2HMSA

Rectangular-shaped octameric ring structure of an rck domain with nadh bound
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
138
structure length
138
Chain Sequence
b'KQFAVIGLGRFGGSIVKELHRMGHEVLAVDINEEKVNAYASYATHAVIANATEENELLSLGIRNFEYVIVAIGANIQASTLTTLLLKELDIPNIWVKAQNYYHHKVLEKIGADRIIHPEKDMGVKIAQSLSDENVLNY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YuaA protein
molecule tags Membrane protein
source organism Bacillus subtilis
publication title The RCK Domain of the KtrAB K(+) Transporter: Multiple Conformations of an Octameric Ring.
pubmed doi rcsb
total genus 44
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02254 TrkA_N TrkA-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2hmsA00
1ONNA 5G0SA 1GAEO 1HDRA 1GY8A 3SLGA 2VZ0A 4JBGA 4NBUA 5A05A 2FOIA 4FN4A 2H1SA 2EP5A 4R1SA 4D3DA 2NLOA 1EUDA 1QV7A 5DP1A 1N2SA 4HKTA 5DZSA 4J6FA 4ALMA 2DTDA 5JY6A 3NT2A 1UXJA 2NVUA 3X2FA 2Y68A 4Z3KA 3T4XA 4RVGA 4PLPA 1OC4A 4ZRNA 1HETA 3E03A 5KJFA 3W8EA 1WXDA 1KEUA 3OP4A 1Z75A 2W90A 4O59O 4E3ZA 2IODA 1BW9A 1MFPA 3JQ8A 3PK0A 1DJQA 4RCVA 1A72A 1CQIA 5G4LA 1BVUA 1PSDA 1MG0A 5DBGA 3TWOA 2DBQA 4XYEA 1N92A 4UVGA 1N1GA 2NVUB 5B37A 1E3WB 4BNMA 4GWKA 5CAEA 3ZDFA 4BVAA 4O63O 3EY4A 4EJ6A 1X1EA 1P0FA 3WJ7A 1KS9A 2FZWA 3I3OA 4OOFA 2YFQA 1U1IA 4S3MA 1SEPA 4B3JA 2C2XA 2AEMA 4ITUA 2R00A 5CDTA 2FWMX 3WQQA 4ZHSA 4FFPA 4Y98A 3O8QB 4NJMB 2A35A 1PS0A 4F6CA 2EIHA 4HY3A 4B8WA 4INAA 5JYDA 1ZMTA 3DWFA 1KC3A 3I83A 3D7LA 3BMOB 3LC7O 2VTDA 1DRWA 1F8GA 4NK4A 3PIDA 1UP4A 2FN7A 2JCYA 3PJDA 4M49A 4FB5A 3WNVA 2H9IA 1V8BA 1HXHA 2HMSA 2O2YA 2P68A 1JA9A 1E7RA 4MVJA 1NHWA 1VRWA 2HLPA 1LRLA 1Z7EA 5EPOA 2WTBA 2Y1OA 8ADHA 4RF3A 1O6ZA 2E82A 3U4IA 4MKRA 4WCFB 3GDOA 3ULKA 5BSGA 1GUZA 1S6YA 3P2OA 1U2DA 3EGOA 3RJ9A 4J1TA 4MPDA 4URFA 4UUPA 3HN7A 4FS3A 5BSEA 3ZNQA 3GNTA 1MXHA 1ULSA 3ASUA 3TZQA 4N7RA 1DFIA 4U6QA 1SEVA 2JFFA 2O48X 3MJCA 3RAJA 4XYMA 2NU6A 4U8GA 5I7SA 3KYDB 5CPFA 4W99A 1KBZA 1ZIDA 2YHIA 1L7EA 1AUPA 1ZFNA 1IL0A 4XRGA 2D0IA 1L1FA 4O0LA 4CV0A 1R12A 3KVOA 4NK5A 1PZHA 3WIDA 5T5QA 1YB1A 3WSVA 5C5IA 1Q7BA 1SB8A 3BMCB 3WIEA 4K6FA 4DREA 1HYGA 5G4KA 1I2CA 1N9GB 5EINA 4QT0A 1DHTA 2HMTA 3GLQA 3AM4A 2GPTA 2DKNA 3TNLA 3DB2A 1NBOA 1X14A 1IY8A 4IJVA 4H15A 4XQCA 4KUGA 4RVDA 3HHPA 4JJGA 5JW6A 2ZIZA 2Q50A 3WSWA 2ZCVA 4CLRB 4ZJUA 1YWGO 1K3TA 2ET6A 3QHAA 2V7PA 3IS3A 4DMLA 3B1KA 1HLPA 4WOKA 2EKQA 3DQPA 2X9GA 3Q0EA 4JK3A 1Y9EA 1U5AA 4RORA 4XJTA 4KWHA 2NTJA 4NU5A 2Z1MA 1LSSA 2C82A 2D5AA 3DAGA 1FK8A 2EWMA 3HADA 2G5CA 4HX5A 3VPXA 3NYWA 4ZRMA 1SO8A 3QV1A 2VNAA 2NTNA 3A06A 1QYWA 3GHYA 3NT4A 4XB1A 4IQ8A 3FNEA 3VDQA 4CM6A 1HZZA 3C1AA 1HDYA 4CUZA 1U4OA 1H9AA 3HE3A 1LTHR 2I3AA 5DBIA 3ZWBA 2O3SA 1CYDA 1BTOA 1PJCA 2ZQYA 4KUHA 1YJ8A 1ENOA 1FDUA 3ON5A 3PYLA 2CD9A 3DTTA 3KV3O 4TSKA 3LF2A 5G4KB 4Q3AA 4P38A 4LISA 2AA3A 4BQPA 4FFLA 3PDUA 1LEHA 3H5RA 3T7CA 3DBRB 4JP2A 4WCFA 3OMLA 4P4NA 1GD1O 4CM7A 1U7TA 3WYCA 1GCOA 2BMAA 2TMDA 5L7TA 1ZBQA 1XEAA 1P33A 3JQFA 5EL0A 5F21A 3WGYA 2VUTA 3HFSA 4HNGA 5A3VA 4CQLB 4IMRA 3VZRA 4MVJF 3DAFA 1V0JA 1JTVA 3NGXA 1OMOA 4NQZA 3ZU2A 2JHFA 2DU8A 2PZMA 4OOEA 3JYQA 5COAA 1WAMA 1A4UA 3ANNA 3N58A 5F1PA 3D4PA 5LCXA 1R4MB 2CF5A 4RLSA 1GUYA 2QHXA 5JY1A 4NJOA 1DIRA 1NNUA 3DZKA 3RD5A 3D3WB 3ABIA 1EMDA 2WM3A 1UP7A 2ZATA 1F8FA 2B83A 1G6KA 2W4QA 4CV1A 1MGOA 1A5ZA 2HSDA 4J3FA 2XXJA 4FJ2A 4XYLA 3OJFA 4J91A 1ZEJA 1ZO8A 4BNLA 4XGIA 1EE9A 1J5PA 2Z5LA 3OIFA 4L4SA 1VJTA 3RASA 1QV6A 5HA5A 4BMSA 4A26A 2BH9A 2QG4A 2OP0A 1WDLA 2H5LA 4CODB 4R5HA 2YHIB 3VC7A 2WJPA 2GRAA 2FRDA 2NADA 1EDOA 3QP9A 4OIMA 4TMFA 1GZ6A 2FHSA 3NEPX 3NJ8A 1DFHA 2R00C 3I6IA 3ETGA 1LLQA 1PX0A 2AQKA 1JKFA 1VKOA 3ZCXA 1GDHA 1MLDA 2O7SA 3SJ7A 1FDVA 1PJLA 2X58A 5TT0A 1X7HA 5ICMA 5MDHA 5A9TA 2OGUA 4PZCA 3ZV3A 5CG1A 4E5MA 2AE2A 4AL4A 1YBVA 4AJKA 1DFGA 5I8ZA 5HS6A 1F12A 3EVNA 2EW2A 1YQXA 2WE7A 5IDWA 1ZK4A 4TKLA 1LDGA 5A3JA 1HYHA 4YJFA 3L0DA 2ZCUA 4L75A 3LF1A 3UN1A 1DEHA 4YT8A 2SCUA 3PLNA 5I9LA 4CLEA 3PFWO 1SOWA 2Q2QA 1M6HA 2CZCA 2FY8A 2ZB7A 4Z6KA 2W2KA 1B7GO 1HLDA 3BHJA 4BV9A 5IJZA 2NVWA 2X5KO 3V2UA 1KYQA 3QVXA 2IEBA 1TT5A 2GERA 1T4DA 3K2BA 1PZEA 3VHRA 4KWIA 3UKOA 1PGJA 1DBVO 1SOVA 5CG2A 4BO5A 4NFSA 1P9LA 2D4AA 1I10A 3GDGA 4M86A 4ND2A 3W4JA 5KTKA 1O94A 1R6DA 3AU8A 1A9YA 4FGWA 4IUYA 3V1UA 1T2FA 4H7PA 3B1JA 2Z95A 3EAGA 4OKNA 5BNFA 1GYQA 3BMOA 3JQCA 2IDZA 2UAGA 1E3EA 3QWIA 2J3HA 5CHEA 4BS9A 3AM3A 3C1TA 4CUJA 1UP6A 1DLIA 4OO3A 4DGSA 4CLHA 3K31A 1I3NA 4N54A 2XPCA 4BNUA 1DDOA 2NACA 1QR6A 4IDBA 3JYOA 4NH4A 2Q2WA 4E0BA 1T26A 3DMTA 2EG9A 1FDSA 4QFCA 1GEGA 3FSRA 4R69A 4W9NC 3TSCA 4D79A 4G2NA 1ZK0A 2HUNA 2CDAA 3Q9UA 3V1YA 1EUZA 4EUEA 4M8SA 3VH3A 4MO2A 4YYZA 2RCYA 2B4RO 2EGGA 2ZB8A 4JGBA 3PDJA 4IDAA 4K9DA 5ITWA 4HFNA 3KRTA 2JAHA 4JROA 1JWAB 4BGEA 1CETA 4UREA 3OQ1A 4EDFA 3Q3CA 3VH4A 3EVTA 3UOGA 5KOIA 2DT5A 1H5QA 5AVOA 2AG5A 4BO7A 1LDEA 1XWFA 2VHYA 5H82A 1NHGA 3TZKA 4M89A 4WKGA 1Z73A 1VLLA 4BNXA 5KJ1A 2HK9A 5T67A 3OHSX 3NDJA 4U0KA 3JYPA 1MXFA 3PP8A 3PZRA 2YDXA 4UVDA 1Y8QB 5COBA 4Q39A 2I5PO 2OFPA 3N7UA 4FSHA 4M54A 3OJLA 4YAGA 3GC6A 3F3SA 3AUAA 4XEHA 1IULA 2VZ9A 3VVBA 4QQRA 1ZZEA 1ML3A 1B0AA 3U3XA 4AJ1A 3LC2O 4YJGA 1HT0A 5A9RA 2VWPA 4J2OA 2C7VA 4BB6A 1OBFO 3G17A 1LLCA 3AUSA 1GTMA 3I9NA 4XCVA 3I9KA 4QECA 2PD3A 3ASVA 1PGQA 4WK6A 4NBVA 4K26A 3A1NA 5CEJA 1LLDA 2HU2A 4YAJA 3PEFA 5DCUA 3LYLA 3PHLA 4UEJA 3A14A 4DIOA 1NVTA 4L4XA 2QYSA 4AJ2A 3JQ7A 1VPDA 2YV1A 5COQA 4CLOB 2JKVA 1X1TA 1E1KA 3ADOA 3P7MA 2P4HX 3I9MA 1QSGA 3OH8A 4IZIA 4DC1A 4KZPA 3ITKA 4P8RA 2PH3A 1M75A 4K1LA 4YVFA 1XR3A 3ANLA 5ILOA 4DQXA 1XSEA 2OZPA 4LVUA 5F5LA 4XYBA 3I9JA 4I5FA 3GEGA 5B4VA 1I3MA 3Q1LA 4OHUA 3GEMA 4MVJM 3H9QA 5G0TA 3UUWA 1P44A 2X6TA 1R37A 2YQ5A 3PWZA 5KNLA 3KHUA 4B4WA 1B16A 4YRDA 5BSFA 2Y99A 1AN9A 1LXCA 1U7HA 3OECA 4BNWA 5I7FA 3FPCA 4ILKA 1CIVA 1Q0HA 1HEUA 5LC1A 4YRAA 3UAGA 3CMCO 4UVHA 1BRMA 3E9NA 3GH3A 5BNTA 4CM8B 3F6YA 2F00A 1RYDA 2AQHA 1ISIA 4DVJA 5JAIA 2UVDA 3NTQA 3HB5X 1YH3A 3F5QA 3VTZA 4G65A 4Q9NA 3S2IA 5FEUA 3DO5A 3DL2A 1K2WA 1ISFA 3MCVA 5HWSA 2HQ1A 3A9WA 1N7GA 3OA0A 1VE9A 2CFCA 3SEFA 4YQZA 1AE1A 2PZJA 5U4QA 3M1LA 1SB9A 2EF1A 4Q3CA 4TZTA 3WFJA 1H6DA 3F1KA 4HP8A 3C7CB 3JQ7B 2DM6A 1X13A 3S2GA 1T24A 1WZIA 4R9SA 4D7AA 3JTMA 4BHTA 4C4OA 3NJ4A 1PGNA 5IG2A 1DIGA 1EBFA 2HK7A 4W7HA 2BLLA 4JJFA 8LDHA 4FFOA 4B3HA 2Q4EA 4CLXA 2Y66A 3CINA 2C0CA 3RSHA 3UF0A 4QXMA 2Z1NA 3LLVA 1YVEI 2ZKLA 3JD3A 1KC1A 2BRUA 3WNQA 2VQ3A 5EIOA 2NNLD 3NV9A 4PN3A 4W6ZA 3N74A 4K6CA 3RUEA 4Q3BA 4FBGA 4UUNA 1C3VA 3E82A 4MVJG 1GQYA 2OHXA 3H6KA 1BSVA 1Q0LA 4PIVA 3FNFA 1LSUA 3GVHA 2PNFA 1YOVB 5IXYA 1UZNA 3LQFA 4I08A 1B3BA 4ZQEA 1S7CA 2IZ0A 3A28A 3IUSA 5HS4A 1BDMA 1VI2A 3MJVA 5ENDA 3WWYA 3WBBA 1OFGA 1EFKA 2C2YA 1NPYA 3GGGA 3JCZA 2Q46A 5EN4A 3M2TA 4Q3NA 3V1TC 2W2LA 2IZZA 2DQ4A 4NIMA 4N5NA 2D8AA 4CLRA 5CEFA 2X23A 3PTZA 3AY6A 1KETA 4QEDA 4F46A 4FFRA 1C0IA 2CVOA 1GQ2A 4YT4A 1UH5A 2VNSA 4Z0TA 1EK6A 1NTOA 1SAYA 2Q2VA 1YONA 4YBZA 4R1TA 1XKQA 4RO0A 1T4BA 4L73A 3NTOA 3K96A 5KJCA 1WPQA 3W4IA 4XQ9A 2JAPA 1P1RA 4S1VA 4YWJA 3OM9A 4AJHA 3VOSA 2P9EA 1K89A 3ZWOA 1ZUD1 1W73A 1E7MA 4BNZA 1ONPA 1NR1A 4PLGA 5IFLA 3ZW9A 3AY7A 2B4TO 5L4NA 2YY7A 1KEVA 1PQPA 3D64A 1X0VA 5JMWA 3LZ6A 3WJAA 3GMSA 3RU7A 4CMIA 4QUKA 1H94A 1ZH8A 4CM9D 2DPGA 5DBFA 4GVXA 2GZ1A 2WYVA 2O4CA 3RBVA 1E5QA 4B7UA 4BO4A 2GUGA 4XIJA 3CUKA 4P4GA 5F5NA 1YDWA 2V6MA 1EBUA 3DBLA 5CDYA 2I99A 3GN2A 1ADCA 3H2ZA 2BELA 1HL3A 2NVBA 4QSMA 3CPSA 3ZV6A 1GUFA 4E30A 4FJ0A 5TJ9A 5A03A 3RVDA 3GZNB 3LVFO 4RPJA 3DMTC 1EE2A 2OORA 3GK3A 5A5FA 4GVLA 1A71A 1NWHA 2W8ZA 4A10A 4IZHA 5C37A 3AOGA 1Q2XA 3SBOA 4JX8A 2W2KB 2VHXA 4GX0A 4J16A 1RM5A 3OEWA 2HRZA 3AK4A 2V6GA 2X5OA 2FSSA 4Y8VA 1DOHA 4R68A 3TFQA 4YAKA 4CV3A 5IAAA 3AJRA 4DYDA 5JDIC 3BMNB 2EJVA 3BMCA 3QWFA 1Y81A 1VJ0A 1ID1A 3UW3A 4B3IA 3GAZA 1E6EA 3CMMA 3HG7A 1N5DA 4NMHA 3HWRA 5B12A 1KY5A 1P0CA 5KVVA 1JKIA 2WD7A 4J90A 5L7WA 1ZMOA 1IUKA 2NUAA 1W4ZA 2E37A 1GEEA 1V35A 3MTJA 3PRJA 4AJJA 4HFJA 1YOVA 4LW8A 2O3UA 1TLTA 2R2GA 5JSFA 1TVEA 2HMVA 3RBXA 2E6UX 1V3VA 1ONOA 4KUEA 2HDHA 2VRCD 3AOEA 2C54A 3OSUA 2OBYA 4OGWA 3ZWPA 1WP4A 1KEPA 2I65A 4C7JA 6ADHA 1OAAA 2E48A 2EHDA 2PGLA 3K30A 4XKJA 1ENYA 4JBIA 5A5EA 2UUPA 4RVSA 3U49A 4JBHA 5CPBA 4DTIA 5I7VA 1W8DA 3S1LA 4MIOA 3ST7A 4CPDA 1GZ3A 3I4FA 1HE2A 4CMEC 1EFLA 1NQTA 4UEKA 1EVZA 3H8VA 1DJNA 4IJKA 3H2SA 4JXKA 4B7CA 2JHGA 1DIBA 3WGIA 5EJ2A 1P77A 4NU6A 1LDMA 2AW5A 1I3LA 3GG9A 1C0KA 4LMPA 4PZEA 3SXPA 5A04A 4CMGA 1FDTA 5F1KA 1E7SA 1PEDA 2UUOA 5TS3A 1I3KA 2A94A 2X0JA 4R3NA 4CM5A 4E5KA 5ILGA 1PJ4A 1WW8A 4PLYA 3GAFA 4YJHA 3WTCA 4BQRA 3VPFA 4FC7A 5JE8A 1YB5A 4R51A 4HWKA 3OFSA 3D5TA 1ZKMA 3L6EA 5EESA 3VZPA 1A4IA 4E2WA 1U4SA 2X22A 1QG6A 3H5NA 3EYWA 3H9JA 4EJMA 5HM8A 2UV8A 1PJQA 1E3IA 3Q2KA 2VUSA 4CL3A 5KKAA 1RM0A 4D44A 3UVEA 3D0OA 3DHYA 1NAIA 4MP8A 1YL7A 1O9BA 3E8XA 4I9UA 4WGGA 4DPMA 1T2DA 3JQ9A 4E21A 3ZNNA 1IHXA 1JN0A 3PQFA 2QRLA 1YL5A 3VKVA 3HUDA 2WD7B 1P1KA 3MJTA 3PJEA 5KWEA 3S8MA 2PD4A 3NX4A 1PS9A 3JQ9C 1L7DA 3SC6A 3U4CA 4TRMA 3U62A 1JKJA 1CEQA 2YQ4A 1E7YA 4MVJE 3K8ZA 3RUDA 2RH8A 3PFFA 2DC1A 3NT5A 4LVCA 3DDNA 2PGJA 3ORFA 5GZ1A 5ER6A 3F47A 2DFDA 4G5HA 2P4QA 1PWZA 4J9VA 3L6DA 2EKPA 1T2EA 4BNYA 1MUUA 3F9IA 1K6JA 1PJBA 2WD8A 3OQ6A 1PTJA 4MINA 4B4UA 4M87A 3GPIA 1R0KA 3HDQA 2OOSA 4Z9FA 3FR7A 1U8FO 3QWHA 1LQUA 5T64A 1WLYA 3PJFA 2UYYA 3PVZA 4OSPA 4ZD6A 3BTOA 1UZLA 4XGNA 2E49A 1ZJZA 1U3UA 3MOIA 1C0LA 4PLVA 3G3EA 4Z0HO 4PGFA 3RC1A 3MEQA 1Y5MA 1TT7A 1AHIA 4EITA 3KYCA 4Y67A 3AM5A 2ZTLA 4JNKA 5G0VA 1DAPA 4GGPA 1ZJYA 4PG4A 4JCOA 3TOZA 1I36A 2ZTMA 1GL3A 1QYVA 4W9NA 4AJOA 3CSDA 3CTMA 3O9ZA 1P1JA 4JJIA 3RROA 4RV9A 4DPKA 5DN9A 4DUPA 3E5RA 1GU7A 1I0ZA 4KOAA 3TZCA 4CM1A 9LDTA 2JJYA 4L8VA 1QLJA 1VL8A 3JQGA 2IZ1A 2C59A 3E6AA 3F4LA 1N1EA 2Y1DA 4R16A 1N8KA 3MZ0A 3KTDA 2XXBA 4NI5A 1Y9AA 1BVRA 2EKLA 4J7CA 3DBVO 3KEOA 4LSWA 4IIVA 5AXCA 2P5YA 1IZ0A 2IYPA 4MIYA 1DLJA 4CM4B 5C7LO 4O5OA 1PGOA 2GDZA 2J5KA 3U4HA 1TXGA 1CRWG 5IN5A 1W6UA 2D59A 2G82A 3KZVA 4XRRA 3S2EA 1D4FA 1LNQA 1ZK2A 5KIAA 4II3A 1GADO 1UAGA 2YYYA 4IGEA 3C85A 4RDHA 1F0YA 3FWNA 1NX6A 5KCZA 2O3TA 1C1XB 2PZKA 1PZGA 4ZQFA 5MGBA 1LSOA 3IAHA 3HNPA 4W4TA 3ICCA 4AFNA 4BMNA 1BGVA 4MVJP 5FI3A 3CZMA 4YXFA 3PWKA 3LSYA 1QLHA 4CQMA 4MOWA 3NTRA 4BKPA 4EW6A 3G49A 2VHZA 3WGHA 4AJNA 1SCUA 2J3JA 5B4TA 4RLHA 3CXRA 1F06A 4RVUA 2PR2A 1ZK1A 2GZ2A 4BO3A 4A27A 4D43A 3RWBA 1JQBA 1B3RA 1LSJA 3GUCA 5A9SA 5I9NA 3DXFA 2Q49A 4RF5A 3L9XA 3F46A 5CDSA 1KVRA 2RIRA 1UUFA 1HE4A 2VHVA 3R3JA 4RF2A 1PJ2A 1YB4A 3WYBA 2PY6A 3UHAA 3KYCB 4OXYA 5CEEA 7ADHA 1IPEA 2FSVA 3FRJA 4M55A 4NR0A 4N5MA 3PIIA 3CEAA 3BHMA 4GX1A 3RFXA 4DBVO 4TVOA 2VCYA 4EI2A 3ADPA 4WLEA 1DAOA 2Q1SA 2TMGA 2Y93A 1XQ1A 4GWGA 1K6XA 1X7GA 4HFMA 3WMXA 4GPD1 4HBGA 1WDKA 2Y0EA 3E1KA 3HJAA 3U5TA 4MVJI 3EC7A 3I5MA 3L4BC 3D4OA 1HDXA 4PCVA 4OMUA 5U9CA 3V2HA 3Q11A 4GAEA 4Z3DA 3ONDA 2B37A 1K5HA 1KY4A 5IN4A 1CWUA 1AXEA 3KXDA 3GNSA 1UXGA 1XLTA 3INRA 4WNCA 1FJHA 3B20A 3CH6A 3K73O 1Z82A 5H83A 4EGFA 1NFQA 1PWXA 2HRBA 3UCFA 2FR0A 2O50A 1RM3A 4PG7A 1J49A 3HN2A 2IEDA 1FDWA 2FMUA 4WCFC 2LDXA 2YDYA 3QA9A 2EJWA 3ZWVA 1EZ4A 5FI5A 3FTNA 4BKUA 5ITVA 3LT0A 4FD3A 2O2SA 4LMRA 1BXZA 4YQYA 4TQGA 4Y9DA 4MIEA 5TF4A 1NASA 3SVTA 1LDNA 3WBFA 3KB6A 3I6QA 4BO2A 1P3DA 3L07A 4KMSA 3FBTA 4XZ3A 2A9FA 2OMEA 3D5QA 4P22A 4ND5A 1LI4A 3AI3A 3O26A 1C0PA 5EQFA 1G0OA 5AXDA 1I01A 3DEYX 4CM9A 4PG6A 4A5OA 4CMHA 2OL4A 4WEQA 1VL6A 2DFVA 1WDMA 2I9PA 1A7AA 3C7AA 3R3SA 1MFZA 2FP4A 4UUMA 2GR9A 2NSDA 1GR0A 1ZNQO 2JFHA 2G1UA 4NFYA 4OM8A 1RYEA 4CL8A 3QLJA 2J3IA 3AOEC 1KERA 2BFAA 1XYGA 1GQQA 4R4JA 1DC5A 2YZ7A 1HDGO 3ZWYA 4W7IA 4LSMA 4KTVE 2GN9A 2PLAA 5GMOA 2H63A 3WQSB 2NV6A 1BMDA 3FD8A 3JQAB 1JU9A 3VKUA 4CM4A 2VWQA 4LRSB 3TOXA 2O3QA 4OL9A 4D0RA 5A06A 4KQXA 4DA9A 2R6JA 2B5WA 1E1LA 2X9NA 1EQ2A 4AICA 4OXNA 5C7OO 3TFOA 3HDJA 1R0LA 1EUCA 1R16A 1PQUA 3AW9A 4ND1A 4CR7A 3EW7A 1Y7TA 4QFDA 1BWSA 3STHA 3UCXA 1T2CA 1E3SA 4YTEA 3RUHA 4ESOA 5TSDA 3PHGA 4CM8A 1P1FA 2IXBA 4NFHA 5JMPA 3DBHA 4R1NA 5J23A 4NDNE 1ZEMA 2AE1A 3EZLA 4TRRA 4TRNA 3A4VA 1EVJA 4Y6PA 1A9ZA 2NQ8A 4BL5A 1DIHA 3LU1A 3KM0A 1B8PA 3QVOA 5JCXA 2ZJ1A 1TA4A 3H3JA 4RL6A 2Q1UA 3EK2A 4JLWA 4I1IA 4CR8A 3IJPA 3FCOA 4RZIA 4DLBA 4CMBA 6LDHA 2EXXA 2P9GA 5T6BA 3JD0A 2X0IA 4UUOA 3O8QA 2FZEA 3QWBA 5DDIP 1MP0A 2XAAA 3GFGA 4DYVA 1VSUA 1YJQA 2QIOA 3NGLA 1GYRA 4Y6RA 5TT1A 4N5LA 4DL9A 4RZHA 2QRKA 4Y6SA 3UXYA 3MJSA 1K0UA 2X86A 1O8CA 3WLEA 9LDBA 4OQZA 2PH5A 4D45A 3DOCA 2G76A 4AJPA 2VN8A 3OJ0A 1HDZA 5ER9A 2GO1A 1H6CA 2D1YA 1P31A 3PYXA 4R01A 3DZBA 3I4CA 2DUUA 1PGPA 2EGHA 5JPIA 3TRIA 1PZFA 4E6PA 2GCGA 3X2EA 2ILTA 3OJOA 4IMPA 4MKXA 3PQEA 1PJTA 3EHEA 1C14A 3JQ8B 3P5SA 3JQDA 5F3RA 3AI1A 4GH5A 2YHUA 2QW8A 2CUKA 1Z7BA 4EUHA 5IF3A 4QO8A 5JCJD 1A27A 4DLLA 5JAQA 1XU7A 4IY1A 1JVSA 1QP8A 4IDGA 2PKRA 2JCVA 2B36A 1LDBA 2PV7A 1U3TA 1UXIA 2DBRA 1QRRA 1QORA 1EDZA 3IKTA 1AXGA 3L6OO 3RU9A 4WLUA 2VYVA 3RUAA 2P91A 1JAYA 1ARZA 3RIHA 4XGKA 2GSDA 5IZ4A 3QQPA 1M2WA 4E2ZA 5C3MA 1I33A 1ISJA 1UXHA 3PHHA 4IS2A 2WWRA 5IZCA 1YRLA 2C5AA 1ULUA 4WJZA 2Y0CA 4CJXA 3WX0A 2DUWA 1QYDA 3GDFA 3UCEA 3QVWA 4Z9XA 5T57A 1M67A 1ORRA 1IZ9A 5JNLA 3KUXA 3KLMX 3JQBA 5BR7A 3LT1A 1NPDA 2O23A 3SC4A 4YJHB 4I5DA 3WS7A 1Z74A 3GMDA 1YQGA 3R6DA 5DP2A 4GLLA 5K6AC 4YPOA 1T2AA 3BAZA 1NQAO 3HFGA 2POQX 1JW9B 1E92A 3FPLA 4J7XA 4YRBA 3ICPA 2C29D 3C1OA 2WEKA 2PGDA 4ALNA 1TEHA 3FBGA 3JYNA 3O38A 4FW8A 1ZCJA 3B6ZA 1MA0A 1NVMB 4RQTA 5BT9A 1IOLA 3MOGA 4B7XA 3KBOA 1GV1A 4IQ0A 3NAQA 4XIYA 3PZBA 3DZFA 3V2GA 5CDUA 3H3FA 4W82A 3K6JA 1T25A 2EV9A 2NWQA 4PG8A 4FOSA 3KLPX 5K0ZA 4B8ZA 4MP3A 1UJMA 3WG9A 3OF2A 4CUKA 3FTPA 4A0SA 3KYBA 3QVSA 3ENNA 2X0NA 5TC4A 3M1AA 4XX0A 2G17A 1PJ3A 4BB5A 4E5YA 1E1NA 1WZEA 4ALKA 1TT5B 4NBTA 1EK5A 1HSOA 4D46A 5FWNA 1RKXA 2WDZA 2QYTA 4FGSA 1JVBA 3C24A 4IDFA 3GRKA 2XF8A 1LX6A 4IS3A 5ES3A 2BHLA 1KVUA 2VRCA 5JDIA 3GUYA 1BXGB 4J1NA 4E5NA 5L3ZA 1C1DA 1XHLA 3D1LA 4I5GA 1O89A 5DOVA 4D3FA 3NKLA 1OI7A 4FIZA 1K6IA 4J49A 4RQUA 1NR7A 4ZICA 4CLOA 1KVTA 3OA2A 1PR3A 4J9UE 2X8LA 1R4MA 1D8AA 3ONFA 3ZU5A 2DBZA 3KOUA 3FHLA 1SMKA 4LGVA 1P1HA 3BMQA 3AU9A 4BO0A 4B79A 2Q45A 1OOEA 4A03A 1RM4A 2DBVO 4FC6A 1IPFA 4GQAA 2HMUA 4PLHA 1KOLA 1CJCA 4MDHA 4E2YA 1I8TA 3R1IA 5KKCA 1PJSA 2RAFA 1ADFA 1YS4A 1BXGA 3OJEA 3Q9NA 4YJDA 4DQUA 5I9MA 1XU9A 3JQAD 1NP3A 1HRDA 4HADA 4MJLA 1ENZA 3D3EA 2JCXA 3INTA 2HCTA 1XG5A 1ZXBA 4I9NA 4EJ0A 3BMQB 1D1SA 4IXWA 4GSKA 3FWZA 2W2LD 3IQDB 2OP1A 4E31A 5K6AA 2JD0A 4P4LA 2AMFA 1ISHA 1E6UA 4EYEA 1VC2A 1MB4A 2PKQO 3ZW8A 4ID9A 5AXAA 3RI3A 3QRWA 2GYYA 2W98A 4L9RA 4N18A 3WTBA 2GN4A 5DOZA 2Q99A 2X7HA 3WWZA 2DTEA 4J4HA 3BTUA 2BFPA 3OIDA 4UAGA 4YT5A 4YT2A 4YR9A 5IZCC 4UVIA 1YDEA 1YKFA 1F17A 4XR9A 4YB8A 5DNAA 2CVQA 3OQBA 3H7AA 2GLXA 2FR8A 5U1PA 4J7UA 4CMJA 2QX7A 2VTEA 3KSUA 5H81A 2LDBA 4E4YA 5KJEA 3E9QA 2CY0A 2B4QA 1O5IA 4R5MA 3PHIA 1XCBA 3VH2A 1VSVA 3ZWAA 4BNFA 2JFGA 3VZSA 1LQTA 4YCAA 2A92A 1F14A 4BNNA 1BW9B 1JAXA 3EUWA 2BI8A 2BI7A 4HUJA 4DRYA 3GRPA 4F6LA 1YBAA 1I5RA 3DHEA 4YA6A 3G1TA 3JD2A 3Q2IA 2Y05A 3WB9A 1R4NA 4YACA 3TL3A 4M1QA 1D1TA 5CFZA 3KO8A 4HXYA 1JLLA 4J0FA 1XQ6A 1E1MA 2BFOA 4Q3DA 3CZRA 4ALLA 1Y6JA 3ZNOA 4BGVA 2WSBA 1NVGA 1Q0QA 3QWAA 4WLVA 1KVQA 1N7HA 1XELA 4RDIA 2QQ5A 4MVJD 3TZ6A 4MVJH 1X7DA 3INGA 2VT2A 3G0OA 3K9QO 3KSDO 3QW2A 3DHNA 4GBJA 1J6UA 4HFRA 4XQEA 2OBNA 2VOJA 4U6SA 4DBZA 2QRJA 4EZBA 1MC5A 7MDHA 1NQ5A 1LBEA 4IDDA 1HDCA 5JAMA 3DBRA 5G0WA 4CMCA 2IE0A 3WGTA 5TNXA 4YEDA 5L95A 4XA8A 4U0JA 2QZZA 4E33A 4TRJA 1R15A 3GZNA 4IXTA 4ND3A 2BF7A 5TLSA 2OXIA 2Y1EA 2IXAA 4EUFA 4EEXA 2I76A 5ICSA 1ADGA 3WGGA 4ZGWA 1UR5A 3RFVA 3WGQA 5CP8A 3QVTA 1Y8RA 4KDEA 3D4NA 4ONEA 2CDCA 2ZK7A 3PJGA 4UULA 4RVHA 3T7EA 5L4LA 1Y1PA 5T8KC 2BGKA 4BUCA 1PL6A 2O4UX 2GF2A 3AFMA 3JD4A 4BGIA 4D42A 3LT4A 5G2OA 4RPLA 1MX3A 1GCUA 1DRUA 2PKQP 1B26A 1UDCA 1V9LA 2RH4A 3BTSA 3WQRA 4KP7A 5JDCA 1BDBA 1E7WA 3BXXA 4EBFA 3W8FA 2AEJA 1VM6A 1DC6A 2PFGA 1VJ1A 2G0TA 3Q6IA 4GLOA 1ZSVA 1IHYA 2IRWA 4TROA 5TQVA 3TZHA 3MTGA 3QE3A 4JIGA 4L74A 5TX7A 3W4KA 1PL7A 4PLTA 3GVPA 2D3TA 2NU9A 1M66A 1T1RA 5JCJA 4QO7A 1WWKA 2JD2A 1SC6A 4WNIA 1E3LA 5DCWA 5A9SB 4CLDA 5TGDA 3ZHZA 3ZHXA 1I2ZA 3COSA 3AY3A 2ZYGA 1KIFA 2YV3A 3GFBA 3DBLB 3U0BA 3IP3A 4XJSA 1YO6A 2GGSA 5AQ1A 3GQVA 4I5EA 5AYVA 3KEQA 1B8UA 1Y5RA 3K2EA 2AEFA 1E3JA 3VZQA 4OH1A 4HV4A 3IP1A 1DC3A 2C07A 3F5SA 3VPHA 1H2HA 1YL6A 2C7GA 4PLWA 5G0UA 1LU9A 2GN8A 5AOVA 1SBYA 1HTBA 1IYZA 2GNAA 3UICA 3ITDA 4UEOA 1AHHA 1H6AA 5B1YA 4OKIA 4B4VA 4IDEA 4Z0PA 3CE6A 1U3VA 1P45A 5JC8A 3WGZA 1QMGA 3KYDA 3WDSA 1NM5A 2X0RA 3GVXA 2B5VA 4WECA 2AXQA 3AUTA 3DZJA 2AQ8A 2WYWA 2CSUA 3K5PA 3RUFA 4I8XA 1UXKA 1Y8RB 5EQDA 1DB3A 4B4OA 4Q3EA 4L76A 1TB4A 1LA2A 4L4RA 4OAQA 4XB2A 4BNJA 4O6VA 5A1TA 3IC5A 1NAHA 2YW9A 2Q1WA 4GL4A 1R66A 5HBRA 3ZWMA 5ENVA 1GV0A 2Y0DA 2YFHA 4J0EA 3HSKA 3OEYA 1HE5A 3RKRA 4AG3A 5JYEA 4DXHA 3UFXA 1HZJA 2EEZA 3GT0A 3OBBA 4C7KA 1M76A 5DF1A 5JLAA 2QZ9A 5LDGA 5TRTA 2DLDA 2ZTVA 3JQGB 1QKIA 3H5AA 3IOYA 2VUUA 3TN7A 5HTOA 3JQFC 1HDOA 3QJ5A 4XDZA 5JO0A 2ZTUA 3GVCA 1UZMA 3H65A 1LC3A 1U9JA 4TWRA 2WYUA 1Y8QA 3BZUA 3QY9A 4FR5A 4H3VA 4RPHA 1YXMA 4GMFA 4GX5A 4IQGA 4WUVA 4DMMA 1PR9A 3U4DA 3LDHA 4XDYA 4IPTA 1O95A 1QYCA 4NJMA 2CNBA 3EMKA 4CMKA 2D5CA 3TDKA 4IDCA 4PG5A 1RPNA 3GA0A 1LJ8A 3TJRA 2FPPA 3GF4A 3NDIA 4CMEA 5JC1A 3E18A 4CM3A 3JQEA 3ROPA 3JQ6A 3VVCA 4IGFA 4GKVA 3WR5A 1D7OA 4BO6A 2P5UA 2O3JA 3ZHYA 4F3YA 3W1VA 3CKYA 2C5EA 1UDAA 1ENPA 4J1QA 3F1LA 3PQDA 4CQLA 1ZK3A 2VYVD 1LRKA 3GY0A 2EERA 3R0IA 5KVCA 1E5LA 1GZ4A 4FFNA 5HRUA 1I2BA 1CDOA 2X4GA 3OIGA 1WVGA 4PVCA 5L4SA 4ZQHA 3G79A 3SLKA 4JP3A 2I6TA 1KVSA 1KEWA 2CDBA 2HMWA 1ZXLA 3GPDG 4LCJA 4WOJA 5KVSA 3IL2A 4YJGB 2VHWA 2ZB4A 2VWHA 3UGKA 3DTYA 4ZQGA 4BV8A 4WCDA 4XQGA 3BYZA 4DWVA 1SPXA 3RUIA 2BFMA 4BOYA 3ZI0A 3ROQA 2C20A 4Z9YA 1BXKA 4CQMB 4LK3A 2YV2A 1GYPA 2B35A 1LDYA 4H16A 3FF4A 3KETA 1NFRA 1QYXA 1EEHA 4TKMA 2BKAA 2HJSA 2V6FA 3OETA 1GPDG 2IYOA 3NUGA 1DHRA 4WLFA 1GFSA 5LDHA 3JD1A 3P2YA 5ADHA 2I3GA 4GSLA 4KQWA 1ZW1A 2PTGA 1T1SA 1YE3A 4E32A 2NQTA 3M2PA 4OYRA 3E9MA 4PFJA 4E12A 4IBOA 1DXYA 2VT3A 1NWCA 3VTFA 4K28A 4OJNA 1XA0A 4KDFA 1H0KA 1HWYA 3GHHA 3RC7A 4R3WA 4BNKA 4NHEA 4O1MA 3W6UA 4BNVA 3BTVA 3JQAA 3G1UA 3S2FA 1ZSNA 1HSZA 4WLNA 2GD1O 2J3KA 5I7EA 3ROMA 3I23A 4PLZA 1LLUA 1ZSYA 3PPIA 2H6EA 5AXBA 2PA3A 5T8KA 1PU2A 4E2XA 1M6WA 3S55A 1U3WA 3DAPA 4L0QA 1FF9A 1IB6A 3DZGA 3RQSA 2O7QA 3TL2A 3JSAA 1LUAA 3ZZNA 1HYEA 1DO8A 3ZWWA 3TQHA 2YUTA 4NZ9A 3WLFA 5A4DA 3WOHA 1GPJA 2WE8A 3JYLA 2V6BA 3GG2A 1G0NA 3WMWA 3ANMA 4J4BA 4BKOA 3ZV5A 2ZB3A 1OC2A 2NTVA 4R41A 1VL0A 3PGJA 4IJWA 3FR8A 2AG8A 3GNQA 1E0DA 2Q4BA 5JO9A 3PWSA 5FF9A 4CR6A 5BQFA 4AJLA 4ZN6A 3OICA 3LLSA 1ISMA 1VKNA 2NM0A 1U8XX 3L4BA 3FI9A 4BIIA 3DOJA 4IIUA 1B2LA 2J6IA 1ZVMA 3H4VA 2UDPA 3HB4X 3ZWXA 1W0CA 3D3WA 2DAPA 1J4AA 3PI7A 4LRTB 4WE3A 2Y67A 3IMFA 1DRVA 5DCYA 3ETEA 4DC0A 2DPHA 5EERA 1Q1NA 2JD1A 3MJEA 4LN1A 3ZN2A 2VYND 3DZIA 1C1DB 1NPTO 4OQYA 2Y1GA 2NU8A 5IXSA 1NXQA 5JDCC 1G1AA 5GZ3A 5B4UA 3LK7A 2EW8A 1HKUA 3DONA 3JV7A 3RFTA 4X54A 4RPKA 1H6BA 2PZLA 2ZYDA 4D41A 5EMHA 3DMYA 3U9LA 3TPCA 2CMDA 3NDRA 4WLOA 5L40A 4NBRA 3T4EA 2HO5A 3DBHB 2VYNA 4A2CA 1H93A 1XIVA 2HJRA 3M6IA 1DC4A 1U2GA 2RBEA 2PWZA 2NU7A 1J0XO 1Q7GA 2P9CA 3H9UA 2CF6A 2X5JO 4NNJA 5L7YA 4NBWA 4BNTA 5C7IO 4WPGA 1D3AA 1WMAA 3F4BA 4D3SA 3FNHA 4F45A 2Y1CA 2J8ZA 4XYGA 2Q3EA 3IIEA 1B14A 1IE3A 1CQJA 4J2HA 4NG5A 4BNIA 3GEDA 5L51A 1WMBA 4HNHA 2ZYAA 2A4KA 2OO5A 3PXXA 2B69A 5DULA 1E6WA 4CMAA 4R1UA 4ALJA 4PRKA 1CF2O 4YJFB 4DPLA 1YGYA 4KTTE 3K92A 3I1JA 3FN4A 3AFNA 3RC2A 3GGPA 2X9VA 4WASA 3O03A 2BD0A 3JQBC 1Q7CA 1U5CA 5CDGA 3H9GA 3C3XA 4RPGA 4FPXA 4PZDA 1DIAA 4IINA 4NPCA 1EVYA 3WICA 3BIOA 4LCEA 3VPSA 3RC9A 3TF5A 3O4RA 4RGBA 1EVIA 3V8BA 3AWDA 3QIVA 2CVZA 2AQIA 1QXSA 3MWEB 4D0SA 1V3TA 4ND4A 4FFMA 1MV8A 3LT2A 4QTZA 1P74A 2GASA 2PK3A 4AJEA 3PGXA 4BO8A 5BNIA 4BKQA 1PQWA 1RWBA 2O3RA 3WFIA 5KJ6A 4JQCA 2BGLA 1JWBB 4U7WA 5TIIA 3FNGA 1E3WA 4MKZA 1MG5A 2B0JA 3DC2A 3C7DB 1HE3A 4ZQBA 3ZV4A 4J43A 2ZQZA 3C8MA 3RBZA 3PHJA 4A7PA 1Z6ZA 5THKA 2JL1A 4RVFA 3QSGA 4OSOA 3V5NA 4RJTA 4A73A 1PL8A 2HAEA 1TI7A 1H9BA 2WMDA 3WYEA 5L45A 3DFUA 5F1OA 4U5QA 3U09A 5KVQA 4E13A 5DT9A 3UH1A 1I24A 1X15A 5THQA 1OZAA 2EP7A 3P19A 1BG6A 4CV2A 2ZJ0A 1PIWA 2J5RA 4GI2A 5FYDA 3AUUA 1E7QA 2BGMA 1UDBA 3HZZA 1O0SA 1EQUA 4BGUA 4CMIB 1B8VA 2P2SA 3IUPA 4ZA2A 3GR6A 2GZ3A 4BKRA 4DLAA 5BSHA 5JAZA 1YBMA 1P1IA 3B1FA 3BA1A 3ZWNA 2FPIA 3I52A 1JDJA 2FR1A 3SX2A 3ZU3A 4DIFA 4MP6A 4R9RA 4GX2A 1HF3A 3L77A 2XOXA 1XDWA 4BO9A 3HDYA 3IKVA 3BMNA 4ZU3A 1SNYA 3ZGYA 4TZKA 4AJIA 1CERA 3HDHA 3L4SO 1C1XA 4ZVVA 4E5PA 2D2IA 3ZHBA 5TJHA 4ROSA 2VWGA 1NYTA 3EZYA 4YDRA 2X1HA 5GY7A 2DVMA 2DTXA 5JXWA 4DIBA 4XR4A 4JN6B 5L9AA 1I30A 3E5MA 2OUIA 1ISGA 5IDXA 4PLFA 4J1SA 5GZ6A 4GMGA 3ZH2A 4XD2A 1FMCA 1LC0A 5A02A 2AHRA 3L9WA 4YAIA 3DFZA 4BO1A 3SJUA 3VH1A 3IJRA 1MC4A 2RHRA 4GKBA 2GN6A 2PD6A 5FFFA 4FJ1A 1V3UA 1LRJA 3AI2A 1UAYA 3WXBA 2Y1FA 4CQMD 5JBIA 3PYMA 3RJ5A 1B15A 2F1KA 3KSZO 1I32A 2VRBA 1U28A 3ZNPA 4IJUA 4PRLA 4QX6A 4RF4A 3RCBA 3DR3A 1WNTA 4G81A 3RKUA 3DZHA 4II2A 3LC1O 3GZ4A 1YQDA 3VDRA 3ZWCA 4ALIA 1DSSG 3E48A 4FQ8A 4PLCA 3VAZA 4FCCA 3GOHA 1Z45A 3I9LA 3MWDB 1NQOA 2E4AA 4FDAA 2VZ8A 1R0SA 2V65A 1A7KA 3ONEA 1XGKA 4UVEA 4R54A 2Q1TA 3GGOA 3IDSA 4BMVA 1AGNA 1N9GA 3WGOA 2YJZA 3I9OA 4YAEA 3VPGA 5IDYA 3BHIA 3ZU4A 5K9ZA 3CIFA 4OXKA 1R4NB 1DPGA 3B70A 3GVIA 3H9EO 3ROKA 2HK8A 5I8WA 2FPGA 4I9HA 3ENKA 1NFFA 3HQ4O 1ADBA 4PVDA 2I66A 4EEZA 3PLRA 1V6AA 3RUCA 1BHSA 1SZJG 2HKIA 3DOOA 3GN1A 1H2BA 4TVBA 1E77A 3W8DA 5JFOA 1RJWA 2VOEA 3NRCA 3ETDA 4DQVA 5L53A 1PS8A 4XWYA 4IM7A 4J4TA 4FOOA 4AVYA 3MJ4A 5IDQA 2I67A 2RHCA 2J5QA 4GGOA 1FXSA 4WEOA 4BNGA 4BNHA 5JS6A 3EDMA 1X0XA 3W6ZA 4AJ4A
chains in the Genus database with same CATH superfamily
4G0YA 4U7HA 1DL5A 2PZEA 3UHJA 3S29A 4HD8A 3ZR4B 2QD3A 1EGVB 4RK0A 4C4RA 3LDUA 2O6HA 1QCYA 1U8EA 3G85A 4ALMA 5AVZA 2DTDA 4TKVB 3DULA 5JY6A 3HCAA 2AWOA 3LFUA 3PFGA 4MRSA 1NLMA 3NT2A 5E9WA 2NVUA 2VNIA 3LCMA 2IIBA 3X2FA 5H9WA 3OQOA 1PZXA 1FVFA 4DJDC 1AQJA 5AW5A 2VKQA 3RSCA 3SCZA 1DJMA 2V54A 4PLPA 2X8JA 3UMCA 4ZRNA 3EEQA 2CD7A 5AOBA 5KDLA 1KEUA 1Z75A 2V4MA 3HVUA 2EDCA 2HJWA 3IHWA 4FD2A 1BW9A 3BS4A 3A1TA 3JQ8A 3PK0A 3PIRA 1OLSB 3OO0A 1A72A 1CQIA 2F1JA 3EXIB 4QXRA 5LYJA 2XZPA 3IE2A 1PSDA 2PT9A 3LUCA 2MYNA 4IFIA 4B0PA 5F23A 4OA5A 1AA6A 4WNYA 2XMCA 3URMA 1E3WB 5ES4B 4KAJA 2W71A 4IIFA 1MHTA 5CAEA 3N6RA 4MMYB 4M1KA 3IDQA 3JAMA 1X1EA 2ZB2A 3C8UA 4I6JA 3S5UA 3WGKA 4CFYA 1EXVA 4WXPA 821PA 3K09A 3I3OA 3IR5A 2IUTA 1NRWA 3VOAA 4HUTA 2HJVA 2IF0A 4QDXA 3MIZA 4U02A 3R7WA 1AK1A 2AEMA 5AJXA 4W5NA 1ORWA 5CDTA 3PNLA 2FWMX 1VZ2A 1IK6A 3T6KA 3WQQA 4BAUA 5BRJA 5CD9A 1ZUNB 1JJ7A 2VF5X 2VBGA 3MTEA 4WK0B 1T9GS 5E4TA 1HT1E 3A6EA 4UASA 3UAXA 3V9PA 4XWAA 4QU5A 5CR9A 3C6KA 4L9WA 4Y2TA 1RXVA 4HY3A 4ZVKA 1DBWA 3SYKA 3QBJA 4GRIA 1OXSC 1IHPA 2OFOA 3LP6A 5DTEA 5JAPA 2BKVA 2O5RA 4DKJA 3FPEA 1W5AA 3F5DA 1VP9A 1VP3A 1QMPA 3IEIA 4NK4A 2BFEB 2R751 1QBGA 3MHPA 3TPFA 1UP4A 4RE5A 3EQ7A 3VV2A 1ABFA 1L5OA 3WNVA 4EHKA 1V8BA 2ZJFA 3HCRA 1VJ5A 1GTVA 2O2YA 2P68A 3AEXA 5E1DA 1SBQA 2REBA 5EI5A 1G18A 4MVJA 4GIBA 2V0CA 4G8BA 2HLPA 2WY2D 2PG3A 3O9MA 1VCIA 2ZI6A 5EPOA 2DGDA 4EW1A 1O6ZA 2E82A 3U4IA 4MKRA 1T9GR 2D5BA 1NVVQ 1QVZA 1U0GA 4KLAA 5EJ9A 1U2DA 2CXRA 4Q24A 2V03A 4XJVA 4YJ2A 3P52A 4UUPA 3SQMA 3OWXA 1HG1A 2I6FA 3EMDA 4L07A 3W78A 2FZ4A 3GNTA 1BU8A 4ZQCB 3ASUA 4N7RA 1DFIA 1DCTA 4FOPA 4BBJA 3WZ2A 1F1BA 4CEIA 3UGTA 3RAJA 4XYMA 5B1SA 3KAQA 5I7SA 1J5EB 3L93A 1CY4A 3PA6A 2YHIA 1L7EA 1OFVA 3IJ5A 5KX5B 3ESQA 4XRGA 2QRGA 5JMTA 4PEVA 3B8HA 1L1FA 5C5CA 2VP9A 5I01A 5JAHA 5C8DA 1II0A 1ESMA 1VHDA 5BQOA 4LRUA 1A77A 1J23A 2V8OA 1U7XA 2IP1A 2O1SA 4BQSA 1K68A 1M72A 5T5QA 2HXGA 4BFSA 1CRPA 1WUKS 1RAFA 1FP6A 3ZE7A 1SB8A 3KKPA 4KXQA 3NV7A 1W94A 2DQYA 4R2MA 4ZVRA 3PXEA 2PBZA 2YHSA 1UBOS 2WF7A 3C2QA 3QMWA 5G4KA 5EINA 3QPWA 5JCOC 4PC2A 1DTSA 4QT0A 4RCZA 2Q27A 4P35A 4URWR 3LAWA 1W5BA 4OYLA 2GPTA 2DKNA 4X44A 5IP5A 3FLAA 3DV2A 2RCNA 4XQCA 2I6GA 2AOUA 4AKEA 3QKWA 2QDKA 2VPYA 5JW6A 1E1DA 1NUPA 2H1IA 4EW3A 1VHTA 3WSWA 3D7KA 1VLHA 4N9WA 5AKJA 4CLRB 3KR2A 4LHYA 4WKCA 1P73A 5LR6A 1QIGA 3LBAA 2HOQA 4QBHA 4DMLA 3B1KA 3UUEA 5KNCD 2K2QB 2L19A 1HNZB 1BDHA 4CG3A 2FLWA 3RHFA 1TCAA 1U5AA 1QHXA 2AG1A 3HA2A 4XJTA 1IN8A 3EC2A 2NTJA 2PT6A 3F3KA 1LSSA 2C82A 3HADA 1SCIA 4L28A 4OCZA 1XVAA 2G5CA 2ZW9A 3VPXA 3KAKA 3PPXA 4ZRMA 2VNAA 3NT4A 3L5KA 4DEXA 4DCPA 1HZZA 5HNKA 3LY9A 4IP0A 1KARA 3C1AA 3D8RA 4LYFA 3EJWA 3HE3A 5FOXA 1XZIA 2I3AA 2JFZA 1MAAA 1TU0A 2CXSA 3CNNA 4KMOA 4WVFA 4OHVA 1GUAA 3ZWBA 2O3SA 1PJCA 4MYTA 3C6BA 2MYUA 2JH3A 3TCNA 1DEKA 4E03A 3VJMA 3PYLA 1ZJJA 1MZVA 4P4UA 2F7SA 4B09A 4B2LA 4UBIA 4EHBA 4LISA 4BQPA 4PQRA 3RV3A 3K1AB 4FU0A 3H5RA 1PAUA 1IEQA 2IA5A 1DQRA 1BWPA 5H68A 1ELOA 1WV0A 2ODNA 5IJAA 4CM7A 5J2TA 2OXRA 2XA1A 2IV2X 1X8JA 2P9HA 4LG1A 5CCBA 3B9BA 1O77A 1RC8A 2HFJA 4G8CA 3VJRA 3CWQA 1XEAA 4HB3A 5CB6A 5EL0A 2NO7A 2F9MA 2F3UA 2HIAA 2NX2A 4QOHA 1N6IA 3WGYA 3WISA 2AFHB 1E98A 4IMRA 4MVJF 3COWA 1V0JA 1GXSB 4KRYA 2X1VA 3L1KA 2Z2XA 4G1FA 4WBNA 1VSQA 4MS3B 4YRGA 4K9SA 2JHFA 2AXNA 5GGXA 4W5TA 1BA3A 1BMFA 2DU8A 2Q41A 3JYQA 1ADJA 4LDZA 3DJYA 4OOEA 1QDEA 3KDSE 4RA6A 4D5GA 4M9RA 3OT1B 4EPWA 1R4MB 5CA1F 1SUIA 2YFYA 3MTQA 3FZNA 4RLSA 1YK1A 3TE7A 4KWTA 3EVDA 2EX0A 1J07A 2E4WA 1NNUA 3I9V1 2WW8A 2ZJ3A 4EJFA 3BF8A 1CJTC 2IYUA 1D0SA 1TRKA 2ZATA 1G6KA 3TS1A 3BD9A 1T1GA 3NYRA 3EF1A 1A5ZA 1H1TA 2NSHA 4J3FA 3R7FA 3A3KA 3F4KA 4BLQA 1ZO8A 1XVTA 2D3WA 1W75A 3QTBA 4PFKA 1TUEA 3DMPA 3RM3A 2B8TA 3ZUGA 3D6HA 4KC0A 1WB5A 4G0UA 5HA5A 5J2UF 4KGXA 5F78A 3F0TA 3V4ZA 1KJWA 5AHOA 2JFUA 3RUFA 2ZPTX 1NUHA 4R5HA 2WJPA 2RGRA 3KPUA 4L08A 3TOSA 2NADA 4G4JA 1U5BB 3LW7A 1ZJ4A 3BIXA 3DMFA 2AFVA 4D80A 1QK3A 4QIHA 2CNLA 1KU0A 1NUUA 5AJTA 1UAAA 1O58A 1PX0A 5JVDA 4LZWA 1TTPB 1R4ZA 2FCAA 4M21A 1EP1B 3OESA 3QVUA 5IJWA 1G8KA 3AR4A 1A9XB 1TIBA 2O7SA 1EGMB 1LPBB 4A16A 4YUXA 3UENA 3PU6A 2AH5A 4MQMA 3BGWA 3V8PA 3VR3A 1X7HA 3CX8A 4D1YA 1QZZA 1UIRA 3OZDA 5ICMA 1IEWA 5I51A 1OXBB 4HYTA 1HKHA 1YAJA 1T15A 1ZUNA 1Z7GA 2CBGA 4AL4A 2WNIA 1U8AA 4AJKA 3VO2A 2C5LA 3FB4A 2FKNA 1F12A 3DDSA 3EVNA 1KEKA 4JP5A 2PRYA 2RARA 3B3FA 2HNBA 2GHQA 3WL4A 4LJRA 2LWIA 1D9ZA 4HWTA 2R6HA 3N2GB 5CDHA 4GOMD 3HO1A 1P5FA 3GIDA 4OHPA 3PPVA 4POAA 3PFKA 3K0FA 4QUIA 5AKGA 3LBIA 4JUCA 3T7AA 4YT8A 3ERCA 2SCUA 2C94A 3PFWO 2VTVA 5JTTA 1SOWA 2Q2QA 2JFPA 3CEJA 2XQGA 4UU8A 2CZCA 2D74A 4UUQA 3I2KA 4RHFA 4C2AA 4JA0A 4DUGA 4Z6KA 3U9TA 2ORWA 2Y6UA 4M7WA 1N5RA 2DWCA 2QX6A 3SDZA 4B83A 1G7RA 1N6KA 3P9SA 1MW9X 4EGJA 8ATCA 3TLGA 3M8KA 1SPBS 2IEBA 1GCGA 3IXLA 1T4DA 2DR0A 1PZEA 3CLTD 3G5LA 3LSTA 1EG7A 4KWIA 1CUWA 4ZGBA 4B3XA 1DBVO 1UOEA 2PX0A 3UJ9A 1ZD8A 2D4AA 3KFVA 3VI3B 2BEUA 2R1TA 1JR3D 5JYBA 1HRKA 3K5IA 1N1DA 4JLPA 4YY3B 2YIJA 1V26A 2NU6B 1GKIA 2I7DA 2LNDA 3EQ9A 4IUYA 4MJXA 5TDHA 3THXB 4C01A 2WUWE 4IO1A 1T5BA 3DCIA 5EIBD 4H7PA 4RCYA 3QVGB 1CEXA 4QOFA 3NVMB 4K40A 1QVWA 4JQZA 4D4GA 2CNWA 1LPPA 2ZR0A 1M2KA 1R9MA 2IF2A 3CF0A 2GXAA 5EYPA 3UOWA 2Q1YA 1VIDA 3BB3A 2AK3A 4BS9A 1SCQA 3C1TA 3EOAI 4JOBA 4OO3A 4Q66C 3RVNA 2J30A 4AC9A 3K31A 4N54A 3NDPA 3RVSA 4CEHB 1X3SA 3G1WA 5C0OE 2EFCB 2BM0A 4JMLA 1KXJA 4O08A 4TLMB 1BC5A 2I7XA 3D3QA 2Q2WA 2EYUA 3NANA 4MV1A 2QE7D 2CLFB 3JZFA 4NH4A 4RKFA 1E0AA 2VXBA 4BRWA 2F1IA 3OEHA 4L0MA 1OX4B 3RREA 3KR0A 4QWWA 1O0BA 5FPHA 4D8WA 4YDQA 1ZK0A 5AW6A 2PUWA 4BAZA 3L7CA 1XU4A 3FUWA 4EUEA 4EJ2A 3B9QA 4NE9A 4P08A 2R0QC 2ZITA 2H7CA 2B4RO 5D3ZA 3A4LA 4IDAA 5ITWA 2ERYA 1M34E 2W6OA 3T1YB 2YS6A 4LJ5A 3W2HA 4Q4LA 3UHOA 1RLMA 1X7XA 2VJQA 4HDAA 4Q6BA 4KITB 3UOGA 1JSLA 4JIMA 5HIAA 4RHEA 2IXDA 4AWBA 4DNFA 3FOAA 2O19A 5AVOA 2JIZD 2P35A 4B81A 2P4UA 1QQBA 3B38A 1L1QA 2C92A 3EFEA 2VTKA 4NHOA 1RP7A 4M89A 4R71A 1CZUA 5FWYA 1N0VC 4Q9AA 4JFAA 3V1KA 2A9OA 3Q3EA 3GLFE 1AUXA 3AB7A 1J2TA 2VSOA 3NDJA 3EVGA 1T2VA 3JYPA 5EE5B 3M82A 4ZT3A 5IC5A 4RU1A 2J0VA 2YCLA 1GITA 2QT9A 2YDXA 3PZRA 3UV7A 5COBA 4Q39A 1ZA2A 2I5PO 2QSYA 3N7UA 2EQBA 3WLLA 3WFZA 4M54A 1CJBA 4R9VA 2JVJA 2A86A 3HXLA 1JL3A 2O0JA 2QR2A 4LOAA 2HI0A 3OBIA 4TLLB 4P83A 3OU2A 4EUNA 5CB8A 3VVBA 4P7JA 1ZZEA 1N6NA 4Q18A 1ML3A 2P77A 4QQRA 5FPPA 5LMUB 4HHEA 4FI3F 2CHFA 4CG0A 5A9RA 3ZY4A 3EUAA 4GLJA 3U16A 1OBFO 3G17A 4HUQA 3DM5A 4MCJA 4TUYB 1GTMA 3M1IA 3OUZA 3I9KA 3KVNA 4C0JA 4MQLA 1GSIA 5D85A 1R0RE 3M5DA 5FO0A 3JVUA 3NU1A 4OQNA 4YQFA 3A1NA 4BQEA 1L5HB 4KV7A 1N5MA 2IOQA 3H5IA 3A58B 2PX4A 2VK8A 5HE8A 3FAZA 5DCUA 5EMMA 4V3BA 3NP9A 3A14A 1V5WA 3CO5A 2WT9A 3PKIA 2XSZD 3UAVA 1W5SA 3A6HA 4CLOB 3TXXA 1ZJ6A 5TY0A 1A04A 2HSJA 3FZQA 3AGQA 4LQCA 5B3AA 1Z5UA 3OEEA 4ED9A 5CDFA 4JYZA 4DC1A 1FUEA 1V6SA 2HHLA 4I4TA 4KZPA 5IBRA 3SKYA 3RIYA 4QULA 4CG1A 5IBCA 4DQXA 2OZPA 3ACDA 5L6LB 2ZXUA 3WQHA 3GLUA 1U9YA 2BP7A 4I5FA 1VQ1A 3L04A 4OYYA 5H7XA 5BV8A 2OGWA 2JGRA 4RA9B 4O2LA 2Q6IA 1N2GA 3TTYA 1WW3A 1R3DA 1CVRA 3ZCUA 3AM1A 2L42A 4RSRA 5G0TA 3UUWA 4JGIA 5A5VA 2CB0A 1JA1A 5A4JA 2CXNA 3THYB 2X6TA 4NBNA 5DLEA 2R5WA 3PWZA 5HZKA 3RO7A 5KNLA 1TQ6A 2CHQA 2A5LA 2C9MA 4YN3A 4LF8B 1UWKA 1J9GA 1UL1X 4R8MA 4YRDA 1U7HA 2BMEA 2G04A 4BNWA 3SQXA 4XUCA 5I7FA 1G60A 5IT4A 1CIVA 1Q0HA 1HEUA 2Y92A 4MI6A 3UAGA 1IRIA 1S89A 4Q3LA 3ORHA 5AW0A 3EXG1 5BNTA 4CM8B 3F6YA 4J8PA 4BGDA 2AQHA 4GGMX 3ND6A 2E6KA 3C5EA 1T8TA 1DKMA 1YH3A 3VHLB 4X66B 3KOWA 4D9NA 3BJEA 2VBIA 3E7DA 2HIHA 5CT4A 4FEGA 3ML1A 3DKPA 3S2IA 5FEUA 4PO9A 1WSWA 2LP4Y 3LGXA 2ZAGA 3F74A 4X85A 1K2WA 3X44A 5FIUA 3AUXA 1BHO1 1KZ6A 2I4OA 1QIEA 2LTAA 4JXJA 5HWSA 1ZUIA 5E6SB 3W3AH 3O8OB 1DRJA 2J7PD 4Y7CA 3BIFA 2E1PA 2C0QA 2W8BA 3SEFA 4YQZA 1AE1A 3D3JA 4J76A 5U4QA 1P8JA 1L5WA 1T1JA 4Q3CA 1XPJA 1QTRA 4KQ2A 3LPLA 1FFEA 1KI1A 2QL7A 3WFJA 2ZULA 5HKLA 1VGQA 5D6OA 1H6DA 3IH5A 1LNZA 3OIVA 2NYAA 4AECA 2YQZA 5A5GA 3U7GA 1T24A 1NW5A 1G20A 4ZWNA 1E4OA 4OPMA 3HWWA 3PHBE 3UJ6A 3UTDA 4G0VA 4D4HA 1TO2E 3ETHA 3NAGA 1RI5A 5LFAA 4C0BA 2OCAA 2HK7A 4HG2A 2BLLA 4JJFA 5HOQA 3TR0A 4X65B 4CLXA 3KIPA 2A78A 2Y66A 1MBZA 4TWIA 3RSHA 3UF0A 1TYZA 2V55B 1J00A 1YVEI 2ZKLA 1OUMA 1KC1A 3AR2A 3DDWA 4J3JA 1QRSA 2I2XB 2P27A 1OZFA 4M60A 2NNLD 1OU4A 2FPIB 4GM0A 5B3KA 4W6ZA 4PY2A 5LWQA 3HKCA 4LBVA 3ABRB 3RUEA 4Q3BA 2PT5A 2CCGA 5EWJA 4F1WA 4FBGA 2G28A 3L8ZA 3U39A 3TVTA 4GOND 1GQYA 2IKSA 2OHXA 2B4AA 3H6KA 1TDJA 1I9GA 3I1IA 3NRJA 2R3SA 2TS1A 1H8EA 5AVTA 1SCKA 5AUPB 2BLNA 1B3BA 1O95C 2I54A 2QRZA 4MI3A 2QWXA 5K8CA 1KQGA 2I1VB 4B3TB 2DPMA 2I91A 4KKVA 3FMOB 3ZGNA 3BIJA 5EP4A 4BDTA 3OD1A 5KQRA 2HB6A 3A2NA 3HZRA 1XNJA 5A4KA 4Y1RB 1CY0A 3MAAC 1FMFA 3DE0X 4JYPA 1FFCA 1X1SA 1QGDA 2Q46A 2YN4A 3N6VA 4UTOA 3V1TC 2W2LA 4YS6A 1M5UA 5KAPA 3QPCA 5LIRA 2XCTB 1PQ4A 1AVTA 4CLRA 2X23A 1XZDA 3UWMA 3ZDBA 2Y6VA 4M83A 1GQ2A 4A0FA 1SXJE 2VNSA 5CFPA 3W5BA 2DJIA 4V0KA 4Z0TA 2NNWB 4I1PA 5BSWA 4NZYA 2YZ2A 1SAYA 1YONA 2JLRA 3S2SA 3ZX4A 4HGRA 4R1TA 1XKQA 3UATA 2I8LA 4DUYB 4UAVA 2FUCA 5KJCA 1SIUA 5LYJF 2P3QA 4HTFB 1WXFA 5IEJA 4ZYXA 1YA6A 1P1RA 2B1GA 4YWJA 1O87A 1PFYA 4Q82A 1F8UA 2ZEJA 2QMYA 3OCVA 2J1LA 3NVKI 4GI3A 1GPH1 1W73A 3O1IC 4UQPA 3NHMA 4X64B 1XMJA 5FCDA 5IFLA 2B4TO 4KLZA 1U8UA 4EG4A 1LI5A 1PQPA 1WVIA 5JMWA 1KIAA 3ZY5A 2GCIA 3FPBA 3JR7A 3LZ6A 4CMIA 2ECFA 4CM9D 2DPGA 1U0EA 1WDTA 1KI7A 3SYTA 3DAHA 3A1WA 3ET4A 3RBVA 1P19A 4B7UA 1H4TA 2XRYA 4GQIA 3WGNA 2G0AA 5ALPA 4R2JA 5F5NA 1GFZA 1YDWA 2V6MA 4JENA 5CM2Z 3SFVA 2I99A 3WIOA 5IS2A 1T3SA 1ADCA 4UFOA 3VNSA 1D5CA 1XEWY 4QSMA 3QEKA 5HZMA 2HYIC 3FLMA 4L0DA 1GUFA 4FJ0A 4NY1A 3SM9A 5MFPA 4F4FA 3RVDA 3R23A 2VZEA 1EE2A 2J5BA 2KE5A 3CC8A 1UOQA 3GK3A 3KWFA 4GVLA 4I66A 4J0HA 4M0CA 9ATCA 1REQA 3WLTA 3V4VB 3VR5D 2DFKB 2OYRA 4A4DA 4A10A 4DJEC 3CZPA 3CF4A 3AOGA 1Q2XA 2WIGA 5IAGA 4JP8A 3SBOA 4B33A 4LOKA 4FHZA 4UUAA 2VH1A 3U7RA 2C7BA 3OEWA 4KAFA 3EXHC 4GZ6A 2ONJA 4DADA 1F7UA 4MR9A 2ENUA 4G1VA 2X5OA 5L3SA 1P7ZA 2IYVA 1UT8A 2DKFA 4KIUA 3S7TA 1TK3A 4BFZA 4ZVSA 4D4IA 4WOBA 1DOHA 3IGFA 4FN5A 4MSUA 4ESOA 4YAKA 4YV1A 3KWJA 3R4CA 4DB2A 3BMNB 2F8LA 3L1VA 2BFFA 3U81A 2HHCA 1GTSA 1RBMA 2EJVA 3QWFA 3W6NA 5DGHA 1VJ0A 2LD4A 3HI6A 2H57A 4U2CA 3EPRA 3TRJA 4Q9LA 4WACA 3AZPA 1I1QB 4QLOA 2V6IA 4O4HF 2GM3A 3U3MA 4IOJA 5DGXA 2W6ID 1H42A 5LSAA 3HA5A 1P0CA 1YGPA 4QAJA 4R8SA 3ZD6A 4J90A 2G71A 1DE0A 2R6FA 4OUKX 2X0FA 3GP8A 1N32B 4D9FA 3G2HA 2UU9B 2B1IA 4B32A 2RHTA 2E37A 4R6WA 4M1TA 3VZBA 5DHTA 4HFJA 4E7PA 4LW8A 1WBDA 4UAUA 1Q12A 1XQWA 2P30A 2ZRQA 4P0QB 1CJMA 1OLSA 3RBXA 3RDPA 3DEFA 3S1SA 3IEMA 2YX1A 4FWIB 3TXAA 4HRAA 1Q0TA 1ONOA 1Q95A 1E32A 1S4MA 3PC2A 1JU4A 1T3ZA 2YJGA 3QVLA 2PSFA 2VRCD 2EX4A 2C54A 3AOEA 4R40A 5C8ZA 4Q9IA 3M4XA 3OSUA 4GNKA 6ADHA 1KEPA 1O5TA 2FX3A 2YTZA 1CZLA 2P2GA 3EAQA 3KTAA 1NJ5A 4C6HA 5CFLA 2EHDA 1KE1A 4GMHA 1YA8A 2OPBA 3K30A 2O2DA 1ENYA 1E9EA 3FM9A 3FDXA 3GFFA 4DNQA 1U1FA 1XKTA 2RHOA 4M1WA 5ALUA 3AILA 4JBHA 4DRZA 4PX2A 1XUOA 1G8SA 1OTYA 1AT1A 4O3FA 4EHHA 3W05A 1V48A 2AHOA 4RFLA 4UPVA 3ST7A 1VKHA 4CPDA 3I4FA 1HE2A 4CQJA 1EFLA 3R6TA 2BFCB 1IJKA 1DJNA 1MOPA 4HLQB 3LTEA 3AKZA 1NV9A 3A27A 4B7CA 5EZYB 3ANTA 2Q29A 4GPBA 3AEQB 1JS1X 1XXHB 4QM6A 1H4VB 4LY3A 3ROXA 1KI6B 3DNMA 4A3SA 1H2XA 4Y2SA 2AW5A 4R84A 4PHGA 1JQKA 4FMCF 4PZEA 5C34B 2QF7A 2OCGA 2VJKA 5B6IA 4ZQIA 4F2WA 3V4SA 5AVXA 2X42A 1PEDA 5TS3A 1OB2A 4R3NA 3DP9A 4FFSA 4E5KA 4B3DA 7REQA 2V3CC 1QF7A 1ZD2P 2ZQ5A 4NE7A 1PJ4A 2W58A 1S02A 2Q3FA 3L7LA 5ILGA 4XXHA 1IJEA 4YJHA 4AG5A 1RIIA 4NCIA 3MMPA 4H08A 1M2VB 4FC7A 1YB5A 5JE8A 4ZT6A 2IX3A 3EGDB 4R51A 4TTVA 1K0FA 3GLVA 1BQEA 1Z2EA 2FUG6 2FPLA 4OM7A 1A4IA 1Z7YA 1GLNA 5AW1A 2CHVA 1F6WA 3ZGVA 2JB9A 3KKQA 1QFXA 1ODTC 4URYR 4L6CA 1QG6A 3U31A 1ZGAA 3JWPA 3EYAA 4LEIA 2YV5A 3VKGA 1Y3FE 3A0RB 5DRYA 5FPTA 1U5BA 3ACCA 1WO8A 4OG2A 3W9YA 5LKAA 3KQLA 1FNDA 3UVEA 3UH0A 4Q4HA 1NAIA 4MP8A 1YL7A 3L02A 1Z6GA 4MWOA 4NMXB 3TI9A 2IEAA 4TV9F 3DLTA 4KH0A 4BX0A 1XL1A 4LGCA 1RXWA 2JIQA 3AT1A 2IY9A 1ZXXA 4B5LA 4OHXA 3RYIB 3V4LA 1Z83A 3VKVA 4X7PA 1AKVA 3MJTA 1IPHA 5K8VA 1MEEA 5JRZA 4OB8A 5AJHA 1YULA 1A5BB 2PD4A 5LZ4A 1JEJA 4C4ZA 3JQ9C 3FGNA 4EL5A 5HUHA 1L7DA 1HEYA 1XQVA 2CKDA 2QTVA 2PUHA 4G26A 3SC6A 1NMQA 1CEQA 2QLJA 1ZICA 1RLIA 2R87A 3DXZA 2NO1A 1ZU5A 1UDRA 2X5XA 2AN3A 2PS3A 4MVJE 2PXCA 3UKJA 5REQB 2CCJA 2QMOA 2RH8A 3PFFA 4BLOA 1DAEA 2DC1A 3LBNA 1Z0DA 4IQ4A 5K0FA 2Z6UA 4IF6A 4OU4A 2WFMA 2NU8B 4D8YA 3CVVA 1KOGA 2H1FA 2I2FA 1J2EA 3RKSA 3QEAZ 1KSJA 1K3FA 2H3EA 3DDNA 3G8DA 2GILA 5GZ1A 4CU2A 1D6SA 1HY3A 2DFDA 5A7GA 1HTWA 2P4QA 1PWZA 1T2EA 1MUUA 3KVVA 2FN8A 2LKDA 3DLAA 5JALA 1E64A 1EFCA 1OJLA 3HY4A 4C7XA 4GPIB 4M87A 2QN9A 3HY3A 1REQB 1KSFX 3JWGA 2H7VA 2W0MA 1R0KA 3HDQA 1SVUA 4X1OA 2NPFA 2OOSA 4G09A 4I55F 3L43A 2P9ZA 5A4AA 4I9FA 4KGDA 4LDQA 5T64A 1XZHA 2PMBA 4ZOLA 3T41A 4FHDA 3ZZMA 3BKXA 1Y3DE 2GOYA 4MS1B 1Z5NA 1Z0SA 1L6IA 4OSPA 5LBTA 1QM5A 2LUOA 3DVQX 4H60A 1I6LA 3RJMA 3CU5A 1GT6A 2VBFA 2E49A 3MOIA 5ALKA 3H4MA 1C0LA 2G7ZA 3H1AA 2N75A 3P0FA 1NKTA 3TTWA 4YIKA 4R05A 4EITA 1GPMA 3KYCA 4Y67A 4KPFC 3AM5A 1JKJB 4MVWA 1VHJA 2ZTLA 2KPOA 3V4RA 3LZCA 1DAPA 1P80A 4IHKA 4PG4A 3GO4A 1RJDA 5FI0B 3WAKA 2A1UB 4Q1CA 4RZ2A 4LXQA 3QVVA 2ZTMA 4LXHA 2GHRA 3T9CA 2YJ6A 3PD7A 4AJOA 2AC4A 1DO2A 4CXMA 1ZMXA 1R6XA 1KJ9A 2FWNA 2HF2A 4NABA 4P4SB 3QXXA 2LXNA 2Q8NA 3MGBA 4MWZA 1GU7A 1IMOA 1I0ZA 3RS9A 4EJSA 1WD7A 1QK5A 4CM1A 3L84A 2KLHA 5HRAA 4L8VA 1BRTA 1QLJA 2F43A 1MAUA 1USWA 3C5CA 1OHHD 4MK4A 3D59A 3ZHRA 721PA 4B31A 1XJ0A 3G2IA 1G55A 5ALYA 2EYQA 4HDMB 1GXSA 1N1EA 3V3KA 4C89A 2PAAA 1DQYA 1UKBA 1PJ8A 3UPUA 2P7HA 2OCDA 2X0DA 1GZ5A 2POCA 1RQGA 2XXBA 6CHYA 3U60B 3O4GA 1Z68A 4J7CA 1TU3A 3GJ8A 1WBJB 3KEOA 4L8GA 4OQEA 2FE4A 5C5DA 4OHKA 1TFUA 1IZ0A 1DLJA 3MLEA 3B89A 1PGOA 3MUFA 2J5KA 3KT8A 3NI2A 4D74A 1APBA 2PWPA 1TXGA 2OXEA 2WUGA 3RAEC 1CV2A 2X9QA 1R10A 2LE0A 3VSAA 2HT1A 4QDUA 5LU8A 1AUOA 4II3A 1GADO 4QL3A 1UKEA 2BW0A 2FA9A 3C43A 5EZ5A 1FYWA 2FPPB 3C85A 4MB6A 1F0YA 4DSOA 2Q8PA 4ZDIA 2WABA 1NX6A 5BRAA 3D8NA 5KSWB 3DO6A 3LA6A 3LX5A 1R5NA 4JBXA 5F2EA 3HNPA 3VM6A 3K9WA 1A95A 1E3TA 1PE0A 2ZSHA 3P97A 5FA6A 4AFNA 2OV6A 3M6AA 5ITZA 1XTPA 4BXOA 2IYWA 1WULS 5JWHA 4PGGA 3CZMA 3ZLUA 1JHQA 3DHWC 2WIBA 1M1NA 4IYJA 5TQ2A 2I33A 1F0KA 1PTJC 4E46A 3SC3A 1X80B 1PWEA 1V9CA 3AJDA 4FFVA 4QYIB 4ZU1X 4M36A 4DCVA 5B4TA 5FL7A 1PK9A 2FN3A 2PR2A 2RG1A 4UFNA 3TSAA 2OO5C 2GZ2A 4BO3A 1ECPA 1G5FA 5B55A 1BDJA 3RWBA 1FTGA 4G1MB 4JKYA 1M0WA 1A82A 3MBOA 5A9SA 5I9NA 1XA4A 3VU8A 4HNAA 2PKWA 3N75A 1DX4A 1JJIA 2X8WA 2GVNA 3N0WA 1QPZA 1HE4A 1JT9A 2N1BA 2VHVA 3R3JA 4ERNA 3A3PA 3TD6A 2HK6A 4OXYA 4AF8A 3PL5A 1F5SA 1ZQ1A 4IIJF 2JFXA 2FSVA 4D9GA 3ZHCA 1G66A 5CEEA 2FSFA 4ATNA 4IRUB 1SELA 3EEYA 3PIIA 4IEEA 4N5MA 4TTTS 4DBVO 1BX3A 2V7QA 4D3ZA 1O9GA 5LQSA 3ADPA 1PDOA 3VTAA 3IB6A 4WLEA 4MUNA 5FOTA 2J3EA 3CUUA 3P9ZA 3TEJA 1XDUA 4RFVA 3KQTA 1K6XA 5TR9A 1U6KA 3ND9A 5ARBA 1RKBA 2IX9A 1Z4OA 3GMTA 3ESAA 2IPLA 3CX4A 3IQGX 3E1KA 4DMCA 2XUHA 4MVJI 2JLCA 2VDMB 3DHVA 1OYVA 1EDBA 1TZBA 3CW2A 3G02A 3N87A 4HZIA 5LZ8A 3RHTA 4LNUB 4OMUA 2RGBA 3V2HA 2RKOA 1KY4A 3KJQA 5CAEB 1MV5A 2X4LA 3CURA 2WP8J 3GNSA 1Z06A 1YRHA 5IBQA 1UXGA 2FR8C 4I46A 4GVPA 4MIKA 2VXCA 4ODIA 3E3MA 4BYMA 2NSJA 1QVRA 1NDQA 2F62A 3S8YA 3RQIA 4EGFA 3U61B 3T7JA 1E79D 2C42A 1NBIA 1PWXA 2HRBA 1ZC4A 2RHHA 3A10A 3MBIA 3STTA 3I62A 1AZTA 4PG7A 4OGGA 5ECYA 4Q47A 5CB0A 2Y71A 3R5JA 1R27A 1GWNA 3PUYA 4CG2A 3L8HA 1SQ0A 3KNZA 4QYTA 4TS4A 3A36A 1YR2A 3DOHA 3QA9A 4XIIA 3Q7PA 1QS0B 1ORIA 5FI5A 1WPRA 1JQAA 3LT0A 4FD3A 2O2SA 4LMRA 1MU0A 1IWPB 2X4IA 2ZR8A 2A1TR 3NETA 4WT7A 3WNZA 2Z57A 5AKYA 4G8JA 3KFLA 1ULZA 2OHOA 4G4GA 3ZQUA 4GR9A 2PUTA 5IKMA 2FEPA 4FFBB 2XKBA 4QJBA 2J4FA 1YNSA 3G9ZA 4IIEA 2FSUA 2PGIA 1LD3A 1UKVY 4P22A 4UU1A 5K0LA 1EX7A 1VDZA 3AI3A 4AM8A 1JG1A 4A1OA 4RD2A 5HF9A 3KHKA 1CKEA 2Z5VA 4CM9A 2N46A 1RYYA 1T0PA 3VR0A 3OT5A 1JDBB 5FNVB 3V4PB 3UGQA 4AZ3A 1VL6A 2H5IA 2DFVA 4Z49A 1WDMA 3P0EA 4NYJQ 5C1OA 5IM4A 2AOTB 2BGJA 4MLZA 4CNQA 4MJ7A 4BVFA 1THZA 4I4NA 1UANA 2JA1A 5K05A 4MJ3A 1VLJA 1UPAA 4FT2A 4R8LA 4I55A 3HKEB 1MO2A 1R2QA 4X7BA 2WWYA 1E61A 1LVHA 4R83A 2Y0BA 4CKBB 1FFYA 1MVOA 1RYEA 2AZDA 3BEOA 4PINA 4RYDA 3QLJA 5CIYA 3EXIA 4DLVA 1F9AA 1R1DA 4V0NA 1GQQA 5EJFA 3TM4A 4R4JA 1QANA 4R1OA 1J39A 4L85A 2C4HA 4KTVE 2ETVA 2PLAA 3WQSB 3PLAE 1P4JA 1QKKA 4GSYA 1BMDA 2BCEA 1FSGA 1WL8A 2FZ5A 1T43A 2W00A 3FD8A 3OZWA 4AUKA 3SE0A 4LMBA 4OL9A 2Y2UA 2C4TA 2OCPA 2J6BA 4D0RA 4MUYA 1PFQA 3FGZA 1MJHA 1IN7A 4F3CA 2LIVA 2X9NA 1T3HA 4AICA 2XYHA 1NDHA 2P7IA 1R0LA 1EUCA 5BV7A 3VX3A 4UCXA 4X6XA 1YFKA 2PRZA 2WZBA 3CH5A 4D8XA 1Z22A 2WQ6A 3RYFB 5EKSA 1BWSA 3U80A 3R7AA 4DIEA 3DTVD 3FTEA 5LIPA 1NURA 2OY0A 4YTEA 1GPNA 3A1EA 4GWLA 4B6PA 2QE6A 4KB5A 3NEAA 3RJTA 1UDWA 1O96B 1ECBA 1Y4AE 3GCDA 3QUQA 1PEKE 2P2NA 4R1NA 4Y9TA 4NDNE 5BYJA 5TMPA 3U6KA 3FYTA 4RSGA 3IELA 2X2EA 1RP1A 4K3UA 1RQXA 2AE1A 2BFBB 2BZGA 4ENUA 5FTLA 1T13A 1QQ5A 4GUAA 3MGAA 3FYUA 3PQCA 4GI5A 4KQ9A 4Q01A 1PLJA 4RSHA 1A9ZA 2XW6A 3E9ZA 3SXUA 4BFCA 3IIIA 1J9ZA 2XBLA 5GV8A 4BL5A 5C8XA 3WLRA 3QFCA 5TPZD 3WK7A 4ER6A 3QVOA 4G36A 1QQ7A 3ND7A 1RNLA 2Q4RA 3IQXA 5FLKA 4D3XA 1M0EA 2G09A 2V7TA 4OKSA 3SOPA 3T3GA 3PSHA 4B6RA 4XTRA 3B82A 4CMBA 5H3CA 4GKAA 2AKYA 1U2QA 1YHNA 2PKXA 4Y9RA 4ARBA 1U99A 2IWRA 3UV3A 3EXFA 1Z6QA 2X0IA 3DDUA 3QV2A 2G70A 5EY5B 5ALQA 3QWBA 3F9CA 4RABA 2XEXA 5DDIP 3ZDQA 1MP0A 1UADA 2REXB 1OE0A 3HKBA 4O2BB 4BYGA 1SH7A 1YJQA 2NO0A 3GRUA 3IP8A 6Q21A 3C15C 2CW5A 4EMBA 1CZKA 2B2CA 2IXEA 3CV3A 2A0WA 1H3FA 5F5XA 2C3MA 4I50F 4ZO9A 5J1TB 3ZHQA 2QENA 4EB6A 1KBOA 1TF2A 3ISVA 1Q3TA 3PUWA 3S2YA 2D2VA 2FP4B 4FZ5A 1JFFB 3OJ0A 1N6RA 3B6KA 4J0GA 2CXXA 3FH0A 5FWXB 4NCBA 1P31A 5I45A 3EDRA 3DZBA 2WF6A 4Y1FA 3I4CA 1U0OC 2R8YA 3TRIA 1T9HA 3UWPA 2OTCA 3KJZA 1RABA 4MV7A 4K05A 3HMQA 4XFJA 3SXJA 4DV3B 3FE2A 2GA9A 1XX6A 2XGGA 1SXQA 1OXUA 3CX6A 2F59A 4MI1A 4YCLA 2QW8A 4KQKA 2CUKA 2D2FA 1WE2A 5K01A 5JCJD 1ACJA 1UPXA 2R9VA 1FW8A 2JGIA 4IY1A 1JVSA 1QP8A 5E9QA 1UXIA 1LDBA 2AYXA 2CLHB 1W1IA 2HLHA 2OVBA 4K9LA 4V2IA 2VHEA 3UW1A 3QXSA 1AKEA 3A32A 1CUGA 2VAXA 4Q05A 4C6TB 2BEVA 3RUAA 2HIMA 4LDNA 1JAYA 2IPXA 3RIHA 5B6JA 2WM2A 3IDZA 3NC4A 2QP4A 5CT9A 2F3SA 4Q1BA 1BCSB 1QOZA 1TW3A 4YK7A 4YECA 3TOVA 5IZ4A 4KLCA 3AF2A 1CYEA 2CMHA 1ISJA 4DDMA 2GJAA 5IZCA 1ULUA 2ZYRA 4O4IA 3VNVA 3TLMA 4CJXA 3WX0A 4XWGA 1P0PA 2DUWA 3ONWA 1GQRA 5EXTA 4CKEB 4PPNA 3GLGE 1ZX1A 3VYVA 1XTKA 4GZ3A 1KAHA 2HCRA 5T57A 4H7DA 4DABA 1FRVA 1ORRA 4G25A 5CYPA 3KUXA 5BURA 3JQBA 3N0VA 3LPDA 6NULA 3CVYA 5BR7A 3T5CA 5JZSA 1H66A 1UBJS 2O23A 4Q4CA 5AVWA 1YZFA 4YJHB 2DRIA 4C3ZA 3KOMA 1Z74A 2VRWA 2VSFA 5BN4B 2WI8A 4J0CA 3OPYI 3R9XB 1YMUA 3BAZA 1NQAO 5CLJA 2ZT8A 2F1HA 1S8OA 2CT8A 2GKOA 4YRBA 1O08A 2I55A 1WKBA 4QBIA 5ESWA 4MW4A 4IRXA 5FT9A 5FO1A 1TEHA 4ZYLA 4JZYA 5KVAA 5P21A 4PQYA 2VK4A 5EZYA 3X1JA 2A1IA 5KWVA 1OWNA 1N6PA 1WHTB 3C8DA 3K1ZA 4X3OA 3RT1A 5K8JB 4HLCA 2I6SA 3SVLA 2DQZA 3QTLA 3O8BA 4YDHB 1Y4DE 3WI7A 4ZP1A 3K6JA 2DWPA 3E9YA 3NATA 4R1PA 3QU2A 2PEYA 2IHTA 2OE2A 3E15A 4O0MA 4IF4A 1O6BA 4MP3A 4IZOA 3RSFA 4BU0A 3WG9A 2FW8A 1EX9A 1H2YA 1X3LA 5B1EA 3FTPA 2W93A 3KTAB 1ZVVA 3KPJA 5DKFA 5JQGB 3GRRA 2ZIGA 2VJOA 5I4KA 3KYBA 1UT6A 3QVSA 1SVIA 2H1CA 3Q5GA 2PYZA 3CUEF 4YAOA 3R76A 2X0NA 1BS1A 4MQBA 4WCVA 2WVJA 4RK7A 3U3ZA 1G5TA 4XX0A 1I94B 1PJ3A 3K7EA 1AKMA 1E1NA 1WZEA 2NU7B 2R1ZA 2F3RA 3FPSA 1X7ZA 3HA7A 5I4CA 4NBTA 4UEQA 1EK5A 3NO4A 3OAAA 4RZSA 4