2HMSA

Rectangular-shaped octameric ring structure of an rck domain with nadh bound
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
138
structure length
138
Chain Sequence
KQFAVIGLGRFGGSIVKELHRMGHEVLAVDINEEKVNAYASYATHAVIANATEENELLSLGIRNFEYVIVAIGANIQASTLTTLLLKELDIPNIWVKAQNYYHHKVLEKIGADRIIHPEKDMGVKIAQSLSDENVLNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The RCK Domain of the KtrAB K(+) Transporter: Multiple Conformations of an Octameric Ring.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Membrane protein
molecule keywords YuaA protein
total genus 44
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02254 TrkA_N TrkA-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2hmsA00
1EQ2A 5KVCA 1PS0A 2BHLA 2NQTA 2PR2A 4FFNA 4FOSA 1J6UA 2DBRA 1CQJA 4NU5A 3L6DA 2PZKA 3RASA 3JQAB 2QG4A 3H65A 2O2SA 1V9LA 5TLSA 4XR9A 5IDXA 4LW8A 3DOJA 5BSHA 4XIJA 2WD7A 1WXDA 1YL6A 4WLVA 1F0YA 1GZ6A 1LXCA 2D0IA 4GX1A 4WASA 3QVTA 3SVTA 3GNSA 4YBZA 2P9GA 4UVEA 3ZV6A 5I8WA 5L45A 1E7RA 1D1TA 4A73A 4IJKA 1T24A 1BVRA 2YYYA 4IXWA 3GGGA 1UZNA 1LLDA 2QX7A 1KETA 4BNXA 1KVQA 5DOVA 2X9GA 2VWQA 4BV9A 1G6KA 4N5LA 2EP5A 4GGPA 5HBRA 3BTSA 4R9SA 4NG5A 2BGLA 1VSUA 4EUHA 2GDZA 3D1LA 4N7RA 2AEMA 4CV0A 1BGVA 4J9VA 2WDZA 2GN4A 1KBZA 1DIBA 3GUCA 3RC2A 3RU7A 4DA9A 4NI5A 3I9LA 4MKZA 2BGMA 4Q3BA 3JQBA 3O9ZA 3IL2A 4CLRB 1Z6ZA 2NVUA 3IP1A 4PLTA 4FSHA 3L6EA 4WLNA 4J2OA 3G3EA 2WM3A 1YH3A 2HMWA 1BRMA 1DLJA 2O3TA 4B3HA 1LQTA 3ORFA 2NLOA 3AOEC 5I7FA 3VPHA 3E03A 3LT1A 1C14A 4X54A 4BV8A 3RIHA 1KYQA 3K8ZA 2EIHA 1M67A 1Q7BA 1KVTA 3DZJA 2NSDA 4MVJP 3NYWA 4L8VA 3BMOA 5TQVA 5JDCC 4NR0A 3ZCXA 4BO2A 5B4VA 5JBIA 4HBGA 1IZ9A 1ZVMA 4II3A 4JCOA 1OOEA 2DFVA 3MTJA 3ANNA 4CL8A 1FXSA 4A5OA 4BNWA 4XB1A 4IQGA 2CD9A 2JAPA 2OFPA 3FTPA 1NTOA 1Q0LA 2AHRA 4GLLA 1LA2A 2Y1EA 4ZQEA 3PGXA 4KP7A 1P1FA 4GX2A 3JV7A 1V8BA 2ZKLA 1BXGB 4U8GA 4MIYA 5J23A 1HZJA 3OJOA 5DBFA 4BNZA 4EUEA 4YPOA 5CDSA 3MJTA 3ANLA 3HN7A 1O8CA 1PJCA 1YQGA 1ZMOA 4FJ1A 4AG3A 3AM5A 1T26A 1MUUA 3A06A 1G1AA 2I5PO 1R4NA 3K30A 5DOZA 4IJWA 2AW5A 3DZFA 1Y5MA 4NFHA 4CM8B 1VKNA 1ISFA 1BVUA 3FWNA 3G1TA 1L7EA 5BQFA 5ENVA 2C2YA 3KYDB 1XU7A 1LSJA 2BGKA 1SB8A 1E7QA 3HDQA 3M1AA 2GPTA 1SZJG 1E7SA 1DOHA 1N92A 3D3EA 1ZK2A 1GYRA 2XXJA 1U8FO 5ILGA 3ZN2A 4DTIA 3DHNA 2WE7A 2PTGA 3OIDA 1VL8A 5L95A 3DOCA 3H3FA 3JD0A 4YCAA 2BLLA 3DHEA 1ZKMA 5TC4A 2BFMA 1VJ1A 3I83A 1AUPA 5A3VA 5L53A 1C0KA 2AEFA 4CQMD 3PGJA 5G0TA 3F4BA 2GCGA 4AJ1A 3X2FA 1X0VA 1D4FA 1K5HA 1DFGA 2BI7A 3GG2A 4OXYA 3EC7A 4N54A 4RVFA 5ADHA 3EY4A 2V6GA 1FDVA 5CG1A 1Q2XA 4BB5A 2EHDA 1Y9EA 2EWMA 3HJAA 4O0LA 4B3JA 2WJPA 3F1KA 4CLOB 5BSGA 1GQ2A 4TRNA 3NTRA 2VOJA 4ZQBA 4AJIA 4CM4B 2VHVA 1WWKA 3VZRA 3DZGA 3PHIA 3JD4A 4L9RA 2I67A 4A27A 1QXSA 4WCFB 3D5QA 2E82A 3L77A 4WEOA 2O3UA 4R1TA 2CY0A 4TKLA 4BKUA 3PHHA 2G5CA 4GI2A 1PWZA 4TVBA 3D0OA 1JWBB 4N5MA 4CR7A 1K89A 3QVSA 3GHHA 2J8ZA 1HYGA 1U3TA 2X58A 3AI1A 3KM0A 2W2LD 2I6TA 4BKRA 3H6KA 3PJFA 1OC2A 4NNJA 5AYVA 1V3UA 4NFSA 1SC6A 4IMPA 4AJ2A 5LCXA 3F47A 3FN4A 4UVGA 5KIAA 1EFKA 4GSLA 1R16A 2Z95A 4CR8A 2D1YA 1J49A 4TRJA 2NTJA 3UKOA 1HDRA 3KLPX 1CWUA 3JQBC 5L40A 3INGA 3B70A 1M6WA 2O7SA 5IXYA 5JC8A 3V2GA 1HDCA 3E48A 4IBOA 4U0JA 2NVWA 3U0BA 4HFNA 3I4CA 1N1GA 3CXRA 5T6BA 1P77A 4XA8A 5JAIA 3AU9A 3JYOA 3IS3A 3TOZA 3ZW9A 3IKVA 2DUUA 3PLNA 5KJEA 4EBFA 5TF4A 3L4SO 1A71A 1SBYA 5L7YA 1HYEA 2ZIZA 3JQAA 3D3WB 4D41A 2Q1WA 3ZWXA 3A14A 4OL9A 4HFRA 1P33A 1FDWA 3RROA 1GYPA 3D4OA 1HSOA 3WSVA 2JL1A 4AJNA 2VOEA 2RH8A 3DWFA 5JS6A 4R3WA 4ZGWA 1DAPA 3OQ6A 4FCCA 4PLCA 3MJVA 3R3SA 1ID1A 4J90A 4BNNA 5T5QA 1A7AA 4WLEA 1YJ8A 4MP3A 1GQYA 3H5NA 1HETA 1E1LA 3IOYA 3EUWA 4DBZA 2J3JA 2VN8A 1GAEO 3JTMA 3VOSA 1PL7A 1YQXA 2HJSA 5TX7A 4XQEA 4NJMB 2A9FA 1DRWA 4IQ0A 1ENOA 1JTVA 4WCDA 2JFHA 1P0CA 1GUZA 1LX6A 3L6OO 1VJTA 4F6CA 2PNFA 3DB2A 3GPIA 4NK5A 5T8KA 4B3IA 3A28A 3VKUA 4Q3AA 4UVDA 3HUDA 1PGQA 2D59A 3GZNB 2ZQYA 3H8VA 4I9HA 3DDNA 2OGUA 3JSAA 1S7CA 1ML3A 2WMDA 3NT5A 4U7WA 1PWXA 3WS7A 4CUKA 2X23A 3I5MA 4J4TA 1F8FA 4CM9A 3HSKA 3DHYA 1MV8A 4C7KA 2PK3A 4JP3A 3C1AA 2C54A 3WYCA 5I7EA 3KUXA 4FOOA 5DNAA 4A03A 3EDMA 4XJTA 1GUYA 1WAMA 2GASA 2YV2A 3ZW8A 4HV4A 4RPLA 5I9LA 1AE1A 4E5MA 2J3HA 1BSVA 1UXJA 2VRBA 2VYND 1U28A 1ZJYA 2VTDA 4NHEA 1YDEA 2NTNA 4O59O 1YOVA 4P4NA 1NFQA 3RKRA 1GD1O 3E5RA 4CMGA 5A1TA 3U4HA 4XX0A 3S55A 4Z3KA 2JCYA 1ZW1A 4E2ZA 2B5VA 3KYCB 5JFOA 4K6FA 3JQ7B 3WIEA 1A27A 2YFQA 2RHRA 4KMSA 4RO0A 4ZN6A 2EP7A 3GZ4A 3T7CA 2Y0EA 5C37A 3JCZA 4LMPA 2HMTA 1H6CA 4RGBA 5L7WA 4TWRA 1EEHA 3A1NA 1ARZA 1HE2A 1VJ0A 1RWBA 2VT3A 3HFSA 3I52A 3L9XA 1PX0A 5IN5A 2DC1A 1MA0A 1EDOA 2HU2A 2NU7A 4E4YA 4Z0TA 2EGGA 1A7KA 5FYDA 1VRWA 3LLSA 2BFAA 2J6IA 1FK8A 4OH1A 4MKRA 3E9QA 3EZYA 5HS4A 3T4XA 4PVDA 2AE2A 3VDQA 3O26A 3WR5A 4AJ4A 4IDCA 4BO6A 2IEBA 3OFSA 1OFGA 1TT5B 1DFIA 2TMGA 4ALJA 3AUAA 2DPHA 1CQIA 3DZBA 5FEUA 3GC6A 2C59A 6ADHA 1M2WA 3FR8A 3L4BC 4L74A 3ANMA 5MDHA 3ZV3A 4I5FA 1G0OA 3GVIA 1IB6A 3PXXA 1MXFA 1TLTA 1XA0A 2B36A 3Q11A 4ZQFA 4J9UE 2H1SA 3ITDA 4LCJA 3KXDA 4R16A 3VC7A 2I3AA 4CM9D 1PZFA 3F46A 4HXYA 2A92A 4WLFA 3AW9A 1L7DA 1VSVA 3W4KA 1PU2A 3U3XA 4I8XA 2X0RA 4AJOA 2JCXA 1N9GA 4FD3A 1ENZA 1EVJA 3CMMA 2Q45A 3GGOA 5A06A 1HYHA 1R12A 3Q2IA 4IXTA 1X1EA 4BNIA 4E33A 4KUHA 4DREA 4ZD6A 2QRLA 5CDGA 2EJVA 3DFZA 4D42A 4BNHA 4YAGA 2PKQP 2IXAA 4ZVVA 4ALIA 4BNFA 4D46A 3WYBA 1I5RA 1H6BA 5L51A 2JJYA 2P5UA 3AY6A 2PKQO 3H5RA 1I30A 3VDRA 3B1JA 4NBWA 2GN9A 5GMOA 3OJLA 3ST7A 1HE5A 4P22A 1UH5A 3WLFA 1SOVA 3KEOA 3TZ6A 1BW9A 2VT2A 2DTDA 1LI4A 2VUSA 4IDDA 4N18A 3JQ9A 3PDUA 3KO8A 4OQYA 5G0SA 4YAIA 1JVBA 2QYTA 5IG2A 3GNTA 4CQMB 2QIOA 4II2A 5C7LO 1EQUA 4FPXA 3KETA 4F3YA 3UXYA 1P1KA 4HWKA 1TT7A 1E3SA 1PL8A 4RV9A 1KEWA 2DBVO 2TMDA 3QWFA 4KTVE 2F1KA 7MDHA 4YJHA 5T8KC 4O63O 4B8ZA 2VZ0A 2HK7A 4RLSA 3DTTA 3WG9A 2VHYA 2X9VA 3TSCA 3ZZNA 3CINA 2AMFA 3K9QO 4WK6A 4XKJA 4E2WA 1NBOA 1Z45A 1H6DA 4Z9XA 1K0UA 1CYDA 1I32A 3KYCA 4H15A 3GA0A 5B4UA 2AQ8A 1WW8A 2HUNA 1MP0A 2GD1O 3DZIA 1PZEA 2Y66A 4PLZA 3FHLA 3PEFA 3BIOA 2OHXA 5KKAA 3KB6A 4EJ0A 1FDUA 1N7GA 1M6HA 4ZQHA 1O9BA 2VQ3A 4CMHA 4B4VA 4R01A 3S2EA 4XYBA 4J0EA 3WSWA 3DAFA 3RFXA 1PJ3A 3ZGYA 2H6EA 2FZWA 1N5DA 4B79A 4GL4A 3UCXA 2XF8A 1DAOA 5DP1A 3W4IA 5B1YA 3RJ9A 3VH2A 4EEZA 2YDXA 1ENPA 1U3UA 2X22A 3JQDA 2VWHA 1GYQA 1E7WA 4JGBA 3P5SA 3GMDA 1HLPA 4U6QA 5F1KA 1A4UA 1KVUA 4GMFA 3LVFO 2DUWA 2AXQA 3S2FA 2NU9A 2J3IA 3UHAA 2CSUA 3GZNA 2O3RA 2V6FA 1XSEA 2WD8A 1W8DA 1LDMA 5EERA 1E3JA 3VPXA 1KY5A 2DQ4A 3RU9A 1LLCA 5K6AC 3LK7A 1QYCA 4PRLA 3OMLA 2NACA 4DMLA 2GNAA 4Q3CA 3ZU3A 1F06A 2AG8A 1E6EA 2DAPA 4AJHA 3SXPA 1PGNA 2VRCD 1GCUA 3NKLA 2E37A 2FY8A 3PIDA 3NDJA 1S6YA 5IZ4A 2OP0A 4TMFA 1B8PA 1U8XX 4TKMA 1YVEI 1RPNA 1FDSA 1HT0A 4UUMA 3LT0A 2Y1GA 4KDEA 3K96A 4JP2A 4E30A 1ISGA 4A2CA 3BMQA 4DC0A 5COBA 5CP8A 3K5PA 3FRJA 2Y1OA 2B4RO 4IPTA 3RC7A 1ZH8A 3NT4A 2YY7A 1KIFA 1X7GA 1YKFA 4CV2A 1ZIDA 3UICA 2WTBA 3C1TA 4IDBA 4XRRA 2FPPA 3BTOA 5G0VA 4PFJA 2IYOA 1LBEA 1BW9B 3U4DA 2A94A 2YJZA 1UDAA 1RM4A 3DZKA 4GLOA 3ZHYA 1SEPA 2GF2A 2Y1FA 4B4UA 2EGHA 4IDEA 4J6FA 2WD7B 3V1TC 1E92A 1NM5A 1T1RA 4WOJA 4JQCA 5JY1A 1Z74A 1ZFNA 3FD8A 1HTBA 1C1DA 2VWPA 1ZK0A 2P4HX 1CJCA 4RL6A 4YB8A 5EIOA 1VI2A 3CH6A 3KYBA 1PJLA 1R0LA 2ZQZA 2CFCA 4YT8A 3RQSA 3B1KA 1I36A 1MXHA 4FDAA 3ETEA 2CF6A 3BHJA 4BO7A 1H5QA 3GVPA 4NQZA 3FBTA 3QLJA 4PIVA 8LDHA 5AQ1A 3CPSA 4XQCA 4HP8A 3HFGA 2DBQA 3OBBA 3RBZA 3PTZA 2HK9A 2OOSA 4PLVA 2QHXA 1ZEMA 1PGPA 5MGBA 4LVCA 2CDBA 3BMCA 4D79A 1LSSA 2BMAA 5A3JA 4RVGA 3WB9A 2BF7A 3LF1A 2P4QA 2HLPA 4ALLA 1BDMA 1CIVA 1DPGA 5IAAA 3WGZA 4UUPA 5DDIP 3BZUA 1UUFA 4Q3EA 1TXGA 4UUNA 4A7PA 4I9NA 3QY9A 1E6WA 2GERA 4RZIA 3NRCA 3OF2A 2Y1CA 3HADA 5G0UA 3AWDA 3V1YA 5KVSA 1VE9A 2UV8A 1EE9A 4CM4A 2OL4A 5LDHA 1PQPA 1LJ8A 1DC3A 3JQAD 3TDKA 2ZB7A 3IAHA 1I8TA 4AJJA 1FDTA 4RQUA 4L0QA 4FFPA 4JBHA 5A04A 4JBGA 3RC1A 4OXKA 4DIBA 4BNYA 5EPOA 4E31A 1XCBA 1ZCJA 1UZMA 4M89A 2JFFA 1JVSA 3WQRA 4DQUA 4QO7A 1Y5RA 1QR6A 4XQ9A 3KV3O 2W2LA 2EKQA 1VL0A 2DT5A 2EW8A 2X9NA 4INAA 3JYLA 2X6TA 4U6SA 3JD2A 3NGXA 5AXBA 1QLJA 3WMWA 3GDGA 2O23A 4AL4A 3I3OA 2EG9A 1BXGA 5JDIC 3IKTA 4D7AA 1GZ4A 1AXGA 3N74A 3UW3A 5HTOA 2LDBA 3FR7A 3ZWCA 1GV1A 1U3VA 4L76A 1NPYA 1EUDA 5HRUA 3H9GA 3WGYA 4CV3A 3ZWOA 4OSOA 4ZA2A 4M1QA 5EINA 3L07A 3OQBA 2WE8A 4L4SA 3H9QA 4BNJA 3UCFA 2GZ2A 2V6BA 2YQ4A 4U5QA 3TL2A 4KZPA 4E32A 1HE4A 3DC2A 1RYEA 1ZMTA 4W99A 1BMDA 3TPCA 4BNLA 4IM7A 4E2YA 2DVMA 3JQGB 3BHIA 1C0PA 4QECA 2YV1A 4L73A 4Q39A 5I7SA 2HAEA 4YJFB 3E5MA 4DMMA 2PZLA 3UGKA 1EVYA 3UH1A 1PJTA 1QMGA 4O5OA 3JD1A 5CEFA 2ZB3A 3DTYA 4NPCA 4ND4A 1F8GA 3UF0A 1ULUA 2GZ1A 1I10A 2VTEA 2O2YA 5AXDA 3A4VA 3FNEA 4R41A 2NVUB 3TOXA 4CLRA 4WE3A 3PJDA 2FZEA 3ADPA 1PJ2A 4MO2A 3TZQA 4CLXA 3ZH2A 5C7IO 4BO0A 2ZTLA 4RORA 4CJXA 4L75A 4DGSA 4WNIA 1VKOA 4E12A 2AQIA 3LYLA 1R6DA 2GYYA 2RHCA 1C1DB 5U1PA 4WGGA 1EK6A 1N7HA 1XLTA 4J3FA 4R3NA 4W7IA 7ADHA 2B69A 2RH4A 3I9KA 4WOKA 3U09A 1XR3A 3OEYA 1GCOA 5I7VA 3GMSA 2CDAA 4K26A 3BMOB 1WP4A 3P19A 5DF1A 1F12A 3WNQA 4JIGA 2FN7A 1VC2A 1V0JA 4WUVA 4CMCA 4ND1A 2Q4EA 3QJ5A 5DCYA 3SC4A 2RIRA 2O48X 2X86A 4TSKA 4YJGA 3C8MA 3INTA 5TJHA 4CQLA 1ZK1A 4GSKA 3A9WA 4Y67A 4R1NA 3SJ7A 1P74A 1YQDA 3AY7A 4EEXA 2GR9A 2PGDA 3E9NA 4TROA 3PHLA 3OIFA 3DZHA 4CMKA 4QEDA 3VVBA 1PGOA 2X0IA 3DMTC 3NT2A 4B4OA 4ZQGA 4YAKA 1AXEA 4HNGA 3GVCA 1PZHA 3ZHXA 1ADCA 1NAIA 3N7UA 4XYMA 3BAZA 2ZTMA 3E82A 2VYNA 3P7MA 3WICA 1JKIA 4CLEA 1NPTO 3RUFA 1NX6A 2FMUA 4FGWA 1UXGA 2OO5A 4IJVA 1I0ZA 2PGJA 2Y93A 1NHWA 1YONA 5COAA 1XKQA 5KOIA 4Y6SA 4AJLA 1NFFA 1DC5A 1ZO8A 1T2AA 4I5DA 4YEDA 1Q7GA 4Q3NA 5FWNA 1EBUA 1QSGA 2EF1A 2Z5LA 5HA5A 2PD3A 3R6DA 3VTZA 4XD2A 2ILTA 5ICSA 5F21A 1E5QA 3ONDA 4MDHA 3RUIA 2D4AA 2FRDA 2NTVA 1NFRA 3EHEA 3PI7A 4DLAA 1B2LA 2IDZA 1DJNA 3AUSA 4OIMA 3FNFA 4M86A 1HZZA 1I3KA 1XIVA 2AG5A 4I5GA 1DB3A 2W2KA 1LLUA 3AOGA 3LLVA 4AFNA 4QFDA 2YHIB 5EESA 3RBVA 3VH3A 2G82A 2Q99A 2P2SA 3GVHA 4J91A 2NV6A 4CQMA 3QWAA 2HMVA 4J1NA 4ND2A 1WNTA 1B3BA 2WWRA 4EI2A 3C7DB 3ASVA 4A26A 3AFNA 1YBMA 1UR5A 1Q7CA 3JQFC 3SC6A 1JDJA 4FFRA 4TRMA 1T2DA 4NIMA 2QYSA 4D44A 1JN0A 1IHXA 1RM5A 4CV1A 2FWMX 2ZATA 1EVZA 4R69A 3VH4A 3VPGA 3I9JA 3OH8A 4NBVA 5JO9A 4YT4A 4XGKA 1JAXA 4TZTA 4D0SA 3BMNB 4RF2A 5KCZA 5B4TA 3B1FA 3GK3A 6LDHA 4PG6A 3D7LA 2I66A 2Y0CA 5TJ9A 4EGFA 2IEDA 1E6UA 1IL0A 4R4JA 1EUCA 5JE8A 1SNYA 2EW2A 3WGGA 1ULSA 3U4CA 3H9UA 4OJNA 3QW2A 1P1JA 1D1SA 2AEJA 1E3WB 3GVXA 3WX0A 1HLDA 4JROA 4WNCA 4YACA 2P68A 1DIAA 5I8ZA 4BHTA 4FN4A 3DBLA 3FBGA 5A5FA 5TRTA 3CIFA 3PHJA 2ZB8A 5CPFA 5HS6A 1PEDA 3QRWA 1Y8QB 3ROMA 3LQFA 2ZYAA 4YJGB 2CVZA 3QWBA 2P9CA 3WTCA 2H63A 3WBFA 2JFGA 5JCXA 1LRLA 4ID9A 4J1SA 3IMFA 4UEOA 1UZLA 3O03A 3GG9A 4CM3A 2EV9A 3FF4A 4NBUA 4YDRA 2UDPA 4PVCA 4W82A 1UP6A 2VYVA 1DFHA 3HDHA 2Q4BA 5FFFA 1X13A 1PQUA 4QX6A 4JJIA 4Y6RA 1UDCA 4BNGA 2NUAA 2IRWA 3ZWBA 1GV0A 3SBOA 4BKPA 4MVJG 3PZRA 4HFMA 5ILOA 4GBJA 4GVXA 5BNTA 1LDEA 4YR9A 5ER9A 4DQXA 2YHUA 3F5SA 1K6IA 2B37A 4EZBA 1DHTA 3G17A 3HB4X 4PG5A 4B7CA 1WDLA 1Y8RA 2Y99A 4MVJE 4YT5A 4YVFA 1I24A 1DEHA 4GQAA 3CMCO 2ZK7A 3TRIA 4YJFA 4XYEA 5DBGA 2DM6A 3E6AA 4BVAA 4ZICA 5CHEA 3WGQA 3L9WA 1JWAB 1T4BA 4CM6A 4E2XA 2FSVA 2OORA 3NDRA 5IDQA 3NEPX 4DPKA 1AHIA 3PHGA 3GEDA 1HKUA 2DPGA 3DBHB 4BKQA 4CM1A 3QV1A 1E3LA 1WVGA 1PJBA 1DXYA 4D3DA 1UAGA 2O3SA 3WIDA 1VPDA 5TGDA 2LDXA 4IGEA 3P2OA 2C82A 1VM6A 3FPLA 5AXCA 3BA1A 1NPDA 2G76A 3HWRA 2E49A 3R3JA 2R00A 3IQDB 5COQA 3UOGA 5C5IA 1ISIA 3WWYA 3STHA 4BNUA 2I9PA 3E9MA 5TIIA 3SJUA 1NNUA 3GGPA 1M75A 2OBNA 3G49A 1WLYA 5F5LA 4R9RA 4HKTA 1O5IA 5L4LA 2A4KA 1YBAA 1EE2A 1IOLA 1UDBA 3ZU2A 1E3EA 4DXHA 4OGWA 4PLFA 3PIIA 2I3GA 5BNFA 2E4AA 4I5EA 1SAYA 4GKBA 2IZZA 3KOUA 3GN2A 2YV3A 1LDYA 5BR7A 2R6JA 3CSDA 5JW6A 3RUAA 2BI8A 3BTUA 3CE6A 1ZBQA 4MVJM 4XYLA 3Q9NA 3PFFA 1IULA 3I1JA 1AN9A 2Q49A 3TZHA 3LU1A 2POQX 3AUTA 4WJZA 2A35A 4MVJD 4QT0A 1WMAA 3I6QA 3PK0A 1YBVA 2W90A 3GQVA 1LRJA 4GVLA 4LN1A 3V2HA 3GDFA 2VUTA 1QORA 1QYVA 1ZXLA 2D8AA 1ZUD1 2QZZA 4XGIA 2W4QA 1UP7A 1Z82A 1U1IA 1T2CA 5EQDA 3F4LA 2WYUA 1TA4A 4BNKA 1N9GB 5IFLA 4OAQA 1CETA 4NMHA 5AXAA 3VKVA 1K3TA 4XEHA 3SEFA 3WWZA 1LSUA 4F6LA 1YL7A 5ITVA 3WMXA 1J4AA 4PGFA 1NR7A 3MOIA 4WCFC 2WSBA 3K6JA 2FR1A 2I65A 1ADGA 1OMOA 1FJHA 3OHSX 5JMPA 3HG7A 1R4MB 2B83A 2X0JA 3MJ4A 2X5KO 4BGVA 1DC4A 3MJCA 1B15A 3T7EA 3TNLA 4M8SA 3VZSA 3C24A 1HDZA 5CEEA 4RCVA 1H9BA 1YL5A 1Z73A 1NR1A 5JPIA 2W8ZA 3OA2A 4KQXA 3NDIA 4CPDA 2OP1A 3LC7O 4KTTE 5TNXA 4YRBA 3GF4A 4F46A 1JU9A 2DBZA 1NWCA 1PR3A 1PJQA 4O6VA 1YB1A 3B20A 3COSA 4FJ2A 1H9AA 1HXHA 2H9IA 4TRRA 3U9LA 3R0IA 4Y8VA 1A4IA 4PG7A 1JKFA 5JAZA 2I76A 1IHYA 4BO5A 1H6AA 1ZSYA 3KZVA 5A9SB 3ICCA 5F1PA 3AFMA 4BGEA 1AHHA 2O3JA 1GEEA 3EMKA 4DQVA 2BD0A 1WDKA 2OBYA 3EK2A 5KVVA 4PG8A 4PLPA 5JCJA 4DRYA 4LK3A 5IZCC 3GRKA 4J49A 3WDSA 2ZYDA 1UJMA 1X7HA 5IXSA 1YWGO 4KWIA 4XZ3A 1V3VA 1UXHA 2YW9A 3TN7A 2DFDA 4CMJA 4KOAA 2BFPA 4HADA 1R15A 1LDNA 1GDHA 3OP4A 5FF9A 4IY1A 3JQEA 3M2TA 4C4OA 5TSDA 1HE3A 2V7PA 1JLLA 1LLQA 4CLOA 3RVDA 2X5OA 1WPQA 2BH9A 2JKVA 4K6CA 3UUWA 3GPDG 3W1VA 3ICPA 4EW6A 3H4VA 4HNHA 5JNLA 5JC1A 3GY0A 5KWEA 1DRVA 1ZNQO 3K2BA 3FNHA 1R4NB 1Y81A 5A03A 2IZ0A 3DMYA 3TJRA 5K6AA 4CLDA 3KTDA 1PZGA 1P0FA 5JDIA 2PLAA 3LF2A 3ZWYA 1V6AA 5JY6A 4XIYA 3DEYX 3RFTA 1HSZA 4DUPA 3GLQA 3C3XA 3DL2A 3GOHA 2ZTVA 2CUKA 2GO1A 3JQ8A 1I2BA 3Q2KA 3OJFA 1XQ6A 2C29D 4LISA 3PWSA 1YO6A 1HWYA 5H81A 1PJ4A 4ALMA 1B26A 2GGSA 5G4KA 1J5PA 1NWHA 3I9MA 4NU6A 2Q46A 3WLEA 5JMWA 3AUUA 4W6ZA 3PDJA 3OICA 2J5RA 4OXNA 1O89A 2H5LA 1PSDA 3RUDA 4RPGA 1WZIA 4WECA 4D3FA 1P45A 3I9OA 4BKOA 2AA3A 1ZSVA 3WQQA 5IJZA 5EQFA 2NU6A 3D4PA 2JHGA 3AY3A 1NYTA 3ZV4A 2DTEA 1Q0QA 4LRTB 3ULKA 1O94A 1Y8RB 2PH3A 3RCBA 3TZKA 1KEUA 3ONEA 3MJEA 1ZSNA 3PRJA 5I9NA 3IUSA 5EJ2A 2JD1A 3IIEA 3M1LA 4BL5A 1LC3A 2XAAA 4M49A 4HX5A 2VWGA 3JQGA 2Y67A 3LT4A 3FSRA 3R1IA 3ROQA 4CMEC 1C1XB 1P9LA 3PQEA 4XJSA 4R1SA 5BSEA 1PQWA 5U4QA 5EMHA 3NGLA 5JAQA 3WXBA 4YRDA 1WDMA 4KWHA 3D4NA 5JAMA 1I01A 3EVTA 3I23A 3GEMA 2Y68A 1IY8A 3X2EA 2EERA 2V6MA 1P3DA 4IMRA 2WEKA 4CUZA 3GNQA 3FI9A 3DXFA 4YT2A 1P1RA 1B3RA 1M66A 2PZMA 3DQPA 4OKNA 2PKRA 2RCYA 1X14A 1EBFA 1XYGA 4MP6A 3RUCA 3ZV5A 4XQGA 5ICMA 1W6UA 2DKNA 3F3SA 3JYNA 1B0AA 4MINA 2X4GA 4G81A 5DP2A 4ZU3A 5TT0A 1SEVA 4IIVA 4YQZA 4XR4A 1T1SA 1G0NA 2GSDA 4N5NA 1DIRA 2Y0DA 1EVIA 3SLGA 4Q9NA 1GFSA 1UP4A 2HRZA 2B0JA 1DO8A 3QE3A 9LDTA 1N8KA 2PGLA 3ZDFA 4CQLB 1MC4A 2VHXA 4QQRA 3B6ZA 4EJ6A 2P91A 2HMUA 3AI2A 1YXMA 3T4EA 2ZB4A 3WJAA 2C7VA 2QRKA 1W0CA 4HFJA 4PRKA 5BT9A 1SPXA 1KVSA 4W7HA 1RM3A 1U4SA 2ZJ0A 4JBIA 4JXKA 1JAYA 1EK5A 1RKXA 2NNLD 1HDXA 2Y05A 1IE3A 4EJMA 1GR0A 1KC1A 3QVWA 4GX0A 1UXIA 4J16A 4Z0HO 4Z6KA 1LTHR 3MJSA 5KJFA 3WTBA 2CVOA 3WYEA 3E18A 3PWZA 1C1XA 1HL3A 1PS8A 4IS2A 5H83A 1XDWA 2PFGA 5K0ZA 3DO5A 3QP9A 1H2HA 1QKIA 1LDGA 1D7OA 4IDAA 1PJSA 4G65A 4J2HA 3WFIA 4YYZA 4GGOA 2EKPA 1IUKA 2HJRA 4IJUA 1LUAA 5HWSA 1ORRA 1PL6A 1V35A 2F00A 2VYVD 4CR6A 2YHIA 4RLHA 4RVSA 4MVJH 3HE3A 3H9JA 3NAQA 4PLWA 3JQFA 1CERA 4ONEA 1ENYA 3DMTA 3HDJA 4AJEA 4M87A 2X7HA 3LC1O 1DC6A 5L4SA 1BHSA 4CUJA 4DLLA 3PWKA 1E3IA 2VNSA 1ZXBA 4J7XA 4PZEA 3WOHA 1IYZA 1K6JA 3H3JA 3WGTA 2J5KA 1NAHA 3F5QA 4S1VA 2FP4A 5ER6A 4BQPA 1SB9A 4I1IA 1W73A 3RUHA 3W8FA 1C3VA 3PPIA 1UAYA 2HRBA 3HZZA 2PY6A 1YJQA 4UEJA 2ZCVA 3CTMA 4QXMA 5THQA 3ZWVA 4M55A 2QZ9A 3JQ9C 1LQUA 1U5CA 2VZ8A 1XEAA 1YOVB 4NH4A 4BUCA 4OHUA 1OI7A 3VAZA 1HDYA 4MOWA 4WLUA 5JSFA 3M6IA 4IGFA 5LC1A 4EUFA 1GTMA 2O4CA 2UUPA 4E6PA 1PIWA 3ENKA 3P2YA 5G4KB 4IINA 1YS4A 3EW7A 3GFBA 3GDOA 3GFGA 1O0SA 4MIEA 5AOVA 5KJCA 4NBRA 1E3WA 1WZEA 4W9NC 5ITWA 3EAGA 5DT9A 3BMNA 3S2GA 2Q1SA 4Q3DA 3W8EA 4P8RA 3C7AA 1E1MA 4DPLA 3KHUA 3MEQA 4J43A 2OMEA 4TZKA 3ETGA 3TQHA 3H2SA 4UVHA 2P5YA 4AICA 3IUPA 4LSWA 3ZHBA 3RC9A 3PYXA 2JAHA 5CDUA 1B16A 1GU7A 3JYPA 2PV7A 2HKIA 3V1UA 4RPKA 1MC5A 2FOIA 2O4UX 5F3RA 2D3TA 5L9AA 3L4BA 1HRDA 2JD2A 5G4LA 1R37A 5LDGA 1E7YA 3PFWO 3PVZA 4Y6PA 1KEPA 2HMSA 3I6IA 1XWFA 4FBGA 1AGNA 2FHSA 4FW8A 3E1KA 2XPCA 1JA9A 5FI3A 4F45A 4UUOA 3Q0EA 1D3AA 1XHLA 2CMDA 4MJLA 1A9YA 3PYLA 3QVXA 1KERA 1JQBA 5FI5A 3S8MA 4BMSA 3PZBA 1RJWA 4JX8A 2ZYGA 1T4DA 2OUIA 3DFUA 1FF9A 3FCOA 4IZIA 4FGSA 5DBIA 4R1UA 5DULA 5A9SA 4PLGA 4I9UA 4BO4A 2QW8A 3Q9UA 4E5PA 4EDFA 2C20A 3MZ0A 3MTGA 1E0DA 2D5AA 2JD0A 4NJMA 1NQ5A 4OM8A 3ZU4A 3FWZA 4B7XA 3ITKA 1MX3A 3RD5A 4NJOA 1ISMA 1C0LA 2C07A 3W4JA 5JLAA 4FFLA 4E0BA 4OOFA 1P44A 4BO9A 1ISJA 3H9EO 4QUKA 3RBXA 3FPCA 2O50A 1QV6A 1YB5A 3ZNNA 4ILKA 4YAJA 3KEQA 3INRA 2AQHA 4M54A 1NQOA 5A05A 3S2IA 2VCYA 5CFZA 5CAEA 2C5EA 1Q0HA 1GUFA 3VH1A 1BXZA 1QYXA 3LZ6A 4RPJA 3RKUA 1X15A 4L4XA 3VPFA 4BNVA 4DVJA 1SO8A 4MVJF 1ZK3A 3CZRA 2HSDA 4FB5A 4ZRNA 4R5MA 2Y1DA 2G1UA 4DYDA 4BNTA 4B4WA 3VHRA 1T2FA 3C1OA 3ZNQA 2G0TA 3BXXA 4L4RA 1XGKA 5CEJA 3QQPA 3CEAA 3ZWWA 1OAAA 2HK8A 4YA6A 5CDTA 5IDYA 4RJTA 3OSUA 3O8QA 2PD4A 2Z1MA 3I9NA 1BG6A 1FMCA 3ADOA 2IZ1A 4BIIA 2ZCUA 5F5NA 3W6UA 3U49A 3GAZA 1OZAA 4OYRA 4TVOA 4PCVA 3NTOA 4G2NA 4CM5A 2UUOA 3D64A 3DAPA 1I3MA 4BQRA 1KS9A 1EZ4A 3RWBA 3ONFA 4OSPA 1P1HA 4Z9YA 3CKYA 4FFOA 3WNVA 4BOYA 1F17A 2FPGA 4MVJA 4UAGA 3MWEB 4Y9DA 5IDWA 5IF3A 3V8BA 2BELA 3HDYA 1IPEA 3ZNPA 3AOEA 4QFCA 1ONNA 4DBVO 4CMIA 3CUKA 4PZCA 4Z3DA 2B5WA 3ZWMA 2NM0A 4RF5A 2XOXA 4DL9A 3F1LA 1BDBA 1TI7A 4G5HA 5A9RA 3WGOA 1LNQA 5A9TA 2DU8A 2NU8A 3KVOA 5JCJD 3IJPA 3FNGA 3ZWAA 4JLWA 2NVBA 1TEHA 4WEQA 1MLDA 1Q1NA 1JKJA 4BNMA 4BMVA 3MCVA 2Q2QA 2C7GA 3W6ZA 3JQCA 4BB6A 1MG5A 2GRAA 4PN3A 4FQ8A 4DLBA 1SMKA 4R5HA 3SX2A 2IXBA 3PP8A 4NDNE 3MOGA 3Q6IA 2VHZA 1NASA 2GUGA 5B37A 1BXKA 1SOWA 2Q2WA 3NTQA 4K1LA 4H7PA 4GWKA 4JJFA 2ZJ1A 3KLMX 4WPGA 3E8XA 2GZ3A 1DLIA 3RI3A 3ZWNA 2YQ5A 2O3QA 1YGYA 3TF5A 4W9NA 1C0IA 4CM8A 3JQ8B 1D8AA 1Y1PA 3LT2A 2VHWA 1ZZEA 4DPMA 2GN6A 2WYVA 3DBRA 1LRKA 1DHRA 3O4RA 4XWYA 4FFMA 1YB4A 1YDWA 3QHAA 4ALKA 4D0RA 5BSFA 2CNBA 3TL3A 3H7AA 4KUGA 2J3KA 3F6YA 5KKCA 2AQKA 2Q50A 4FIZA 3NX4A 3HHPA 4GWGA 1EUZA 2C2XA 1XG5A 5G2OA 4ZHSA 1NQTA 5JO0A 1TB4A 1R0KA 5IZCA 2W98A 4ITUA 3UFXA 3VTFA 4NZ9A 1IPFA 3BMQB 4A10A 4CLHA 3ZWPA 2X8LA 4R68A 4J4HA 3NV9A 4AJKA 1I2ZA 4DIFA 3NJ4A 3KSZO 5GZ3A 4OOEA 1E7MA 4JJGA 4RZHA 3O38A 3IP3A 2EXXA 3U5TA 4CMBA 4Z9FA 4NK4A 3H5AA 5F1OA 4QTZA 4PLHA 4WCFA 3GN1A 5CG2A 3RSHA 3LSYA 5C7OO 4IDGA 3KBOA 2FR0A 4RVDA 3HN2A 4RF4A 3Q1LA 4DIOA 5G0WA 3TWOA 3ZNOA 5GY7A 1U5AA 4KUEA 3OA0A 2VRCA 4Y98A 1Z7EA 2FPIA 3UCEA 1KC3A 4BGUA 5JXWA 4MVJI 4D43A 4KQWA 5EN4A 1NVTA 4UEKA 1B8UA 1T2EA 1QP8A 4J7CA 2B4QA 4K9DA 3QVOA 3FTNA 2I99A 3NJ8A 4MP8A 4QSMA 1DIHA 1R66A 3PLRA 4RVUA 3OETA 1E1NA 3G0OA 1RM0A 3O8QB 1ZJZA 3LC2O 3WGHA 2J5QA 3RFVA 5JYEA 3GR6A 1ZK4A 3PYMA 3I4FA 4J7UA 1R4MA 4RDIA 4XGNA 1KVRA 5TS3A 2C5AA 3AJRA 4AJPA 5T57A 1KY4A 4IUYA 3HB5X 3OEWA 4GAEA 4IQ8A 3IJRA 2EKLA 3BTVA 4J1QA 3S1LA 1U3WA 3RAJA 1GEGA 1GQQA 2YUTA 1E5LA 1QG6A 1H94A 1U9JA 2CDCA 1VLLA 2PZJA 4P4GA 4RQTA 4BO8A 4E5KA 2PH5A 3WJ7A 4PZDA 3DBHA 1DRUA 4LRSB 3KYDA 1SCUA 4UULA 5T67A 5THKA 1B14A 2XXBA 1TVEA 3CZMA 1H2BA 4E21A 1QYDA 5L7TA 2Z1NA 1GY8A 4QO8A 1LSOA 3HNPA 5CDYA 1Y7TA 2RAFA 1L1FA 1ONOA 3WGIA 5A4DA 5T64A 1NXQA 3H2ZA 4PG4A 1CF2O 2E6UX 4E3ZA 3AK4A 4XCVA 3U4IA 4YJHB 4WLOA 5GZ6A 1LEHA 2FR8A 1HDGO 2AE1A 2IE0A 1CEQA 4ND3A 4J4BA 1I2CA 4RVHA 4JNKA 1I3NA 1PR9A 4XYGA 1GL3A 4CM7A 3UVEA 4C7JA 4OMUA 1ONPA 1PGJA 2CVQA 4FC6A 2D5CA 3DBLB 3N58A 5K9ZA 1Z75A 3JYQA 4BO3A 4IS3A 1P1IA 2B35A 4DWVA 3K73O 4H3VA 4UREA 4YAEA 1EMDA 2BKAA 4FC7A 4ZJUA 1A72A 2BRUA 8ADHA 1CDOA 1BTOA 4KDFA 1UXKA 1MFZA 4XRGA 5A5EA 2X0NA 4HY3A 4IZHA 3W8DA 1XU9A 1GPJA 3BHMA 2WYWA 2UVDA 1IZ0A 2QQ5A 4XB2A 1N2SA 1YRLA 2VUUA 3OM9A 2CZCA 5KJ1A 2BFOA 4S3MA 1XQ1A 3GUYA 1K2WA 2ZTUA 3UAGA 1N1EA 4D45A 5KTKA 2UAGA 3BYZA 4YRAA 1A5ZA 3K31A 1H93A 5IN4A 4ROSA 1OC4A 4OO3A 2NQ8A 1J0XO 4GPD1 4A0SA 3EYWA 3RUEA 4FS3A 3C85A 2HDHA 4GKVA 5DZSA 5EL0A 4ESOA 2YDYA 3TZCA 4BGIA 5DCWA 1RYDA 2DTXA 3TFOA 1K6XA 2Q1UA 2IYPA 4IDFA 5H82A 5U9CA 2G17A 1BWSA 1TT5A 1B7GO 4FR5A 5HM8A 2EEZA 2UYYA 2V65A 4YXFA 4O1MA 4RDHA 2OZPA 4LVUA 4CMIB 3U62A 3M2PA 2EJWA 4YJDA 3JD3A 2O7QA 3KSDO 3GEGA 2B4TO 4PLYA 3GRPA 3PJGA 5I9MA 3ENNA 3OQ1A 4FJ0A 3ROPA 3VPSA 3L0DA 3WFJA 4BMNA 1GZ3A 2R2GA 2NWQA 3EGOA 3TFQA 9LDBA 5GZ1A 4NBTA 5B12A 4GH5A 4Z0PA 4CMEA 2PD6A 1U2DA 5C3MA 2Q2VA 2X1HA 4D3SA 3V2UA 2GN8A 4RF3A 1HF3A 2OXIA 1NHGA 3GAFA 4MKXA 2JCVA 5DN9A 1MGOA 2P9EA 4P38A 1NP3A 1QLHA 3WQSB 3LDHA 2D2IA 1DDOA 3DOOA 3C7CB 1E77A 1U7TA 4ALNA 1LDBA 4JN6B 1MFPA 4EYEA 3QA9A 4IIUA 3DONA 3AI3A 3WBBA 4LMRA 3KRTA 1U2GA 3UN1A 4BO1A 2NADA 3JQ6A 4YWJA 4E13A 3EVNA 4YTEA 1B8VA 3OJ0A 3PQFA 1OBFO 1PS9A 1NVMB 4TQGA 3ZU5A 5TT1A 2GLXA 4MIOA 2PWZA 3V5NA 3VVCA 3G1UA 1WMBA 3GT0A 4XDYA 1KEVA 4E5YA 1GADO 1DSSG 3DBRB 3SLKA 2Q1TA 5DCUA 3AU8A 5JDCA 3JQ7A 4HUJA 4BS9A 1Y6JA 4WKGA 3Q3CA 4EITA 3ABIA 2SCUA 3K92A 4R54A 4URFA 1EDZA 1V3TA 5KVQA 4JK3A 1P31A 3OJEA 2JHFA 1MB4A 1I3LA 4AVYA 1GPDG 5CPBA 1E1KA 4U0KA 5A02A 4OQZA 3ETDA 1I33A 1YE3A 4LGVA 3GHYA 1HEUA 2RBEA 3QWHA 4UVIA 3ON5A 2VNAA 3NUGA 2DLDA 4B7UA 1ZEJA 1A9ZA 1O6ZA 4GX5A 5KNLA 3PJEA 4GMGA 3IDSA 3ZI0A 4DYVA 2ET6A 1QRRA 1X0XA 3PQDA 3GH3A 1X1TA 2IODA 4H16A 2Q3EA 1T25A 4ZRMA 1KOLA 2E48A 4E5NA 2HO5A 4LCEA 3DAGA 1DIGA 2PA3A 1NVGA 3MWDB 5JYDA 3OECA 3QWIA 3AM4A 1W4ZA 4I08A 2CF5A 3QIVA 5ES3A 1JW9B 3VZQA 2YZ7A 1O95A 4P4LA 5L3ZA 4W4TA 3EZLA 3RJ5A 1MG0A 4MPDA 4B8WA 1NQAO 4CMAA 3ROKA 3OIGA 4CL3A 1PTJA 1LC0A 4ND5A 1ISHA 1U4OA 3D3WA 3HQ4O 4RPHA 1DJQA 2X5JO 1DBVO 3VZPA 3F9IA 1X7DA 4DC1A 4YQYA 2FSSA 4K28A 4R51A 4XDZA 3K2EA 1U7HA 4CODB 3G79A 1Y8QA 2HQ1A 3DR3A 5BNIA 3IC5A 1R0SA 3ZHZA 3QSGA 4OKIA 2VZ9A 3ASUA 5AVOA 1XELA 1M76A 1QYWA 3D5TA 4LSMA 4J0FA 4NFYA 1LU9A 2QRJA 2YFHA 5L4NA 3BMCB 1Z7BA 5KJ6A 1EFLA 1VL6A 3AM3A 1ADFA 4J1TA 3DBVO 1CRWG 5ENDA 2R00C 2W2KB 2C0CA 1HDOA 1Y9AA 1ADBA 3KSUA 1QV7A 1F14A 1H0KA 2HCTA
chains in the Genus database with same CATH superfamily
4GRIA 4KI7A 5KVCA 3ESYA 1ODCA 3NNSA 3QENA 1K86A 4XM2A 5F2OA 2ZBEA 1NKVA 2PR2A 1BNCA 2D8MA 3OESA 4FOSA 1MEOA 1FPQA 1CS4C 2YXDA 3T1VA 3L6DA 3O31A 1TGYA 1ESEA 4AB1A 2CHUA 2QG4A 3OOWA 4LJRA 3V80A 1RTTA 2PJDA 3TRJA 5BN4A 4ZQCB 2X7XA 2P2YA 5IDXA 4WK2B 5BSHA 4HEJA 2W8BB 3B7WA 4GICA 3U1BA 2WD7A 1YL6A 2BMEA 1F0YA 3ENQA 4HPJB 4HZGA 2HCRA 3NCHA 4F4UA 2CNWD 3GPCA 4DDVA 2OE2A 3IR7A 3OBIA 3W2GA 4X8MA 1A8IA 4HT3B 3SCZA 4YBZA 2P9GA 4UVEA 1QFJA 3ZV6A 5JTTA 1E7RA 1P3JA 1D1TA 4A73A 1D04A 3I1IA 1BVHA 3EUAA 1LLFA 1KPGA 1N6OA 4EQ6A 2C4TA 3CR7A 1F6DA 2J9FB 1Z26A 2YYYA 1GPH1 1KKMA 2VH1A 2YWEA 3A4LA 3PRKE 2GM4A 2FDCA 3OWXA 3LUCA 5DOVA 5JG7A 3SZRA 3MUNA 3LUJA 2VWQA 1BROA 1QTIA 1A98A 2GJKA 4J76A 3S68A 3WAGA 1XA3A 3ZDYB 1AQYA 1OTXA 5TE9A 3T9DA 1K5GA 1X2EA 1W5TA 1T5BA 3Q4GA 1ORTA 4R9SA 3HB1A 1GTSA 4H4DA 2VQEB 4HDNA 2GDZA 1TCUA 1G21B 4MDFA 4QOGA 1JFFB 4EZIA 4KAXA 2AEMA 3NKVA 3R23A 1SU8A 1G38A 2ZJOA 2Y4OA 2GN4A 1DIBA 4MJ3A 2VPPA 1H3FA 3KQPA 4NENA 1JFTA 3GWZA 4MUAA 3KQNA 1ZVKA 3R7DA 3JQBA 3F71A 4X5OA 1E9DA 1EA7A 1SD1A 3KOWA 4FSHA 5A6SB 1TK2A 3O0DA 1K98A 1DP4A 1D2CA 1QE0A 2HLHA 2WM3A 2PMWB 1BRMA 1DLJA 1QIKA 2O3TA 4XASA 1LQTA 5AKJA 2WW8A 1I14A 1FP6A 2W2PA 5BSRA 3TM4A 3VPHA 4EFKA 4K8RB 2QROA 3R5KA 1C14A 3QVJA 1K2VN 3LHFA 3L4KA 2O8CB 2AKAB 5K0JA 3RIHA 5U4XA 3OC6A 4FDUA 3K8ZA 1XFAA 3QFCA 1EG2A 3CEMA 1K08A 2AUMA 1M67A 5A6SA 3QLTA 1MX5A 1KVTA 3GRZA 2NSDA 5LQSA 4ABTA 2IOYA 2OMKA 2B8JA 4L8VA 4DR1B 2PVPA 5TQVA 3OHPA 3OTWA 3ZVLA 3J7AC 2QTGA 1OW3B 4R0VA 4CKBB 4OAOA 5JBQA 2FCRA 1LWOA 5B4VA 3B1YA 1DBSA 1ESDA 2QLBA 3DMPA 3I0ZA 2DFVA 3KT3A 4F21A 4XSVA 2R8BA 3ANNA 1SPBS 3EIXA 3MC1A 4HB2A 3RHSA 3ZY6A 121PA 3C48A 2WA1A 2R44A 2Y9PB 3IRUA 4XB1A 2WPNA 5D3QA 4K9SA 2AHRA 3KKNA 1P73A 2UUBB 3FCYA 2OCXA 3PGXA 4KP7A 3HKCA 5GIOE 1P1FA 1CCWA 4H7KA 3ERCA 4RVCA 5J23A 2ZSIA 5D6NA 1JJFA 2JA1A 4P92A 3PICA 1RW4A 3WMRA 3S1AA 4BZZA 2GJ8A 1GPBA 3UC9A 2RGGA 5CDSA 3MJTA 2W2QA 4XARA 3MYYA 1ND6A 4ER6A 3NVDA 2P9YA 2YWDA 2G0NA 3KPJA 1ZMOA 3R9XB 3AM5A 1DXOA 1V6CA 2YOFA 1T26A 2HCJB 1MUUA 1TC1A 4QQNA 5D3KA 5HMLA 4RYLA 3WLMA 5K8TA 5DOZA 3L05A 4IJWA 2PO7A 4M7RA 1H2WA 3DZFA 3MT8A 1YAJA 5ALZA 4CM8B 1L6RA 2RCNA 4KREA 4B3MB 3H4MA 1XKXA 2BTOA 4XM0A 1O94D 1VHDA 3BK2A 3NLLA 1TQ6A 1YZGA 5ENVA 1QC5B 3WWDA 1ST2A 1XU7A 2E9SA 2NPOA 1JMVA 3PNLA 2EZ9A 1P0MA 2NO7A 5CW1A 4BJ1A 4C5AA 1E7QA 5KU7A 2GPTA 3GLIB 1JEQB 3PXGA 4PC2A 1SZJG 1TZMA 2RB5A 1N92A 1RWNA 2Y2VA 5LBUA 1SUWA 1TM4E 2OENG 1GYRA 4DTIA 1U8FO 2AN3A 4NXNB 3BORA 2WE7A 3UATA 3GGDA 4MKGA 2XVMA 4WMLA 1U28C 1VCIA 4J1TC 1KKUA 4BTLA 1SM4A 1U0JA 4B48A 1VJ1A 1SXJC 1ESNA 1Z62A 2L0XA 5A3VA 5A0TA 2AZ4A 2IU0A 1ECGA 5BPHA 1GNTA 3UB2A 2C8LA 3F4BA 1YR8A 1KK1A 2GCGA 3WLOA 4PTYA 3WLTA 4AJ1A 3X2FA 2A7XA 4G2TA 1D4FA 1K5HA 3HKDB 2BI7A 3FM9A 3K0AA 1J56A 3OMWA 4MYCA 1K06A 4S35A 6NULA 2OHJA 4Q3LA 1JIUA 4WXHA 5FUVA 1T6YA 4M1WA 2PE5A 1V25A 4CU2A 1UAAA 3BE5A 1VCMA 2W5UA 3EVEA 5CT9A 1YZQA 2EHDA 3WBJA 2D5LA 1K88A 3EQ7A 3QU9A 3F1KA 4O0LA 4NESA 1E0JA 1VECA 2Q3CA 4H60A 4P4TA 3R3WA 5KQMA 2I78A 1U1EA 1RLTA 3P2IA 4RY0A 2VAMA 1LS1A 3P9QA 4XUEA 1WBJB 5I5EA 4CEJA 2D5BA 2V7QD 4PWZA 5FRDA 1QFYA 1CF4A 2BC9A 4UHEA 5EPEA 2XKBA 3JD4A 4DXAA 3T7KA 2Z4SA 4O4HA 4Q12A 3U80A 2VK2A 2X1MA 4A27A 1QXSA 2C8KA 3F2IA 4IJMA 1E9VA 3L77A 4IIJF 4LY6A 2R4TA 4HX9A 4R1TA 4WEOA 3DO8A 2V7EA 1TJYA 2J6BA 4RTJA 2FMXA 2IY9A 1W29A 3T06B 4WN3A 3CNQS 4RSHA 2C9MA 3D0OA 2Q5JA 1K89A 1VLMA 2J8ZA 2VFAA 3GHHA 3G5UA 4P3XA 3AI1A 3PL1A 5CM8B 1ZNZA 3RSFA 3PPXA 2I6TA 3K8OE 1OC2A 4LZZA 2IY8A 4CTMA 4R1LA 5AYVA 4R2LA 4I8DA 4G9GA 1T5LA 4LXIA 1RZVA 4BECA 4IMPA 1GPYA 1XKTA 5IM4A 3V1MA 3F47A 4HWGA 1MAHA 2H2IA 1GGEA 4K8OA 5KIAA 1R16A 3TTYA 1KOGA 4QLAA 1J49A 5DRYA 1FB5A 1XDDA 1RYYA 2BFFB 2NTJA 4MUMA 3ZK8A 2FGKA 1UMBA 5KNDH 1PLKA 2ACVA 1JYEA 3NHYA 4HDSA 2WMNB 3C5HA 3PFHA 1CWUA 4LOHA 4OBWA 4JR2A 2CHQA 2P3SA 4EPRA 3BL8A 4EJSA 2JPDA 3KKOA 1HDCA 3V2GA 1XN1A 3OPYI 3VSEA 3U0BA 4ITVA 4O4JB 3UFBA 821PA 4IHAA 1CQJB 1FFSA 4CT0A 1JA0A 2DHDA 3I4CA 4FIDA 5I7UA 1N1GA 5TMEA 5LVAA 1JWLA 3GQBA 1C3JA 3W6OA 1G66A 1P77A 1CQZA 3EIOA 3FUWA 4QDXA 2YKGA 1E1RD 1W2HA 2J08A 2WIJA 3JYOA 3T1QA 3IS3A 4XVQA 3KUUA 5JSZB 5H3HA 3I3SR 3ZW9A 3MCAA 4KFTA 4YJ2F 1ETUA 5AVWA 5TF4A 5FUMA 1A71A 1SBYA 4AW9A 5K20A 3ZD6A 1HYEA 2FN9A 4OBXA 4B74A 1D0SA 3AHDA 4Z1OA 1QH8B 4D41A 1LD3A 1D2NA 4JC8A 3RROA 3WSVA 1TEVA 2XB6A 3D4OA 4BMDA 4ENRA 1P6QA 2BLNA 3K0CA 3WHPA 3KR0A 4RETA 1ZGBA 2VOEA 3C43A 1F20A 4AJNA 4BBZA 3KR9A 3PV0A 5K5EA 1ZHOA 1T10A 1UFQA 3BQMB 2Y1XA 1DAPA 4PLCA 4OAPA 4RELA 3KQLA 3SHVA 4J90A 5IWAB 1XQWA 4P2GA 2J46A 4MRNA 4UJ3A 4WLEA 3C1UA 1GTG1 2W2MA 5HKKD 1X1CA 2L82A 4DBZA 4KE7A 2VN8A 4AF7A 3GXOA 4OBBA 5FNZA 1GAEO 1BOFA 4Y1FA 5L3VA 2ZYIA 1PL7A 2Q3MA 3P0HA 2HJSA 521PA 3F8WA 2ZXFA 5GADl 3IPAA 1NMQA 2PWYA 1D7AA 1M0WA 1M3SA 1KH3A 1LX6A 3A37A 1KFJB 3L6OO 3MIZA 3QQ5A 4Y2GA 5E2BA 1B1AA 3BX1A 3SE0A 5T8KA 4BLPA 4B3IA 4ZYTA 4JLAA 3EZFA 4Y9RA 1GAWA 4PYQA 2F9FA 1MB9A 3I53A 3QBDA 4UVDA 1J2EA 3P2JA 1Y1TA 4RC9A 1H8ED 3GJXC 3MG9A 3JSAA 2WMDA 5ITZB 3U61B 1U3GA 3I5MA 4J4TA 5FV4A 4CM9A 2Q07A 4A1FA 3DHYA 2G6TA 4UCXA 3DJYA 2TECE 2VVTA 4H1VA 2PK3A 1GKUB 3R5XA 4JP3A 4DAOA 4PHGA 4A03A 4RTQA 1IVYA 5ICGA 2XCIA 4RPLA 2VPZA 4AZ3A 4AAYA 2M6SA 1P72A 1RRMA 2GPSA 2J3HA 2NYAA 3FFBA 2JJQA 1E9AA 4NMWA 3WZMA 1BJRE 2B99A 1JXQA 4HSEA 1Z5NA 1ZJYA 2VTDA 4I2VA 3ZQUA 4O59O 3M3DA 1M0EA 1J07A 3PFNA 5EJ9A 1YOVA 1U3CA 4W8GA 2CXQA 3ZIAD 5A1TA 1JHAA 2QTAA 5HGXA 1RLMA 2VAXA 4NTZA 5IT9A 4LOJA 1ZW1A 1RHMA 4F6RA 4QZVA 4K6FA 3K0KA 3OPYA 3JQ7B 3A9RA 4LECA 3MWKA 3V4LA 1A27A 4A0FA 5LU9A 3U60B 3LDAA 4OPMA 4F3NA 2YFQA 3DNMA 4G4SO 2GBIA 2BEJA 1RBZA 1KMIY 3C6KA 3T7CA 4OHPA 1DV2A 2IGTA 2Y0EA 3L7CA 1OLUA 2ZB2A 4LMPA 4HQOA 4GUAA 2C2HA 4IHJB 2HMTA 2J0UB 3OM8A 4L28A 1H6CA 1K3FA 2ZS9A 5DNWA 1ZL2A 3RYHA 3VSBA 5L7WA 4TWRA 1QU2A 3MT7A 3A1NA 1ARZA 1HE2A 1VJ0A 4JEIA 4MR7B 4KQ1A 3RNOA 4A2QA 4BJ5A 5LNK6 1JSXA 2CLLB 4L6CA 4P3YA 4QNRA 1CPYA 1XD2B 2GM3A 4MGHA 4F6RB 3UBTA 5AKEA 5IN5A 4F5EA 2HA4A 4G5OA 2AC2A 2IEYA 3T5MA 1ZJ4A 4MS4B 2EU8A 3EOBI 5AICA 4E4YA 4L6AA 5A1JA 2O5EA 2D1RA 1VYVA 4AMZA 2EGGA 1VPEA 4RGVA 2BFAA 2J6IA 3EXIB 5CIYA 2XOEA 3E9QA 3QTBA 3EZYA 2DECA 4G0PA 5GV8A 2AEEA 5KWJA 4AMUA 2ZTSA 1W4LA 4JGGA 3A0UA 3OFSA 1TT5B 5EUQB 4Q4CA 1R6AA 3AUAA 4XEUA 5DPMA 3DZBA 3GARA 4RJIA 5FEUA 3ZDEA 1TYDE 2C59A 3GC6A 1X1AA 2PTHA 3L4BC 1E8DA 4FYVA 3TLCA 2VEDA 3FPFA 3ANMA 5MDHA 4EPVA 3L6CA 3GVIA 3N8GA 2NIPA 3HEAA 5HF8A 3WL4A 4DNPA 3HBLA 2WJWA 1MXFA 1SVIA 2W7TA 3MS4A 1XA0A 3FVTA 3ZWCA 4ZMRA 4TTSA 3BJIC 4QUHA 4FMCB 1J22A 3PX7A 4J9UE 4F60A 4C7OB 3ITDA 1VHLA 4KN6A 4Q1DA 5B6PA 4JEMA 1V7QA 3KXDA 4LKRA 3KOXA 3R6GA 4WJKB 4X71A 3VC7A 2ZWIA 3GEIA 2I3AA 4LVNA 2AUTA 3EODA 2PXCA 1OGIA 1EJ6A 3ZHRA 3THYA 3BE6A 3KTAB 4IG9A 2ROQA 3ABOB 1O3YA 4HGOA 3AVXA 2XUHA 3KE8A 4LZWA 4ZXFA 2YMMA 2I2BA 1L7DA 2AF3C 5DMXA 1TVMA 2WWTA 4NFLA 3W4KA 3RYFA 5KBYA 3I28A 3TPFA 3FGOA 2MSCB 4J7AA 2HWYA 3SDBA 3OZVA 4K9RA 2JCXA 1N9GA 1KYYA 4EK9A 2PSFA 2RGDA 3BJEA 3UMYA 1ENZA 1DKQA 1EVJA 2JKYA 2WBLC 3CMMA 2LD4A 2O8NA 2SECE 3KZMA 3S27A 4KLCA 4O5AA 1QFSA 2XQFA 4O08A 1A88A 4MMXB 3B12A 4YDQA 4DREA 3PC8C 1W93A 3Q5GA 5HZMA 3SC2A 3I73A 5CDGA 1IZ7A 1EWRA 3KJNA 4BNHA 3BFJA 4YAGA 2IXAA 4BNFA 4D46A 3WYBA 2BH2A 3MQFA 3TIVA 4ZI7F 1FVHA 5L51A 1ZQ1A 1VRCA 1OR8A 3QF4B 1WTAA 4JELA 5C8YA 5KNDA 2P5UA 1DEXA 2PDAA 1PEAA 3D7SA 4S1OA 1ANKA 5EA2A 2EARA 4AYTA 1I30A 4RULA 1IPHA 1OI4A 2YCBA 4JY7A 4O4LB 2PZGA 1ZRSA 5HCNA 2JFNA 4BX3A 1TIPA 2NSJA 3RVJA 1AUOA 1SOVA 3TZ6A 3V8QA 1ST3A 4DLKA 2P9FA 4ZPJA 1Z2CA 5EQJB 4IDDA 1J24A 1T4GA 4TXHA 2B92A 2IUYA 3MCWA 1UQUA 3LHDA 1EFDN 1L4HA 4OQYA 3DTVD 2A6PA 2JGKA 1M1XB 2CB9A 3ZLVA 5A0VA 1TYBE 3GNTA 4DT1B 1OLSA 1XL0A 1CUEA 2DF8A 2AX4A 4KKVA 4II2A 2OZVA 2YV5A 3UXYA 1P1KA 4HWKA 2OPHA 2GXUA 3LP6A 1X70A 1Z2PX 3IRVA 4I1VA 3VDNB 5KTOA 2DBVO 3L7NA 4I3HA 4C0AC 4YJHA 3ESRA 1YC5A 3K20A 4GI7A 4A8JA 4RWEA 5E9AA 4JWKA 2C1EA 1XTTA 2VZ0A 1YZYA 1KH2A 1W49A 2HK7A 3C6ZA 3ELYA 2X9VA 4XM1A 4MV7A 3TSCA 3I42A 2Q5HA 5TR9A 4XKJA 3FPAA 5FL3A 4E2WA 2OCPA 2ZJ8A 3AJEA 3CJRA 1PD0A 1H6DA 3ZX5A 3EZ6A 1CYDA 1I32A 3KHTA 3REOA 2CT8A 2HTEA 2XMZA 5HJEA 3GA0A 3FG9A 3MJRA 4OHYA 3IVRA 5B4UA 2ZULA 5DBHX 2CYCA 4PQEA 4BUZA 4E03A 1S2GA 1ZYUA 4ZJZA 4IEFB 1TQ2A 3VNSA 3QE2A 4UMDA 3X3HA 1U8YA 4ARZB 4AUKA 1KRHA 1N7GA 2FW9A 1U2EA 3DCYA 1O9BA 3I1FA 1TW2A 3MJFA 1GT91 4HDKA 2C96A 3UWOA 4B4VA 5LQRA 5BN3B 3VPAA 4XYBA 2QL5A 3MFYA 3FZYA 4HEQA 1DXQA 4M60A 3IEUA 3LP8A 2FYTA 2H6EA 2O9JA 2ORVA 4EHBA 1O95D 2FZWA 2QK4A 3KQOA 4B79A 3OLXA 4G63A 1XEWY 4IDNA 4QWWA 5DP1A 4D98A 1XJ0A 1A96A 2YMQA 3LQYA 4D4JA 1J8QA 4DHWA 4OXQA 5FR1A 1WCWA 1R5OA 1U3UA 3SR4A 3QA3E 1JG2A 1RKUA 4RSGA 5CJ2A 5SY4A 5J4YA 2PANA 2CLOB 2PT7A 1GYQA 2AW3A 5BWMA 1YJBA 5CM2Z 2W22A 4ZYVA 1F51E 1WV0A 3P5SA 4U6QA 5EVCA 5IABA 1MZVA 1A4UA 4DANA 4F1WA 1KVUA 1VZ2A 3CLTC 2EFDB 2DUWA 2Q29A 1JR2A 1S8AA 2PG3A 1H2ZA 1YI0A 2EZTA 5HUQA 2QN2A 2NZVG 2RONA 3GZNA 4DXDA 2PUBA 2V6FA 2QR2A 2AN1A 4Q1CA 5EERA 4DYHA 1E3JA 1ZH4A 2VJCA 2OAP1 1DQRA 1OFUX 3P9ZA 1H1LA 2D7JA 5DHUA 3BD9A 4OB7A 4C21A 1BCRA 4PRLA 2BYTA 2RJ3A 2ZRFA 4ZGGA 5KYYA 3ZU3A 2G6BA 2G9NA 3RSOA 4AKIA 1NN1A 2QQ0A 4OATA 1LH0A 3SVLA 3UO8B 1KPIA 3T5CA 5LWQA 2EQ5A 3JZIA 4WBNB 3C87A 5KWIA 3ZD9A 2ZRQA 4J0GA 2XDQB 2V58A 1YZUA 3PIDA 1X80A 3NDJA 5DM60 1DEAA 1YZVA 1UKZA 1LZKA 2YJNA 4TKMA 1JALA 3NHBA 1RPNA 1F8XA 2FTKE 4EG8A 2JANA 3OF5A 5AJVB 1RSZA 2IITA 1JR3D 3LQ1A 2Y1GA 1C8LA 2I7XA 4JP2A 3ZJVA 1BX0A 1I5OA 3ZWKA 3ZGXA 1YU9A 3VC1A 3OZAA 4JEHA 5AUOB 5I4BA 3OCVA 5COBA 1GNRA 5CP8A 1XZDA 1A5SB 3FRJA 2GQ0A 2P27A 4GM1A 4QE3A 1A4RA 1AKUA 1M1NA 3RC7A 3NONA 1RMQA 3NT4A 4Q01A 5DYTA 2HADA 2ZPTX 1KIFA 1X7GA 1YKFA 1DJLA 1EI9A 2ZSBA 3OHMA 1G6OA 1RVV1 2WTBA 1FTNA 1P2DA 2FPPA 3BTOA 3C1TA 1K7XB 1WUYA 1ZD3A 3N2LA 4IDBA 1SCAA 1LBEA 5AM3A 1BW9B 1GA4A 1NOJA 1VB5A 1ZA1A 2QE6A 2QAJA 3ZHYA 2YZKA 1CY6A 3EIQA 1U0GA 1SEPA 2GF2A 2W2VA 3OLWA 4UU8A 2EGHA 4KLAA 1ZD4A 1QQBA 3HABA 3IULA 5TVGA 3V1TC 4KMMA 3B38A 4YXWA 4W9MC 2Z43A 1QPZA 3B9QA 3FD8A 4TV9F 5LQCA 5IKEA 1ZK0A 1PD1A 1WVMA 3AEKB 4YB8A 4HWOA 2NT3A 3DFKA 1VI2A 2IEAA 3CH6A 1PJLA 2YINC 2ZQZA 6GPBA 2CFCA 5IUNC 3B1KA 4LXYA 3E35A 4KSYA 2XJ4A 1I36A 3NUQA 1AMOA 2CF6A 3BHJA 3OM0A 1DBQA 3JR7A 3GVPA 2C1XA 2A5LA 2G80A 1PW7A 2V0NA 3CB2A 3IEXA 3BXGA 4P32A 5DXFA 4ESHA 5AQ1A 2GK6A 1KJ9A 2DBQA 3FUXA 4I5IA 3TDMA 3REGA 5HUJA 3HJNA 3PTZA 2OOSA 2FG6C 2X1VA 5DN6A 4HRYA 1ZMRA 4HDOB 3RVQA 3DD1A 1PGPA 3PUWA 2ZDHA 3W1EA 3WGMA 1JKJB 5MGBA 1CBUA 4CL3A 1IQRA 4FB4A 1E94E 3BMCA 1SVOA 2A78A 3D8HA 4F5YA 2WHYA 4RHYA 4D8TA 4JLVA 4ALLA 1DJMA 3AONB 3HCDA 3IEPA 4IMIB 3VPBA 1CX9B 2HWWA 5FXMA 5DDIP 3G2KA 3OTQA 1E0AA 4IVQA 4MCJA 1GJRA 5BUQA 5LXTA 8AT1A 1TXGA 4X1IB 1UZUA 3WQBA 1ZI6A 4I9NA 1T5TA 2AJ8A 2GERA 1T9DA 3NRCA 4LOAA 3RTBA 2ZUVA 1P4RA 5CLGA 5C1BA 5G0UA 4R05A 3DCNA 3SQWA 2EFGA 3AWDA 4BVBA 3OU6A 2YYAA 1DC7A 2XWSA 5KVSA 2Y3IA 1M2VA 1EE9A 3K70C 3UMCA 3OZCA 1VCOA 2F1JA 13PKA 5KKNB 3NBXX 1FX0B 3TDKA 3PQ3A 5K0NA 2WWGA 3IAHA 2UVQA 5WRFA 1FDTA 4OCZA 4RQUA 3OEHA 2QP3A 4L0QA 3FMPB 1Z8DA 3H9BA 3IBTA 4IH1A 4OQPA 5DGIA 4S1TA 1ZNXA 4UUBA 1L5OA 4NP6A 1GRRA 5EPOA 4YP5A 4E31A 2J3EA 3MNFA 4QU5A 2D0OB 3ICQB 4M89A 3D0RA 1JVSA 3WQRA 2QL9A 4IDOA 2RFLA 3O7WA 4QO7A 5JCOC 2JJ2A 4P35A 3AR7A 1BDIA 2EOAA 3CY6A 4RFSA 2W2LA 4ZC1A 3HXKA 1W4CA 4UFPA 1DL5A 1LPBB 3UFXB 1P5FA 3NGXA 1VIAA 4OI1A 3WMWA 4BATA 3GDGA 5JDIC 4KR0A 3QH4A 4L8LA 1GZ4A 3TW0A 5I4CA 1AXGA 4TZ0A 1ULAA 2L19A 2WABA 3N74A 3OCUA 3T34A 4DJ5X 4CEJB 2J31A 2ZJYA 4W5HA 2LKCA 3OQIB 1KQOA 1AKRA 3RTDA 4ZRDA 4EVRA 1XZBA 4ZDKA 1EUDA 3LUHA 3TTTA 4EF6A 1Q1QA 3H9GA 1N2CE 4P7BA 1FX1A 2P0YA 2R68A 3ND6A 2VAPA 4HB3A 4BQFA 5AKGA 5LU8A 2J32A 2PRZA 5EINA 3GEHA 2PSJA 5KAPA 1J5XA 4I2NA 1PTKA 4QC2A 3H9QA 5DGCA 1Y4AE 3OZFA 2VJPA 4KO2S 5CJJA 1T8WA 3R7BA 3UCFA 1OHHA 3FWKA 4BNJA 1TDJA 4JLSA 3SNKA 1A9QA 4BVEA 1RYEA 5AW2A 3CLUC 3ND5A 4BNLA 4HOYA 3EGDB 4GLJA 5DWDA 3WI7A 1C0PA 2YV1A 4GI5A 4Q39A 4P2BA 3WZLA 2A1TR 3STUA 1PUIA 4ZT4A 4DMMA 2PZLA 4LXXA 3RQIA 3UGKA 1OX5A 1VKRA 1YVDA 2RKWA 4EYKA 4BX0A 3JD1A 3TRFA 1FDRA 1PSWA 2ZB3A 3U4QA 4NPCA 4LQDA 4ND4A 2JRCA 2JGFA 1A9XB 1A1VA 4DV7B 4B32A 2IUUA 1EP9A 1AKNA 1DNPA 1X74A 2GZ1A 2O2YA 2O0LA 3FNEA 5LYJA 2GILA 2GHQA 3IFSA 3TOSA 4A4DA 3D8SA 4WESB 2JAXA 3CF0A 5EJIA 2V3VA 3H11A 3RBAA 3FVRA 3V4VB 4DADA 3O5AA 1DDGA 3LWNA 3U7QB 5C7IO 2H5IA 4RFVA 4BO0A 3RV4A 3FCXA 5TVKA 4L75A 3V4FA 2J6CA 1VKOA 5EUBA 3TLAA 4E12A 3HJCA 3LYLA 4Y0VA 1K8XB 2Z2JA 4IX1A 3QUSA 2A8YA 3KOZA 3A6KA 1VYHA 4RHEA 4RMNA 4WGGA 4DDTA 1Q19A 2OC9A 7ADHA 1C8KA 3EGXA 1KJ8A 3N0VA 3A0RB 1F0KA 1RAAA 2MOKA 1NW3A 3P9CA 4QUAA 4XH9B 2PGIA 1XTVA 2EDCA 3DDSA 3QLUC 5EG5A 1OAOA 3AEQB 2FSHA 1EDBA 4LI0A 2SICE 4JA0A 1PF7E 3BVPA 2FN7A 1VC2A 3TGLA 1G3MA 4WUVA 4CMCA 5FWYB 3TI7A 1UBNA 2QENA 3F5DA 3ECCA 4Q1BA 3S1AB 3UMGA 3SC4A 2RIRA 4ZI2A 1NN0A 2O48X 2GCIA 2X86A 1QHSA 1X92A 1XF9A 3ESAA 3A1EA 3OLCX 4HK4A 5TJHA 2C9BA 1ZK1A 3A9WA 4Y67A 4AP9A 1SHZA 1MNQA 1SBCA 2HMAA 2NUAB 1GGNA 2GR9A 1T9GS 2JF0A 2FR8C 2PGDA 3PUZA 4KFSA 4MW4A 4TROA 3MLAA 4RFSB 2ZVDA 4TXJA 4N48A 1MIHA 2HWKA 3RO7A 3OIFA 3DZHA 2WFLA 3N39C 4GMDA 2JGEA 4HRAA 1NUTA 4QUDA 1WD7A 1T6BY 3Q8XB 2NSLA 3N8IA 4DMCA 3UYKA 1K66A 5HQ3B 1XTBA 4M8KA 2H1HA 2PQMA 5EZYF 4CT5A 2X2FA 1AXEA 1XNJA 2CHEA 3HRHA 1CJMA 2GKSA 1E89A 4HNGA 2IXFA 2HTFA 1JZTA 3AH8A 2HJGA 4RHTA 1GAJA 4D82A 5KNBD 4DIMA 4N3AA 2AOXA 2ZTMA 3A36A 2Q6VA 2BR5A 3E82A 4JL5A 1JKIA 4OEHA 5ALFA 1QR2A 1V7PC 3EDYA 3MGGA 1RYNA 1FFXB 4M7WA 3GJQA 3RUFA 4FGWA 3W78A 3KHSA 4C1NA 1PG0A 1VIDA 2CMHA 2PGJA 2Y93A 4MPTA 2RG7A 3DS8A 5FX2A 4KPFC 4P86A 4UAUA 3ZXSA 4TV8A 5K4AA 1OBCA 3K1TA 4PO8A 4TLLB 3ZKWB 1BD4A 1LV8A 4Y2VA 3FW1A 5KO2A 1T2AA 2H4FA 3ZWVA 2FAXA 3D43A 3R0ZA 1S3GA 3BIJA 4B1FA 4BFXA 3ZVKA 1DV1A 3VTZA 2YWGA 4O1IA 4C0XA 2FEWB 2JLCA 4XD2A 4S24A 1HT1E 3E9RA 1E5QA 2QB5A 4U2KA 4X41A 4RTOA 3RUIA 3R7NA 1RI4A 1U8AA 2D4AA 1SQ6A 1OWMA 5JQGF 2FRDA 2ZVPX 3DLPX 1JV2B 2NTVA 3NATA 5BSUA 5LZ8A 3UHFA 1CRPA 3AHIA 1KIMA 3FUVA 3S0JA 3DTNA 1DUVG 1RABA 5HK8A 1G42A 1W94A 2Q0XA 3AUSA 4FVTA 4OIMA 3FNFA 1RHKA 3WGLA 1I3KA 2AG5A 2CLEB 2FCAA 2IDMA 1F2UA 1NQUA 1YQ9A 2FSIA 2XA9A 1PDOA 2GWHA 2Q4TA 1HUQA 4LJ5A 2IYNA 4RZQA 1UWKA 3VH3A 2Q99A 3IE0A 1WA5A 4OYLA 3ET4A 2P2SA 5LP6F 2NV6A 1AQ6A 5TQ0B 3UTCA 3QWAA 4CQMA 4J1NA 4W5WA 4KGZA 2ZT5A 2VEOA 4AO7A 1SBNE 2VHCA 3ASVA 3R41A 4R1PA 1GDTA 1E2BA 3JQRA 1ZITA 1PLLA 4DS3A 1XE3A 4LFBB 4I19A 2JGRA 1Q7CA 1ZUNB 4KBFA 4C03A 3HCBA 2WHRA 2A33A 3TLEA 5IFKA 1VKJA 1LPOA 2WYIA 3LY5A 4Z9BA 4TRMA 1U1DA 3OT1A 4ZDIA 3TLKA 4FX5A 4QGGA 5CLHA 4HS9A 1ECFA 2EJUA 1J2TA 2F3TA 1OXTA 4CL2A 1ZM4A 3ZDBA 1POWA 3VPGA 4PSVA 3OH8A 4WV3A 2DZDA 3TRKA 2R79A 4XGKA 1KS2A 2B4AA 3GFFA 1N6KA 4D0SA 4LRUA 1TRHA 4MULA 1E66A 3H19A 5BMVB 2FDRA 2MYTA 3FSGD 1FIUA 4PG6A 3PI6A 3HKDA 3FTEA 4EJFA 4PV7A 3H84A 2DH6A 1J8YF 2AFHE 3SJBA 3V32A 5CLJA 4IMJB 1IL0A 1EUCA 4OQ4A 2MCFA 1QGDA 4EA8A 1K5PA 1RIIA 2EW2A 3VV3A 1B43A 3M89A 1TK9A 1SUEA 3RS5A 3TLGB 3DNPA 3EE6A 2X8JA 3H9UA 4TT8A 5DH9A 2AZXA 1I4OA 4EAAA 5F2KA 5LSAA 3QFSA 1D1SA 2YQZA 2QG6A 2JLZA 2Z56A 1K75A 1N2BA 3GVXA 3WX0A 4MWCA 2LXNA 2ZUTA 3VR0A 2VSFA 3K4HA 4YACA 3KG2A 1C9YA 9ABPA 5I8ZA 3I45A 4FN4A 3PUYA 4BHTA 1E2LA 4DG5A 3DBLA 1U1CA 3FBGA 5AM2A 4NEHB 2CV2A 1AUVA 1FTYA 3A10A 4F1JA 4XWGA 3A3YA 4ALMA 4LYFA 3PHJA 1GN9A 5JD5A 4QGHA 2C57A 3D3QA 3OX2A 1XD2A 3PGKA 3QRWA 5HS6A 3Q8WA 3ROMA 1FTGA 2VBIA 3K1YA 2NSYA 4DRZA 1JS1X 1RAFA 2P9CA 2QDXA 5EZYB 3SG0A 3WBFA 2QTZA 3SBEA 5IEJA 2P8SA 4J1SA 2OG1A 4TYYA 4B9EA 5KQPA 4LJ7A 1QQ7A 4JKOA 2IBTA 3ZGZA 3NETA 3O03A 3GG9A 4RCZA 3CZPA 1PEYA 4ZAYA 2IU3A 4DCOA 4RDCA 2UDPA 4IIJB 3EJ6A 3HDHA 1HYQA 4LWZA 1X13A 3TRHA 1FFEA 3TQQA 2ZWAA 1PQUA 4F71A 5LJIA 1WBDA 1W59A 3EF0A 4PSDA 1DAIA 1UDCA 2A9PA 3SYNA 3W2FA 3K6SB 1SCDA 4BVHA 5A3QA 2HLDA 2IRWA 2BZ1A 2IYAA 3CO0S 5GTDA 3ZWBA 4DM4A 2JFOA 2YY6A 2AWNA 4BKPA 3A3NA 1WD5A 3PZRA 4PHCA 3KUDA 4GVXA 5FBHA 4YUWA 1GTJ1 1E4EB 3DQZA 2WJHA 4O3FA 1JAIA 5ER9A 4BWFB 4DQXA 1BQ4A 1K6IA 2B37A 2NPIA 3U56A 5T4BA 3HB4X 3ESQA 2BAGA 4EYGA 3AINA 1RHJA 1Z0ZA 3H2KA 4MEJA 3C97A 4B7CA 4XVCA 2IIQA 4MUFA 2Z6QA 2A84A 2VNJA 3TXYA 3IBCA 3WHKA 1R9MA 2XA2A 1I24A 2NXEA 1DEHA 3FYHA 4GQAA 4YVFA 3QG1A 1MQ9A 4LPKA 1BHO1 3TL6A 1H2AS 1SXPA 2VTKA 4YJFA 4E07A 3CT6A 3H8WA 3OU2A 4GQBA 2DM6A 3E6AA 3VMFA 1T3HA 1QPGA 5CHEA 4ZAXA 2R6FA 4BMCA 4BVAA 1K27A 2CC2A 1ZJJA 4K9OA 1LVGA 2HZBA 4MWDA 1T4BA 4MR9A 2GVNA 4FSDA 1GLVA 1AHIA 4HRVA 4EF4A 3AUKA 3GEDA 3A1WA 1SCUB 1N6NA 3QLEA 4BKQA 4CM1A 3JW8A 1E3LA 3N59A 5B6JA 4JOSA 1H2FA 2OO5C 2H2WA 1YR7A 4Q00A 5DI9A 4CDRA 2J0SA 5A3SA 1Q21A 1VM6A 5AXCA 3WYAA 4DNQA 3BA1A 1AZTA 1NPDA 4M22A 1Z4NA 2E49A 3NBAA 4BVJA 5KB3A 3ZH9B 3W05A 3R6LA 1M5TA 3AVTA 2WAXA 1J09A 4TQUS 1SVLA 1A9OA 1XBTA 4MQ6A 4ZANA 5C5IA 1ISIA 4E7OA 3STHA 2RD2A 5B1IA 4BNUA 2RJNA 1Y3CE 1PWYE 5TIIA 2AD1A 3IOCA 1CEXA 4KXLA 3ZXXA 3R40A 2BFNA 3UGJA 5IUJC 4ZK2A 4R9RA 2JW5A 2CK3A 5CBPA 5T7BA 1EE2A 1GXSB 1IOLA 1UDBA 4NECA 2WF7A 3SS8A 2GTIA 3FKSD 3CRNA 1WW2A 4FN5A 1YQQA 3PIIA 3PPYA 5BSKA 1BEZA 2QBYB 2XUZA 4DR4B 4EHNA 1JKMA 1P9OA 2HPVA 5BSFA 3M70A 3PE6A 4GKBA 1DEOA 2DHQA 3RFCA 3V2IA 2GJAA 5CUQA 2ZUBA 2H3HA 4PS1A 5AJTA 2G7MC 2NG1A 4GUDA 3O8OB 3ZIAA 2PYIA 1QRDA 3EAQA 3OZDA 2D0PB 1JMKC 5MF6A 4E3WA 1ZBQA 3NWJA 4XYLA 1N3BA 4NJEA 3B6EA 3PHCA 3UGQA 5KYWA 2O2XA 1RYFA 3WOVA 4WJZA 4N8EA 4MVJD 3I6QA 3PK0A 1C9KA 1LRJA 4LN1A 3V2HA 3GDFA 1PE0A 3L2OB 4XCXA 4B44A 2ZI9A 1RYZA 3OU7A 1ZXLA 2WJJA 3M9XA 3PXUA 4MHOA 3IEKA 3E3NA 1IOZA 3EG9A 2QZZA 3TGWA 1UP7A 1XMQB 4IHQA 4U4AA 1V2GA 2V3WA 3LYUA 3AR9A 3F4LA 2EVWX 2Z4TA 2ZIAA 2WYUA 4XLTA 3HHEA 1N9GB 1GQFA 2I2DA 1TM3E 5LXTF 3WE7A 5AXAA 3LFUA 3HH8A 1XPJA 3C7TA 5K0EA 3VR6H 1M2OB 3ANXA 2HJHA 1ZUIA 4U7GA 4F6LA 3BQNB 2JJ8A 1MIOA 1NE7A 3Q12A 4FFDA 4JB3A 5EIXA 4OX9Y 3ND8A 2M32A 1WZUA 2FR1A 2GEFA 3WMFA 3T1NA 3PU6A 4Z54A 1ZU5A 1MN6A 3C15C 2X0DA 2B2XA 4QUBA 1YA4A 2SHKA 5EKXA 2ONJA 1NI4A 1DG9A 1WVIA 4LHYA 3T7DA 1DCFA 2B83A 4K03A 4KQGA 1CR0A 4HH3C 1U9YA 5TV2A 4A0QA 2X5KO 1Z0IA 4F9TA 3MJCA 1B15A 3T7EA 5CFOA 3X1DA 2E4YA 4M8SA 5CHYA 3AHFA 4U7HA 4TLEA 3EQ2A 3TK1A 4BJ6A 1U0FA 4L8FA 5JPIA 4WUTA 4CPDA 2OORC 2FEPA 1MT3A 1MOPA 2I7VA 3AIMA 3K94A 4LHZA 3RG8A 1N2CB 1SXQA 3EVBA 1G5PA 1RACA 4US2R 4JYPA 4UJ5A 3PB3A 1A5TA 1V6SA 1W19A 2MTBA 3OQIA 4DG9A 1R5JA 2DWCA 3HCFA 3J81A 3R3YA 3UB3A 5DM70 3UJAA 3B20A 3OG9A 2FFAA 4IL5A 4HEA6 5KYUB 4FJ2A 3ZWQA 4NS4A 2WINI 2ZIWB 4HYEA 1HTWA 3ER9A 1G21E 5JAZA 3AVVA 4N3NA 3F74A 2ZJ4A 3TE6A 3HKEB 5AVTA 3PFKA 1IUOA 4GXTA 2XODA 1Q15A 3KZVA 3LBAA 1QZ3A 4IF4A 1JIJA 2R1TB 3ICCA 3LBHA 4XIIA 2J33A 4BGEA 4M0FA 4FKMA 3M4JA 5BSTA 4DQVA 4MQ5A 5KYXB 4PPGA 4QIHA 3EK2A 1M2OA 1JQ5A 1IDN1 3AEYA 3MUOA 3E5HA 4UE2A 4WKNA 1RPTA 2J3QA 3EWSA 4LK3A 4P84A 4DQKA 3T5BA 2PWAA 3V3TA 3V9AA 4Z7JA 2PS9A 2KBEA 3KTFA 3KZ1E 1NC1A 2ZYDA 3D2BA 1NBAA 4HJRA 4UHBA 3B48A 3UK6A 1SR8A 1KJNA 4IIDA 1YWGO 4KLNA 5FBQB 2VP9A 4WBXC 2IEIA 2DFDA 4RJJA 4CMJA 1IBMB 2VC2B 3GMTA 2O0JA 1LDNA 5C5EA 1B23P 5CTAA 3OP4A 4M7PA 4EENA 4F3CA 3PD1A 3JQEA 4R8LA 4NV0A 2IZ6A 1HE3A 4JVLA 2V4MA 4L8WB 3SZUA 3GLHB 4D26A 2D1SA 3RIEA 3TAHA 3JU3A 3TM5A 4C0JA 5MN6A 3AF3A 2QQEA 1O1YA 1WPQA 5J4VA 3L8DA 3GFRA 3HB9A 1A77A 4E1BA 1VJDA 3GELA 4MQ4A 2IXDA 5ERXA 3RS8A 3S2SA 4NAHA 5K8IA 4KNYA 5JNLA 4JJ6A 3C16C 4MV4A 3ISJA 1ZNQO 2C3OA 1L9KA 2H17A 2E4VA 1P5JA 1R4NB 3CU5A 2FRXA 3FNHA 4EW3A 1ES9A 1OZGA 3HO8A 5K6AA 4F8EA 4CLDA 4OKSA 3DWGA 3KLOA 3DKKA 1QHNA 2HR1A 3VR4D 2PLAA