2HMSA

Rectangular-shaped octameric ring structure of an rck domain with nadh bound
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
138
structure length
138
Chain Sequence
KQFAVIGLGRFGGSIVKELHRMGHEVLAVDINEEKVNAYASYATHAVIANATEENELLSLGIRNFEYVIVAIGANIQASTLTTLLLKELDIPNIWVKAQNYYHHKVLEKIGADRIIHPEKDMGVKIAQSLSDENVLNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The RCK Domain of the KtrAB K(+) Transporter: Multiple Conformations of an Octameric Ring.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Membrane protein
molecule keywords YuaA protein
total genus 44
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02254 TrkA_N TrkA-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2hmsA00
5MDHA 3H9UA 2ZCVA 3KYDA 1X7DA 1MV8A 4ESOA 3RUIA 2OBYA 1PZGA 3FCOA 4BQPA 4XJTA 2JAHA 2VTEA 3OJOA 1NHWA 4MIOA 2O3JA 1E7QA 4I5DA 4NFYA 2VHXA 1A9ZA 5JBIA 5IZCC 1J4AA 4TRMA 4TQGA 4OSPA 2EGHA 5A9RA 3AU9A 3CZRA 3GAFA 4GSLA 2AE2A 2NSDA 1B8UA 3O38A 3ZWVA 2YUTA 2PH5A 3H9GA 1C0PA 1O5IA 4Q9NA 2VOJA 1UAGA 3BHJA 2QW8A 3D4NA 4RVHA 2PWZA 3OM9A 4Y6PA 4UUPA 4YJHA 1BWSA 4YT5A 3UKOA 4EJ0A 1JKJA 4PGFA 4R9SA 3IC5A 5DOVA 4BO1A 1SC6A 4EUFA 3G49A 3AUTA 3PFFA 4R41A 3HFSA 3HQ4O 1AXGA 1UUFA 2OP1A 2Y1DA 3FBTA 1E6WA 2WSBA 3H3FA 4HX5A 7MDHA 1YJQA 4BO8A 3WWYA 5FFFA 4M8SA 1BXKA 3CPSA 1EZ4A 4Y98A 5CDTA 4XR4A 3GF4A 5A05A 4I9NA 2GN6A 2X6TA 2DT5A 2X0JA 4E32A 4Y8VA 2GDZA 1FK8A 4A26A 3H2SA 1EDZA 5T5QA 4B8WA 3M2PA 3JQFA 4YR9A 1DSSG 2GPTA 3CIFA 3V2HA 3I1JA 4N5LA 4OMUA 4WKGA 4R01A 1U4SA 2ZJ1A 1NM5A 3ZNNA 5L53A 4W99A 1TXGA 3N58A 4WK6A 3NX4A 1GV0A 2X4GA 4ALMA 4PG7A 4XGNA 3DBLB 3U5TA 2ZKLA 3WTCA 2WDZA 4FN4A 1QYWA 3ITDA 3KEOA 1LSSA 2FHSA 3BA1A 3U3XA 1TB4A 1GPDG 3GZNA 4XB2A 1TT7A 5A3JA 1I10A 2B4RO 2B5WA 1I2BA 1XG5A 3NTQA 4OOFA 4IDBA 4NBRA 1P33A 2VYND 1W6UA 3WGZA 5AQ1A 5IZ4A 4XYBA 3ZZNA 2X5KO 1UDBA 1NBOA 1VC2A 3DFUA 4CMKA 4CLDA 4E5PA 4MKXA 4CMCA 2B5VA 2FZEA 2FR8A 3WS7A 3RUAA 4PLCA 3U49A 4UULA 1C1DB 1U8XX 4H7PA 1LA2A 4RVDA 1E3LA 3GG9A 4DTIA 2PV7A 5L4SA 1CF2O 3Q2IA 1SCUA 1LLQA 2WWRA 3QVTA 4GX0A 4FC6A 3ZNOA 3KHUA 5DCWA 3KEQA 4TRRA 1TEHA 4HNGA 3QHAA 4WOJA 5KVQA 1KBZA 2ZB3A 2O50A 4GX2A 1LLDA 1WDMA 1EQ2A 2C5EA 3FNEA 4PLVA 2ZYDA 4RDHA 2RIRA 3UGKA 2HMWA 3HSKA 5EIOA 4W4TA 1ADBA 1E3EA 1N7HA 3B6ZA 4AFNA 3AI3A 4OXNA 4NPCA 3L4BC 5L45A 3QA9A 4Y67A 3MJEA 1W73A 3DAGA 1IPFA 5F21A 5A9TA 1AHHA 3RD5A 3UAGA 3BMNA 1Z74A 5JCJD 3G17A 4RV9A 2QRKA 1ENYA 1VL8A 4FSHA 2IEDA 3SVTA 1JKFA 1NR1A 2GSDA 3IJPA 2EERA 4J1QA 4UVIA 4PRLA 5EPOA 5B4VA 1P1KA 2RH4A 4MVJP 4ZQBA 4PLHA 4R16A 3WXBA 5T8KA 1ARZA 2LDXA 1WDKA 3DFZA 4IXWA 4PLFA 2C20A 2YFHA 3EMKA 1LC0A 2C5AA 3ZWAA 2CF6A 4H15A 4QT0A 3HE3A 1D1TA 4U8GA 2A92A 3SBOA 1TI7A 2QYSA 4YA6A 4YT8A 4EYEA 2VUSA 2EEZA 2DFVA 2NWQA 4WEQA 5JDIA 2W2LA 4ALJA 5JS6A 1A9YA 2R00A 2X0NA 3B1FA 3S1LA 2FPPA 5IAAA 4CM8A 1P44A 2XAAA 4R1NA 5F5LA 2YDYA 4WLVA 3OQ6A 4I5GA 1ZK2A 4ZQEA 3ASVA 3KOUA 5BSHA 1LI4A 2H63A 4BB5A 2Y68A 5KKAA 1MGOA 3T7CA 4W9NC 1PWXA 4GGOA 4CMEA 5U9CA 3OA0A 1BSVA 2I3AA 5I9LA 3ROQA 3AOEA 4CV1A 5AXBA 3VH4A 4MIEA 3WFJA 2QZ9A 4DLLA 1I36A 2CY0A 1T24A 2OP0A 5C3MA 3E48A 2UAGA 1YL7A 3JYQA 3KB6A 5JCXA 1Q1NA 4RCVA 2X9GA 4ND3A 3MJVA 3K31A 4GAEA 5DP2A 1ZIDA 2H5LA 1VRWA 2A4KA 4OJNA 4RPHA 3RBXA 3ZV5A 2VZ8A 1YBAA 1HEUA 2PKQO 1PL8A 3FSRA 2BGMA 1JA9A 3WGHA 3WB9A 3I5MA 4BUCA 1QSGA 1HDRA 1DC3A 3GY0A 3KZVA 3U4DA 2NVWA 2X9NA 3JD2A 3LF2A 1L7EA 3A4VA 3DTYA 4ZVVA 2QZZA 1XU9A 3I9LA 2DUUA 3MTGA 1F8FA 5EMHA 1YXMA 3I3OA 2EKPA 1DB3A 1AHIA 4TZTA 5G0TA 1H6DA 4XRGA 3RUCA 1XU7A 3VKVA 3JQBC 4PRKA 4ZGWA 3E18A 3GDFA 1TT5A 3ONEA 1HDZA 4LCJA 4UVHA 5IG2A 4DRYA 2A94A 4Z3KA 4CLHA 2ILTA 2CSUA 3RVDA 2FN7A 1KC1A 3AOEC 2W2KB 3BIOA 4L9RA 1N8KA 1K6JA 7ADHA 1B3RA 3WJAA 5CDSA 4BO7A 1E1NA 3H7AA 3PQEA 4QQRA 4J7UA 3Q9NA 3B70A 3MWDB 4NJMB 3JQEA 2VRCD 3ZU3A 4IMPA 4XR9A 3DTTA 3JQAB 1T2AA 2JD0A 4WOKA 2A9FA 4N5NA 1F12A 3LK7A 1LDYA 5C37A 1I3MA 1Y8RA 4BKQA 2BI7A 1GEGA 2FOIA 3CMMA 1NVMB 2PGLA 3OECA 1YQDA 4R1SA 1A7KA 2IYOA 2VOEA 3Q2KA 1H0KA 2V6FA 1QKIA 4Q3DA 2OXIA 4EUEA 4B3IA 1GCOA 3DONA 2V6BA 2NVBA 2AG8A 4PZEA 2ZB7A 2Q99A 2JCXA 2JJYA 4BV9A 1LX6A 3CEAA 2CVQA 3K2EA 2YV2A 4XYGA 1VKOA 3JQ8A 1LDGA 5LDGA 5TS3A 1B2LA 2X9VA 1EK5A 1ISGA 2DU8A 4CM7A 3RUFA 4M55A 4E2WA 1P0FA 3NDRA 3VZSA 3PYLA 3HDQA 1Q0HA 1ZSVA 1WWKA 1BHSA 1E7MA 2RHRA 3DMYA 4I9UA 1UXKA 1N9GA 4LW8A 4UEKA 3TL3A 4BNJA 4CLOA 2F1KA 4L73A 4Y6SA 3FTNA 1XEAA 4J1SA 5TJ9A 3RASA 3ZWOA 2YZ7A 3CXRA 5TF4A 5JW6A 4ZRNA 1OC2A 3FPLA 4XQGA 3WLEA 4WCFA 3RIHA 1LUAA 2J5QA 4CM3A 1HE5A 4CMEC 1YWGO 1AE1A 3QJ5A 1JN0A 1LQTA 2DLDA 2NACA 3F9IA 3SEFA 1Y81A 4QO8A 4PG5A 4PLPA 1YO6A 4K6FA 4XYLA 2QRJA 4B4OA 4JN6B 4R69A 5KTKA 5TJHA 2PD3A 4J91A 3S8MA 2QYTA 5K6AA 3F1LA 3F6YA 4D3SA 3VKUA 1Q7CA 3VPHA 4CM9D 4W7HA 1U7TA 4QTZA 1R12A 3LT2A 3GGGA 1DJQA 4YYZA 5I7VA 1X7HA 2Q1SA 3OEYA 1NPTO 4O0LA 4FW8A 4XGKA 2B37A 4E33A 1ADCA 3GUYA 4HBGA 3JQAD 3VPFA 5CDUA 4I9HA 3WGIA 1PSDA 4RVSA 2Q2QA 3Q11A 3WGGA 1HL3A 2Q46A 1H2BA 3NDIA 2O48X 3MJCA 1HZZA 2X1HA 1L1FA 3EZYA 3ZW9A 5JSFA 1E1LA 2B4QA 3HB5X 5CDYA 1PL7A 1V8BA 3FN4A 4BNMA 5KNLA 2O3QA 3PLNA 4NJMA 4O5OA 5HS6A 1T25A 3JQAA 5KJ1A 3TOZA 2W2LD 3PZRA 4L0QA 4TROA 1EK6A 3UN1A 2FR1A 4XD2A 1KEVA 4OL9A 4LSMA 1ZSNA 5BNIA 3VVBA 1IZ0A 3QRWA 3NYWA 1GY8A 3WNQA 3H6KA 3GG2A 5DF1A 1ZH8A 4NHEA 1PJ2A 4CM9A 4JXKA 3L6EA 1I3NA 1NX6A 4BNZA 4DGSA 1E3WA 5ITWA 4JJFA 4AJ2A 4XZ3A 1LC3A 4UEJA 1TT5B 2GZ1A 1NAIA 5KJCA 4OHUA 1XKQA 3GEGA 3JSAA 3M6IA 1GQQA 1ONPA 3U4HA 3FNHA 4OYRA 4NU5A 4E31A 2EKQA 4DQUA 2FZWA 5A5FA 3PHJA 8ADHA 3LVFO 1PQUA 1FDTA 2P9GA 2VYVA 3E6AA 3GH3A 3L6DA 5C7LO 4AJLA 1YOVB 3D7LA 1P9LA 3CH6A 4IJUA 4D43A 2XOXA 4F3YA 1JU9A 3JQ7A 3AUSA 4CLXA 3OICA 1XWFA 3ZWYA 1SMKA 3H3JA 3LT0A 4K9DA 3GFGA 4RPJA 1B14A 3DOOA 1DRUA 4J7XA 2CD9A 1J49A 3DBLA 3GEDA 4M1QA 3JQ9C 2Y0EA 4U0JA 2ZYAA 3N7UA 3ZHXA 3IDSA 1PJBA 1UDCA 4KTVE 3ETEA 2AMFA 1NVTA 1W0CA 2G0TA 1PGNA 2EP7A 1PGQA 1V6AA 1F0YA 2CUKA 2VHYA 3LSYA 4R4JA 4FDAA 5KVCA 3OJFA 2DPHA 3ADPA 3W4IA 5KCZA 4MOWA 1JAYA 2NU8A 3RKRA 1U3WA 5JDIC 3DZGA 2PD6A 1KVQA 4KOAA 3DZJA 4B7UA 4CQMA 4CV0A 3VPGA 1UJMA 4C4OA 5I8ZA 4WJZA 4GLOA 4Z0PA 1F06A 1HLDA 1YB1A 3PZBA 4ND1A 6ADHA 1EFKA 3KSDO 4BNLA 4GX1A 2PK3A 5C5IA 3DBRA 4IXTA 5CPFA 1GUFA 1PU2A 5H83A 3GEMA 4I8XA 2GR9A 1QLJA 1XYGA 3H5NA 1HE2A 2O2SA 3HNPA 4W9NA 1GZ3A 4Z9FA 5G4KB 2Y0DA 4DPMA 5TIIA 3P19A 4DWVA 3ABIA 3K9QO 4QSMA 4D44A 1ZJYA 4NI5A 2HO5A 2OL4A 2QRLA 1NR7A 4NBWA 4ND5A 4R3WA 1GQ2A 1WZEA 1EUZA 1GYQA 3DBHB 1B0AA 3R3JA 3GVCA 3KSZO 5BSEA 2TMGA 5HS4A 5KOIA 4Y9DA 4HY3A 4PLGA 1ZK0A 2J6IA 4DQXA 2X86A 3ON5A 4R9RA 3NGXA 5ICSA 5L7WA 3PJDA 2VHWA 4BKUA 3PYMA 2CNBA 2ZTVA 1H93A 1CYDA 4AJ1A 1HTBA 3AI2A 3EHEA 1A5ZA 3KYBA 4U7WA 5KJEA 3KM0A 1X15A 3EY4A 4JBIA 4DREA 5KJFA 5A06A 2Q2VA 2W4QA 4JJIA 4R54A 3DB2A 3WYCA 1LDBA 3PIDA 1PEDA 5I9MA 1DPGA 2NQ8A 3GNTA 1N1GA 5L4LA 2IYPA 5T64A 2DFDA 2QQ5A 4H3VA 5TRTA 4DYVA 1I3LA 1A7AA 3JYOA 3OBBA 3FI9A 5JFOA 3LF1A 4P4LA 4RVFA 5C7IO 1N2SA 2D4AA 1HZJA 2QIOA 3GRKA 2ZB4A 3PHHA 1SO8A 3U4IA 1A27A 3WSVA 4JX8A 2ZQZA 4W82A 3U0BA 2AEMA 1M75A 1UAYA 4NBVA 4URFA 1E3JA 4B79A 4CMAA 3M2TA 4EJ6A 4TMFA 5CPBA 3F5QA 3IIEA 4NFSA 5THKA 4ZN6A 2CF5A 3QP9A 4GMGA 1VSVA 3N74A 3TPCA 2V65A 3L4BA 3B1JA 4BNGA 2GN8A 2P2SA 5BR7A 3JYLA 2UVDA 2D5AA 4UVDA 1GZ4A 1Y8RB 2WYUA 3JQBA 1W8DA 1X14A 3UICA 1IOLA 3IUSA 5AXAA 3RWBA 3C1AA 3H9JA 1NFQA 4WLUA 1Y6JA 1KERA 3E9NA 4L8VA 1BG6A 1P45A 1LDMA 1EVIA 1RM3A 2IZ1A 4RF4A 1XELA 4MIYA 3ZU2A 4I1IA 1PS9A 1YS4A 4G81A 1DRWA 3MTJA 1N7GA 4AICA 1MXHA 5K9ZA 3O8QB 3WGTA 3QE3A 3D0OA 2PZMA 3I4FA 4TSKA 4O63O 1DFHA 3RBZA 2VUUA 4LRTB 4BO6A 4ALNA 4A73A 5L4NA 1DC5A 3ICPA 4CL3A 3P7MA 2P4HX 4GH5A 2YV3A 3D3WB 1VJ1A 1HDCA 5ILGA 2Q1TA 1NFRA 1E3IA 3W6UA 2VWPA 4XDYA 3GPDG 1ZXBA 4DIFA 4RLHA 1IE3A 3VDQA 4IQ0A 4OXYA 4NK4A 1EE9A 1Z7EA 4KQWA 4RGBA 3V8BA 2O4UX 3KV3O 2EJWA 3JTMA 5KVSA 1B3BA 2HRZA 3KTDA 3LT4A 2DBZA 4WECA 5I7SA 4C7JA 4LRSB 3ASUA 3OQBA 3PDJA 1E1KA 4EGFA 2DBVO 2VYNA 1KVRA 3GRPA 1P1IA 3FR8A 4MKRA 4XQCA 3JQGA 4D46A 4GL4A 3BMCB 2AHRA 4YJDA 1O8CA 4LMPA 8LDHA 4KMSA 2V6GA 4MP6A 3JYNA 5EINA 1NPDA 5AYVA 3U62A 4A7PA 5ILOA 2WM3A 2JFFA 5ER6A 1A4UA 3AW9A 4ZD6A 1HT0A 5DULA 3PFWO 2UV8A 4UEOA 2BHLA 3ZN2A 3GDOA 3KYCB 2UYYA 1QG6A 2AQHA 1ZVMA 3FNGA 1MXFA 2I76A 4IS2A 3UW3A 4DBVO 4EZBA 3PGXA 2Y1GA 4ROSA 3F47A 1HKUA 2J3KA 3X2FA 2Z1MA 2GASA 1T2FA 5IN4A 1X7GA 1LRKA 3RQSA 1YBMA 3JD1A 4F6LA 2E49A 4B7XA 1G0NA 5IDXA 3STHA 2ZATA 1LSOA 3WOHA 3ZWCA 1D1SA 1ZMOA 4BKOA 3OA2A 2OO5A 4B7CA 2EW2A 5JLAA 3HG7A 3VAZA 1UXIA 3NGLA 3DHEA 4RO0A 1BTOA 5A3VA 5JMPA 3WFIA 3JQ6A 1X13A 4BO2A 4E30A 1QYDA 4GWKA 5ES3A 1I3KA 3CE6A 3FWNA 1U28A 3TZQA 3BHMA 5A4DA 3AU8A 4ILKA 1YQGA 4PLWA 1VPDA 1Y9AA 1KYQA 5JO0A 4OXKA 4YRAA 4BNIA 4II2A 3WNVA 1NYTA 4DYDA 1GUZA 3VTFA 1P3DA 4BNYA 2AQIA 4ZJUA 4BMVA 5IF3A 4DPLA 2GF2A 3QVOA 4BNWA 4RZHA 4R5MA 1O94A 4AG3A 3C8MA 1KY4A 2IZ0A 3MOIA 3BTVA 2DVMA 1J6UA 1YBVA 5HA5A 3WQRA 3ZHZA 1C0IA 1VE9A 2I9PA 1Q7BA 1ZBQA 1UP4A 2EG9A 3ZV3A 4EDFA 3RFXA 2DTEA 1ENZA 3HFGA 2NLOA 3OQ1A 1GCUA 5T67A 2V6MA 1HLPA 3NAQA 3D3EA 3KYCA 3T4XA 3WMWA 5BQFA 3EDMA 3ONFA 4WEOA 1U9JA 1U5AA 4RF3A 2HK9A 4B4VA 4A2CA 3I23A 5AXCA 3HDYA 2GD1O 1K6XA 3PTZA 4NK5A 4MVJA 3TN7A 1DOHA 4HFMA 2XF8A 5L9AA 4MVJE 1PGOA 1VL0A 5TT1A 2TMDA 5JY6A 3OMLA 3W4KA 2Q50A 3WYEA 4L74A 1IZ9A 4N7RA 1JVBA 4X54A 2GYYA 4YJFA 3WSWA 2WYVA 2J3JA 2NQTA 4K28A 5KJ6A 1R16A 4XDZA 3RU9A 5CAEA 3UF0A 4RF5A 3GDGA 1GADO 3GVHA 4P22A 1BDBA 2YY7A 2NNLD 4IDGA 3UCEA 5JO9A 3SXPA 3VPXA 1IHYA 2P91A 1DC6A 1E3WB 3I52A 1EUDA 2Y1OA 1PR9A 3QVWA 1MA0A 1DIHA 2IE0A 4CQLA 2X5OA 3EK2A 4M89A 4U0KA 4YDRA 3NKLA 4CQLB 4A03A 4J2OA 4NQZA 2NTVA 3DOCA 1ZUD1 3GZNB 3GOHA 5AXDA 4ZU3A 1X1TA 5EL0A 4GBJA 2VRBA 4JP2A 1YGYA 2EP5A 5L3ZA 4BB6A 2QX7A 3LC1O 3W1VA 2Y1FA 3HJAA 1G1AA 1AXEA 4ONEA 1ONOA 2AQKA 3QWFA 2Y1CA 4M87A 3PPIA 4PLZA 2X58A 1HYEA 3RFTA 1LDEA 3GFBA 1E0DA 3NDJA 1FDUA 3VVCA 1TLTA 1HE4A 5LCXA 5A5EA 5IDWA 3LDHA 2H1SA 4EBFA 2IXBA 4DLBA 3JQFC 3BXXA 5TC4A 3AY6A 1HSZA 1SOWA 1CRWG 4XA8A 3KVOA 4WE3A 3X2EA 3QQPA 2FPIA 4D42A 1HDGO 4H16A 4GGPA 2B83A 3D4OA 4GMFA 1P1HA 4M49A 4J1NA 5ER9A 5COAA 3L07A 3Q9UA 3IP1A 3ZNPA 5FI3A 1H6BA 1X0VA 1XSEA 2UUOA 3R6DA 4BOYA 2EIHA 3GC6A 1H9AA 4BNXA 1QYVA 1IUKA 3EVTA 2D8AA 1Z73A 2UDPA 1YDEA 3S2GA 5GZ6A 1Y5RA 4OKIA 4QFCA 4YEDA 3E8XA 3GHYA 4TWRA 3BTSA 1ORRA 2O3TA 3IS3A 5CP8A 3RKUA 1I2CA 3QWBA 1KETA 2YHIA 5F5NA 2D5CA 1Y1PA 1PL6A 3KLMX 4CM8B 5ENDA 1YRLA 1GFSA 1EBFA 4CLRB 3DR3A 2Q49A 4N18A 4E4YA 2D1YA 2JFHA 1AUPA 1K2WA 1FDSA 3ANMA 1NHGA 4PG4A 5IN5A 4B4UA 1JAXA 1QXSA 4DLAA 5JYDA 3E82A 1B8PA 1XIVA 3DMTC 3DOJA 2Z1NA 4KQXA 1NQ5A 1T1RA 4CL8A 3K96A 4MINA 3OIDA 2NU7A 1R4NA 1JDJA 2HMVA 3PHGA 3QIVA 2WE7A 4MO2A 1WP4A 1VLLA 4J9UE 4PN3A 4RJTA 9LDTA 3ANLA 4Z3DA 3CTMA 1C1DA 3O03A 1PS0A 4FJ1A 1WMBA 4YAKA 2GUGA 6LDHA 2H9IA 1VSUA 1P1RA 4ALIA 2LDBA 3BMOB 2DM6A 4PVDA 2PGJA 5JMWA 3ZWWA 3P5SA 1BVRA 4WNCA 1CJCA 1U3TA 1NQTA 1PJLA 1NASA 5J23A 3GR6A 1V3TA 3AFNA 3V2GA 4DC0A 1ZK3A 4GPD1 4NNJA 2GRAA 5ENVA 3Q0EA 5FWNA 4GI2A 1LJ8A 1KY5A 1QYCA 3WQSB 3AUAA 1D3AA 1EUCA 5ICMA 4J1TA 2C0CA 4P8RA 3UCFA 3GHHA 2PGDA 3QSGA 1ISHA 5BNTA 3LQFA 2B69A 4FFOA 2EKLA 2WD7A 4WASA 4D7AA 1DIAA 2AEJA 4WPGA 2X5JO 3IAHA 3K30A 3BYZA 4A0SA 3AWDA 4CMHA 4BGIA 1BW9A 3PHLA 4DXHA 3ROMA 2AE1A 1ZEMA 5KVVA 3HUDA 1RM4A 1SPXA 3FRJA 3ZHBA 4A10A 3ZV4A 1IPEA 3I6IA 3CZMA 1Y8QB 1D7OA 3WDSA 2AEFA 4BGVA 4TVBA 2PTGA 1VJTA 3OHSX 4WCFB 1XCBA 3DZIA 3GGPA 3UXYA 1M6HA 3GQVA 3OETA 4FJ0A 1M67A 1PZEA 5TLSA 1R4MB 1IB6A 5DBFA 1BDMA 2W2KA 1Y9EA 2BRUA 5DCYA 1PGJA 4LCEA 2GGSA 4YTEA 4G2NA 3UOGA 4BNNA 3JCZA 1NWCA 3H9QA 4IGFA 5JXWA 4YQZA 1R15A 3AK4A 3OEWA 1FMCA 4B4WA 3RSHA 1CWUA 2VWGA 4F6CA 2X22A 5TGDA 4FFLA 2ZTMA 5JYEA 4D0RA 4U6QA 4E13A 4C7KA 1BGVA 2EXXA 1ZZEA 4HNHA 5JC1A 1BRMA 1DFGA 1A72A 1WNTA 4IZIA 3K92A 4ZQHA 2X0RA 1NQOA 1ENOA 3PYXA 4UVGA 1IULA 5JY1A 1OI7A 3E1KA 4ID9A 3ZH2A 3IUPA 1KVUA 3TZ6A 2NU6A 1IHXA 1V35A 1O95A 1K5HA 1G0OA 2ZTLA 4JIGA 1UR5A 3ONDA 5TX7A 3GMDA 4AJ4A 5F1OA 2FPGA 2GNAA 1XLTA 4BKPA 1Y5MA 3VH3A 4YQYA 1SEVA 4YRDA 3R0IA 2HCTA 4GVXA 1JTVA 2CDAA 4J3FA 2ZK7A 2ZTUA 3ADOA 3KETA 3TFOA 2OUIA 4J16A 5G2OA 4LVUA 4MVJF 1T1SA 1Q7GA 1U2GA 1MLDA 2FRDA 2YQ5A 2B35A 2BGKA 2HDHA 3HB4X 4NH4A 1PWZA 3KBOA 5FF9A 4AJHA 3TZKA 3WBFA 1P1JA 4OM8A 4RF2A 4RPGA 4WNIA 4WUVA 3WGYA 3KRTA 2WYWA 4CM1A 4QUKA 1C1XA 2GZ2A 1ULUA 1XQ1A 2DBRA 2ET6A 4FGWA 5DP1A 4CMBA 4E0BA 1NNUA 2W8ZA 3QWAA 1DXYA 4NIMA 3O8QA 4JBHA 1OFGA 5KIAA 2CVOA 1N1EA 2O4CA 4KUHA 3ZW8A 2VUTA 4ZQFA 4YT4A 4CUZA 4LSWA 4OOEA 5BSFA 2VHZA 5DOZA 5HBRA 2VQ3A 5LC1A 3PDUA 1GQYA 3WBBA 2WTBA 3JQGB 2Q1WA 4BV8A 4U6SA 4EI2A 1K89A 3OFSA 1SOVA 2JHFA 4R1TA 4XB1A 4OQYA 1R6DA 4JQCA 1BMDA 5EERA 4PZDA 1WAMA 1XGKA 5GY7A 4BMSA 4BVAA 5JDCC 3BMOA 1XHLA 4E2XA 2JFGA 1U4OA 3GPIA 2Z5LA 5CG1A 2G1UA 2WMDA 2RHCA 1LNQA 5GMOA 3AOGA 3OIFA 5H82A 2JAPA 3VDRA 1DIBA 2AG5A 3GVXA 3NTOA 1PJ3A 5BNFA 1WXDA 3INGA 4WGGA 1WLYA 1R4NB 2DBQA 2DTDA 2Y1EA 1H2HA 1HSOA 2EW8A 3AJRA 3BTUA 3IP3A 4FOSA 5G0UA 1N92A 2BELA 3RU7A 4EJMA 1PS8A 2A35A 1DLJA 3GVPA 3B1KA 3COSA 4L4XA 3V5NA 4PG8A 5L7TA 1ISIA 4WLFA 1UZLA 4R3NA 4PIVA 4D45A 2BFOA 2OHXA 3W8FA 1MFZA 1C0LA 1JWAB 2NTJA 3Q3CA 4LGVA 5EN4A 2VRCA 4P4GA 4OGWA 3EC7A 1J5PA 4IMRA 4Q3NA 4IUYA 1LU9A 1BXZA 4LN1A 1LLUA 4YRBA 1UXGA 3JD4A 2VT2A 5HWSA 3FF4A 3AI1A 1RPNA 4B8ZA 1TA4A 4KDEA 2DQ4A 4IJWA 4CM5A 2NVUB 3F1KA 3TRIA 5CDGA 5CFZA 4KUGA 1YKFA 3H8VA 4UREA 2VT3A 4JCOA 3ZU4A 1YB5A 4JLWA 1DBVO 3PWZA 1ZW1A 3O4RA 2I99A 1ISMA 4J90A 4CPDA 3BHIA 2RH8A 1DAOA 1VL6A 1ENPA 1PIWA 2VZ9A 3ITKA 3QY9A 3U4CA 1GYPA 1BW9B 4TZKA 3PI7A 2P4QA 5JPIA 3FBGA 4FFPA 4MDHA 1GZ6A 1M6WA 5JE8A 4BO9A 3MOGA 5ITVA 1D8AA 3UUWA 5DCUA 3K5PA 3KLPX 4IPTA 1R0KA 3FTPA 3BMCA 4HFNA 4YWJA 2I3GA 5BT9A 2Y99A 1GUYA 4PLYA 1E7YA 3DZFA 1R0SA 4IDEA 3WQQA 1ADFA 1QLHA 4BQRA 2GN4A 2JHGA 4IZHA 5A1TA 1O0SA 1GR0A 4MP3A 4BS9A 1RWBA 2EWMA 1P0CA 4TVOA 1E3SA 4D79A 1J0XO 2PZJA 5L51A 1LRJA 4IDAA 2FMUA 2HMSA 5DDIP 5G0VA 4HKTA 1T2CA 4DUPA 1EFLA 1QR6A 1U5CA 3C3XA 1LXCA 2DPGA 4FIZA 1U1IA 4PG6A 1IYZA 4Q3CA 4J6FA 4QFDA 1I24A 4J4BA 3ENNA 2JCYA 3D3WA 3DHNA 1CEQA 1Z75A 3K6JA 4XRRA 3F46A 4O6VA 1KEUA 4BGUA 2PNFA 4I5EA 4ZICA 5COBA 3T7EA 4Q39A 2IEBA 1UXHA 4BNKA 2WD8A 2HMTA 3NV9A 2VTDA 1PGPA 3VC7A 3QV1A 2J5KA 3FPCA 3C1OA 3WICA 4BKRA 2WEKA 4PVCA 3CUKA 4YCAA 4Z6KA 5AVOA 3JQ8B 1D4FA 1RM0A 1RJWA 4IIUA 2E82A 5LDHA 3U09A 1QYXA 4N5MA 1MUUA 3RJ9A 1LSJA 1X0XA 1WZIA 3DEYX 4CMIB 3IL2A 3C7DB 3WWZA 5A04A 2O7SA 5U4QA 3D1LA 1YE3A 4S3MA 3DBHA 5T6BA 3C1TA 2YHUA 2HU2A 2D3TA 4KDFA 3NRCA 4L75A 4EEZA 3TJRA 1V3VA 4QO7A 1PJSA 3GN1A 4CM4B 1RYDA 2DTXA 4M86A 3H65A 2QG4A 4Y6RA 2B0JA 4YPOA 3EAGA 5IXYA 3GZ4A 1RYEA 5F1KA 4DIBA 3ETGA 2PD4A 1UH5A 4E5NA 2IODA 1GD1O 4UUOA 5EJ2A 3WJ7A 3RC1A 3GNSA 4Z0TA 2C7VA 3LU1A 1SBYA 4HXYA 3A06A 1MG5A 3RUHA 2H6EA 5F3RA 3NT4A 3CKYA 4RQTA 4XIJA 3A9WA 3VPSA 1Q2XA 4NR0A 2G76A 4OIMA 3ZWPA 2X23A 3VZRA 3QVXA 5H81A 2I5PO 2CMDA 2Y05A 4DMMA 4PFJA 3JQ7B 1EEHA 1GPJA 2VN8A 4KWIA 4NU6A 4QEDA 1E77A 4FBGA 5B12A 1G6KA 3INRA 3ULKA 2HJRA 3DBRB 3INTA 4BNUA 5HRUA 3E03A 4OH1A 1L7DA 3WG9A 1NXQA 2HSDA 2HK8A 3DZKA 1E6UA 1GTMA 3WR5A 4AJIA 4WLNA 1PTJA 2J8ZA 4XQ9A 1DIGA 9LDBA 1E5QA 1TVEA 4ND2A 4DMLA 4YAJA 1ZK1A 2VNSA 4J4TA 3L9WA 5EESA 2WE8A 1R37A 1EBUA 1ZXLA 3OIGA 4NBTA 4IM7A 1E6EA 3T4EA 3RC2A 3SLKA 2I65A 2NVUA 3JQ9A 3R3SA 4J43A 5T57A 3VHRA 3LLSA 1V3UA 1LSUA 3DC2A 4J49A 1WMAA 1H6CA 3WIDA 4R5HA 4JJGA 4DVJA 4G65A 3DAPA 1Z6ZA 3GAZA 4AJEA 1C1XB 2YFQA 3VH1A 3IOYA 1LTHR 3L77A 4E2YA 1HF3A 3RI3A 3HWRA 2VZ0A 4UUNA 2Q45A 1VI2A 4XKJA 1A71A 4YB8A 3AM3A 3ZI0A 4HWKA 1QRRA 1KOLA 3BMQA 3GN2A 4HUJA 2X7HA 1AN9A 5KWEA 4GWGA 2VYVD 3PIIA 3E5RA 1MX3A 3S2IA 3ZWBA 1YL5A 1U8FO 1N5DA 2PZLA 1S7CA 1UXJA 1EE2A 1M76A 2BFAA 2BH9A 2E48A 2J3IA 3FHLA 4OAQA 4DBZA 1B7GO 3G0OA 4PCVA 3VOSA 1KVSA 4D0SA 1FDWA 4BL5A 1K0UA 5JAZA 2SCUA 4MVJD 1HXHA 4TKMA 4DQVA 1OMOA 3I9OA 2ZQYA 1T4DA 1ZK4A 2EHDA 4CV2A 5C7OO 1I33A 2BLLA 1NTOA 3H4VA 3F3SA 4JBGA 2HRBA 5COQA 3TF5A 3AY3A 4J0EA 2O3RA 3EZLA 1V9LA 5JDCA 4W7IA 5JNLA 3C24A 4FS3A 4KUEA 4HP8A 1X1EA 1Y7TA 3SX2A 4KP7A 1B26A 1E7WA 4EUHA 1RM5A 4BO5A 2RCYA 3WYBA 4BNFA 2HQ1A 1T26A 1P1FA 4YXFA 1CQIA 3MEQA 4LISA 3O9ZA 4IDCA 4S1VA 3ENKA 3HN2A 1B8VA 1ZMTA 4NBUA 3BTOA 3HDJA 3G1UA 3PJGA 4JGBA 5L40A 3PGJA 2B4TO 1ZNQO 3OJEA 5EQFA 1ONNA 2C59A 4YAGA 3ANNA 3F5SA 1ADGA 1KVTA 1E92A 4FQ8A 2EV9A 3F4LA 2OMEA 3OF2A 5DN9A 5GZ3A 1U7HA 4K26A 3I9KA 4BMNA 3V1TC 4NDNE 4Z9YA 4FCCA 3PRJA 1PZFA 3S2FA 3ST7A 1T2EA 5TNXA 4OQZA 3I9MA 4J4HA 1JKIA 1DRVA 3UCXA 3HADA 1NAHA 4EW6A 1VKNA 2ZB8A 1HYGA 3AY7A 2PH3A 4JP3A 4J7CA 2CDBA 3NEPX 2GCGA 5FEUA 2VWHA 3IQDB 2C82A 1XDWA 3ZWXA 3M1LA 4FPXA 2GERA 1I5RA 3W8DA 2PY6A 1OAAA 3WX0A 2ZIZA 1O9BA 3BAZA 4TKLA 1E1MA 2AQ8A 4CLOB 4K6CA 4NJOA 1F14A 3PVZA 2OZPA 4D3DA 3GGOA 4IGEA 3C7CB 4KTTE 4IINA 5G0WA 3RAJA 2BMAA 3QW2A 3DMTA 1GAEO 1EDOA 1F8GA 4YJGA 4BGEA 4IJKA 2Y93A 3UVEA 1I8TA 3BMNB 3L0DA 4CQMD 1ZCJA 4E5KA 1YB4A 3C7AA 4XX0A 1YVEI 3TWOA 1KIFA 5AOVA 2PFGA 2FR0A 3E5MA 4CMJA 1GU7A 4XWYA 2X0IA 5ADHA 1T2DA 5HM8A 2JD2A 4CR8A 2VNAA 2G5CA 2PLAA 2AW5A 4IIVA 3UHAA 1GDHA 3C85A 3GMSA 2D0IA 4UAGA 4OSOA 3TZCA 2O2YA 3JD3A 2WJPA 1FDVA 5IZCA 1UDAA 4CMGA 4D3FA 2Y67A 4RQUA 4AJNA 1DIRA 3D4PA 4QX6A 4A5OA 2NUAA 5L95A 5I8WA 1B16A 4P38A 3TDKA 3MJSA 5DT9A 3W4JA 2VCYA 4NMHA 4JNKA 5B37A 2JCVA 2HMUA 1ISJA 1GL3A 4RZIA 2O23A 3AUUA 3EUWA 3DQPA 5EQDA 1K3TA 4XCVA 3JQCA 3IKVA 4GQAA 4PLTA 1CETA 2XPCA 2HJSA 2Q4EA 4FGSA 5KKCA 1ID1A 1NPYA 2FWMX 1R66A 4K1LA 4YJHB 2C2YA 1Q0LA 4GSKA 4B3HA 4Q3BA 2OORA 3TZHA 4E12A 3RFVA 1QV6A 1Z82A 3ZNQA 1PJ4A 2AA3A 2EGGA 1ZO8A 4FR5A 2VWQA 3P2YA 4GKBA 2POQX 1VM6A 4W6ZA 5U1PA 1O6ZA 3GA0A 4CUJA 2BFMA 4IBOA 3LLVA 4MKZA 3AM5A 1YQXA 3RROA 1XQ6A 2PA3A 3A1NA 2JKVA 3PP8A 3ZCXA 3PWKA 4AJJA 2Y0CA 5IXSA 2W98A 2C54A 4LVCA 5THQA 5CEEA 3AFMA 4FJ2A 3LYLA 1FJHA 4BHTA 1W4ZA 2DC1A 4EITA 2E6UX 1PJCA 5JAMA 3OJLA 4II3A 1UZNA 4P4NA 3RUEA 3I6QA 3LT1A 1DEHA 3SC4A 4BNTA 2BD0A 3KSUA 4KWHA 1EVYA 3WGQA 4WLEA 1I30A 3CINA 3ORFA 1KEPA 4IQGA 4IY1A 2W90A 2PKQP 3OSUA 4RPKA 5DBIA 4NFHA 1E5LA 4LMRA 3MZ0A 3SC6A 5F1PA 4BIIA 1I0ZA 1PJTA 4AL4A 4DL9A 4ZRMA 3I9JA 2ZYGA 2GN9A 3DZBA 2BGLA 4XGIA 3EGOA 1YL6A 3HHPA 3Q6IA 3ZV6A 3RUDA 2P9EA 1GV1A 4G5HA 1KC3A 2HLPA 4GX5A 2HKIA 1QV7A 4B3JA 3KXDA 4YAEA 1P31A 3WIEA 5A9SA 3FD8A 4Z0HO 3ROPA 1HDYA 1B15A 4JK3A 4NZ9A 3WMXA 2FP4A 1ISFA 1H9BA 5A9SB 1ZEJA 1OOEA 4XIYA 4ITUA 2QHXA 3BZUA 3H2ZA 1QORA 2YJZA 3OH8A 3D64A 2EJVA 1EQUA 1JLLA 3E9MA 4J2HA 3QWHA 5IDYA 4BNVA 4HV4A 4FOOA 4O1MA 3PQFA 1O89A 3ETDA 3G1TA 3PJEA 1CDOA 1YONA 2Z95A 3KUXA 4ZQGA 1BXGA 5DNAA 5TT0A 1IL0A 4ZHSA 3PXXA 1BXGB 1RKXA 4FD3A 1PZHA 1KEWA 1NWHA 2CFCA 2FSVA 3I4CA 4Z9XA 4DPKA 1U2DA 1H5QA 2F00A 3V2UA 4CM6A 2X8LA 1DO8A 3SJUA 1WVGA 4MVJH 2Q4BA 2CDCA 2D2IA 3A14A 4FFRA 4RVUA 1YOVA 3I9NA 4L76A 3TFQA 4WLOA 3OP4A 4WCFC 2DAPA 4CMIA 3GNQA 2P5UA 4YJGB 2DKNA 1JQBA 5TSDA 4UVEA 1U3VA 2BKAA 4CLEA 2G17A 1Z7BA 1SZJG 1DDOA 4IS3A 4GLLA 3UFXA 3M1AA 3H5AA 5CG2A 3LC2O 1DC4A 4M54A 5I9NA 1ULSA 1WDLA 5JCJA 1ZKMA 3H9EO 5IJZA 5JAIA 1EVJA 3PK0A 1PR3A 2JL1A 1OC4A 3DZHA 1YH3A 2BF7A 2GLXA 4UUMA 1I2ZA 5G0SA 3Q1LA 1XA0A 4MPDA 2XXBA 3MJ4A 5IFLA 3EYWA 2C7GA 4CV3A 1NVGA 1KS9A 2CZCA 1PJQA 3ICCA 1SAYA 4E2ZA 1JW9B 3JYPA 5CHEA 3D5QA 3LC7O 4QECA 1JWBB 3FWZA 2XXJA 1S6YA 1Y8QA 4L4RA 4BNHA 3IKTA 3GLQA 1Z45A 5B4TA 2OFPA 3JV7A 4RLSA 4IJVA 2CVZA 4AJOA 3H5RA 2P68A 1CQJA 3JQDA 3DWFA 4XYEA 4YBZA 1CERA 3TOXA 3RC9A 2YV1A 3SJ7A 1P74A 2YHIB 3ZDFA 1CIVA 1HYHA 2I67A 1DFIA 2Q3EA 1SB8A 4XJSA 3NT5A 3PWSA 3S55A 3GK3A 3PQDA 2WD7B 2Q1UA 1LRLA 4WCDA 3RC7A 3G3EA 1IY8A 2B36A 3NT2A 3TSCA 1WW8A 1XR3A 2UUPA 1M2WA 3TL2A 3V1UA 2NTNA 3WGOA 3OJ0A 2OOSA 4U5QA 4CM4A 3G79A 3FNFA 1LLCA 5DBGA 1LBEA 4NG5A 4OO3A 1ZSYA 2P5YA 1OBFO 4GVLA 3PEFA 3BMQB 2YDXA 2RAFA 4HADA 3I83A 4R1UA 4YACA 4E6PA 2ZCUA 3RCBA 4D41A 3DO5A 2C07A 3CMCO 4MVJG 3V1YA 1OZAA 3FR7A 4I08A 4A27A 1PQWA 4CR7A 4IDFA 4INAA 2I6TA 1A4IA 1LDNA 2G82A 1MP0A 5G4LA 2YQ4A 5MGBA 3NUGA 4Q3AA 5FI5A 2PKRA 1F17A 2Q2WA 2FY8A 3RJ5A 3S2EA 2IXAA 1DHTA 3QVSA 4RPLA 4CUKA 5DZSA 1P77A 4YAIA 4O59O 1FXSA 1UP6A 4DIOA 3DL2A 4ALKA 3NTRA 4FC7A 3NJ4A 3PHIA 4EEXA 3ZU5A 3ZWNA 3HZZA 1U3UA 1HETA 1I32A 4E5MA 3TNLA 3DDNA 1QP8A 3ZWMA 4XQEA 1GYRA 1JVSA 3WTBA 4QXMA 5K6AC 3R1IA 2I66A 4L4SA 1LEHA 1E7SA 2E4AA 3QWIA 4YVFA 4AJPA 3MJTA 2J5RA 5CEJA 4HFRA 2BI8A 5CEFA 1MC4A 3ZGYA 2DUWA 1SB9A 1HWYA 4FB5A 2AXQA 5JC8A 3HDHA 3WLFA 1ZJZA 5FYDA 4YJFB 2IRWA 2IZZA 2O3UA 5A03A 3RBVA 3AM4A 4E21A 2YW9A 4TRJA 4AJKA 3QLJA 1C0KA 1ZFNA 3LZ6A 1DJNA 4RL6A 4DC1A 1T4BA 1YDWA 4IQ8A 3GT0A 3KYDB 2YYYA 4R51A 1WPQA 3D5TA 3SLGA 1E7RA 5I7FA 4CLRA 4FFNA 2VHVA 4N54A 5L7YA 1I01A 1NFFA 2RBEA 2ZJ0A 1K6IA 3ZHYA 3PJFA 4DA9A 4F46A 4E5YA 1MFPA 2BFPA 3L4SO 1C3VA 3E9QA 1BVUA 1DLIA 1H94A 1C14A 4XEHA 4CJXA 2OBNA 2P9CA 3MWEB 2E37A 3K73O 5TQVA 5HTOA 4AVYA 3GUCA 3VTZA 2GO1A 1EMDA 3K8ZA 3L6OO 3VH2A 1HRDA 2J3HA 2HUNA 3ROKA 2O3SA 3K2BA 4MVJM 4HFJA 4CR6A 4MJLA 1HDOA 5B1YA 1MC5A 3MCVA 1HDXA 1R0LA 3P2OA 2IDZA 3EVNA 3EW7A 4R68A 4IDDA 2PR2A 4ALLA 3PLRA 3HN7A 1V0JA 1PX0A 4MP8A 3JD0A 1GEEA 1R4MA 1UZMA 3W6ZA 2HK7A 5JAQA 2Y66A 3DAFA 4CODB 1NP3A 3DBVO 1DHRA 4BO3A 4RVGA 4E3ZA 4YT2A 2R2GA 4I5FA 3W8EA 1NQAO 4LK3A 2EF1A 1MG0A 3A28A 1M66A 4CQMB 5A02A 2HAEA 3B20A 5K0ZA 4MVJI 2C2XA 1MB4A 2JD1A 4RORA 2PZKA 1H6AA 4ND4A 2NM0A 4XYMA 2O7QA 2OGUA 1VJ0A 3IMFA 3TQHA 1YJ8A 1SEPA 4OKNA 3NJ8A 5T8KC 3IJRA 2NU9A 2NV6A 3DXFA 4ZA2A 4Q3EA 1EVZA 1DAPA 2FSSA 4J9VA 4RDIA 5G4KA 3CSDA 4BO4A 4JROA 1SNYA 3VZQA 4GKVA 1AGNA 3F4BA 4TRNA 1PQPA 3GVIA 4KZPA 4BO0A 2NADA 3L9XA 4J0FA 3DHYA 4PZCA 2D59A 1Q0QA 1QMGA 1FF9A 2V7PA 5IDQA 1ML3A 5I7EA 2C29D 3UH1A 4F45A 5GZ1A 3KO8A 3O26A 1LQUA 5B4UA 2R6JA 3U9LA 2GZ3A 1UP7A 1N9GB 3VZPA 5BSGA 2R00C 1HE3A 4FFMA
chains in the Genus database with same CATH superfamily
3FWKA 4LV5B 3T4PA 3VV3A 3WYGA 4RK1A 1X7DA 4C1BA 4YDSA 4JD5A 3RUIA 3R6GA 4XJTA 1E0AA 2GCOB 4FYPA 4MCIA 2ZZMA 1CRZA 4N65A 4YK7A 4MIOA 1UJBA 3QIAA 4DEXA 3L01A 2HI0A 1QHSA 3IVRA 4I5DA 4C0BA 1JEYA 4PGHA 2YJ5A 2BW0A 5JBIA 3RG2A 3PB3A 4P0QB 2P5TB 3SZRA 1ZRMA 2XVYA 3PDIA 4TRMA 3N0XA 5CCBA 2HNAA 2QLNA 2W2QA 2ECPA 4TQGA 3EGVA 4OSPA 4EHNA 5A9RA 3WGKA 2CV2A 5K0LA 3L2OB 3CZRA 3LNTA 3QI2A 4GSLA 2AE2A 4AZSA 1B8UA 3NHUA 4F9TA 2PMFA 1SUIA 2VPIA 1RWNA 2GFIA 1RQPA 4LOJA 1QU2A 3DDUA 3I2YX 4Y2GA 4UTRA 5EZ6B 2JJ2D 2DR3A 1E8MA 1O5IA 5FYQA 3FH0A 2AWOA 1XVVA 4Q9NA 2VOJA 3BHJA 4WK4B 1XKLA 4ADSG 3RS9A 1E2HA 4J8PA 5EPEA 2YRFA 3EFEA 5AR1A 4EKGA 3TGWA 2O2CA 1OYYA 3FZYA 4EJ0A 2FJUA 4O02B 5LP1A 4PGFA 2B6NA 2ZIXA 4R9SA 1WB6A 1JTEA 3IC5A 4KQMA 1KWGA 5DOVA 4BO1A 1DCTA 5C53B 3AUTA 2X77A 3PFFA 3K6SA 3LA6A 1K08A 1PFKA 1AXGA 3C5WP 2OP1A 4BTEA 3P26A 1ZJ4A 2P6NA 2Y1DA 3WO0A 3H3FA 1MPXA 1Z0JA 4HX5A 1YJQA 3IKMB 3B6IA 2PZAA 5E9WA 2ZIEA 4E88A 4FUQA 4Q1CA 1BXKA 3KB8A 1YR3A 4NNOA 1OR8A 5AJWA 1EZ4A 2VJNA 3P0RA 4XR4A 3GF4A 4NE9A 3WK8A 4I9NA 4N8EA 1G8FA 2GCNA 3KHTA 3FOEC 1M73E 4Y8VA 2ISQA 3QXHA 3LS2A 4ZYYA 2GA9A 4XGQA 1IMOA 1M34E 1LLFA 3G6KA 3H2SA 4KNVA 4XCXA 3JQFA 3CVUA 5MN4A 2PX3A 3CIFA 4OI1A 3GUZA 4F8EA 1J21A 1Z13A 4DHEA 3CVXA 3I1JA 4BCBA 4ZZ1A 3KUCA 1Z7GA 3O3NB 1P60A 1BD4A 1JU4A 1SC3A 1SG9A 1UEIA 1W5TA 1XFAA 1RWXA 2J9FB 1NM5A 3GBSA 5CVEA 5L53A 5AW0A 1TXGA 3N58A 2ATXA 5AI5A 3NX4A 2NYUA 3MBKA 2DPMA 4PG7A 3UBTA 2O0MA 3DYIA 3DBLB 3DAYA 3ZQKA 2QXTA 3U5TA 2D6FA 2ZKLA 2NZWA 3WTCA 3RV4A 4WOCA 2G9VA 4PX9A 2RARA 4PWYA 4B6PA 3KEOA 4BEBA 4MW4A 1EFTA 3TCXB 1E3DA 1DE0A 1I4WA 1PFUA 1X19A 4HDMA 1CJTC 4P35A 3ZY2A 3BA1A 4YPVA 4HQFA 3U3XA 1GPDG 4HPWA 4Q1BA 3TDNA 1OZFA 4RGYA 4GI7A 1TT7A 1ZCBA 3SIPA 4MV1A 4D5EA 5FV7A 5LYJF 5D8DA 3TMYA 2H4ZA 4I19A 4ICIA 4R2IA 1QHEA 2HSEA 3NTQA 4RU1A 4UTOA 3H18A 4ESEA 3R5FA 1U0JA 2WIDA 4UCQA 3HCDA 2JLZA 1AG9A 3DO8A 4X20A 5IZ4A 3I2GA 1IN8A 2W8BA 4XYBA 6REQB 3A6DA 1H3FA 1UDBA 5KKNB 1SIWA 3Q41A 5FP0A 3SVZA 4CMKA 4DLSA 3I0ZA 2F8SA 1Y1LA 1QHFA 4MUEA 1Q77A 3ONWA 3OOSA 4MMYB 4CMCA 3OKCA 4QYMA 2WNSA 3WS7A 4B48A 4ZGBA 3U49A 2R8OA 2HHJA 3MGAA 3PPYA 3EA5A 2P69A 2C9BA 5JLJA 1YS2X 2ZPTX 4X0EA 4XM1A 1KMHB 1LNZA 2OV6A 5IAOA 5BV7A 1CUIA 4YHBA 5L4SA 3OTIA 1R0YA 2G40A 2IU4A 5AHOA 3QVTA 3DHWC 5HIAA 2VNJA 5DYWA 3RSFA 4M1MA 4TLDA 4HLCA 3DV9A 2CDRA 3L7AA 4JX9A 5DCWA 2XCSB 3EARA 2RJ3A 1TEHA 4TRRA 1IQPA 3QHAA 1GFZA 4JKYA 5EXTA 5LNK6 2O50A 4J2TA 3RHFA 3F90A 2G04A 1SD1A 5ISMA 2C5EA 2D5BA 4PLVA 3T34A 2PJRA 1KO5A 2ZYDA 2JNWA 3EQ8A 3G7UA 1M83A 1V1RA 2X6RA 2X7XA 3Q40A 5DLQC 2HMWA 3HSKA 3KQLA 1EA7A 2XCRB 1XD9A 3K4QA 1P62B 3SM9A 1L2TA 1N7HA 4X63A 5E4TA 2FYTA 3EE6A 2X2PA 4AFNA 2G6BA 3QA9A 4V39A 4Y67A 4BV3A 2W42A 3W3AD 3OFKA 3DA8A 2VQ6A 2CV1A 3DAGA 1DO2A 2MSWA 3VVMA 3KAQA 1CTQA 1V45E 3KFLA 4YLEA 4YUXA 5KTYA 1CYEA 3OF5A 2G9UA 1VYUA 3PX2A 3G17A 3PNPA 1KJWA 5AK3A 5EMMA 4HN9A 1SRQA 1SVMA 2XZDA 1JKFA 3VKGA 2MYPA 2XYPA 4Z2AA 4EFLA 2V7XA 2OV8A 2CC2A 1EP2B 4J1QA 4UVIA 1ZS9A 4KJXA 3BFVA 5EPOA 1MNQA 5HF6A 4UKDA 2DSTA 3OPYB 4K2AA 1TRHA 4K40A 3RVJA 4WK2B 3DLHA 3DFZA 3HRKA 3DPIA 1Y8AA 4ZI7B 2ONCA 2ZUTA 3PNYA 1TQ6A 3C6QA 1T5IA 4NCXA 5ALDA 1FFXA 5ECGC 1Y6QA 3TLGB 1ZRSA 1II9A 4C5BA 3DLBA 2O19A 3TBKA 3ZWAA 4KDRA 4QREA 2CF6A 4H15A 4DCTA 4O4HB 5CVDA 3OFJA 2HPAA 5BN1A 4PQGA 1A9OA 4YT8A 4YA6A 3FFTA 4RTKA 3GLGA 2VUSA 1YU6A 2F9FA 3U3MA 5KWSA 2E4YA 2ZYWX 4L07A 2W6ZA 2A4MA 2W2LA 2YC4C 4IIJA 3A1DA 2Q27A 5JS6A 4J0HA 2OGTA 4TWIA 2X0NA 5KSPA 4W7SA 5EVCA 3X1WA 3BN3A 4BN4A 1QQ7A 2WJ4A 4BP3A 5GM1A 2C03A 2EL7A 2RBKA 4R1NA 1SXJC 1N75A 1GGHA 1WXFA 5F5LA 1V1MA 4QHTA 4ZQEA 3F67A 3RG8A 1U94A 3ASVA 4EA6A 3WADA 5BSHA 2H63A 3UA4A 4ZTUB 2QTVA 2VP9A 3T7CA 2CK3D 2G25A 3Q2OA 4HK4A 4GGOA 5U9CA 5CXSA 2R6CA 3OA0A 3LBAA 1BSVA 3BT7A 3NOXA 1WP9A 3IA7A 3P9YA 4ENQA 4CQNA 1QGED 1VPWA 2ODPA 4LZZA 5AXBA 3VH4A 3IPRA 2QTGA 4D9GA 1FLDA 2J3DA 3GBVA 4MEJA 4DLLA 3VJRA 1I36A 1MVLA 2QVYX 1UKVY 4JLMA 2OP0A 3IBSA 4L3WA 4QQ8A 2YIJA 2O52A 3IULA 4QUIA 3T1OA 1LBIA 1CRQA 1YL7A 3VJKA 2OGSA 3KB6A 3ECSA 4ZMSA 1V4NA 2NXJA 2X9GA 1E2QA 2AZTA 3K31A 4JC4A 4ND6A 5DP2A 1QB7A 3V7NA 5AW9A 5HDBB 2XDQA 1CX9B 1Z4JA 1UDXA 2A4KA 2XITA 4OJNA 3ZV5A 1C4XA 2VQSA 3D0QA 1HEUA 3I2HA 2NUTA 4DDUA 3AGPA 2BGMA 3WGHA 3O1IC 1L7NA 3I5MA 4TUYF 4Q4LA 2O14A 3U4DA 3JD2A 3PE4A 1L7EA 1P4AA 1M6NA 2WSMA 1NZJA 3C70A 2QZZA 5D00A 5H1YA 5EMHA 3UHJA 3MTGA 4ZIRB 2O2DA 1Y1TA 2QP9X 2C3YA 1PYOA 4O0MA 4RYLA 1XVTA 1TFUA 3P4XA 3RUCA 3U2QA 4PRKA 1CJUC 4ZGWA 5FLEX 1TT5A 2K5UA 1B23P 4RANA 3V9PA 1XRSB 3BCUA 4LCJA 2J9YB 3SM3A 5AFSA 1T3HA 1U90A 4QU5A 2YQZA 1DL5A 3OESA 4UDNA 3VKWA 2TMYA 2PGAA 4DV1B 2QW1A 4X85A 5PGMA 3RYFB 1OH5A 3DT9A 2NTEA 4N39A 5IBPA 3SDSA 4G0QA 1HDIA 1NC1A 2GZSA 1AKYA 1HT3A 4OQMA 1NRXA 4FYMA 5H59A 2GK7A 2BV3A 4DSTA 4UOQA 1VMIA 3ZGOA 1B3RA 3UK0A 3AR5A 5CDSA 4Q3LA 1YBHA 1E1NA 1V7QA 4K9NA 5ALTA 4AZWA 1CCWA 5T3UA 3L7DA 3ZVNA 4GEKA 3Q9NA 1C80A 3B70A 3LBFA 4DDMA 4D9FA 5BV0A 4EYOA 5K8IA 3UUEA 2EFEB 3CR3C 4IMPA 4HNRA 3N2KB 4NBKA 4XR9A 4WIAA 3EPPA 3DTTA 3JQAB 4U4AA 1P3JA 3ZVRA 4BMZA 2Q62A 5EJIA 2A9FA 3U7GA 1E1CA 1F12A 1Q2UA 1R6UA 3VNRA 5C37A 1I3MA 2VDJA 4ZVLA 3V4VB 2NZ2A 5KSZA 2QAIA 3OT1A 3QXXA 3SE7A 3LX5A 1RW4A 3R3XA 4DV5B 4RY2A 2IYOA 2VOEA 4ZDWA 3VI4B 4AY6A 1D5CA 2CYBA 4RY0A 3S7ZA 2YVUA 3DXXA 4EUEA 4B3IA 5GONA 1GCOA 3DONA 4OHKA 1V5WA 2OFWA 1AN0A 1Y3CE 1N5RA 3QE2A 2FUCA 1NYRA 2Q99A 3TTYA 2ODEA 2JFWA 5C8DA 4TT3D 5FOWA 1TJ3A 2ENUA 1AGXA 1LX6A 1KMQA 2MSLA 3CEAA 1Z9BA 4EI9A 1TLFA 3GFVA 3QYPA 2IS4A 1HV8A 4E5SA 1KJZA 1MJNA 2O1SA 4DCVA 5K0GA 4M55A 4MNTA 1GCGA 4B80A 3GMTA 3PYLA 4TS4A 3FYDA 1ZRNA 1Q0HA 4I9UA 4M7PA 1BHSA 1GGEA 2RHRA 4UEKA 1JFTA 4JXXA 4Q6BA 2LCFA 1E94E 5HK9A 4KXYA 3S5UA 3KPJA 1NU6A 3WLTA 1XEAA 2QTTA 1DV1A 2TSYB 2AG1A 2H4JA 5E7IA 1E18A 2W2TA 3RASA 2YZ7A 2G67A 1FY2A 3I6BA 1X7WA 4HEHA 4MGYR 1PE0A 3FPLA 4ZRNA 1KZ6A 3U40A 1QTIA 1KS2A 3EVDA 4B47A 5IASA 1VDZA 1EVLA 5AJYA 4CM3A 1YWGO 1I9CA 1AE1A 3UY4A 1TZMA 1H1DA 1UBJS 4OPMA 3F9IA 5EE3A 5HIIA 1Y81A 3M83A 5BW8A 4HDMB 1U02A 1SQ0A 3HI6A 5E2IA 2GESA 1BU5A 2VXCA 5P8WA 4XYLA 5EUQB 3S8MA 2PD3A 3GEIA 5K6AA 3F1LA 1JJFA 3ENWA 3VKUA 3C14C 4LBZA 3B48A 3GCXA 2YWGA 3VPHA 2O8CA 3SDBA 6CHYA 1U7TA 3FRIA 3UJ7A 2JJ8A 5D3QA 1X77A 3GGGA 1DJQA 3S1AA 4YYZA 1Y5NA 1X7HA 2BGRA 3OEYA 4O0LA 1MABB 3V6LA 3VTAA 1APBA 2ZWAA 3L7YA 1QNLA 5EKSA 2VBFA 3G5TA 4FS8A 4YCJA 4EYKA 4TMWA 3VPFA 1R6TA 1IQRA 3NEYA 3SQNA 4BYGA 1W30A 1VBMA 2ZQ5A 3CNNA 3BF8A 4NX2A 4EJSC 3KKPA 3Q11A 4PF1A 2WT4A 3UMSA 3V8EA 4C05A 1HL3A 5CNMA 1H2BA 2HB6A 5D3ZA 5IDVA 1C29B 1W5EA 1HZZA 2OHHA 1Z4MA 3EZYA 3HZHA 4N3NA 5JSFA 1T8RA 1FQKA 1V8DA 2XQVA 4OU5A 4D5GA 1CUAA 4RIHA 3AFGA 1G8JA 2VHTA 3DXYA 4A0HA 5ICFA 4BNMA 4NJMA 4NL4H 4JJZA 4L7VA 1U8CB 3DVAB 3CLSD 4BX0A 3WRXC 3ORQA 3KJZA 3PZRA 3ZY4A 3HRIA 3U37A 4CIXA 1BHQ1 5F1YA 3UN1A 4XD2A 4UC0A 2WHPA 5DO9A 2FW1A 3TQOA 1T3SA 3VVBA 1AT1A 1QFZA 3F6RA 4HH1A 5CNJA 5DF1A 5BSUA 1ZH8A 4F2GA 5I48A 5AUNB 2E4WA 4XRGA 4DM7A 4ZOLA 4UMVA 5KTOA 5L3SA 6GPBA 3HU5A 2YH2A 1P0MA 3JATA 5C32A 2GXAA 1SHJA 3H2IA 5KJCA 1DNPA 3OE7D 1WMFA 2RGCA 3A3PA 3JSAA 2ZE6A 3HJTA 4I0WB 4JEUA 4L72A 2V55B 1RBZA 1JL3A 1P5HA 5A5DA 1MO3A 1FTNA 4OYRA 2XJ9A 2D2EA 3R09A 1H3NA 2FZWA 3KALA 1KOFA 3PUIA 3PSAA 4M1WA 2BUBA 3WP0A 1U1FA 3TB4A 2XMRA 1L5ZA 3D2AA 2TYSB 4LFAB 3E6AA 4ZZ2A 3VZBA 3TAXA 2E87A 1BFDA 3D7LA 3CH6A 1W0JA 1B8OA 2MMGA 3QPBA 4JHLA 5E4FA 3PQ5A 2GEVA 3AUSA 3PR3A 1MAVA 5KAMA 5TVGA 2M6KA 1GZ7A 2AJ8A 3HVKA 3JAWB 1SMKA 3H9CA 5BO5A 4JUBA 3LT0A 3GFGA 4RPJA 3NM4A 3CG0A 5G41A 5F78A 4J7XA 3DBLA 3N5KA 2NSLA 4V1CB 1LB1B 5JQWA 2Y0EA 5FUXA 3IPAA 3N7UA 5KYUB 3OD5A 1XZMA 3GIWA 4KTVE 2V7WA 5CH3A 1YNSA 3KXLA 4X45A 5TPZA 1TEZA 3HP1A 5EP2A 1PGQA 1U3GA 1NW3A 2I4IA 5DEIA 4A6EA 3BD7A 2X3FA 4YRKA 3KD3A 2F8TA 3PCRB 5AVWA 5CFNA 4TTQA 3EMDA 2RKBA 3FNQA 3QF7A 3U4GA 5KVCA 1XMJA 3ADPA 1IY1A 1E2LA 2WDPA 3CE9A 1JEQA 4MOWA 4CHGA 5KCZA 2D74A 1JAYA 2F43A 1B73A 5JDIC 1O58A 4M6WB 1NL3A 3DZGA 2XT9A 5KNDD 1WX1A 4KO3S 1KVQA 4ZQIA 3DZJA 4N49A 1M2NA 2H3EA 5LZ5A 4CV0A 1YS1X 2Y76A 2QTWB 3F7OA 3DF7A 5I8ZA 3AVQA 1XPRA 4Z0PA 3WFZA 4HHEA 1HLDA 1SC9A 2XUGA 1Q7TA 1M7HA 1QH1B 1EFKA 1XXHE 1FA9A 2ECFA 2LR0A 2OAQ1 2YV5A 3DPUA 4KIWA 5TEWA 1IWBB 2XNKA 4IXTA 4ZIRA 3OPNA 1GUFA 4NF2A 2Q3JA 3KPYA 4I8XA 3ISJA 3G2HA 3KX2A 2A2ZA 1IVYA 1HE2A 1TVCA 2O2SA 1GZ3A 3AGQA 2YWJA 3HNPA 3ITNA 4HQOA 3BK7A 4W9NA 4Y9TA 4DPMA 4OV6B 4WESB 2A1UA 2C4HA 3P19A 4DWVA 2ZYRA 1Q0PA 1C30B 3CN9A 4ZOCA 1S8FA 2ZYHA 3ZD6A 1L3CA 2W6CX 1G9XA 3W2GA 5DNDA 4FMCF 5AW7A 4L78A 1ICEA 5IW8A 2OL4A 1JFRA 1F3LA 4MZXA 5BXQC 4PCLA 5A6VA 1RWKA 7MHTA 3R8CA 2BJWA 1GHTA 4DNOA 3OFVA 2PX4A 3R3JA 4FQ7A 3M33A 3KSZO 3JALA 1OWLA 3CFYA 4GP7A 1RE0A 1Z35A 4M8LA 1GXSA 4PLGA 2ZJ8A 2J6IA 3PC3A 2FWNA 1VKJA 2QPLA 1DKLA 4XX1A 1NNLA 1QP4A 2XNHA 2W2VA 1JKJB 3L5KA 2VYCA 3GYBA 4ATNA 1X7XB 2A0WA 2XWJI 3PJDA 4D4HA 4L8WB 5B30A 5L7WA 3OPQA 2Z58A 2BM1A 4MKHA 4LWQA 3W5VA 4DEYA 1ICIA 3AI2A 3UKJA 1S02A 5H8WA 1XRNA 1A5ZA 1ZHHA 4FI3C 2O05A 4U7WA 4BVBA 4QLBA 2Y4OA 1Y4UA 1A1SA 3ZWKA 5A06A 3KSMA 4I14A 4OJMX 3K9HA 3MYRA 2G1JA 5E7QA 2W4QA 2H52A 2WU4A 3MPOA 4DDTA 1NURA 1RKVA 1U4NA 5IC4A 3DNMA 3WDMA 2B94A 1HBJA 2NO0A 1LDBA 1WTAA 2FKAA 2J4DA 1V71A 4ETIA 3HACA 3PNMA 2CLFB 4WDQA 2GWRA 3FROA 4JC5A 5AJZA 2R6FA 1RCTE 4AN0A 4P7FA 1L1RA 3GWGA 3ZVMA 1DT5A 1CY1A 3H5IA 3FI9A 1NF9A 3LF1A 5JFOA 4P4LA 4DABA 3IILA 4F9EA 1KHTA 1N2SA 4INZA 5C7IO 4G84A 1KWKA 4KO2S 1FP4A 3KL2A 3WMGA 4IIHA 2Q1XA 1O94C 1ZGJA 2P9HA 2OR3A 2R8EA 4X84A 3ETCA 4AC9A 2V9CA 2ZQZA 1GFWA 4B79A 3KT8A 3DVQX 3M1IA 3M2TA 4GEGA 3U44B 5CPBA 2PWBA 1QGYA 1ESNA 3IIEA 3FTFA 4GE0A 4M0UA 5THKA 4CG0A 2CF5A 3K0KA 1J25A 1EDBA 2EZTA 4KI0A 3EJWA 1V37A 1E0SA 3B1JA 2MU1A 1Y7HA 1TMOA 1V41E 3FW1A 3L4BA 3DYVA 4G07A 5E6UB 3RS0A 1YS7A 3VNSA 3JXEA 1Z5WA 4IDOA 4QU9A 3Q8LA 4QOSA 2D5AA 1GZ4A 1L6IA 3IIMA 3QKSB 2BM8A 4N47A 2PJZA 4MWDA 3UICA 3ZBQA 5IVKA 1CB7A 4Z4FA 4GWLA 3D31A 3IUSA 2D62A 2JAWA 4AZ3B 3LPNA 2XD9A 1PK8A 3H9JA 1NFQA 3EY9A 4HNSA 2GARA 3E9NA 4PYOA 2Z98A 1OT5A 5BPFA 3Q9LA 1YE8A 3D7MA 1X94A 2H2WA 4RF4A 3HY6A 3KV1A 1TJYA 1VBKA 4I4LA 4MIYA 3ZU2A 4BWFB 2P11A 1G8KA 1PS9A 2H7YA 2WAXA 1E2NA 1BH6A 2HF7A 3MTJA 3UJDA 5K9ZA 1HMPA 3INYA 1BOFA 2FW8A 2QZPA 3D0OA 3L6UA 5FR2A 3ZLTA 1CDDA 4DJJA 2FEKA 4EOGA 3HYRA 3RBZA 2VUUA 3B9RA 3G0BA 3NTXA 3L7BA 3QG5A 4CF6A 2B7LA 3PTAA 3BDIA 2WICA 2GAFA 4BLVA 4CL3A 2HRCA 3ZPXA 3KZCA 1TC2A 1G2QA 2ACVA 1VHWA 4QRIA 1GPNA 2K7ZA 2HN9A 4RJIA 3RYHB 3KDPA 2CUTA 3D3WB 3G5UA 4ZKEA 5BYAA 1JLSA 5ALVA 1T0PA 1E3IA 1SELA 1Z16A 3V7FA 2Z2ZA 1YQ9A 1EU1A 2P9TA 1ZXBA 4IAOA 4P3XA 3ZCUA 4RLHA 3LPAA 4F4UA 2A67A 4X6LA 3UJ6A 3J7AC 4RGBA 2QRQA 5K20A 1B3BA 2FPRA 4BVGA 3KTDA 3LT4A 4PYJA 5ALLA 1KMMA 3LRPA 5F35A 2OXFA 2Z2XA 4GC5A 4B82A 4Z4EA 1YFKA 1UC9A 3FA2A 4G37A 4BC1A 4C7JA 1JBQA 4ZJZA 1G21B 1CK4A 1D0IA 6YASA 2DH5A 4M0KA 3GRPA 3HO8A 4MQEA 2R86A 3LUAA 2B8EA 2EJCA 2IHUA 4BB0A 1CHDA 2DHQA 4GXRA 4Y2PA 2P9BA 4ZZ3A 4J94A 1NJ1A 5KAPA 4F04A 5EZ5A 1XTVA 3GJYA 4QPCA 3GGJA 2OHGA 1A8HA 3U62A 1W9MA 1D4ZA 4B83A 1RLJA 4PFSA 2PL1A 2GYWA 2JFFA 5ER6A 2XHEA 4N6OA 1FNMA 2IOFK 5CFOA 5DULA 2Q3LA 3PFWO 5F7JA 2Z57A 3ZN2A 1NUUA 4Z51A 2Z2KA 3BXOA 4IKEA 1WG8A 3RVLA 2AQHA 1ZVMA 3FNGA 3T3OA 5EMJA 3IVMA 4Q93A 2J3MA 4HWRA 3F47A 2YHAA 1HKUA 2Z3VA 2ZJYA 3X2FA 4D9KA 1MJFA 1YDFA 3ESRA 1ZI9A 2SBTA 3L7KA 3IPLA 1G18A 4FIDA 5LJIA 1LRKA 3GXOA 4MA0A 4G5OA 1PW7A 5EE1A 1NATA 5JSHA 1IBLB 4B7XA 5EG5A 1G0NA 1XUOA 1JNYA 3WOHA 3IPXA 1ZMOA 4MV7A 5T7BA 3OA2A 1HTTA 3C8HA 1XDSA 1QOPB 4ENSA 4Y7CA 4B7CA 1FVHA 5JMPA 1Z12A 3DHEA 3TR0A 5A3VA 1GZUA 1SUBA 2P9QA 4FHEA 1HEIA 3UATA 5K8JB 4UZFA 1OXUA 1QYDA 3CM0A 5EUMA 1QOQB 1OXBB 1I3KA 1M8PA 5ES3A 3VR2D 1HUQA 1WD5A 4X97A 3DYBA 4DMFA 1VPDA 4NCKA 4N1AA 4C7MA 1QO0D 3PQ8A 4G56A 2IOHA 1BYIA 1NLUA 1QIHA 2OBMA 3E81A 4OXKA 4YRAA 3M4NA 5FI0B 1GUZA 3N8GA 4HB0A 3TZLA 4MVYA 1D6MA 1TYBE 1OTHA 5AKKA 4ZJUA 4BMVA 1EGAA 2GF2A 2JH8A 2P6MA 5HEKA 2PZGA 3HEAA 1ADJA 4AG3A 1UFOA 3C8MA 3FPKA 2BCEA 2IZ0A 4FONA 2DVMA 1J6UA 1EB9A 3DQZA 3TR5A 1YBVA 2XVXA 3GLIA 4BQSA 3WQRA 1C0IA 4M36A 4UTXA 5JROA 3T5BA 4HAIA 2EG9A 2FZGA 4R8SA 5J47A 4EDFA 1XTZA 1GPH1 2LNDA 4GZ6A 3HFGA 3LOUA 3T94A 2NLOA 1GCUA 2KSQA 2IYUA 2FQYA 1HLPA 2WF6A 3AJ9A 3NAQA 4BN0A 3KYCA 2W6QA 5BQFA 2R3SA 3MGKA 4WEOA 1U9JA 4BBJA 3QW4B 1MX5A 1N4DA 3KUUA 5AXCA 4ZJYA 3ZJVA 2PM8A 3FHTA 2JIRA 3OLZA 2Y1LA 3HA5A 1GPUA 4TQ9A 1K6XA 4KQCA 5BWBA 2Z8XA 3LFUA 3NATA 3ZE6A 2G8NA 2VXBA 1OGIA 1XTSA 4EB6A 2A9OA 3K70B 1MZPA 1DOHA 4GC9A 5K2MA 1XMVA 2QTVB 2XF8A 1PGOA 2AOUA 3LECA 3EISA 3Q85A 4JNCA 3U5ZB 1MB0A 3TGLA 3OMLA 3G88A 2GPYA 2DHDA 4L74A 4O4HF 1FSPA 3A70A 1ZUNB 3NO4A 4O4IB 4M38A 2GYYA 3GFRA 4R8LA 3GUVA 2Q5HA 1XEWY 2J3JA 2M2IA 2VJLA 2WYVA 3WSWA 4WADA 4Z7NB 4XDZA 2PT5A 2QK4A 3RU9A 4IIFA 1D8TA 4GO1A 1J07A 2ZWIA 3F7TA 2JFVA 2VT7A 3GDGA 3H97A 1S3IA 3GUUA 3PT9A 2NNLD 4P22A 3UCEA 3VPXA 3ZYZA 1AKQA 4BEWA 1WR8A 3MCTA 1R5BA 2P40A 4IIGA 2XB2A 3HJBA 2PMKA 1QYRA 3CLRD 3LTNC 2VKQA 4OK6A 1OLUA 3IERA 1KRHA 1SGWA 1CD5A 4UFOA 1GTJ1 4U0KA 2P2LA 2BT4A 2NUTB 5EJ9A 3B7GA 3F3MA 3NKLA 3OIYA 4NQZA 4EQZA 3K70C 3DHVA 2F8MA 4S12A 3GZNB 2GSWA 4U00A 3FY4A 2HUPA 1P5JA 4X44A 5G40A 2VJDA 3I28A 5ITZA 3HR7A 4AN1A 2VRBA 4HDRB 1ONBA 1UJNA 2X14A 1JQEA 1E96A 1ULHA 1YGYA 1AOXA 1GN8A 1OA1A 4BB6A 2YJTD 1DC8A 3CNQS 3JR7A 4RDXA 2WM9B 4G8BA 1OX6A 1A9XA 2H06A 1A9SA 2QMOA 3C5EA 3H0CA 1Z8NA 1W4LA 1KH2A 2Y1CA 621PA 4PLZA 5HKKA 1B6RA 2IXTA 1PV1A 5ALOA 3WHIA 1LDEA 4JLUA 3FFBA 1OXTA 1RJFA 4G85A 5CJPA 4G2TA 1AGRA 1MH1A 1TLTA 1HE4A 1HFWA 1T9KA 1S9DA 2BIFA 5GOZA 4HC4A 1MHPA 2N3ZA 2ZYSA 3I92A 3GLGB 3CH5A 2H1SA 1QG2A 2AR0A 4FINA 4DLBA 4UE6A 3PU6A 3JQFC 3BXXA 3J7TA 2WHEA 1HNZB 3W7AA 1JR6A 2R8ZA 1HSZA 1NQVA 4YCSA 4XA8A 5AIBA 3OTOB 4D42A 3MCWA 4QJ5A 1MENA 2B83A 3AY0A 3B5EA 2AN5A 2Z8ZA 4UTNA 2G4CA 1LPBB 2D0PB 4J1NA 2HF2A 4JU8A 3IP1A 4JLAA 4RNDB 1TJPB 2H1HA 4YYEA 1I3OA 3M5WA 2ODTX 5EIBD 2GX6A 1IUKA 1GNRA 2WF5A 2CHFA 4MUHA 2AF4C 1Z73A 3BDVA 1FX0A 3WA6A 1YDEA 2E2WA 3D8RA 4NWIA 3QLEA 4J0JA 1TUGA 1VSBA 3E8XA 4OKSA 3IAS6 1ORRA 4TWRA 2O3TA 3IS3A 3U3ZA 2BF4A 4D96A 3ODGA 3LZDA 3MF4A 5AICA 1JSZA 2D5CA 3ML1A 4LJSA 4DWWA 4Z4IA 2E5LB 5ENDA 1YRLA 1EBFA 2VPYA 1CRLA 4E4YA 1A82A 4DV0B 1F1JA 2QY9A 4BLQA 1ULZA 2PX8A 1AUPA 3MLAA 1YMUA 2UUCB 1E0KA 1JJIA 5A4KA 1QE0A 4EHFA 4F96A 3ECAA 1KEEA 1NHGA 3QXJA 5DMHA 3P8ZA 4B4UA 1W35A 1JEEA 2V03A 3AEUA 4JOCA 3TLEA 1JT9A 3E82A 5TMBA 1XIVA 3DE1X 3AEUB 3E1GA 3RKSA 3LBHA 2OTCA 4MW0A 3OPVA 3NH9A 3V48A 1HLFA 1SC4A 1N77A 3T12A 2C9DA 1Q15A 4ZO7A 1RT9A 4XASA 2BR4A 1TTHA 1FTWA 1QIJA 1YJBA 2I6FA 3FSEA 3H87A 3N8DA 4LZPA 1A04A 1IG0A 5HTKA 1Z5NA 3LKVA 1XNJA 1GKLA 1GNQA 1K8YB 2Q6KA 3CTMA 3O03A 1ZH2A 1WMBA 1DKRA 5KYVA 1ADYA 1HG0A 3N28A 1TZJA 3FZNA 3O8CA 3VC1A 1RS0A 2NPOA 3AHCA 1PWEA 2GJKA 5BSRA 2Q2NA 5EMLA 1NN0A 1P1RA 2JDID 1CZKA 1WXIA 2IPNA 4Q21A 4ALIA 4E1VA 5KINB 4UTZA 3OZTA 1T1IA 2GD6A 2AD1A 3EZ2A 1IY2A 3VO9A 2PGJA 3LDGA 5GOTA 2VA9A 1K5PA 4F4DA 3B78A 4AURA 2IU6A 4HUQA 1NQTA 2P1DA 1T4CA 4CT5A 3GR6A 2PU7A 3M1YA 2FWIA 3PR1A 4DC0A 3V2GA 3TLJA 1GPYA 2MIIA 1ZK3A 2FSVC 5ENVA 3HFJA 5FWNA 2FEWB 2QN8A 3WQSB 5CYFA 2LV8A 2WZBA 3AUAA 3C3JA 4UQLA 1VYVA 2O2HA 4ZDJA 3AYXB 3JWEA 3EB9A 1MIOA 4WZAE 4EKDA 5ICMA 4TL8A 5F2OA 3I45A 1GDDA 4P8RA 5G1NA 3ZDYB 1GP2A 4REMA 1P2UA 4DRXB 4WASA 1UBNA 2H11A 4D7AA 2AEJA 2Z3ZA 1Y6ZA 1LY1A 3K30A 5DRYA 4Q7QA 3HVUA 3LDUA 4L02A 1D0SA 2EFYA 3HUFA 3JR3A 3PHLA 3TKLA 3ROMA 1P9NA 5EUBA 2F1JA 3CGGA 3ILVA 2C95A 3NETA 3HUDA 1NI5A 4GKAA 3TTWA 1RM4A 1GM5A 1RRKA 1OFUX 3GWZA 1X42A 3ZHBA 4CG3A 2R87A 1VJRA 1N5OX 3IT0A 2B1JA 2Q4DA 2CBGA 2IIVA 4H7EA 3TCKA 1IPEA 2TMKA 3I6IA 3QLUC 3A1EA 3CZMA 3JATB 1XE3A 1D7OA 4BGVA 3HWWA 1QH0A 4JY7A 3SC2B 1ZMBA 3NXKA 2YC2C 4QZVA 1Y63A 5F98A 3EXIA 3KOOA 4JJ8A 4Q9KA 1E8DA 4C4AA 4W1QA 2OM2A 4NU8X 4Z9BA 3AW8A 1JHMA 1PCXA 3QXCA 3EXIB 4FJ0A 1BS2A 4WFKA 1EGMB 1PZEA 5IANA 2ZZNA 1JPNA 3TPFA 1ZU4A 2W2KA 2I71A 1Z8HA 2PGNA 2PMWB 1YS9A 3HA7A 7ABPA 2EOAA 2H7XA 1QQBA 4XTCS 3TEMA 3CRQA 4NONA 2CMHA 3DWGA 3TYXA 3NHSA 1XNQB 3EEIA 1J0BA 3AK4A 3HV0A 3VO2A 1ISPA 5TGDA 2QTCA 2ZPAA 3EVGA 3TRDA 2VJQA 3WK4A 4C7KA 4YGYA 2C1XA 5EE5B 1QONA 2Q0SA 2Q6IA 4HNHA 1BRMA 4FWIB 5JEDA 1GT6A 5IT5A 4EY4A 3A8TA 1K66A 3BIFA 5J1SB 5FPKA 1NQOA 3PYXA 1KYIA 3I09A 3MIZA 5JY1A 1OI7A 121PA 1QGUA 4X66B 3WKAA 9MHTA 1C2TA 1ZZGA 1EK2A 3ZH2A 4EZEA 1JHQA 1NLFA 1X3SA 3HC7A 1XVUA 1V35A 3ZJ5A 1G0OA 4ZCQA 1Q7EA 1G42A 2YHBA 2X5XA 3FI0A 3SIXA 2GNAA 3S40A 3D54D 4JZKA 4BKPA 1ZNYA 1Z2DA 1U8AA 1PNOA 1Y5MA 3VH3A 2PYZA 1PYGA 1NVKA 1MV5A 4JQOA 4O2AB 2PRYA 5IKXA 2PSEA 4ZT3A 3HJFA 2CDAA 4D6XA 4RW0A 3B6KA 2HF8A 1T6BY 1TGVA 2C9ZA 2I22A 1D4OA 3BORA 4MJXA 2Q3BA 3FCAA 3FVQA 2QT1A 1LKZA 2WZCA 4QWWA 2FRDA 2X6QA 1OXXK 1GQOA 3T7RA 2G71A 1W87A 1CQZA 1XB2A 1V5EA 1CJBA 3EGEA 1O4WA 3ZXUB 5BN5A 2ECKA 5AI9A 5LA6F 2POCA 2YVAA 5FORA 3VR4A 4GYYA 4AJHA 2BM9A 1P1JA 3K9LA 4OM8A 4RF2A 3R9KA 3WGYA 5K3DA 5K2OA 4Q02A 1MC8A 3CX4A 4JI1B 4CM1A 1OCEA 4XVUA 3SSAA 1C1XA 4NBNA 1PG2A 1VBFA 2GQ0A 2GZ2A 3E5NA 2ET6A 3EQ9A 4FGWA 4WESA 4GNKA 2HA0A 1I7PA 1NNUA 4JMLA 4Q9DA 3WB2A 1ISRA 1ELOA 3WK9A 4C3VA 4NIMA 4LJAA 4IFIA 1OFGA 5KIAA 2C61A 2OHFA 2CVOA 1N1EA 1WUHS 1W29A 3CO0S 5F2KA 3AR8A 1T1GA 2GPWA 1NJGA 3B3FA 1U0GA 2O5EA 3AIIA 2OUKA 4CCWA 4ZVOA 3RNLA 4TL6A 1AQIA 3WLRA 2NP6A 4MQ5A 1YVPA 4WWHA 3UUGA 2VHZA 5DOZA 1UBUS 1DEOA 1CZOA 1SBIA 2QMUA 2QVCA 3K20A 4G0MA 4ZAVA 1EK1A 4KE8A 4JGGA 2EFDB 4N5IX 5J9FA 3B6MA 2P2ZA 4RIFA 4J0CA 4EECA 4MRVA 3JQGB 1JI3A 3MVEA 4KN5A 1O3YA 4YUAA 4P5PA 1AA6A 2V3CC 5KWVA 2WTXA 1QH8B 4PANA 3EPKA 4OQYA 1U9ZA 1NSYA 5JQGA 4KXXA 5IJ0B 4PZDA 2DQYA 5FUWA 3BICA 2IHVA 5EYPA 1XOIA 4BMSA 4DILA 4Y1RA 2O5CA 3LY8A 3FYHA 1OIWA 1CQWA 3O2SB 1QCZA 4JUAA 4ND8A 3MERA 1SXIA 5LN1A 2QL9A 1U4OA 2XEDA 2JFNA 3BFPA 2AN4A 3FZEA 3NHPA 2XGOA 3OZAA 2Y8EA 4OHMA 3GJTA 1B1CA 4DMCA 1OH7A 2AXNA 2HJWA 2WMDA 2GT1A 3ZI7A 4B76A 2WQ6A 1LNQA 1D2CA 1YCGA 3MIIA 2ZSDA 4JP5A 3AOGA 1MTZA 1WPRA 2JCSA 2XVZA 3K8OE 4LY9A 1LS6A 3N2IA 4D0NA 3CIOA 4R7TA 1W59A 1YZLA 3E27A 5B7NA 1UADA 2QBYA 1J8DA 3NWEA 4X92A 1RRCA 1EB8A 1II8B 2DTDA 1QUFA 2G63A 4XUGB 4G0XA 5LBIA 1EJBA 4FOSA 1DWOA 1PZXA 4PXAA 3ROTA 4BCDA 3K6KA 2Q1YA 3O91A 2COUA 1KI6B 1N92A 1QTRA 2BELA 2F3PA 2H2GA 2REXB 1ECJA 2XCUA 3RU7A 1LS1A 4HN2A 4QBFA 4L27A 3EG9B 5IM4A 1F2VA 4ZAGA 2H29A 2JK0A 3B2QA 3BEOA 3GRAA 3BEDA 2A35A 3KWMA 1XYYA 4KO8A 3RSLA 3IE2A 1YIDA 5D84A 1X1BA 3B1KA 3COSA 3SR4A 3ZJTA 1OU0A 1D9ZA 3OC6A 3F8TA 5I45A 1UK8A 1MF7A 1RRMA 4WLFA 5K7SA 4D45A 2IEYA 4LUCA 4AS3A 1Z4IA 1JWAB 1SUPA 3I0NA 4UBNA 4D8YA 4MARA 1WXGA 1DG9A 2I80A 4M83A 2W9XA 1E3TA 2AKAB 3AG5A 3B8HA 1TU4A 1UPBA 5BQPA 3VTKA 2D13A 1M72A 2GJSA 2GJ4A 3AVPA 1NN3A 3D7RA 1LU9A 3NPMA 4PTYA 4ZMBA 3E9RA 4Q4DA 3A11A 1GU1A 1OFIA 2OB1A 3KEGA 4TYMA 1SH7A 1PLKA 5HWSA 3H2BA 3CZ5A 3PL1A 2PDAA 4Q18A 2YZGA 4Y30A 4AZVA 4TMYA 5CGQB 2UU9B 4KL8S 2FW0A 3VSBA 3WLIA 5HKKD 3TVTA 2DQ4A 4UTPA 5JIBA 1TYEB 3LQKA 5HE8A 2ZRCA 4J6EA 2NVUB 3TRIA 2OCXA 5JU6A 4KUGA 4YPFA 3CRVA 3H8VA 4RVNA 1UMDB 1ZH4A 1ZOSA 3M6UA 3UXYA 1AS2A 1ZNWA 3PWZA 5KYGA 1ZW1A 3O4RA 2WJ3A 5TPWB 2ATCA 3BWEA 3A9SA 3AEYA 4IV0A 1NULA 1ZGAA 4MQ4A 1U63A 1VL6A 2A59A 2O8NA 3QLTA 1SXGA 2VAWA 4EHKA 2OXEA 2G4LA 4ZO6A 5JG7A 3QY9A 3QPDA 1A9PA 3AERA 4GZMA 1BW9B 3ADKA 4TZKA 1R3UA 2P4QA 3FBGA 3M5DA 3QE9Y 1CUWA 4KSYA 1PKEA 1SVWA 2WWIA 4BO9A 3MOGA 1PFQA 2IUYA 3GA5A 1V11A 2XA1A 3SXUA 1D8AA 3UUWA 5DCUA 4ENWA 1XA4A 3IH5A 1PDOA 2ISSD 3M9LA 3PA6A 1AXRA