2HMSA

Rectangular-shaped octameric ring structure of an rck domain with nadh bound
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
138
structure length
138
Chain Sequence
b'KQFAVIGLGRFGGSIVKELHRMGHEVLAVDINEEKVNAYASYATHAVIANATEENELLSLGIRNFEYVIVAIGANIQASTLTTLLLKELDIPNIWVKAQNYYHHKVLEKIGADRIIHPEKDMGVKIAQSLSDENVLNY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YuaA protein
publication title The RCK Domain of the KtrAB K(+) Transporter: Multiple Conformations of an Octameric Ring.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Membrane protein
total genus 44
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02254 TrkA_N TrkA-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2hmsA00
1KBZA 1VM6A 3WGYA 1PL8A 1Z73A 5HBRA 3PGJA 1HXHA 4BGUA 4RVDA 4B7XA 4GVXA 1GEGA 2V6GA 4YPOA 1G6KA 1U28A 4I1IA 4FGWA 4I9HA 2VWQA 1PQUA 4PVDA 4NK4A 5COQA 4BQPA 3RC9A 1PR3A 4BB5A 1HTBA 3VOSA 3X2FA 4MO2A 1DOHA 2IZ0A 4U8GA 4W4TA 3F4BA 3NKLA 4TZKA 2HJSA 3VDRA 3B20A 4EYEA 4CMKA 2PFGA 3H2SA 3UN1A 4QFCA 1LSOA 3NTRA 5JE8A 2G1UA 4M89A 5JYEA 5IDQA 1ZK1A 2BI8A 5ENDA 3FRJA 2QZ9A 4J0EA 3GFGA 3H7AA 1YOVA 2HSDA 3ZU5A 3IAHA 3D64A 2Q45A 4P4GA 4PLYA 3JQ8A 4JK3A 4JBHA 1HYGA 1P1IA 2ZQYA 3BMOB 1Q7CA 3W1VA 4CMBA 4BO7A 3GK3A 3WXBA 2JKVA 3FCOA 4BKQA 1QORA 5LC1A 2G5CA 1M67A 4CJXA 5A04A 1ZMTA 3FI9A 4TRRA 3ZV4A 2PGLA 5JNLA 1HDCA 3WGOA 3IMFA 2GR9A 4GPD1 5HA5A 3VH4A 3JD3A 1NVGA 3QIVA 4DC0A 4MVJI 1PU2A 3GPIA 4JQCA 4N18A 5H83A 4B4UA 5A03A 4Q39A 3E48A 4JGBA 4QTZA 3OQ1A 2EV9A 4NJMA 4CL3A 4RV9A 1E3SA 3WR5A 3VZPA 4LMPA 2CNBA 4PCVA 4CV0A 4Q3EA 3HADA 2P5UA 1F12A 3TL3A 4XYGA 4F45A 2YV1A 1AXEA 3H2ZA 4DC1A 3UVEA 2ET6A 2PZLA 5L7TA 3FNEA 1IL0A 1S7CA 3WQQA 3O38A 1NPDA 4D44A 1HE5A 3U62A 1DSSG 3I9KA 4LVUA 2IXBA 3ZNOA 4BNGA 3ORFA 3E9NA 1WZIA 3GLQA 3CH6A 3H9EO 1P3DA 4D7AA 4IZIA 2ZJ0A 4KUGA 3ROPA 2WYWA 1PJBA 5TJ9A 2HO5A 5HS4A 4R9SA 4YEDA 4RZIA 4G81A 2NLOA 3I9MA 1J4AA 2OOSA 4UUOA 2WD8A 1DFHA 2Q49A 4BS9A 2JD0A 3B70A 2DT5A 1DDOA 4O5OA 4Z9YA 4Z9FA 4YVFA 1ZK2A 2UUOA 3K92A 4KWHA 1ZSNA 4E5PA 4JXKA 3ZV6A 1U4SA 2Y1DA 3E5MA 2R2GA 2W2LD 5A3JA 1N9GA 1K89A 2Q1WA 3LLVA 2C29D 4YA6A 3V1UA 2OORA 4J9UE 2J8ZA 4L74A 5C7OO 5JW6A 3IUSA 7ADHA 1DRWA 4PZEA 4AJLA 3VVBA 4B7UA 5J23A 3JQ9C 1N1EA 1NYTA 2A35A 4OIMA 4AJHA 1LDEA 5DBFA 2YV2A 1Z82A 3E03A 4PLFA 2X1HA 4J1SA 4QECA 2HMTA 1EVYA 2OBNA 3PQFA 3ZU4A 1E7YA 3MZ0A 2BMAA 4GGOA 4TKLA 5AXDA 2DFDA 2GO1A 4D3DA 3ETEA 1ZH8A 1NQTA 2SCUA 3KYCA 3C24A 1QKIA 3WIEA 3VH3A 3DDNA 4JROA 2AHRA 1V3VA 2P9CA 4IMRA 4BO2A 1I2ZA 4WLNA 1MC5A 5GMOA 4YR9A 2I65A 4FJ2A 4XGIA 4URFA 4CQMD 4UVEA 1KVSA 1IYZA 1E7WA 4L9RA 1WXDA 4BKUA 1Y81A 3GVIA 3EAGA 2TMGA 2NU6A 1YOVB 4Q3DA 1DFIA 1PEDA 4Z6KA 2CMDA 4U6QA 4Q3BA 2OHXA 1QYVA 2WDZA 3O4RA 3JQ8B 2G76A 3A06A 3ZWWA 2VN8A 4BVAA 2D4AA 2YDXA 1FDSA 2NUAA 1UDBA 4ALMA 4LISA 1TT7A 1PTJA 3D1LA 5TT0A 5DOVA 4E5MA 5JC8A 3GVHA 4ZD6A 1LBEA 5TJHA 4BV9A 4ZRMA 3F9IA 2PZMA 3UXYA 3FTPA 4CMCA 1O6ZA 4WLEA 3EC7A 2Y66A 3T4EA 3U09A 3G1TA 2PA3A 1U3VA 4XCVA 5B4VA 2QHXA 3PWKA 1B15A 1EVJA 1KVQA 3PRJA 3WS7A 3LC2O 5DBIA 3JQBC 4CQLA 1U3TA 1GZ3A 2IDZA 5AXBA 3MJCA 3GRKA 4IXTA 2ILTA 4MP8A 4IXWA 3QVOA 4U0JA 3VC7A 3IUPA 2QZZA 1Q0HA 1UP4A 1S6YA 2EHDA 3C7DB 1JKFA 1I24A 3NGLA 4J4BA 1H0KA 5GZ3A 1GTMA 1A7AA 3U4HA 2CDCA 5G4KB 3OMLA 2ZTUA 1N7GA 3VTZA 2EP5A 3QA9A 3TOZA 4ESOA 3W8FA 3F4LA 4PIVA 1DRUA 1H2HA 3PFWO 3F1LA 5EQFA 2VYNA 3F5SA 4DWVA 1NVTA 5BNFA 4ZN6A 2H6EA 1GPDG 1Z6ZA 2V6MA 4IIUA 3ADOA 3PDJA 5LCXA 1PJLA 1CETA 3ZI0A 3I9LA 4GGPA 2C7VA 1KOLA 4NIMA 5BNTA 2NVBA 3L77A 2OZPA 1LRJA 4MKXA 3RQSA 4GWGA 3DBRA 4C7JA 3OIDA 3K96A 3GRPA 1N9GB 3BHJA 3INRA 3WGGA 1ULUA 4ZJUA 1UH5A 1KS9A 4OXYA 2DTDA 3MWDB 3RBXA 4CQMB 4WLVA 3GH3A 3UCEA 1IZ9A 1UJMA 3JSAA 2C2YA 2PY6A 2B83A 4ZVVA 4Y8VA 4EZBA 2YFQA 2X9VA 4UAGA 1I32A 3S55A 4MKZA 1O94A 2YZ7A 1NXQA 4PLVA 3QRWA 2Z5LA 4RPGA 2BELA 5DDIP 3K2BA 3KUXA 1PL6A 3KYBA 1DIGA 4H3VA 3WJ7A 3GMDA 1DAPA 4DUPA 4RPLA 1GR0A 5B12A 3C3XA 1LQUA 2RH8A 4IJKA 4YAJA 3GUCA 5JMPA 1MGOA 1ISGA 4W9NA 3PTZA 3ANMA 3NAQA 5L4LA 2IE0A 1NWCA 4I5FA 2GUGA 1DHRA 3IKVA 3A9WA 4E2ZA 3SC4A 2FPIA 3NDIA 5F5LA 1T4DA 1R12A 1OOEA 2E48A 5KTKA 2O3QA 4GLLA 3FWNA 5KVVA 1ZJZA 3HUDA 4QXMA 1DJQA 3AM5A 1U8FO 5KCZA 3WFIA 5TSDA 3RD5A 3HDHA 5TC4A 4Y6SA 3NGXA 3UUWA 3GA0A 3TL2A 5KIAA 3QW2A 4OH1A 2YDYA 3WWZA 5C7IO 5JPIA 3AY3A 4FN4A 2ZTVA 2NU8A 3DZFA 3QVSA 3T7CA 4RVFA 1VE9A 4TQGA 3MTGA 1KVUA 3D4OA 4NFYA 2RHCA 3PEFA 2VYVA 2X86A 3Q9UA 2X5JO 3MCVA 2PTGA 4E30A 1BVRA 5CP8A 3S2IA 3DAPA 2ZB8A 1LLDA 3A1NA 2AXQA 3KTDA 1CEQA 4RF3A 1RM0A 2WE8A 3WYEA 1ONOA 4H7PA 2ZQZA 4RL6A 4IM7A 2PKQO 1QR6A 2D59A 3BIOA 3DZHA 3AK4A 2VHZA 3A28A 4BO5A 5A02A 1DFGA 4TRNA 9LDTA 3ST7A 3TN7A 3ASVA 4XR4A 4CMEC 1P1KA 3CIFA 1KEPA 3HJAA 1MXHA 1I3NA 5BSEA 5CG2A 5ILOA 1IHYA 1MXFA 4WLOA 1XIVA 1LLQA 3WQSB 5EJ2A 1E6EA 4RF5A 2YHIA 4OSOA 2VHWA 1VJTA 2XOXA 2FP4A 4GSKA 2ZJ1A 4AJEA 4E12A 2HRZA 2VRCD 1RKXA 4MKRA 4MVJD 3O03A 4NU5A 1RJWA 2AQHA 4G2NA 5L53A 2PV7A 1M76A 5T8KC 1BW9B 2VYVD 2HQ1A 1AXGA 4BNKA 5CEFA 5AVOA 4NI5A 2Y99A 1HEUA 3K5PA 2A92A 1FMCA 2NSDA 4JP3A 1EEHA 3WDSA 4WCFA 4R41A 2JFGA 4UULA 3WFJA 4CMAA 1VL0A 1F14A 1LNQA 5FEUA 2DLDA 2W2KA 1NBOA 1E5LA 3DBRB 5TQVA 3ZWCA 1WMBA 1NR1A 2B4TO 4KP7A 4B3IA 3UOGA 4XRGA 1XQ1A 4MDHA 3KETA 4XIJA 3CUKA 1R0KA 1B14A 2YW9A 1DRVA 4D41A 3AM3A 1G0NA 3E9QA 3FTNA 1T4BA 5F3RA 1EK5A 2NWQA 4A5OA 4GX0A 5AXCA 3SJ7A 4CLEA 4WJZA 4J43A 3U4IA 4A03A 1CDOA 4PZCA 4ZU3A 3ZWPA 5DP2A 8ADHA 3EVNA 4D0SA 1VLLA 3TZCA 4FJ0A 5DULA 4PG7A 2AG8A 4PN3A 3IKTA 3PK0A 1B2LA 1KEWA 4A2CA 4DRYA 4IQGA 4XJTA 1MG5A 2IODA 2C5EA 4KWIA 3RUDA 3AUAA 3C1OA 3JQCA 2NVUA 3OHSX 1SB8A 2FR0A 4PLCA 2Y0DA 4FS3A 1ENPA 4WECA 3VH1A 2FN7A 1U7HA 3Q2IA 1E1MA 3ZZNA 1QRRA 5G0TA 2VNSA 5HM8A 2RHRA 2QRLA 1PJTA 1KC1A 1W4ZA 5ES3A 3DBHA 1ISIA 2OUIA 2I3GA 1MB4A 4R68A 2AEMA 2ZYDA 3T4XA 4DPKA 4IDAA 1P1RA 3GHYA 4II3A 3C7AA 3WMWA 4E31A 3ZHXA 1E7SA 1YL5A 4LSWA 4IBOA 3BHMA 1PSDA 3IP1A 5B4TA 5TRTA 2Y1OA 4DPLA 3AOEC 3I9JA 4PG6A 4K1LA 2E6UX 1HRDA 1DIHA 3GG9A 4OAQA 3RJ5A 4UEOA 3H9JA 2B5WA 2IRWA 4X54A 4E4YA 5BT9A 2XF8A 3L4BC 3GEDA 5CAEA 2Z1MA 3EY4A 4BB6A 1LX6A 1K6JA 3W8EA 1CWUA 5KVQA 3DEYX 4IJVA 1WDKA 4YJHA 3GFBA 5TGDA 1E1NA 2HK7A 1OMOA 1U3WA 2DTXA 2CVZA 5DCWA 4DLLA 3PXXA 1YBAA 3PWSA 1Z74A 2VNAA 4GAEA 1P74A 2Y1GA 2XAAA 4CODB 4KDEA 1UDAA 1WPQA 2J5KA 1A5ZA 3LF2A 3NT2A 2YHIB 4BO0A 3QQPA 3QWAA 2XPCA 3BTVA 2RCYA 2IXAA 1NM5A 1PX0A 1SO8A 5KVCA 5I7FA 1ENOA 2NTVA 5DBGA 2OGUA 4AFNA 1SMKA 2X0RA 1PZEA 3DMYA 5JAZA 1U2DA 3KEOA 4Q9NA 4ROSA 3V2UA 5IF3A 1B8UA 3JQFC 2IEDA 3GN1A 2GZ3A 2I3AA 3JQ9A 4DTIA 4LVCA 4WCFB 3ZNNA 4HY3A 2EGGA 1I10A 1I3MA 3PGXA 3RROA 2W2KB 1D1TA 4E33A 2GZ1A 2RBEA 3U0BA 4MIYA 5KVSA 1DB3A 3ROQA 3TPCA 4HADA 3AOGA 4FFNA 3FR8A 4PG5A 2ZCVA 1Z45A 2WE7A 5DP1A 1PZHA 1TI7A 5L51A 5A9RA 1E7RA 4ND2A 4IJUA 2DPGA 4Q3AA 4R3WA 3UFXA 2GD1O 1DJNA 3M1LA 3CE6A 1VL8A 3KM0A 1YB4A 1R6DA 1JDJA 1HLDA 3GG2A 4NFSA 4HV4A 4D3SA 2A94A 3ICCA 4OOFA 3K9QO 2O23A 2E49A 1T24A 1B0AA 1SPXA 1YJ8A 1IUKA 2P9GA 5JXWA 2J5RA 3WB9A 2DFVA 4GMFA 4NQZA 3CSDA 2X6TA 3GUYA 1SEPA 2BFAA 2PKRA 3L6OO 3NX4A 4OKIA 2GSDA 3WYCA 4B4VA 1QLJA 2NVUB 3L6DA 3MJTA 1ONPA 4XYLA 1ZVMA 3VZRA 4DIFA 3JYPA 1SB9A 4XGKA 3TFOA 1UP6A 1Y8RA 1ARZA 3I9OA 4YRAA 2WD7A 4AL4A 1ISHA 4W7HA 1C1DB 1LLUA 1Q0LA 4KDFA 4CR8A 3DBHB 2RIRA 4XKJA 4MVJM 1AHHA 1RM3A 3GMSA 4HNHA 1Z75A 1CIVA 2PLAA 4XWYA 3A4VA 4XD2A 2ZTMA 5ILGA 3FNHA 1XQ6A 2GN6A 4WPGA 1M2WA 4OMUA 4IDEA 4E13A 1HYEA 3MTJA 1H2BA 3I4CA 2EJWA 3JQBA 1U4OA 1YGYA 3DZKA 3RIHA 3ZWMA 3ZV3A 5U1PA 3ZN2A 2I67A 1FF9A 1P77A 4FOSA 1P9LA 5K6AC 1X0XA 1VL6A 1YQGA 3WGTA 2X0JA 3H9GA 4R1UA 3QVTA 1QLHA 4YAIA 4IS2A 3SX2A 1Y6JA 3GDOA 4WNCA 4YJHB 2C82A 4J3FA 2DBRA 2PD3A 3KV3O 4ZHSA 4LRTB 2EWMA 2WSBA 3K30A 3G49A 3G0OA 2E82A 3X2EA 4EUEA 3DZIA 1VC2A 3HNPA 1GZ6A 4D3FA 3JD0A 3W6UA 1HL3A 2NVWA 1PJ4A 3FBTA 2BF7A 1EQ2A 2NU7A 4XQGA 1GQYA 3U4CA 4DIBA 2FR8A 3GVXA 5F1OA 4ALIA 4Z0TA 1HDGO 4DMLA 5CDTA 3INGA 3VVCA 4I8XA 5L40A 3KRTA 4DYDA 4IJWA 5LDHA 4PG8A 1M6HA 3LT4A 3PYLA 4RDIA 1WMAA 4EEZA 3ZWAA 3C85A 1ZJYA 3RUAA 1N92A 2X0IA 3OSUA 3CZRA 1TXGA 5F1KA 3CZMA 3AU8A 1NAHA 1RM5A 2LDXA 3JQDA 5A9SB 4FOOA 2WEKA 3RI3A 1XA0A 1DC4A 1L7DA 3OFSA 3AWDA 1WDMA 4CM6A 1I2BA 3F47A 2O3RA 1Y5MA 3GNQA 5ICSA 4YJFA 4YXFA 4E32A 1UXJA 1SZJG 4NK5A 1X13A 5KWEA 4F46A 1A71A 2O3TA 2DPHA 4GVLA 2ZB3A 4M49A 3DQPA 2V6BA 2W2LA 4OOEA 4OXNA 1YKFA 1BSVA 1EBFA 3TZHA 3VPXA 5JFOA 3D4PA 4OO3A 1LU9A 4YQZA 4CM9D 1H6CA 1C3VA 1YDEA 3OJFA 3G17A 1X1TA 3JQEA 4RVGA 1V35A 4EJ6A 5TT1A 3L6EA 3MJSA 1GEEA 1V3UA 9LDBA 4AJNA 3LC1O 1UXKA 4K6CA 1WNTA 5G4KA 1CQJA 2ZIZA 4YBZA 1VRWA 1LRLA 3DAGA 4K26A 2BHLA 3PJFA 4CM7A 1P31A 3JYLA 1Y8RB 1BMDA 3RASA 4E21A 4L4RA 2WD7B 5JO0A 4BO6A 1YBMA 5TIIA 1ADCA 4CM5A 1YE3A 3GDGA 3FSRA 1T1SA 2I6TA 2GCGA 3FPCA 3DFZA 5AOVA 3RU9A 5IJZA 3JYOA 3OA2A 5H81A 4JJIA 4GX2A 1I8TA 4RF2A 3ZNPA 1K6XA 2F1KA 4ITUA 1WDLA 5F5NA 4GKVA 1EE2A 4WOJA 1U7TA 4XGNA 3RFXA 3NV9A 3BTUA 1LRKA 4CQMA 3DO5A 3OIFA 3P19A 2JL1A 4NU6A 1T25A 1PGJA 1PL7A 3DBLA 4FW8A 1OBFO 1GYPA 1LSJA 2GERA 2EERA 4R1SA 3VTFA 2JCYA 4P8RA 1YS4A 5TLSA 4XRRA 3RUEA 4CMHA 2CF6A 4YRBA 3VH2A 2VRBA 4BHTA 4I5GA 4CMEA 4TMFA 4GWKA 3CPSA 4JIGA 3SJUA 4FFRA 1F06A 3HHPA 5EESA 4B3JA 4R69A 5DZSA 4MVJG 2ZYGA 4BNXA 4WE3A 3L4SO 1T2EA 1TT5A 3FNGA 2B5VA 1EUDA 2AG5A 5A4DA 2B4QA 2Q99A 5T64A 4DLAA 3ZH2A 1A72A 5T8KA 5JDIC 1XCBA 2O3JA 2VQ3A 3RU7A 3M1AA 3AJRA 4NDNE 1WLYA 3H6KA 4K9DA 1X1EA 2D2IA 3I23A 3LT2A 4QT0A 3F1KA 4TRJA 1QYWA 4U7WA 4EGFA 3QVWA 4P38A 3HSKA 4CLRB 4RGBA 2PWZA 3NDJA 2J6IA 3P2OA 3TRIA 2CZCA 1EE9A 4BNZA 2Q2QA 2QYSA 4BQRA 2OP1A 1MG0A 4LCEA 3O8QA 5IZCC 1ZKMA 3KLMX 3NTOA 3H9UA 3E18A 1VSVA 2BI7A 1E6WA 2OL4A 4ND1A 2PGJA 3ZWBA 4EJ0A 3DBVO 5I8WA 1K3TA 1LUAA 4N5NA 1DPGA 5ITVA 4R9RA 1HWYA 5F1PA 3C7CB 1BVUA 1GUYA 2UUPA 3PIDA 1P33A 3PQDA 1TA4A 1DIAA 2DU8A 5FF9A 4J2HA 5T57A 4AJOA 3CKYA 4OKNA 3VPGA 1NFFA 1AE1A 1HSOA 4FFLA 1UXHA 3DTTA 1E3JA 5GZ1A 3PJEA 4BNNA 2O3SA 4PZDA 1JTVA 5L95A 4I9NA 3C8MA 4J4TA 1UDCA 2AQ8A 4YJFB 5HTOA 4BO9A 3OH8A 4GKBA 2PZJA 4DQXA 1V3TA 1E7MA 1CYDA 4J90A 3WNVA 3ASUA 2NM0A 4CLXA 1NR7A 1ISJA 4JX8A 4LRSB 2HK8A 2HK9A 5COBA 3G79A 3ITDA 4CM8A 3RCBA 1JWAB 1BXZA 2PR2A 3N7UA 3ZHYA 3AY6A 3CEAA 1JWBB 2H1SA 3WG9A 5ENVA 5DNAA 4Y9DA 1DBVO 1YQXA 2VTDA 5CEEA 3DZBA 4OJNA 4LSMA 4DL9A 1BW9A 4DIOA 4XJSA 2FHSA 3WMXA 4CM4A 1LDGA 5A05A 1D1SA 1T2AA 2DTEA 3BXXA 4ALKA 1Q7GA 1K0UA 1PJSA 1NFRA 5MGBA 3IJRA 1W6UA 3WBFA 2Z95A 3ITKA 5IAAA 1PWZA 4EUFA 1X15A 3AOEA 3ICPA 4WEQA 4XB2A 5G2OA 3OBBA 2DQ4A 2HMVA 1C0IA 2HU2A 3SVTA 5A5FA 1EFLA 1N5DA 3PYMA 3L4BA 3UHAA 2J3KA 4NBRA 2GGSA 1NNUA 1PGNA 3DBLB 4UEJA 3BZUA 3WBBA 5CDYA 1ZW1A 5A3VA 4BO3A 4XIYA 2FWMX 4FSHA 1AHIA 3ETDA 1AN9A 3UH1A 3QWBA 1SOVA 3P7MA 1GL3A 3DTYA 4GX1A 3CINA 2VHYA 4YAEA 2AMFA 2Q1SA 3EVTA 4O6VA 2Q2VA 3KVOA 4FJ1A 1JAYA 1G1AA 1YB5A 4S1VA 4J91A 1TT5B 2X22A 3I5MA 3HG7A 4UVIA 5CEJA 1UAYA 3WTCA 3VDQA 1ISFA 6LDHA 1NVMB 4NH4A 4PRKA 3ZWNA 4H16A 2A4KA 1K5HA 4MOWA 1YONA 5JDCC 3JQFA 1R15A 5I9MA 2O3UA 4MVJE 3RSHA 4XEHA 4BO1A 4AJ2A 1U2GA 3EDMA 4HBGA 5FI5A 4NG5A 3INTA 4BIIA 2FZEA 1LDYA 5G0UA 2VOJA 3DAFA 3ZHBA 2CVQA 4C7KA 2EF1A 1E0DA 4D79A 1DXYA 2Y93A 4IS3A 4DMMA 1O9BA 1YDWA 2P4HX 1IZ0A 3O8QB 3I83A 4GMGA 5DCUA 4CV1A 4CUKA 1N2SA 2D0IA 3AUUA 3AY7A 4JLWA 4BNYA 1C0KA 4YYZA 1X14A 1NX6A 1NP3A 5CDGA 3V8BA 2EP7A 2JJYA 4JBGA 1K6IA 2BGLA 2HLPA 5B1YA 4OHUA 3RUHA 2Y0EA 1ZIDA 2VRCA 5EL0A 1L1FA 1NFQA 4MVJA 4BGEA 3S2GA 3TSCA 1KEVA 1UXIA 2O4UX 1I3KA 4PLZA 3ZDFA 4QUKA 4BO8A 2ZB4A 4WK6A 4XQCA 4Q3NA 1YJQA 4R1TA 2J3IA 3LT0A 1ML3A 4PLTA 3DFUA 4XA8A 3FNFA 1BWSA 4PLGA 4RDHA 2JFFA 4L4SA 1VKOA 3PJDA 2W8ZA 1MC4A 3GZNB 4RLHA 3DWFA 4XQ9A 1NPTO 1OC2A 1YO6A 1YL7A 3DOJA 1R16A 4CM8B 5IDXA 4WASA 1KY4A 2NU9A 5KJ6A 3L9WA 4W7IA 2DBZA 4HFNA 2GRAA 3U5TA 1VI2A 5THQA 5I9NA 1QYCA 2X4GA 4DGSA 1J5PA 2VWPA 3UICA 3D5TA 3JQAD 3A14A 3OA0A 4RPKA 5KKCA 4OXKA 3O26A 4OYRA 4AJ4A 4BV8A 4D0RA 4IUYA 3KBOA 3UCFA 4CM4B 1Y9EA 4AJKA 4FB5A 4OSPA 3B1JA 1P1FA 4BNMA 2HUNA 1A9ZA 1ULSA 2WTBA 3NJ4A 1P45A 1R37A 2JCXA 4HX5A 3UCXA 2HRBA 2JD2A 4IDDA 4DXHA 4HFRA 4FC6A 3STHA 1LC3A 5K6AA 3LU1A 2JAHA 1BHSA 2YYYA 1EBUA 3H5NA 3EK2A 1B8PA 4ND3A 2DM6A 5L7YA 3UW3A 4IINA 3OJ0A 4NPCA 3MJEA 3GNSA 3QJ5A 1LTHR 2QRKA 4J7UA 6ADHA 5IN4A 5G0SA 4GH5A 2QX7A 1Q0QA 5BQFA 4TWRA 4IQ0A 3D4NA 4EJMA 3HDYA 4K6FA 1XEAA 3RC7A 3GC6A 2WYVA 5BR7A 3WGIA 3OIGA 1WWKA 2X5KO 3BMQA 3NT5A 5ICMA 1JAXA 2FOIA 2B69A 5JLAA 3IC5A 3W4IA 1VJ0A 5JMWA 3ONFA 3GVCA 5KKAA 5H82A 1HDXA 4I5DA 5FYDA 3GY0A 3TF5A 2GLXA 4E0BA 5IZ4A 3RC1A 4CLOA 3HE3A 3OJLA 4HKTA 1WZEA 4P4NA 4UREA 3QWIA 1SBYA 2POQX 3CTMA 4HP8A 2NTNA 5CFZA 2ZKLA 1HDYA 1JA9A 4J0FA 4J6FA 4TVBA 3UF0A 1C1DA 3Q3CA 4BO4A 3UAGA 5L7WA 3LF1A 2R00C 4R51A 1CRWG 1ISMA 3MWEB 4L73A 2NQTA 3D3EA 3W8DA 5IXSA 4YACA 4UUPA 1D7OA 1Y1PA 1CERA 1EDZA 1H6BA 1U9JA 1XU7A 2Q1TA 2ZK7A 3NUGA 4NR0A 1GAEO 3R3SA 1OAAA 1R66A 3WGHA 4N5LA 2OO5A 4ZA2A 3GHHA 2CVOA 4IDBA 2NQ8A 2BD0A 3AU9A 3GVPA 4J7XA 4L0QA 4YTEA 1IE3A 2D5CA 2Q4BA 3JQAB 3MEQA 4UVDA 4GSLA 5KJ1A 5BSHA 1QP8A 3GQVA 3PHLA 1H9AA 4II2A 3R3JA 2O50A 3I1JA 3PQEA 2HMSA 5L9AA 4B4WA 4AJJA 4PLWA 4FCCA 2C0CA 4XYEA 2OFPA 2VT2A 3OM9A 1DAOA 2ZB7A 3OP4A 4XQEA 5TS3A 4J49A 3C1TA 1N8KA 3JQ7B 4RPJA 1PS0A 4JBIA 2D5AA 1R4NB 4M87A 4UVHA 2GYYA 1JQBA 5JCJA 2AQIA 3RVDA 1IULA 1ORRA 3BMNA 2EKQA 3QLJA 1DLIA 4Y98A 4QX6A 2X7HA 3Q1LA 3NTQA 1GV0A 4W6ZA 4ND4A 1D3AA 1W0CA 3TNLA 3JV7A 5I7VA 1MLDA 2VHVA 1I5RA 1ZZEA 1ENZA 2VTEA 2X9GA 2Y1EA 3QV1A 1DIRA 2BGKA 4CUZA 5EQDA 4BKRA 1T2CA 1NTOA 4FD3A 3GR6A 7MDHA 3H4VA 2VUTA 2D1YA 4E5YA 1DEHA 1V9LA 4OQYA 3GN2A 3OF2A 2VOEA 2YHUA 1T2FA 4CV2A 2NNLD 3FF4A 4EI2A 4O63O 5A9SA 3MOGA 3QVXA 4R01A 1DO8A 3TZKA 4BKPA 1Y8QA 3U4DA 2ZCUA 2FR1A 2QG4A 5HS6A 5JCJD 1GFSA 1PWXA 4GX5A 5K0ZA 2Q50A 3IS3A 1XG5A 1EZ4A 2AEJA 3JYNA 1BXGA 3OECA 4E2XA 1T2DA 4ZQFA 1TB4A 1U3UA 3WLEA 1BDMA 1BGVA 1ZBQA 5JDIA 1B7GO 2OP0A 4CPDA 1AUPA 2G82A 3KZVA 3JQGA 4XB1A 5IXYA 5A5EA 1IY8A 4HFMA 3BMQB 1HDRA 2TMDA 5IFLA 3KSDO 4UUNA 1BG6A 4CR6A 3KXDA 1SEVA 1KIFA 1ZK0A 4AJIA 2E4AA 2Y0CA 3PPIA 5C5IA 4D43A 3W6ZA 5IG2A 5COAA 1PS8A 3EGOA 1H5QA 1MUUA 3SLGA 1RYEA 4E5KA 2DVMA 3H3JA 4MVJH 5BNIA 1RM4A 4AG3A 5IZCA 3R6DA 3KOUA 4CLOB 2JFHA 5EIOA 1PQPA 1WAMA 3MJ4A 4N7RA 3LQFA 1NQOA 1DHTA 1V0JA 3BAZA 3DOOA 2CF5A 2V65A 4MINA 4BMNA 1HF3A 4CM3A 1PJ3A 1Z7BA 1XKQA 1ZSYA 4AJ1A 3IDSA 3PLNA 2H63A 1NASA 1H94A 4NJOA 4TRMA 5JY1A 1IOLA 2GPTA 5KNLA 1CJCA 1C0PA 4YT5A 4A10A 4WNIA 1JKIA 4DBVO 1QMGA 3DZJA 1GUZA 1ENYA 4XZ3A 5G0WA 4BNTA 4TROA 3IL2A 4PVCA 3VPHA 1U5CA 3RUCA 1RWBA 2C2XA 3DC2A 4FDAA 3OETA 1E3WB 3AM4A 5EERA 1M66A 2HKIA 4F6LA 5ER9A 1JKJA 2I9PA 2VUUA 3BYZA 1HE2A 1PGOA 4WCDA 4L76A 5T67A 4BKOA 1LXCA 4HXYA 2EKLA 2O4CA 4OL9A 4BNWA 3GT0A 5B4UA 4DA9A 3OQBA 4LK3A 1GY8A 1A4IA 5JY6A 1IPEA 4AICA 1I30A 4TSKA 4QO8A 2I76A 4MIOA 3ZWYA 3JD1A 1XYGA 1H6AA 2I5PO 2J3HA 1R0SA 2RAFA 1LDNA 2JD1A 1HE4A 3GF4A 2WJPA 3IOYA 4M54A 4XDZA 1PJ2A 3PFFA 3ENNA 4WUVA 4MVJF 4ALNA 1HT0A 2GN8A 4E6PA 1HLPA 1RYDA 3CXRA 1ZUD1 2FZWA 2F00A 1EFKA 1ZEJA 1MFPA 3BMNB 4QFDA 3TFQA 2CDBA 4NBVA 1FDUA 3EZLA 4J1QA 4B4OA 4CLRA 3LZ6A 1PGQA 4QQRA 3RKUA 5JSFA 3Q11A 4FBGA 4D45A 2P91A 3H65A 5I7EA 3AFNA 3FBGA 5THKA 2B0JA 4PGFA 4CMGA 3Q0EA 2VHXA 2DKNA 3QSGA 1N7HA 2GNAA 4CM9A 3TOXA 5L4SA 4KTVE 3GOHA 4UEKA 3WIDA 3FN4A 4LCJA 1GV1A 4I9UA 3BTOA 3LLSA 2DC1A 2I99A 1ZNQO 4D42A 2BFPA 1UZMA 3TWOA 1KY5A 4FFPA 1ONNA 1Y8QB 1XGKA 4FFMA 1UXGA 3OICA 1E3IA 2PD4A 3RC2A 4B8WA 3S2EA 5L4NA 1ZCJA 3HDQA 3K8ZA 2VUSA 3PWZA 3ETGA 5TNXA 1BXGB 3N58A 5IN5A 2JHGA 3GNTA 4PRLA 1SOWA 1I0ZA 1WVGA 2B37A 4Y67A 1XLTA 5JC1A 2B35A 4RQTA 2G17A 2VWGA 3QY9A 1O89A 1BDBA 1XWFA 2Q46A 3JQGB 4I08A 4TKMA 5A9TA 5I7SA 5JDCA 2JAPA 1HETA 1HZZA 2HMWA 2XXBA 1L7EA 1FJHA 4OQZA 4OM8A 3W4JA 1X0VA 2WMDA 3VPSA 1X7HA 2FRDA 3HDJA 2HDHA 2AQKA 4LN1A 2VT3A 3HB5X 3QHAA 2P4QA 4KQXA 1T26A 1ZSVA 3ZGYA 4XYBA 3IQDB 3S2FA 1MP0A 1PIWA 3ZU2A 1OZAA 4RVUA 2Y1CA 2X58A 1YB1A 4QSMA 1JU9A 5CG1A 3H5AA 1E3EA 1IB6A 3RBZA 1FXSA 3BA1A 4BGIA 5K9ZA 5A1TA 1N1GA 1M6WA 1OC4A 5FI3A 4DREA 3EHEA 4KTTE 5ITWA 2PH5A 4J4HA 4K28A 3VAZA 3KEQA 4ONEA 1O5IA 3NYWA 3GGOA 2X8LA 3LC7O 2EGHA 2QRJA 4WEOA 3JYQA 1PZGA 4ID9A 3K6JA 4KOAA 4BNFA 1F17A 2X5OA 4QO7A 1H93A 4INAA 4RVHA 5KJFA 2EIHA 4YB8A 3PVZA 5JCXA 1W73A 3H5RA 2FSSA 3ONEA 2BLLA 5C37A 1XSEA 4LMRA 2W90A 4L75A 3E9MA 3DHYA 4CV3A 2WM3A 3D3WA 3OQ6A 1B26A 3PLRA 1KETA 2Y1FA 5IDYA 1ZK3A 4L4XA 3VZSA 1GYQA 3ROMA 3ZCXA 4GL4A 1P1HA 2B4RO 2IZ1A 3WICA 5AXAA 1J6UA 4RQUA 2Y05A 1VJ1A 3AUTA 2YQ4A 4MIEA 2AW5A 4NBWA 1EK6A 1F8GA 3V5NA 4BGVA 4ALLA 4AVYA 1JVBA 2VWHA 4G5HA 4NHEA 3OJOA 3WYBA 4KUHA 3HB4X 5T6BA 1O95A 2AE2A 3EUWA 2O2YA 3SEFA 3DB2A 1E7QA 1Y7TA 5JAQA 5JO9A 3DMTC 4M55A 1TEHA 2EG9A 2JCVA 3NEPX 2P68A 4NBUA 4PFJA 1WP4A 2V7PA 4HNGA 4HUJA 2J5QA 2Y67A 2ZATA 3AI1A 2XXJA 4LGVA 5L3ZA 1SC6A 1NWHA 1QV6A 2X23A 3E8XA 4WKGA 3H9QA 2IYOA 3ZWOA 5CPFA 1YWGO 4Z0HO 4HFJA 1HDOA 3NT4A 4BNIA 3PJGA 4Y6PA 3AW9A 3RFTA 4NFHA 3V2HA 3PDUA 4GBJA 3S1LA 2YQ5A 3BTSA 5G4LA 3U9LA 1V8BA 1LA2A 3LSYA 1KC3A 2J3JA 1PR9A 1A27A 4J16A 3HZZA 1I2CA 1YVEI 4M86A 1C14A 1GPJA 3LT1A 2W98A 5FWNA 4J1NA 2V6FA 4W82A 3ZW9A 3GZNA 2GN4A 2PK3A 3DHNA 2Q1UA 5EINA 1J0XO 2HAEA 2AE1A 1LI4A 4BNJA 4XDYA 1Q1NA 5F21A 2DBQA 1LLCA 4KMSA 4PG4A 4B7CA 1NAIA 1PQWA 3ENKA 3WGQA 3DL2A 2R00A 3WQRA 2CUKA 3V2GA 4NJMB 1DLJA 4ILKA 3TJRA 4CMIA 1GU7A 1EVIA 1HSZA 1WW8A 1QXSA 3R0IA 3E5RA 4FPXA 1FDVA 5TX7A 3AFMA 4IY1A 1Z7EA 5JAIA 3OEWA 3RFVA 1LDBA 1P1JA 3DONA 1C1XA 4R3NA 4H15A 5DCYA 2D3TA 1PZFA 2H5LA 4MP6A 4ZQGA 4R5HA 2PD6A 1XDWA 5DN9A 3SLKA 2G0TA 1X7GA 3PP8A 1VKNA 1EMDA 3RKRA 2Q4EA 2PKQP 3HN2A 3WX0A 1MA0A 5AYVA 4Q3CA 4MP3A 2GF2A 4B3HA 2QQ5A 4O1MA 1GUFA 1Y9AA 4ZQBA 4KUEA 2CY0A 4TVOA 3OJEA 1MFZA 1X7DA 2DUWA 3HQ4O 1DC5A 4YCAA 2O7QA 2BKAA 4DBZA 1JVSA 4IMPA 3I52A 1SAYA 3KB6A 1ADFA 1QYXA 4J1TA 4XX0A 3NRCA 1KERA 3FR7A 3VKUA 3EW7A 3WLFA 4EUHA 2CFCA 3D3WB 1ZEMA 3KHUA 1CF2O 3BMCA 2PZKA 1F0YA 4U0KA 4BUCA 2RH4A 3GAFA 4B79A 1BTOA 1MV8A 1GD1O 4MPDA 3F5QA 5U9CA 1UP7A 3TZ6A 4ZICA 3CMMA 1LSSA 2HCTA 2A9FA 4RO0A 3GPDG 4BMVA 3GGGA 5DOZA 5GY7A 3TDKA 1HE3A 3ZWXA 2FPGA 1AGNA 1NHGA 3EYWA 4BNLA 2VYND 4JJGA 3LK7A 3IJPA 2EXXA 3WSVA 1PGPA 1UR5A 1GQ2A 4YAGA 4Z3KA 1NQ5A 1U5AA 1E92A 1T1RA 1VSUA 3K73O 1GADO 4YJGA 3KYCB 1O8CA 4C4OA 3TQHA 3DOCA 3GGPA 2IEBA 1D4FA 3DXFA 1ZO8A 4RCVA 2PH3A 3JCZA 1VPDA 3B6ZA 5AQ1A 2WYUA 4JNKA 1C0LA 4FGSA 1SCUA 4UUMA 3Q9NA 4GI2A 4IDGA 4A27A 2EW8A 5CPBA 3BHIA 4YAKA 3JQAA 1A9YA 4A0SA 4R16A 2YUTA 3AI3A 3PHJA 4FIZA 3HWRA 1UUFA 3RUIA 3Q6IA 2UDPA 1E1KA 1DC3A 2VZ0A 4YDRA 4EITA 3QE3A 1P0FA 5G0VA 2DUUA 2BH9A 3LVFO 1LQTA 1ADGA 2X0NA 5JS6A 1I01A 2R6JA 3C1AA 3JQ7A 4ZQEA 3D5QA 2UAGA 1R4NA 3KLPX 3T7EA 4FR5A 1U8XX 2YV3A 2VZ9A 4ZGWA 3PIIA 1U1IA 3KO8A 3B1FA 5FFFA 5C7LO 5I9LA 1H6DA 4CMIB 1NPYA 4M1QA 3W4KA 4BNUA 4YJDA 4EDFA 3NJ8A 1GCUA 2IYPA 3CMCO 2VZ8A 2EKPA 3S8MA 4CQLB 4NBTA 3GAZA 5IDWA 4R54A 2UVDA 1C1XB 1BRMA 3GDFA 1J49A 4DLBA 4P4LA 1HZJA 3WNQA 3K2EA 4OGWA 3K31A 4E5NA 1FDTA 2ZYAA 4JN6B 3ABIA 3I6IA 4RPHA 2CDAA 4F3YA 4YT2A 5KOIA 1G0OA 3N74A 5KJCA 3LDHA 2CSUA 3EZYA 2C5AA 1EVZA 5U4QA 1R4MA 1NHWA 1OI7A 4R5MA 3P5SA 3PHGA 1QG6A 2DAPA 4IGEA 1QV7A 3RJ9A 4ZQHA 2OBYA 1B3RA 2O7SA 3AI2A 4TZTA 1PJQA 4IZHA 5GZ6A 1F8FA 4XYMA 4RVSA 4N5MA 2BFOA 3KYDA 1PJCA 5EPOA 2NTJA 4CL8A 3GZ4A 2GZ2A 2GDZA 1DIBA 1IHXA 3PI7A 4L8VA 2YFHA 4Z9XA 3SBOA 3BMCB 2E37A 3QWFA 4JP2A 1Y5RA 2VCYA 4WLFA 1E6UA 4YQYA 4A73A 4YT4A 3ANLA 1I36A 4Z3DA 3WGZA 2O48X 2DBVO 1QYDA 4ND5A 4P22A 5CDUA 4CLHA 4FC7A 1LC0A 2FY8A 1A4UA 2BGMA 2PGDA 4PLHA 5DF1A 1HKUA 1GDHA 1KEUA 1MX3A 1UZLA 1FK8A 3HN7A 4YT8A 3ONDA 5LDGA 1XR3A 3UGKA 4S3MA 1GQQA 1ID1A 4J7CA 4DYVA 4BNHA 4BNVA 3L0DA 3D0OA 2BFMA 5KJEA 4IPTA 4RZHA 4YRDA 1ZFNA 1B3BA 1W8DA 2EEZA 4YJGB 3UKOA 3F46A 1LDMA 1XELA 3E82A 2FPPA 3D7LA 2YY7A 2B36A 3U49A 3RAJA 2OXIA 1OFGA 3L07A 2EW2A 3Q2KA 1QSGA 1E3WA 1O0SA 1Q7BA 4CLDA 5JYDA 3PZRA 5BSFA 4CR7A 1KVRA 1LEHA 1E77A 3PHHA 4IDCA 2O2SA 2C59A 1LJ8A 1I3LA 3ADPA 2BRUA 4BL5A 4DPMA 3E1KA 4RLSA 4CMJA 1NQAO 4XR9A 3RWBA 5ADHA 4R1NA 3O9ZA 1ADBA 4B8ZA 3P2YA 4E2WA 4RF4A 1ZXBA 3WOHA 5TF4A 5ER6A 2OMEA 3WTBA 1BXKA 3G3EA 3G1UA 3M2PA 4GLOA 3WWYA 4NZ9A 1I33A 1Q2XA 4RORA 3ROKA 3HFSA 2Y68A 2C07A 3MOIA 2H9IA 2C7GA 2CD9A 3COSA 2P9EA 2JHFA 5EN4A 3FPLA 4MVJP 4U5QA 3V1TC 1DC6A 2NADA 1P0CA 2UYYA 1EUZA 4IDFA 1GCOA 3I6QA 1JLLA 3U3XA 5MDHA 3KSUA 3ANNA 3EMKA 1YBVA 2C20A 3FD8A 5A06A 1UAGA 4BMSA 1GYRA 2PNFA 2W4QA 3M2TA 3ZWVA 3OEYA 5I8ZA 1SNYA 1YH3A 1E3LA 1JN0A 2EJVA 2HJRA 2YJZA 5DT9A 4J2OA 1H9BA 1UZNA 3SC6A 3VKVA 4AJPA 3JD4A 4ZRNA 4W99A 2FMUA 4I5EA 4IIVA 1R4MB 3RUFA 1R0LA 4DQUA 1CQIA 5B37A 1FDWA 4EEXA 3LYLA 4EBFA 3H8VA 3NDRA 4DQVA 3JTMA 2GN9A 2IZZA 2NACA 4Y6RA 2I66A 3JQ6A 4W9NC 1YRLA 2Q3EA 4YWJA 3DR3A 4DVJA 2X9NA 4O59O 4Z0PA 4E2YA 3BMOA 1B16A 5L45A 1YQDA 1PS9A 2AEFA 4A7PA 3KYDB 3ZHZA 3WJAA 4LW8A 4GQAA 1TVEA 1YXMA 1HYHA 4F6CA 3VHRA 5CDSA 1GZ4A 2P5YA 3B1KA 3GEGA 4UVGA 3PYXA 2QW8A 8LDHA 3WSWA 5BSGA 5HWSA 1YL6A 2D8AA 3ULKA 3PZBA 3DHEA 4JJFA 1B8VA 1TLTA 1XHLA 5EMHA 3M6IA 3DMTA 2C54A 3IIEA 1ZMOA 4NNJA 4WLUA 3V1YA 1KYQA 3GEMA 1A7KA 3PHIA 4RJTA 4MJLA 4CUJA 5C3MA 4N54A 4A26A 3H3FA 3R1IA 4WGGA 4WOKA 3ZNQA 4J9VA 3DZGA 3I9NA 4FQ8A 3VPFA 1HDZA 2QIOA 3FWZA 1E1LA 1XU9A 1LSUA 3I3OA 1RPNA 3MJVA 4HWKA 4EW6A 3RBVA 5HRUA 3L9XA 2UV8A 3ZV5A 4M8SA 1P44A 3IP3A 1KVTA 2GASA 4FFOA 3FHLA 4KZPA 2LDBA 1D8AA 4IGFA 1ZK4A 2AA3A 1EDOA 3JD2A 3ON5A 4QEDA 4U6SA 5CHEA 4G65A 2NV6A 3I4FA 1E5QA 3KSZO 4D46A 3QP9A 3SXPA 3AUSA 1K2WA 4JCOA 1JW9B 4O0LA 3ZW8A 2Q2WA 2Z1NA 2ZTLA 5JAMA 1ZXLA 3F6YA 3E6AA 4CM1A 2WWRA 3F3SA 4E3ZA 4R4JA 4BOYA 4ALJA 1EQUA 5JBIA 2HMUA 3QWHA 1IPFA 2FSVA 2QYTA 3ZU3A 1EUCA 4NMHA 2P2SA 4IQ8A 1V6AA 3VZQA 3HFGA 5T5QA 1M75A 3TZQA 4PLPA 4WCFC 4KQWA
chains in the Genus database with same CATH superfamily
5FTJA 2HPVA 1QIEA 2BBOA 4YP0A 1OLXA 3TTYA 2QY9A 2A5YB 1XOIA 3DFMA 3TIVA 1GCGA 4F9TA 3QX8A 1HFEL 1HXHA 2HN9A 2Q3LA 2VYCA 4MGKR 2X2PA 3PUIA 4X8OA 2OYCA 1NRWA 3IA2A 4GVXA 5DBEX 2EFHB 4DYHA 3OEHA 4EMTA 3UJBA 1O97D 3L1UA 2VWQA 1PQUA 3CLKA 5COQA 1A5AB 1Z3IX 2P9YA 4BQPA 2QL7A 3RC9A 3RLFA 2YFYA 3VOSA 2O8BB 2BLNA 3BF8A 4U8GA 5LPNA 4AC9A 2IX3A 3EPHA 4TZKA 2HJSA 2OC9A 5ITZB 3GZTB 1T0JB 5LA6F 2ZRNA 4EYEA 3PD7A 4DUZB 4IOJA 3H11B 3R5HA 1MAAA 4QXOA 5J63A 1G16A 3UN1A 2C2ZA 3CG4A 3IHKA 1LPBB 3O92A 4Z7NB 2FA9A 3MS7A 3QOWA 4M89A 2IBTA 3HBJA 1VLHA 5AHWA 2BI8A 4XB6B 3WIUA 1U0RA 1ODCA 1FIUA 2PU7A 4QGSA 5JZ9A 1RAFA 3MTBA 4J0EA 1RZUA 3E9CA 1YOVA 2H8KA 2JARA 1YS1X 4LJAA 5JRZA 1AQJA 1CQIB 4Q19A 4EJSB 2BP7A 4X90A 1XZIA 2DHRA 4KVAA 1EK1A 4PLYA 4TYPA 3PUHA 2FK7A 3DLPX 3JQ8A 3PPXA 4BQNA 1HYGA 1P1IA 3BMOB 3JWJA 1Q7CA 4PZUA 3TXXA 2WWWA 3BXZA 4ZRDA 5IH7A 4BO7A 1O77A 4RZ3A 2MINB 4WN3A 5AHOA 4ETNA 5JQGF 1Z6XA 4BKQA 1RWPA 3L4EA 2O2JA 2G5CA 1PO7A 2PUTA 3ZVRA 1ZMTA 4XEUA 4TRRA 4DLVA 1G98A 3GQBA 4FFSA 4LX8A 4O02B 5KDLA 2PQ6A 4DCMA 4GDMA 3K0KA 4OGKA 4MVJI 3L8YA 3KT8A 1JBKA 3GPIA 2UZAA 3GX1A 4Q39A 2HH9A 4OV6B 2JLQA 3VDMA 1VECA 1AKYA 4ACAA 2XNKA 4E6EA 3WR5A 4BX0A 3G5LA 5EXXA 1WCWA 1CJSA 3CO0S 2CNBA 3H7IA 5J4KA 3BXPA 1CUAA 2ERYA 2GJ9A 1FE8A 2P6UA 3WS7A 1ZUHA 2ZB2A 3DW3X 4CG2A 3GLIE 4UBMA 3SAJA 4EB8A 1J2YA 3DXYA 3LX6A 4I0WB 4KRXA 5H3LA 3UVEA 1S7CA 4ECAA 5L7TA 3O38A 1NPDA 1QK3A 1HE5A 4W5TA 1DSSG 2NO6A 3GMTA 4WSOA 4IMJB 3SJAA 4OTZA 3ZNOA 3LVRE 3ORFA 4BNGA 4AMGA 4BBZA 3GLQA 3QU9A 3U3OA 2QTLA 3W6NA 1OXUA 3WSTA 4DCOA 5TVKA 3ROPA 5JJLA 4D4JA 1QGDA 2V3CC 4EIWA 4MQFA 3LFTA 4RABA 1M6VA 3H87A 4XIFA 5HCNA 3RFUA 3V1MA 5HS4A 3OUTA 5CXSA 3TLYA 4YEDA 4RZIA 5ILQA 2BEKA 5LXTA 3G6KA 2R8YA 3RYTC 3I9MA 3IILA 1C8BA 1EFPA 2FP3A 2G4CA 2WD8A 4DZTA 2WIJA 3KTFA 2OC4A 3X1WA 4NMXB 4OQPA 4DABA 4R2HA 1I7LA 1BMQA 1HY3A 2JIBA 3KKPA 3KPWA 4TN1A 4B6OA 4A6XA 1NVAA 4EX7A 3G0IA 4FQ5A 1QYRA 4WZBE 4HX2A 4JXKA 2CNKA 1E1CB 1S3GA 4FCVA 2Y1DA 3AJ9A 4KKXB 2GZSA 3E5MA 1J8QA 1NM5C 2R2GA 5A3JA 3DLBA 2Q1WA 1T9DA 4YA6A 5FXMA 4WZAA 1ZGAA 5ESDA 3V1UA 3WIVA 3TQRA 3NPMA 5KYWB 2CXRA 2JGNA 2PUWA 5BR8B 2XODA 1FLAA 4B84A 1EJBA 4FZVA 1O3YA 4AJHA 1UBUS 5DBFA 2O2IA 3VYWA 4FM9A 2ZUTA 4PLFA 1XVVA 2HY7A 5TDHA 1O5OA 3AVUA 1SC1A 3AJEA 3Q88A 4N0DA 4PZAA 4A92A 4ZVPA 3QPWA 3E58A 1VJ5A 3PQFA 3T5DA 1UBJS 2Q27A 5I9BA 3FKSD 3SYTA 4CT0A 5K09A 5LNK6 4QM7A 1BE8A 2HSZA 2FMTA 4B2IA 3DNPA 2NZJA 1GRNA 2ZI6A 5EFZA 3EGXB 5AKXA 3FUVA 3L1KA 4D3DA 4EYQA 1T13A 1QF9A 1QKIA 3WIEA 1D0VA 1EXMA 1YGPA 3DDNA 2AHRA 3M4NA 3V42A 1UT5A 3FPGA 3BCHA 3D7RA 3LIIA 4BO2A 2WZBA 4QUJA 3ZU6A 3MINB 2F3RA 4YR9A 1E2PA 2ZM5A 2OCYC 1K3UB 4UVEA 5IRCD 5JS7A 2HF2A 3E1SA 2JB9A 4EYKA 1QCYA 1P3Y1 4QPCA 2DPMA 1T9BA 4NOJA 3WB0A 3BIFA 4DARA 3V00A 2NU7B 3HNRA 3FSEA 1LQ2A 3R09A 4GOLD 4UXIA 3ZZUA 4BJ1A 1IUPA 2FUEA 4OBWA 2NPFA 4R0MA 2VHUA 3HLKA 4U6QA 3UJ8A 2OHXA 2WTAA 3H2JA 1G7SA 2F7SA 2F90A 1WETA 5HHTA 1RRFA 1H4TA 1D2AA 2XAUA 3E1GA 1FU4A 2D4AA 2YDXA 1RMYA 4NABA 3SVZA 2IPOA 1IY9A 2JFNA 5KINB 1KYWA 4UNSA 1F8YA 1OFTA 4QWWA 3TTWA 4E46A 3GWZA 1NBWB 4GW3A 4O33A 4OHBA 4ENPA 4ZRMA 2GA9A 4KCGA 2PZMA 1OPRA 3FVTA 4JI6B 4UNQA 4GRIA 3MBKA 4CMCA 3SYRA 1O6ZA 3R7DA 4QT4A 4OMCA 4N5IX 1CRLA 2BFCA 1JG2A 2Z9DA 3G1TA 1QG2A 3T5PA 2HIAA 4HLDA 1G4UR 1N57A 3H3XA 2QE7D 3IO5A 5ALFA 3LC2O 3MFQA 2AXNA 4P7BA 3W9SA 5BXQC 4RS3A 2FN9A 5DBIA 3JQBC 4PFSA 5C80A 4YO8A 2IDZA 4H1VA 1WUTA 3HDTA 2DPLA 1IQUA 2H1FA 3GRKA 2C03A 3LYUA 3QENA 4DCGA 3BE6A 3K0EA 2GLUA 3H83A 3HYLA 1ZGZA 3AUYA 2QZZA 3F49S 4A16A 1UP4A 3IT2A 1XD8A 3IX7A 3OI7A 1LVHA 1QNFA 2I2DA 2JGRA 1AUVA 2EHDA 2Q6KA 3AZOA 4XIGS 5HPYB 1H0KA 1YJAA 2HA0A 1YU6A 2PZFA 2R4UA 2XBMA 1OVMA 4ZYYA 2C3UA 2QQEA 1YB6A 9ABPA 3VTZA 2ECOA 3WLQA 3RVRA 3CWCA 5CNMA 4L1KA 2P3OA 4IXMA 2AOUB 1J5XA 3CGWA 4YROA 3GLFA 4PIVA 2YTZA 1H2HA 3W3AD 3PFWO 5EQFA 2Y9MB 3F8TA 3IUEA 1FW8A 5A4FS 1X77A 1KMMA 3T5MA 3ADOA 5C1PA 5K51A 3HM9A 1QHNA 3GJ0A 3I9LA 4IJQA 2C7VA 2PM8A 2R84A 3W34A 3D6JA 4KWTA 3L77A 4V0KA 3WL7A 1E79A 5FHRA 1LRJA 4GWGA 3OU6A 3DV0A 3K96A 3GRCA 5GWXA 2FR8C 3CUVA 3Q7IA 4L4YA 3T9CA 1SRQA 5ESWA 1FYFA 5IDVA 2B7CA 3WGGA 1L4YA 4J94A 4HLUC 3H8WA 3MCTA 4WLVA 2X1LA 1UJMA 2Z9BA 2PKWA 2XQKA 3QNWA 1G8GA 2IXDA 3KXLA 3EZ7A 3WL4A 4K0KB 2B83A 4RADA 2WP8J 1OKKD 4EZBA 4YCBA 2UXDB 3BSYA 3CUUA 3QI7A 1IRIA 4FVTA 4JLBA 3L1VA 1NQWA 3VR0A 2YZ7A 1NXQA 5E8RA 2P78A 4QWMA 5LU9A 4E14A 5A4JA 1NNI1 4PAQA 2EFEB 4ENQA 3BK1A 1YRYE 1C7QA 1ORTA 1W25A 3KUXA 1PL6A 4L2IB 4NX2A 1P2UA 1RCUA 3ZGLA 4H3VA 1NP7A 1VYUA 1IN8A 5TGZA 1RPJA 3DYBA 2SCUB 5LZ5A 5FJIA 1E96A 3FFXA 4RPLA 4CKWB 1GR0A 3OZSA 4P36A 1LQUA 1RPAA 4YP5A 4YAJA 3GUCA 2VQFB 2LCQA 2IELA 3R9XA 4UNRA 1AN0A 1TU3A 2REBA 3ANMA 4TTRA 5AJYA 4IJ5A 1DBQA 3CRRA 3TOSA 1CJUC 1Z0ZA 2R8BA 3A1WA 5L6LB 1GNVA 1N1DA 1JHXA 1EYZA 1DHRA 4I14A 4UMFA 3OE1A 5F5LA 4QDUA 1JV2B 1UMBB 1WXGA 1Y5NA 2NU6B 3BJRA 3T1TA 4S1WA 2E48A 5KTKA 2O8FB 1YCHA 1KXZA 3LQ1A 4J0CA 2BGIA 2CMHA 2ODEA 1IFXA 3PR1A 2R25B 4FGLA 4UNPA 5IBPA 3HN6A 1IBKB 2LP4Y 5TSDA 4JBWA 1S8NA 4FX5A 1IJKA 3H5OA 1H0SA 1UM8A 3CZ9A 4WESB 5H9VA 3F3KA 3RD5A 3AGQA 2PGXA 1U0NA 1FFCA 3V46A 3MT7A 2KBEA 3DM5A 4ARSA 5GTDA 5G40A 4QG3A 3TL2A 5AVYA 1L7BA 3LT5A 4OH1A 2JNWA 1M2EA 3WWZA 4S24A 4UTVA 5C7IO 5JPIA 4QJ4A 3UYKA 2ZTVA 1H3NA 1T1EA 1VE9A 3MTGA 3D4OA 1N78A 3ROEA 1KO4A 1RU3A 3GFTA 3Q9UA 4MKHA 4H6XA 5FL3A 3SSAA 4AKTA 5C2JB 3ZLBA 2HLDA 2O2CA 1RLUA 5AKIA 2IOHA 3QXSA 3A6PC 1XALA 2FMKA 2EU8A 1QOQB 3I3SR 3KTDA 5L3QB 1CEQA 2R11A 4PYNA 1ONOA 1GDDA 4EGCB 2X1VA 3PEEA 2XUQA 2ZQZA 2ZRIA 1WG8A 3B7WA 4LGMA 1QR6A 4TSRA 3AK4A 2VHZA 3P9RA 1JH9A 2PUBA 3CLUD 1PUXA 1F6BA 4DW8A 3STYA 5A02A 4EDHA 3TSYA 4M7PA 2PYZA 3WWCA 4ZOQI 3O9MA 3ASVA 4XR4A 4D0LB 1RKQA 3IERA 3VHXA 2QR5A 1P1KA 3LUBA 4BC1A 1KEPA 1C0EA 3GJRA 1MXHA 1VG1A 3RRYA 1QHXA 5ILOA 1VPEA 3VPAA 1XIVA 2ZAMA 1LGYA 1NUSA 4POOA 1JDNA 1QHEA 2ZDHA 5EJ2A 3HWWA 4OSOA 1GNTA 1RRPA 1Y3FE 4OMDA 2NOAA 1AHNA 4NU5A 4MKRA 4MVJD 3ROXA 2MSNA 4HDMA 1VMKA 5CEFA 1BW9B 3QJGA 5AVOA 4BCCA 1EHYA 1QPGA 2A58A 5I9IA 4JI4B 3V4PB 1ZH4A 4FOLA 1VHTA 4F2HA 4YJ3A 3PKZA 4AIIA 1GN9A 1L5GB 3MXTA 1RKVA 1APBA 4YLYA 3DEHA 3SY8A 5A5GA 1CUGA 1DUVG 2JFGA 1VL0A 5H8WA 1D03A 5B5SA 1P4SA 2DLDA 1O58A 1KJYA 3DBRB 5AK4A 4B3IA 1IG0A 1NR1A 1T3SA 5HX7A 3DQQA 2R1TB 5EQTA 3WMGA 2O6LA 3L7JA 2I2XB 1YZVA 4C0QC 5C53B 3NU1A 1FZTA 4V0NA 3VR6D 3U1TA 1DRVA 1L9XA 2AYXA 5H80A 1NKSA 2ZUDA 3CJQA 2HWXA 5EJ6A 3UV7A 5EIHA 5ARDA 5F3RA 1OX4A 2BGNA 3LE8A 1JRLA 1FTNA 2RHOA 4LJ8A 4UXJA 2B8WA 5J2TF 3TMKA 3ZCRA 4J43A 1YACA 4G5SA 4ZU3A 1ZJ6A 3UG6A 2HZ7A 8ADHA 3LO8A 3FNBA 1YNOA 3VSCA 2O8CA 4TVKA 1YB2A 3TZCA 2BOVA 1Q91A 2G5GX 3QUQA 5DULA 1J21A 4PG7A 4ZEOA 1YZTA 3R8CA 3SX2A 4PN3A 4CEIB 2VDNB 2YRFA 1OQAA 4ZVKA 4KPGA 1KEWA 1RWKA 4IQGA 4LFCB 4XJTA 5C5EA 1DU4A 4UBKA 4WFIA 2IODA 4Z5XA 2I6FA 3IKJA 2BFEB 4Q37A 5LLSA 2QBYA 4KWIA 2XMQA 1SCQA 1CQZA 2H18A 2PCLA 1M10A 3KEMA 3JQCA 2BCJQ 1SB8A 1E9RA 2FR0A 2Y0DA 3E8MA 3ESDA 2B4YA 3OHSX 4FS3A 3VH1A 4ZOBA 4C1NA 2ZI3A 4MDEA 1YFZA 4NAVA 4FCTA 3N0VA 2WNHA 2WAAA 1OZHA 1QRRA 1YJBA 4G1MB 4N0EA 5HGXA 2VNSA 2O8VA 3U1BA 1V16A 4Y0AA 3H99A 2FWBA 5A0FA 3DBHA 3FDZB 1ISPA 3ROFA 5D7NA 1H42A 1MB4A 4LXHA 5M29A 4G4GA 4EA9A 2EIXA 1SG0A 4KNYA 3M83A 2BPOA 1XZNA 3GHYA 1BS1A 4D8TA 4KIGA 3R6GA 4K9KA 4LJRA 4II3A 3C7AA 5JWHA 4BWYA 3PQ6A 2QD3A 3ZDRA 4F71A 4RYLA 3WIOA 1YL5A 2PWBA 2I80A 3ED5A 4LSWA 2J9ZB 1Z5NA 1PSDA 3WLRA 3IP1A 4WW0A 2B8NA 3ANTA 3OM8A 4QSHA 5TRTA 4MVWA 1P0QA 2Y1OA 2A5JA 3A1EA 4BVGA 1RCTE 4DPLA 2OCGA 1DT5A 4BZPA 1QR2A 2E6UX 5AVXA 4IJMA 1WW3A 4ZAFA 2G9ZA 5KQRA 4B6FA 2EJCA 5K05A 3BWMA 3F8SA 4IIFA 3B13B 1M5RA 3SXUB 5DU2A 5CAEA 2HDOA 2XF8A 2YC4C 3L4BC 2Z1MA 2QM0A 3EY4A 4WV3A 1FDIA 3ZYZA 1DXQA 5LQSA 2YFKA 1K6JA 3A11A 2UYQA 3AEKB 3JVEA 4ZOEA 5E3JA 3RSQA 5FV4A 2C88A 1PF7E 4G2TA 4YJHA 2GILA 2P6OA 3FTQA 3UKJA 3GFBA 1E1NA 1OH8A 3QUBA 3V4VB 1ECLA 4QC2A 1HOTA 5REQA 5FPQA 4BMOB 3WLSA 1L7PA 4ZIRA 4BXOA 3FHOA 2OBMA 4Y6LA 1Z16A 4DR3B 1XVUA 3N28A 3PXXA 4IUBS 2XAAA 4FMDB 1NBMD 2QLFA 1WPQA 3EIEA 3NT2A 3K2IA 1I14A 1MAVA 4K05A 4L7VA 5LVAA 4BO0A 3SK0A 1S7GA 2ZP1A 3OT4A 3EAQA 1ID8A 2IXAA 4Q47A 4UDXX 5D1HA 1PX0A 2AMJA 4C5AA 5KVCA 1MIOA 4G23A 5DBGA 4JUCA 1JIUA 1SMKA 2JH8A 1KAQA 3AHEA 3MPOA 4LHWA 4FB4A 1JSXA 1MRNA 1U2DA 2ERXA 2PZEA 3CEJA 5JD4A 3V2UA 3AIOA 1KKLA 5LOVF 4YMTA 2GAIA 4WCFB 1MPTA 4IAOA 4HY3A 4YP9A 3NC0C 1R00A 4WKOA 3L8CA 2IHUA 1AKTA 1XA3A 3GJQA 2QP4A 2W2KB 3QFHA 1K63A 1TZCA 4E33A 4DBLC 2GZ1A 3OZBA 3AFOA 2FUG1 1T3ZA 3U0BA 1T5HX 1Z2OX 2VPIA 3ZXIA 2H1HA 3ZXUB 3O1HB 4RD2A 2H51A 4ZAYA 4QREA 5HUQA 4GBED 3FR8A 4U2BA 5AO9A 2E5LB 4Z3OA 5TY0A 2ZCVA 4LBWA 4AXBA 5KYGA 3HHEA 1F2UA 4RXUA 3IRVA 5A9RA 1E7RA 2RGAA 4ND2A 2GEFA 5IS2A 1NJ1A 1ESMA 4AULA 5B6PA 2XQGA 4Q3AA 1WVIA 2XNHA 2DWOA 1OWOA 1VL8A 2QTMA 2VSYA 3IP9A 2F9MA 3PXBA 1HLDA 1YC5A 3GG2A 1W47A 2C92A 3L8ZA 2VDQB 2K4MA 4HXFB 4JY7A 4HV4A 4ABTA 2HIMA 1SD5A 3ICCA 1J5EB 4I6JA 2O23A 5ULLA 1YJ8A 3MJRA 4AECA 4O1HA 2FQXA 1GG2A 5FL7D 1FJGB 2VS1A 2P9GA 4RTLA 1BEUB 4X6UA 2AI1A 5IANA 2J5RA 2VP6A 1JE0A 3GFFA 2DFVA 1UBSB 2DX7A 2IKSA 2QN2A 4GMFA 3D4BA 4UJ5A 2PBZA 2BAGA 5AKZA 3L41A 3W90A 3L6OO 1C30A 3NOOA 1Z88A 3LX8A 5C31A 2XXAB 4OQXA 4LBZA 4OHFA 4DMKA 4DIFA 4Z54A 1SB9A 3TFOA 1Y8RA 2DPYA 5EE9A 5EPUA 4GR9A 3EMBA 4C4RA 3FOBA 4W7HA 1EFDN 1LLUA 3MQFA 4AUKA 4N8EA 2ZTSA 4KU4A 2X0EA 2CHFA 3U19A 4V0RA 5H59A 5EWLA 5DNDA 4NXMB 3FMIA 4KSCA 1CIVA 4ZAWA 5HJ2A 4V1CI 2PLAA 2XCTB 5J59A 2OVFA 4KQ9A 4KPUB 3FCAA 1PLLA 3F8WA 3T12A 1ECGA 4ZGBA 3FNHA 4W9MC 2GN6A 7GPBA 3VC3A 1M2WA 4H7HA 3RVKA 4PO8A 1JAIA 1Q1EA 1QVWA 1T0PA 2XRYA 3UGQA 4I99A 4W5JA 4E13A 1E63A 4GR4A 1QS0B 3DGEC 2ZIXB 1GAQA 5CLLA 5DEOA 3ZWMA 4DUGD 2CJXA 2ZSKA 3DZKA 3QPAA 4ZTBA 5TXGA 3ZV3A 1PAUA 3O1LA 4RPIA 4PYLA 5TE9A 1UT6A 2JLRA 2LBPA 3C3MA 4FOSA 4BLVA 1P9LA 1YR7A 4DJJA 1AB6A 5K6AC 3MQ2A 4GHWA 1EXWA 1VL6A 4AW9A 4P5PA 3V8VA 1OBCA 3H9GA 2P2LA 4MV3A 5E0KB 5EIFA 3OTIA 4R1UA 1R8XA 1SH7A 3G9TA 3T9DA 1AJEA 2FSGA 1QE0A 4IS2A 4REOA 4M0EA 1Y6JA 4WNCA 1WZUA 3NW9A 1P5HA 3BFVA 1WV0A 5BSUA 3EODA 1QGOA 3IRUA 3DOFA 4P58A 2NZUG 1H66A 4LRTB 2EWMA 3LQRA 2Z4SA 5H70A 4BLUA 1MJHA 2GFQA 3G49A 4LQDA 5JEEA 2KPOA 1JEAA 3BBPA 1UKBA 3X2EA 1JHOA 5K0FA 1USKA 2CFIA 3N07A 4EKYA 2ISSD 3JVVA 1LWOA 3GGJA 3EZFA 4P53A 5KUTA 3DO6A 4G9GA 5FWYA 5P21A 3FBTA 1QJ4A 2Q5IA 4QLOA 1I0IA 4Y2GA 5I9TA 1E20A 4C01A 1CBUA 4EVSA 1EQ2A 1G8PA 3OU7A 1GL7A 1GGEA 3V7WA 3EDCA 4DIBA 2QJRA 5I7AA 2XMPA 4KYUA 4FDUA 4YAWA 5L40A 1JAHA 4MI6A 5LDHA 1U1EA 1SXHA 2H4JA 1O87A 2VDUE 5KHAA 2B1IA 1M6HA 1YDFA 1J23A 3MLBA 3MBOA 4Z4CA 1HE8B 2KJQA 4G0YA 3LRXA 2PSEA 1SBHA 5FNVA 3H4TA 3TVTA 4FSXA 3NAMA 2X0IA 5DGCA 3OSUA 1GTZA 1FYVA 5DH9A 3AR5A 1Z5VA 5F1KA 3U7IA 1A5TA 3CZMA 4OB6A 5E4TA 2CK3D 2LDXA 4FOOA 2YZGA 1FFGA 3VU3A 2WEKA 3RI3A 3EEYA 1JDPA 4C0HA 4HDSA 2BFFB 2OHGA 4LF9B 1YR8A 2PPLA 4DV4B 3LQYA 3F47A 1OJLA 3OY7A 1DKQA 1E89A 3Q0TA 3K1TA 3C7TA 1TVKB 1VIMA 4OJMX 3VR5H 5DX8A 4N03A 1JFRA 2VP0A 1X13A 3MNFA 2IXTA 3E2MA 5FBKA 1A71A 2POCA 2O3TA 3HLTA 3R5XA 4TGLA 2DPHA 2DYKA 4K8OA 2XMSA 5JNUA 1G6HA 2ZB3A 3I64A 2FQ1A 1DT3A 4JC8A 4X6XA 5B30A 4M49A 4OXNA 2V6BA 4OOEA 4QOSA 4WL0A 5DYIA 3VPXA 5JFOA 2VDVE 4JI8B 1LU9A 1TYCA 3LMKA 8GPBA 1RXYA 1A9SA 2UYOA 3SR0A 3K6SB 3VNUA 3VDNB 3VI3B 5KWJA 2IITA 1V35A 2G9RA 5K2MA 1M2JA 4YUZA 2Z2KA 1V3UA 1IB0A 2HCRA 4AJNA 1TW2A 3M6VA 2L82A 1KK3A 5BUQA 3AWIA 3GBPA 3LG2A 3OZTA 1CQJA 4A0HA 4CFZA 1VRWA 2UXBB 2ZYHA 3DAGA 5CR9A 2BHLA 2R97A 1UBCA 2HO4A 4ARZB 2C31A 1MGPA 3ABQB 5CNJA 4CM7A 1PEYA 2B7LA 5DE3A 3NC4A 1BMDA 2YBEA 3FKSA 5DTEA 3ZKWA 4E21A 4L4RA 1I5EA 3MYYA 1PD1A 4BO6A 3WKEA 3JASA 1OIVA 3PUZA 1X1BA 2AZDA 4TWBA 1Q1BA 2XMZA 3FSRA 1DADA 3FPCA 5LUBA 4KAFA 3R7SA 4G0UA 3AYXB 2ZIEA 3DLIA 2OM2A 2CWDA 1T5TA 1W5BA 1KAOA 1ZU5A 1XTQA 1GWNA 2ZRJA 3IQGX 4FFWA 4RF2A 3K1AB 5AH0A 5DM2A 2I7TA 2WWXA 3ZNPA 2V97A 1BE6A 1SBQA 3F7OA 4K9RA 1UEIA 4JKYA 5F5NA 5KNDH 1OXSC 3L7BA 1EE2A 2G9VA 1JWLA 2C9YA 2PFSA 4XGNA 3NV9A 2H7CA 5LL6P 2A84A 4RVOA 1VXRA 5LP6C 4FW8A 2A5DA 1XVLA 2QGNA 4QOHA 4PPFA 4TMVA 3V4OA 3ZJYA 5EZSA 7YASA 5TLSA 4DOMA 4FYVA 4XRRA 4ZXFA 1FP2A 1GTJ1 2CF6A 3VH2A 1XDGA 3TM5A 2VAXA 4I5GA 3GGCA 1W1UA 3IDAA 4NCJA 2QLLA 4GWKA 1NMXA 4RM2A 3SJUA 1GLVA 3A27A 3V9AA 1LY1A 4IHQA 3TCKA 4B3JA 4EHKA 2B78A 1S9HA 4BFUA 5DZSA 2IW1A 3PFGA 3L4SO 3FNGA 1BHQ1 1TT5A 3QOXA 5HIKA 2A5LA 1YQ9A 3L01A 4P9NA 3O31A 2B4QA 2PGAA 5T64A 4DLAA 1CYEA 3DEZA 3CLSC 1A72A 2O3JA 4LIPD 1U31A 2OHHA 4UZEA 3RU7A 4YCNA 2X14A 5FTNA 1DBWA 3AJRA 3QA3E 2CUNA 3H6KA 4TMZA 5D3MB 1X1EA 2ZS8A 3U48A 3LT2A 1CR1A 1T6ZA 3WV5A 4TRJA 2E5FA 5DNYB 3O74A 2FETA 4FU0A 3RNLA 3RYHA 1TIBA 4P38A 4H1HA 3HSKA 1AK1A 4KQ1A 3F0TA 2PWZA 2AWOA 3H6GA 3NDJA 1N5OX 3I2FA 4HHEA 2CZCA 1EE9A 4Y9RA 4BNZA 2EQ5A 5FWXA 1TX4B 1SQFA 2ISCA 2QYSA 2Z2YA 4U39A 2QMUA 3ZQJA 3ESQA 2QJWA 2W58A 1C7EA 4LCEA 4BFWA 2VTBA 5DMHA 3M9WA 5FLEX 1FFXB 1MX5A 1OZGA 3E18A 4IL5A 3S5UA 3PNLA 3IDZA 1E6WA 2OL4A 3ZWBA 1DG1G 4M3NA 4O4IA 5F9HA 1NRJB 2BCGY 4N5NA 1U0JA 5H68A 4RULA 3TI7A 4UDYX 3MAAC 3C7CB 4YK7A 2XJ9A 3F6SA 4ZTUB 2UUPA 4AURA 1YULA 3DEKA 3HABA 4L78A 1Q19A 2KBFA 4PQYA 5JCOA 4JP5A 2DU8A 2VH2A 3VKGA 1TQ2A 3CKYA 4OKNA 2RKBA 1NFFA 2DQYA 2IVZA 2SICE 3VPGA 3DTTA 1KAMA 1G8SA 4EPTA 2PUJA 1CUYA 4MW6A 4PZDA 1JTVA 1TQHA 2QVCA 4W5NA 1CR2A 2PX4A 4I9NA 4OLAA 1E3MA 3HGMA 2AQ8A 1BCSB 4YJFB 2ORED 4V38A 2IHVA 2VPZA 1C7JA 4LBYA 3FMOB 4BO9A 5JOQA 3GLFE 3W9BA 2PKXA 2F8TA 4GL2A 2HRCA 3L8MA 4GKBA 4X91A 1MORA 3TR5A 4DQXA 5A4KA 5KB3A 3IT1A 3LSTA 2QVYX 5LYJF 3G2NA 2F1IA 3ASUA 1RQNA 2YJGA 3HU2A 1UC9A 2NM0A 3W8NA 4MMZB 1NR7A 4M1SA 3K9NA 5GINE 2A9OA 4H1WA 4LYEA 4QD3A 1Y33E 3WB2A 3IQZA 5COBA 2XGJA 2HA6A 1KI7A 3BB1A 3SJCA 3RCBA 5KOJA 3IDQA 1HEYA 2QRMA 4KPEC 5EY5B 1K7FB 1PR2A 2YNMC 3IELA 3DWEX 1ZLYA 3N7UA 2C9MA 3OE7D 3B85A 2FSPA 3EGCA 3ELUA 4OHRA 2FU5C 4K6HA 2B9VA 2JBWA 2JK1A 3DLAA 3IV6A 1JWBB 1Y48E 3IJ5A 3LDAA 1H8ED 1O6GA 1G20E 1PT8A 2VAWA 3FYSA 2OBLA 4L72A 3RSOA 3TTVA 2VTDA 3QF4A 3ZX4A 3QVUA 2AFIE 2PEZA 1ZOSA 3FUTA 2JVKA 2K2WA 4LSMA 4DL9A 3DR5A 4LX0A 1C7ZA 1KDTA 1CUUA 3OO1A 4OK6A 4CGYA 4LXYA 3NYIA 2YZKA 1E2HA 4CG0A 2YKGA 1T0IA 2CBGA 4EY7A 2CL7X 2ONJA 3EJ6A 4DA7A 1C29B 2VUHB 1NFRA 1NVWQ 1CUIA 1V4NA 1KDRA 4NZOA 2EX0A 3VNBA 2Q9UA 3VR1A 2CLSA 1D7AA 5MGBA 3ITKA 3B12A 3ZKAA 4KGXA 3B7PA 2GHQA 2VYFA 4PCLA 3ROTA 1RHUA 3CJTA 1Z28A 2PNJA 1T5LA 1C0IA 2ZWVA 3K2QA 3RYIB 1UMCA 3SVTA 1F48A 5HF9A 4FYKA 1N5DA 3MERA 2QK4A 4RA9B 4JR2A 1N33B 1M8FA 2J3KA 4RU1A 1V39A 1CC1S 2WIGA 4NEHB 1NNUA 1TCUA 2NP7A 4PW0A 1PGNA 4JFAA 4AMYA 2WNIA 3R5KA 3BZUA 4DV0B 5KC8A 2ZQ5A 4PQEA 4XUDA 1JQ3A 4X8MA 4F8YA 3ETDA 3P1JA 2O2XA 1IQPA 2XGOA 1Z9BA 1U8UA 1MRZA 1SOVA 3RT9A 2FLWA 1W59A 4P3KA 1GL3A 2GAAA 1WS6A 1L5OA 5GAJA 1KQ3A 1M2OA 1T2NA 1ZNYA 1KO7A 2VHYA 4M6WB 5KI6A 3V6MA 2XCUA 4AF7A 4D8YA 1CY4A 1WBBA 2Q2VA 3KVOA 3NGMA 3Q3IA 1XTKA 4JI3B 3EPJA 1YB5A 3QITA 4O5AA 1QNLA 2FW0A 2X22A 4HG2A 2I22A 1M7GA 3I5MA 1Z07A 2JJQA 3L0OA 2GOYA 4QYSA 1OREA 2J4FA 3V1NA 2F64A 3WTCA 1PLKA 2NZWA 1NVMB 2WJYA 2GAFA 1H8HD 4I3HA 3QW4B 3RDPA 1EGVB 2IOQA 4Y9SA 3UXEA 1L5VA 1Z7YA 3UAXA 1HZZC 4BZQA 3QX7A 3VVMA 3FNIA 4JT2A 4ZHQF 5L3SA 3WQHA 2HFJA 2IJGX 1G21B 3EDMA 1RR6A 2YMPA 3NETA 5FI5A 5K6RA 4NG5A 1CSEE 3VMFA 3HXQA 2O20A 2VT6A 1T9AA 2FPUA 3ITNA 4PIPA 4EI8A 1VLJA 1E0DA 4S1NA 4CHGA 1YDWA 2DR3A 1IZ0A 3O8QB 3OQIB 4TTIA 1Y6GA 4Q6WA 4AS1A 1ZHFA 3DC7A 4IXNA 1YR9A 2LZ0A 4MXDA 2ODAA 2R751 3N75A 1NBIA 4CKCB 1X80A 4BFXA 2GCOA 1CUBA 2I29A 3OX1A 1GJRA 3F9CA 2GARA 3DE6X 5BVGA 1X14A 2FGJA 3D7NA 1PV1A 1Q1GA 1M1NA 3GLHB 1JUDA 3BWVA 1BN6A 4DDHA 4DDTA 4L85A 1Q7EA 2QVXX 4XWOA 3SPXA 6PFKA 2JJYA 4B3CA 1RADA 1Z2AA 5DYYA 2OESA 3TPZA 2BGLA 2BN4A 1E2KA 3P94A 4NMLA 4FNGA 5JG7A 3RUHA 2Y0EA 4BVKA 4ZYWA 2IPXA 1NFQA 4MVJA 2V7GA 4D4KA 3EW9A 3KTAB 2WW8A 4BGEA 1RPZA 1FRNA 2WM9B 3S2GA 3TSCA 4CIDA 3IAUA 5FRDA 1H23A 1PK8A 2V7EA 3A6LA 4BO8A 3GXOA 4E5DA 3G7SA 4R1TA 3FOEC 2J3IA 2VYQA 3RJTA 1P5FA 3M33A 4WXEA 2OAP1 2WSSD 3AIIA 4HVCA 5B7NA 3SVLA 2PUEA 4RDHA 4UE6A 2TECE 5HIIA 5KX5A 1U98A 1KS2A 3RADC 1T10A 4UM9B 2XE6A 4MA0A 1JSCA 1Q1QA 2W8ZA 1SXJD 4KBGA 3I6BA 2CLOB 4CM8B 5IH3A 3LLUA 4Z0NA 5JHGB 2GBLC 3TRKA 4WASA 2QWXA 4ZCRA 4HCJA 3L9WA 2C2HA 4HDQB 4NTZA 4DRXA 5CDFE 1BKSB 2I2FA 4NYIR 2QAJA 4HFNA 1CZLA 2GRAA 5CTJA 2P1RA 5F3WB 5THQA 4A8JA 5I9NA 2ZJ5A 4RAOA 4MV4A 2Q0QA 1CZKA 4FYJA 3JQAD 4MR9A 3UICA 2D2XA 5FEMA 1FP1D 2SHKA 4OXKA 3SM9A 1COWD 1VE5A 5KYXB 4OYRA 5E6UB 1EVLA 2RMKA 5AK5A 4AJ4A 4BV8A 3HC7A 3KBOA 4COKA 4D0RA 2Z3ZA 4F5YA 3IEVA 1P0MA 3TLXA 4FB5A 4E5VA 3VJMA 3PNKA 3RYCB 4LZOA 3HXTA 4BNMA 3L0YA 1SELA 1GGKA 5GV8A 5CCBA 3LGXA 1MBZA 1Y4AE 1CEYA 4BQEA 2DULA 3JPWA 5CURA 2HRBA 4L8LA 3F97A 1DJLA 2JD2A 3KQYA 4NKRA 4DILA 4RSRA 4ZDIA 5H16A 5T4EA 3IAM6 3PNOA 1CS0B 2Q6TA 4ER5A 3ZHOA 2FCAA 4HGQA 2JAHA 1UC5B 2QMQA 2I7DA 2I33A 3H5NA 1W0KD 4FBLA 1JQEA 3KPUA 1R6BX 1V1RA 4W63A 2XDWA 1K8YB 2CNNA 3EGEA 2JFYA 4NPCA 3S2YA 2QRKA 3QVGB 5IN4A 4JEMA 4ML3A 4WFKA 5K4HA 1XDBA 1NLMA 2C9BA 4KXMA 5IT9A 3T54A 1YBHA 3HDYA 5TVGA 1AKMA 1XEAA 1XTBA 2CLHB 3RC7A 5HXAA 5IJWA 1DC7A 1M33A 1J1IA 3LCUA 5DGDA 1MCZA 2QM3A 1UEJA 5E4YA 3UZUA 3RIGA 4AWXA 1IXKA 1TKCA 2V5AA 3TBKA 5HW0A 2IHTA 2P2YA 3W4IA 2I1VB 2QRVA 3M82A 2QRHA 1XZHA 1PJ8A 3WYNA 5HKBA 1IDN1 2NYUA 5DMXA 5KKAA 1V45E 3FW1A 1HDXA 1YCGA 3ZDXB 5TQJA 5FYDA 1CP3A 5HIJA 1J9ZA 1D9ZA 2YOGA 1JECA 4E0BA 1U9IC 1F2TA 3VZCA 1T5DX 4TT3D 4F3CA 3R6LA 2JDIA 1T8YA 4EQ6A 4FZ5A 1WZEA 3MTDA 3MS4A 4IFEA 4G85A 4JUBA 5IJ0B 1X7YB 1YI1A 2OWDA 2VTVA 4L07A 3H9CA 2POQX 1UMKA 5FA6A 5DN6D 2O14A 1HDYA 4J0FA 4J6FA 3UF0A 4H1UA 3RM3A 3Q3CA 1CX9B 2VRWA 2OM6A 1OU0A 3CISA 4L3OA 1SBZA 2BMEA 2V03A 3FHCB 1CD5A 2R00C 1KPGA 3L7CA 2P4EA 3N7AA 2P9JA 5JIBA 1KI6B 1ISMA 3DXZA 4A1FA 2DGDA 5IXSA 1ESEA 1NNLA 5AW1A 4HBZA 4UUPA 2ZK7A 3NUGA 2Q1TA 4WRRA 3ZVNA 1U9JA 4YCSA 3ILXA 5EJFA 4D5EA 2YV5A 3URKA 4Y1RB 3BL6A 1NBMA 2OO5A 4D9EA 5KNCD 2R0QC 3LBAA 5AJHA 4DJTA 2QN8A 1TYDE 4HNSA 4J7XA 2W6ID 1IE3A 2D5CA 4OSEA 4TMYA 5KJ1A 2ATXA 4GSLA 2EGUA 1XTUA 3P2JA 2XT0A 2WAOA 5K0CA 2YH2A 5K8TA 3TAUA 1W36D 1ZJWA 1U8ZA 3AF1A 3VOTA 2Y1WA 2GYVA 2WOOA 5JASA 4RJKA 5L9AA 4F2GA 3P2EA 4AJJA 1ZITA 3EWNA 2QP3A 2OFPA 5A7HA 1JIVA 3WYGA 3S1AB 3ZE9A 2HHAA 3EUFA 1DAOA 2EKDA 2WT8A 2ZB7A 4RWZA 4YAFA 2V58A 4DV6B 5TS3A 4TKVB 4MVCA 5C1BA 1PS0A 1WMSA 4LI0A 4FYYA 3KNZA 4M87A 4BFVA 3O83A 1BH2A 4LDRA 4LRWA 3FGZA 1MOSA 1VIYA 2GYYA 2PAFA 1IULA 5ALSA 3R41A 1XMJA 1NRIA 2EKQA 2XGGA 3QLJA 2VNHA 5HMMA 1BD4A 3GV0A 3RHFA 3NTQA 2ECKA 4W6ZA 4TTTS 1B0ZA 4ND4A 1AMNA 2UYCA 3TNLA 3AR9A 1TM3E 2VHVA 5I7VA 2JLVA 2VTEA 4H7FA 2HWUA 1ILWA 1H2YA 2BUAA 2V8BA 4DHEA 5EQDA 4BKRA 2F2TA 1QIGA 3WP1B 1ESDA 5G02A 1MW9X 3TMAA 1Y3BE 3GR6A 3NTUA 4W5HA 2QAGA 2H4YA 4Y0VA 1K6MA 4RTSA 3ADBA 2I2WA 2D1YA 3TW8A 2DXIA 1V9LA 3F7TA 1MQ9A 1XCOA 3EUAA 3GIDA 3GN2A 2ZWIA 2REQA 3LUGA 3OESA 5FL7A 2OHJA 1CDDA 2DPXA 2FWNA 2EYQA 3NI2A 4N0PA 3ZVKA 2IBSA 4EI2A 3H2GA 3X1DA 4O63O 1Y5IA 2UVPB 3UMGA 3MC1A 3QVXA 4MR8A 4R01A 2AXEA 2ZI5A 2G9NA 1YUNA 3O3OB 3TIXB 1YU9A 2GWHA 2ZE7A 1HFKA 1UBHS 2REXB 2FR1A 3QVVA 5IMSA 4XWKA 3KS9A 2OQ2A 4LWQA 5FUBA 1K1EA 1P8JA 2CLIB 3CX8A 3FYDA 1WHSA 4E2XA 3ILVA 3I39X 4G37A 3SR3A 3EDOA 4ZQFA 4AZ3A 2VH1A 1FLVA 1BDMA 1BGVA 4MYTA 4Y2RA 5JDIA 4EKEA 3RABA 5LBTA 1XMVA 3DDZX 1B7GO 4D0GA 3QU5A 5NULA 4CPDA 5ISMA 2LNDA 4BVBA 4LDAA 3JQGA 3DTVA 3NBXX 2ZYRA 4HQNA 5JNSA 1CULC 1KAHA 1YAJA 2FMXA 1U9YA 3Q3VA 5A5EA 3AERB 1QCCA 3BMQB 2TMDA 1TVMA 3UIEA 5IFLA 4NPHA 1V6CA 1