3WQRA 1PGOA 2YFQA 3RASA 2C5EA 1WMAA 4PFJA 1C1DB 1HDGO 4N18A 4RDIA 1EK5A 5TS3A 5KOIA 1YBMA 4ALIA 1U9JA 3UUWA 2EGGA 1E3SA 2GN8A 2VNAA 4YJGA 4BMVA 3F4LA 4Q3BA 3D5TA 5C7IO 4Y6RA 1VKNA 3TRIA 5JAQA 3WLFA 5CFZA 1NQOA 2DT5A 3I83A 4IXWA 3WGZA 3ZW8A 3RFTA 5TX7A 4NNJA 1QYXA 4E6PA 4NBTA 1PJ3A 1KOLA 3ZHBA 3JD1A 3I6IA 1GV0A 5DBFA 2I65A 4IQ8A 3QWAA 1F8FA 1B16A 1J5PA 4NZ9A 5JAMA 2OP1A 3F5QA 5T57A 4Z9YA 1XKQA 1AHIA 3WFJA 3UCXA 2I9PA 3PWSA 4I9HA 1ENYA 3BTUA 1WDLA 3O4RA 3ZHZA 1E1NA 3ZWWA 4A26A 4JP3A 5IZCA 5JCXA 1E1LA 4TRMA 3H6KA 3WGQA 2IDZA 1GQYA 1CERA 3FR7A 4OYRA 3E6AA 4XR9A 3ZU3A 2HLPA 4WK6A 2GASA 2CVOA 2NQ8A 2GF2A 1DAPA 1ZMOA 3KETA 4WLOA 3FF4A 1KC1A 3ANLA 3L6OO 5A5EA 2FPPA 4J4TA 1F0YA 2X4GA 3HN2A 4FOOA 5TC4A 5FI5A 2A35A 5BT9A 1DXYA 4R16A 5I7FA 1AGNA 4UVHA 1QXSA 2P4HX 3HFGA 3BHMA 3GEDA 2VWGA 4BKOA 4RPGA 5CEJA 2QYSA 1VPDA 4NBRA 4B7UA 2HMWA 3RWBA 2BH9A 3DOJA 5C37A 3VOSA 3HDJA 1KYQA 4EYEA 2WE8A 4MP8A 3INGA 3MOGA 1P1FA 1VSVA 4XRRA 4YJFB 4CMHA 4J1QA 1EFLA 4AICA 2CDCA 5K0ZA 2X9NA 4RLHA 4F3YA 4XWYA 2BGLA 3DBLA 4Q3AA 1VLLA 3L9XA 4YJHA 2W2KB 3GMDA 3W8EA 4CLOA 1XCBA 2EKLA 4OH1A 1PR9A 3U4DA 2VWHA 2V6GA 3WFIA 4CV3A 3JV7A 3NT2A 5F21A 3NYWA 1H6AA 1CJCA 1LA2A 4TRNA 4D3SA 3X2EA 4IXTA 4F45A 3K9QO 4AG3A 5DT9A 1JWAB 3GAFA 4FFRA 1R0SA 4KQWA 5LC1A 4PRLA 3FNEA 2AE2A 1H94A 3C1AA 4G81A 4PLTA 3H4VA 2YDYA 1QYDA 1G6KA 4GMFA 4YAKA 3DL2A 3LT2A 4UUOA 2ZB3A 4ALMA 3R0IA 5FEUA 1N1EA 2POQX 3H9JA 3SLGA 2VTDA 1R66A 3G1TA 5KCZA 1SNYA 3JQGA 5JW6A 1U8FO 1ZNQO 4R54A 4N7RA 3OIFA 2D59A 2Q49A 4U8GA 3H7AA 3SXPA 5CDYA 3PTZA 4JQCA 4DIBA 1EVJA 4KUGA 3PIDA 4CMCA 5L7YA 4MVJD 4XA8A 1O6ZA 2GN4A 1E92A 2NVUB 1K6JA 1SPXA 3DBRA 3TDKA 3Q11A 2V65A 4C7KA 3WG9A 4ZA2A 5BNFA 2BFOA 5KIAA 4PLHA 4U5QA 4MVJA 1LDBA 4OMUA 4UREA 3C1TA 2UUOA 3RUAA 3GVIA 4WJZA 3DZHA 2RHCA 5L4NA 3KUXA 4OSOA 3VC7A 4E32A 3GMSA 4GL4A 2AHRA 3HSKA 3AOEA 3JYQA 2NU6A 1K0UA 1ZZEA 4RCVA 3LF1A 2Q1SA 5GY7A 4CL8A 3EC7A 4XDYA 1EDZA 1XLTA 2FZEA 3I4CA 4FS3A 2ZK7A 1W4ZA 2CF5A 4DBVO 4EUFA 5KVVA 3U0BA 1PR3A 4RPJA 5FFFA 4AJKA 1Q7CA 4FD3A 4BO8A 2C29D 1YBVA 4JCOA 3VKUA 2WE7A 3M1LA 2GZ2A 1P45A 1UXHA 3L6DA 3B70A 3IKTA 4F6CA 1LQUA 3WYBA 4UEKA 2PA3A 3OA2A 1PGPA 5KTKA 1R6DA 1LDYA 1I30A 4JJGA 5TIIA 1IY8A 1GCOA 4BHTA 9LDTA 1ZO8A 1ZK0A 2GERA 4FIZA 2PY6A 1BVRA 4MP6A 1V6AA 1GTMA 5AXDA 3WJ7A 1NVMB 4D44A 1XELA 3CSDA 4CMKA 1QMGA 1VRWA 4BO5A 5IN4A 4L4RA 1N1GA 4I9UA 3BHIA 1YJ8A 1YE3A 4TVBA 4ALJA 1HE2A 3TFOA 2NLOA 4OSPA 4Z3KA 4XB1A 2VZ8A 3UN1A 4AVYA 1H93A 4B8ZA 3PDJA 5L95A 3A14A 3KB6A 3L4SO 1TA4A 1H9BA 2C59A 2OXIA 2EP7A 3BMOB 2AEJA 2VOJA 4KWHA 3DWFA 3KVOA
chains in the Genus database with same CATH superfamily
4J94A 1UXKA 5LYJB 4AN1A 4IWYA 1GUFA 4PGMA 3GJ4A 1JI0A 4OHKA 2VDNB 2HH9A 3RIGA 4GM1A 4A82A 3QSYA 2I2WA 4IIHA 2R7MA 4WA8A 1I3MA 4WT7A 2WYHA 3GT4A 3SR4A 1YONA 4LXIA 3PVCA 3U4QB 2NM0A 3CRW1 5J5AA 3T7IA 5CNIA 1SUCA 4CMBA 1U0SY 3H3JA 1Q0PA 2ZUCA 3C5CA 1E99A 4F8JA 2YWCA 1HDXA 5G4KB 4TM7A 4GNRA 4YX9A 1NI4A 2AI2A 4PICA 1IUPA 3AT1A 3KEMA 3NM5A 5AI0A 4DCUA 1AMUA 2BGUA 3LLSA 3KBOA 3O74A 2XA9A 1I4OA 2D7JA 1CDDA 1LJLA 4FFDA 5J1SB 2VHYA 1SB9A 4IDOA 1RJWA 1S4MA 1TOAA 1TMGE 3DVAB 1VC2A 5CA1A 2YN0A 4HVTA 2H4XA 4Q1AA 3FNHA 2JBWA 4ETMA 3Q98A 4B81A 4PGFA 1OROA 3EIXA 2Z2ZA 5CFOA 5JVDB 2XCTB 2A9PA 2XHZA 3PGKA 4KKVA 1LEHA 1CJSA 1SULA 2AOTA 2XVMA 4U9IS 4ZZ1A 5JFGA 4MNTA 5CP8A 2XYHA 2FMFA 1AQUA 5FO0A 4L50A 5MGNA 3QF4A 4LWZA 1VJCA 2QL5A 4QG3A 4I1YA 1AUPA 3OOJA 2ZBQA 1BJRE 3DBHB 4L2IA 1AMNA 5BPFA 2YOFA 3BA6A 2FUNB 1A50B 1IOLA 1C8BA 1Z75A 2O7RA 3EJ6A 4FGLA 4Y6QA 2C9BA 3EGXB 3ZDQA 4LCBA 1ADGA 3OEHD 2I4LA 3AR7A 5E4TA 4BWGA 2JGKA 4R1MA 5DM70 4MV1A 2PBZA 1JBQA 2BEVB 3VR5D 2JIPA 2GCOA 3CLTC 3OKAA 3C4JA 4IHJA 1J2UA 4QPCA 5DEIA 3ROQA 2JFPA 4H6VA 4D9BA 4C0WA 4ACBA 1VKHA 4R0MA 2R79A 3W5CA 1RI2A 4LF9B 1JHYA 4BX2A 2JKZA 2FETA 2N0SA 1T34A 3K8QA 1VRVA 3OPXA 1WKVA 3LIPA 3N58A 4HWRA 5U4XA 3RRBA 3ZGYA 5EWMB 3Q8XB 1OWLA 3KE9A 4NJEA 1LW7A 1XGKA 3PCXA 3JQ9C 5AM1A 4DQDA 4CKXA 5LQRA 1N7HA 4TROA 3ZY6A 2PWPA 4XWAA 4FOPA 5AUQA 2DFNA 1FDIA 1XCMA 3ANYB 5E7IA 4KFRA 5SY6A 5A4MS 1U9IA 3EISA 3FGOA 2FN3A 2VJNA 3CURA 1P33A 5BV0A 4CIAA 4MIEA 4JGIA 5IDWA 2R2AA 4TYYA 1G60A 4U9HS 2D00A 3EG9A 3S7TA 1YVUA 2PSEA 1EFRD 3IVCA 4CVNA 4LQLA 3RANA 1GPMA 1XZPA 3ZWVA 4WSOA 2QW0X 5HP4A 2YV2A 2UZ0A 3PD1A 5KTOA 5ECGC 3R5FA 3RSCA 1L9XA 3WMXA 5HRUA 1IBRA 1R9GA 1S4QA 3HP7A 4YWHA 5JZVA 3RUHA 4CJXA 1P39A 4L08A 4B40A 2ODPA 3QLVC 5HE9A 3I5AA 3LVFO 2FMKA 1XV5A 1ZK2A 2CNWD 4AN4A 2RBEA 4LCEA 3UK6A 2UUCB 4B4UA 1THGA 2E1RA 5K01A 4TUYB 1FYFA 5KX5B 2VJKA 4IH1A 3PFBA 5IZCC 4ZZIA 1EQUA 3DEKA 1P5ZB 2EKZA 3WWEA 3R7NA 4RO0A 1BCRA 1AD2A 3FA2A 3LLUA 5LUBA 1ONBA 3I9V6 1S96A 2VSNA 1X1TA 3A4NA 2KJQA 3D0RA 2JD1A 3S44A 4DHWA 4REQB 4YCCA 4RAQA 2Y1XA 2XNDD 2NMVA 3LGSA 3QEOA 2RKOA 5F76A 1A9OA 2IDJA 3CPHA 4W82A 2WSIA 3IT0A 3JQPA 4X3PA 4DLBA 1KRXA 1T13A 4J6FA 4KMSA 3H7IA 4MAFA 4MJLA 3ZZNA 1MOQA 2VK1A 3BWDD 4LF7B 5H1YA 4O4LB 2OD2A 1G6HA 1DKPA 1VG1A 2CCGA 2J3IA 5ILGA 4YT4A 2E4UA 4CPDA 1OC4A 2QRZA 4XYEA 1EIWA 3ODPA 1RTTA 4KMRA 3AK4A 4Z4QA 3CGGA 3KTOA 1SHZA 1LLCA 2E7ZA 2IYZA 2WJPA 2XMPA 3FN4A 3QITA 4R98A 4TSRA 4KR2A 5ELXA 4HQKA 4TS3A 5DSTA 2HSWA 5AHKA 4J4HA 2QTVA 4XQCA 2GZMA 2I3AA 4ZDWA 4YRAA 1YA6A 3FGPA 1JA0A 3BMQB 3EULA 4B80A 2EQ5A 3V2GA 3WICA 4EUKA 3R1IA 2AFHE 1TT5A 3CQ9A 3QWBA 2WMNB 4XQGA 5P8WA 4ES6A 5LL6P 2VHVA 2VJAA 3REQA 4AMZA 2OZEA 3T15A 1WUYA 3I32A 3LX5A 2G80A 2VT3A 4LTDA 1HORA 2WZBA 1A5BB 1EFPA 1NLMA 2A58A 3KD3A 2O57A 5JCOA 2F8SA 2I7DA 2J9YB 3ZKAA 2Q3LA 5D86A 3BXGA 3GJRA 3KPJA 4J7XA 4E1AA 2ZUUA 3C7AA 3TSAA 3VU3A 4LWOA 4X1IB 4E2WA 2WTNA 3AY6A 1AXRA 2QKYA 3P9RA 2MT9A 3G2HA 3DEHA 4QGHA 1O3YA 2ZLBA 2HA5A 5DZSA 1A5AB 3C3BA 4RMIA 2C4KA 2XB8A 3PEFA 3DQZA 4RPCA 4TLLB 1RU3A 1VYUA 5FIUA 5EZYB 3U40A 2Q8NA 5ALFA 3CEHA 4GHWA 3OLXA 1CS0B 3JVIA 5L3QB 3R7SA 2UDPA 1QIEA 1U0BB 4TVSA 5JEEA 1P74A 2WWYA 4FLMA 4Z7NB 1CIVA 2R9VA 3W5VA 4TVOA 4BMYA 3CNNA 3OZRA 4L85A 4HH1A 4N5DA 1I6MA 3LXRA 5IRCD 1HRDA 3N2EA 3RVOA 5KTMA 1SKUA 4PHCA 5ITWA 2ZJFA 2QXTA 3CR7A 1G8KA 4NYMR 1LNQA 4DJDC 4DV6B 1L4MA 1C9DB 1DRKA 3JXEA 4TVKA 4OK6A 4FBLA 1RXCA 1TUBA 1U2QA 4DMGA 5KS2A 1WSWA 2CL0X 5IG2A 2W6MA 3V1UA 3JZFA 4P86A 1QS0B 2ZBPA 3L1UA 4BO9A 2EF0A 1JR6A 3LX6A 4WAUA 5JCPA 3N87A 2JK1A 1KI9A 1SXJA 1WBBA 5FD8A 4C0KA 4IDBA 3CR3C 3MHPA 3ESXA 4I5FA 4RFVA 3BYZA 1BS1A 4RMHA 3K6SA 1GIAA 3FTFA 5FV7A 3JWJA 3K8ZA 3TDMA 1WEKA 5EN4A 1UBRS 3HFJA 4BGEA 4TV8B 3T8YA 1QAOA 3TNDA 3B48A 3ZDFA 3PJEA 1ZG3A 2BV3A 2HREA 3F7NA 3PHJA 4X44A 1KZGB 3DKKA 3S70A 3PC7A 1GPKA 1PS8A 3P2IA 4IZ6A 3IIEA 2Q6OA 1DB3A 4X5OA 2V7QA 5JD3A 1MTZA 2GPJA 3UUEA 1BO6A 4J16A 4DA4A 3HWX1 3DDCA 1A1VA 5DK4A 1S9HA 2QOEA 5DO9A 5CXQA 2J07A 1XLTC 1ZSYA 1D4FA 2EEZA 1NJFA 4FOLA 1IXYA 4BRSA 2WSSA 3ZN2A 1Q3KA 3NJRA 4NAUA 4AXXA 1ZC3A 2JFHA 2QLLA 2R8EA 2Z4SA 4YCBA 5LIPA 4ARVA 2YZNA 1RI4A 3SE0A 2QZ4A 3ES9A 3UG6A 4A7PA 2V7TA 3E9QA 4E13A 4YDHB 2GZ1A 1O0SA 2PUBA 1UAYA 2DPMA 1FVFA 2I8AA 3TQIA 4HX2A 1E8MA 3DL4A 1M67A 5K4AA 5HIJA 5KAMA 4DMUB 2FK7A 4D0SA 1OYWA 3DXZA 2UZ3A 1N6RA 2YXLA 2DFKB 3H9BA 4W8HA 4DOMA 4N39A 4B3TB 3GDHA 3TKAA 4AMYA 2OKGA 2ZT8A 4GU5A 2IITA 2Z3VA 2BN4A 2CFOA 3A04A 4WKCA 1OH5A 3EGCA 2G07A 1NY5A 4ZOCA 3BCUA 2CFRA 1NUSA 2R87A 1V8BA 3BMCB 3M5WA 3PUIA 1SQFA 2Y6VA 3B9BA 2ZI6A 2OGSA 3EGDB 3HUEA 1FLDA 4L78A 1PFQA 3AWIA 3KJGA 4V1CI 2BH2A 3LX4A 4YS6A 4M7OA 2C9YA 1M2FA 1C7QA 1VHTA 2WZQA 1H6DA 2VDPB 4H4EA 3QEAZ 3KE8A 4G8BA 3DXFA 4YJ3F 5HMMA 1Z5GA 2DT8A 1CRZA 4Z0TA 1QPZA 3HO1A 2H7CA 2RH5A 1L5HB 3EXIA 2EF1A 4Q3KA 3W3AD 4DLWA 1I7DA 2XCQA 1XDSA 3OTWA 2YICA 1QFSA 2YC2C 3UMRA 3W3ZB 1K9SA 2AYYA 2BF7A 2XGOA 3ETJA 4RYDA 3KFXA 4Y1GA 2ZAMA 2HJ9A 4P53A 2QX7A 4C03A 3LHDA 4C89A 2G17A 4CV0A 2VBGA 3L8CA 3X1ZA 4BDTA 2MYUA 3CVYA 4BP9A 3TB4A 2XDQA 3ZV5A 1D2RA 2F7SA 1GRVA 3COYA 2C4VA 3P5SA 2BEWB 5F5XA 1MV5A 3IVMA 1F6WA 3LC1O 4JLJA 4N8EA 1M73E 4Q1BA 3S2EA 4BC0A 4HT3B 5FT9A 1DCMA 2ZWVA 3WHLA 5KSYA 2HMUA 3CA8A 5KQSA 2HFKA 4BASA 3DXYA 4PM4A 4Z1MD 2G9QA 1ZGZA 3HYCA 1MB4A 3K05A 3X1MA 4NENB 5HIAA 1CQJB 3H97A 3VFDA 3FY4A 3VR4H 4DCNA 1J8VA 1ORHA 2ZFUA 1IHYA 3T9FA 1VQ1A 4G9GA 4TV9B 4KVFA 1KEUA 3UK7A 4RS4A 1T5OA 5CPBA 4CMHA 1U4OA 1OBFO 3B7WA 4F96A 5GADl 5DX0A 3TMAA 3HNPA 2H1VA 1QLJA 1RKQA 2DPHA 5EWJA 3DE2X 3OSZA 4IV8A 4WZBB 3RK0A 4YR9A 1KZ9A 3SJCA 3ACBA 2JH8A 3F6RA 2HV8A 2QMYA 3LQFA 1G8GA 3PHIA 2V3VA 4RTJA 4WXHA 5ALKA 3PQ7A 4LJ9A 3RC3A 3STYA 1NV8A 5JZBA 2I6QA 2QEQA 5BV1A 3EZ9A 2GSWA 2EJCA 2VPXA 5IAGA 2V96A 2ZUBA 2ZITA 1HYEA 4R5MA 1U2PA 2VA8A 4PTZA 4RK0A 2YVKA 3LSYA 4EGJA 1UAGA 4LHVA 1W5BA 2GPBA 2VS1A 3HVUA 2KLHA 3RVJA 3VI3B 1PZFA 2W8ZA 2J09A 3EIHA 2DB3A 2OHFA 2HMTA 3O9ZA 5ETJA 1YR3A 5F1YA 1QTIA 4UNPA 1SCUB 1SCIA 3UT5B 2IWHA 1N7GA 2GKOA 6CHYA 1M34B 1HDOA 3ZZ1A 4IJ5A 4LI3X 4X6LA 2GMWA 3DZKA 4TSKA 5F7OA 4BFXA 1NM5C 4MUFA 1M2JA 1E2UA 1D7OA 1TCUA 3AO0B 3R0ZA 4HXFB 5IDVA 2Z98A 1VJRA 4M0UA 1KZHA 3OM9A 4YAOA 3LUBA 1KDZA 5HQTA 1OBHA 1V7CA 4U0KA 4F9GA 3FE2A 4PGHA 3ZXIA 3ETCA 3UMCA 5BUCA 4LXYA 4CKBA 1YRYE 3JQEA 3QJGA 1XHLA 3GT3A 3U62A 4CT0A 5K3EA 3AHEA 1RYNA 2WQZA 5EIXA 5EIWA 2VRCD 5ADVA 4ZVOA 3HBNA 4AAYA 1O94C 2Y27A 1UZAA 1LSSA 3FETA 4MKIA 4N3NA 4Q24A 1E3WA 2WNIA 2PNFA 2XXBA 3JSXA 3KKNA 5E4YA 4YUVA 3X2FA 3NOOA 4WFQA 4GSLA 4DE5A 2PV0A 2ZBGA 4UE6A 4E5NA 1TMYA 5BP7A 2WJHA 2R62A 5EJ2A 3FPFA 1IRXA 4FSDA 1B6SA 2BZSA 2SICE 4JKOA 4F86A 5AM2A 1Q1BA 2HA6A 3RLFA 3X1WA 5BQXA 4TL8A 1FRQA 4AJ2A 3D7LA 5BWOA 1KQNA 1MUUA 4TSFA 4R01A 2BEUA 1L4HA 1YB2A 2IXAA 4F5ZA 1G2IA 1T5LA 1ZU5A 1L3CA 4EIWA 1MRNA 2FE1A 3ZW7A 3OCJA 4UCWA 4L6CA 3CF6R 3UJBA 1SZPA 3OJCA 1JRLA 4MVJI 4MVJH 2HA4A 1Z6PA 2HDNB 3SX0A 1YL5A 2EZTA 1Z5OA 1BMFD 2B99A 1TTPB 2XGMA 3TRDA 3D31A 3NV9A 1GWNA 3CNBA 3L0SA 2Y1FA 4ZYVA 4V0KA 1KJNA 3OPYA 3ZYZA 1U81A 2LWIA 3I73A 5BMVA 3U3OA 4DUGA 3EX7C 1T3HA 4E5YA 3N74A 4L8YA 5K6RA 1I5OA 3HJBA 1UPFA 1W0JD 1MQAA 3O3OB 2WT4A 5IVIA 3T5CA 2WHYA 1NBWB 3IPRA 1SD1A 4ZOLF 3ZY4A 2AN1A 2FVXA 1JU9A 3VPGA 4WCFA 2PK3A 4LRSB 2I2FA 1WXIA 3GNTA 2HWKA 2MSDB 1FMJA 2EKQA 3Q41A 5JH7F 4RABA 4MW9A 4LJAA 4N3BA 1P81A 4J76A 4UQPA 1CFZA 4OA5A 1LBIA 4Y0NA 3IKLA 3OQIB 1DKNA 1XTQA 3SZLA 2P6OA 1IJKA 4GI7A 1Z4LA 2ZI9A 1ZIDA 2V03A 3MC1A 4J1TC 4L6AA 1R12A 2X77A 5M2QA 3DHYA 2JANA 2D1SA 3R2JA 2XV1A 4ZYZA 5KC9A 1J2TA 5EXTA 3LUAA 2HF7A 1R50A 3EXEB 2G77B 1OOEA 3I2GA 3PWKA 4QBGB 4QDZA 3RTAA 3FPLA 5K0GA 4HB3A 3NAMA 1UZMA 4NU6A 4KR0A 1T9GS 1I4LD 3RK1A 5J2UA 1JDTA 1I7LA 3PX7A 3LNTA 1TEZA 2VP2A 1J56A 1UDXA 2ZYWX 1GTJ1 4WI1A 5DYGA 5JMTA 4RTOA 3VHXB 1VIVA 2ZWMA 5A6VA 1N2SA 1Q92A 2CL5A 2R6R1 2OV4A 3BCRA 3X0DA 4CR7A 3GVXA 4XDGA 1YACA 3LG2A 4YCAA 2ZVQX 4N3GA 4XYLA 5TGTA 2XOEA 3KVVA 4V2IA 3WZLA 3PFNA 1J1ZA 4QYIB 5G0WA 1TTTA 1BHO1 1G8AA 1IMOA 1QHHA 3GGJA 1OB5A 3QXCA 4PYLA 5KNBD 4AJHA 2PWYA 1MMFB 1T3TA 1S01A 1KMIY 1QHYA 3SF8A 1GTRA 3LY9A 3JASA 2HLDD 5LQDA 3E0XA 5HDBB 3VC3A 4EHBA 3OF3A 3EFOB 5KTYA 3H4MA 4OFXA 4B47A 5JCZA 1FYWA 3JD2A 4CU5A 2FEKA 1IAVA 4I08A 3WNZA 3ZVMA 1MF7A 2IGBA 5CFLA 1N6PA 1W4CA 3F3SA 4II3A 3QUAA 4R9SA 1Z15A 3MRTA 2Q4EA 1IU9A 1ENZA 1J2JA 1CHDA 2IY7A 3U81A 4LJSA 2V8BA 2QX9A 3BRCA 3VNAA 4BPRA 1Z4QA 2JVJA 2QT1A 2AIRA 2JK0A 3C3EA 3I0ZA 1RAEA 4PYQA 2HOQA 3PYXA 4D42A 3EB9A 5H8WA 1LDMA 3SR3A 4GSYA 1NVAA 1E8NA 3PP8A 2GN0A 4IM7A 2NTNA 3DCNA 1KOJA 1JR4A 2FJ0A 2PS0A 2WA1A 3FBWA 3G89A 4FCWA 4MAAA 5H3HA 4RSHA 5KVSA 2J67A 1JAXA 2IUFA 4CW7A 3LT1A 4IWNA 5J58A 3B2NA 5LD2C 3V80A 1QGAA 1GNSA 2FA9A 2GJSA 1JA9A 3VTFA 4LG1A 4DT1A 1E0SA 1PCXA 4EB6B 4INZA 4RGBA 4X90A 4OI4A 3IEVA 4YYEA 1QBKC 2ZBRA 2VQDA 3SKYA 3WGYA 4DIDA 2YWRA 4C7OA 3I2YX 4FYHA 3M4ZA 1GAXA 2B2NA 2NXEA 2A4KA 3A1DA 3WOHA 2R8PA 4G0UA 1FUIA 1T4CA 2DKOA 2PAFA 3OBIA 1RAGA 4ZZ2A 3HSSA 4Z1OA 5BV2P 5E9WA 5IFLA 5KVCA 1Q3HA 3JRNA 3HPRA 1G20E 1TGVA 1XFDA 3UQYS 3EVNA 1O7JA 4JH0A 2QV0A 2VJBA 3E22B 3KR1A 1A8PA 2Z8ZA 2F8LA 4EUNA 1NWHA 3EQ9A 3K5WA 3L0OA 3PVSA 5K1ZA 5M34A 3OQ1A 3PBKA 1T4DA 1T8UA 1OR8A 1T9DA 1I14A 1KU0A 1OI2A 1EK2A 1W5FA 3HE3A 3PITA 1UP7A 4GKBA 3WAKA 5TARA 2I2DA 1YR2A 5CW2A 4O25A 5A0TA 1WP9A 4TWBA 3AI2A 5HW0A 2NTYC 2B21A 2QUBA 3PEVA 1NMXA 3JVVA 4EZBA 2GK4A 4EFLA 1L7RA 2HJVA 3GDOA 3ZE6A 1DOHA 4KXWA 4RVSA 4KK4A 5BO5A 2ZJ2A 1J90A 1VG0B 1ZUNB 2XQGA 3JYNA 3KT8A 1DS6A 3PUZA 4FJ1A 4IZHA 4C29A 1FYXA 2Z1MA 2F00A 2AWNA 2XQKA 1IZ8A 3B6MA 3CX7A 4HNRA 4X41A 4EJSB 1AZLA 4D25A 3CWQA 1KO4A 1XLVA 1CJVC 1EQ2A 5AOCA 3OUUA 1Z07A 2JAUA 1GILA 2AC2A 5JFTA 3LOQA 3G2NA 3MVEA 5AKZA 2FPRA 3SHQA 3JTEA 3WK4A 1U1GA 2B4QA 4FIDA 1LWNA 4MWTA 3W2IA 1WB4A 1PT5A 2RC5A 5I9IA 1L5ZA 4QDKA 1D0SA 1U0NA 4JLAA 3JRXA 3SYTA 3CN7A 3TPCA 5C9ZA 2R2GA 1QZ3A 1WKCA 2KWIA 3A4LA 3CLSD 2ICAA 1IN5A 3NM4A 3W5IA 5HS4A 4GW3A 2PPVA 1Y7PA 1U1EA 4D4JA 4ZJYA 1DFGA 4B1FA 3U4AA 3VYSB 3FJYA 2J5KA 2XNHA 5D3QA 5FBZA 4Q05A 3UOGA 3VC1A 3ZWBA 4DXDA 1SUIA 1BHSA 3K2EA 2W22A 1GPYA 4GICA 1JKJB 5G0VA 3AKDA 3BXZA 5EUQB 4QM7A 3NZEA 2XMCA 1V8FA 3T9DA 2J0SA 2XXAB 3HP4A 1M2KA 2C2KA 5CTAA 2I91A 3K20A 5DHFA 2JFYA 2XDYA 5FQOA 3D64A 3OFJA 4DR6B 2AQKA 4RD6A 3PF9A 4BB5A 3WL6A 1KYZA 1DAIA 3KLBA 3BFXA 5EE9A 4QLBA 2VHXA 4DA6A 4WN9A 5KJ1A 1JQ5A 4FMDB 4GVLA 3PUYA 1G3UA 1YZVA 4KQIA 5EPEA 4CM1A 3EVFA 1PU2A 3IGFA 3OCWA 1FNMA 5BN3A 1E4OA 1USKA 2AX4A 2VH5R 1XU9A 4FLFA 2P7HA 1BMDA 4Z8YA 3H9EO 1LBQA 4FINA 4JVLA 5BNTA 1YQXA 5CM2Z 3DT6A 2X1LA 7GPBA 1SBQA 4XGIA 5A4FS 5C52B 4HRYA 2PTHA 1ZKDA 3QA9A 4GGPA 4F46A 1V5WA 3R77A 2Z58A 4MKFA 3DEZA 3GPDG 1SELA 3H13A 5JRZA 2BFMA 4HADA 5HVNA 4KHZA 1FYEA 4F93B 3W4IA 1DPFA 5A04A 1TFUA 2AF3C 3C8MA 4YMVA 3BDAA 4IRMA 3RTBA 4C4XA 4L3VA 2DRIA 2CHUA 1RAAA 4RTQA 2O3RA 3BIFA 4UBJA 2B1JA 4B85A 4EW6A 2NSJA 1JQKA 4IVQA 1OBOA 5E4FA 2FSVC 2JFXA 3FVQA 4GX2A 3UGTA 4B5LA 2JLVA 1OLSB 2O8EB 4JQZA 1FUEA 4PAMA 1AOXA 1WW2A 2UXBB 4C05A 4PO3X 2HY7A 1UM9B 4YRBA 4MEBA 3AEYA 4QECA 2DFPA 2NXCA 1Z4IA 4F84A 2KMLA 1PJ2A 3T7TA 3FDFA 1R8SA 3BMNA 4HVLA 5ARBA 4NPAA 2IXGA 4RPIA 3RVNA 2J9FB 1XJ5A 1MBZA 5EXXA 1G18A 4YHHB 2PKYX 3Q3JB 3TLBA 5AUPB 3FTDA 3ZU2A 4MMYB 1Y81A 4S0XA 2CXRA 3UCEA 4M21A 3VR2D 1OA0A 1ZCAA 3WDMA 4KJXA 2PH3A 3F3YA 1YDHA 4D9KA 2IEAA 1O77A 5HTKA 3I9JA 5CYGA 2EDCA 4H18A 1FEZA 3RC1A 4N5HX 4HC4A 1ZKMA 4DBLE 1UKVY 1HOTA 4XFDA 4OMCA 5ITZA 1LSUA 4TMWA 2BGIA 1L5FA 3BXXA 3CPEA 5G4LA 3UO8B 3ZHUA 1F8GA 1K92A 5KDLA 5ER9A 3HRHA 3UA3A 3V1MA 3ZZMA 6ADHA 1IC6A 3COJA 2XDAA 3QE0A 2FMHA 2Q4OA 2RGNA 2E4WA 3DMFA 3FPGA 5DHPA 4F06A 5LLDA 4BMCA 4C4OA 1NRXA 5FNVB 3L8YA 4R2MA 4V1CB 2C2ZA 1ONPA 2C8JA 3KWJA 4L8WB 4FMPA 4RK7A 1LS6A 3KLNA 4X24A 4W5OA 2W5UA 3DTVA 2VDQB 1HY3A 2F8MA 1ENOA 1FPQA 1ZBQA 2O6HA 3KS9A 1V3QE 2DWOA 5TGZA 5CB8A 3TLZA 1XDGA 2KQUA 4FP9A 1FVOA 1EUZA 1ARZA 2REBA 1XZIA 3CZ9A 3CB4A 3HDTA 2JGNA 3IOCA 4GEKA 2HQ1A 4K8RB 4NTZA 4OYYA 4FVTA 1VZ2A 1WCXA 4J0CA 4EVRA 2YNMC 4F1KA 2XF2A 1TA9A 1X1QA 1E9RA 1DC6A 5EJ8A 1HYGA 1CZHA 3PYLA 4IKEA 4MUYA 5FTNA 3K5PA 1B0UA 3LQ2A 1PR1A 5LCXA 3V34A 4HGYA 1BE6A 4TYMA 3C7CB 2R5WA 3ILSA 3KU4A 3HBFA 2W6QA 2C2GA 1XEWY 3C8ZA 3M6FA 2C84A 1E6LA 4RH3A 1M2HA 2IZ1A 4INJA 4QAQA 2HAEA 3IAM1 4E5MA 1YK0A 3FR8A 2I2AA 1YI0A 5AESA 4G41A 2WF5A 1GTZA 4D43A 1RXWA 1SEPA 3ZH9B 5MN4A 1RDFA 2DQ4A 1T1RA 1JYEA 3PNSA 4OB8A 1PV2A 1M2OA 3MWDB 2O1SA 1MQ9A 2CJPA 4LZZA 3UFXA 1RZUA 1FLAA 4PR3A 3AJDA 3PEWA 2B4TO 4YRJA 3OAAA 3KOOA 3LCCA 1V41E 3LPNA 4JZKA 4LRYA 3KQTA 3QTLA 2OHXA 3GAZA 3RR2A 4CLDA 3TIXB 3COVA 2E5FA 3NG1A 1N6HA 2HDWA 2HA7A 3KT0A 3KPWA 5F9FA 1FTYA 3W2FA 4AZWA 2ERYA 3GQBA 4KI0A 4PCAA 1N78A 4WHMA 2IE0A 3DB1A 1X39A 1NUTA 1E2QA 4FW8A 4LYAA 3JYOA 1UJ4A 1J7KA 1NF9A 2VO1A 1WV1A 4YWJA 1WCV1 2JFFA 4HGPA 1VL6A 3EJWA 1P62B 3EZXA 2P3LA 1CR4A 1NT4A 3ECAA 1XKXA 1ADCA 2D5CA 1HE1C 2WI8A 2X2PA 3M5PA 3NTLA 1M2VA 1R88A 1REQA 1SVIA 2X9LA 3ZE8A 3B1ZA 1RP1A 1OKKD 1CYEA 3BIJA 3DD1A 2D62A 1XZFA 4QYXA 3RVBA 3ZGLA 2GD0A 4BCDA 3L92A 4CM7A 4ETNA 1EMDA 1E9AA 5FORA 3NIWA 2Z3WA 1G21A 2FG5A 3P52A 3ND5A 2ZREA 3GBSA 2W2KA 3LUDA 3PNLA 4LNUB 1NFRA 3G0OA 4U00A 4B6QA 3E1KA 1JPNA 4KR3A 1WU7A 2PKXA 2RGBA 4NK5A 3A10A 3D5EA 1C9MA 2CXTA 3IAHA 4MHOA 3WO0A 4Q4JA 3ZE1B 4DMKA 5BSEA 4GZMA 3F1LA 3W34A 4A6PA 3GUCA 2ZBVA 3NOXA 5FQNA 1N75A 1I0IA 3WXMA 1UFRA 2B6HA 2CL6X 4UBNA 5SICE 1A2QA 3QVUA 1H2ZA 2QIOA 1X7HA 2PX0A 4M3NA 2ZZNA 3DD5A 4D1YA 3SIWA 2BZGA 4NY1A 4E30A 1GGKA 1ZITA 2WG2A 1YDGA 4FI3F 4QDOA 1P17A 4R6XA 3N9IA 3ZI0A 2PRSA 5FWNA 3RRYA 5A05A 2WJZB 1LV7A 3AFIA 4CG2A 4GR5A 5M7EA 5AW0A 3GPBA 4PC1A 3ICEA 1ZONA 3L1IA 2AD5A 2C9CA 2XQJA 4R9RA 4ERXA 3OOYA 4XGNA 3D3QA 1J7JA 3EUWA 1UH5A 4I1OA 2VNHA 2O2IA 1AKQA 1F12A 4CIXA 3A06A 2P9HA 5DM4A 4LF5B 4EDFA 3FHLA 4IQGA 5EPUA 3W04A 5B53A 4QVIA 4FLEA 3WGTA 3VU8A 2JAPA 3DFFA 1WABA 2R60A 2ZKIA 3F90A 1JPUA 1IXRC 3UV7A 3QUCA 2Y92A 3C5EA 3ZWPA 5L7TA 3KKPA 2MSNA 1JE1A 3MYYA 4Y9DA 5F33A 3D8SA 1HDYA 3EPPA 4HZUA 4LRXA 3OJ0A 4CCYA 4Q12A 1GZVA 1DBWA 1PG2A 1LRKA 1EA5A 1JG1A 4BQQA 3BH7A 4GMHA 3F4KA 3RJ5A 2UUAB 4KLRA 2ODQA 1P4GA 3WIBA 1CR2A 2HKIA 1WWKA 1ZUD1 2C96A 2HZBA 4BNMA 3SIRA 1Q7RA 1UF9A 1TJYA 4R6WA 3ZDAA 5HIIA 2WMOB 2W6CX 1C29B 5FOUA 2C1ZA 1KKMA 1RQPA 1J2EA 4G5HA 2ADFA 3SPXA 2AWOA 1NX6A 2CLDX 3AHGA 2PUDA 1VE5A 2P91A 4G56A 4ZXFA 2R7KA 2IF2A 2JDIA 1G9TA 1AKUA 1HDZA 1NW5A 3QMMA 4UEQA 4E31A 3GFPA 3FNFA 5L4SA 3O8CA 1UJNA 5KQGA 4QX6A 1EDDA 4AJ9A 4HOYA 2J6CA 3P2OA 1GQ2A 4K9NA 5GJBA 1ZPDA 3RYCA 3RSSA 1XNHA 1Z26A 2HTFA 4GPAA 3K09C 5J23A 3AJ9A 5DCWA 4INOA 2GAFA 2PLWA 4V0ME 1E1MA 2I6TA 3HN6A 5AKLA 1HZZA 4J7UA 1G5QA 1NBMD 1UQTA 3KOYA 5U1PA 4EDHA 1I10A 5EFOA 3MCUA 5D3MB 1X15A 2VSXA 1FP6A 1DUVG 2OK8A 2XUZA 2ZEJA 3E1SA 3PICA 4NC9A 3MTDA 4GYYA 1LK5A 3UENA 4A5SA 1E1RA 1GU0A 3GJ8A 3GZNA 4ZFNA 4C3OB 3EPJA 1M7GA 3R8FA 2VPYA 2JIZD 1ML4A 2XECA 4WL0A 5C0OE 3RFUA 4DYHA 1QKKA 1SCAA 2RAVA 4QT0A 3WMFA 2I34A 2HHCA 2WIBA 3OO0A 1I2MA 3CSUA 4GR9A 2P4EA 3OP4A 3U48A 2RI0A 4E2ZA 4EL5A 4QTUB 1XRRA 3OJLA 4HLCA 1LKZA 1JVSA 3FM9A 4PLGA 4N48A 2ZYAA 3PQEA 2PLNA 3F3MA 4KGDA 2ZAOA 2ATXA 3G0CA 2XMGA 2QR3A 4G0QA 2ZBFA 3WTBA 2DUJA 3ROGA 1QM5A 4J29A 5I8WA 1YE8A 3PNQA 2Q3JA 4KGVA 5G0UA 5KHAA 1QVZA 3RAPR 3LO5A 4I55A 1WX1A 5I9BA 3E84A 1DV1A 2F17A 3FKQA 4C6HA 4QU8A 2BT4A 2V7PA 2YFKA 1GSAA 2YN2A 3HM2A 3UMJA 2PIDA 2WRZA 1JIQA 4PW0A 1ZGBA 5ESDA 4UKDA 1SVNA 1P8JA 4CTKA 1RCTE 1AUVA 2ZU6A 1EZ1A 2ZWAA 4LPSA 4LVOA 4RHXA 4NATA 5LYJA 3P9SA 3K0SA 2PYDA 5EYPB 3GRPA 1JDJA 2C5HA 3NBUA 4AUNA 3L02A 3WLQA 5F4ZA 2XUFA 1GPH1 4FFNA 5A0FA 3U4QA 2VK8A 5KTNA 1OI3A 2ARKA 5AR1A 5HRAA 3ER8A 3W5BA 4P9NA 5B3JA 3UWKA 2JLZA 4I19A 4LOAA 3OEED 5E2IA 1D8TA 3W7AA 1SVSA 5G4KA 1E3TA 2OBBA 4AX4A 1D1PA 2C2XA 2ZETA 3B82A 3NDIA 1DCKA 4R8MA 1GPAA 2CYCA 3E7WA 4J49A 1L5WA 1XAIA 4HEA1 3UM9A 5JR3A 2FMTA 2OB1A 3LDAA 4AWAA 1PYGA 6PFKA 1F7UA 1WM1A 3CVOA 4JJEA 3DVAA 1XWWA 3ZCPA 3MT8A 2XAAA 4TTQA 1CUUA 1O5IA 4PWYA 5FPPA 2XBLA 4EHJA 4DCVA 1G63A 4MLDA 4BKPA 3IAM6 3CXRA 2HJHA 3FWYA 4M9RA 1BU8A 2AG1A 4A03A 1BGVA 3PNKA 2YRFA 2YWGA 4KGZA 5AVUA 5JVDA 1YR1A 3UG7A 1KDPA 3JZDA 1S2IA 4LECA 3BJIC 2CC2A 3GJZA 3OLVA 1LQ2A 1QCCA 1INLA 2MMCA 1ULZA 5DNUA 1I2ZA 3GLGE 3FCYA 3DBHA 4HK4A 3WHKA 2IYRA 5IX8A 3H2HA 3TINA 3D2BA 1T15A 1DBIA 4YLEA 4X7MA 5DXFA 2C3PA 4OIFA 5SYMA 3SKVA 4C21A 4AY6A 1GPUA 1GZSA 1A9TA 3RNLA 2QPOA 1NXXA 3EGXA 4OL0A 2CMGA 2AG5A 1SQSA 4B0PA 2P6PA 4P7FA 4Z4FA 3FNIA 3MJTA 2VTBB 2BEVA 3NKVA 2IHUA 4Q4AB 1R8QA 2PD6A 1J0DA 1NJ8A 2H1LA 3FWNA 5KEIA 1ZCFA 1RYYA 3R20A 3RGWS 4Z7QB 5IVHA 2XPCA 4BFYA 1AS0A 1KMMA 3KTDA 2PGNA 1M6NA 4HRAA 3SYMA 3A2KA 1K7YA 5EWMA 4C2TA 1KP9A 1QIJA 3AF0A 4JWTA 2CB0A 4UM8B 2YDXA 3I37X 1Y9EA 3JQDA 1Z7GA 4Q02A 1DFHA 3SQWA 1G0NA 4ZCQA 2CHFA 2PUVA 3KKKA 3S4YA 4IP0A 1JFFB 3SQOA 2AMVA 1X1RA 3QXXA 2WDZA 3AL2A 4L9RA 3HC7A 3EVCA 4XAQA 3RS9A 2EW2A 3MILA 3OD5A 2F67A 1GZ4A 2CE2X 2CGEA 3PUXA 3EIUA 1RHKA 3R4VA 4B7ZA 3RS2A 4CR6A 1UFKA 4Y2TA 5CBPB 4MV8A 4BLWA 2XRFA 3KQNA 1TU0A 2JBAB 5JD5A 2VXYA 5LVAA 1CJUC 3H84A 4HLNA 4ZO8A 3WMWA 4IBOA 2Z0MA 4A8JC 4QGGA 5IK2A 2IYUA 4FR5A 5D1NA 1LSJA 4R8KA 3FDJA 1SQ6A 1ZD3A 4MRSA 3N07A 2FMXA 3RIMA 4ZIRB 2Z8XA 4HNSA 2ZQ5A 2NPFA 2H3HA 3L6EA 4CG1A 5JFOA 1GZHB 1GKKA 3ZLVA 3UB3A 4L5JA 4TTVA 4DQVA 5AM3A 5HOEA 5HWSA 2HIGA 1NJSA 2I7XA 1JA1A 3LI2A 1H0KA 1N0WA 1FU8A 2G6BA 5LBTA 4AZTA 4CR8A 4CLRB 1IHXA 4EA6A 4HY3A 2XZDA 5KX5A 2PO5A 4MGKR 4TUYA 4YMIA 1JEEA 5GGYA 3NUQA 1BDHA 3GUYA 4OHCA 3VR6D 4R0VA 2B2CA 3JWPA 5E38A 2F3UA 2XDWA 1YS6A 2OFWA 3EGWA 1NVBA 1TMOA 1Y7LA 3KDSE 3PEUA 5FTKA 3VTAA 4WTOA 2PUAA 3PEYA 1UC4B 1ISPA 2H1CA 1OT5A 2QVBA 3PZBA 3JU3A 2JI6A 4RXUA 4F3NA 1W93A 2WUEA 5FDFA 3LHFA 2L2QA 3OZEA 4HD8A 1M83A 3LT0A 4REQA 4BNJA 1WUKS 1JYFA 1UOQA 1Q44A 4B7AA 4BBAA 1T6XA 2H7XA 3WKEA 4WINA 5CA1F 1Z37A 2ZUVA 1Q0LA 4GXNA 4XX1A 5ADWA 1KI4A 3GBPA 4P32A 2DERA 1IN1A 3QWIA 3TM4A 4O4LA 3W05A 3WBJA 1BS9A 1PJCA 2Q4RA 5DCYA 5DT2A 1PV4A 1J99A 1OTXA 4DG8A 2Z04A 4E12A 1V39A 4GOOD 1MORA 3EZ6A 4WNYA 1FY2A 2NZWA 1AXEA 4P22A 4Z51A 1Z4NA 3OZSA 4AG6A 3PI6A 4E7OA 4I81A 5REQA 4JY7A 3C5WP 3V6MA 4AP9A 1XKTA 2IEIA 4LDPA 2FSIA 4LFCB 2QYTA 1J24A 4LV8B 4RTMA 3SQXA 1A72A 2GAOA 3BMQA 3HCWA 2CNNA 3OCXA 4LMPA 2HSGA 3MG9A 4O59O 3G8CA 3HV2A 3QF7A 5F9MA 3IPCA 4OHRA 1DWPA 1X9IA 3OE1A 4OG2A 4HBZA 4IHJF 1CUWA 4ZK2A 3C45A 3HI4A 1NJ1A 1QLHA 2YJZA 1GEGA 1M8JA 4QXRA 5IAJA 5BSTA 4DPLA 2YIJA 2ZW9A 3AUAA 4ZCPA 4CRWB 1KS2A 3B6EA 5JS6A 2P9TA 4MMZB 1RI3A 2Y93A 3E18A 3IEUA 3Q3CA 4LW8A 4R1UA 4DMCA 4F4DA 1CY8A 4RAOA 4NJMB 4OPMA 1TC2A 2V54A 2BKLA 3AUSA 3V1KA 5JZOA 1B6TA 1YH3A 2F1HA 4FT2A 4B6EA 4DQXA 4B4VA 4KR7A 1JDUA 2Y05A 3HBMA 1XTZA 4QWWA 1VKJA 1UBCA 3UMSA 1SXGA 5EZYA 2FPOA 1BZYA 3GRKA 1CS0A 1E94E 2YCBA 3HJGA 5L3QA 3R75A 1AV6A 2OCXA 2N42A 2ZI5A 3MUNA 4KSBA 4O29A 2E18A 2FN4A 3COSA 3EDRA 4BMPB 1ILEA 2XMZA 3I4FA 2B9EA 3AF6A 5JWHA 1P3Y1 1OXBB 1W44A 3O75A 5GIOE 2D4AA 3BB1A 5AXBA 4BAGA 3IPAA 3TZHA 5C3MA 3BZWA 3RS4A 3WSTA 3GPIA 3BKXA 1ESNA 4GI1A 1CG6A 4UVDA 1BHJA 1Q84A 3B2EA 3RJTA 3TIGA 4AW9A 1UM8A 4OQEA 2V7VA 1UKYA 2NO9A 4FCCA 3GEHA 3F6EX 4IMJB 5LD2B 3O7MA 1CRLA 1T10A 3RRZA 2Y0EA 5ALEA 1Z7WA 4PR0A 1QS0A 1ZK1A 2ZRDA 4I4IA 1FSFA 1OZAA 1X8XA 4L5YA 4G23A 2EIXA 2OA0A 3FZGA 3JQBC 3SMQA 7ABPA 2SBTA 2O2GA 1NW8A 5CEEA 2XJ4A 3MWLA 4TRRA 1UR5A 1IHPA 3WB2A 5KQRA 3NHBA 3OLYA 3KUUA 3ESAA 4JOSA 1RYBA 4BGVA 5ICSA 2C98A 4DEYA 4TV8A 4BO7A