5TT1A

Crystal structure of a putative short-chain alcohol dehydrogenase from burkholderia multivorans
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
230
structure length
217
Chain Sequence
RPTILLVGASRGLGHAMAAEFLKRGWDVVGTVRADRGRTPLHALAEAYPDRLRIETLDITQPEQIRALAARLSGRVFDILFVNAGTTNPDPTQTIGEVSTDDFVDLMITNALSPMRVVETLAGLVPRDGLIGIMSSGQGSIADNESGQRELYRGSKAALNQFMRSFAARHAQTPLAMVLIAPGSIDESVPGVVDVLLAKRGRAGLEYLDYRGRTVRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Putative short-chain alcohol dehydrogenase from Burkholderia multivorans
rcsb
source organism Burkholderia multivorans (strain atcc 17616 / 249)
molecule tags Oxidoreductase
molecule keywords Putative short-chain alcohol dehydrogenase
total genus 76
structure length 217
sequence length 230
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5tt1A00
1VL6A 1R0KA 2OUIA 4BKRA 3I9MA 3FNHA 4G65A 4XQGA 4DIFA 3P2OA 4J7UA 3CSDA 5JC8A 4ZJUA 3HB4X 1WPQA 3QWAA 2WE8A 2IXBA 3IAHA 5A9TA 4L73A 2AG5A 1ISFA 2O3UA 3QA9A 1ZEJA 2AMFA 4E2ZA 5L7TA 3ST7A 4CLEA 3L4BA 1YXMA 4BO8A 2QX7A 2Q2QA 3BTVA 4JN6B 3FRJA 4XR9A 5JY1A 4BO6A 1P74A 4DGSA 3JV7A 1GV1A 5JDIC 5F3RA 3NGXA 3DFZA 5KJEA 4FC7A 3D4NA 5ITWA 3KETA 4RQUA 3ANNA 2JFHA 2B0JA 2YHUA 5KJ1A 4HXYA 3VPSA 1PGQA 1BVRA 2QHXA 2H6EA 5KKCA 3RIHA 2Y66A 4NBUA 2OGUA 1C1DB 2QQ5A 1Q2XA 3QY9A 2EG9A 2Y1OA 4Z0PA 3D64A 2W2LA 2YFQA 3I23A 3LT0A 2VWHA 4FFOA 3DHYA 1I0ZA 3VH3A 3Q9NA 2VHXA 3ICCA 3RJ9A 5I8WA 2RBEA 4CM4A 3JD1A 4QFCA 2FR8A 1IULA 4R69A 2CD9A 3RQSA 3ZWBA 4BNMA 1DLIA 5EERA 4EYEA 1RKXA 5IN4A 1HE5A 5TGDA 3JQ7A 1R0SA 2NNLD 2O3QA 4W82A 5ADHA 3HZZA 4E5KA 4ZHSA 1DDOA 4IDDA 1QYWA 1P33A 1ZK0A 3K9QO 5JE8A 1ZXLA 4LMRA 3E8XA 4XJSA 4PRLA 3DEYX 1LU9A 3AOEA 3TZKA 4O5OA 3W4IA 3PIDA 1LSUA 4UREA 1E77A 1O89A 3WIDA 4RDHA 3M2TA 1D4FA 4UUPA 1I5RA 5GZ1A 4QEDA 3MWEB 4OXNA 1J6UA 2PZKA 1XWFA 4C4OA 3CH6A 1LSJA 1T2CA 1NQ5A 1UDCA 1WNTA 2IEBA 3BMOB 1HSZA 3R3JA 2Q45A 3UF0A 2FZWA 3GQVA 5TRTA 4E6PA 1ZMTA 3PWKA 2NADA 4QO8A 3G3EA 4Y98A 3TOZA 1C14A 3P2YA 4HY3A 3RUAA 4Y67A 3ZNNA 4CM6A 1NVGA 1OC4A 3LU1A 4RPJA 4LCJA 3UCEA 4ZQGA 4GPD1 4R4JA 3F9IA 1DOHA 4R5HA 1T26A 5CAEA 2NLOA 3QQPA 3V2GA 3WIEA 5CG1A 4CMHA 3MJSA 5LC1A 1X0VA 3RUDA 5JAQA 1XU9A 4IMPA 2E49A 5IXYA 5DCWA 1B3RA 2PKQO 4IPTA 4YJDA 3OJLA 3GZNB 4NDNE 4BNYA 4FB5A 2CDAA 3RI3A 1NM5A 1IPFA 3SJ7A 4E21A 1CYDA 4LGVA 4EUHA 1MG5A 4CODB 1GUYA 2IZZA 4Y6PA 1UDAA 2NQTA 4KDEA 1E3JA 3B1KA 3TZCA 3C7CB 4NR0A 3DTTA 4CLRA 1I01A 2WEKA 1PR9A 3ASVA 2AQKA 3P19A 4E2XA 5L40A 3F1LA 4IZIA 4Q3AA 2E82A 4E12A 1PWZA 1EQUA 3ZNPA 4CM4B 3BTUA 3O38A 1HLDA 3BTSA 2FRDA 1P1FA 4IM7A 4DQUA 1GEEA 1BXKA 4KQXA 3F5QA 4AJKA 4BQRA 3DBHB 2W8ZA 4IXWA 4MVJF 2Y05A 5AXCA 1L1FA 3O26A 3L6EA 3KUXA 1AGNA 4PFJA 3RUEA 1Z73A 1H6CA 1Q7CA 1J4AA 5G0WA 2B5WA 4RF3A 3DHEA 5J23A 2DC1A 4I5EA 3LF1A 4LRSB 3ANLA 3LT4A 2YV1A 5DBGA 1SB9A 1VLLA 5B37A 1T2DA 3PFWO 1KVTA 1DIGA 1RM5A 5U9CA 2PR2A 2WD7A 5DOZA 4NJOA 3ADOA 2JFFA 3UOGA 1P31A 1U2DA 3SBOA 1ZXBA 4YAEA 4NI5A 2CNBA 4M89A 2BGKA 2QRKA 3GGOA 3GGPA 4YA6A 2EW2A 1N9GB 3VOSA 3MJEA 1N7HA 2Y0EA 3PWSA 2X9NA 4K9DA 5C7OO 1SMKA 1SAYA 4S3MA 4B4OA 5COBA 2EKLA 2I6TA 2QIOA 1D8AA 3ETGA 2C82A 4ND3A 2HLPA 4ND1A 3OP4A 1U3TA 4K6FA 4AG3A 2NVBA 4FGWA 5EL0A 4WASA 2VOEA 2VTEA 4EITA 1IHYA 2X0JA 2VQ3A 1ENPA 4RQTA 4UUNA 1EFLA 1SOWA 3OHSX 2YQ5A 3BA1A 3PJDA 4FQ8A 1N7GA 1LQUA 2EP7A 3K92A 1S6YA 3VTFA 5BSGA 4HP8A 1H9BA 1IOLA 2RAFA 2UAGA 3OFSA 4M87A 4BVAA 4A7PA 3PIIA 3MWDB 4KTVE 4KOAA 4Z0HO 3GVIA 4A26A 2JCYA 2NU7A 3UVEA 2GN8A 2OHXA 3DHNA 2FOIA 4U0KA 5H82A 3W4KA 3Q11A 2HMSA 4NBVA 4AJIA 5JY6A 2R6JA 3WSVA 4IINA 1PZGA 4WE3A 4MINA 3BMCB 1A9ZA 5FF9A 1ISGA 5I7EA 2D4AA 3JQ6A 1IZ0A 2UDPA 4PVDA 4LVCA 5TT1A 5C7LO 3GZ4A 1UP4A 1YE3A 2BI8A 4JIGA 4RVGA 5I7FA 4GAEA 4O6VA 5IZCA 2NVUB 2F1KA 4R1UA 3WGIA 1TVEA 3GGGA 2WYVA 3I83A 4CMEC 1ZSYA 5DZSA 2VYVA 4UULA 2D1YA 4PGFA 1TB4A 3IL2A 4H15A 4Y8VA 5LDHA 1ZSVA 2NM0A 4FOOA 3CMCO 3OJEA 4JK3A 2GCGA 3TFOA 3HUDA 1XYGA 1ZIDA 4ZU3A 4XYBA 3OEYA 3HWRA 2X0NA 2ZCVA 4NH4A 1RYEA 2Y68A 3I6QA 4FPXA 4WCDA 1J0XO 1H2BA 2IEDA 4ZRMA 1T25A 2ZJ1A 3JD4A 3Q2IA 1P1JA 4IJWA 2P9EA 4ALLA 3B1JA 4A2CA 2FMUA 1ID1A 3AK4A 3GVCA 4D3SA 3E5MA 1QV7A 5G0SA 2H9IA 2IXAA 1XKQA 1Z74A 2HK8A 5BSHA 1GEGA 3DONA 5I9LA 3INGA 2HMVA 2QRJA 2VN8A 3SLGA 3MJTA 3N7UA 4YJHB 3MOGA 1JU9A 4YB8A 1QYDA 2WWRA 5A1TA 3QSGA 2BFOA 1NQTA 1FDSA 2AEMA 3PHGA 4BOYA 2O4UX 1QYVA 4IS3A 2JHGA 3E03A 5F5LA 4A5OA 1IYZA 3JQBC 1YRLA 4YRDA 4FFPA 2AG8A 3BTOA 3PYLA 2X5KO 4HFMA 4NJMB 3ZWNA 5KNLA 1E7QA 4J3FA 4LMPA 4XYGA 3SVTA 1LC0A 2FPPA 2HU2A 3RC2A 1EK5A 1LDGA 4RZHA 2JKVA 1NFRA 4NQZA 4UEOA 2I76A 4PZEA 3JQGB 2FPIA 4QTZA 4RO0A 1O6ZA 1HWYA 1IB6A 5LCXA 2YJZA 1GPDG 2X58A 1AE1A 3WLFA 3GOHA 5TSDA 3LLSA 1XR3A 5L4NA 3NAQA 3GC6A 4NPCA 4PZDA 3WBBA 1FK8A 3F1KA 3INRA 4JP3A 3I9OA 4DC0A 4U5QA 1YQDA 5EIOA 1Y7TA 4J91A 3W8EA 5C37A 3DO5A 2Y1CA 1K6XA 3JQEA 5CDTA 4HWKA 2H1SA 1H94A 5KTKA 1JLLA 1YWGO 4DLBA 1K3TA 1YKFA 2J6IA 4JBGA 4ZICA 4Y6RA 2GDZA 4UVEA 4BNUA 1KETA 3JQBA 4DIBA 2HJSA 2VRCA 1UR5A 1P1HA 4GQAA 3AY3A 3GVXA 3LK7A 4TKMA 2GD1O 4IBOA 4BNFA 3GMSA 3OIGA 1E7WA 1PGNA 1Q0QA 1V3TA 3NKLA 1DC3A 4P22A 3I9LA 5IXSA 1CF2O 1JAXA 4IY1A 3HDYA 3JD2A 1IL0A 3EY4A 3NEPX 3ZWXA 1UZLA 3VTZA 3H2SA 4BV8A 3W4JA 3FWZA 1NFFA 5DBIA 3U4HA 1E6WA 2GZ2A 5KIAA 4CLOB 3L6DA 3NRCA 3P5SA 3WQRA 3X2EA 4MVJG 3IKTA 3Q9UA 1CQJA 3WGGA 1E1MA 4W7IA 4TVOA 1YJ8A 3VC7A 3PYXA 1IUKA 4OOFA 1O9BA 4PN3A 1OI7A 1C1DA 1LX6A 4WPGA 3H5RA 3SC4A 2AHRA 1MC5A 1ZSNA 2ZTUA 3UW3A 4WLFA 5BNTA 3ZWWA 4XQCA 3GNQA 4CQLB 1NNUA 1XEAA 4BQPA 3QWBA 1Y8QB 3TZHA 3KYDA 4RLSA 3LVFO 1C0PA 1VSVA 2JL1A 3WICA 3WLEA 1GV0A 1YDEA 3RBZA 1R4NA 3WFJA 2DUUA 5BNFA 3LC1O 1KEUA 1Z6ZA 2C2YA 4G81A 1UZMA 3AU9A 1RM3A 5THKA 1HF3A 1NASA 3CMMA 2YV3A 4PLHA 1X1EA 2P4QA 3HJAA 4JJFA 1WVGA 1P1RA 1PQUA 3DBVO 3H5NA 4I5DA 3KEQA 2I5PO 3PQFA 3ZH2A 1H9AA 3CIFA 3LYLA 5DCUA 5TJ9A 3A4VA 1YQXA 2CSUA 4YJFB 2PZLA 1GL3A 4OL9A 5CEEA 3U3XA 1A9YA 4OSPA 1TT5A 2OFPA 5HRUA 3ITDA 1E5LA 4DBZA 2EWMA 1GCOA 2VNSA 1EVYA 2GERA 4J4TA 2C54A 1GTMA 3WFIA 2OBNA 1UXKA 1SOVA 5B4VA 2DUWA 2HQ1A 3FNGA 3H65A 5TC4A 3WB9A 5H81A 2DLDA 4OM8A 3OF2A 2W4QA 5FEUA 4OQYA 3FBTA 3ROPA 3EVNA 1V9LA 1I36A 1NFQA 1B2LA 1VJTA 5T6BA 1SZJG 3R1IA 1LLDA 1PIWA 3RFTA 3U62A 5IFLA 2RH8A 2Y93A 2QW8A 3W8FA 4PLFA 3PXXA 2PGDA 3F3SA 2GZ1A 2O7SA 3ZU5A 4CMAA 2RHRA 4XA8A 4E30A 1N2SA 4CUJA 1OMOA 3GUCA 3GHYA 3LF2A 4AJNA 1PQWA 3WMXA 4F46A 2X86A 3NT2A 5C7IO 4I1IA 4OJNA 2X22A 5IG2A 3E9QA 3UGKA 2P2SA 2ZATA 3JYQA 4EBFA 1HE4A 1VM6A 2YFHA 3NYWA 3U0BA 1HKUA 1MXFA 1NX6A 4L75A 1PGJA 3X2FA 2A92A 5B12A 1YB5A 3I9JA 1E1LA 1V35A 1YVEI 2EKQA 3VPHA 3G17A 1ADGA 4D0RA 4GVXA 4WUVA 4Q3CA 1M76A 4ZVVA 1NQAO 1N5DA 3E5RA 3WJ7A 4U7WA 5JDCC 2Y0CA 4KMSA 2NU9A 4YT8A 4PLWA 2PZJA 4Q39A 1JW9B 4LSMA 2VZ9A 2B83A 4JCOA 4TRJA 3NTRA 2B4TO 2HMTA 5JNLA 3HDJA 3ZWYA 1JDJA 2FR0A 3EGOA 3B20A 1PJBA 3ZV6A 4N18A 3AUUA 1A5ZA 1E7YA 2D5AA 4B3JA 5DP2A 3IMFA 2HRZA 3D5TA 1G1AA 1U5CA 1Z7EA 5EN4A 1FXSA 1K0UA 3R6DA 3JD3A 4J1TA 4B8WA 3HN2A 2CDCA 1JWBB 3PVZA 1PJ4A 1F06A 1P44A 5IN5A 1JVSA 4BB5A 1I2CA 3UFXA 4MIYA 1ZK1A 1TEHA 3C1OA 4D79A 5F5NA 4CMIA 1UP7A 4ND5A 3FTNA 3H8VA 3QIVA 4QXMA 1LA2A 1YQGA 2W98A 4HKTA 4W9NC 5JMWA 5JS6A 4LSWA 1F12A 3K96A 4E4YA 4YTEA 3ZWMA 4GSLA 1WDMA 1MC4A 1Y81A 1B8UA 1H5QA 2EV9A 3L77A 4LK3A 1LSSA 3F6YA 1MX3A 2DFDA 3QJ5A 4HADA 3GG9A 3PLNA 1FDTA 5TJHA 2E4AA 1DRVA 1V0JA 3ZV5A 3EHEA 3JYPA 4J49A 3W6UA 1ZFNA 3OMLA 1H6DA 3WXBA 1CJCA 5AYVA 1GPJA 3UICA 1ZBQA 1IE3A 5A04A 3KV3O 3M6IA 4YJGB 2O4CA 1P3DA 4J4BA 1HRDA 2VHVA 5A9SB 2D59A 3TSCA 4EZBA 4IDBA 2JCVA 3G79A 1OOEA 1J49A 4NU5A 4HFJA 2ZTVA 4RF4A 3PLRA 1MG0A 3VVCA 3F5SA 4I5GA 4GX5A 3M1LA 5DCYA 4WCFA 1PJQA 4DC1A 2VUUA 1K6IA 4INAA 3JQ9C 3DOJA 4RPGA 1MFZA 4Z0TA 1L7EA 3I1JA 3WYCA 3WWZA 1RWBA 2QG4A 2VOJA 5ICSA 5MGBA 4LISA 2C29D 2FP4A 4W6ZA 5F1OA 4UEKA 2HSDA 2O2YA 3UXYA 2NUAA 2VHWA 3GHHA 3IC5A 3CEAA 3GNTA 1UAYA 5JYDA 4GI2A 1VRWA 2GN9A 2PH3A 3AUSA 3KSUA 1DRWA 1TXGA 2W2KA 3GEDA 3V1YA 1MA0A 4Z6KA 2HUNA 4FJ0A 4PLZA 2ZB4A 1QV6A 1A7KA 3GR6A 1M66A 4CMIB 1BDBA 4WEQA 2TMGA 1Z75A 3AJRA 5I8ZA 1GD1O 2DTDA 4J9VA 1DIRA 3HHPA 3RWBA 1DC4A 1ENZA 2EJWA 5JAIA 2VYND 2ZYAA 1A4UA 3JQ9A 3QW2A 3Q1LA 4XYEA 4BGIA 1O94A 4O63O 5I9MA 2E6UX 3JYOA 5EESA 5IZ4A 3EMKA 4FJ2A 3VPFA 4J2HA 1E3IA 3ZWVA 1JQBA 3E82A 3OIDA 1DJQA 4J1NA 1ULSA 3GY0A 4RVDA 4RVFA 4TQGA 3PDUA 1Z45A 2FY8A 2GN6A 2OL4A 2X5JO 3C1TA 4QSMA 3ZHBA 4Z3KA 4WECA 5DBFA 3S2GA 1C0IA 4J16A 4C7JA 4Y9DA 2P9GA 2OO5A 2NV6A 4OHUA 4YQZA 1DHTA 3UUWA 3RUFA 3UCXA 2HCTA 4WKGA 1I3LA 4B8ZA 3ZGYA 3KM0A 4AL4A 4BNJA 1ENYA 4YT4A 5K0ZA 5JLAA 4IMRA 1JWAB 5KVSA 3KSDO 1E3SA 2C0CA 3H9UA 4D41A 4XZ3A 3VZPA 4N5LA 3OICA 2A35A 4B4WA 3JQ7B 1DFHA 2O48X 4XQ9A 1HL3A 2HMWA 4CMEA 3L9XA 4FGSA 4FOSA 4Q3DA 3RASA 4BNHA 1H93A 3EW7A 3HB5X 3I9KA 5A3VA 1W6UA 3TWOA 3E18A 3L9WA 4QX6A 1I3MA 2YDYA 4R1SA 3DAPA 4J7CA 3V2HA 3A28A 2PKQP 2IODA 3PEFA 5CDYA 1PJTA 3AU8A 1GQQA 1U4OA 1JAYA 4MVJM 1HETA 1MLDA 1Y9EA 4L8VA 3U4IA 1UXIA 2BD0A 3S1LA 4BO0A 3KBOA 4OQZA 2Q49A 2XPCA 1LSOA 3D4PA 3IOYA 1VI2A 4KDFA 4R51A 4TZTA 1ZZEA 4IZHA 3DR3A 4PLPA 3B6ZA 5BSEA 4CUZA 2CUKA 3IKVA 3H6KA 2PZMA 4B7CA 4L9RA 1QRRA 3HFGA 1LRKA 4RPHA 5B4UA 2ZKLA 4PLGA 2P5YA 4DPKA 4YAIA 2EW8A 5JCJD 4DQXA 4RGBA 3TZQA 5IJZA 2NVWA 3GVHA 4I9HA 4NBRA 4YYZA 2CVZA 1SCUA 3EDMA 4AFNA 5G4LA 3DQPA 5A05A 5CG2A 5MDHA 1C0KA 1MFPA 4E3ZA 4FIZA 2BRUA 3TDKA 2RCYA 2PGJA 3GN1A 1P0CA 2O3RA 1PQPA 4HBGA 1QLJA 1XG5A 4YVFA 1ZW1A 1UP6A 2V7PA 1DIAA 4JBIA 1OC2A 4IDFA 1DLJA 5CDSA 2TMDA 4GMFA 1KERA 3ROKA 4CLDA 1B0AA 4RPLA 4L0QA 3U09A 2CY0A 4MP3A 4OKIA 4XCVA 5G4KA 4KUGA 2QYTA 3C1AA 2AXQA 3UAGA 3HSKA 4TVBA 1D3AA 1DPGA 5KJFA 3LC7O 4B3IA 4MKRA 4Z9XA 3WS7A 4CL3A 3C85A 4CQLA 1X13A 3FTPA 2X7HA 2G82A 1VL8A 5JYEA 1KC3A 4DLLA 4EEXA 3MOIA 3RUHA 4AJ4A 5L4SA 4YT2A 1E6UA 1YO6A 4AJEA 1Q0HA 2DBRA 1NHGA 2FSSA 4Q3EA 4XX0A 1PJCA 1QMGA 1HDXA 1D1TA 2WYWA 3UHAA 3DBRA 3V2UA 3W8DA 2NTJA 4W4TA 3KB6A 3WX0A 5KKAA 1PX0A 2C59A 5EPOA 5B1YA 3ZW9A 4DPMA 3CZRA 3EVTA 1VJ0A 4EDFA 1U28A 4E5NA 4RF2A 1M75A 5EQDA 3BHJA 1NXQA 1WP4A 2PD6A 4ND2A 4GKVA 1U5AA 2FZEA 5K6AC 5T8KC 4PG5A 5DOVA 1I2BA 3GH3A 1MUUA 4MO2A 4IDGA 4II2A 1DC5A 3M2PA 5KWEA 4PCVA 3G0OA 1GADO 1BDMA 3CE6A 3CTMA 1ISMA 4RPKA 3BMOA 2RIRA 5ILOA 1SBYA 3MTGA 1PSDA 3RCBA 5HWSA 1XU7A 2B69A 1WLYA 4QO7A 4UVIA 1KVQA 4XYLA 4RLHA 5T64A 2YV2A 1E5QA 1LRLA 1HT0A 1MXHA 5FFFA 1B26A 5B4TA 1BMDA 2VHYA 3NDJA 4Q3BA 5G0TA 2QRLA 2BGLA 1ML3A 3GT0A 3G1TA 3H3JA 1ZMOA 2ZB8A 3QV1A 1M6HA 1BG6A 3TZ6A 2NACA 4CMCA 1ZEMA 3NTQA 4MVJI 4N54A 5TX7A 1W4ZA 1KIFA 1YOVA 2F00A 3CXRA 1B8VA 2POQX 1Y5MA 5AXAA 4ALNA 3I4CA 1E6EA 2Y1FA 3ZDFA 4E33A 3NGLA 4CPDA 4FW8A 1EDZA 4RF5A 3NJ4A 1QORA 1DO8A 3UCFA 1MP0A 1HLPA 1HTBA 4C7KA 1KEWA 2ZYDA 1PZEA 2VUSA 3SEFA 3IP3A 1HDRA 2PD3A 3TRIA 3W1VA 1LUAA 1SC6A 4MIOA 3BZUA 5L4LA 1GZ3A 5L53A 1Q7BA 2CFCA 4X54A 4H3VA 3DBRB 3ZHXA 3RAJA 2IYOA 1FJHA 2ZK7A 3HN7A 3JQAA 5A5EA 2B36A 2V6GA 4M55A 4BNZA 1B8PA 3HFSA 3ANMA 1BXZA 3GF4A 5F1PA 4BS9A 3DBHA 3OETA 1PJSA 4CR6A 3L07A 1DRUA 7MDHA 3PYMA 1H2HA 1CDOA 1W73A 4O0LA 4CM5A 2VZ0A 2Y0DA 1LQTA 1ORRA 3WR5A 3FD8A 1YBVA 1NYTA 3G1UA 4AJ2A 4ZN6A 1BGVA 1U2GA 4L76A 4L4XA 2EEZA 5TIIA 1P77A 1VC2A 3C7DB 2HK7A 4E2YA 4JX8A 3VZSA 3JD0A 2NVUA 2X1HA 4QFDA 1ADBA 3Q2KA 4Z9YA 2Y67A 3EUWA 2WSBA 2PA3A 5IF3A 4ID9A 1E3LA 1QP8A 3W6ZA 3TOXA 2HRBA 2QYSA 4OGWA 4DYVA 3GPIA 2UUOA 9LDBA 4BL5A 5CHEA 4MKZA 4BNNA 2J3HA 1DAOA 3ZV4A 4P4GA 4KWHA 4TKLA 4I8XA 1ZJZA 4NU6A 4FFMA 4BKPA 4IUYA 2Y99A 3NJ8A 4FFNA 4MDHA 2HAEA 3GG2A 4FFLA 5ER9A 1BVUA 1GU7A 2NQ8A 3JQ8A 2I67A 3MZ0A 4TRNA 4PG7A 2DQ4A 1P0FA 3RUCA 2IDZA 1ADCA 3DB2A 4B7XA 1LRJA 2GRAA 2ZB7A 1UXJA 2BFMA 3PJEA 4QUKA 1LXCA 3JSAA 4W7HA 3SC6A 1H6BA 4GSKA 2R00A 5A9SA 4CMBA 2PKRA 5CDUA 2X8LA 3JQAD 4Y6SA 2VTDA 5JPIA 3M1AA 4U6SA 1GAEO 1ZH8A 2WD7B 1OFGA 1M6WA 1ZK2A 1PL7A 4RVHA 4WCFB 5JO9A 4IJKA 1O5IA 4R01A 3H9JA 3GDFA 4GH5A 3WNVA 3GDGA 3QHAA 3I52A 3DDNA 2WYUA 4YCAA 1HYHA 3DZJA 1NVMB 1GZ6A 3JQFC 3ZWOA 1A72A 2JFGA 2DBQA 2J5RA 5I7VA 1B14A 3QLJA 1U8XX 3QVSA 4UEJA 4BO1A 1X15A 4U6QA 3Q3CA 1GYRA 3AI3A 5JCXA 4RORA 3LT2A 3DOOA 3T7EA 1UDBA 1G0NA 4J0EA 2FSVA 4J1QA 3ONFA 1QYCA 4DA9A 3ZU3A 4RV9A 4DXHA 1NWCA 2GZ3A 5DNAA 2FWMX 2D5CA 2W90A 4FDAA 2BH9A 4XKJA 3KVOA 3DZGA 4HFNA 5F21A 1EUDA 4AJLA 3PZBA 3GAFA 3L6OO 1U7HA 5A5FA 1E1KA 3FSRA 1DXYA 4MVJP 2J8ZA 3N58A 3D0OA 4NFHA 4MP6A 3ZWCA 1CETA 2VWQA 4JLWA 1LBEA 1QR6A 3NDRA 4IDEA 3ORFA 3BMQB 2NTNA 2X5OA 1Q1NA 2Q1SA 4II3A 4PLVA 4NHEA 1QKIA 2JAHA 4MKXA 4CMGA 5K9ZA 1Y8RB 1DEHA 1E3EA 3D3WA 4IQ0A 1P9LA 2FN7A 1RPNA 4M54A 1LDMA 1SO8A 2GN4A 3WGTA 3BMCA 1EE2A 3FPCA 1M2WA 5TLSA 4LW8A 1NTOA 2IZ1A 1IZ9A 2I3AA 3KHUA 3MJ4A 2E48A 4U8GA 4FS3A 3OBBA 4FJ1A 3WGZA 4E5YA 4TSKA 1NP3A 3V1UA 3FR8A 3RFXA 3S55A 2FPGA 4WOKA 5KVQA 3RROA 2BFAA 2CVQA 1ZK3A 2YHIB 4D3FA 1HXHA 1JKFA 4OXYA 2UUPA 3KYDB 3O03A 2PFGA 2BF7A 1WDKA 5COAA 5L7YA 1XQ6A 3V1TC 2A4KA 3FWNA 2R2GA 1LTHR 3QVOA 1A7AA 3IP1A 4MVJA 4NMHA 3QVTA 4BNGA 4ZA2A 4DBVO 3CINA 3DZBA 1F0YA 1A4IA 1DJNA 4R16A 3ZHYA 3DBLA 3EC7A 5T8KA 4RVSA 3NDIA 3VPXA 4OH1A 2AA3A 1V3UA 3QVWA 1AXEA 4AJPA 3NT4A 3TPCA 3ZN2A 1B16A 1CRWG 3D3WB 1YJQA 1X7HA 2AEFA 1BW9B 1R4MB 3DFUA 3VVBA 2O3JA 3OSUA 3GNSA 4DL9A 3MEQA 4A27A 1NPYA 1ISHA 1P1IA 5JMPA 3FN4A 2J3KA 4DPLA 4I5FA 1I10A 2AEJA 3FCOA 4BO7A 4GBJA 4CV1A 2LDXA 2YZ7A 3EAGA 2O23A 3WGYA 3AI1A 4BGEA 2NU6A 1JKJA 4J1SA 1XLTA 5L7WA 4BNTA 4ROSA 3V8BA 5DULA 1OAAA 1TI7A 4PZCA 4PLYA 2X0IA 3A14A 3RU9A 4E0BA 5BSFA 4IGFA 1LNQA 2J5KA 4HUJA 1TT7A 3COSA 1EMDA 3FNFA 1NR1A 2X6TA 3DBLB 3CPSA 4N7RA 1WMAA 2OOSA 2PTGA 1V6AA 1R16A 4BO9A 4ZQBA 1T1SA 3KSZO 4WNCA 1Y5RA 1YL6A 4Q3NA 3B70A 3IJRA 4W9NA 2CMDA 2I65A 3VH2A 2J3IA 1YB1A 2XAAA 5A3JA 4S1VA 1ENOA 1PR3A 4BV9A 2G1UA 2UVDA 3RSHA 1DBVO 3E1KA 2GASA 3ONEA 3ONDA 4E5PA 3H4VA 2Q50A 4KTTE 2HDHA 4PIVA 1PTJA 2C20A 1UH5A 3WTBA 3AUTA 4TRRA 4WLUA 1XELA 4YACA 5DN9A 5HM8A 4D45A 1SNYA 2DBZA 1KBZA 1NPDA 4E13A 2H63A 3JCZA 2ZQZA 4XGKA 3OQBA 4G2NA 4ONEA 3WDSA 6LDHA 4OO3A 2C7GA 1WZEA 4YT5A 2EKPA 5ICMA 4NG5A 1LDYA 1PGOA 4UUMA 2Q2WA 1R4NB 3ETDA 4BIIA 4IGEA 2GR9A 5T67A 3KYBA 4R9SA 1I24A 1ZUD1 4MPDA 5JCJA 1KS9A 3JQCA 3DZHA 2CF5A 2SCUA 3LT1A 3MCVA 2C5AA 4GVLA 5FI5A 1JA9A 3P7MA 3ABIA 3G49A 3PJGA 1MGOA 2EP5A 3GFGA 2JCXA 1YOVB 4TRMA 2ZTLA 4XGIA 1ZK4A 4E31A 3MJVA 3JQFA 1HZJA 3B1FA 2FHSA 2GGSA 1GUZA 5EQFA 2DKNA 3EYWA 3Q6IA 2X9GA 3AFMA 4RJTA 4P4NA 1NPTO 1EUZA 4EJ6A 4XRRA 2DT5A 3TJRA 2GSDA 2VHZA 2IYPA 5T57A 3DZIA 5KVCA 4BMSA 5FWNA 2PK3A 3WYEA 2UYYA 1KVUA 3RD5A 1KY5A 3KXDA 4R1TA 3RBXA 4PLTA 4YPOA 1LDNA 1E3WA 1YGYA 2EXXA 4TZKA 3ZWAA 3LC2O 1GDHA 4LN1A 2X0RA 2OBYA 1MB4A 4BUCA 5T5QA 3S2IA 3RFVA 1G6KA 2JD2A 3RKUA 3RKRA 4CUKA 2G76A 4ESOA 4ND4A 1ISJA 1WAMA 4PG4A 4MJLA 3PHHA 1EBFA 1ZKMA 4FN4A 1PS0A 1U3WA 4DMMA 5IDYA 1BXGA 4YRAA 1BRMA 4J0FA 3PPIA 1F14A 4CM3A 1JVBA 1PL6A 1E7RA 1Z7BA 1HSOA 3GAZA 4UVGA 4R54A 4EUEA 3GN2A 5L9AA 2D8AA 3AY7A 2Y1GA 4MIEA 4XR4A 4AJOA 4KQWA 3KTDA 4A73A 4EGFA 1I30A 3WGHA 4EJ0A 3DMYA 4AJJA 3NUGA 4EW6A 4CM9D 3OJOA 2VT3A 2W2LD 4BNKA 1PZFA 3BXXA 1T2FA 2QZ9A 2DTEA 5HTOA 3D3EA 4DUPA 1PS9A 4RDIA 4MVJE 4DIOA 5JXWA 3T7CA 4K28A 1QXSA 2Q4EA 4FD3A 4XIJA 3JQAB 1C3VA 4JBHA 4XB2A 5L3ZA 1LI4A 5TF4A 4XDZA 1HYEA 4H16A 4CL8A 2O3TA 3BMNA 4TROA 1C0LA 3MJCA 4IXTA 5GMOA 4K26A 3C24A 4LCEA 3S2EA 1HDGO 3A9WA 2NU8A 4ZRNA 3RC1A 1WDLA 3E9MA 3RJ5A 3AI2A 4A0SA 3U4CA 3AFNA 3WJAA 3I9NA 1T2EA 4GLOA 1BXGB 1LC3A 1O8CA 2AW5A 2YQ4A 3STHA 1LDEA 1U9JA 1WZIA 4GX2A 1I33A 3U4DA 3WNQA 4B4VA 1N92A 2BKAA 3IUSA 3O8QB 3N74A 3ENKA 3GEMA 3IJPA 4NBTA 4RCVA 1H6AA 4L74A 1VJ1A 5U1PA 4CM8A 4D7AA 4EJMA 1AXGA 3DMTA 4D44A 1AHHA 1E92A 4IIVA 4OIMA 3WGOA 3I6IA 4P4LA 3EZLA 5CFZA 5IDXA 1L7DA 1G0OA 3PTZA 1HDCA 1GQYA 5ER6A 1A27A 3VHRA 1XHLA 4BNXA 3BYZA 3DZKA 1R0LA 1R37A 4CJXA 3HQ4O 4GWGA 1GYPA 4OSOA 2EGGA 1YH3A 1Y9AA 1PL8A 1UXHA 3OM9A 3SLKA 2DU8A 1K5HA 1ONPA 4HNGA 5EJ2A 1PGPA 2JHFA 4PLCA 4FSHA 1PJ2A 4O1MA 1T24A 1DC6A 5JDCA 3JQ8B 4WLOA 3Q0EA 1YDWA 5A02A 2DTXA 3PK0A 5I9NA 1X7GA 1OZAA 4BO2A 1JKIA 2I99A 1AHIA 4IJUA 3PQEA 2RHCA 4ILKA 5FYDA 3DMTC 4FCCA 3DL2A 3DOCA 3D7LA 3K8ZA 5IZCC 5HS6A 3SX2A 3K5PA 4CM8B 2X23A 2ZYGA 3NV9A 3CZMA 1F17A 2P9CA 2QZZA 5A03A 1DB3A 9LDTA 1Y1PA 3A06A 4CLRB 1PEDA 4G5HA 2Z95A 3E48A 3PGJA 3TQHA 3F47A 1U1IA 3ZI0A 1GZ4A 1PWXA 4CR7A 3I5MA 3PFFA 1TLTA 2NTVA 1O95A 2CZCA 3UH1A 1HDYA 1WWKA 3DZFA 1LJ8A 4GLLA 4QT0A 2O7QA 4XQEA 3RC7A 1QSGA 3D4OA 5ENVA 4ITUA 3PP8A 8LDHA 1PZHA 2GNAA 3TF5A 3IDSA 2BMAA 3WG9A 3DXFA 1EBUA 4URFA 1I32A 1ONOA 3OIFA 4FFRA 3PZRA 4NNJA 1UUFA 4F6CA 5JAMA 4XWYA 1NAIA 4NK5A 2YHIA 4YAKA 5I7SA 2W2KB 2PNFA 1U3VA 5G2OA 2EF1A 3T4EA 2VT2A 4M49A 5DDIP 5CPFA 5FI3A 1ADFA 3OQ6A 4K1LA 2A94A 3R0IA 3U5TA 1PJ3A 5CEFA 3L4BC 3VDQA 3HE3A 3E9NA 1NBOA 1Z82A 4BHTA 3AUAA 5H83A 3AOGA 1RYDA 2Q3EA 3OQ1A 2YDXA 1Y8RA 4BNWA 2C5EA 1BTOA 3E6AA 2P68A 3KRTA 2BELA 4Z9FA 5KVVA 3H9EO 1D1SA 4FC6A 4U0JA 3PI7A 3QWIA 1ZVMA 3C3XA 4YRBA 1WXDA 4XIYA 1KVSA 1KVRA 1ARZA 1LLQA 2D3TA 5CP8A 4BNVA 1AUPA 4JJGA 1JN0A 2NSDA 4XYMA 3F46A 3PWZA 1B15A 4D42A 4EI2A 1LLCA 2Q2VA 3K6JA 4OYRA 4DQVA 2HK9A 3TFQA 4YWJA 1PS8A 4WCFC 4CM7A 3L4SO 1ZO8A 1WW8A 1FMCA 1VPDA 3PQDA 1ULUA 2EGHA 3AM5A 1XGKA 4Q9NA 4CMKA 4NJMA 4JXKA 5TNXA 1IPEA 4TMFA 4F3YA 4DWVA 1XA0A 3UKOA 2C7VA 2ZIZA 5HBRA 3NX4A 1EUCA 3AM4A 2Y1DA 5JDIA 3JQGA 3KYCA 4ALIA 3INTA 3H9QA 1F8GA 4XEHA 4Z3DA 1SPXA 1XCBA 5GZ3A 4MVJH 1R4MA 4QQRA 5K6AA 3IS3A 1HZZA 2OMEA 2OORA 1EQ2A 1FF9A 1OBFO 2PLAA 4GWKA 4PVCA 1EVZA 5AVOA 3DWFA 4YXFA 4MOWA 3WBFA 4IS2A 2XOXA 4JROA 2BLLA 4D43A 4XB1A 2EIHA 4R68A 2JD1A 5KCZA 4O59O 3PGXA 1R15A 3FR7A 3TN7A 3LQFA 3JQDA 2EJVA 3L0DA 1EZ4A 1UJMA 2JAPA 4KUEA 2IE0A 1Q0LA 2J3JA 4IQ8A 4GGPA 2VNAA 1GUFA 4JJIA 5KOIA 1Y6JA 1KEVA 3I4FA 1N1GA 5JC1A 2Q1TA 5TQVA 1V8BA 3WWYA 1LLUA 4IJVA 3OH8A 1A71A 1ZNQO 3WTCA 3PDJA 3TL2A 2DFVA 3LLVA 1F8FA 1BSVA 5C3MA 3GEGA 4PG6A 4BKQA 2Z1NA 2B35A 4CLOA 5ENDA 3WQQA 1N8KA 2YY7A 2X4GA 3QP9A 5C5IA 4YR9A 3C8MA 2X9VA 3ZW8A 1HDOA 1VSUA 4XGNA 2VWGA 1D7OA 2Y1EA 4P8RA 2PV7A 4UVHA 4HV4A 1IY8A 4ALKA 5JSFA 3JTMA 5TS3A 1Y8QA 4R3WA 4AJ1A 2E37A 4CQMB 4KP7A 1J5PA 3DC2A 1TA4A 1E7MA 4UUOA 1B7GO 2JD0A 1GFSA 3PJFA 4GX1A 4DYDA 4DTIA 2C07A 1N9GA 2PGLA 3ULKA 2G17A 1JTVA 2ZJ0A 1M67A 4JGBA 4IDCA 2P5UA 3I3OA 1ONNA 3GDOA 5GZ6A 3JYLA 4NZ9A 2ZTMA 1E0DA 3K2BA 3TL3A 4GGOA 1YONA 3WQSB 1T4DA 1K89A 2AQ8A 3O9ZA 5JW6A 2AE2A 2B4RO 3GLQA 4P38A 1U7TA 1BWSA 2YUTA 1X7DA 4WK6A 4B79A 1P45A 4A10A 5G4KB 5BNIA 1I2ZA 2WDZA 3GRPA 4WEOA 3U49A 3OJFA 4MP8A 3ZCXA 2UV8A 4WLEA 1SEVA 4IQGA 4WLVA 1NVTA 3UN1A 2NWQA 3OA2A 3AWDA 3FNEA 5EINA 2VWPA 1KOLA 4BMNA 3ON5A 2FR1A 5DP1A 4KWIA 2V6MA 3IIEA 1E3WB 3DAGA 2ET6A 3PRJA 2GF2A 2YW9A 4OMUA 4D0SA 5G0VA 4QECA 1AN9A 4J4HA 3V5NA 4PRKA 3H9GA 3ZHZA 1EVIA 3MTJA 3GFBA 2I3GA 4W99A 3RC9A 1MV8A 5BQFA 2R00C 2Q1WA 1UXGA 3BMNB 4RVUA 1DAPA 1EE9A 4HX5A 1DHRA 1NQOA 3FI9A 1EK6A 2Q1UA 2B37A 4GX0A 1I3NA 2P4HX 3A1NA 3PHJA 2C2XA 4OKNA 3S8MA 3WYBA 4B3HA 4H7PA 3GZNA 4HNHA 1XIVA 1XSEA 2D0IA 3C7AA 3OECA 4OAQA 5CEJA 1O0SA 5AXDA 3RBVA 3ENNA 2Q99A 1HDZA 3O8QA 3ROMA 3ZNOA 3GRKA 3RU7A 6ADHA 1KC1A 3DTYA 2P91A 4EEZA 3FPLA 3FHLA 4RZIA 1NWHA 2GYYA 4F45A 3H7AA 4CQMA 4BMVA 1KEPA 5BT9A 4J9UE 5L45A 4J6FA 3VH4A 1LEHA 1GR0A 3LSYA 1R66A 3NT5A 4NFYA 3GUYA 4CQMD 1DFGA 1DSSG 2GPTA 2PY6A 4KZPA 2V6BA 2VRBA 1GCUA 4XJTA 5BR7A 2PH5A 2B5VA 2VYVD 3KOUA 4J43A 1CIVA 1QYXA 1FDWA 1YBAA 1E1NA 2YYYA 3ITKA 4NFSA 2G0TA 3GA0A 4BKUA 4CLXA 1VL0A 4UAGA 1CQIA 2XXBA 4AJHA 5A4DA 1C1XB 2WM3A 2HJRA 5TT0A 4EUFA 2G5CA 3K2EA 1DIBA 4KUHA 4R9RA 1HE3A 5KJCA 5JFOA 4CM1A 3KZVA 4BGVA 3GPDG 5JBIA 1HYGA 2B4QA 5U4QA 4YJFA 3T4XA 5KJ6A 4JNKA 3CKYA 2Q4BA 1NAHA 4XRGA 1XQ1A 4ALMA 1EFKA 5CPBA 4YJHA 2O50A 3IQDB 1RJWA 4IIUA 3F4BA 3SJUA 4GMGA 4CV0A 5JAZA 3O4RA 2ZCUA 3JYNA 5DF1A 1PU2A 4JP2A 4BNIA 3WSWA 4ZGWA 4B7UA 3OJ0A 3BMQA 2ZB3A 4AVYA 1KY4A 3FF4A 1UAGA 3WGQA 5THQA 3LZ6A 1EEHA 3F4LA 4NK4A 3VAZA 1GY8A 2V6FA 3OA0A 1NHWA 1NR7A 4L4RA 4M86A 1R12A 3GVPA 4GL4A 4ZD6A 5IDWA 1BHSA 1ZCJA 1C1XA 3BHMA 2GUGA 5CDGA 2PWZA 3PHIA 3H5AA 3KLPX 1YS4A 1ZJYA 3EK2A 4ZQEA 4YJGA 4YBZA 5L51A 3HNPA 1CWUA 4D3DA 2GLXA 4LVUA 1K2WA 2XF8A 3ZZNA 2I66A 2A9FA 3D5QA 4K6CA 1FDUA 5EMHA 4ZQFA 2PD4A 2JJYA 3DAFA 3ZWPA 4DMLA 4CMJA 3VH1A 2AQHA 3LDHA 1K6JA 4E32A 4YEDA 1U4SA 3KLMX 2O2SA 4CLHA 2DPHA 4N5MA 2OXIA 3RUIA 2XXJA 3PHLA 4CV2A 2Z1MA 5ES3A 2VZ8A 1P1KA 3K73O 4UVDA 4I08A 3BAZA 3S2FA 1IHXA 3ZNQA 4OOEA 1WMBA 2HO5A 2LDBA 4L4SA 4R5MA 3QWFA 1GYQA 2DAPA 3AW9A 3QRWA 4ALJA 4BKOA 1T1RA 5A9RA 4XDYA 5HA5A 2Z5LA 4PG8A 2WE7A 4N5NA 3U9LA 1T4BA 2OP0A 1SEPA 5AOVA 1T2AA 5AQ1A 1BW9A 2BHLA 3BIOA 3QWHA 4HFRA 3WMWA 1R6DA 2VYNA 5AXBA 1VKOA 3K31A 4LRTB 5ILGA 5F1KA 1E7SA 2WMDA 2J5QA 3GK3A 4R3NA 3ADPA 4TWRA 1UZNA 4OXKA 3ZU4A 1GQ2A 4FR5A 1XDWA 4RL6A 4DVJA 4DRYA 2OP1A 1S7CA 2VUTA 2DVMA 2IRWA 4NIMA 3SXPA 1W8DA 2DBVO 3HG7A 4WJZA 1YB4A 2DM6A 3QE3A 5LDGA 1EVJA 1FDVA 3KO8A 3R3SA 3AY6A 2WTBA 2ILTA 2DPGA 5A06A 3ROQA 3EZYA 3NTOA 1DFIA 1U8FO 1EDOA 1YL5A 4J90A 4WNIA 4D46A 2EHDA 4R1NA 1W0CA 2CVOA 2WD8A 1KYQA 3D1LA 4YAGA 4XD2A 1DIHA 3HDQA 2EERA 3KYCB 4NBWA 4B4UA 4YQYA 2D2IA 4DREA 1SB8A 3VPGA 4YDRA 2CDBA 5ITVA 4E5MA 1X0XA 2RH4A 4WGGA 3WOHA 5IAAA 2BGMA 1TT5B 2V65A 1N1EA 3RVDA 4R41A 4BNLA 2VRCD 3K30A 1V3VA 3FBGA 3H3FA 1CEQA 2Q46A 2I9PA 1RM4A 1U3UA 1VE9A 3TNLA 1QLHA 1I3KA 4FBGA 1HE2A 3ZV3A 3H2ZA 3VZRA 5GY7A 2BI7A 3ETEA 4GKBA 3ASUA 3CUKA 4CV3A 4M8SA 4WOJA 4YAJA 5DT9A 4WLNA 4A03A 1YL7A 7ADHA 2OZPA 1ISIA 2H5LA 4I9NA 2IZ0A 5L95A 4CR8A 2ZQYA 3IUPA 3ZU2A 5HS4A 3BHIA 2GO1A 1Q7GA 3AM3A 1CERA 4J2OA 4J7XA 5JO0A 2HMUA 1PJLA 1X1TA 4ZQHA 3AOEC 8ADHA 1RM0A 4JQCA 1HEUA 1X14A 3GMDA 3QVXA 4CM9A 5IDQA 2AE1A 4BO4A 1VKNA 3KEOA 4I9UA 2BFPA 2O3SA 1QG6A 5G0UA 4BO3A 1H0KA 3VDRA 4DLAA 3HDHA 3VKVA 3VKUA 4F6LA 2WJPA 3HADA 4BO5A 2CF6A 3ICPA 4IDAA 4AICA 4BB6A 4M1QA 1LDBA 2AQIA 3OEWA 4MVJD 3VZQA 4E2WA 2HKIA 1B3BA 1I8TA 4BGUA 2VCYA 5COQA 1YBMA
chains in the Genus database with same CATH superfamily
1CY2A 1W0KA 1QX4A 3OKPA 4BFZA 3HN6A 4BKRA 4H60A 1JALA 4DIFA 3ZIAA 2XUZA 3KJEA 4EEKA 1T3ZA 2QRPA 4Q4AA 4GYWA 4ER0A 1VPWA 1KO1A 5ADUS 1K5GA 3REQB 4OGKA 3H0KA 2VTKA 4IOKA 4B6JA 1ISFA 3C3YA 1Q0UA 3ST7A 3RTCA 2G4VA 2H31A 1TYCA 2BW0A 3BTVA 2XVZA 5KOJA 2NIPA 4J16C 2X3UA 2DHEA 4ZO6A 3SMVA 1SUIA 1Y7PA 4IZOA 2A5FA 4AZSA 1GV1A 3T7DA 1XV5A 2ZT5A 4BZWA 3L93A 3K35A 2PG3A 5HJ7A 3DFZA 5KJEA 4CF7A 1UEJA 1ECPA 2A0FA 2AIRA 1XLWA 2JFHA 5DKFA 2LIVA 2QNRA 4LYFA 4HJRA 5IH3A 4ER3A 4HXYA 1OD6A 2X5NA 3OO0A 1M6YA 3PDIA 1LF5A 2HT1A 5IRCD 4ZI5A 4U6NA 1NP6A 2H6EA 2HYDA 5EZ6B 2IYZA 1GZVA 3MG9A 2OGUA 1C1DB 4NBUA 1QM5A 2QQ5A 2F4NA 2FUNB 3RYIB 2P1ZA 3QY9A 4ZOQI 3MS7A 4JYPA 2YMQA 1BCSA 2HPVA 3HPQA 2Y1OA 4Z0PA 3FJYA 1QPBA 1UPXA 1IRIA 1I0ZA 2INGX 2JI8A 4H7FA 3OUUA 4HDAA 1PW7A 4KO3S 5DGXA 2MMGA 3FBWA 2VK1A 4OK3A 4JEHA 1LWOA 3THOA 2FR8A 1IULA 2PWYA 3GT3A 3K9HA 4HWOA 4PFSA 4BNMA 4UE2A 4CU5A 4DAOA 2JGJA 5KZMB 4OY3A 5CA0F 1KQOA 2O3QA 3K9CA 4W82A 3VTAA 4JLKA 4YDSA 1LNZA 4IDDA 3UYLA 1I1HA 1QYWA 1W5BA 3K9QO 4HYEA 2A6PA 2YRFA 3IELA 2B82A 2C7PA 4YY3B 2QW0X 3NHLA 4O5OA 4HDCA 3PIDA 3TAUA 1V16B 4WVLA 1TECE 3HJNA 1O89A 3PEWA 2IP4A 1WETA 5BVGB 1I5RA 5K0NA 5KTTA 3K6SA 4QBHA 1I9CA 1T36A 2R44A 2A9RA 4KFRA 2PZKA 1WKVA 1ICIA 2R1TB 1KSJA 3NNDA 4BPRA 1T2CA 1AV7A 2KHZA 4JLSA 3RS8A 3H2JA 3QIAA 4Q48A 2QTVA 4S0ZA 2FZWA 1E3MA 3B60A 1E1QA 2YOGA 4ARZB 3CZPA 4QBIA 1ZMTA 4URUR 1KHTA 3HL0A 4QO8A 3ZXYA 2ZUSA 1KYVA 4ICIA 3P2MA 3TOZA 3O8RA 2WB4A 5H70A 1G8JA 4JT4A 2B8TA 5E4JA 1TYZA 2IYNA 3WIVA 5ARCA 3ZNNA 4CM6A 4G4IA 5M29A 4QPDA 3VAAA 3W5SA 5E1DA 4YMWA 3UCEA 1AG9A 1H8EA 3M6WA 5FYQA 5IM4F 2JA2A 4F1WA 1NLYA 2WWXA 4EQ6A 4DNFA 4IWXA 1SUAA 1WXWA 3O1HB 1CY7A 2WSSD 3U61B 4XVCA 1SZDA 1XNHA 4L5JA 2ATXA 5CG1A 3FHOA 2WIKA 5CVTA 3LKBA 4FYHA 1NURA 5LC1A 1XCMA 2MCFA 4A0RA 2FW6A 2FPMA 2CV1A 3RUDA 1D1QA 1UJNA 2XBLA 1XU9A 5AK3A 3LCCA 5AVWA 4WDRA 5EC8A 1ZUIA 1E2FA 1E2NA 1W1UA 2VF5X 4JITA 1F1BA 2CXHA 4YJDA 4YJ3B 1T8RA 4RFSB 2ZJFA 1T2NA 4I55B 5FOTA 1E4OA 3GZNB 2V4ZA 4UHDA 1P8AA 2PXXA 1NM5A 4PHFA 4HN2A 1D0SA 3PDIB 4LGVA 4P3KA 5ILQA 3R77A 4KRGA 1NBWB 1R6AA 4BMXA 4CODB 4H77A 3P2JA 4RKRA 4Y6PA 1UDAA 1FNBA 4KDEA 3B1KA 3QXXA 3TZCA 4E08A 2XCUA 1YD7A 3P4XA 4BECA 3P94A 3D6AA 1AKNA 3N8DA 1JIKA 3AO0B 3B6JA 4JFRA 4ZALA 1Z56C 3URMA 4BVHA 3F1LA 4IZIA 3HM2A 5DYWA 3OOWA 2E82A 1KAEA 2G0NA 3AG5A 1EQUA 1QQ6A 2J0UB 1XTRA 2OHJA 3E5HA 3OQHA 4NICA 4UNIA 3R8FA 4Q9IA 4DQUA 1P1FA 4RYDA 3VYWA 1P75A 4QDOA 1CP3A 5KOHB 2G6TA 3AR4A 3F5QA 3MINA 3AF1A 3DJFA 1GUBA 1W4RA 2W8ZA 1UBSB 3DBHB 4P4UA 4KI7A 5GVRA 4DSAA 1F2DA 2Y05A 1ACJA 4IXNA 3QH4A 5GM1A 2QLFA 1L1FA 3UB3A 3O26A 1R18A 2VIIA 2BN4A 1P91A 2ZVDA 4RSHA 1F5NA 4GE3A 1KWGA 3E70C 3B5JA 2XWSA 3JAWA 1IN5A 2B5WA 3EMDA 5FTNA 4BVKA 2QM0A 4G0MA 3LT4A 4QXPA 3LY7A 1E4EA 3RFFA 3K5IA 3AR5A 3QY0A 1GSAA 4ZP1A 1E0SA 3HVHA 1YJXA 1RM5A 2E2WA 2PR2A 3ONVA 4KXVA 2WD7A 2DQZA 4MUBA 5DYIA 5C9ZA 2O5RA 2XDWA 4NJOA 2LCQA 3GEEA 1CY6A 1U8EA 3BBPA 2NU9B 4HMPA 4H3KB 3FSGA 4O4LF 1U2DA 1A9RA 4NI5A 5ESRA 8MHTA 4M89A 3NOVA 3NPMA 3GGOA 1YCGA 2HBRA 2P62A 2EP8A 2WHPB 3KJZA 2R6CA 1GCAA 1LI7A 3HGMA 2M1XA 3MJEA 4U7DA 3RC3A 3PWSA 2X9NA 4JELA 1NXPA 2ZUWA 4P3NA 1K7SN 4DLSA 2A8YA 5JCOA 2MSDB 1L4GA 5COBA 1LVUA 5B2ZA 2UZ1A 2I6TA 2FETA 1D8AA 3ETGA 3GX1A 4MHTA 2C82A 1SD2A 2M6SA 1PR4A 1G60A 1P7YA 1VPLA 3DV0A 4ZVSA 1USKA 2IL1A 5J2TB 1RC8A 1JZQA 4RFSA 4WASA 1ZIOA 4DIKA 4J3NA 1BS9A 4LG1A 1Z4KA 4EITA 1TJ4A 2VNHA 3DW1X 5AW2A 1IHYA 1FEZA 2HIAA 3U48A 4K9OA 1XMQB 4JT2A 1BE6A 4C7OA 3NVAA 4RPCA 3BFKA 4RQTA 4POOA 1CEXA 1VFNA 4FE7A 4JOQA 1E1DA 4WQMA 2RBKA 5IULC 3TLBA 3QPVA 2VI5A 1IOLA 1XVVA 1KQPA 2EQBA 2UAGA 3O3NB 1A69A 4M87A 2OBMA 3RJMA 4EGQA 4EI8A 2F3UA 3GLKA 3PIIA 5B55A 3SHQA 2XMCA 4PU0A 1T6BY 2WBLC 4KOAA 2YVAA 3R0QA 4AT1A 1MAAA 3LFTA 3PXGA 2I71A 1DKRA 3NNSA 2DGDA 2FK7A 3C5EA 5DHTA 4A26A 1Y82A 5HZKA 1ZI9A 4ESVA 3UVEA 1TJPB 2X2EA 4G85A 1R7RA 1TZMA 1M2NA 4S0XA 3JARB 4UCFA 2OTCA 4X7MA 4OYLA 5H82A 3W4KA 4F72A 4DUZB 2HMSA 2BSQA 1SCBA 1T8YA 1USGA 3KVNA 1J8MF 2JAQA 3WSVA 2EIXA 3SR3A 5I7WA 2GBIA 4P53A 3AF0A 4R6WA 3SZMA 4MINA 3BMCB 4YDQA 2IDKA 3C41J 3FOWA 2RARA 5AJUA 4H6PA 1XRRA 5J43A 1R4ZA 2GEVA 4NCJA 3UB2A 3VU8A 3R3HA 4N01A 2V6IA 3JQ6A 1PYGA 4LVCA 3G7SA 2AZMA 1NT2A 4I2NA 2YJ4A 4YCLA 4RESA 1ZJ6A 1YE3A 1MDBA 4BUZA 2BI8A 4X8LA 2ZRIA 4JIGA 1E4EB 3QPAA 1XEXA 5DTIA 3OQMA 3COZA 2QTLA 3FPKA 1V43A 3NAZA 5IJ9B 2FPXA 2WF6A 2DY0A 4O6VA 2DXIA 3E53A 2HV8A 5HKKA 1J22A 4R1UA 3P26A 4I50A 4XI9A 3WVNA 5IKMA 3NBXX 1G4HA 4MUHA 1J8QA 3GGGA 1KNXA 3G2MA 2WIAA 3OIUA 3DUFA 3P9SA 1ZSYA 3IE1A 3HO1A 5DZSA 1TB4A 1X2EA 2E4UA 2VNJA 1N2EA 2OAGA 4H15A 4BMZA 5EKDA 1ZSVA 2NM0A 4I2VA 4K0KB 3OCWA 3EIUA 3K15A 3IAM1 1G2OA 3HUDA 4YS6A 1XYGA 1PD1A 2H06A 4OLBA 2IVFA 4FGJA 3OEYA 4F7WA 4QL3A 4H6XA 4WCDA 3BWBA 1VIDA 1GL6A 3BH7A 3PPWA 1J0XO 1RT9A 2JS7A 1ZPDA 4L3VA 1G3QA 4QHTA 2XNCA 2ZJ1A 5K4HA 1WXEA 4ALLA 1NY6A 1QIMA 4NABA 4A2CA 5E3IA 4TYYA 3D8RA 3STWA 4D3SA 3E5MA 3CNBA 5CFRA 1FMFA 2AI2A 1YRYE 4ZMRA 3UM9A 1L5SA 1XKQA 3R4VA 2ZVJA 2HK8A 5CCEA 1ABFA 4TV8F 2BL4A 3NIFB 1KAMA 1N2XA 2VN8A 3UTCA 2FXVA 3HR4A 2W2VA 3UXMA 4YB8A 1ZVVA 2FQQA 2ZRFA 1J97A 2HRQA 3CY6A 3D8SA 3P0RA 1PKXA 5MN4A 3QSGA 1P5JA 5FAXA 3UV7A 2EBWA 3TCKA 3X1KA 4DQLA 3NDBB 1CR1A 1A0OA 1IXSB 1QYVA 1QUEA 1GL7A 2W0SA 5H68A 2F4VB 5K03A 3BL8A 3QFRA 1D2GA 1ACLA 1TAHA 3G8YA 3K0BA 3KJNA 4HK4A 3RE1A 1YRLA 4QOFA 4FFPA 2BSXA 1GGNA 1G3MA 3PYLA 1JDPA 2PT7A 5J2UF 5KNLA 1L5YA 4XYGA 5AD1A 2FPPA 1CJKC 4O4HF 2JGMA 4Y2PA 2R47A 4RZHA 2YZKA 4PS0A 2W7TA 3EVEA 3FH0A 3SSNA 2QSYA 4UEOA 4HG2A 2I76A 4W8GA 2J48A 2FPIA 4QTZA 1O6ZA 1BMQA 1HWYA 1IB6A 1B1CA 3ITEA 3DVAA 2FE1A 4FDLA 3EUAA 3FUCA 1AE1A 4K8OA 3WL7A 3RJZA 1BD4A 1TM3E 1KJWA 1XR3A 4BRUA 3NAQA 4P0PB 5JH7B 1KZ7B 1FK8A 4OM7A 5K3BA 3STXA 1IONA 2QVZX 4U5QA 1KDZA 4JQYA 4YMSA 3UJBA 1H5UA 1Y7TA 4EH1A 5C37A 3DO5A 4RZ2A 5PNTA 3NI2A 4HWKA 5FBVB 1H94A 2PX6A 3KUKA 4OREX 1YWGO 2RB5A 5KTKA 2QX6A 4DLBA 3A0RB 1QQ5A 4DDUA 3SHWA 2R6GA 1L8OA 2GOYA 1R9MA 1Q77A 3K0EA 4PSDA 4WY8A 2A1UA 4BNUA 2HJSA 2J7PD 1U1EA 2VRCA 2XZDA 2ZWMA 3KE9A 4GQAA 3RHFA 3AY3A 3LK7A 4IIFA 3SBXA 2GD1O 4BNFA 3TGLA 5CLQA 1E7WA 5ED4A 5AVKA 1PGNA 1V3TA 1MIOA 3TFWA 4KN9S 2DEUA 3TOVA 3EZXA 3AB3A 2RDMA 3PTLA 2DFTA 4IY1A 3VOTA 2QB5A 3QYFA 4CN8A 2JIDA 4Y2SA 3NEPX 3ZBTA 3VTZA 3WYAA 4PFKA 4DWWA 1WQ1R 1YZLA 4OJYA 2A3RA 5KNBD 3W4JA 2NSHA 4PAGA 1KKMA 1DBIA 4TOIA 2GZ2A 2QLMA 3I6BA 5DYGA 3H05A 2FFRA 4HWSA 2A0UA 2F9FA 1ZIXA 1E9EA 3Q9UA 1O95C 4FDMA 3BDAA 5CVJA 2OVFA 1E1MA 3OVMA 1GKYA 2OY0A 1IUKA 1Y98A 4OOFA 5AQEA 2GD0A 3JASB 1LX6A 3FLBA 4WPGA 3H5RA 3T7JA 4PN3A 3T9CA 5CLJA 1MC5A 1NLZA 1X38A 2JI6A 5EJAA 3S29A 3A9CA 2VDWB 2GDJA 3HCRA 1JA0A 4C0AC 4GBGA 4PYOA 1SCNE 3O82A 4QEZA 1Q0PA 4IUCS 5G3ZA 2PAFA 1PD0A 3L7LA 3QWBA 4BQPA 1V8DA 4RHYA 1VSVA 2AFHA 4BZQA 1RYHA 4KGVA 4BTLA 4ROTA 3GD7A 2DUUA 1CJSA 1FUEA 2PDAA 4FINA 4RABA 1KEUA 3L49A 4XPZA 5AW5A 2P3QA 1ULZA 4G81A 1ZG3A 2JK1A 4KG7A 4JCCA 3EGIA 5KPJA 3PKZA 3AU9A 1DG3A 4UMVA 4LPSA 2Y6VA 2I7XA 2FFJA 4KR6A 3Q10A 2UXCB 3CMMA 3P0HA 3G9XA 4N65A 1K68A 2Q9BA 1R6UA 2ZDQA 4MGEA 5J5VA 2P4QA 3BBLA 4JJFA 1C4XA 3EOAI 3Q6MA 3QFCA 1Y3DE 4MYDA 4I5DA 2I5PO 3T7AA 3QI7A 5DCUA 1PUJA 1KR2A 3A4VA 3CVOA 2PZLA 2REBA 1DCKA 2Q5JA 2UVPA 3WKDA 4OSPA 4JH0A 3MT7A 2IX9A 4WOPA 2OPBA 3JATB 3UMSA 4N40A 1XCLA 2BM8A 3EBLA 4XE5A 1WEKA 2OKCA 4C14A 3G0DA 1DJLA 2C54A 2XKKA 1E2KA 1SOVA 4I4LA 2DUWA 3FNGA 2OYRA 4UFNA 5IVIA 3WB9A 4G8CA 3PXUA 2OBLA 2RHWA 3VU9B 5B30A 3QMWA 5GGYA 2C04A 5FEUA 3DM5A 4HDSB 1O94C 4J0CA 1ZC4A 1FRQA 2E5WA 2BZ1A 3WLSA 4B81A 3ISTA 1H65A 3LL4A 3QA3E 1KORA 5CX4A 4XX0B 1IOWA 3PC7A 1EESA 4B3CA 4DBLC 2JW5A 3U7RA 3JXEA 2RGGA 3AI7A 5A5DA 2R4QA 4PLFA 3P8ZA 5KNDH 2O7SA 1Z0UA 3ZK7A 2RHRA 2IZOA 1RAEA 2C2GA 2O2HA 4CUJA 2F64A 3GUCA 2G9RA 1PQWA 3NBYC 3UMMA 3E7PA 4E03A 4I1IA 1REQA 3TJZA 3UJHA 3QPCA 2AW3A 5EPEA 3PENA 421PA 3ZZMA 4X62B 2PXAA 3E9QA 3U6KA 3L8GA 3W5DA 1SXQA 1JDBC 3DXYA 5EE9A 5KNCH 4P7GA 2D2VA 2IDMA 2IU6A 3BG5A 4QXOA 1YAJA 2YFHA 3QLVC 3TOSA 2J9GA 1HKUA 2TRSB 3OX1A 1NX6A 2NSJA 2YWJA 3F67A 3V8QA 2IBSA 1MB3A 3E58A 2XKBA 5B12A 1YB5A 3KD2A 5KU1A 5LQUA 1E1LA 1Y3CE 3WA6A 2Z09A 4BYGA 3C6ZA 3B1WA 1C3OA 4Q3CA 2HBQA 1EE1A 2XB8A 1T5OA 2GJ4A 2QD1A 2WF5A 4FOPA 1N5DA 1LTKA 4HEJA 3ZJ4A 3CVVA 4IOMA 4ZCPA 1TQ4A 3WAGA 3C6KA 2Y0CA 2X19A 4N39A 2FVYA 2JHAA 4EVSA 1KXZA 3PNBA 4MI9A 1TL7C 1FFSA 3JX9A 5IKPA 3MF4A 3X1XA 3IULA 1KI1A 2VZ9A 4X1IA 3K0KA 2WKPA 1NVWQ 2HMTA 2ON6A 4CCYB 4AQDA 1DELA 2Q4TA 3LE8A 1UBTS 5M2QA 4BY9E 1JG6A 2BKUA 3N59A 3EG5A 2QBYA 1FFWA 1T4CA 2HZ7A 3EDQA 3R24A 4WZAA 3UOWA 2ORVA 2FR0A 5AUNB 4EFLA 3ZV6A 2D5LA 2X15A 2ODTX 3MOSA 1O96A 2KJQA 2B2XA 4XIIA 5AHRA 4B3JA 1A8SA 3IMFA 2HRZA 3D5TA 4UASA 2TS1A 3EG9A 5FTKA 4BVGA 2QZSA 1XMIA 2WJYA 1GN9A 2N1BA 3T15A 3FLMA 2AH5A 1K0UA 2G77B 1WUIS 3AXTA 1KQFA 1RYZA 2GTHA 1AY0A 2AFIB 2QTHA 4FZRA 3HCOA 3PVZA 1KRWA 2XEXA 2WIDA 4EY4A 4GOMD 2V55B 4FKZA 3R7FA 3LXRA 2R0QC 1T9KA 1JFLA 1ZK1A 2W2QA 4MEBA 4RXMA 4D79A 1TUGA 2FCRA 4AXBA 4ND5A 4NBNA 3FTNA 3H8VA 3QIVA 5FL7D 4G0UA 1HOXA 4QUBA 2W37A 5FTWA 3SP1A 3DD5A 4HKTA 2GPSA 2JLUA 3GZTB 1K8ZB 2ZB2A 1CP2A 1CSEE 4II7A 3TAXA 3AR8A 2YS7A 3GZJA 1EKXA 4JBLA 1RYYA 2KBFA 4JYMA 4BVEA 3ZWMA 1UC4B 3L4EA 1WDMA 1Q17A 5LP6C 3UO8B 5MN6A 2BV3A 3COYA 4LF7B 2GO7A 4P58A 2EV9A 1H5QA 2MT9A 1FW6A 1LBSA 4F2GA 4EYQA 1M2KA 4M0CA 3UY4A 2HWKA 3ENQA 2IHJA 2YVQA 4G0QA 4YBRA 2OD2A 1O6GA 4PNZA 4B09A 2XCIA 2E4AA 1DRVA 3PUKA 3CC8A 3NCHA 5LP6B 1OWNA 3VOBA 2YY6A 2G9ZA 2PM8A 3WSTA 2FWIA 3JYPA 2NPOA 3AYXB 1KI7A 3W3ZB 4V2UA 4I4CA 4EUNA 1SPBS 3GB9A 3THRA 1F0NA 2XNDD 1EWKA 2P40A 1RXUA 1Y37A 2NQ2C 5ALJA 2ZUCA 1L7XA 1ZBQA 4HDOB 3HJHA 1P3DA 1YC5A 2I4TA 1EP3B 1KI8A 2FSUA 3S4YA 1WXGA 3JS5A 3TSCA 1Y6RA 3HKCA 3GJSA 4RTMA 1J49A 3LUJA 3WLHA 4IVNA 1Q7RA 1GP2A 2PX8A 8OHMA 1RBQA 3PLRA 3O21A 4YFVA 3VVCA 4IRUB 1LPAB 4EF5A 1IBRA 2PZBA 3M1LA 4AP9A 3DF9A 4MQ4A 4DC1A 1JSRA 4W5WA 4C5AA 2QN8A 1K6IA 3I42A 1XQVA 4INAA 4CIVA 2VP9A 1V7QA 1F7VA 1IBKB 3HFRA 4IQFA 4Z0TA 3WYCA 1Z34A 2GEFA 1E8DA 4IW3B 3I61A 4LF6B 4UUBA 3BD6A 4YMVA 4JUDX 1JXQA 4TKZA 4WZAE 2OG1A 2C29D 3X1DA 4W6ZA 5DASA 4IHAA 5F1OA 3EDYA 1Y1QA 4Q4JA 3UXYA 2O2YA 3KWFA 1RYMA 4DR2B 1YJCA 1CC1S 2VHWA 3PEVA 4RIHA 1M2VA 1UL1X 2FSGA 3T5MA 3AEQA 2V1UA 4EKEA 1UAYA 3A9SA 1J90A 3A4NA 3EUFA 1CRZA 5ALSA 5JYDA 1AQJA 2IJGX 4ND7A 1R50A 5KMGB 2NSLA 5JCOC 2HGZA 4RD0A 1VRWA 2FJUA 4L6CA 1N3YA 5BW6B 2W2KA 3G0IA 3SLRA 3TLJA 3V1YA 1MA0A 5BN1A 1QOPB 1ECGA 2LP4Y 4PINA 3W3AD 4FBMA 4CFYA 3WLTA 3GCDA 2P2YA 5K0JA 4HDQB 1EFCA 5AHKA 3C74A 1Z75A 1ZVJA 3EVBA 3LP6A 1YSCA 1NJ6A 1ZMRA 2ZJZA 3NOXA 5CM9C 4EARA 7MHTA 2FWRA 1L8LA 5I8ZA 2XMPA 5BUSA 4F9GA 4TMZA 4OHYA 3IDFA 5B3LA 3PKIA 4OI4A 1OYOA 3PUXA 1U3CA 1T0BA 4DLUA 4J9VA 3HHPA 2JLRA 1LFAA 1RI2A 1RLIA 4QTTB 1ENZA 2EJWA 4MWTA 4D8WA 4EG1A 3L40A 5JAIA 2XQIA 1FDOA 2ZYAA 2VJMB 1A4UA 2H4JA 4G01B 1SUPA 1H23A 3ROFA 2VK8A 3LHSA 4W8OA 2C1EA 1QHGA 5EJ8A 3I0MA 3JYOA 1NI4A 1U63A 3EF1A 5HIAA 3QTTA 4MTCA 3VPFA 1TRHA 1Y8CA 1JQBA 1MABB 4BP8A 3E82A 1G8AA 1S2NA 2A67A 2RC6A 3OIDA 4XFKA 3ZXIA 4J1NA 1ULSA 4Y1FA 4RVDA 4F56A 2PLWA 5KTRA 2J46A 2OL4A 2X5JO 4BLTA 5FL7A 3B53X 2UZIR 1FU7A 1RKUA 2PMWB 2AZTA 2W43A 3ZHRA 2Q6TA 3W9BA 4J16A 2P9GA 4FOTA 4OHUA 2NV6A 1DHTA 4B6FA 2VDKB 1BX3A 4JLUA 4QPCA 4Z86A 2YKGA 5B2EA 3OPQA 2OVBA 1YQEA 1A5SB 4B76A 5K0ZA 4QGBA 1JWAB 1M6EX 4KWTA 5GGXA 2A5YB 2C0CA 2COUA 3EODA 4IRMA 4KE6A 2LPMA 1W48A 2Z9CA 4XZ3A 4H18A 3V7FA 3VZPA 3ELDA 1L4BA 3OICA 1KZHA 4E1BA 2G67A 5J47A 5AICA 2ZUUA 3TI7A 1HL3A 2HMWA 5BOSB 1WKCA 3B7WA 2B2CA 3FMVA 3HU3A 3IUEA 1YVRA 3PR1A 3K9LA 5FI0B 3IPAA 3P9IA 3QZUA 4INJA 1CUIA 1GGMA 1JHQA 5ICCA 1H93A 4GKAA 3I9KA 3HB5X 3NHZA 3NPAA 4X92A 3QKSB 3OD1A 3L9WA 2VG8A 1KJIA 3NH6A 3BXPA 4QX6A 3RSGA 4K6MA 4GXNA 4QTUB 4LY6A 3NETA 1GSIA 4J7CA 3VR4A 2WA2A 3OZWA 5HQTA 3D0RA 3V8EA 1BYIA 3QVLA 5AKLA 4EFNA 5CDYA 1K9SA 1AUQA 3CBQA 4QM7A 1GQQA 1SJ9A 1JAYA 2K7ZA 4U2CA 4G1VA 4YAIA 3AIOA 1R6BX 4BO0A 4UDXX 1TADA 4DLAA 1LSOA 2EAUA 4RA9A 2J87A 2PUJA 1O94D 1L8AA 3O4JA 4PLPA 5BSEA 3T7IA 5E4YA 4HHEA 4MVXA 3KK0A 1JSCA 1U8TA 5HVNA 4NV3A 1PDVA 1TF7A 1VOTA 5B4UA 2ZKLA 4PLGA 5UKDA 4KXUA 4OHKA 4AF6A 1FNNA 2HCFA 4GP9A 3OPVA 521PA 1Y3HA 3V9PA 1CK4A 4JU9A 4MSUA 4ND6A 3SYRA 1SCUA 2HF9A 4AZWA 3I3SR 3WV4A 3ESAA 4KVFA 3OZFA 4OTZA 3S68A 4PNEA 5MDHA 2FWPA 1C0KA 4Q03A 1W85B 4Q18A 4FIZA 3EZ9A 4ZC1A 2RCYA 1RPTA 3M6AA 4KLNA 1L9XA 4MW0A 5AJWA 3REFA 4KQ9A 3UJ8A 2PGJA 1A2KC 3GN1A 1PQPA 1U8CB 1W6RA 1BHJA 4JBIA 1L5HB 1UP6A 5BRNA 1OC2A 4AUEA 2CC2A 5CDSA 3ROKA 4R6XA 1CZLA 5FPSA 3MCAA 4RPLA 2VYCA 4DEXA 2P30A 2Q9UA 3A2LA 1J8YF 4OKIA 4UAVA 3U1BA 2H3EA 1W19A 4BFVA 4EMTA 5LU9A 3MRSA 1W5AA 2WAMA 1JFVA 4NAUA 4DLPA 5FOXA 1UT8A 5AW1A 3USCS 3MBIA 5K8VA 2XYHA 3LC7O 4NOMA 2C58A 1Z15A 4MKRA 3CJTA 3A6GA 3OU2A 1WPXA 4YP5A 4CL3A 5KS2A 5M5BA 4F97A 2ZROA 1N2IA 3LJKA 2F3SA 3P4UA 1M33A 4EEXA 3MOIA 3EQ8A 3CTPA 4XGQA 2A86A 4Q6BA 3EYAA 2OXFA 5REQA 1N0HA 3DEHA 1PR5A 2DBRA 4AJEA 4XIGS 2WJVA 3LV8A 1PJCA 1O95D 3UNXA 3V2UA 1M2GA 1XPOA 2NTJA 4W4TA 3W2HA 1L7NA 1O5TA 3SDBA 1CZUA 1M2HA 2I6FA 3EFOA 2C59A 1AKEA 3FMGA 1JPVA 2W00A 3AVPA 4NQRA 4TXLA 4JL6A 5B58C 4NSNA 1QAQA 1OT5A 3IA2A 2IOQA 1U28A 2NUTB 2V6JA 1M75A 5EQDA 3SC2B 4FEAA 3BHJA 2ROQA 4LBYA 3G0HA 1NXQA 1WP4A 1KJ8A 2PUWA 3IOMA 3E0XA 3ZGVA 1FTSA 1T13A 2C9BA 2NPIA 4FUTA 5C4MA 1N2BA 4PG5A 4ARCA 1EP2B 1UBLS 2WTEA 4PZAA 1MUUA 5AVUA 2A9OA 1XN4A 1FMLA 1PNTA 5HW0A 2OCLA 2QVCA 3G5AA 3RABA 1DC5A 2QUHA 1EFRA 3HYCA 5DI3A 2IPNA 5KWEA 2Q8PA 3HCNA 4TLDA 4XWTA 3A4LA 3CE6A 2FLVA 4R2LA 4B3GA 4JC4A 1ONSA 5D3MB 3BL5A 5LXTA 4CIBA 3DOFA 1NVBA 2Z08A 3EFHA 5ILOA 1CUBA 4UXJA 1SBYA 4HUTA 5C4IA 1PSDA 5HWSA 1UKZA 4EKIA 1KVQA 2VRNA 3UB4A 1KP3A 4BLSA 1A5AB 1BU8A 4XYLA 4LQLA 1JB1A 3HNRA 4MB0A 3U26A 5JSQA 2CN1A 1LRLA 3RT1A 4DG5A 5FFFA 1MXHA 2WT9A 3LP5A 4IYRA 1B26A 4B75A 2UUBB 1KFJB 4Q3OA 1JGTA 2H4ZA 5CBPB 4FMPA 1NP7A 2X0FA 2DFPA 2WV9A 4XH9B 2BGLA 4JASB 1UF9A 3WL3A 1UC8A 1ZMOA 2C4VA 3QV1A 3DMDA 3ZIUA 1M6HA 1PJZA 1BG6A 1U3FA 3IQFA 4OBEA 4OCZA 2BJVA 2G40A 1JSLA 3DBOB 5IANA 4JLOA 2XVYA 1E9BA 4N54A 2BI4A 1OZFA 1KJJA 1QIHA 1W4ZA 2DPLA 5FNVA 4D25A 5K8IA 3M6MD 4G56A 4DRXB 2V3VA 3UPDA 5TF0A 3QF4A 3IQHX 4X1KA 4ZCRA 4F8EA 7ABPA 1YZQA 2WU8A 4MV0A 3VMMA 3ZCSA 4IG4A 3NGLA 3V7UA 3AV0B 3GUHA 3UMGA 1J2EA 2JI7A 3UV3A 1AGXA 4X1OA 4X97A 3SMQA 3NJ4A 3OCYA 1QORA 1DO8A 3UCFA 3ZCUA 3Q0TA 5AVSA 4JA0A 5HPYB 1JNYA 1HTBA 2OXTA 2ZYDA 5IM5A 2FQ1A 3MMZA 3DL0A 3HCWA 4UPVA 3SEFA 3L7NA 2Q0SA 3LXXA 2CYAA 4IF4A 2EG5A 4AO6A 2XGSA 3ADKA 2B8EA 3BFPA 5EWJA 4MIOA 4NYMR 4EHLA 2QV7A 1UJ4A 5KPDA 4Y30A 2EKBA 3RVJA 4X54A 4H3VA 4WGFA 3SZOA 4BRZA 3X3HA 5CA1F 3V4VB 3ZHXA 3OZIA 1T6ZA 1FJHA 2IYOA 4ER6A 3D7SA 4TL8A 2IKSA 2ZI6A 5A5EA 1NBMA 3DLIA 2B36A 1PFYA 2V6GA 4M55A 3NTLA 2XDQA 3EDOA 5B57C 3HFSA 2QLTA 4LFCB 3UGQA 1BXZA 3OETA 3ZG6A 3VR6D 1UC9A 2BMDA 1T9GR 1K8YB 1PJSA 1ZWLA 3MPUA 3VBEA 3OKFA 5BMOA 1DRUA 5EZYF 4P81A 1H2HA 4O2BA 4V0LA 1CDOA 4O0LA 5KHAA 5CM8B 1IZZA 4CM5A 4UM5A 2H7CA 1ORRA 2AOTB 2V74B 4BFUA 4RQBA 5FB3A 1JT2A 2V59A 4B7AA 1KEKA 3L84A 1TOAA 1C4OA 4ZOEA 3RQIA 3RRZA 3MM4A 4L4XA 4JQZA 1P77A 2QL7A 3KR0A 3LH5A 2EZUA 2HK7A 2R8BA 2Z5FA 4JX8A 4AZ0A 3EE6A 3AEKB 3ZDZB 3EVGA 1QIFA 1ADBA 1MF7A 3I58A 3LBFA 3GMTA 3QOYA 2QRZA 2PA3A 2WSBA 1QR2A 5ALEA 3FWYA 1OREA 2I2AA 3PVSA 3W7AA 4QHSA 4DDMA 1NVUQ 1CFZA 3HSSA 3IXQA 3MXOA 2RD2A 2XIJA 5L6MB 2VF2A 3M82A 1HT1E 1T15A 3EGEA 3I45A 2Q1YA 3Q5DA 4OYHA 4BL5A 1BNCA 4TM8A 9LDBA 4AKSA 1Z6XA 1Z5UA 3IEMA 4D97A 1DAOA 3T9EA 3U4AA 1X3SA 4P4GA 3ZV4A 4KWHA 2JDID 2BRUC 1N5LA 1CS4C 2C5GA 1NNI1 1ZJZA 2VSOA 4I8XA 4BKPA 5JNSA 3KIPA 4YUXA 5I7HA 3V32A 2XMQA 3P0EA 1ZOIA 2HAEA 2AOXA 3GG2A 3ZVKA 1CE8A 3PFBA 4GHWA 2MMCA 2BTEA 5IT4A 1F48A 1L1RA 1JB9A 4UOQA 3ZY4A 4C2AA 3WDMA 5AVXA 4O4LB 5IUKC 2IDZA 4U7GA 1ADCA 3N8HA 4R2JA 3OOHA 3RUCA 3T7KA 1CU1A 2BFEB 1Z0IA 2WFAA 4QJ5A 4DEYA 2GRAA 4ZMBA 2GAJA 2H59A 3PJEA 4W7HA 4C4RA 1GFIA 5AK0A 1H6BA 3HI4A 3G2QA 3WBKA 1FRZA 4X84A 4ZYTA 5A5VA 3IQXA 2D5BA 1UK6A 3NR2A 2X8LA 3IIJA 3I2JA 4A8JC 1K5DA 1U5BA 4Y6SA 3C4JA 4L95C 5JPIA 3VMFA 3EXHB 3OTWA 3M1AA 2ZZMA 2WD7B 5I9TA 2DHRA 4DNXA 2GVNA 4N6NA 1IK6A 4KSBA 2EBHX 3ZBQA 4YLYA 4NAVA 4WCFB 1UQTA 4QHYA 3CNHA 4G8DA 4IJKA 5DXFA 3WWPA 4AUNA 2XCSB 4O2RA 2AJBA 1QRTA 1C7ZA 1IHOA 2IWRA 2X0KA 5I47A 4ENWA 4URVR 5DNYB 3SXUA 3QHAA 3CHYA 1G7TA 3I52A 1XRLA 4PRZA 2DB3A 3DDNA 1QF6A 1B6SA 3UHOA 3DZJA 1J33A 1NVMB 1MU0A 2NU7B 3JQFC 3JSXA 4JOSA 4OHMA 5D87A 2JI9A 3R9XA 3R5KA 3GFFA 2P2CA 5ALZA 5I7VA 3QLJA 1KXJA 3T61A 1JQKA 1U31A 2D1QA 3QVSA 3QYPA 4HOYA 4MS4B 1X15A 3QUSA 4KGDA 1XXHE 3ENVA 3NKFA 2WVHA 1ISSA 1RFLA 3AI3A 4O2BB 4Q1CA 1AQ6A 2XDAA 4LF9B 1W94A 2RJ3A 3T7EA 1XF9A 4J0EA 3TEFA 2G88A 2Q6IA 4I1PA 1VJDA 4DXHA 4EJSA 2PGOA 2XOKD 4N82A 3QXCA 1AH2A 2FWMX 4GDMA 2FPRA 4M0MA 4COKA 1PFQA 2PWAA 5D5PA 4QSHA 2BH9A 1DDIA 4MW9A 1TZBA 1KE1A 2EX0A 4DM4A 2GN2A 3L7BA 5BQ5A 2EJBA 3DZGA 2Z83A 4HFNA 3BWDD 3T1TA 1A9TA 3NANA 3KDPA 2GBLC 3GAFA 3CF0A 3L6OO 5ANRB 1U7HA 4X71A 1Z63A 2BFNA 4TMKA 4AX8A 3TVDA 4YJ3F 1Q2UA 1IY2A 3ZWCA 4ECEA 3PNLA 4AQYB 2YN2A 1QR6A 3NDRA 5BN3A 3R7SA 1F3LA 3ORFA 1PTJC 5SYAA 4K87A 3OEED 2HCBA 2NTNA 1Q1NA 2OUKA 2X5OA 4KN5A 2IEIA 2JAHA 3S2SA 4FLFA 4BBJA 4XD7A 4RCZA 1DG1G 1B8OA 3C3JA 1Y8RB 4IQ0A 1FNSA 2B5OA 1MRZA 4L5BA 5EWMB 1VIVA 3F6RA 3G8BA 2A57A 4KW7A 3J80A 6NULA 3UWMA 3BMCA 1CDDA 1QLWA 3G7UA 4EG3A 2AF3C 2HA3A 2IZ1A 1EYZA 3FMIA 4X6UA 4OUDB 4V03A 3ELBA 3JWJA 3JWHA 2E48A 3MJ4A 4FS3A 3OBBA 4PO8A 4Q21A 4MKGA 5HF9A 3SG0A 5K0EA 2JFXA 1KSHA 3K53A 5LA6B 1HY3A 1HQDA 1QIKA 3FR8A 3IUYA 2PGAA 3JVDA 3JVUA 2OGTA 4FNGA 4L9SA 1P7ZA 1W4BA 2LBPA 4LY0A 4TV8A 4ZAYA 5IJ0A 4YMGA 4EHNA 4YRLA 1L8XA 1WDWB 1XEXB 3BF7A 1W36C 2C9OA 1GTRA 1TVKA 1JKFA 2QUZA 5CNIA 2UUPA 3O03A 1TEXA 2BF7A 4KCGA 1WDKA 5L7YA 4D2IA 4EO9A 1XQ6A 4R40A 3C14C 3V1TC 1M8FA 1F4LA 2AR7A 2UYOA 5HNKA 3O0DA 4IH9A 4Q12A 4LYEA 1FJGB 1E63A 1OTHA 5KX5F 2GM3A 2PX3A 4ZA2A 4EL0A 4W5OA 1A4IA 1DJNA 2ASVA 1DAEA 2IV2X 3HBFA 3T7RA 3FCUB 4B48A 3NDIA 2P8JA 2ZJ2A 3KP1A 2EGUA 2PBFA 3ICEA 3U37A 1CQZA 2IV3A 4AJPA 1EWRA 1XU4A 4BN4A 3GFTA 4IEIA 1CRWG 3AJDA 4GZ6A 2CLKB 3IR6A 1YJQA 1X7HA 2AYZA 4HLNA 1SXPA 1AQLA 4J0QA 1NXSA 1R4MB 2EOAA 1L7VC 2IIQA 3RVRA 1Z62A 2VJCA 1TFUA 2R48A 3C3WA 4YRIA 1ISHA 4ZAFA 9ABPA 2W8BA 3G2NA 1HE8B 1P1IA 4UTOA 5JMPA 9GPBA 1DMRA 3BA6A 3FN4A 2J3KA 4F71A 4DPLA 4I5FA 5CFPA 3IPXA 4JI6B 1Q14A 4B6QA 4LJRA 2LDXA 1ESEA 3RTGA 3EAGA 1NNSA 1UZUA 2GILA 2XQJA 2OYCA 1K7YA 2QI9C 4J1SA 4DNPA 1FYVA 1XLTA 2F1JA 1WHTB 2P2ZA 4ZTBA 3V8BA 4PZCA 4TQAA 5AT1A 4EB0A 3WK7A 3AF6A 4PLYA 3T0FA 1KBOA 1X86B 3FYHA 4PPYA 3IO3A 5AMXA 3RU9A 3UA4A 1EGMB 5K3AA 1WY5A 5DPMA 4G23A 2J5KA 4KHZA 1DL5A 3WA7A 3PUIA 2D3WA 4KSYA 5AR1A 2R8YA 5BN3B 3COSA 4R81A 1N6NA 1O58A 4YK7A 5LSAA 1EMDA 2AK3A 2WU4A 1NUUA 4RC9A 4IF6A 3UAOA 4B6PA 4MK4A 2PFSA 1AQIA 1R16A 1SN7A 3NWOA 3RSCA 4KO2S 1T1SA 2V7TA 3MB8A 1NUSA 4Q3NA 3DPSA 1Q3HA 3F96A 5JYEA 3R23A 2KW5A 3AZOA 1SBQA 2CMDA 1LQ2A 3CZ5A 1KDOA 3D54D 3MXTA 1CT9A 1N57A 3QFSA 3S1AA 1UMCA 4D3XA 1SU8A 4UU1A 3HXKA 4OUDA 1NBIA 1ENOA 4ZZIA 2F8TA 4BV9A 1U0GA 2UVDA 4EY5A 1JX6A 1XTSA 4PSUA 3E1KA 4GMKA 3GLIB 2YN4A 3ONDA 1IZ8A 3H4VA 2HDHA 1FTNA 3AEZA 4J3JA 1UH5A 2LIPA 3C70A 3SHTA 2OGWA 4WLUA 4D45A 2GWHA 2DBZA 3QBEA 2QAJA 1NPDA 4JI1B 3T52A 5L3SB 4S04A 3BUSA 3IH5A 3FKSD 1OF1A 4HPXB 1Q1AA 2G08A 3PGMA 4XGKA 4Q82A 3ZPXA 1QK5A 2H1CA 1ITZA 1RPAA 1M2OB 3F3YA 3H1FA 2XMRA 3OQBA 3WDSA 6LDHA 1RXYA 1WZEA 2HA7A 4ZOLF 3CRVA 3I72A 3L1HA 4YT5A 1H9CA 3OTHA