2HMSA

Rectangular-shaped octameric ring structure of an rck domain with nadh bound
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
138
structure length
138
Chain Sequence
KQFAVIGLGRFGGSIVKELHRMGHEVLAVDINEEKVNAYASYATHAVIANATEENELLSLGIRNFEYVIVAIGANIQASTLTTLLLKELDIPNIWVKAQNYYHHKVLEKIGADRIIHPEKDMGVKIAQSLSDENVLNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The RCK Domain of the KtrAB K(+) Transporter: Multiple Conformations of an Octameric Ring.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Membrane protein
molecule keywords YuaA protein
total genus 44
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02254 TrkA_N TrkA-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2hmsA00
2Q49A 2D1YA 2JCYA 3OETA 2J3JA 4TSKA 5FI3A 1F17A 3DZBA 4I9HA 2CSUA 4FFRA 1C14A 3LSYA 4JQCA 1QP8A 3RFTA 2ZIZA 2BRUA 2PTGA 2VZ8A 1BVRA 2A35A 1RJWA 5TJHA 1ZMOA 4IDBA 3VAZA 3KBOA 3HJAA 3FNFA 4I1IA 1PTJA 2UUOA 1X7HA 4BNZA 5EERA 2Y1DA 2RAFA 3ZNNA 4II3A 5JE8A 1O95A 5THKA 1LQUA 4GL4A 3QRWA 3EZLA 4OMUA 2PGLA 1H9AA 3AUTA 2EJWA 2POQX 4D79A 4LW8A 1DEHA 3GPIA 3GVXA 4D0RA 4FDAA 2X8LA 3HDJA 5BSFA 1UXHA 3OIDA 3OIGA 2VWPA 4RF3A 3ADPA 1DIAA 1R66A 3F1LA 3LT2A 4WOKA 1XIVA 1R15A 3TZ6A 3E9QA 4J90A 3GR6A 3HFGA 1EQUA 2YQ4A 3JQAA 3VTZA 3RQSA 1NVMB 1C0IA 1EUZA 3S2EA 3INTA 2NUAA 4LK3A 1H93A 1Q0LA 4XYLA 4XDZA 2HQ1A 1LUAA 1LDGA 4S3MA 4LVCA 3ONDA 3VKVA 4Z6KA 5L4LA 1WMAA 3JD4A 3FI9A 1VE9A 3FWZA 3JTMA 1ZSYA 2E6UX 2O3JA 3JYOA 3WIEA 1UXJA 2X5JO 3PQEA 3VDRA 3PGJA 4Q9NA 2EG9A 1Y9AA 3ZU3A 5I7VA 1ISHA 2BI8A 5COQA 3LC1O 3IKTA 5DP2A 5KVQA 5DBGA 4OSOA 3ZV6A 3GQVA 1HT0A 3PHLA 3Q2IA 4TWRA 4B3IA 1GTMA 4TROA 1PZHA 3SX2A 2VWGA 4ND1A 2BGLA 3L0DA 1H2HA 3CZMA 4R16A 4XJSA 3GZNA 1Q7GA 2H1SA 1QR6A 5I8ZA 1XWFA 1HSOA 2NACA 4RVUA 4IDDA 3SJ7A 3JQFC 2VNSA 1P0FA 3D3WA 1FDWA 4MIYA 1H6CA 5HS6A 3KYDB 2VRBA 1DC4A 1KEPA 4EZBA 5F3RA 3AOEC 3DQPA 3OJLA 5JY1A 2UYYA 3EY4A 1P1HA 4U6QA 5KKAA 2FSVA 4YTEA 3D4NA 3WYBA 1LLUA 4MJLA 2ZCVA 1PWXA 1KEVA 1XHLA 3V2GA 4R5MA 4WLOA 1ZK2A 5ILOA 4EEZA 2CVOA 2HRZA 4CLEA 2DBVO 5ENVA 4WNCA 4XQCA 3EVTA 2I3GA 2WTBA 3AY7A 4GWGA 4BO6A 4CV2A 1U2GA 3QV1A 4PIVA 4BHTA 2AG8A 3DFUA 3IOYA 4M89A 1E1NA 3PJDA 5MDHA 4ZJUA 1CERA 3ITKA 4YPOA 1EK5A 3VTFA 2FPPA 3DMYA 2CZCA 3TL3A 3UFXA 3E5RA 1O89A 1GQQA 1A9ZA 3GNTA 2X4GA 3GHYA 1I32A 3ZHBA 4XGNA 1TT7A 1E3IA 4NMHA 2B83A 4KQWA 5C7LO 3WLFA 3TRIA 4ZGWA 3UOGA 5A06A 1W6UA 4HV4A 4IDFA 1CWUA 2CDAA 2JHFA 1TT5B 1XKQA 4I5EA 1SNYA 3HG7A 3N7UA 2Q1UA 1QSGA 5JW6A 5BSHA 2O3UA 3HE3A 1Z73A 2X23A 1ZKMA 1I5RA 4MVJE 3ZU4A 3IIEA 2J8ZA 4BNMA 2NWQA 4XD2A 5I7SA 1N9GA 3AM4A 4HFNA 4K1LA 2R00A 1GV1A 5JC8A 3PI7A 2P5YA 3CTMA 5IDYA 3NGLA 3DZGA 3GRKA 5CFZA 1ONOA 3L6EA 1ZIDA 3I3OA 1X0VA 2GR9A 4MP8A 4OO3A 4RVGA 1P1FA 4H3VA 3RI3A 4RORA 4BUCA 3ZHYA 1YVEI 3L9WA 5IDWA 5L7TA 2Y0CA 3HB5X 1GUZA 4YAIA 3Q1LA 4MVJA 4IJVA 1JQBA 2PD6A 4AG3A 5A05A 2VYVA 1E3JA 1E1KA 1PR9A 3EAGA 1A9YA 1ENPA 4I08A 3F5QA 4RLSA 3DDNA 1LRLA 4RQUA 3JQFA 2IDZA 3QHAA 4EUFA 4K9DA 3TL2A 1IZ0A 2EJVA 1T4BA 4BKUA 2PK3A 4E33A 3H7AA 3DAFA 3I9MA 3ZU2A 4DC0A 1Y8QA 1GYQA 1RYDA 4KDEA 4YWJA 1HZZA 1PQPA 4G2NA 4GSKA 4DXHA 2EV9A 3KLMX 3V8BA 1ZEMA 4C4OA 1NX6A 3KYCA 1EE9A 4E4YA 4R9RA 4KMSA 1JW9B 1SB8A 4NBWA 3ZU5A 2PWZA 4M54A 2FRDA 5HA5A 4CQLA 4E32A 4K28A 5CP8A 2FR8A 4GX2A 2GDZA 2ZB3A 3FBGA 3WGHA 1FJHA 3JQBA 3PIIA 4XQ9A 1GDHA 4WLVA 5JSFA 2VN8A 1BGVA 3GAFA 1KS9A 3BMOB 3DL2A 1YJ8A 3WGYA 4ZD6A 5A9TA 4BGUA 2RH4A 1WNTA 4F45A 3OF2A 3SEFA 3GNQA 1DRWA 2E82A 4YQZA 5GY7A 3DWFA 4E12A 4E5YA 3WTCA 4MDHA 3JV7A 1RPNA 3E03A 4B8ZA 3U3XA 2VT2A 4DUPA 1QG6A 1K6JA 1R0LA 2O3RA 4II2A 5EL0A 3H5AA 1ARZA 4PLVA 3VVCA 1ISIA 3QY9A 4RVFA 4E5PA 1HLDA 4JLWA 5BNFA 1YE3A 3UKOA 2DPHA 1T1RA 1IY8A 1DJQA 1PZFA 4PG4A 2C54A 3ZWAA 4JJGA 4XEHA 3VZQA 3QWAA 1CRWG 2VHWA 1P1IA 1QLJA 1YQXA 4YR9A 3I6QA 2HRBA 3E8XA 4PLYA 3ZN2A 5KWEA 3O03A 2D4AA 3NKLA 5ER9A 4RPHA 1IPFA 1E6EA 2Q2QA 3GEMA 2X86A 3KYCB 3G0OA 4FC6A 4PZCA 3RD5A 4A7PA 4BKRA 2ZATA 2C7GA 4AJ4A 2I66A 2CFCA 3I83A 3LK7A 1LRJA 5FFFA 1O0SA 3S2IA 1PGQA 1UXIA 3ANLA 2B4RO 1DAOA 1K89A 2V6MA 1UDCA 3NDJA 5G0SA 4CV1A 5A9SB 4NH4A 1XU9A 2HK8A 3OSUA 3EGOA 1SPXA 2VHVA 4TQGA 3F4BA 4JX8A 4DBVO 2GERA 2FR0A 2WDZA 2QRKA 2ZB7A 1R0KA 4N18A 2NVWA 3A14A 1DIGA 2C59A 5F1PA 3CZRA 1BTOA 3OQ6A 2HK7A 2YFHA 3BIOA 3WMXA 2OBYA 1Y8RB 3PXXA 1O8CA 4OGWA 4CM6A 2FOIA 3RVDA 4XQGA 4C7KA 2EKQA 3GVHA 4RCVA 4RV9A 4R1TA 5A5EA 2Q99A 5AYVA 4FC7A 5I9MA 1MFPA 2DQ4A 1Q7CA 3VC7A 5ITWA 5GZ1A 3QIVA 4YAKA 4XYBA 2EHDA 3UW3A 5IJZA 3H3FA 3PHJA 2HMSA 3PPIA 2AEJA 5CHEA 4ALJA 5CG2A 1JLLA 3R1IA 1YQDA 1WZIA 1H9BA 3KSDO 3VHRA 3V1YA 4PVCA 1BXGB 5DCYA 5AOVA 3K2BA 4DPKA 2XPCA 3KHUA 5U1PA 4CM9D 3MJEA 4GKBA 4UVIA 4D41A 3DZHA 4BGIA 4DC1A 5A5FA 4FR5A 2B36A 4MO2A 1Q2XA 4AJJA 5HWSA 2OUIA 4Q39A 3TZQA 3NTOA 3C1OA 1KC3A 2NU8A 2VTEA 4W99A 5T6BA 3HZZA 3KZVA 5C7IO 2V6FA 4AJLA 1NHWA 1N9GB 5FYDA 1JVBA 4M49A 4CM9A 1FF9A 3ZDFA 4NR0A 2EGGA 3UCXA 1C1XA 3PLRA 4IJWA 4WLEA 5KJEA 5LCXA 3JD1A 1TI7A 1PS9A 5I9LA 1RYEA 3A06A 1B7GO 1VRWA 4TKMA 4P38A 1DLJA 3DBRB 5TLSA 2HUNA 4B8WA 4D46A 5L9AA 4R4JA 5EESA 1ZK3A 3V1TC 2X6TA 1YB1A 1LSOA 3AU8A 1P1KA 2Y67A 4XX0A 3WB9A 2NU7A 3NTRA 3CPSA 1YRLA 4CLRA 3B20A 2DBRA 2CMDA 2ZB8A 3WGQA 5KJ1A 1ID1A 4IIVA 4WLUA 2OHXA 1B8UA 4YVFA 4MVJF 3RFXA 5CDYA 5IXSA 4A2CA 3ZWOA 1NAHA 5CDSA 3C7DB 4JIGA 2QW8A 1LNQA 4M1QA 3KEQA 1HLPA 1LJ8A 1PGNA 3AFMA 4FW8A 2ZYDA 1NASA 2Q3EA 4MVJI 4CLDA 1EDOA 1LDBA 1UZNA 1W0CA 1KIFA 1I24A 3G1TA 2ZQZA 2HDHA 1P0CA 4YAGA 1F12A 3PZBA 1B3RA 1SBYA 1U3WA 4ND5A 3AM5A 2D5AA 3IP3A 2O7SA 1HKUA 3C8MA 4QFDA 5I9NA 3EHEA 3C7AA 1ZEJA 2JAHA 3MOIA 4PZDA 5L4NA 1C0KA 1IPEA 4BS9A 4R01A 1G1AA 2Y0EA 2E4AA 2O48X 1P77A 1T4DA 2PV7A 4Z9FA 4PLFA 2FHSA 1PIWA 3GC6A 5LDGA 1NHGA 1UUFA 4YRDA 5DULA 4CM7A 1ZXBA 4BNGA 2BH9A 1EMDA 1OC4A 2O23A 3HNPA 4S1VA 3PLNA 4GLOA 4J7XA 3NYWA 2O50A 2VUSA 1K5HA 1X14A 3BAZA 4J49A 4JXKA 3VPHA 3QVOA 3A4VA 1LEHA 2GLXA 2HCTA 4YA6A 1O6ZA 2YV1A 1WXDA 2O4CA 1HDCA 2X0JA 3BMCB 3OQ1A 4LMRA 4R1NA 4EITA 1E7WA 4E2YA 1BDBA 3VPSA 4LSWA 1DIBA 1I30A 1S7CA 1F0YA 4NDNE 1LI4A 4GQAA 4AJNA 1A5ZA 1QYCA 1V3VA 4BNTA 2P4HX 5CAEA 3AOGA 4MKXA 3PJEA 3RBXA 3B6ZA 4TMFA 2W90A 2VWQA 1QRRA 4KUHA 2HU2A 3QA9A 3LZ6A 5TNXA 2YDYA 4RQTA 4BMSA 3DZKA 1UH5A 4EJ6A 1K6XA 2EW2A 3D5QA 1BXZA 4NK4A 5T57A 3GEDA 4OKNA 2A92A 1E7SA 1YO6A 1MG0A 2B37A 1Z45A 3FTNA 2IXAA 4N5NA 4RPGA 3QVSA 4X54A 5L7WA 5JMWA 1EVYA 1HYGA 3RASA 2GASA 3K73O 3RUIA 1YOVA 4JK3A 1A27A 1M75A 5JDIC 2HSDA 2Y1EA 2DPGA 3BTSA 1T2CA 3T4EA 1UDBA 5T67A 1C1DA 3VPXA 1TT5A 3NT5A 1VI2A 4IJUA 3BHJA 1DLIA 3GGPA 4YB8A 1PR3A 1OI7A 1PL6A 1U7TA 3U4DA 3GZ4A 5K6AC 2VHXA 1I36A 5H83A 3DHYA 3PYXA 3RU7A 3F9IA 3H3JA 2PY6A 3OFSA 2D8AA 3DZFA 3ZI0A 1QMGA 1JKIA 3W8FA 1L7DA 4AJPA 1HL3A 3P19A 1HF3A 1X15A 3ZWPA 2JJYA 3DHNA 2B5VA 3EYWA 3OH8A 4QO7A 3ROKA 4R51A 1KYQA 3E48A 5CPFA 5DBFA 3MJSA 3H9GA 3NAQA 4W9NA 2DUUA 1NPYA 2AXQA 1M6HA 2VHYA 2DFDA 3CSDA 4DIFA 1JAXA 3B1JA 4YBZA 3AWDA 2P5UA 4IQ0A 3TSCA 4FN4A 1YONA 3GOHA 1YL7A 2WWRA 5K9ZA 4B4VA 1HWYA 4UEKA 5CPBA 1MX3A 3LYLA 5L45A 2C2XA 2QZ9A 2QHXA 1PX0A 4WEQA 1DB3A 2A4KA 5EPOA 5IN4A 3WXBA 2OO5A 3JCZA 2VTDA 3PVZA 1A4UA 4E2XA 1W73A 2W8ZA 2V7PA 3UCFA 3VKUA 2D0IA 3LVFO 4NI5A 4DPMA 3LLSA 3E18A 1VC2A 3WFIA 5BNTA 4BO9A 4IBOA 5JCJA 4B79A 3HDQA 1IHXA 1VJTA 3MZ0A 1X13A 2DKNA 2YY7A 4FFMA 1R4MA 3IUPA 1I3KA 3TZCA 3FF4A 5B4UA 1BW9B 3PHIA 1PEDA 3IUSA 4O63O 3JQ8B 3PWKA 1C0LA 1SC6A 1I3NA 1P1RA 4L75A 1A7AA 4OAQA 3HWRA 5DP1A 2X7HA 3HDHA 4M87A 4F46A 2YHIB 5L4SA 2DM6A 3HN7A 4J2OA 4MVJG 3UAGA 4GGPA 1Z7BA 9LDBA 5IDQA 5JAIA 5DF1A 4WEOA 2AE2A 2XOXA 3NUGA 5IF3A 1ZVMA 1R6DA 4AFNA 5CEEA 4YEDA 4A03A 2B4QA 1GADO 1PU2A 2NTVA 4RDHA 1KEUA 4XDYA 1Y6JA 4BQRA 3NTQA 3BMNA 4QFCA 4LN1A 4YQYA 4Z3DA 5T5QA 2WEKA 5K6AA 1Y7TA 3NDRA 5IN5A 3PP8A 1B15A 3D7LA 5JAZA 2GUGA 1SOWA 1MC5A 1M6WA 1SOVA 1LLCA 2W2KA 1P31A 1WP4A 1PJSA 2Y99A 3AJRA 4GVLA 3AUSA 1TEHA 1J5PA 4CJXA 1OC2A 4BNWA 1NWCA 4GX0A 5HBRA 3FTPA 3LT0A 4YRBA 2PFGA 1EUDA 2ZTMA 1FK8A 1F06A 4PG6A 4IDGA 5A04A 2HMVA 1FDUA 4H7PA 4BO8A 2FMUA 4YYZA 3LLVA 1X7GA 4RDIA 4IQ8A 2PGDA 3JQ9A 1ISMA 3ZV5A 1WVGA 1SO8A 1SB9A 1GU7A 2JAPA 4LMPA 3D5TA 5A02A 3HHPA 2NQTA 4YXFA 1EZ4A 2VHZA 5TIIA 2Q1WA 5EN4A 4PG7A 1IB6A 1VL0A 4BKOA 5ADHA 3PTZA 5JLAA 1UXGA 4AJIA 4E6PA 5AQ1A 2O2SA 2HMTA 1RM5A 4MVJP 4AICA 1XQ6A 3ZHZA 1O94A 1SEPA 4P4NA 3ROQA 1W4ZA 3MWDB 5JO0A 1LDEA 5F1OA 3VZRA 2Y1FA 3QW2A 1E6UA 5ES3A 4KP7A 4OYRA 3ICCA 1YJQA 4Z9XA 4OJNA 3NDIA 1PZEA 2RHCA 3PJGA 5LC1A 1NFQA 4BKPA 3BHMA 3CXRA 1PS8A 2BGKA 4BNFA 1XLTA 1M66A 1UJMA 3Q6IA 2PZMA 1J49A 3TOZA 3H65A 1YL6A 4NQZA 3ADOA 4M86A 2G17A 2Q4BA 3R6DA 1BRMA 1GYRA 1ONNA 4ROSA 4Q3AA 3OJ0A 4ZRNA 1ZH8A 4RF2A 1QYWA 4DREA 2HK9A 4NFHA 1AXGA 3ZW8A 1XG5A 4CM3A 3GVIA 2IYPA 2QX7A 5L95A 2FPIA 3L4SO 3C24A 3DZJA 3GGGA 3K6JA 1LSSA 2Q4EA 3RFVA 1HE4A 5KVSA 4KTVE 3RC9A 4W82A 5THQA 2GZ2A 1UZMA 3FHLA 3EK2A 4WK6A 1ZSNA 4A0SA 1HZJA 3D64A 2EF1A 1IUKA 4Y6RA 1EBFA 1YKFA 4RL6A 3VPFA 1T2EA 4IXWA 2ZJ1A 1NXQA 4BQPA 4CMIB 2NVUB 3KYBA 4BV9A 2DAPA 1I33A 2X5KO 4PLPA 4CV0A 4Q3EA 1DXYA 1A71A 3JQAD 5T64A 2J3HA 1MA0A 1CETA 4YJFA 4R68A 4CM4A 2DT5A 3UVEA 4BNXA 1P44A 4D43A 3GDGA 2YFQA 4RPJA 3GMSA 2PNFA 3GN1A 1RM3A 1PL8A 4PLWA 2GPTA 4D42A 3WLEA 3JQ9C 1U8FO 4B3JA 5JBIA 5C7OO 3VDQA 4IY1A 2VRCD 5JNLA 3IMFA 5JMPA 1KEWA 2AQKA 3FR8A 1OOEA 4ND2A 3F47A 4CMHA 3ENKA 1T2FA 4B7XA 3R3SA 1C3VA 3P2YA 1FXSA 3A1NA 4Z9YA 3GUYA 3B70A 3NJ4A 5CDGA 2VWHA 2I9PA 3WTBA 4CODB 4HNHA 4BV8A 1K0UA 3SBOA 4P22A 4ZQGA 4QEDA 4NJMA 3JD0A 4A5OA 5TS3A 2GN6A 1YWGO 3O8QA 3OMLA 1N7HA 4FPXA 4PRKA 1LDMA 4I5GA 1EFKA 3I9OA 1DFHA 3JD2A 3L4BA 1J4AA 5F1KA 3SC6A 4H15A 1VSUA 4NJOA 1E3LA 1EVZA 4DPLA 4A73A 3FCOA 2Y93A 2BFPA 3KEOA 1JKFA 2P9EA 3GLQA 2JCVA 1HTBA 3ROMA 5KJFA 1GFSA 4WNIA 4QSMA 1XEAA 1WW8A 3PWSA 4RPLA 4FFOA 1IOLA 1NPDA 2EKLA 1N2SA 3D1LA 3I52A 4FJ1A 4B4OA 5BSGA 4YJDA 1E3WA 4D3SA 3IJRA 1AHHA 3NEPX 5GZ6A 2D3TA 1ZFNA 5H81A 1LDNA 2NU9A 2AE1A 4AJEA 3GVCA 4MIOA 4CLOA 2FSSA 2W4QA 4L4RA 3DBLA 4N5MA 2IYOA 3JQBC 1PGOA 6LDHA 1D8AA 5ILGA 3FR7A 3ROPA 4DYVA 4Q3NA 1KY4A 4GH5A 3WWZA 3TQHA 5C37A 2YHIA 2Q1SA 3EUWA 5J23A 4WE3A 4PCVA 1S6YA 1B26A 1U5CA 1CDOA 2CUKA 3KTDA 4CLHA 4PFJA 1KVQA 4E2ZA 3JQDA 4NBVA 4HY3A 1PGJA 4W9NC 4XYMA 3IP1A 2BHLA 3WDSA 4HNGA 4YACA 3KXDA 4J1SA 3C7CB 3WBFA 2ZK7A 2GSDA 4NU5A 5DOVA 2EEZA 1LXCA 5AXDA 3INGA 5TSDA 1Y9EA 4E13A 3QWBA 4JBIA 4KTTE 3GZNB 4L73A 2X1HA 4AJKA 3GMDA 4CMJA 4BL5A 3ICPA 1DHTA 1KVUA 1YBVA 3O26A 3ZWBA 4OH1A 1GV0A 2JD1A 4C7JA 3RJ9A 1MG5A 2IXBA 4PLCA 3WG9A 2OP1A 4MP3A 1FDSA 3ETGA 3WIDA 2YJZA 4P4LA 3EZYA 1ZSVA 4U7WA 4HUJA 3S55A 3WGIA 2NVUA 1XSEA 5F21A 4E5MA 2BFAA 3BTUA 4YJHB 3CEAA 4DRYA 2C29D 3T7CA 1E7RA 2GF2A 1NPTO 3IQDB 3NJ8A 2NM0A 1ZNQO 3TNLA 1HDZA 4B4WA 2Y66A 2AHRA 1Y5MA 3MJTA 4CPDA 2BFOA 1SCUA 3BMQA 4G5HA 5L7YA 4D7AA 3SXPA 3FPLA 2GYYA 4M8SA 3TJRA 5B4TA 3ORFA 5KJ6A 4ID9A 5TT0A 2P9GA 1ADGA 4CM1A 3NT2A 4DBZA 1DFIA 3MJCA 2RH8A 3TFOA 3OQBA 2VUTA 1VLLA 2XXBA 7ADHA 1R4NB 4WKGA 3IJPA 4R1SA 2NLOA 3QP9A 1LRKA 1JTVA 4E21A 3FWNA 4Z0PA 2UVDA 3K8ZA 3QVTA 5JPIA 4CQMA 3ULKA 1NBOA 3CMMA 4FCCA 3RKRA 3W6UA 4EW6A 1ZK1A 1WLYA 5JYDA 3GF4A 3GT0A 3JYPA 4QUKA 4B4UA 4YT4A 1AN9A 3DBHA 3PDUA 1NM5A 2IEBA 4FD3A 1PGPA 1XYGA 1DIHA 2WM3A 1ORRA 1QYXA 4AVYA 4BO0A 4ESOA 3DR3A 3PYMA 3BHIA 3F6YA 3D3EA 3CMCO 3P2OA 1Y1PA 3VZSA 4NFYA 5TRTA 3EC7A 3OICA 2FR1A 4XWYA 4CQMB 4DYDA 1UP7A 4BNIA 4EI2A 5F5LA 3KSZO 4AJOA 4JCOA 1H2BA 1BHSA 2PLAA 3JQGB 4J16A 1GQ2A 4CM8B 2ZTUA 3PGXA 4EYEA 4D3DA 5JCJD 4DGSA 4UAGA 4QQRA 1WPQA 3AUUA 2AMFA 3ONFA 1JKJA 4GMGA 1VKOA 2HMWA 1VL6A 1ZZEA 1H6BA 5T8KC 5L40A 2X9NA 3TWOA 4BO1A 5EMHA 1VJ1A 5JAMA 1X0XA 1Z82A 2B5WA 4JBHA 1CQIA 1GZ3A 1TVEA 4INAA 4DVJA 3Q9NA 2QYSA 3LQFA 3MEQA 2X58A 4KWHA 2Q2WA 1B0AA 3H2SA 3TN7A 1ZXLA 2CDBA 2I99A 5L53A 2PKRA 3X2FA 2H9IA 4NBUA 5IDXA 5KVCA 3RUFA 1MXHA 2RIRA 3H4VA 3U4IA 4IS2A 5G0WA 3K92A 3GNSA 3WGGA 2J5QA 4XIJA 1ML3A 3HSKA 1LLQA 1UXKA 2SCUA 4MINA 1TXGA 4PRLA 3PHGA 1YL5A 1X1TA 4ONEA 2WSBA 3GA0A 4QT0A 4CMEA 4DMMA 2WMDA 1U3UA 3WFJA 1BMDA 2XXJA 1E1MA 2B4TO 4LGVA 2FZWA 2EWMA 1N7GA 4Z0TA 4L4XA 5G4LA 4J4TA 1G0NA 3INRA 1F8FA 2JKVA 3P7MA 3U09A 3NX4A 4UVHA 3PZRA 1UZLA 5KTKA 1GR0A 4LVUA 1ISFA 3U0BA 3PRJA 6ADHA 5A3VA 1KC1A 2JFGA 1MUUA 3GY0A 4XJTA 5DZSA 5TJ9A 1E5LA 1L1FA 1LTHR 3VH2A 1E3EA 1WWKA 1I0ZA 3FNHA 3WX0A 2ZYGA 3ZWCA 4E30A 3LC7O 4YDRA 5BR7A 4UUNA 2NADA 4CLOB 4NIMA 3NV9A 2X9VA 2Y1GA 4YJGA 3RROA 1ZJZA 2YYYA 1CJCA 3B1FA 3EDMA 4P4GA 1CIVA 2AQHA 4Q3CA 4WCFA 3HADA 3ZCXA 3IDSA 4NBRA 4OOFA 4R69A 3GHHA 2UUPA 4Y6PA 4ND4A 2C07A 2OZPA 4YT8A 1O5IA 4YJGB 1LX6A 1QYVA 3FSRA 1GCOA 3OJOA 4K6FA 3F1KA 5FWNA 1V3UA 3OA2A 2IZZA 2DTEA 4BB5A 4ZQFA 4XRRA 4GAEA 1MP0A 4OXKA 4ZVVA 3B1KA 8LDHA 5G4KA 1YBMA 3WQRA 4DQUA 4MVJH 1TLTA 2Q45A 1I8TA 1LA2A 1O9BA 2GZ3A 3I9JA 4XYGA 1E77A 3DBRA 4J0EA 4IUYA 4KUGA 4WPGA 1OMOA 4MVJD 2EERA 4R1UA 4TZKA 1XU7A 1UP4A 1VM6A 4TVBA 4BVAA 1GD1O 2DBQA 3O9ZA 1DAPA 4MIEA 2CD9A 1HDGO 1N1EA 1P9LA 4OXYA 4YAJA 3NGXA 4L8VA 4Z3KA 1XQ1A 3Q0EA 1AGNA 4HXYA 2JL1A 1PJ4A 4QO8A 1DC3A 1VSVA 3PQDA 2X9GA 2BMAA 4IDAA 5H82A 4HWKA 1N1GA 4IZIA 1LSJA 1P74A 2OOSA 3BA1A 3KETA 4TKLA 3GEGA 4XYEA 3CE6A 2EW8A 3S1LA 1W8DA 3EMKA 2EP7A 4YT5A 1C1DB 3W4KA 4FB5A 4FJ2A 5JDIA 3ZZNA 1VKNA 2HKIA 3JYQA 3S2GA 1PJLA 1ZW1A 3ABIA 3KUXA 2P91A 4YJFB 3GFBA 4MKRA 3DTTA 3SLKA 3RCBA 1ZUD1 3OM9A 4BO3A 4JBGA 4MOWA 3GK3A 3I23A 1K6IA 1PJCA 2B0JA 3R0IA 4R41A 5BNIA 2PZLA 1OFGA 2C5AA 4IXTA 3W4IA 2E49A 3E9NA 4NPCA 4WLFA 1YB4A 4A27A 4XB2A 2DVMA 5DCWA 4BO7A 3TDKA 1M67A 4ZICA 1K2WA 2PGJA 4O1MA 1V6AA 5CEJA 4WCFC 4RVHA 1XELA 3DBVO 4YAEA 1RM0A 2I3AA 2W2LD 1X1EA 5G0UA 5JDCC 3W4JA 3WJ7A 3H8VA 3ETDA 2YQ5A 1UR5A 3PIDA 4IJKA 2VZ9A 2R6JA 3GN2A 1ZCJA 4BMNA 2P2SA 3RAJA 4RLHA 4W6ZA 5FF9A 1MXFA 4BO4A 3AI2A 4ND3A 4J3FA 4B3HA 5C3MA 1QKIA 1E6WA 2FPGA 4XGIA 1YDWA 5COBA 1NAIA 4IMRA 1MLDA 3O4RA 3W1VA 2CVQA 3F46A 3QQPA 4BIIA 4BO2A 3WR5A 5IXYA 3G49A 4JN6B 5FEUA 2NNLD 3WS7A 1BWSA 4XR4A 4GGOA 3V5NA 3TF5A 5JC1A 5HM8A 2X5OA 3FBTA 5EQFA 3U62A 1HDOA 1DPGA 3QE3A 4ITUA 1U7HA 1H0KA 1IYZA 4I8XA 2QQ5A 5KNLA 4RF5A 1QORA 1QLHA 2Z5LA 3COSA 4XZ3A 3P5SA 1LU9A 5KJCA 3A9WA 5GZ3A 4KOAA 5IAAA 4BOYA 1DRVA 2EIHA 2A94A 2FY8A 4W7HA 4DTIA 2YUTA 3H9JA 3KLPX 2VOEA 3DBLB 2WE7A 3BYZA 3WJAA 1CYDA 4GKVA 4PLTA 4U6SA 3IS3A 5TT1A 3RUEA 4CR7A 4E3ZA 3RUDA 4KDFA 4XIYA 3RC2A 3S2FA 3JQ7B 1YH3A 2CDCA 1HETA 4Z0HO 4J2HA 3TPCA 1NR7A 2VYND 4Y6SA 3I4CA 5A3JA 2OMEA 4BGVA 3PK0A 1GUFA 2GD1O 1BXKA 3D4OA 4U5QA 3GH3A 3ZWXA 1DFGA 2GRAA 3KVOA 3UCEA 2D2IA 2PD4A 2NVBA 4UUOA 2RHRA 1I01A 3RBVA 4DLAA 4RZIA 3ZWYA 1AE1A 1ZBQA 2H5LA 3I1JA 2HJSA 1I2ZA 2OL4A 4LSMA 3DZIA 4TRMA 2A9FA 3OJEA 1LC0A 2YW9A 1A72A 1GY8A 3PDJA 2IE0A 1JAYA 4FOSA 3QVWA 1JN0A 4Y67A 3SJUA 3Q2KA 1YQGA 1Z6ZA 2J3KA 1HDXA 1LLDA 3JYNA 3WMWA 3TOXA 2I65A 4M55A 1DIRA 3I9LA 1HE3A 2C5EA 4DWVA 3L07A 4OKIA 4ZHSA 3UH1A 1AUPA 5CDUA 2DLDA 1NQTA 3LT4A 4NFSA 2OFPA 4DL9A 5AVOA 1V8BA 2WD7A 3GUCA 5EJ2A 2D5CA 4JP3A 1E3WB 3ZNOA 3GGOA 4Y9DA 1U3TA 2GCGA 1AXEA 4PLHA 2GO1A 3GPDG 3RUHA 3S8MA 4W4TA 1MGOA 1HE2A 4OIMA 1KERA 3ZH2A 1K3TA 4XA8A 4F3YA 1NNUA 3ETEA 1ZO8A 1MC4A 4YJHA 4ALNA 1U3VA 3VH3A 1P1JA 1ULUA 3KSUA 4WUVA 5JXWA 1B3BA 1G0OA 3LF1A 4UREA 2IZ0A 4UUPA 1U5AA 4CUKA 4B7CA 1JVSA 1H6DA 1BXGA 5HRUA 2JFHA 4R5HA 4FOOA 3E6AA 1ADCA 3I6IA 1DC5A 5BT9A 2IEDA 4DQVA 5KIAA 4RF4A 3UUWA 5TF4A 4U0JA 4RPKA 4NJMB 1XDWA 3I9NA 4N54A 3IKVA 3ENNA 2X0NA 3GAZA 4ALMA 2W2LA 3ZWMA 3ANMA 3BMQB 1EBUA 1UAYA 3V2HA 4P8RA 3N58A 1Q0QA 4NZ9A 3JQEA 2BI7A 3RWBA 5KKCA 1KY5A 3DXFA 4ZQHA 4XRGA 4CMKA 4IINA 2C20A 3DOCA 3H9EO 4ALLA 3WSVA 1BW9A 1QV7A 3MOGA 2Y1CA 3M2PA 4D45A 3HFSA 4QTZA 5CDTA 1T1SA 5JO9A 3FRJA 4CMEC 3GVPA 3KV3O 2WD8A 4FJ0A 2VRCA 1RM4A 1P3DA 1CF2O 4WCFB 3AI3A 4ALIA 3AOEA 9LDTA 4GSLA 1GZ6A 1B8PA 4G81A 3L6DA 5L3ZA 1J6UA 1ZK0A 1PQUA 4BKQA 1PJ2A 5K0ZA 3KRTA 4EJMA 1HYHA 2O4UX 1VJ0A 3JD3A 4PZEA 3M2TA 4EGFA 5B12A 4DQXA 1LBEA 4R3WA 2DTDA 4J1NA 3QWIA 4GPD1 5JCXA 1GYPA 4FFLA 4HFMA 3K30A 3WNQA 2WD7B 1HDRA 2VUUA 2LDXA 5FI5A 2Q50A 1D4FA 1CEQA 1U4OA 5ER6A 5TGDA 2IZ1A 4GBJA 3E9MA 2O2YA 2CF5A 3V2UA 3GDFA 5AXAA 1NQAO 2Y1OA 4JNKA 4CM8A 1ZJYA 4NHEA 4YRAA 2NTJA 2JHGA 4URFA 1XA0A 3SVTA 4L9RA 2J5KA 3JSAA 5GMOA 4BNUA 2RCYA 4KWIA 2FP4A 3CIFA 1QXSA 4EDFA 2V6GA 3ZV4A 2BGMA 1Q7BA 2AEMA 1B2LA 1ENYA 2Y05A 2XAAA 5DT9A 2WJPA 2E37A 3QSGA 1ZK4A 5A9RA 4E5KA 1OBFO 2I6TA 3DOJA 3QWHA 4HKTA 4DMLA 5CEFA 1BG6A 1F8GA 3DMTC 4PVDA 3UXYA 2Q2VA 1NVTA 4WOJA 1SMKA 1PQWA 2R00C 2CVZA 1EDZA 4ZRMA 1OAAA 2LDBA 3OEYA 3AK4A 3IC5A 3JQ6A 2Y0DA 3CH6A 4NG5A 4U8GA 3K5PA 4BGEA 1I10A 1Q1NA 4KUEA 4QXMA 3M1LA 2W2KB 1ISGA 2ET6A 3WGZA 1A7KA 4TZTA 5DDIP 4CM5A 1G6KA 4GMFA 4XQEA 3ZGYA 1GCUA 2QIOA 5HTOA 2BF7A 4J1TA 3CKYA 4R3NA 3HUDA 1QV6A 1LDYA 2W98A 3PJFA 3HDYA 3Q11A 3U49A 4UULA 4CMAA 3AU9A 3I5MA 3QLJA 1WDMA 3AY3A 4BMVA 1I2BA 1Q0HA 3H2ZA 2HAEA 4A10A 1UP6A 1NQ5A 1PJBA 2PKQO 2Y68A 4O6VA 5EIOA 1Y5RA 3DC2A 4OOEA 1PS0A 4PG8A 1Z75A 4PLZA 1YGYA 2O3SA 1KVSA 4LISA 4J1QA 1QYDA 1H6AA 4K6CA 2C82A 3WYCA 2NU6A 3RUAA 3E1KA 2FN7A 4XB1A 3I4FA 3K9QO 3JQ8A 2D59A 3DHEA 3RIHA 3RUCA 2FWMX 5B4VA 1GAEO 4LCEA 4TRRA 3R3JA 3K2EA 3RC1A 1IZ9A 3DOOA 1GL3A 3OIFA 3ST7A 4Y8VA 4E2WA 3FD8A 3KB6A 4HADA 4AJ1A 1HE5A 5COAA 1T26A 3C1TA 1JWBB 5JDCA 2XF8A 4RO0A 4ALKA 4EJ0A 3W6ZA 4HBGA 2V65A 5AXCA 1M2WA 3FN4A 5TQVA 3RJ5A 5BQFA 4EUHA 1XCBA 5IFLA 5LDHA 4BNKA 3AW9A 5HS4A 2PR2A 2AA3A 3AI1A 1E92A 3CINA 4O59O 4UVEA 2BFMA 4H16A 1JU9A 4D3FA 2NTNA 3VPGA 5ITVA 2VYNA 3ZW9A 2VNAA 3VH1A 2WYWA 1VL8A 4BB6A 4OXNA 3HB4X 3U4CA 2RBEA 1YXMA 5EQDA 1GPJA 3WOHA 4RZHA 2WYVA 4HFJA 4W7IA 5DCUA 3WGTA 3OEWA 5KVVA 1A4IA 1ZMTA 2DTXA 2O3TA 2J3IA 1T25A 1EE2A 2O3QA 1HRDA 3AM3A 3OECA 4QX6A 1BSVA 3UF0A 2VT3A 5B37A 1R12A 2GNAA 4XGKA 1C1XB 1E7QA 2C0CA 4CLXA 4JJIA 4GLLA 1R4MB 1WDLA 1FMCA 2I5PO 2F00A 4YT2A 3ZWVA 1GZ4A 1HXHA 2G82A 4QECA 4DLLA 4GX5A 4BNLA 4I9UA 3WICA 4MP6A 2DUWA 4RVDA 3DFZA 3BTVA 4ILKA 4J4BA 1U9JA 2B69A 2VQ3A 3DTYA 2UAGA 1TB4A 4CLRB 5IG2A 4WGGA 4BNYA 1C0PA 3RU9A 4UEJA 4JROA 5A03A 4J91A 5G0TA 3E82A 5MGBA 4BNVA 3K31A 4GVXA 4J43A 2GN4A 4N7RA 4O0LA 3ITDA 5U4QA 3D0OA 3FNGA 4U0KA 5TX7A 1E0DA 2Z1MA 3E5MA 2GGSA 2J5RA 3OJFA 1KOLA 4DA9A 3PYLA 4EUEA 2ILTA 3DAGA 2ZB4A 3GRPA 5L51A 2CY0A 2VYVD 5DNAA 3U9LA 4DIBA 3JQCA 2Q46A 1WMBA 5KOIA 3JQGA 1UDAA 3PFWO 3F5SA 2YHUA 3PWZA 4K26A 4TRNA 4BNJA 4L4SA 3WQSB 3C3XA 3M1AA 4OHUA 1PL7A 1EK6A 5G4KB 3WBBA 3MWEB 2HLPA 1E7YA 4BO5A 2QG4A 1T2DA 1DOHA 1N8KA 2EKPA 1RKXA 2V6BA 4XR9A 3A28A 3MTGA 5IZCA 3ZV3A 4IGEA 1WAMA 4R9SA 2AG5A 5G0VA 2OORA 2VZ0A 1U2DA 1Z7EA 1NFFA 5I8WA 4OSPA 2C2YA 1IHYA 2O7QA 2Z95A 4F6LA 1NTOA 1T2AA 3DBHB 4FS3A 3LU1A 3O8QB 4J7UA 1U8XX 3JQ7A 1KBZA 2ZCUA 1I3MA 3PEFA 1EFLA 1EVIA 3K96A 2G76A 4UUMA 3G17A 4WASA 3WGOA 3G79A 3ZWNA 4EBFA 5B1YA 5T8KA 2G1UA 3C1AA 5JFOA 1T24A 2NSDA 2OXIA 3TZKA 2TMDA 1IE3A 4OL9A 1I3LA 2P9CA 4BNNA 3Q3CA 3F3SA 3ANNA 3JQAB 4PN3A 1R4NA 4CQMD 3RSHA 1KVTA 2G0TA 2OBNA 3QJ5A 3M6IA 4IM7A 4J9VA 1PWZA 3LDHA 4FFNA 4RJTA 2OP0A 4L76A 4CR6A 2YDXA 3KM0A 1J0XO 3SLGA 1UAGA 3FPCA 4LRTB 3SC4A 5IZ4A 2DU8A 3VH4A 1ENZA 2J6IA 1XR3A 1NVGA 4ZQBA 3W8EA 1ENOA 2YV2A 2UDPA 1R16A 3H9QA 3H5RA 4IZHA 1ONPA 4BNHA 3KO8A 1B16A 4UVGA 2BELA 3RBZA 1F14A 5TC4A 3L4BC 3BZUA 2H6EA 3H5NA 4FFPA 5F5NA 2CNBA 1D1TA 3C85A 4CMGA 2VCYA 3LC2O 1IL0A 3DAPA 3IAHA 4CMIA 3WNVA 3TZHA 1LSUA 4HFRA 8ADHA 2PH5A 3DB2A 1MB4A 4ZN6A 1DJNA 3I9KA 4PG5A 1D3AA 4E31A 1EEHA 3AFNA 2QRJA 3OP4A 4D44A 4MVJM 1PJQA 3PFFA 3Q9UA 3U4HA 2C7VA 3RKUA 1FDTA 4CUZA 3BXXA 1JWAB 2GN8A 3PHHA 2DFVA 3KYDA 3VOSA 4IPTA 3STHA 1AHIA 2ZQYA 5I7EA 3VVBA 3L9XA 3EW7A 3N74A 4FIZA 1WZEA 4OQZA 3QVXA 4KQXA 1LQTA 4A26A 4Q3DA 5BSEA 2PH3A 1V0JA 1DO8A 3WWYA 1U1IA 4GWKA 3X2EA 4PGFA 4WLNA 1LC3A 5IZCC 1MV8A 4E5NA 3OHSX 1KVRA 1NP3A 1NQOA 3HN2A 4IIUA 5DOZA 1B8VA 2I67A 1EUCA 1M76A 2IODA 4FBGA 3L6OO 5DN9A 1VPDA 3D4PA 1GQYA 1WDKA 2G5CA 3UGKA 2X0IA 4ZQEA 3GG2A 3BMOA 2IRWA 4IS3A 2QYTA 2QZZA 1YS4A 4UEOA 3F4LA 3OA0A 3PQFA 4Q3BA 4MPDA 1YBAA 4OM8A 4CV3A 3ZWWA 3AUAA 2BLLA 4XCVA 3TFQA 2NQ8A 2BD0A 1DC6A 1U28A 2VOJA 4GX1A 4GI2A 2HJRA 4O5OA 3L77A 4FSHA 4CQLB 3EVNA 3LF2A 3BMCA 3W8DA 1R37A 2ZYAA 1R0SA 3ASUA 1E3SA 2Q1TA 4J4HA 1DRUA 3DO5A 3WSWA 1TA4A 4R54A 3NT4A 4HX5A 4LRSB 4HP8A 1NWHA 2YV3A 3BMNB 1EVJA 1RWBA 3BTOA 2EP5A 1KETA 2JD2A 2JCXA 2ZJ0A 3DMTA 3NRCA 4WCDA 4ZU3A 4IMPA 1DHRA 1NYTA 2AW5A 1H94A 5A1TA 1Y8QB 2PKQP 2GZ1A 3CUKA 1ISJA 1NFRA 2AQIA 3QWFA 1ADBA 2P4QA 2TMGA 4LCJA 4J0FA 4NK5A 3IL2A 4FGWA 1XGKA 4Y98A 4I5FA 1MFZA 5ICSA 3DEYX 4YCAA 3ZHXA 2JD0A 4G65A 4IGFA 2YZ7A 3UHAA 2ZTLA 3OBBA 1HYEA 1HSZA 2AEFA 2X0RA 4JGBA 4D0SA 1U4SA 2PD3A 2HMUA 5G2OA 1Y8RA 2GN9A 4L74A 1D7OA 3MJ4A 1JDJA 1X7DA 4ZA2A 5C5IA 3G1UA 4EEXA 1YB5A 1BVUA 1E1LA 4IDEA 3WQQA 1Y81A 2NV6A 2P68A 3ON5A 2QRLA 3O38A 5CG1A 4NU6A 3MJVA 4AL4A 1PZGA 4FGSA 4IDCA 4CM4B 4UVDA 3RC7A 1H5QA 1BDMA 4RVSA 5A9SA 1NR1A 3U5TA 1HDYA 4CR8A 2PZKA 2F1KA 1E7MA 1PJ3A 2EXXA 3FNEA 1DBVO 5U9CA 4JP2A 4XKJA 5I7FA 2HO5A 3H6KA 4NNJA 5A4DA 1V9LA 4AJ2A 4WJZA 1P45A 3HQ4O 4E0BA 1IULA 3VZPA 2E48A 1N92A 3UICA 2CF6A 4RGBA 2BKAA 2ZTVA 3H9UA 5AXBA 1SAYA 3MCVA 4CL3A 4J7CA 1SZJG 5KCZA 3DONA 4MKZA 2PA3A 3WYEA 4I9NA 1V35A 2Z1NA 1I2CA 1PJTA 5JYEA 1Z74A 2R2GA 3V1UA 3D3WB 3T7EA 1GUYA 3MTJA 4WECA 4NBTA 1JA9A 3T4XA 4JJFA 4CL8A 4OQYA 1GEEA 1B14A 3KOUA 2OGUA 4N5LA 1HEUA 5JAQA 2AQ8A 4PLGA 2PZJA 2B35A 4CUJA 1SEVA 1FDVA 1GPDG 3AY6A 5JS6A 4TVOA 1EQ2A 1OZAA 4I5DA 5EINA 1DSSG 4FQ8A 7MDHA 1ADFA 4AJHA 1V3TA 2X22A 2DC1A 1D1SA 2WYUA 3GG9A 4J6FA 4CMBA 5JY6A 1L7EA 1DDOA 1YDEA 2H63A 2I76A 3G3EA 3ZNQA 4J9UE 1P33A 5ICMA 5ENDA 4TRJA 2JFFA 2FZEA 1PSDA 1ULSA 3JYLA 3GFGA 3LT1A 1N5DA 2DBZA 3GDOA 1GEGA 4DLBA 3ONEA 3UN1A 3ASVA 4B7UA 1E5QA 1YOVB 4IQGA 4L0QA 5DBIA 4F6CA 4CMCA 2WE8A 2EGHA 2UV8A 4KZPA 3ZNPA 4DIOA 1CQJA 2ZKLA
chains in the Genus database with same CATH superfamily
1Q83A 2FZCA 3P0RA 2A1TR 3SD7A 3GJZA 1NI3A 4GWLA 2CSUA 3G0BA 4ZYYA 3THXA 3T5GA 3MBIA 1JTFA 2QM8A 3TD6A 1PQ4A 3F8TA 4Q82A 1L7OA 1C9DB 1QP8A 2G0AA 3FYSA 3HACA 3LV8A 4RVNA 3V7WA 5AHRA 3QA3E 4RZXA 2A35A 3M6MD 3HCWA 4OB8A 2PO7A 5TJHA 4BRSA 4JSYA 3DAYA 4WRRA 2NXNA 1V8PA 2R8XA 4IDQA 2UYOA 2BUCA 1WOMA 4HPWA 4OI1A 5T4EA 3UOWA 4C01A 1ADYA 4I1IA 4UQLA 5GVSA 1PTJA 3WJ1A 1XZHA 4KLNA 4G0YA 2Y1DA 3GCZA 3TSYA 2RAFA 1CCWA 3BXFA 3FPJA 2X8WA 1E9FA 3ZNNA 5THKA 4BFCA 4D9EA 1JJBA 3CX4A 4XX1A 2HSZA 3K72B 3X43A 4GR4A 2YS6A 4D79A 4DSUA 1M34E 3PC8A 1Z37A 1DEHA 3JVDA 3RWMB 2Y2VA 3CCFA 1S02A 3GVXA 2VF2A 4C78A 1U0FA 3M6AA 3BXZA 4TL6A 1QNLA 2W6QA 2XAUA 2ZYRA 3DKRA 4CTJA 1UPAA 2Q3DA 2XMRA 2DWQA 2JBWA 4QGHA 1XIVA 5DNEA 2PMKA 3TZ6A 4D9BA 3E9QA 5DN6D 2O0MA 1A4RA 4WD3A 2OZLA 1CYEA 3JQAA 2FK7A 3GB9A 2HGSA 3PQ7A 1BN7A 3IDQA 4R1QA 3RQSA 1NVMB 3S2UA 4F3NA 1L8LA 1E2GA 1U6KA 2RH9B 3S2EA 3AR4A 4DGQA 1YC2A 3H86A 3LKDA 3FKJA 4QFBA 3IE0A 2C1EA 3LRPA 3RS8A 3W5DA 3R75A 3DMRA 2IF2A 4NONA 5BR4A 5MHTA 1XMVA 2GS9A 3HBJA 2G8LA 3SI7A 1KPGA 1MT0A 1OU0A 4IIDA 4NOMA 1QGOA 5C31A 5LKAA 3L02A 1VE9A 3FWZA 2FN4A 2P79A 2D00A 4OHCA 5H59A 5IJ9A 2A4MA 2ZZMA 2L17A 1H3NA 1MH1A 2GF0A 2IXDA 4NZNA 3R3YA 4R2KA 2B1JA 1QU2A 3A37A 3LUKA 3VDRA 4CEJA 1N8SA 5E6SA 3QOYA 1UMDB 1Y9AA 2JJ2A 4MYHA 2XCIA 1X2EA 3LO5A 1XTUA 4PX2A 2GQ0A 4CETA 1JWLA 3EG5A 1FVFA 2ZKIA 4ASUD 4IJMA 1UC4B 4TWRA 4B3IA 5C81A 1PDWA 1XJQA 4JIMA 4I1OA 4IQFA 2OFOA 1LK5A 1XEWY 3GZNA 1Q7GA 4UQPA 1RIIA 1ZKDA 1L4HA 3D43A 5HCNA 3CF4A 3TLAA 4M0CA 2ZXFA 3O90A 4QPNA 5I8ZA 1HSOA 3CIOA 1PFYA 2D2VA 4NAUA 1K08A 3Q8LA 3TCNA 4QXQA 2VNSA 5HFAA 3HU3A 1FXWF 1P0FA 1FRFS 3D3WA 3OKAA 2LVBA 2LCQA 3VU8A 1KMIY 1A95A 1H6CA 1YUMA 4MIYA 4XM1A 1FZQA 2XUGA 3N7TA 1HYBA 4U3JB 1E3TA 2FZKA 4IV8A 2IW3A 2WYOA 2FZVA 1YZ3A 5F3RA 2OZEA 2B9EA 3QBJA 2IH5A 1KJQA 3OJLA 5BPFA 3T3EA 3EGCA 3KAJA 2AGVA 1MQ8B 2VTKA 3DOEA 3EY4A 5KZMB 5KKAA 4YTEA 2O2JA 5TVGA 2C98A 1J97A 1KO4A 2A9JA 4MJLA 2ZCVA 2WZCA 2PLRA 2PYDA 1KEVA 1XHLA 1D9XA 2CFTA 2WOOA 3M6UA 1PR0A 4QWMA 4R5MA 2VEDA 4EEZA 5HYVA 4K03A 5JTTA 5ILOA 1TTTA 2AXEA 4XQCA 1SCBA 1ZQ1A 1O87A 2I3GA 3AY7A 4CV2A 1RABA 1ORTA 4U2CA 2IZ5A 1OA1A 1UJ5A 4KBFA 1FUIA 2V7WA 5DM1A 2FCRA 2G28A 2H59A 3IOYA 4P3PA 1EXMA 4HQOA 5CVTA 4G24A 5ALQA 4PEVA 4O29A 3M9LA 4P82A 1VI5A 2CT8A 4XWTA 4N12A 2CHGA 3VUFA 2NO9A 5E9AA 3TL3A 5I7UA 3E5RA 3EC2A 4YMTA 2HPAA 4M8LA 2OLJA 1I7SB 3GNTA 2QAJA 4DUGD 5CIWA 3ZHBA 1DG3A 2MR6A 3KQOA 4GM0A 3T3IA 2XB8A 1DJLA 2AX4A 2W43A 3CT4A 3LIIA 2B83A 1ZIOA 4KFCA 3WLMA 4Y6GB 2BY4A 4M9UA 1W25A 3TQTA 2XGSA 3K6SA 4HV4A 4IDFA 1CWUA 2CDAA 3QU2A 5CDYA 2H1WA 2OBLA 1JLLB 4FDUA 2ECQA 1QK4A 1WEKA 4ED9A 5CDFA 2XVYA 3JVVA 1KTVA 1Y3CE 2CLDX 2HA7A 4RIEA 2BMDA 2FLWA 4AKEA 1NVUQ 2HA2A 1QO7A 2X23A 1I5RA 1JIVA 4BB9A 1VPLA 3G5MA 5GOZA 3QE4A 2QENA 3SZOA 4RPIA 1R18A 2PUHA 4R6WA 1DTSA 2P9YA 4HFNA 2R00A 2B4KA 2P5YA 3HR4A 5EE1A 1W52X 2ASVA 1KH2A 2B2XA 1E98A 2WWHA 4LV5B 4OBBA 1E69A 5CFZA 5CCDA 4QJ4A 4FI3F 3I3OA 2HYIC 2BFBA 4RVGA 1P1FA 2I78A 3R5TA 4H31A 3FUVA 1WB9A 3S6JA 1GT91 3L9WA 3HB5X 2HPVA 4D82A 3ANYB 1WPRA 5D7NA 1H1LB 1RBYA 4EAQA 4MVJA 2XWQA 1J56A 4CDGA 1PR9A 1E1KA 2GJSA 1Q0RA 4LQDA 2XSZD 3F5QA 2ZWOA 4UJ3A 1LRLA 3FFAA 3OX4A 3BORA 4RQUA 3S3TA 1U3FA 1RCFA 2IDZA 3D2AA 3IAM1 1R50A 4I6GA 3H2JA 4JEHA 4K9DA 2CFOA 4MO9A 1IZ0A 1G4HA 1T4BA 3X1KA 1Z4IA 4BKUA 4E33A 3SZ3A 2J41A 3I9MA 3IOBA 4RV5A 1Y6QA 1EFHA 1PJ8A 4REQA 3ZK7A 1ESDA 1FRVA 4G2NA 4GSKA 4TLLB 2XOKA 4FEGA 3T0IA 3VJMA 1P2BA 3GZTB 4EG8A 1RQPA 1WB6A 2V6IA 1SWVA 3V8BA 3OIUA 1SXQA 4JVSB 2AUTA 5AHKA 1ZCFA 2XQJA 5TGTA 5C2JB 3T06B 2IEYA 4L07A 1H5UA 2A0WA 1DWQA 3CH4B 3QKWA 4E4YA 1RPAA 2RAPA 2VRWA 1QG4A 4OLHA 3SK0A 2GMWA 1L1EA 3QTTA 2BR5A 5CH3A 2FPIB 2PWZA 4I4NA 5I51A 3ZKWB 4M54A 5JQGA 2FRDA 5EKDA 2ZUSA 1YJCA 6YASA 3PFGA 3BD8A 5HA5A 3V4SA 4EI8A 4I50F 4K28A 1R9GA 3EIWA 1TYCA 1BMFA 1EA7A 3U56A 3F2VA 1F7VA 3DP9A 3TH5A 3FBGA 3DKPA 4OQFA 4UNIA 4UCWA 3WGHA 1GDHA 3W9SA 2ZJ8A 3CV3A 2RHMA 1N2ZA 1R27A 3V46A 5M04A 4AUMA 1C3OB 3ICVA 3HJRA 3KWLA 5HMLA 1KY2A 4LQLA 4ZD6A 2NW6A 3IDAA 4ZQCB 4BGUA 1K8QA 3HKCB 1C29B 1T5SA 3QVMA 4MV0A 4FFWA 1GTVA 3U3KA 2IITA 1KE1A 3RIMA 3HXKA 3Q6MA 4YQZA 2IY7A 5GY7A 4D8WA 2ZRCA 2IZ7A 3OPXA 1UKCA 4UNQA 4E5YA 5CXXA 3BH0A 3IULA 4FYHA 2Z43A 2P9JA 3JV7A 5DFAA 4CG1A 4N0PA 1B6RA 1S9HA 1RXCA 3CLSD 4YCLA 1QG6A 1K6JA 1R0LA 5IJ9B 4F04A 1M7HA 2IZOA 4FWBA 4K9MA 4RVOA 1ARZA 3T1HB 2AYZA 2E5LB 1J22A 5BNFA 3UKOA 1XYYA 4C05A 1DJQA 2Q8QA 2Z57A 5AHWA 1N2JA 1QLJA 2Z0MA 1O9GA 1HM5A 2C04A 2FA9A 2HA6A 4X1KB 1BD4A 4DADA 3I6QA 2HRBA 2WJ4A 5EJ9A 1G17A 3E8XA 1UMKA 4RKFA 3EE6A 3D4BA 3IR7A 5ER9A 1E32A 3GEMA 3VU1A 2X14A 3BWCA 4DZTA 4LYFA 1Y6FA 1C2TA 5HFJA 5ILQA 3M3PA 1LRJA 5L6MB 2IUTA 3CZPA 2BEWA 3C8HA 1KAGA 5EKTA 1IM2A 2VDJA 5JASA 3K71B 4KXUA 3NDJA 5G0SA 5JPDA 3KJFA 2H4XA 5HIJA 3VYVA 3D7NA 1XU9A 1Z3CA 3WGJA 4BE9A 3EGOA 3GGDA 1ISSA 3BFJA 3WO0A 4UHCA 2ZE6A 3LZCA 3NBFA 1N33B 2H2FA 3S1AA 2FR0A 3GPCA 1HA3A 1KMMA 3L7LA 4A92A 1R0KA 5ECWA 3M89A 3O7MA 4BQFA 3KQLA 2ZIEA 1L8QA 1ZN7A 3F2IA 1HYQA 3O95A 4URVR 3G2KA 5F1PA 3NR2A 5F4ZA 3ZDDA 4DA0A 4F11A 4XD7A 3LL4A 1ETHA 2HK7A 1MVLA 2C2MA 1SOMA 2Z4SA 3PXXA 1RKUA 1Y8RB 2Q5QA 3V34A 3VSBA 1UM9A 2EKQA 3V3TA 2NN3C 2JI6A 2HWKA 4PU0A 2D13A 1IC6A 8GPBA 5LUAA 5E2IA 3F7MA 5G1PA 4EG0A 1XQ9A 1PQYA 2Q99A 5A5EA 4MQ6A 1SIWA 2HQRA 5KTPA 1S2IA 3GPLA 1OHHA 1NDQA 2DQ4A 2G4VA 2HFJA 3VC7A 4LRYA 3FZNA 3ZZUA 1SH7A 4HDNA 4QPJC 4YV2A 5ITWA 4YAKA 5JFTA 2ZZNA 5SICE 3AHGA 2NUTA 3FUWA 1NXWA 4BNMA 2TSYB 3QUAA 1JALA 3RAFC 4M0KA 3H3FA 5DI3A 2HMSA 4J0HA 2CFIA 2GHQA 1Y7PA 5CG2A 4AX4A 3GJRA 2BLNA 3HRIA 1CUBA 1OW3B 1EPUA 2P40A 4INJA 4CIBA 1BS1A 2AR7A 3LFTA 4QUEA 4LZNA 1SHUX 4ID3A 4J8PA 3S27A 2DQYA 3D2BA 3Q5EA 1GUBA 3K2BA 3ZCTA 4A91A 1JNXX 4CM9D 1C2YA 2AOTA 1M7BA 5FO1A 1PVOA 3FG9A 4Q66C 4YR7A 4NYMQ 4KFTA 1U8UA 4MRMA 4WBNA 2SHKA 5B58C 4MO2A 3U6KA 3GYGA 3OY7A 4NX2A 2ZYUX 3EEIA 5HWSA 1FTQA 4DV3B 2OQRA 2R85A 1PI3A 2A7QA 1KC3A 3MWLA 3SXUA 4PC7A 2VPYA 5DIZA 5T6BA 1MVOA 3P32A 4LZWA 4ZAVA 5FFMA 3WWCA 2V6FA 3CNLA 3ZR4B 4CKEB 1E60A 5FYDA 2IUUA 3L7CA 1Q50A 1J1ZA 1TTPB 2X2FA 4IR7A 1G41A 3PD1A 4K8RB 5D5HA 4CM9A 3IV9A 4QUHA 4HWSA 1OVMA 1A0OA 1NP7A 3PLRA 4IIHA 1L8XA 1LQ2A 4WLEA 3SEQA 4ZYWA 1KYXA 1GFIA 1R5JA 3GWGA 3THOA 1PS9A 5I9LA 1Y9JA 4PO9A 3EUEA 2HCJB 1RYEA 2REQA 3A06A 4D6PA 2PFSA 4KE8A 4B5KA 1Z0FA 2DZDA 1C9JA 5CX4A 1RLMA 3VV3A 3GO4A 5T6MA 2HUNA 4D46A 1A9TA 4R4JA 4QNMA 3SHOA 1AB5A 2VLIA 2CCJA 3M6WA 5AVXA 1LSOA 3EDRA 3KQQA 2PJUA 3GJ8A 4K3UA 1P0PA 2I91A 2DBRA 3T1YB 221PA 3WGQA 1NZJA 4LOIA 5HIKA 4ZRDA 3OFNA 2M9MA 3DVQX 1JLSA 3RFXA 5IXSA 2ODBA 4Z99A 1E20A 4EF5A 5TDHA 4RM2A 4LF6B 3GARA 4GXQA 2HO4A 3TSZA 3K15A 3WY9A 3NI2A 5C18A 1UZAA 3O8OB 4FTWA 3PS9A 3GMIA 1OZGA 3ACCA 1IUOA 1IN1A 1T6ZA 1U4NA 2IP1A 1HLPA 3R5KA 3VSCA 1YVDA 4PX5A 4CKCB 1NASA 4U7FA 3R3ZA 3GFVA 1E4VA 1URPA 1KIFA 3O7WA 3WWDA 1NUQA 1TJ5A 4J3JA 3G1TA 5I01A 3E0XA 5F2KA 3RRJA 2WT8A 1QHHA 4OPMA 4RSHA 2DJIA 1P0CA 3QMWA 4YAGA 4BQOA 3ZXIA 3PZBA 1SBYA 4CT5A 2Y1LA 1U2GC 3DGFC 4ND5A 3LC0A 5JH7F 5DYWA 3S81A 1C8LA 1XZBA 3ONVA 2C2GA 3MOIA 5L4NA 1C0KA 2ERXA 2E9SA 3UMYA 1IPEA 5K3DA 4HG2A 3TQRA 2XUQA 4KR9A 1B0ZA 1T4DA 3QGMA 3S70A 2H0AA 3LKVA 4P86A 1NHGA 2ASEA 3CR8A 1UUFA 2CJXA 3KWJA 4WBSA 5KYWB 1KRWA 4DAEA 3WRWA 1NDUA 4BNGA 2BH9A 4AZ3B 1T5BA 1EMDA 4KO4S 2O23A 2O5VA 3OO1A 3QPCA 5BWNA 2HT1A 4AT1A 4J7XA 1K5HA 1TJPB 1V71A 3HR8A 1CRQA 4C3UA 1W4BA 2A30A 3VPHA 1LEHA 5TS2A 3QE9Y 1UMBA 2PAAA 2YN2A 4NENA 4RDCA 1SWWA 1HDCA 1YBHA 2UZAA 4UCQA 2FPKA 3Q88A 3OE4A 1E7WA 1ACMA 4WFKA 2W2XA 3TKYA 3VPSA 4E2YA 2ANCA 2QIPA 1S7CA 4KB5A 2V7QD 1F0YA 3N2NA 4AJNA 5HK9A 1QYCA 3ZTTA 3DFKA 2B1GA 4G0ZA 2WVHA 2MSKA 1T6BY 5IU6A 3RBXA 3B6ZA 4GEKA 3DC7A 3GD5A 1JQKA 3FCCA 5C1DA 4QM6A 1N5MA 2W90A 2V7UA 2VWQA 2G9QA 4ZDIA 3NQ41 1JVNA 1BCRB 1T6NA 2JFXA 3EF1A 5FO0A 3ZGOA 2BGWA 1PF7E 4O2LA 3D4IA 2HU2A 3OE7D 5D1NA 5LBTA 1Z5WA 1F5SA 3LZ6A 3MT9A 3NNSA 5LQCA 1KDYA 2YDYA 1L9XA 2Q28A 1L7QA 2XECA 4RHXA 1T5OA 2C8VA 2YJ3A 4RQTA 5EGNA 4E15A 5F9HA 2Y2UA 4EJ6A 1JZQA 3PE3A 1JHQA 2KMLA 5MN5A 3MA0A 2GLTA 1ONBA 4XJXA 5AJHA 4HNUA 3CLSC 4KGVA 4KN6A 1AT1A 1U8CB 2DOKA 1MG0A 2B37A 1Z45A 3DOHA 4HAZA 4NOLA 2I55A 1EE1A 1JJ7A 4N5NA 2WNSA 4X54A 5JMWA 3UHFA 4MRAA 1POXA 4P0QB 3ILHA 2H2DA 1YOVA 3DNFA 2FQ1A 5IW8A 3IUYA 1AQ6A 1FQJA 4WVLA 2DPGA 2FLKA 5AVJA 5AVQA 1BD3A 1GM5A 1OV4A 4KPGA 4UAUA 1XZNA 5DM2A 5CA0A 2QE7A 1C1DA 2AN4A 3NC0C 2KS6A 3M6VA 4IDNA 4K8OA 1RJ9B 3NT5A 3VPXA 3WO1A 3BHJA 5TXGA 1K75A 3ASYA 3TSWA 3K0SA 1OI7A 2BVNA 4XGRA 3U4QA 4Q34A 2I8LA 3UWSA 2FN8A 2VDWB 1V48A 1ZM7A 3HPQA 3D7KA 1HE1C 3DHYA 2HWYA 1BMQA 5F23A 4JLKA 4G2TA 3PQ5A 2Q29A 4BEVA 3OFSA 2HZBA 3I61A 1JKIA 4X8OA 1L5SA 3EFEA 3V8PA 3P27A 1L7DA 3N3BC 3QLUC 3URKA 4D4MA 2J0EA 1WKBA 1KEZA 1X15A 2HXGA 2XD9A 2YOFA 2JJYA 4M4SA 3D1JA 3I8XA 4O4IF 2IIPA 3OH8A 1N5IA 1Z29A 3EULA 3OCXA 4R51A 1GTL1 3K35A 2WZQA 3IEUA 4KIGA 3CWQA 1XCJA 4LDJA 1Z5PA 3W5SA 1V6CA 3TIIA 1KJIA 3I3SR 4BV3A 1NPYA 5A0TA 1L7XA 4GRAA 4C4XA 3UT6A 1JHYA 4JMLA 4K6OA 4DIFA 2J0QA 4YBZA 1IQUA 4JC0A 4K87A 3CNNA 2ZUUA 2NXWA 3H1TA 2XA2A 4G01B 1T8RA 2P75A 2RJOA 4W7SA 3VPAA 2BL4A 1L4YA 1YL7A 2XD4A 4Q3OA 4HEA6 3ZWQA 4UEKA 3QKTA 5BURA 5L45A 2QZ9A 4WEQA 4IXNA 4DWOA 1K4MA 4S04A 3IE2A 4YCCA 3H84A 3WXBA 2OO5A 2H2IA 5FEMA 3S0JA 3FNIA 4WN9B 3B9RA 3PR2B 1A4UA 2WVAA 3PQCA 1W73A 3GLIA 4K0KB 4QYTA 2WWYA 4YLEA 4HK4A 4WZBA 1HUQA 1OB2A 2D0IA 2RHDA 4NI5A 1RAFA 3RHZA 2O8BB 1U0GA 4JD5A 1M83A 3S2ZA 1UBGA 4DPMA 4E1BA 3LLSA 4EAAA 3E18A 4GI3A 4F97A 2UXBB 4BO9A 4AY6A 4NWIA 3ZLJA 1PAUA 1RDFA 4X7MA 3WMEA 2UYHA 1R8QA 4NYJR 2XOKD 1IZ8A 3JXEA 3OPYB 4IUBS 3KJXA 2I7DA 1IHXA 2F1JA 3CO0S 3FSEA 3T7JA 3TLBA 4OF4A 3CVJA 2LCIA 3HCDA 4R84A 5CFLA 4FFMA 3P9PA 1XLVA 3IUPA 3TZCA 3T6KA 3IMCA 3L93A 5ECDA 5LP6F 4AIIA 2OK7A 5DTRA 3BQNB 3IEXA 4UKDA 3PHIA 5DNDA 2VYCA 4A0HA 3IUSA 3KS9A 3G0HA 1N2XA 1BVHA 1GNLA 3E8SA 1T36A 5DW3A 1I3NA 2A78A 1J07A 3SM9A 4ERNA 4OAQA 5GIPE 3C8UA 3CZ9A 5DP1A 1VDZA 4F46A 4PYIA 3U4AA 2UZ4A 1CJMA 2DM6A 5FOWA 1KYYA 1QZTA 2FMTA 3UAGA 9MHTA 1YA8A 4GGPA 3DTNA 3KFXA 5J2TB 2C57A 5LQJA 5TB5A 5DBEX 3KUDA 3HJBA 4PSCA 1E4OA 4Z8YA 5F77A 4EG4A 5EMLA 4EY8A 4ZKDA 3JVIA 4M88A 3UWPA 4FE3A 3HR7A 3TMAA 4QOIA 2IEGA 5HKKD 3WLIA 4F86A 4HGNA 1OXSC 4BP1A 5EJ7A 3OJWA 2OXRA 2AF3C 5K8JB 4DIUA 5KBYA 4BQRA 1F1BA 3VR5A 3BMNA 3BGDA 3T0FA 2O2GA 2BW0A 4PHHA 3PBKA 4IVRA 3PC8C 3SYRA 3IEVA 2IJGX 4GR9A 3PP8A 5JAZA 3D7LA 2JPDA 3UUGA 4TUYB 1SOWA 3DLAA 1OX4B 1MC5A 1SOVA 2W2KA 5H02A 4ZZ3A 1ORVA 1WXQA 1K66A 2Q0HA 5IKPA 5H8WA 3QLVC 4ZI7A 4GVLA 5IUNC 4WJKB 5ALOA 2GEVA 1PHRA 3AUSA 1LGYA 2Q4RA 1AH2A 3DLIA 1UBTS 4I3FA 3BVPA 3UKDA 1OC2A 3A05A 1KO8A 3LUPA 3ZG6A 2B5OA 4JL6A 5J2UF 2GA8A 2AOUB 2GD6A 3CS3A 3MCUA 4DE5A 2O59A 2WF5A 1DXOA 3LT0A 2P77A 1QHXA 2ANBA 1C7IA 2PFGA 2WYHA 4EVIA 3ZXYA 3MWJA 4RHTA 1FK8A 2FWIA 3KKNA 3EW9A 4ZVRA 4E11A 3NVAA 5A04A 3IERA 1FDUA 2WZBA 4YYZA 3U6BA 1YZNA 3NJRA 5AQEA 1G8GA 1TADA 1HTTA 4LGMA 2EAUA 2HC9A 1FP2A 4EB6B 1EFPB 5CBPB 4KR2A 5C8YF 4F2GA 5SV2A 3ZV5A 3BZBA 1P2UA 2PMCA 4LMPA 2RGBA 1BX3A 3U31A 4AYXA 2Q6LA 5JBQA 3Q7RA 1NYLA 3IXLA 4FEAA 3N7AA 3IMGA 2CVFA 2LZ0A 4Y7CA 4CW7A 1ZR2A 1XF1A 4UNRA 4MIKA 4ZCTA 1FUYB 3OBIA 4RD0A 1KXJA 2FRVA 1IB6A 1SXJC 1TQ4A 2YFKA 3IUBA 3RU2A 4LYDA 3TAUA 2A1UB 1Z63A 3MTDA 4NV3A 5DNWA 4B6SA 3TIVA 1JHRA 3GJXC 4E6PA 1RM5A 3TR6A 4AYWA 3Q7TA 1V16A 4G9GA 4PYQA 5AKZA 5B1SA 3KXKA 3TMKA 1S5PA 3WZMA 3ZHZA 4P4NA 1RKVA 1SEPA 1W87A 2Q4DA 3KJIA 4Q7JB 4BFSA 1D6NA 3GL9A 3ZQUA 4A3SA 7YASA 4FBLA 1B6SA 5CUQA 4KWCA 5FOUA 3UATA 1D8TA 4WV3A 4JUIA 5EYPA 5LL6P 2TYSB 1WSBA 4OJTA 4HAIA 2RD2A 3LWNA 1PFVA 1ND5A 1YRYE 1XE3A 3CGWA 4O4IA 3EXG2 1P62B 1QCDA 3NDIA 4Z2YA 1QLWA 1CZOA 2RHCA 2ZAMA 3FPGA 3PJGA 4K7JA 1Z4NA 1NFQA 4LOJA 3BHMA 5LC1A 2XYPA 4BKPA 4MKFA 3TOVA 2BGKA 4BNFA 4Y6LA 1XLTA 1UJMA 4ZYXA 1KZGB 4EHDA 1C30A 3FW1A 1Y5IA 2H52A 2Q0SA 5E8RA 5HUQA 1IEQA 1U7DA 1DAIA 1JF8A 1YL6A 3KPUA 3SJCA 3IPCA 1GYRA 4JS0A 4ROSA 1N36B 2DMRA 6Q21A 2OB1A 4RHUA 1FQWA 1NZFA 3K9BA 3RAPR 3UJ9A 4ZRNA 3W8NA 3SR3A 2NTEA 1QYWA 4QTXA 2IBTA 2RGNA 1AXGA 3ZW8A 1MB2A 4GMKA 3V9PA 1EX6A 1OXMA 1P4SA 3ZKAA 4OXRA 3DZJA 2Q4EA 3THWB 1LVHA 2Z4RA 1YMUA 1FXUA 3QHQA 2PUEA 2AKYA 2Q0XA 2O06A 5THQA 3SF8B 2QN7A 2VPQA 3TLZA 4KVGA 5JJBA 3K9FC 2Q1YA 2WSLA 4WK6A 5DISB 3DNMA 1Z56C 3IP9A 3KOOA 3SYTA 4EKNB 4OI4A 2EF1A 1J0DA 3B3QA 5LQUA 1JQDA 1QWOA 1YKFA 3QLVA 1YNOA 4RL6A 1T2EA 1R8XA 5LYJB 5LA6A 4HAOA 4KJXA 4BQPA 2A5FA 3ANXA 3GGCA 4BEBA 3MTAA 3ETCA 4N01A 3S5JA 3WNCA 4CV0A 4DA7A 2ONKA 4Q3EA 4Y18A 2X2PA 3JQAD 4B7AA 4O2BF 3T7AA 5JD5A 4MWOA 2BTOA 1ZD4A 2NU6B 2RONA 2W71A 3H04A 2WAOA 4AY5A 3UVEA 3ZWAA 4FHDA 1J33A 3V6MA 4B8YA 1NTRA 4KK3A 4DKXA 1U6IA 4IOLA 1WMFA 3MW8A 1QOPB 1JG2A 1Z28A 1EP1B 5GJCA 1PKXA 3RREA 3UTDA 3GN1A 1RM3A 2H16A 1PL8A 2X3UA 1RKBA 2JKZA 2PBRA 2GPNA 2HLNA 1U9ZA 2HHAA 3TKLA 3WLEA 4LJ5A 4B3JA 3QYFA 1FSFA 5ALDA 3ZXUB 3ZEIA 1P19A 1P39A 3VR6H 2GK7A 3FVWA 821PA 2PQMA 1ZH4A 1C9EA 2AQKA 3DZ8A 4QDZA 2ZBUA 4RIIA 4EMTA 4OSEA 2IPXA 2C94A 3LXUX 4CMHA 3P2IA 1G3IA 3R3SA 1R6VA 4Q7EA 4RZSA 4RTRA 5C1IA 1P0QA 5BR8B 3GRZA 3H83A 4KVZA 2OCGA 3F74A 5CDGA 5K4AA 2I9PA 3BRCA 3VOTA 2VTBA 3HKEA 4BV8A 1JIXA 1L4LA 1K0UA 2H5JA 1JR2A 4M1EA 4P22A 3N0VA 5JPCA 5A6VA 4HQNA 4QEDA 5H16A 2FSHA 4P84A 4A5OA 5CX1B 4JYBA 2GN6A 2BDUA 3O8QA 4KSCA 1N7HA 1LDMA 3GFQA 4I5GA 1EFKA 5DGTA 4D98A 3C3EA 3ZVMA 3U7HB 5JNUA 1XWWA 5HF9A 4A1OA 3U7FB 3IRUA 1Q2UA 4ZZ1A 3G9ZA 2R7AA 2O7NA 2B8TA 1CQZA 2FUEA 4GM4A 1A69A 4G5FA 5HF8A 3QTBA 5FJIA 4F4CA 1TKAA 2J9FB 2LR0A 2IWRA 1KPHA 1XLTC 2FFAA 3CUWA 1E79D 1LS6A 5H3LA 2BH2A 1UQUA 3O1LA 5JZOA 2P8JA 2ZVJA 2WU3A 2JCVA 1IHDA 3ZCRA 5BN4A 2VJKA 1C4OA 3RK1A 1XB2A 1FSZA 2J46A 5EUQB 4E5UA 2NV2B 3UG7A 1T15A 3HNOA 4IUCS 4L0MA 1YRAA 2GHIA 4ATNA 3CVUA 1SC3A 5JNWA 4B4OA 1VG9B 3FPSA 2ZT7A 2MSEB 3MC1A 3WOVA 3IJRA 2ORYA 2O1XA 3NEPX 2GFQA 1WU8A 4LYEA 4B6PA 2Q6VA 5K3BA 4HB3A 4KNVA 4F6RB 1MD9A 2E2WA 1KNQA 4N5MA 2GEFA 2G67A 4HLNA 3NEJA 5F73A 3HSSA 2FSUA 1OWOA 3FR7A 2PUDA 2OXCA 1KY4A 3KZ1E 4MGIR 3B3AA 4R81A 3TQHA 4MWGA 4B4DA 2XKKA 1P2DA 4WKPA 1YQWA 4H6XA 2R6R1 1QKKA 4HTFB 4EIWA 1OJLA 2Q1SA 1A8IA 2AFHE 4F21A 4JSRA 4L50A 1A2BA 4MRVA 3SBEA 1S6YA 2HV9A 4OL0A 3KTDA 4QHSA 5KDLA 4EG6A 4LHYA 3O83A 3WIUA 4CLHA 1RI1A 4E2ZA 1WTAA 1NW3A 3EMVA 1TTHA 4NBVA 4HY3A 1PGJA 4W9NC 4XYMA 1Z16A 4MK4A 1ZG3A 3KXDA 4P53A 1W9HA 3C7CB 2AC4A 2EEZA 5AXDA 3INGA 3UK2A 4E13A 2X1HA 3MD0A 3WGMA 1NT4A 3V3KA 1VSTA 3NOQA 3O26A 1W1IA 3R41A 4RJJA 3I5XA 1XOIA 2UZ0A 5TMBA 2IYUA 3EZ2A 1KMHB 1DOAA 3QLTA 1ZI9A 3EJ6A 4Q02A 2IXBA 2J32A 3PD7A 1M2FA 5FV4A 1DEOA 2YJZA 3PUXA 4W5TA 2HUPA 4U7WA 1JL3A 3KG2A 3BTUA 1XRSB 3ANTA 4HYTA 4YJHB 3ROFA 2CLEB 2C29D 2PEYA 3PRHA 1Q0SA 3Q10A 3RYFB 3T7CA 1IBMB 4RTLA 1LLFA 5FA5A 3WBJA 3OQVA 2HWXA 1U0HC 4WMLA 4JKOA 1YS1X 3NJ8A 2FEOA 5BO5A 2YXNA 4F93B 1SK8A 1UFOA 5CJJA 3MJTA 4XH9B 4CPDA 4GPEA 2E21A 3DL7A 4G5HA 5EPEA 1FU8A 3B60A 3SXPA 1KYVA 1YCGA 3BQ9A 4D7AA 2GYYA 3I30X 3SSMA 4M8SA 1WABA 1ACJA 3NHLA 2H7VA 3PU6A 1ZC4A 1D09A 1LBSA 3ORFA 4G89A 5B4TA 2GPYA 3Q8XB 1N2BA 4AUEA 2AZDA 1G3MA 4CM1A 1ADGA 3A27A 3NT2A 1DFIA 3NNNA 1M6EX 4CNBA 2JATA 1GSOA 2OE2A 2P7IA 2VUTA 1T1EA 2Q3CA 4JHXA 4QOHA 4F1JA 3D2LA 3HMKA 3MK31 4KXNA 4WAUA 4TVKA 3BFXA 2ZWIA 1KGSA 1MNAA 4MR7A 1C30B 2ICAA 3N2KA 2C83A 4LVNA 5CB8A 5CFOA 1CB7A 3SC3A 4K9KA 4B0PA 2DUMA 1DAFA 3AG5A 3FWNA 2BAGA 3K8ZA 5FL3A 2QAGC 5JPIA 1FUKA 3RKRA 1WL8A 2V8OA 3W6UA 1QH0A 3ERCA 1UWVA 2PRJA 2V9CA 4IIGA 5JYDA 4BX2A 4QUKA 4B4UA 2NO4A 1AN9A 16PKA 2VH5R 3PDUA 1NM5A 3I2FA 3I5YA 2IEBA 1PGPA 3WYDA 1XYGA 5E7IA 1SC1A 1ZHOA 3B7GA 2XR1A 5AIBA 1LTQA 4C7OB 3ZGVA 1SFRA 1P5RA 4X0EA 1T6XA 3OURA 5J4VA 3WHKA 2IEZA 3EZ9A 3TL6A 2YNMC 3F6YA 3GLVA 3L6RA 4JKIA 1Y1PA 3WA6A 1HFJA 3F98A 2H9AA 2FR1A 1A8PA 3PXBA 4CQMB 4R2HA 3DBOB 4BNIA 5EJFA 3M9XA 1HPLA 3CG0A 1VKZA 3B9BA 1SIOA 2P65A 3CRW1 4FFVA 4Q4DA 5F5LA 3X1XA 1MOZA 3ZU3A 4AJOA 4UMFA 4XSGA 1W59A 2J6HA 4A2QA 1DAGA 3ZLVA 3NTXA 3RJZA 1EXDA 4J16A 1GQ2A 3JS5A 3LL7A 4HLUC 1OLXA 1V8FA 2ATVA 3PGXA 3V8VA 1P6UA 2QTAA 5LKRA 1BAPA 2BF4A 3RS7A 4D3DA 5J58A 1U81A 2E4ZA 4UAGA 1H65A 4X92A 4F9TA 5JCJD 3FOWA 1CY8A 2BGGA 4YRZA 1N5OX 2Y77A 2AFVA 2JA1A 2QMQA 1CEXA 1KHTA 1GQFA 3GLSA 1PDOA 1BFDA 4TTAA 3HV0A 1ZZEA 1ZMXA 1H6BA 4QE3A 2X9NA 3VQTA 3N0RA 3TWOA 5EMHA 4BO1A 2Z2KA 2R6CA 1X0XA 1Z82A 3W2FA 1CQIA 4K6GA 3P94A 4HMQA 4FGUA 1GZ3A 3TBFA 5BSKA 5JT1A 3AKEA 5DYIA 4G0UA 4INAA 4BLOA 1KI8A 1ULZA 3K0KA 3LLCA 4CIXA 3C4JA 3O73A 3M1IA 1IXSB 2MSDB 3C74A 2Q2WA 4QU5A 3TLXA 3V4FA 1B0AA 3LUDA 3H2SA 2C1XA 3K32A 5GM2A 1ZXLA 3D3JA 3P2KA 3HK2A 3KXLA 1L4KA 2I99A 2PS0A 5ERYA 2PKRA 3GEEA 4ZGBA 2XLCA 4GPIB 3A6LA 4NS4A 1O97D 2RIRA 3DEIA 3H4VA 3U4IA 5DEIA 1CY1A 3GNSA 4NPHA 2PRYA 4ZCMA 5B6JA 1UXKA 5ED4A 1RYNA 3T52A 2P3QA 2W4IA 3FLBA 3KPVA 1TXGA 5AVSA 3SFVA 5I7RA 4ZVQA 3G68A 3PHGA 1YL5A 1X1TA 4M1WA 2WSBA 2O1SA 4ONEA 4Y7DA 4LJ9A 4BQNA 2WMDA 3NIBA 1B1AA 3R0XA 2X76A 3QXXA 3WFJA 3NC1C 4LGVA 4JYAB 3AR5A 3PA6A 2FN3A 3OU2A 2IHZA 3BRSA 4HQLA 3G9XA 4QBTA 3RNLA 2GJAA 1Y4SA 1CZLA 621PA 3V4RA 1G0NA 2J7KA 2QN9A 3DTVB 4YUWA 1M9NA 3OI7A 3P7MA 3PEVA 4P4SA 4UVHA 3EH1A 4P6VF 1UZLA 4DLWA 4QYIA 1VI6A 2ZBGA 4J0QA 5JJCA 4KX5A 1J2YA 1X7XB 4L2IB 3SNKA 1KC1A 3K0HA 4YGXB 4IHAA 1E5LA 2ZJFA 1LTHR 4I55A 1X7YB 2R96A 2E85A 2HU7A 1CU1A 1GNQA 1ODSA 5F7OA 2H51A 4NCAA 1I0LA 4NIMA 3NV9A 1E4EB 1E2EA 3F8WA 3RROA 4DSOA 1KL7A 3B1FA 2AV6A 3EDMA 1W44A 2FQXA 3L8EA 4IF6A 4P4GA 4MYSA 4BCBA 3I04M 4IX1A 4FFSA 2PFKA 4MUKA 1Y8ZA 4Y1RA 4E22A 2OHGA 5FUYA 3A10A 5HK8A 2O2IA 3QI7A 4M83A 4JOQA 3UK7A 1UJCA 5FR2A 4DILA 1Q0TA 2QKYA 4ND4A 1Q3HA 5TARA 1LX6A 5KOJA 3T1OA 3FSRA 4XIIA 3SS7X 1GCOA 3OJOA 4K6FA 3F1KA 3OA2A 2IZZA 1VIDA 1ZN2A 4XOUA 3ITEA 1NRWA 4UATA 1DE0A 1PR1A 1MP0A 1XU4A 1EHCA 3B1KA 3GELA 4ZVVA 4F4IA 3WQRA 3ZJYA 3SYMA 3FLMA 4DQUA 3FFBA 2Q45A 1I8TA 3FUUA 3WKBA 2WM2A 1O9BA 4P08A 4N3GA 4JI7B 1E0JA 1Z07A 2C8KA 4K81B 1HRKA 2FX2A 2RHWA 4GFDA 4MVJD 1YA6A 4CEIA 2HI0A 1UDXA 4I4TF 2XCOA 1GCGA 4Y2UA 2VJDA 1XU7A 4QNNA 4MICA 4TVBA 2XRZA 1LWNA 1K7YA 4P3OA 3SX4A 4X44A 1M5TA 1KO5A 2WHYA 3FH0A 4GBMA 3G8YA 1M2VB 2RHLA 1A50B 2BCGY 4OK5A 4TKUA 4L8VA 4E4TA 4RIFA 5EMJA 5HRAA 1XQ1A 1BDIA 1IIBA 2RDMA 2IEIA 4ABTA 3SS9X 3WK8A 4AWBA 1PJ4A 5LXTA 2ZE5A 2YC2C 4JKYA 5HEKA 4AF6A 1G3QA 4IMIB 4HUQA 2CHVA 4PXSA 2IV2X 2VI5A 4CQNA 1THGA 1VSVA 5EIXA 4JCCA 1TU4A 3BE4A 3E9CA 3TR0A 3F73A 4HWKA 5IH3A 2DKOA 1LSJA 1BC5A 1THTA 2OOSA 3KETA 3C48A 4CKWB 1RRMA 4TKLA 3PDWA 4KODA 1I0IA 1SC4A 3EIUA 2HHCA 3GW8A 2XZPA 4YRGA 4LA4A 5JZMA 3RS0A 2VT6A 4WXYB 1BFUA 5FA8A 1C1DB 3D81A 5JDIA 3ZZNA 3GP8A 1VKNA 2I1WA 1QAMA 1ZUNA 3KUXA 1Y3BE 3GFBA 2I8CA 3SLKA 4EF4A 1M2KA 2O1WA 3HB9A 4UW9A 1CUHA 4IEEA 1W2WB 3DFIA 3O4JA 1PJCA 1N0UA 4R41A 1OFGA 5D2CA 2OV1A 5D8DA 4IXTA 3SYLA 3I62A 4R6XA 2E49A 3LH5A 4A27A 1KKUA 1D5WA 2QN2A 1KFBB 1QQAA 4BMPB 1KYZA 5LZ4A 1M67A 5GPBA 4ZICA 5INTA 1K2WA 3N6RA 4DJJA 4YROA 5I5GA 3R6WA 5BYJA 1XZMA 3DQQA 4XGQA 5PGMA 5CEJA 4A6PA 3IB6A 3OEHD 2ZRDA 3E7FA 5ALHA 5D3MB 1D03A 5BUSA 5KDDA 2WAYA 1S4QA 3DBVO 3ZI4A 4YAEA 1RM0A 1YCFA 2HWUA 5G0UA 4BX9A 5JDCC 1EX1A 2DXIA 1T2UA 3ETDA 2BC9A 2YQ5A 4M6WA 1UR5A 3S1AB 2R6JA 4OU4A 4UDNA 3VO9A 3WLNA 4UTVA 1A5AB 1JE1A 3KX2A 8ABPA 1RI5A 2P2SA 4KE9A 4C4TA 3QG5A 1Z7GA 3CVYA 1CV2A 4RLHA 3NWEA 1WJGA 1X87A 2JK1A 3R2JA 3AI2A 2QLJA 3DF9A 4CKZA 3T5AA 2FFQA 1ZW6A 2FPGA 2IPNA 5COBA 5LIRA 1NAIA 1ZUHA 1MLDA 2ZTHA 4MW9A 4G4GA 3EWNA 3GYBA 3HEBA 4YRRA 1X1AA 2J48A 1HI9A 1SULA