2HMSA

Rectangular-shaped octameric ring structure of an rck domain with nadh bound
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
138
structure length
138
Chain Sequence
KQFAVIGLGRFGGSIVKELHRMGHEVLAVDINEEKVNAYASYATHAVIANATEENELLSLGIRNFEYVIVAIGANIQASTLTTLLLKELDIPNIWVKAQNYYHHKVLEKIGADRIIHPEKDMGVKIAQSLSDENVLNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords YuaA protein
publication title The RCK Domain of the KtrAB K(+) Transporter: Multiple Conformations of an Octameric Ring.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 44
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02254 TrkA_N TrkA-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2hmsA00
3NT4A 1H0KA 4BNZA 4XYEA 4UVGA 4YJFB 1YRLA 4PN3A 1J6UA 4DL9A 1B8UA 2G76A 4ZA2A 3VTFA 4E5PA 2EERA 4S3MA 2A35A 4BNJA 4L73A 4LK3A 5DDIP 4MP8A 4NZ9A 3KUXA 4XZ3A 1CEQA 3U9LA 1DC6A 5GZ3A 2VZ8A 1P0CA 2D8AA 3OJOA 5JYEA 2Q49A 4UVHA 1U2DA 1ZXLA 2IXAA 3FWZA 4EUEA 1A5ZA 3HDJA 5G4KA 4GX0A 4N54A 4HWKA 5KNLA 4GSLA 5EERA 3B1KA 3OQBA 1K5HA 3AK4A 4LISA 2J8ZA 4IIUA 4UVDA 3WYEA 1SEPA 1YL6A 3ZHYA 1UJMA 1YKFA 3D4OA 3Q3CA 1TT5A 3DZIA 4XDYA 1EK6A 4PGFA 1P77A 4BO4A 4M55A 4TROA 4DQUA 4UUNA 4NFSA 3LLVA 3WOHA 5JO0A 1VL8A 3M1LA 2QG4A 3DC2A 4E2ZA 1V3TA 3KETA 3S2GA 1V35A 5CDYA 4FJ0A 2B69A 1AGNA 3QVSA 4Z9XA 2NU6A 2PK3A 3WG9A 2X0JA 4CL8A 1EBFA 3DBHB 4P4GA 4WUVA 6LDHA 3GC6A 3D4PA 3H3JA 1WMBA 3KLMX 4WNCA 3KM0A 4WCFA 1C1XB 1LSUA 1LDNA 4MIEA 5G0SA 4B4WA 1HSOA 2ZYAA 2VUUA 4W7HA 3TNLA 4NQZA 4CODB 4GWGA 4TZTA 2FWMX 2GCGA 2ZJ0A 1UXJA 1ZO8A 3FBGA 3B1FA 3FN4A 3ZU3A 1JN0A 4GMFA 1EUCA 2Q4EA 3RUCA 1Q7GA 5C7LO 1H9AA 3UGKA 1JLLA 4CV0A 1QYWA 3UF0A 3WGOA 1HDGO 3DO5A 2YDXA 2VOEA 2PD3A 1QP8A 2UYYA 3E1KA 2B35A 4J2HA 4AICA 2RHCA 1LUAA 4QEDA 3BMNA 3ZW9A 3Q1LA 4P8RA 1KIFA 3ASVA 2ZTMA 3KLPX 3NDRA 4PLYA 1PQUA 1YBVA 5CEFA 2HK7A 5AQ1A 5L4SA 1G0OA 3DOJA 4FIZA 2GZ1A 3AUUA 5G0VA 5JY1A 2C5EA 2AQKA 5TF4A 4PLVA 3PRJA 3DZJA 4ND5A 4J1SA 3W8DA 4AJOA 1N7GA 1R0LA 2FN7A 3KTDA 3HADA 2WYVA 5FYDA 3C85A 3RC7A 4LMPA 3HN7A 3Q6IA 2PGJA 4URFA 4JGBA 2NU7A 2FR1A 1LDEA 3ZU5A 1H9BA 4J7XA 1IE3A 4JBIA 4CUZA 1YJQA 1YVEI 4WLUA 4YJDA 2VQ3A 2GASA 1ZK3A 4NG5A 4LN1A 4BGEA 3PEFA 5DNAA 4CMBA 3D5QA 2VYNA 3MWEB 1YQXA 1I3NA 4U6QA 4BUCA 4CQMB 4UUMA 4QUKA 2PH3A 3AY3A 4FFLA 2HJSA 1EVZA 1HE5A 4MKZA 4WOKA 1RJWA 3B70A 3DZHA 3KXDA 4B79A 4E0BA 1E6WA 3HFSA 2DQ4A 1W73A 2HDHA 2NVUB 4K26A 1D7OA 2X0NA 3TFOA 2I5PO 1TA4A 3PGXA 5CDTA 2G0TA 3ZV4A 3JQGA 3AI3A 3H9QA 3PLRA 1B8PA 2DU8A 2OXIA 1LJ8A 1PR3A 5BNTA 4DGSA 3DBVO 2FSSA 2E82A 3SJUA 5TLSA 2GUGA 2Y99A 3RQSA 4J7CA 3TJRA 3FF4A 4IBOA 2CVOA 3PPIA 4IXTA 4L75A 2VRCD 3I9KA 1ZJZA 4ITUA 2W90A 1BDBA 1ISJA 1U3WA 1ZNQO 4BNUA 1TLTA 3VPSA 4D79A 3V2GA 2ZB4A 2NV6A 3E5RA 2G5CA 3OETA 4A73A 3EGOA 2VHVA 1MUUA 2FPIA 4Q9NA 4IXWA 4J6FA 2FRDA 4KUEA 4R1TA 1IZ9A 2WM3A 1HF3A 3GVHA 3WMWA 3JD0A 4PVDA 4NBUA 5EQDA 4RDIA 3PZRA 4HY3A 3DMTC 4XYGA 3FNEA 3AW9A 1Y5MA 1A9YA 2QHXA 1GTMA 1O89A 2QRJA 1NHWA 3OJFA 3AM4A 4TRMA 2NADA 3C7DB 2OBYA 1NQTA 2X0IA 1XELA 4GX5A 4EJ6A 3E48A 4NJOA 4RZHA 5IN5A 1T2AA 2O3TA 2GZ3A 2JHFA 5LDGA 2HQ1A 1XG5A 1YOVB 1P74A 3TRIA 2JD0A 5JYDA 1LLQA 3V8BA 1Y8RB 2OO5A 4IQ8A 1N9GA 3PHGA 1E7WA 4EITA 3VH1A 3EVNA 1XQ1A 2IZZA 1IHYA 1PTJA 2RHRA 4RPJA 2QRKA 1XHLA 4QX6A 1GZ6A 4E33A 3GVXA 5B37A 2AE2A 1MP0A 2QYTA 5B4UA 1OMOA 2W2LA 3OICA 4DC1A 1HZZA 4CM4A 4DIFA 1OZAA 1YB5A 4H7PA 4BKRA 3GA0A 4ZQGA 2NSDA 3FTNA 4PFJA 4JP2A 2GDZA 1ZEJA 1NWHA 3QVOA 4CLOA 1R4MB 4AJLA 4U6SA 3K73O 1OC4A 2XAAA 4IM7A 1AE1A 2B4TO 3AOGA 4I9NA 1PJ3A 5CG2A 5KJFA 2DPGA 2VN8A 1DIGA 1HT0A 4LSWA 1LLDA 3JQFA 4W9NC 4YRDA 4I9HA 5IDWA 3BMOA 3E18A 5EN4A 5A04A 4Z0PA 2FY8A 3WGQA 3L9XA 2P4HX 1XIVA 2EKPA 4N5NA 4OM8A 4GMGA 4TKMA 3WGHA 4YACA 4RL6A 3JQEA 1HKUA 1BW9B 1MLDA 5I9MA 1Y1PA 4Z0HO 4R68A 3RROA 4B4VA 1VJ0A 3S1LA 2VNSA 3ANMA 4B3HA 1ADFA 3JQCA 4AVYA 2GGSA 4TKLA 4FOSA 1ENYA 2E49A 4YEDA 5ER6A 5IF3A 4CL3A 4DIOA 3V2UA 3RWBA 3WDSA 1I30A 2X9VA 1NVTA 1GYQA 3OFSA 1ISGA 4GLLA 2Y68A 3PXXA 1N1EA 1N5DA 4PG5A 3GN2A 3KYBA 3HG7A 3BMQA 3PYMA 4DPKA 4BO7A 3AOEA 1PZFA 3GK3A 2VHWA 3ETEA 3JQ8A 1W4ZA 3SXPA 3M1AA 4QO8A 1CRWG 3WWYA 4FC6A 5DBGA 4PLCA 4GL4A 4R3WA 4G5HA 3EK2A 1IZ0A 2GYYA 3FHLA 4CM9D 4KZPA 4ROSA 1ZBQA 1MGOA 4FJ2A 5IDXA 2D5AA 1Z82A 3GZNA 3E6AA 1YL5A 4D42A 4ZQFA 3PHLA 3RVDA 1CWUA 2B4QA 3IIEA 1K6XA 3JYNA 3SC4A 2O3UA 2BELA 3DL2A 1O5IA 3WNVA 4B4OA 3GVPA 1LDBA 2P91A 5C7OO 1H2HA 4ALMA 2VWHA 3AWDA 1M67A 3PWKA 1XGKA 2X86A 4IPTA 1XU7A 2B5WA 3MEQA 2V6GA 3RUEA 4JLWA 4WECA 4BQPA 1UUFA 3WJ7A 1L7EA 1EVIA 2AA3A 4IDEA 1DLJA 4RPHA 3T7EA 1C3VA 3OA2A 3P7MA 5ILGA 1BG6A 4CM6A 4G2NA 1ZCJA 4D43A 3PFFA 3LC1O 2F1KA 1AXGA 3W4JA 5EMHA 2PGLA 3EHEA 5F5NA 4MVJM 3DBLB 4WJZA 1U28A 2I67A 3VKVA 4B7XA 1HLPA 3GOHA 2X9NA 3QWHA 3MZ0A 3MJSA 3WGZA 3IJPA 4DQXA 2OMEA 4H16A 1OAAA 4BGIA 1NM5A 4E30A 5KIAA 4AJHA 1R15A 2PZMA 2P9EA 3ITKA 4OHUA 5B12A 1QXSA 1KVRA 4RVUA 1NX6A 1P1IA 1H6BA 4IDFA 1DOHA 3DMTA 4TRJA 5BNFA 1LRJA 5GZ1A 3K31A 5H81A 3DAGA 1IHXA 3D3WB 5DP1A 1CERA 3NDIA 4HFRA 5CDUA 2ZATA 7ADHA 1E3WB 3DBRB 3KHUA 4B3IA 3DOOA 1GAEO 4JQCA 1YXMA 2X22A 4KUGA 4P22A 4XB1A 5IN4A 2C20A 1TVEA 1Y8QB 5COQA 3BTOA 3D1LA 5LCXA 1GQYA 2B83A 4A5OA 3GT0A 3K30A 3K92A 1FF9A 3ZHXA 4XD2A 3BHMA 5BSFA 1VC2A 1YBMA 4Y6RA 3ULKA 2Z95A 3E82A 2ZCVA 2GLXA 2EGHA 3LF2A 4BB5A 2ZTVA 1GPJA 2JL1A 4MKXA 4GH5A 1LSSA 1ZK2A 3CPSA 3IUPA 2BFMA 4XIYA 3TZQA 5KVSA 1GZ3A 1MFZA 5I7EA 1DC4A 3UUWA 1AN9A 1RM0A 2PY6A 4XX0A 1WMAA 4BKOA 3WLFA 3CH6A 4EI2A 1D1SA 3OJLA 1KC1A 3F6YA 1LSJA 1E7QA 2AG8A 1KC3A 4KOAA 4AJIA 3H5RA 2AEMA 1SAYA 1E5LA 4FC7A 4DUPA 3ZH2A 4ZHSA 4IZHA 3GVCA 2X5KO 2YHIA 4W9NA 1NVMB 3AI1A 5I7VA 3OQ1A 4IUYA 1CF2O 1FMCA 1K3TA 3GG2A 3A4VA 3ZU4A 4PCVA 4E5NA 3RKUA 4R4JA 3GLQA 4J1TA 3K2EA 1DRVA 2JD2A 2F00A 2W2KA 1P33A 3NT2A 4OXNA 1JKFA 1ISHA 1AHIA 1SOWA 3DXFA 4BB6A 3G1UA 3HDYA 5A3VA 1Z6ZA 2BFAA 4PLZA 4GKBA 2NM0A 3IKVA 3U09A 2YUTA 5EPOA 1H2BA 1J49A 1FJHA 3RD5A 3VH3A 1H6CA 1WW8A 3EZLA 4ILKA 3ZWOA 5JY6A 4GKVA 4R1UA 1SO8A 1Q1NA 4XA8A 2GPTA 1R0KA 3F3SA 2JCYA 4E31A 2AEJA 1QYDA 1GV0A 1NASA 1UZLA 2DLDA 3JYLA 1WLYA 2DM6A 4MINA 5A4DA 3ORFA 2B4RO 3CUKA 2Q50A 4CLDA 4ND3A 4FFNA 2J3HA 1XR3A 3TF5A 3LLSA 1X7GA 1OOEA 4IY1A 1E7MA 4J7UA 4LW8A 1Y9EA 3JCZA 1EDOA 2UDPA 2UVDA 1TI7A 3KYDA 3VDQA 3AM3A 3DZKA 1N2SA 4NMHA 1RM5A 4R01A 3LT0A 1ISFA 3QJ5A 2DFVA 4NH4A 1U1IA 3BYZA 2H9IA 1K0UA 2VTDA 3V1YA 3WS7A 5L7WA 1BXGA 2NQ8A 3ZV5A 2O2SA 5IDQA 5LDHA 1H5QA 2V6BA 4D0RA 4AJKA 5I8WA 5K6AC 4TRRA 5KWEA 2CD9A 3HB5X 1K6JA 1HSZA 5JC1A 4E21A 4BNWA 4MVJP 4YJHB 1LEHA 1EQUA 3TOXA 4CM3A 3NV9A 4D3SA 4NK5A 2HKIA 1HWYA 2RBEA 5TT0A 2V6FA 1UDAA 2CDBA 4PG6A 3ZWAA 1DFHA 5CP8A 3GUCA 1HE4A 3AUAA 4IGEA 3S2EA 2C0CA 3D0OA 3ON5A 1ADCA 1O95A 2CNBA 2ILTA 1T2DA 2QYSA 1LRKA 1J0XO 2GO1A 1IPFA 4ZGWA 2VUSA 3HSKA 2OORA 4D41A 4RPGA 1E7YA 3GNTA 5TJ9A 5J23A 5JCXA 2OP0A 5AOVA 1I5RA 1A4IA 1YQDA 1DRWA 2PD6A 2JCVA 4WEQA 2AMFA 1UP6A 3ASUA 3HUDA 2BLLA 1PGNA 1NXQA 3FPCA 3RU9A 5HWSA 3MOIA 4LCEA 2VWQA 1KOLA 1ZEMA 3CZMA 1TT7A 1VI2A 1DIBA 4DTIA 2ZIZA 3KZVA 3JQAA 4R1NA 3STHA 4RGBA 1GCUA 2WEKA 4B4UA 3R1IA 4DC0A 3DDNA 1SOVA 4R9SA 2FR8A 3RJ9A 2JFHA 1RM3A 4M87A 4IJWA 3CEAA 5T8KC 4HV4A 3GNSA 3LZ6A 4L8VA 4TQGA 4AJEA 3GGPA 3I9OA 1YS4A 3ANNA 5I7SA 4R5MA 1VPDA 3DEYX 4GBJA 4WLOA 3E8XA 2AQHA 2Y1OA 1D4FA 4K6FA 2J5KA 1GEEA 3CE6A 4U7WA 4FSHA 5T6BA 2GR9A 3TL2A 2EWMA 1NPTO 5JW6A 3TZHA 1SBYA 3NDJA 1V8BA 1ULUA 2E37A 4IDCA 3QRWA 1E3EA 3CIFA 1CJCA 1X7HA 2CSUA 4UEKA 2BKAA 5C3MA 3V1UA 4LMRA 3ZWCA 1NBOA 4QO7A 3JD1A 4M1QA 5L7TA 5DOVA 1U3UA 2OFPA 1DSSG 1UXGA 3OM9A 4JBGA 3NRCA 1LLCA 2DT5A 1NR1A 2Q1UA 4EBFA 4IMPA 5IAAA 1P1FA 3HDQA 1A7KA 3ONEA 4HXYA 4D44A 2D3TA 2FR0A 4E5YA 3U4HA 4Z3KA 3ITDA 2B0JA 2Q3EA 3AUSA 3FCOA 2O48X 3F4BA 2HMWA 5GY7A 5FEUA 2ZB7A 4DA9A 1U2GA 2BFPA 3HQ4O 1ISIA 2RH4A 1ENPA 1T2EA 2FZEA 2WD7A 1KEWA 5TX7A 4CJXA 5B4TA 1XCBA 2DUWA 5KCZA 4JCOA 3ZI0A 1X7DA 5HS6A 2CF5A 5I8ZA 1I36A 1ML3A 2O3RA 5I9NA 2EF1A 4KTTE 2ET6A 4W82A 3I4CA 5MDHA 4E5MA 4E5KA 2BD0A 4CMGA 3IQDB 1M76A 4BNIA 4ZICA 3SLGA 4YAGA 1C1DA 2AEFA 2I3AA 1T1RA 4NJMB 1DHTA 4Z3DA 3RUFA 5F21A 4QECA 1FDSA 2EW8A 1DEHA 3KOUA 4AJ2A 3AM5A 2HK9A 5AYVA 4FJ1A 4WK6A 2R6JA 3HJAA 4IGFA 3FTPA 1E7SA 4BV8A 3PHIA 3WWZA 3ROPA 3DR3A 4II2A 4HUJA 3RBXA 4CQLA 1ARZA 2Q1SA 5KVQA 4PRKA 1GQQA 1NFRA 1T25A 1XDWA 3H9UA 3ZNOA 4N7RA 2Y66A 1GL3A 4NIMA 1ISMA 5AXDA 4GSKA 2P9CA 1I3LA 3ENNA 2A92A 3PDUA 4GQAA 1A7AA 2O3QA 3W4KA 3UCEA 1QG6A 1K2WA 3C8MA 4I5DA 4XJSA 4DMMA 3ZNNA 1F17A 1CETA 2OOSA 4I08A 7MDHA 5K6AA 1R4NA 4OGWA 3L6OO 1Z73A 3BAZA 3PTZA 4EZBA 4BOYA 3ONDA 4XR4A 2Z1NA 4R1SA 4W4TA 3JQFC 3BMQB 1YO6A 4M8SA 5IDYA 1A27A 1L7DA 3IAHA 4FOOA 4XEHA 4BMVA 4QT0A 4U5QA 2XXBA 5H83A 2WTBA 3F46A 5HBRA 3D5TA 2VRCA 3R3SA 4DLBA 3O38A 1SCUA 2EHDA 4YT8A 1B16A 2JD1A 4YA6A 4HFMA 1SNYA 3EAGA 4MVJA 4CM4B 3GZNB 4YJGA 5CG1A 2DAPA 3UHAA 2PA3A 3EY4A 3RSHA 1T2FA 1BWSA 4ZQBA 2YDYA 4EJMA 4J4HA 4NPCA 3UCXA 3QIVA 1PJ4A 2Q46A 3ST7A 3EUWA 1LA2A 4GVXA 1H93A 4MVJG 1QRRA 4XYLA 3QWBA 2O7SA 3AOEC 1C0IA 1DO8A 4ID9A 4QFDA 4C7JA 2Q1WA 3VZPA 3JYPA 5T57A 3M6IA 2WWRA 1I2BA 3GR6A 3ZWMA 4YT5A 4RPLA 5T8KA 3WMXA 3WXBA 1VJTA 2NQTA 3DFZA 1EMDA 3F1KA 3P2OA 4O5OA 3AY6A 3D64A 3LU1A 3RBVA 4OAQA 1NTOA 1WZEA 3NX4A 4W99A 5THQA 1B3RA 4BGUA 4L4SA 4IINA 2YHUA 3EVTA 3ZDFA 2B36A 1W8DA 1PZHA 2D0IA 2YYYA 3KYCA 4O59O 5FI3A 3DTTA 2IEDA 2WDZA 3DONA 1WAMA 2J6IA 4AL4A 4FD3A 2PZJA 2CFCA 1LLUA 3LF1A 3UAGA 3WTCA 1VJ1A 3PHHA 5L7YA 4A0SA 4JK3A 3LT1A 5G4LA 2C5AA 3MJEA 1Z7EA 1IULA 2CVQA 2EP7A 3K2BA 4FQ8A 4MIOA 1XSEA 1TXGA 1BVUA 4WE3A 3VKUA 3UH1A 2WMDA 2WJPA 2ZJ1A 4WLVA 1EVYA 1X0VA 3PJFA 3WSWA 4GVLA 2QZ9A 2HMUA 1U9JA 2NTNA 3ZV3A 4NI5A 3CINA 1G6KA 4UUPA 3RU7A 3ETGA 1Y9AA 3UXYA 3DFUA 2Y1GA 3ZZNA 4JROA 4OKNA 4G65A 4NDNE 1E0DA 1YWGO 1EE2A 2A4KA 4I9UA 2DUUA 4RVDA 1UDBA 1WVGA 1YDEA 4CLRB 1X15A 4F46A 2Y05A 3ABIA 1CYDA 1HETA 3R6DA 4IDDA 4E2YA 2CDAA 3DZGA 1P1JA 2IZ1A 2VTEA 1QYCA 3DHYA 1JWBB 5TJHA 2P5YA 1NFQA 2NWQA 1B8VA 2G1UA 1GUFA 2NNLD 2JKVA 3GPDG 5A5EA 2OZPA 1PJCA 2HUNA 3B20A 4O1MA 1MG5A 4BNHA 1KEVA 3WBBA 1N92A 3O03A 1GYPA 1YE3A 1SC6A 3I9MA 3P5SA 4D45A 1VLLA 2QX7A 4NNJA 1C0LA 1V3VA 4QSMA 3ZWPA 1HDXA 4NHEA 3ADPA 1M2WA 3INGA 1F0YA 3OA0A 3WB9A 4RPKA 1KYQA 4M89A 5TIIA 1E77A 3JD3A 3LSYA 4P4NA 2VYND 3BIOA 3WQSB 5JCJD 2W2KB 5TS3A 4XWYA 1M6WA 1DIAA 1B3BA 3A06A 3TDKA 2WSBA 4J43A 5HS4A 4KDEA 3HE3A 2E6UX 4J2OA 3GDFA 4H3VA 2NVBA 3Q9UA 2Y0CA 2YQ4A 4ZRNA 3X2FA 3PJEA 4M54A 3H4VA 2X5OA 4DXHA 5TRTA 3OP4A 3ZWBA 4DREA 4DPMA 3GHYA 2J5RA 1PS8A 1QLHA 3RFVA 4EW6A 2VZ0A 1ZW1A 1K89A 4FFOA 5IJZA 5IXYA 1R66A 3JSAA 4NU5A 4XR9A 3OIDA 5EQFA 1CDOA 3U49A 3E9QA 3K96A 1LX6A 3G0OA 2C82A 4MPDA 4BHTA 4WLNA 1UZMA 3L4BC 5F1KA 1ID1A 3DQPA 3WGIA 3BTSA 3EC7A 4Z0TA 5ICMA 1JVBA 2O4CA 1B2LA 5A3JA 5T67A 3I6IA 5F3RA 1ZK4A 3QVWA 4J1QA 4RVFA 3ZWXA 1HLDA 3NJ4A 4CMKA 5ES3A 5THKA 1BXGB 4MJLA 2PTGA 2O3JA 5COBA 1P31A 4AG3A 1GUYA 3HNPA 4PVCA 2D59A 3AU9A 1GV1A 1Q7BA 2HJRA 3WX0A 1R0SA 1YH3A 5ENDA 2ZCUA 3INRA 4N5MA 3RBZA 1I3MA 3BXXA 4ALKA 3I5MA 1ZIDA 3WIEA 4CPDA 3WLEA 9LDTA 5L53A 1GY8A 1DPGA 1TEHA 1C1XA 1QYVA 2DTXA 5AXCA 4L74A 4CUJA 3GMSA 4YAKA 3ZGYA 3MJCA 2J3IA 4DPLA 1V9LA 3WTBA 4KP7A 1I33A 5CEEA 2BRUA 1MC4A 2B5VA 1W6UA 4Q3NA 4E2WA 1G1AA 2VYVA 4MVJI 3H65A 3ZHZA 3MOGA 3BTVA 4MO2A 3L9WA 3SLKA 4XGIA 5HRUA 3BMCB 4BO3A 1HZJA 3BHJA 5DOZA 3ZN2A 1I24A 2W2LD 4RZIA 3JQAB 2ZB8A 5KJEA 2VWPA 2GRAA 3LQFA 4IDBA 4BGVA 1G0NA 1VE9A 4PZCA 4U0KA 4UULA 4FFRA 4YWJA 4RVGA 2WE7A 4DMLA 1I0ZA 4IS2A 4IJVA 4WGGA 4OH1A 5DT9A 3Q11A 5ITVA 1RWBA 4CM5A 1DIHA 4O0LA 5KJ6A 3L4SO 3RUDA 3H8VA 3WFIA 1KS9A 3F5SA 2IRWA 2OL4A 3GGGA 4CMEA 2Z5LA 3DTYA 1BXZA 5LC1A 1QLJA 4FBGA 3H5NA 5HTOA 2C29D 4BO1A 3NTOA 1BGVA 4D46A 2ZTUA 1NQAO 4CQMA 4YYZA 2I9PA 3UFXA 5BSEA 3DZFA 3NEPX 3OSUA 1JKIA 3OIGA 3NYWA 2H5LA 3GH3A 3VVCA 5CDSA 2NVUA 3H2SA 5KKAA 3QP9A 1PGQA 2VNAA 3JD4A 5CPFA 3QQPA 2D2IA 1M75A 4XDZA 1X1TA 4EYEA 4NBTA 5GZ6A 1KEPA 1SB8A 3ENKA 1PWXA 1PJ2A 4FGSA 4ZD6A 1DIRA 4ZU3A 1VKOA 1Z75A 4A26A 3O26A 4K28A 2EJVA 2O2YA 4ESOA 1AXEA 5DCUA 1HDCA 5GMOA 4XKJA 5G4KB 2PNFA 3AFNA 3IC5A 4ZRMA 5G0UA 2GN9A 4HBGA 3E03A 3E9MA 3WNQA 3OHSX 1XKQA 3R3JA 3PQDA 4IQGA 3I9NA 1V6AA 4ZQHA 1U7TA 1SMKA 1ONPA 2I65A 3C7CB 1QR6A 4RF5A 4BO9A 2Y93A 3HB4X 4IZIA 3JV7A 3TSCA 3CKYA 3X2EA 3GAZA 2RCYA 1OC2A 3ZWVA 4BVAA 1TT5B 2I66A 5L4NA 3C1TA 3NGXA 2AG5A 1PL7A 4WPGA 3PGJA 1O6ZA 3MTGA 1EVJA 4UVIA 2DBQA 5HM8A 1LI4A 1LRLA 5F5LA 2EKLA 5K9ZA 3KRTA 3H9JA 1EFKA 4XB2A 3A28A 1NYTA 5L3ZA 3VH4A 2J5QA 3L4BA 1DFIA 3QHAA 2XPCA 4XJTA 1LDYA 3L07A 1U4SA 5B4VA 2BMAA 4XRGA 4WCFB 2GZ2A 1BSVA 4F3YA 1YOVA 2HCTA 4TVBA 4DYDA 3N7UA 2C2XA 4CR6A 1J4AA 5EINA 1GD1O 1Y8RA 1DB3A 4FGWA 1N8KA 3VAZA 5HA5A 3O4RA 2J3JA 3LK7A 4BNNA 5T5QA 1O8CA 4BNVA 2GD1O 3R0IA 3OJ0A 3S8MA 2GERA 4J90A 4OQYA 1R4NB 3CMMA 4JXKA 4IJKA 4XRRA 2EW2A 2Y1CA 2QIOA 4IQ0A 4WOJA 1D8AA 1PJBA 3QV1A 5AXBA 3WIDA 5A05A 1PR9A 4HNHA 1EFLA 1P0FA 3PYXA 3RUHA 1GR0A 4CLHA 3BMNB 4ZQEA 3TPCA 4ALNA 3K8ZA 4IS3A 5BSGA 1A71A 4Z9FA 1R4MA 4ZN6A 3TWOA 3WYCA 1T4DA 3MJVA 4Y8VA 2GN8A 4NBRA 4YJGB 3I3OA 1T1SA 1H6DA 1SB9A 5ADHA 1GDHA 3FBTA 3KSUA 4BO0A 3QVTA 3GRKA 2DBRA 3IJRA 4YT4A 1LU9A 2HRZA 1ZSNA 4UREA 5G2OA 4M49A 3LC2O 3HFGA 3W8EA 1MFPA 3TQHA 3FSRA 3H2ZA 5KOIA 1P1KA 3CSDA 2EIHA 3ROKA 3TL3A 4Y6SA 3RC9A 4ZJUA 4WNIA 4HFNA 4TSKA 5F1OA 4MVJE 4CMCA 1FDTA 1NQOA 2HRBA 4ND4A 3MTJA 1UAGA 5EESA 4YVFA 1RYDA 4XIJA 5KTKA 1UP4A 3G17A 3GZ4A 3IDSA 1J5PA 3AJRA 5A1TA 1YGYA 3I52A 3HZZA 5EIOA 4J1NA 3L77A 4QFCA 2X8LA 2E4AA 2NVWA 2PWZA 1LSOA 5JNLA 4B3JA 3PWSA 4DIBA 1C14A 3NTRA 2FMUA 4R69A 1GZ4A 3HDHA 3NTQA 3KYCB 1H94A 1YBAA 3JQGB 1UH5A 1O0SA 3I1JA 1MG0A 3SX2A 1ONOA 2C2YA 1F8GA 4J16A 5H82A 5G0WA 2ZTLA 1DFGA 4XQ9A 2GNAA 4EEXA 3PK0A 4I8XA 1IOLA 1I8TA 3D7LA 2YY7A 5ER9A 1PIWA 1XA0A 1KEUA 8ADHA 1GPDG 5JSFA 2Y1EA 1I32A 3DMYA 3GY0A 5T64A 2R2GA 4ALIA 4Q3EA 4XQCA 5BT9A 4P38A 5IG2A 4PLHA 1A4UA 2I76A 1KERA 3RC1A 3RUIA 2Y1FA 3C1OA 4J3FA 2C07A 1OI7A 3DAPA 3GPIA 1VSVA 1X1EA 2DTDA 1TB4A 1DXYA 3QSGA 3TZCA 2PZKA 3IUSA 2PD4A 2HMVA 3PQEA 4HP8A 4K1LA 4YR9A 1E1NA 4QQRA 1EEHA 4GX1A 4ONEA 3W1VA 4YRBA 1IPEA 2YV2A 1ADBA 4DYVA 4HKTA 5K0ZA 1I2ZA 4OO3A 3U4DA 2Y0EA 5JXWA 4R41A 3QE3A 3UICA 3I6QA 2P4QA 4GPD1 2X58A 3HHPA 1Z45A 4J9VA 5DBIA 5L95A 1YB4A 3VDRA 1MX3A 2VOJA 2JAPA 2QW8A 3KO8A 4HX5A 4RDHA 4RVHA 3RKRA 2X9GA 1GEGA 3OH8A 4YPOA 2NLOA 3NAQA 4RO0A 4EDFA 1S6YA 1E7RA 4EGFA 4FS3A 4R54A 2P5UA 2I6TA 5JE8A 3WR5A 1N9GB 2HU2A 1U5AA 4E32A 4AFNA 4YB8A 3SJ7A 1PQPA 4BNYA 1NHGA 3KBOA 3PP8A 1U7HA 5TNXA 1I3KA 2DVMA 2C7VA 3DBRA 1HE2A 1PZEA 1HDOA 4TVOA 4OYRA 2YW9A 1O94A 3I9JA 2UUOA 4MP6A 2PFGA 5C37A 1WXDA 1Y8QA 1T24A 1SEVA 2FP4A 3AFMA 3G3EA 3INTA 5JLAA 1L1FA 3V1TC 4C4OA 5A9SA 2YFQA 3GDOA 2YV3A 4Y9DA 1E6EA 4TWRA 2H1SA 1WWKA 5B1YA 2UAGA 1Y7TA 1O9BA 5L9AA 3WQRA 3JQBC 3SVTA 1JU9A 4J4BA 4BNMA 4CLOB 5KVCA 2EEZA 5IFLA 3PWZA 2GF2A 4BO8A 1UAYA 3JQAD 3VPFA 6ADHA 3BZUA 4YAJA 3EYWA 3BMOB 2DKNA 3DB2A 3IP3A 4A27A 4RJTA 1LNQA 3LDHA 5ITWA 4PLGA 3V5NA 4AJ4A 4BKPA 4TRNA 3O8QA 5ENVA 2QRLA 1VL6A 1LXCA 1VSUA 2O7QA 3H9EO 1BHSA 4JBHA 3GEGA 4BNLA 3H9GA 2H6EA 4A2CA 2H63A 2Q45A 4BNFA 2RIRA 1ZSYA 3SBOA 4RORA 1RYEA 4NBWA 2X23A 4IMRA 2WE8A 4FR5A 2V6MA 2PKQO 4OSPA 4BMNA 4F6CA 3CXRA 4JX8A 1ZKMA 2CMDA 4YAEA 1JVSA 3B1JA 2A9FA 3OMLA 4M86A 5A06A 1PJQA 1MC5A 4NR0A 5C5IA 1MXFA 3RASA 4L4XA 1HRDA 3L6DA 5DULA 1HDYA 5JDIC 2P68A 1FDUA 3ZWWA 3TFQA 3C3XA 3JQ8B 2W8ZA 1E1MA 4CMIA 2FZWA 3FR7A 3NGLA 1JAYA 4LGVA 3VZQA 2LDXA 4CLXA 4BIIA 3EDMA 3PIIA 5DF1A 3JQ9A 3RFTA 2EP5A 3FNGA 3LVFO 5EL0A 4MVJF 3T4EA 3ZW8A 3DAFA 3NT5A 2P9GA 2QZZA 5CDGA 4KUHA 3FD8A 2AHRA 4YAIA 5AXAA 1PS0A 1EDZA 1EBUA 3GEDA 1VM6A 4UVEA 4PLTA 3ANLA 4MIYA 1LC3A 4XGKA 3RCBA 2JFGA 3VZRA 1ENZA 2AXQA 3WFJA 4Y6PA 1E1KA 4IJUA 2W4QA 1VL0A 1DDOA 2C7GA 3MWDB 2DFDA 2NACA 3UOGA 1QORA 4JNKA 1BVRA 1KVQA 5JDCC 1A72A 3RJ5A 3ROQA 2IE0A 2PR2A 2JFFA 4HADA 3ZNPA 4DLAA 1WPQA 4YQZA 3T7CA 5F1PA 3H3FA 3P2YA 4BNKA 5A9RA 5JFOA 1ADGA 4ALLA 1WZIA 1F12A 1ORRA 3IMFA 4XYMA 1NAHA 3UW3A 1JAXA 1PGJA 4GGOA 4N5LA 4J49A 2VT3A 3WBFA 4YJHA 4ND1A 1QV7A 2EG9A 4DBZA 3ZNQA 1NVGA 2HAEA 3GN1A 1T4BA 4MOWA 2IZ0A 3VHRA 3VZSA 1WDKA 4KQWA 4E13A 1KETA 5JPIA 4PZDA 1LDMA 5ILOA 1ZXBA 4TZKA 1U4OA 5KVVA 5JCJA 1V0JA 2Y1DA 4YRAA 1CIVA 3MJTA 1QYXA 1EK5A 3GDGA 3NKLA 1YONA 2X1HA 1P9LA 2Q1TA 4U0JA 3N74A 2BH9A 3CMCO 3Q2IA 2XF8A 1Y6JA 1PGOA 5JAIA 1HE3A 4XGNA 1LQUA 2X5JO 4CV2A 4FN4A 4BV9A 4BNXA 1FK8A 1JWAB 3FRJA 4L9RA 3PDJA 2GSDA 1ZK1A 2YZ7A 2HO5A 5DZSA 1PWZA 1YJ8A 1PEDA 3GFBA 4CMEC 1ZJYA 3H5AA 3AY7A 1R37A 3KSDO 4Y67A 1ZZEA 3OBBA 5EJ2A 4CM8A 4B8ZA 1PS9A 4LVUA 1EQ2A 5JMWA 4EUFA 4U8GA 5L51A 1KY5A 4J9UE 4W6ZA 3U62A 3UN1A 1ZSVA 4MVJD 1FDVA 3VPXA 1QKIA 2X6TA 1JQBA 1B7GO 3QWIA 4MKRA 4E4YA 1XLTA 1GQ2A 1Y81A 3U4IA 4FFMA 4PG7A 5A02A 4XQEA 4I5FA 1Q2XA 2VHZA 1UZNA 3JQ7A 3JQBA 4KMSA 1NWCA 4K6CA 1XQ6A 4E2XA 2XXJA 1UXHA 5A03A 3G1TA 4OOEA 3F1LA 3ZCXA 4B7CA 4BKUA 5L40A 2WYUA 4X54A 2YHIB 4GAEA 4WLEA 3NJ8A 2C59A 1ZK0A 3GRPA 4OMUA 3VPGA 2VHYA 4Z9YA 2ZK7A 1Q0HA 2V65A 3IOYA 1D1TA 1XYGA 4P4LA 3COSA 2GN6A 3PFWO 4WEOA 4F45A 4CM9A 4RV9A 1HL3A 3GNQA 1GYRA 4YJFA 2DBVO 4RF2A 1N7HA 1XWFA 5U9CA 3GQVA 3QY9A 4AJNA 5BNIA 5DCWA 1PQWA 4LCJA 4BO2A 1X0XA 4B8WA 4LRSB 4WCDA 2OBNA 2YQ5A 2Q2WA 4UAGA 3W6UA 4CV1A 1IUKA 2IEBA 2P2SA 4RCVA 2PV7A 3W6ZA 4L0QA 4GWKA 5JDIA 5KKCA 5JMPA 4BNGA 2AQ8A 2ZQYA 3K6JA 8LDHA 3ZWNA 3L6EA 1DC5A 5FI5A 3KYDB 4Z6KA 4PLFA 5CAEA 1N1GA 3VC7A 3QWFA 3KV3O 4GI2A 3PQFA 1MXHA 1GFSA 2BF7A 3WGYA 2DTEA 2FPGA 2RAFA 4FW8A 1P3DA 4NFYA 1Y5RA 4NJMA 1P1RA 3VH2A 1EUDA 3G49A 4MDHA 4DVJA 2Q99A 1NNUA 1M6HA 5U4QA 4OJNA 2AQIA 1YQGA 4CM1A 3OIFA 4CLEA 5DN9A 2VRBA 4EJ0A 1QMGA 1KVUA 4OSOA 3H7AA 2CVZA 3DBHA 4IIVA 4DWVA 4CMJA 1W0CA 2DC1A 2UUPA 3GHHA 3T4XA 4EEZA 1E6UA 3PYLA 4W7IA 5JDCA 4YQYA 4Q3AA 1YB1A 3QLJA 4L4RA 2HLPA 2ZKLA 2ZQZA 2ZYDA 3LC7O 2G17A 2RH8A 4PG8A 3ICCA 3I9LA 2IYPA 4KTVE 2OHXA 1NPYA 1CQJA 2AE1A 4I5EA 3C7AA 4PLPA 1DC3A 2PLAA 4LSMA 4JJIA 4NBVA 3EW7A 4WASA 3VVBA 3W8FA 2O4UX 2BFOA 1OFGA 2IYOA 4B7UA 3PI7A 3UCFA 3DWFA 2Y0DA 1B14A 3QWAA 1ONNA 4E12A 1NFFA 1VKNA 3U5TA 1PZGA 3QA9A 1MB4A 4MVJH 4UEOA 3HWRA 1HYHA 3Q9NA 1PSDA 2POQX 3KVOA 3BHIA 4Y98A 3F9IA 5IXSA 4OQZA 1DLIA 5A9TA 5AVOA 3AU8A 3O9ZA 4JJGA 2YJZA 1JW9B 1UXKA 1IL0A 2R00C 2OGUA 2FHSA 1S7CA 3OQ6A 1Q7CA 1E3LA 4A03A 4A7PA 4ZVVA 4FCCA 2J3KA 1PGPA 4I1IA 5ICSA 4N18A 4L76A 1WDMA 4TMFA 2PKRA 3JTMA 5L45A 4HFJA 4LRTB 4PZEA 3I83A 3IS3A 4Q39A 1B15A 4J4TA 1UXIA 2PH5A 1X14A 2O3SA 4JP3A 1YDWA 2HK8A 4FDAA 5IZCC 5FFFA 1C0KA 1LTHR 3ZU2A 1Q0LA 1ZUD1 2EKQA 5FF9A 5BSHA 1ZMOA 1DJQA 3FPLA 4ALJA 1HTBA 3JQ6A 4AJ1A 5C7IO 3JYOA 3JYQA 1F8FA 5JBIA 5BR7A 1AHHA 1F06A 1UDCA 3RUAA 5A5FA 4D0SA 1U8FO 1VRWA 3GAFA 4OIMA 2OP1A 3OF2A 2Y67A 1RKXA 1R16A 2BGMA 2CY0A 2NUAA 2SCUA 5DCYA 4CM7A 3G79A 3PZBA 2IXBA 1NP3A 3P19A 4YBZA 2DBZA 1A9ZA 1PU2A 1KVSA 3PJDA 1T26A 1ENOA 1LQTA 1OBFO 3PHJA 4I5GA 4OXYA 3S2FA 1RM4A 1BMDA 4R9RA 5G0TA 2O23A 4XQGA 1ZMTA 3PJGA 3U4CA 1ZH8A 2HMTA 4O6VA 1E3IA 3ONFA 1BTOA 1HEUA 1WDLA 2WD7B 3MJ4A 3LT4A 4KWIA 1E5QA 3ROMA 3VPHA 3D4NA 4CV3A 2Q4BA 3Q2KA 3FWNA 4D7AA 5A9SB 2E48A 2HMSA 3W4IA 4R5HA 1NPDA 4NFHA 3DHEA 4BO5A 2VYVD 4FFPA 1JKJA 2WD8A 3WYBA 3M2TA 5JO9A 1KY4A 1B26A 1C1DB 3FI9A 4JN6B 4Q3DA 4II3A 3FNFA 3OJEA 4AJJA 2IDZA 4CMAA 1HDRA 3KEOA 5JAZA 4CLRA 2JJYA 3IL2A 1HYEA 2B37A 3KEQA 1ZFNA 3BTUA 3GUYA 3EMKA 3GMDA 3OEYA 2AW5A 4E6PA 1SPXA 2BI7A 4DRYA 1WP4A 3VOSA 4ND2A 1E3SA 3O8QB 2JCXA 1HXHA 4CQLB 3GF4A 4KQXA 3RIHA 4FB5A 1Z74A 4IDGA 1V3UA 3PVZA 3EZYA 4EUHA 2C54A 1UP7A 3BA1A 4A10A 4OKIA 1PL8A 1GUZA 1R6DA 2EJWA 4OL9A 4JJFA 3UKOA 5TGDA 2VT2A 1IY8A 3C24A 3VTZA 3DZBA 3OEWA 1BRMA 4RQUA 1HYGA 3QVXA 1Q0QA 2UV8A 1FDWA 2ZYGA 5JS6A 1JA9A 2I3GA 4PLWA 3WQQA 1P1HA 1JDJA 3RAJA 3ZWYA 4RLHA 3TZKA 4WLFA 3AUTA 3TZ6A 5CPBA 1U5CA 4CQMD 1R12A 3H6KA 1B0AA 4D3DA 1JTVA 4CMIB 2G82A 1DBVO 1E92A 1U3TA 2JAHA 5L4LA 3E9NA 3Q0EA 1MV8A 4GLOA 2FOIA 3ADOA 1BXKA 1ZVMA 1BDMA 5TT1A 2CDCA 2PKQP 2W98A 2WYWA 3I23A 1K6IA 1X13A 2TMDA 4DQVA 3WJAA 3ZV6A 3WGTA 5JAMA 3DOCA 2PZLA 4RQTA 2V7PA 4C7KA 3CTMA 1M66A 2BGKA 5TC4A 1SZJG 1F14A 4YCAA 4RF3A 3S2IA 2BGLA 3UVEA 4QXMA 1I01A 4R51A 1I2CA 4S1VA 4BMSA 4CMHA 2D4AA 2BHLA 3A9WA 1IYZA 3ICPA 3C1AA 4MP3A 4XYBA 4UUOA 3ZHBA 4CR7A 2EXXA 1CQIA 4IDAA 2D5CA 2CF6A 1Z7BA 4XCVA 3K5PA 1BW9A 1DJNA 4J0FA 4WCFC 5CHEA 1RPNA 4D3FA 5MGBA 4FPXA 4QTZA 2YV1A 5COAA 3LYLA 3CZRA 1PL6A 1DRUA 2X0RA 1KBZA 4K9DA 5CFZA 4KWHA 3GFGA 4H15A 5TSDA 4DLLA 5TQVA 3JQ9C 2VCYA 1UR5A 2NTVA 4CR8A 1U3VA 4YTEA 2QQ5A 2VHXA 4JIGA 3F47A 3LT2A 2R00A 2D1YA 3GGOA 4BNTA 1P45A 3L0DA 1GCOA 1LBEA 3U3XA 4F6LA 3OECA 3V2HA 3F5QA 1FXSA 5KJ1A 3KB6A 1QV6A 2ZB3A 3WICA 4YDRA 4BKQA 1P44A 2PGDA 3FR8A 4CUKA 4OOFA 2FSVA 4R16A 1NR7A 3DHNA 3SC6A 2NU8A 3U0BA 3MCVA 4E3ZA 2VZ9A 1GU7A 2Z1MA 1QSGA 5CEJA 1MA0A 1PJTA 5IZCA 2TMGA 2X4GA 2I99A 3S55A 4BO6A 1PX0A 3GG9A 3SEFA 1LDGA 2A94A 5DBFA 3E5MA 2LDBA 4BQRA 3D3EA 4Q3CA 1E3JA 1DHRA 1E1LA 3N58A 1XU9A 1AUPA 3BMCA 4WKGA 5IZ4A 5U1PA 4Q3BA 4AJPA 1XEAA 4RLSA 4GX2A 1GADO 1C0PA 2X7HA 4PIVA 2VWGA 5KJCA 3NUGA 1D3AA 1H6AA 2NTJA 4NU6A 1DAPA 3JQDA 4UEJA 2DPHA 3FNHA 4KDFA 2EV9A 4CM8B 1WNTA 3K9QO 4NK4A 2NU9A 4G81A 1PJLA 2EGGA 2VUTA 1NAIA 4YT2A 1YL7A 4PRLA 2GN4A 2YFHA 1I10A 1ULSA 2XOXA 3M2PA 2Q2VA 3TOZA 1U8XX 4OXKA 3IKTA 2O50A 3DBLA 4J0EA 3PIDA 4INAA 4RVSA 3WSVA 2CZCA 9LDBA 5I7FA 4LVCA 1PJSA 3RC2A 3GVIA 2IODA 5I9LA 4O63O 3GEMA 1HDZA 3KSZO 4R3NA 3RI3A 4YXFA 3PLNA 2CUKA 3RFXA 3A1NA 1LC0A 3I4FA 4HNGA 1EUZA 3JQ7B 1NQ5A 3A14A 1EZ4A 3F4LA 2OUIA 1DAOA 3ETDA 4J91A 5JC8A 3TN7A 5DP2A 3WGGA 4GGPA 4PG4A 2JHGA 5JAQA 3B6ZA 1IB6A 3D3WA 5FWNA 4DBVO 1KVTA 2FPPA 4RF4A 1T2CA 2BI8A 2HSDA 1EE9A 5BQFA 4BL5A 3JD2A 2Q2QA 1E3WA 3IP1A 3HN2A 3QW2A 3AI2A 4BS9A
chains in the Genus database with same CATH superfamily
3VX3A 4LQDA 1H0KA 3ZEIA 1GKYA 2CHVA 2C3OA 4YCJA 1D1QA 3T3IA 1QVZA 2OV1A 4ER5A 1J6UA 3B89A 1SU6A 3OZIA 1JIXA 1C50A 4HH4A 4E5PA 2HB6A 2QTRA 2HIGA 5ECDA 1NW6A 1YVDA 2QRVB 3FMFA 5ED0A 3V8PA 4YH1A 2V7VA 1IJKA 3IEXA 3KOWA 3P9PA 4MP8A 4MAMA 1JHDA 4XZ3A 1IIBA 1UPXA 1ZBDA 3EXG2 3FTCA 2QB5A 2VDPB 2VZ8A 2AKAB 3MJRA 3OJOA 4JH0A 2Q49A 3RTCA 3X1MA 1WXHA 4EUEA 1JYSA 2YWJA 2GHTA 2JRCA 4ESVA 1DJMA 1QOPB 4I4NA 5JZ9A 2H7YA 3HDJA 4GC9A 1T8PA 5G4KA 4AKGA 1B76A 3H86A 2WV9A 4Y9SA 2PKWA 3KXKA 1MT0A 1NXPA 1QHHA 1YB6A 2O5RA 4KXYA 4HDQB 3GUVA 3OO1A 1SQFA 1Q44A 5F4ZA 2FLKA 3OOJA 5EG5A 2ZEJA 1N4DA 4Q9DA 2ZT7A 2Z2XA 3CUWA 4BFTA 1L4KA 1I7LA 4IIUA 3DFKA 2ZTHA 4EG3A 5JT1A 3WYEA 3ELUA 1W2GA 1SEPA 3OM0A 5GAJA 4F85A 5AI4A 4WVLA 3D4OA 3ZI4A 1TT5A 3DZIA 5BVHA 1F4PA 1WM1A 2A0UA 4M55A 3RS3A 1P4SA 1KZ1A 1W96A 3LJKA 4PFQA 4EYKA 1AKMA 3M1LA 1PV4A 4PICA 1V3TA 3WHKA 5CDYA 5CLFA 3GELA 3FNIA 4XWAA 2XYRA 3WG9A 4E88A 2D7JA 3TKLA 3QLVC 1SRRA 3H9BA 3QX3A 3GC6A 3G8YA 4Y1GA 2LIVA 4LGYA 3H3JA 1QIGA 4A8TA 3KLMX 5EP2A 3THXA 2ZKIA 1C1XB 4WCFA 1L3CA 1LDNA 4IIYA 3HXMA 1YKSA 5J1TB 5C8YB 1Z0SA 3EGEA 3KUDA 2PWYA 3WA6A 4PC3A 1CVLA 4DVGA 5EJ6A 2J0VA 3N05A 3VZCA 2JIRA 5CLLA 4F93B 4YIKA 2YINC 1L5VA 3FFXA 4YRQA 3NTLA 2QTGA 2IEGA 3TZBA 4OI0A 4A8JA 2KPOA 3RF6A 1H9AA 1KU6A 2WF6A 3EDOA 2IXFA 1FTQA 1TEVA 3P0RA 4UBLA 1G55A 3UF0A 4Z5XA 2YZNA 1DELA 2YDXA 1QUFA 1XNGA 2YRXA 3MCUA 1CHNA 1G5FA 1T3TA 2IYXA 3O4GA 3R0VA 4FHCA 1ZONA 2OXTA 4X8MA 4M21A 2BTEA 4HZUA 3E5NA 5DM4A 5JSZA 2QTLA 3FPBA 3WL3A 1OF1A 2DR2A 1TVKB 2FEWB 4H27A 4AICA 1FFCA 4NYIR 4ZO4A 1LUAA 2OE2A 3EUFA 4U3JA 3WMFA 3BMNA 4IG9A 1K66A 2BMEA 1U8TA 4P8RA 4BFZA 1XNJA 4CF4A 3PNOA 1O94D 1XKXA 4WKCA 1V1JA 5AQ1A 4KYVA 1QCZA 1T6XA 1G0OA 3NR2A 3RF7A 1VBFA 3ZS8A 4BX8A 2R8EA 4IVPA 5JY1A 3ZVMA 1GXSB 5TEWA 3DLHA 1EI9A 1KEEB 3L0YA 5LB4A 1NYRA 3N8GA 5E4FA 1JI3A 4QM7A 4R2MA 5K01A 3IHKA 1UK6A 3H1TA 3TI7A 3VJLA 2NYAA 2SKDA 1NW9B 2QD5A 4NPHA 3RVRA 5CA0B 1JH8A 1B8OA 4GBMA 4PEVA 3V80A 4WCVA 4D3ZA 1AKYA 1NBWB 2DHEA 4GNRA 3MTBA 3IELA 4V0KA 3AYZB 2Y71A 3E8SA 2E4WA 3LUGA 3Q6IA 4E03A 2D7CA 4MUMA 2C99A 3ZU5A 2HQRA 3RS9A 1H9BA 1ESCA 2JFYA 3KXPA 1NZDA 1IE3A 3MMSA 4NZYA 1YJQA 4HB0A 4YNBA 3T5TA 3ZJ5A 4YJDA 2GASA 5INTA 1J1IA 3K15A 4O2BA 2X6RA 4URWR 1ZMXA 3OCCA 1OXVA 3OCJA 2K87A 2RH5A 1XU4A 4YMWA 4CQMB 4JFAA 5UKDA 4I1YA 4GDFA 1XRPA 4MKZA 1EVZA 1HBJA 1YU9A 3QFRA 1OW3B 3EQ2A 4K2HA 2B34A 1HX7A 1VLZA 3NNDA 4E0BA 2O0LA 4EHHA 5J5CA 5CBPA 2PMWB 2HDHA 4Z4IA 3KCNA 2NVUB 4P7FA 2X0NA 4B76A 2AL7A 3TFOA 2I5PO 1EQAA 1SXJA 3FMIA 1AGYA 3GFFA 2FE1A 3PGXA 4RENA 5DVZA 4TUYA 5EERA 1XJ0A 3ZR4B 3ZV4A 2OHIA 4L6AA 4AIRA 5K8JB 4DR5B 2CUZA 2DU8A 1FP4B 3LDFA 3R76A 3X1KA 3ZJ4A 4BU1A 1LJ8A 4CIDA 3FCAA 4D8YA 4QU9A 4TS9A 3ADKA 3U44A 4HYYA 4X95A 1T2NA 1QRSA 3U3RA 1NOKA 1FP2A 3SJUA 1CUVA 5TLSA 4PNPA 2GUGA 5E6RB 1M7HA 5AJZA 1COZA 5B53A 1CHDA 2BE9A 1FNBA 1PKXA 2PL3A 3NM4A 4IXTA 4NMWA 1O7JA 3MB8A 3DV2A 1ZJZA 3I9KA 4H17A 4H60A 4EABA 1V16A 2OAGA 4URYR 3NBKA 2ZWPA 3BUSA 1BDBA 2DHQA 1ISJA 5AI5A 1U3WA 1Z06A 4MQ6A 5NULA 5M3BA 1ZNQO 2XSZA 3V4LA 3LY9A 4D79A 2OQ2A 3ZGOA 2I6GA 2C5HA 1RLUA 1KJNA 1Z22A 2G5CA 5TQ0B 3TTTA 1GQFA 1XCPA 1L8XA 2REOA 2LW7A 2WAAA 1EWYA 4GF5A 2FPIA 5ETJA 4KUEA 1RP1A 3W2HA 1IZ9A 1KBQA 2WM3A 1FVOA 3WMWA 3ZZUA 4XWTA 1KQGA 3TH5A 3TLXA 3DCNA 3RVJA 4JEHA 3CRQA 4HZIA 1OVGA 1GPNA 2OWDA 1QFJA 2IV3A 1XEWY 3K72B 1L4YA 2E9SA 2JGLA 2OV2A 1FXWF 1NHWA 3P26A 4G5RA 3TSWA 3OJFA 3QJGA 2C7PA 1LWOA 3ROTA 4XPIB 5E0KB 1TGYA 1XELA 4H6XA 2X3YA 4EJ6A 4ZOEA 4NJOA 5JHHB 4HX2A 2V3CC 3R5HA 2PBRA 4JU9A 4QYWA 2I62A 2COKA 1PG5A 2O3TA 2ORIA 2QUBA 3EGWA 1AUXA 3QU4A 1RRGA 4FIDA 4FE4A 1JQEA 1DTSA 5TPWA 1GZ5A 4E5SA 3PC8A 1P74A 1S8NA 1SVMA 3CWQA 4WBSA 1LLQA 3IRUA 1B6RA 4BRSA 2GCOA 4JYMA 3IBCA 3AF5A 5C4GB 1N9GA 1TPZA 1SUIA 2AOVA 2BR3A 2QQ0A 1GWNA 1E7WA 1N6OA 1TUIA 3F6CA 1K5GA 2IL1A 4MR7A 4TPKA 4YMHA 3IPYA 2DUMA 1TIKA 4RPJA 2QRKA 3R3UA 4NBLA 1O1YA 1EBBA 3FYUB 3GYBA 3K9HA 3RTEA 1AKWA 4KN8A 1MP0A 4MQBA 1GPBA 1L5NA 4CW7A 4IH9A 2OBXA 4DC1A 2XBUA 3DNMA 2WHXA 1RRPA 4WKOA 2XLBA 2HWWA 3G2LA 1TOAA 2OR3A 1YB5A 1UMCB 2YWFA 3DM5A 4TKUB 1XVLA 5LBIA 3MGGA 1YQQA 3U81A 4ZQGA 3QTBA 3VNAA 1P7WA 4ZMRA 1NUQA 4K1XA 4JP2A 4PFJA 1ZEJA 4CDNA 3QVOA 1R4MB 4G97A 4UHFA 4U6SA 1ZWKA 3I39X 1AG9A 3K73O 4XX1A 5LZ5A 3AG5A 5KJFA 1N2CB 3SZGA 1H0SA 1AUOA 4PINA 1HT0A 2FKAA 1D0IA 1YE8A 2CLOB 4ZU6X 3ND6A 3VPDA 2MU1A 4W9NC 2G88A 2E4ZA 3E0XA 3RAEC 5A04A 2J41A 4MWZA 4UUBA 1GTRA 2LNDA 3JPWA 3KQWA 2YW2A 1I4TD 3Q88A 5KOHB 1IXZA 1XIVA 4N5NA 4R7ZA 1LPPA 4RL6A 3L05A 4WZAB 2GBLA 2BFDA 3JQEA 3NI2A 1BW9B 4AWBA 1QWSA 3U7JA 5IJXA 4B4VA 3D0QA 4BYMA 1CRZA 3S1LA 2VNSA 2QVYX 2PLNA 1NJ2A 2JEYA 2RAVA 3DW3X 3JQCA 5D8DA 5TVGA 2A9RA 5BP7A 1YDGA 2BV3A 4FOSA 3ADDA 1RIIA 3AR9A 2E49A 1P1CA 5CM8B 1Y0BA 3V2UA 1HOTA 5IF3A 3EYAA 3OWHA 5IS2A 1P91A 1OLUB 4LWQA 1KYWA 3C6XA 2D2XA 1OYYA 1WCV1 1SUCA 3KKEA 3GN2A 3K1ZA 1MVOA 4ME6A 1E20A 3A2MA 3EIUA 2I2WA 3GFSA 3PYMA 4DPKA 3GK3A 3ETEA 4CEHB 4WZAE 4DSTA 5KYGA 5FA8A 1P4JA 2IYRA 4ZV4A 4KI0A 4XVRA 3SXPA 4DDUA 1BROA 3ML1A 2HYDA 1NZFA 4KPUB 1BS2A 2CLSA 4N0DA 5HOQA 4QBHA 3SCZA 1EWQA 1ZQ9A 1LPBB 1DE0A 4ROSA 4QOGA 3HSYA 3VTKA 2M32A 1MGOA 3MCTA 3SD7A 4FJ2A 1Q1EA 2D5AA 4ER6A 2FNAA 3K9FC 4QVGA 2J9GA 3RK0A 5IF9A 1MX5A 2CNLA 2YS7A 4OUKX 1OHHA 2IHTA 2HRCA 4ZQFA 5CDFE 3B2QA 2IS6A 4L78A 3PPWA 2B4QA 1G7RA 3O47A 3JYNA 4G41A 2FPUA 2A84A 1RC0A 2VJCA 1O5IA 3DL2A 3DYIA 4B4OA 4BAZA 1LDBA 1RI4A 4C0KA 3UT5A 4HR7A 1H2HA 4QJ4A 2GAOA 2RK4A 3JR7A 1M67A 2QDXA 3O94A 2XJ9A 2IZ6A 3MTAA 3NKFA 1VHTA 3ODGA 4G56A 4MW7A 4TWIA 3HVKA 1XU7A 1XZEA 2Z4SA 1YRQA 3FNRA 2B5WA 5BSTA 1OB2A 3ZD9A 1IRXA 2NAPA 1TM3E 4JLWA 4MQUA 4UZEA 1XWWA 3JARA 5FADA 10MHA 4NBNA 3HNRA 1L7EA 1EVIA 1CUXA 1UFVA 2AA3A 3TO5A 4YMTA 2VXYA 1BG6A 8AT1A 1KARA 4G2NA 1P1BA 4B74A 2F1KA 2J3QA 1EFDN 3B6JA 2CLIB 4LY9A 4QD3A 4GEGA 3PPVA 4G84A 5JZOA 4YY3B 3ECSA 1BO6A 1T9DA 2WJGA 3MS4A 4TWBA 2Z6AA 2CCJA 3IJPA 2GPAA 4QYMA 2LD4A 2AZTA 2ZI5A 3CLUC 4H16A 1S96A 4BGIA 4GEKA 4G24A 2PZMA 2P9EA 4RV5A 3M6XA 2YXBA 2B9VA 2JAOA 2D5LA 3SSMA 4OHUA 4X1YA 3MT0A 1T1GA 4LXQA 4QUGA 2DFTA 5BW6B 1H6BA 1NRJB 4CFYA 3I2YX 1VHDA 3R5TA 3L0OA 5BR4A 4QJ5A 1QKKA 1JDUA 3Q9LA 2GS9A 3QKSA 2C5LA 1Q3TA 2VRWA 1J2TA 1RHMA 2OEPA 4XOUA 1KZGB 2HREA 3D3WB 1G9TA 3K0HA 4GR5A 1MQ9A 4LTDA 2F4VB 5JQGA 1XL0A 2PQ2A 2ZATA 4OD0A 5K8IA 2VT7A 3KHUA 1NIPA 2DXIA 3RFUA 4JZYA 3DUWA 3LFUA 1F2UB 3SFZA 2ZVPX 1PR1A 4KUGA 4ZALA 2X22A 2QL9A 2JH9A 3RAPR 3ZEAA 1MNQA 1TVEA 1TMKA 1Y8QB 2YJ6A 5DXFA 3GJ8A 1Z63A 5L8VA 2VNKA 4WD3A 3BE4A 3JU3A 3H83A 4QOJA 5B3AA 2B83A 1CZUA 2P0EA 5FWXA 4A5OA 3WY9A 2AXPA 3K30A 3CE9A 5IC6A 4PW0A 1AQYA 4D4HA 4GIBA 3BHMA 4XD2A 3KQOA 4G0VA 3WAGA 1PT7A 2FE4A 2IW3A 4HDSB 3TRJA 5BSFA 4LF9B 4Y6RA 4CQNA 3HDTA 3H4IA 1HYBA 1GNPA 1U5BB 4A92A 1GGHA 1E1QA 2GLXA 2IEIA 1Z5VA 3FFWA 4HN4B 2ZTVA 4WSOA 4MKXA 3WGUA 1ZK2A 5TXGA 2BFMA 2WFMA 4XIYA 1MJHA 1DXHA 1YK1A 2PV0A 2ADMA 3LBYA 1CQWA 4HPWA 4D9EA 1RM0A 2A1IA 1DVRA 3WP0A 1EFHA 3E5HA 3HCWA 3PE6A 1SH7A 4BWVA 1PR0A 4KXUA 4ZI3A 1F6BA 5DASA 2DFNA 1KC1A 2IUEA 1EGVB 2XYPA 5DSTA 4X7PA 5EJIA 2I2XB 3E0QA 2QLFA 2C95A 4ETMA 4BZXA 1KC3A 2Q7DA 3HBJA 5E8RA 2J0QA 4DUPA 3ZH2A 3RSFA 2B1IA 5BPHA 3HVHA 3AP3A 2I2DA 1KHHA 1R8YA 1W30A 3GVCA 4G5GA 2X5KO 2QL5A 2HEGA 4XLLA 4IUYA 1E2IA 2VFAA 3Q7PA 1U9CA 4YJ3A 4LHEA 4Y2TA 3S40A 3B1VA 1E64A 3A4VA 3GDWA 4TS4A 4NS4A 4MH0R 1YR3A 2NU6B 5LZ9A 2GM5A 5B6JA 3K2EA 2JD2A 4LHXA 5AKIA 2F00A 2W2KA 2V9CA 4QGFA 5FLKA 4OXNA 1JKFA 1C5KA 4YGYA 1V2HE 1AHIA 1SOWA 3DXFA 4IUBS 4BB6A 1Z6ZA 2BFAA 1JEQA 4PLZA 3WA7A 2GFIA 2JAQA 1VDMA 4P4TA 4YI3A 3U7FB 4X66B 4HC4A 4R2HA 4AUNA 4IMJB 5JY6A 1P7ZA 5DM1A 4R1UA 5HXAA 2PJDA 1CFZA 1Q1NA 1L8OA 2G36A 4XA8A 3CLRD 5AKKA 4TS3A 1MR3F 3RYIB 3QBTA 1SHUX 3QITA 4IIEA 4GFDA 5CW2A 2B4RO 1G8GA 4BTVA 1J25A 1I1QB 2JLBA 2WLTA 3VMMA 1ECGA 4L8LA 2R3SA 4PU0A 3I2HA 4FFNA 1M2OB 3OY7A 3W90A 3ZBQA 4MR9B 2OAQ1 4I4TB 4I0WB 2A9OA 1OIXA 2QM0A 2IS2A 4J7UA 1P5ZB 5CTAA 3MWKA 5IYZB 3OPQA 1NKTA 2R7MA 2V9PA 1WEHA 2W71A 3EQZA 2F43A 2PUTA 4R01A 2FWAA 3AB3A 4JMLA 4GRIA 2IPLA 1KKLA 1NMZA 1SVIA 2C04A 4DIMA 1I6KA 1K0UA 4QHTA 1OWPA 2QD4A 1E6CA 1T9CA 3VR5H 2P9YA 4HDAA 3OEEA 3NVKI 2NQ8A 5BSUA 3WE7A 5IDQA 1Z15A 2A0KA 1BJKA 1EJBA 1ZCBA 2Q6OA 3MF4A 3DFMA 3PUZA 4A2WA 2VPTA 3PDWA 2PXCA 4YDQA 3IQZA 5I8WA 5KWVA 4NBSA 1SBHA 5K6AC 1HK7A 4MRAA 1GGFA 2QM7A 1O3YA 3HB5X 3VUFA 3H2GA 1YCGA 1K6JA 1MAUA 1HSZA 1X1AA 3FJOA 3RE1A 4BNWA 2BW0A 2ZRNA 4D4IA 4UTVA 3RFFA 1GT6A 2QPLA 1PK7A 3CC8A 3GV0A 2FYTA 4TM8A 3HO1A 4MW5A 1CDZA 5LA6B 3GJRA 4F97A 5AVKA 2F8LA 2VQEB 4FNMA 3IEMA 2VJQA 1RZVA 5IC5A 4BP1A 5CGZA 3KTFA 1KGDA 1PNOA 1SD2A 3ON5A 3LMKA 3PVCA 4GOND 5AW0A 2FW9A 4FNAA 5EJFA 1Y6FA 3O8BA 4E33A 2QRNA 1GRRA 2GO1A 1IPFA 2UVPB 1XJQA 4W1PA 5TS2A 4DZRA 2I78A 1YF3A 5TJ9A 2YNMC 3U6KA 5IJ9A 2OP0A 1I5RA 1Y1TA 1J0AA 5CFMA 1YQDA 3IIKA 3VUEA 2JCVA 2YN0A 4D4GA 3H9CA 4WEQA 3UB4A 2MR6A 1UP6A 1HMYA 2HZBA 2ETVA 3HUDA 4PHHA 3RU9A 5ITZB 2O59A 3CV3A 2WKPA 1G6OA 1M74A 1ZEMA 1SKYB 3CZMA 1Y8AA 3QF4B 4NCJA 1I80A 5D5QA 4R1NA 3EDRA 4R8SA 3I2JA 4KR0A 2W6PA 4RGBA 1Z88A 3RSLA 4LHYA 1GCUA 1CJKC 2VO1A 2WEKA 2ERXA 3L0BA 4ZDKA 1WB5A 3R1IA 4N82A 4FW9A 4EI7A 3H2HA 4UHEA 3ZIDA 4M87A 3CEAA 3OFKA 1Z17A 2YYZA 3UV6A 4HV4A 2YQZA 2K4MA 3OD1A 3GNSA 3NVDA 4L8VA 4TQGA 4AJEA 2CK3A 1GFIA 5TMDA 1JBKA 3I9OA 5GONF 4Q16A 1U7WA 1RBQA 3AHEA 4KQJA 4NYIQ 4ODIA 4HAUA 2IOFA 1CV2A 1EDDA 4ZI7A 2RBKA 2WU1A 2X42A 4NCIA 4RGQA 4ENUA 2JBAA 5FOWA 4H0NA 4C7VA 4QYSA 2VTKA 3E8XA 2Y1OA 1CR4A 4L1KA 5DGDA 1S02A 4U7WA 2ECFA 3FSEA 4NECA 6YASA 5ALGA 4C2AA 2LWIA 5JW6A 1XD2B 1H2EA 3NDJA 1DV2A 1M2HA 1ULUA 2ZRPA 3HL4A 1Y3AA 1EWRA 3QRWA 1E3EA 3Q98A 5C3MA 3LFHA 4Q93A 3MPUA 1T1IA 3V1UA 2YXDA 5J47A 3CVJA 1O6GA 2H65A 1E58A 3ILYA 1P6UA 4YS6A 5CYGA 3GPLA 2ONKA 4RTJA 3A9TA 3K9BA 4EKIA 4OGLA 4ZARA 2HPZA 2GZHA 1ZZGA 1U9ZA 2YC2C 1R0RE 3WP1B 2OVFA 2H9AA 4Z99A 1TAUA 4EIWA 2OFPA 1DSSG 1RLIA 4BKMA 1E0KA 3T54A 1LLCA 1SBQA 2Q1UA 3EXIA 3T0IA 2FMKA 1SCQA 2PCLA 4WNAA 2V98A 4U2KA 5IAAA 5K20A 1ODFA 1ZX1A 3L1VA 3ONEA 1A7KA 3BAFA 4G5FA 1IWPB 4L15A 5JU6A 2D3TA 4E5YA 3U4HA 2LCFA 4HRAA 3WK5A 4Z3KA 4WXPA 4BC0A 2KI5A 1NKSA 2XD9A 3F4BA 5FEUA 5JNUA 5CX1B 4DA9A 3HQ4O 2BFPA 2CHUA 3TTVA 2OT3B 4ZVNA 4REMA 3V4SA 1N78A 3AJ9A 4I1VA 1YQEA 4OY3A 3AQIA 1XCBA 2DUWA 4JCOA 2A86A 1SG9A 3DAYA 1X7DA 2GKGA 3CPJB 1VXRA 2VF2A 3G8DA 4JA0A 1SBIA 3NHSA 5J2UB 3T3OA 2O2GA 3DBIA 3LYUA 3ABQB 1J22A 4Q19A 5J40A 5I9NA 3ZBPA 3HU5A 3UJPA 4BVAA 3K7EA 2H4HA 2X9QA 4NMXB 1IATA 4TX1A 1AQLA 4E5MA 1NQVA 5BO5A 3S5JA 4BLUA 2IZ5A 4HGRA 4BNIA 2GEVA 4JJAA 3SDSA 1IAQA 1C1DA 4QQKA 4A6DA 5HPYB 3MT8A 4P54A 4P4SA 2B2CA 3UB3A 4Z3DA 1EUDB 1U8ZA 3H1GA 5SZIA 3DTVD 3KOUA 3DOEA 3FETA 2W9XA 1LBIA 4R8RA 4H4DA 1TKRA 3P9QA 5AYVA 4ER3A 4WK6A 3THRA 1M10A 4HQ0A 1W59A 3KQMA 4OMCA 4BV8A 3PHIA 1L7PA 1C7JA 2EBHX 3DR3A 4N40A 5FNVB 1EHIA 3RBXA 1D6JA 4IO0A 4CQLA 5KEIA 4NICA 4OV6B 1NFRA 1T6NA 1KQ3A 1HZZC 2PZBA 3R6LA 2B92A 4NLLA 5LN1A 1J0CA 2E5FA 3MSCA 4FP9A 3I32A 4N7RA 4NIMA 1GL3A 5FXMA 1L4HA 4F4CA 2P6UA 1I3LA 2P7HA 1TMOA 2O3QA 1W4RA 3UCEA 1AM4D 2I6FA 2WAMA 1KJYA 1TYDE 4DMMA 1NI5A 3ZNNA 3HWSA 1FMFA 4D9CA 5A2QA 1VKHA 3HKEA 1JFLA 3BIXA 4HVLA 3OT1A 2QY6A 2ZR9A 1JAZA 4NCNA 4BZZA 4O5AA 4EZBA 5DTEA 3F3YA 4BOYA 3ONDA 4XR4A 4L3VA 4W4TA 4AYWA 4KREA 5HMLA 1P17A 1LWNA 1YO6A 4JUAA 4M8SA 1NUAA 4OH7A 2A14A 2QT0A 1YI8A 3IAHA 4QEZA 2BAGA 4GOXA 5HW0A 3CZCA 1R0XA 2BZ0A 4U5QA 1C3OB 3E58A 3IMCA 5H83A 5K3CA 2H48A 3D5TA 3HPQA 1HNNA 3R3SA 2BISA 5LQAA 5E2AA 5LOVA 5BNWA 4V03A 1WB9A 1B16A 2DJIA 2YWGA 1TRHA 2JD1A 4MGIR 4HFMA 4B3GA 1SNYA 1QZ3A 2IUTA 4CM4B 4MVJA 2WF9A 1ISRA 3STUA 1Z6PA 2FWNA 1R18A 2WVHA 3D54D 5JSHA 4IYRA 4RXTA 1IEWA 1WCYA 1F8UA 3DP7A 5CCXA 1RPTA 2YHSA 1I2AA 1U2QA 4ZQBA 4EJMA 4BAUA 2IX3A 4J4HA 3PXUA 5E7MA 3CUTA 1ZJ6A 5B2ZA 4AUEA 2FB9A 4FI3F 1R0BA 4PGHA 3RSGA 4UOZA 1L3BA 2XDAA 2VSQA 4MTCA 1OLXB 2OGZA 1E9AA 2CUTA 1LA2A 4MVJG 1H93A 4BBJA 1QRRA 3IDAA 4C0QC 5FL7D 4FFBA 3VNUA 3QK7A 1CJVC 2BFCA 3AOEC 4ID9A 4QFDA 2HIMA 4E14A 1SIBE 1LBQA 2B4KA 3IDOA 5M2QA 4BVHA 3M6IA 2QK4A 1I2BA 2WWRA 4O2BF 1FRZA 2XT0A 2JHAA 3HR7A 3GRRA 2CWDA 3NAMA 5T8KA 3WMXA 4YUXA 1VJTA 3A1WA 5TQ2B 3T9FA 2XY4A 2RGWA 3DFZA 2YIMA 3EIOA 1UJ2A 4ZVTA 4O5OA 2BRUC 4IGKA 2Z8YA 3LU1A 2WF5A 3BXEA 2AZ4A 4JLPA 5DIZA 5SYNA 1YZGA 3X1WA 5K0BA 4OAQA 3VKHA 1NTOA 3EWAA 4G4SP 4W99A 5AVZA 1V96A 1G9XA 5BV1A 1B3RA 1W1IA 1EH5A 4JB3A 1P2BA 2YHUA 4QBKA 2BSAA 2GLUA 3CJQA 4TUYF 1S3GA 1W8DA 1XJWA 4XWGA 1JQ3A 1RYBA 3CKLA 5DYGA 2VSNA 4AJ1A 3KYCA 3RSOA 1T3LA 3NOQA 3DTTA 2SCUB 1WAMA 2J6IA 1UPFA 4UAJA 3WK4A 2TRSB 4AL4A 1THMA 2A5DA 4M9CA 4EJ2A 4EJSC 3PHHA 3FJ1A 5K05A 3E84A 2I7CA 3G2OA 2BJHA 3LT1A 2DLNA 3OJCA 6REQA 1X1CA 3BEDA 3ISJA 4WZBE 4Z4FA 3MJEA 3D02A 2CVQA 2EP7A 3CISA 1LJUA 4FQ8A 5HSGA 1FPMA 3MGCA 4KZKA 3KYJB 1TXGA 2DZDA 1QGAA 3PNVA 1YV9A 2XKAA 3C4QA 2O1WA 2Z2JA 4UTOA 3P96A 4BTEA 4C4RA 4E15A 4CRWB 2FMTA 2XEXA 1T9GS 3GOQA 4F91B 4HMPA 4QU0A 1OH6A 1X86B 4NQRA 1EVYA 2YC4C 3IAEA 1DCTA 3P0FA 5IULC 3K70C 3SNHA 4QU8A 2HMUA 4V1CB 4QWMA 1RWXA 3O74A 3ZV3A 1RBMA 3RSZA 1G6KA 4DS3A 1IZYA 1CBUA 1BOFA 4QGBA 5CH3A 1ZJJA 4PQRA 1WMEA 3OP1A 2VC2B 5FUYA 4BVFA 5A4AA 1R2QA 1JTEA 5IT4A 4JROA 3Q0TA 1TF7A 3U60B 1U81A 2BVNA 4G3XA 3G8AA 4G65A 4NDNE 2IF2A 3NG1A 4TN1A 1E0DA 3KTAA 1C7ZA 4WQMA 3EGVA 1TYAE 3C8DA 4ZTBA 1JIUA 4RVDA 3G5TA 4U02A 1UDBA 1X15A 4EHAA 4Z49A 4ZTZB 3R3WA 3ABIA 3BDAA 3LKDA 2JA2A 2ZBVA 5BSVA 1DKPA 4OFZA 2O19A 5ALEA 4IDDA 4KQ1A 3QELA 1R7RA 3MHPA 3CW2A 1FE8A 1BMTA 1EWVA 2ZVDA 5ALHA 1SU7A 1YZQA 4OHOA 2HV9A 2J9ZB 3DVQX 4PO3X 2NNLD 4EMBA 4Y2YA 2M98A 3U4QB 1OWOA 2OZPA 4U2GA 2G4CA 5I7UA 5J4KA 1KEVA 1ZHFA 3REQA 2AT1A 1KOFA 1RQNA 3RS2A 1YE3A 3I9MA 1SC6A 4F3KA 1M34A 1XA3A 4U7GA 3Q7QA 2XNSA 2OLKA 1HDXA 3NNNA 2X40A 4XASA 1G6HA 4WOBA 3LH5A 2WHQA 3M4NA 2LE0A 2OAP1 5CH8A 3WB9A 4RPKA 4B4KA 1A8QA 2P30A 1P7YA 2CBXA 2ZWIA 2WNSA 2FUKA 4KQ6A 4P82A 4RS4A 3JD3A 3I61A 4P4NA 1QIIA 3AVQA 1QC5B 3BIOA 1K7SN 4J76A 4XWYA 2HXGA 4UMEA 5H3LA 3UG7A 1JU4A 3FCEA 4TYPA 3ESQA 2DWPA 4CI0B 1Q20A 4KDEA 3O1HB 3PPYA 5DRYA 4DCNA 1JMKC 1KOGA 2G5GX 3VDNB 4P32A 2QKYA 3DT9A 4GPEA 1M2GA 2A5LA 1T3ZA 2PRZA 1CULC 3WWPA 3UHJA 1TFUA 2Y0CA 2YQ4A 2QRVA 4RTMA 2ZIGA 3X2FA 4KFTA 5IVIA 3AF2A 4DLZA 2QMEA 3V7UA 4BV2A 1G42A 5CLGA 1HNZB 4DPMA 3AF1A 1UL1X 1IN1A 2I4TA 1ZIYA 5BYAA 4BQNA 3ZDXB 2GQ0A 4HTFB 4I9GA 4WFKA 3MN1A 1VSBA 1K89A 3ZYZA 4DNPA 2HQOA 1FYXA 2XH8A 4IFIA 1RADA 2G25A 2E0IA 4FYHA 4MMYB 4NU5A 2GX6A 5IXYA 5EQFA 1KAGA 4Z51A 2AG0A 3U49A 2R85A 2J1LA 3G2IA 1EEXB 4AYTA 4OJYA 2GARA 4BFWA 4FYYA 4M0MA 2CV1A 3L4BC 4J1TC 1ID1A 3ZTTA 2A9VA 3AJDA 1US8A 5LQJA 4RTPA 2H1LA 4OP2A 2HT6A 4OSEA 1JVBA 5CXXA 1FLVA 2O4CA 2IGBA 5ARDA 2BR4A 2IHZA 3SZ3A 3QVWA 2GBGA 3HC7A 1YR8A 4QUBA 4RVFA 2QRZA 4UBIA 5A6SB 3C8HA 4FILA 5P8WA 3KT8A 1W46A 5ES3A 4D45A 4MJLA 3FROA 2O3JA 3KELA 1P31A 1GUYA 1Z12A 3AIIA 5HE8A 3VDMA 1DEAA 3AU9A 3C6QA 3RYFA 1QYRA 4WJLA 2ZSKA 4GHWA 5FOQA 3EFBA 1RYYA 4C6TB 2ATXA 5ENDA 4F5EA 1AO0A 3RBZA 1AC5A 4OQPA 4UMDA 1ZIDA 4NSNA 4CCYA 4F4JA 1YU6A 3TTWA 3WLEA 1ZXXA 3LCJA 5SYMA 4F86A 9LDTA 2JIPA 1EP3B 3I3SR 1GY8A 1QRTA 2BHNA 3VPCA 3LW7A 4LVOA 1TEHA 1C1XA 1UKVY 2I71A 2E89A 2IITA 3PSAA 4B6QA 4CUJA 5WRFA 1D2NA 5C8YA 4ZMSA 3NTVA 4F21A 3GMSA 1PN3A 1GT91 3ZGYA 4YAKA 3MJCA 3LFTA 2RJNA 2C97A 2J3IA 1L5ZA 4OVKA 4EG4A 1V9LA 1RZ3A 1AA6A 3L6CA 2GN1A 3T7KA 2WJJA 5JZBA 2P5TB 4HN2A 1HTTA 1I33A 3ED1A 4GMHA 3NBMA 4NRDA 5F7XA 2B5VA 4RVCA 2JCGA 4E2WA 3KUCA 1Y3FE 4RHXA 1BU5A 1G1AA 2L17A 2VYVA 1AK1A 3DMPA 3DZ8A 3K9NA 4MVJI 3WDKA 4P92A 3WL7A 3SZLA 3MOGA 2EZ4A 4DCVA 2AG6A 1JBEA 2GO7A 2ORYA 3L9WA 4DDMA 1BGWA 1TVKA 1DUIA 2E4UA 3MTDA 3P0IA 1SU4A 4BZPA 4OUDA 4DMHA 1W36C 4GS5A 1NC1A 4E07A 3ROFA 2QM8A 3H8SA 4G1UC 2DMRA 3ZN2A 4JL5A 4HQFA 2W2LD 3D81A 3QX8A 3UQYS 1R6XA 1EVLA 3B1YA 4MWDA 2XUOA 3FCCA 2WBLC 1FOEB 1RPAA 3I92A 4JLSA 1PVDA 3FZYA 4P3NA 2GRAA 4YRRA 3RGGA 1GXSA 3CF4A 1G21E 3HB7A 4NCXA 5DB4A 1KEEA 4JELA 5KS2A 5T3UA 3T7AA 1QOZA 4KL8S 5ITSA 5KNDH 4RVGA 2WE7A 2QYHA 4MUXA 4DMLA 4MRPA 1G291 5D84A 2ZDGA 3P9ZA 1HM5A 3R23A 4C6RA 5ECWA 4XWWA 2ZXEA 2VQ6A 5CA0A 3JVVA 3IKLA 4FYMA 4Q1VA 5H3CA 3Q11A 4CCWA 5AVUA 5ITVA 1TF5A 1BMFD 3BXFA 2VHTA 3VAAA 1CS0A 3KAJA 3LUHA 1RWBA 1UIMA 1VPLA 2RJ3A 3P71T 4K05A 4O0LA 5KJ6A 2O8FB 3H4MA 3L4SO 2XCTB 2ZITA 1NLUA 1CUSA 2ODPA 4L16A 4UEWA 3LV8A 4TTRA 3I9FA 5JUWA 4KPYA 2IRWA 4IMIB 2GEUA 4X91A 4L4UA 4EFDA 5EUBA 4ZVPA 1M8GA 5CT9A 1QLJA 3SF8A 4AULA 2BFFA 5HX7A 1U31A 3H5NA 4LBYA 5ES4B 4X9XA 3BB3A 5LMCA 3M33A 1NLYA 2XUAA 2EX4A 3QBJA 2O1EA 4AXXA 4ARCA 1NQAO 4FYXA 3MCWA 4CQMA 1UM8A 4PO8A 2RHWA 4V0MA 5C35A 1PHRA 1SUAA 1G5RA 1JKIA 3OIGA 4QPNA 4V38A 5H4HA 3GH3A 4WHMA 3VVCA 5JQGF 1JSZA 2Z9BA 1DWUA 2NVUA 5AKHA 3OZWA 4KSBA 4RVOA 3H2SA 4WAUA 5KKAA 1PGQA 2VNAA 5BYBA 1K88A 4D4LA 2FMIA 2O8DA 2GTPA 3PQ8A 1UQRA 2P9QA 4OQDA 4XDZA 1QP7A 3ZKWA 3WKDA 1FP4A 2OA0A 2GETA 2ZIUB 2PMFA 3HY6A 3P20A 5GZ6A 3OUUA 4DLWA 3B8EA 2JLRA 1XDZA 3M1YA 1N4AA 4LFCB 1PWXA 1PJ2A 4IXMA 5E6RA 2CV2A 3RJTA 2F8SA 4FFDA 2E4YA 4WDRA 3WRXC 2ESRA 1Z75A 1V5FA 3N2GB 1ZH0A 4K28A 2A57A 4R9UC 4MRSA 3IUNA 5TVKA 5HQJA 2EJVA 3G0CA 2O2YA 3I37X 4MUIA 4Y2PA 2YIJA 3TS1A 4EB3A 4ESOA 3ND8A 1HDCA 3O31A 3OTQA 3Q9SA 4MGKR 5CYOA 3PFCA 2PNFA 2FW0A 3KR0A 3TLEA 4DIKA 1AS3A 4HBGA 3E03A 2MJLA 1YDMA 3FPJA 5TQ0A 1DUVG 1UWVA 1V6AA 1WB6A 1X80B 1U7TA 2JKYA 1ONPA 1YRAA 2P9BA 1MD9A 3ZC3A 5BWBA 5LNK6 1JPJA 1QR6A 3Q4GA 4RF5A 4D26A 2GAFA 5EY5B 1JGTA 3GAZA 4WV3A 1OC2A 4R8VA 3L7AA 4RD4A 2I66A 1S7GA 3H1PA 1KJZA 4U7JA 4HAIA 3MWJA 3NGXA 2AG5A 3PEYA 1PL7A 4OQMA 1UJ6A 3PGJA 2IIQA 2ZXFA 3BZBA 4OHPA 4RY9A 4YJ3F 1O6ZA 2PHZA 1EVJA 1K7XB 1LS6A 4YMVA 2FPSA 4XPIA 1K4KA 5HM8A 1U2GC 5F5LA 1A76A 3KRTA 2WJZB 3EZNA 3H9JA 3A28A 4XB2A 2J5QA 4EB0A 3AHFA 3LXRA 1LDYA 2BZSA 3QHPA 4FDTA 2IUSA 2XT6A 2O0HA 5K0TA 2P2CA 2HCTA 2H51A 3UEOA 4DYDA 2C2XA 4ERXA 4WH0A 4YMIA 5AW3A 1F60A 1VFPA 1BA2A 3ICOA 4N0QA 3IAM1 3O4RA 1AOXA 3AR5A 5E9WA 2L19A 1O8CA 1ADYA 2GD1O 3QUAA 1W94A 3BJRA 4RCZA 1Y7IA 3FYUA 4O29A 2C58A 1DZ3A 1HRKA 1QH8B 3HYCA 2C8LA 2Y1CA 3IOMA 1CLEA 1JLLB 5KC9A 3B8HA 3PXGA 5DH9A 1SKBA 4WOJA 4GP9A 3AR6A 1N6HA 2OB2A 1D8AA 3O7MA 4AMVA 1N3LA 3QV1A 5AXBA 4RV4A 4HVTA 1VJGA 3OZSA 4H7DA 4TKUA 1P0FA 3PYXA 1R9GA 3ZLTA 4C2TA 2FV8A 4ZQEA 2PGXA 5JI2E 1JQ5A 4QGGA 4DFDA 3OLVA 2QGNA 2FLWA 3K8ZA 1O97C 5J5VA 4C3UA 4OGGA 1XPOA 5BSGA 4Z9FA 3ZWDA 1R4MA 3GLKA 3QFFA 1QNFA 4TMVA 1O8BA 3TWOA 3VYVA 4TSFD 1RMTA 3MJVA 1VL1A 4U7DA 3NHRA 2IYNA 3ZGVA 1OU0A 4G8DA 4XEUA 2IW1A 1A0OA 1KYXA 1H6DA 2RGNA 3ESYA 1QZTA 4WZ6A 3LYAA 4FU0A 2LGJA 3E7FA 4FEYA 2GRUA 3SI7A 2GXAA 2Q0QA 5PGMA 3UHFA 3WMRA 1XZKA 4C0HA 1T8RA 2VHCA 3LC2O 4B8YA 2CDNA 4DG9A 1KAOA 2B4YA 4JY7A 2AVDA 4MDYA 3RHFA 3W8EA 4EFLA 3GFPA 1Z2NX 2QZ4A 5KOIA 2PZ8A 3A1TA 3CSDA 1OCEA 5EOVA 3WLJA 1TUGA 5J4HA 4LE1A 4RPCA 2NSLA 2QQGA 4EVQA 4WBXC 1WXIA 3R5XA 1J0DA 4CMCA 1MOPA 3MTJA 1UAGA 2J3DA 3UJ3X 2J3MA 4AZ3B 2OHGA 2PEYA 2PU7A 3KJNA 3G17A 4RZQA 4H7IA 5LLTA 2QT1A 4ZCMA 2LP4Y 5I9IA 4NXMB 1OLUA 3IDSA 4GE3A 3WNCA 4F56A 4I66A 4FONA 4US1R 3ZE1B 4DB2A 2I91A 1BGXT 1TIBA 4AC9A 1WUHS 5K2MA 4EY7A 2HFKA 3P5BA 4MITA 1NXWA 3CX4A 5CFOA 1XMVA 2GM9A 5JNLA 3PWSA 2D54A 2D5IA 5LQCA 3IVAA 3NTRA 3PTLA 3BKWA 2FMUA 4OQXA 5HFNA 4KYTA 4XOIA 1GZ4A 4BMOB 1NDHA 5E3HA 3I12A 3LWBA 1H94A 1NA5A 2JGKA 3W79A 2C2YA 3ILVA 4KPUA 3PPXA 2RG7A 3GPBA 4X3PA 2P2YA 1TYCA 3EUEA 4LE2A 4B46A 5DK4A 1VTKA 1OIWA 3QOFA 5LZ7A 3ZHVA 1UQUA 2XWJI 3AHHA 3D7LA 4EEKA