4JWKA

Crystal structure of the complex of peptidyl-trna hydrolase from acinetobacter baumannii with cytidine at 1.87 a resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
193
structure length
193
Chain Sequence
MSNISLIVGLGNPGSEYAQTRHNAGFWFVEQLADKYGITLKNDPKFHGISGRGNIEGHDVRLLLPMTYMNRSGQSVVPFSKFYQIAPEAILIAHDELDMNPGVIRLKTGGGHGGHNGLRDIVPHIGPNFHRLRIGIGHPGSKERVSGHVLGKAPSNEQSLMDGAIDHALSKVKLLVQGQVPQAMNQINAYKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-tRNA hydrolase
publication title The Mode of Inhibitor Binding to Peptidyl-tRNA Hydrolase: Binding Studies and Structure Determination of Unbound and Bound Peptidyl-tRNA Hydrolase from Acinetobacter baumannii
pubmed doi rcsb
source organism Acinetobacter baumannii atcc 19606 = cip 70.34
molecule tags Hydrolase
total genus 61
structure length 193
sequence length 193
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2013-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 4jwkA00
5IKEA 4HOYA 3KK0A 4QBKA 3TD6A 4JX9A 5IMBA 4FYJA 3VJRA 3OFVA 4JY7A 3TCNA 5B6JA 4LWQA 2LGJA 2Z2IA 2Z2KA 3NEAA 4FOTA 4OLJA 4JWKA 2JRCA 2PTHA 5IVPA 4QT4A 4IKOA 3TCKA 4FNOA 4YLYA 1RYNA 3P2JA 4JC4A 4P7BA 1RYMA 4Z86A 4QD3A 4ZXPA 3TD2A 2MJLA 2Z2JA 4DHWA 4ERXA 4QAJA 3V2IA 5EKTA 1RYBA 4DJJA 3KJZA 2NAFA 4FOPA
chains in the Genus database with same CATH superfamily
4RLQA 1ELOA 3UJ9A 5HA5A 3R74A 1RI5A 2J9FB 1DXHA 3O95A 3QUBA 1KH2A 2KMLA 1I6LA 2V98A 3S40A 4IHJB 4DGQA 4EVIA 4XGKA 4IJWA 3KKPA 1SC1A 4KPGA 4WKBA 1E0SA 2A9FA 4Q4AA 3A6FA 5B1IA 2P9ZA 3G17A 2IQIA 4LSGA 3ETNA 4BV2A 2H2AA 1TMYA 5B55A 4MV3A 4YLYA 1THGA 3PRYA 3R0ZA 4XDGA 4JC5A 2EBUA 2GETA 3W2FA 3VPCA 1ZVMA 3PNOA 5I4CA 3ESYA 4N6OA 4QDXA 4D0NA 1V26A 2BGRA 3ZCSA 1XQVA 4RC9A 1CDOA 2PH7A 1SKQA 3WV5A 1DQPA 3ORRA 4PANA 1AMNA 1RIIA 5GGYA 4NYIR 4XX0A 1BCSB 4GT1A 1J8FA 1Q3HA 5K4AA 2AA3A 2BFCB 5FAXA 1NSYA 5AW5A 1CZLA 1AN9A 1VA5A 3I9V1 1HDZA 1IBSA 1GZ6A 3H17A 3LZCA 4M1EA 4D8UA 5JNTA 3T5PA 4JYAB 4IJKA 1F2TA 2AMJA 2H85A 5I7FA 4U39A 1F2VA 1G7SA 1XRMA 4FDLA 3ROTA 4UNRA 1NVDA 3C70A 3IKVA 3HK2A 2BFMA 4TRMA 1YT5A 1T6NA 1G18A 2ZJ2A 1G20B 4FIDA 4RESA 2CXXA 1Z8FA 1DXYA 4RH3A 4FE7A 4I3FA 4YRIA 1CDEA 3BGSA 4P4UA 1YR1A 3ABRB 5DGDA 1E6WA 2JLWA 2XQIA 4Y1EA 5AHWA 4MGYR 1QRTA 5FNVA 4C76A 4DMHA 4UTPA 5HIKA 4E5VA 3GK3A 4CKEA 1MB9A 3KU1A 1NE2A 4D3FA 1DI0A 2FZ5A 3A6DA 4OQDA 1T8PA 1EFUA 4KYTA 3K8ZA 1IBCA 1I5EA 2QQ5A 4CF5A 1ZK4A 2HK7A 5AUPB 1E96A 3PFNA 1PLLA 1MAUA 4GKJB 2WJGA 3NOVA 4D79A 3UHJA 3PYMA 4R9VA 1YD7A 2CLKB 1DWQA 5FTKA 5SZKB 4LJRA 3TWOA 5F51A 3HDTA 1EBUA 1U3GA 1F2DA 4BNIA 4H35A 2C2YA 4KLRA 3G2MA 1QLWA 2N47A 2PBRA 2R8RA 4F5EA 1E6EA 3SMVA 1MQ9A 2EXXA 1CXZA 3CB4A 3UANA 4EHFA 1E2MA 4PSVA 3FUTA 1C0LA 5HCUA 3H86A 3AIKA 1Q1QA 1ACLA 1CZNA 2UZ4A 4BZZA 1HY3A 2P2NA 4GPIB 3VPAA 3EARA 4M1SA 5KREA 1SPXA 2PRSA 5I4BA 1DEOA 4XE5A 5IG2A 1G8JA 2BLLA 5ETJA 6PFKA 3DMGA 4UD6A 2XB9A 4CW7A 3WE7A 3TTUA 2RHLA 3ZNNA 2P5TB 1TECE 4RTRA 2FZEA 2IIPA 3TNFA 5SY6A 5GZ6A 3NBFA 3T7DA 1PVVA 5AOBA 2WM9B 4GOJA 3MWLA 4E14A 1CJCA 4UOEA 5C1BA 3WBKA 4JJZA 2HWUA 4U8HA 2OG1A 5HS4A 1JFTA 3QKSA 4DJFC 2DBRA 3DYBA 4JDPA 3IOMA 1FFYA 3PKIA 3ENQA 3I62A 4C0JA 4MI9A 2WW8A 1SVKA 3VNBA 1JDZA 1VGVA 2C29D 2JI8A 4I5FA 4MUEA 2IP2A 1MW9X 1JTEA 1N3BA 2QVBA 3F9RA 4KACA 2CMHA 1RU3A 3VMFA 4LMBA 3E53A 3CC8A 4TTTS 1FRQA 1M7GA 3CNHA 3PGKA 4P6VF 4U63A 4H3HB 4EI7A 4R4JA 4X92A 4CKXA 4EJ2A 2W7TA 2Y2VA 2EDAA 3DA8A 1N1MA 3D7KA 4Q1VA 2G76A 2PCLA 2O6LA 3GPCA 3PUWA 5K4HA 3GXBA 4M9ZA 4HH3C 1XLWA 4G9BA 4CCWA 4BE9A 2QP4A 4CIYA 5I7SA 1U4NA 3D5QA 1EFVB 4OL9A 4PBRA 3K94A 4TTSA 5FFNA 3ZE2B 5DI3A 4MGIR 1RZ3A 2VYNA 3H5VA 1OYOA 2ZI6A 3F7MA 3OZBA 4WXEA 4W7SA 1MB4A 3IUSA 3OIUA 4PZPA 3C3XA 3WL8A 2YKGA 1J90A 2ODAA 2ARKA 3N3AC 1RRMA 2ANCA 2FG5A 2TMYA 1GAWA 3KOZA 4IUYA 4JT2A 4MHSA 4O4JA 1ISIA 2FSIA 3NKFA 4PZYA 2WKPA 4OP3A 4R8KA 3M2PA 2IZ1A 3VZRA 2PS1A 1HLDA 1PHRA 2KBEA 3GJTA 3NONA 4FC6A 2XUHA 4TXJA 4UHKA 5ILQA 4EPWA 2CZGA 3E9RA 4B82A 3DXYA 5JMWA 2BHSA 3A28A 4JL8A 2C82A 5AW0A 3UMYA 1FYDA 5J2UA 2OZKA 1DP4A 3VI4B 4HN2A 2HT6A 4GE0A 5AKZA 3BGWA 4KE9A 4EI9A 1RTTA 3PUJA 3G5TA 1NXSA 4KBFA 1L5QA 1S7CA 1W4ZA 1R6AA 1SHKA 3WR5A 5A6VA 4JT9A 5LZ7A 5K2OA 1ESEA 1XMXA 2CNDA 1NDHA 2FPSA 3AI3A 4BWVA 1CLUA 4JQZA 4H3VA 1PNVA 1WXIA 1ONOA 2Y67A 1U2TA 1OVMA 3M6AA 3O7WA 4Q9DA 3NTXA 3SZMA 4EOGA 1ZMOA 2G72A 4OV6B 3VPDA 2QRZA 4YMHA 1XEFA 2H6EA 1IBKB 1YO6A 2VT7A 3EZNA 1DJPA 4JH0A 4AZVA 2IHUA 2JGNA 3GFQA 3G0HA 1EK2A 2Y76A 1D4OA 1H3FA 4MYDA 4DMFA 5AW2A 2B1GA 4TS3A 4YUVA 3AYXB 4F21A 1WB6A 1OX4B 3OT4A 4RYLA 5HR5A 1RRCA 2IYEA 4ZU6X 4W1QA 1ZNZA 3M9XA 4DJDC 4BP3A 3GLIE 3GLGE 1YQ9A 3ROXA 1NQAO 3GNSA 3C6KA 3L7YA 1A88A 1SOAA 3O8BA 4C7MA 4NJMB 5BR8B 1DFGA 3EAQA 3PWKA 5A0VA 4LOIA 1KK3A 5DDIP 2AQ8A 3CH6A 3COPA 1J8QA 3H9GA 4C0AC 1G19A 5DMXA 3ZNOA 4D97A 3D8BA 1GDHA 1OWMA 1DC6A 1HE5A 2ICAA 3O03A 3DUFA 5JALA 1BA2A 2ZWOA 4RWEA 2XXBA 3PR2B 1UEXC 2I71A 3CUEF 1Y42X 1V0JA 4EW1A 4BQFA 1O94D 1P3DA 3NHKA 5IANA 4TM8A 1C3OB 5AW1A 1KJIA 1VYHA 3R7NA 1ZHOA 4NHEA 3TO5A 1RHKA 2JG3A 3U7FB 4FOLA 1ZUD1 3N0TA 1N5MA 3HYTA 1IQ0A 2ACVA 3N8GA 3FZNA 1QIGA 1BAPA 2D54A 1L7MA 3ZVLA 2IYAA 3MWJA 3NGLA 3NV7A 3MBOA 2M32A 2EAUA 2OXFA 4RQTA 1IAVA 1VKHA 4FYKA 3RVBA 1GUBA 4ND4A 1LNQA 3EA0A 1O4VA 2A3RA 5KYGA 2LDBA 2XHZA 4HSGA 4IZIA 5E3JA 2W6JD 5ERGB 3Q98A 1VL2A 4N4AA 3OF5A 2OFXA 4PLGA 4JOSA 4WWHA 2JH8A 2A9KA 5CX1A 2DHQA 3B1VA 4BLOA 3JALB 1QP8A 1CLEA 5CXXA 3B1YA 4OP2A 1NAIA 1W25A 4WEQA 2XUGA 1UFKA 4G5HA 3KTAB 1S0UA 2PM8A 1K2VN 3DOHA 3QE9Y 4IMJB 5B2ZA 1NXWA 2VT3A 3K9BA 2GJ8A 1T36B 4BGIA 4I6JA 3TRDA 2Z30A 4RXMA 2BMFA 1TJ3A 4WT7A 5CD1A 2AXQA 4RIHA 3DUWA 3HWWA 4G0XA 2JFBA 2VA8A 4HPXB 4WY2A 4WZAE 3OFVA 5AVQA 3V9PA 3R75A 2PT5A 1COZA 1V8DA 1CUHA 2FFJA 1UR5A 3DKKA 3GROA 3JZDA 2XTZA 1KKMA 2YVLA 4L0MA 1WEHA 4QLOA 4EKIA 2QV0A 1XQ9A 3LDUA 3OZEA 4Q19A 3TLMA 3V4ZA 1N9GA 3PG5A 5BVGB 1TTQB 4TS1A 2HRZA 4BLSA 1X8XA 1LQ2A 1LWOA 3JQEA 1E3IA 3VR3D 1K08A 1EB8A 1PZFA 2R2AA 2O3UA 3BTOA 4PHCA 1PWYE 1O2DA 5B3AA 1XKQA 2ZRPA 3X43A 1VKZA 1E7WA 4K9SA 4N7MA 3TTVA 3ZGVA 1A8IA 4DUPA 1JECA 1LPBB 1GPUA 4GR5A 4AKGA 3F1LA 1RYFA 3RVDA 3YASA 1ZNWA 1IN1A 1Z33A 4GX0A 3X1MA 2B30A 2J3LA 3KLMX 4LX0A 1DBWA 4NBLA 2VRNA 5C8DA 2X0RA 3AEZA 2FSUA 2O7NA 3NBMA 1A5ZA 1BVRA 1DG3A 1QRRA 2W4QA 3Q12A 3R1IA 4MVXA 2A6PA 3SJUA 4DCMA 2XZPA 4RFLA 1U7XA 4IXTA 2UUBB 2F1OA 4GDFA 4HGRA 1UQUA 4GICA 1DSSG 2WVJA 4LW8A 1YBVA 3REQB 3H3FA 4DNPA 3O91A 3O8OB 3TD2A 4AN0A 2Q1UA 1KJNA 2X2OA 3ENZA 3FCYA 4LPSA 1QG4A 4N5HX 4ADSG 1RAIA 1TT5A 2OENG 3CCBA 3JQFC 3L8HA 3U9TA 3AG5A 3WMWA 2ZKLA 2GWHA 1U0OC 5I8WA 3IXQA 1V11B 4OMDA 1E9FA 1B0PA 1GZ4A 2XJ4A 4G5YA 4PSCA 4HP8A 3GP8A 3MILA 3NDIA 2WU8A 1A3CA 4NSNA 2QGNA 1V96A 1XG5A 1OZGA 4BBZA 4Q7QA 4BRUA 1WOMA 3LP5A 1OMOA 1GUFA 2Q2VA 1LJLA 3ON5A 4L28A 4TN5A 4ZOCA 5K8LA 1O96B 1Y6JA 3QF4B 3AR8A 4KPUA 3C1AA 1PU2A 3PI6A 1CRQA 3EISA 1IDOA 2BKUA 3GYGA 3SCZA 3KETA 5DYTA 1RI1A 1D2EA 1QG6A 4Y2SA 5FI3A 1WCV1 3WGTA 4DWVA 4E70A 4ISBA 4UM9B 2JFWA 5K0LA 2P4SA 3DL2A 1HUQA 4QAQA 4BC0A 3JATA 3OETA 2ZJ5A 3OKFA 1ECLA 2C2HA 1NW8A 3DCYA 3LGAA 3QMVA 4HEA6 2W11A 4JROA 4XD7A 4D98A 1QZTA 1T4CB 4X8OA 3ZDYB 2QX9A 3ZK7A 1YE5A 5KYXA 1PK8A 1JKIA 2A92A 5I01A 4IWNA 4BNWA 3A8TA 1EH5A 1RACA 4O2RA 4MVYA 1FL9A 2ZUTA 2O8VA 3ESAA 3TF5A 4LMRA 5DTQA 3P9PA 2ZB4A 3KKZA 1A8UA 3ONDA 4P53A 3W7AA 3ZV4A 2G1KA 4M37A 2BGNA 4LIPD 5DM4A 2ISQA 5J63A 2W2MA 4H1TA 3GHHA 5EG5A 2FK8A 4PQGA 3RGWS 4ENRA 4I2VA 4TN1A 4GP7A 1PNTA 1RLJA 4OQNA 1RI3A 2SICE 2W2KB 1NJSA 1QIIA 5IT4A 3BSWA 3UICA 4L73A 3PWZA 1HTTA 2R8YA 4GX5A 4F38A 2ATIA 3HA3A 2BFDB 4AN4A 4BRWA 3I8XA 4M83A 4GLLA 3D2AA 2WTUA 2X41A 1L4BA 3W5VA 5H81A 4JHXA 4BN0A 5IM4F 2CEKA 1NYQA 2E4ZA 3HGMA 2LKDA 4I5GA 1KRXA 5JCJD 1UBFA 3DEFA 1SXJC 3AYZB 4JFRA 4V0OA 4QRIA 5CRIA 2JD1A 2Y1WA 2ZUUA 1GGKA 2QJFA 2OD2A 2AT1A 3K15A 1GZ5A 5EIBD 4F2PA 1JBEA 2FEKA 3D8HA 4QREA 3LJKA 1RYBA 2DT8A 1R8YA 4DSTA 3EH2A 3QRWA 5JWRA 4RK0A 2CFTA 4G36A 4GIBA 2WFZA 4CFZA 2IH2A 1KP2A 3Q7QA 5FA5A 2WC1A 2BFOA 2E82A 2P68A 1W88B 4ER0A 1AF4A 2ATEA 3SYTA 2EKDA 5CFNA 4JBGA 1D4FA 4KO4S 1GR0A 1Q22A 4JLKA 4BZQA 4TXMA 2NAPA 3ZWKA 2PSDA 3PRKE 4NBUA 4EGAA 1RPZA 2IU4A 2P35A 4YVFA 1EM8A 1X7ZB 2BBTA 2GCIA 3TLBA 1VRCA 4M0KA 5KNDA 2YQZA 3O8DA 1G41A 3CNNA 2JA1A 4J16C 1WUTA 1K6IA 4KI7A 4EG6A 3FCEA 3GVIA 3RIGA 3FTNA 1UFRA 3JARA 5DU2A 5CDUA 3WZ2A 3U7EB 1B6GA 1JEYB 4EFMA 1VZ2A 2VSFA 1H1TA 2HJGA 4PPQA 4EI8A 1ZCAA 4UZEA 3BREA 1ZOPA 2QPAA 4L08A 3BIFA 3ESBA 2Y3IA 4HJRA 4P2BA 1NTOA 1FFAA 1JVBA 2F43A 5ECYA 4ZAZA 5HX7A 3AI2A 4RTKA 3BD6A 3PNVA 2FVXA 3EDMA 1PZMA 3BWEA 3MD9A 1P4RA 3EWIA 3Q72A 6REQA 1FFSA 2P30A 3B3JA 1KETA 1E2GA 1I6WA 2Q5IA 3EVAA 1NJ2A 1SCKA 1Q7TA 3GNLA 3PXAA 4ESEA 2W2PA 4Y8VA 4B09A 4FDTA 1YDWA 2PUFA 1SA0B 1X0VA 2PD3A 3LBYA 1Y3CE 5K3CA 4E6EA 1NJGA 1U28A 1TJPB 1YRAA 3BK7A 5DX0A 3DMFA 3V32A 1GPYA 2DBZA 2BY4A 3CUSA 4KRGA 4KXQA 3VZCA 4CG0A 3LT5A 3LRXA 3G49A 1RKUA 5CR9A 2NVUB 1K0FA 1Z6GA 4X8LA 4ER3A 1NDQA 2WU3A 1TPYA 5KX5F 2VWGA 1YBMA 3IC5A 1CS0B 3HUTA 3LECA 3N2KB 4QUJA 5TIIA 5DTRA 4HWGA 2W43A 4RFSA 5AKJA 4KR0A 3QV1A 2B2CA 3A1SA 3KPWA 1CR0A 2VRCA 1B8UA 1EYZA 2CEAA 5EFZA 1KE2A 1GSOA 3BHIA 2E6KA 2CHQA 3BGIA 2X5JO 4LYDA 4QOFA 4WOJA 1FX1A 1XZAA 3GJ3A 3K5IA 3WKCA 3HSKA 1EX1A 1QK5A 2W2XA 2YIVX 3NI2A 4MKIA 3AHIA 3L8FA 1VM6A 2FU5C 5EZYB 4C3OB 5KNBH 3VNAA 2GN0A 3GBSA 4MVJM 3R3WA 4KAFA 1KGSA 3T34A 3TLKA 2PJZA 3HJHA 2JAHA 3S2YA 1CR4A 1KPHA 4KIUA 4MP6A 4Y9UA 1RYEA 2PKEA 3RV3A 2IODA 5DB4A 1E3LA 2ZS7A 4DUGD 1SQ0A 3ZHBA 5J4HA 2IYNA 1G5RA 3QYAA 3DMNA 2IX3A 3I2YX 3P0HA 5GP1A 2AG0A 3SKXA 4KQFA 1UBJS 2DLDA 2IUTA 2WWTA 3GZNB 3QWFA 1DZ3A 3Q9NA 1DXQA 2P11A 1KYTA 2OA0A 1T0HB 2ABWA 3LPLA 4YP1A 5H9VA 2Y0DA 5DBFA 3ZLBA 2FPWA 2A5YB 3Q41A 4DR4B 2CL7X 2V45A 4YJHB 1T9BA 4MIKA 3OJCA 2H7VA 1AMUA 3AL3A 1IJBA 1IY2A 2PWBA 2CK3D 2RGAA 4EUKA 4FM9A 3DB1A 1VYVA 4Z49A 4G1VA 3INNA 3P9SA 4Y2VA 1I4WA 2AFRA 3IQHX 3HCCA 1XYVA 2JIZA 3U4GA 1GRQA 4ZOQI 6CHYA 5IT5A 3K0SA 2ZTLA 5CM8B 5JC1A 2F3TA 1YMQA 2YIDA 3H16A 4JJIA 3HSSA 2E1PA 2GJ9A 4NL4H 1Q0SA 1T43A 2ZI4A 3AVPA 4KYUA 4JODA 3NLLA 2R7NA 2ZRKA 4TTVA 5BY2A 3HB7A 5TRTA 5MHTA 4WHMA 3ADBA 1L1EA 1IZYA 2OHHA 1TM4E 2CNNA 3MJTA 2GK4A 2Z3ZA 2ORYA 3EUAA 1AGPA 3N0VA 4G1BA 1RYDA 3I3SR 4YJGA 1HKUA 3D6AA 2X8LA 2OV8A 1QWSA 4M0DA 4GI2A 2PTGA 2PPLA 2HA2A 3AR6A 3OUTA 5T6BA 3WIEA 1U98A 1E9RA 3FM9A 4H15A 2W70A 3HACA 1PLKA 3RS0A 5AH0A 3UN1A 1H69A 2OZVA 5IDWA 1A9XA 2X8JA 3GT7A 4HS4A 5H02A 3SEAA 1ZGHA 4EAAA 1NE7A 1ZU5A 1B6SA 2WAMA 5JAPA 3MOGA 1EVQA 3H1BA 1ZHHA 3TTYA 4EB3A 1MTOA 4KFSA 2HSZA 1JR4A 1L4LA 3ROEA 3HM9A 4WLOA 3TQFA 3RAFC 4UJ3A 1Z4IA 5F78A 4OX9Y 1FPQA 3SDZA 2QW8A 4RW0A 3QA3E 4ZJUA 4X6LA 3V4RA 5GZ3A 5J4YA 4D26A 4QQKA 5H5JA 1PAUA 3ZJ5A 1SC6A 4GM1A 4M8LA 5H9WA 2GPJA 1BW9A 1GZSA 2YWGA 4JLUA 3FYHA 4NJOA 2GA8A 4QJ3A 1U2SA 2QD2A 2JAXA 4RO0A 1NC3A 2C2MA 3R3VA 2YJZA 3WMFA 5LP1A 2JPDA 5BW5A 3F4KA 1SC4A 4R54A 4EQ6B 3F96A 3K70C 2XMRA 2BGLA 4R2WA 4FK8A 4RVNA 2P1DA 3DDSA 3MN1A 2IUSA 2XMZA 3LRPA 4RTOA 1MENA 4L57A 1R8XA 1NQ5A 4GKKB 2AEMA 3LD9A 2XZLA 2VRBA 3CX7A 4BCCA 5K03A 1I3CA 4U7FA 1PZEA 2OAGA 3LX5A 3I04A 3WK8A 1MOQA 5KWVA 4WKPA 3HY3A 5CIYA 3VSAA 1SVNA 1WCIB 1I3LA 3BCUA 4UKDA 3NNNA 1EG7A 4V1CI 3NETA 4CUJA 2CLSA 3DBIA 4OAOA 4XTRA 4FXOA 3DE2X 3HN6A 1HGXA 1JXAA 2XQJA 1CS4C 2XVMA 1DCMA 4HPJB 4G0UA 4AO6A 3S1AA 3KOWA 3S2GA 4Y1RB 2PTHA 3PD1A 3QKRB 1NLYA 3TCKA 1D4ZA 4HUQA 1PS0A 4RKQA 4DV2B 2QRGA 6NULA 3II6X 3KXPA 3COZA 3WL6A 1FXWF 3HKCB 3AP2A 2Q45A 3C6BA 5FFMA 5B1YA 5FTLA 3WLIA 1FXSA 1GZHB 1VC2A 1U0FA 2QMUA 1PR6A 4P98A 1ZFNA 3ISTA 3OKPA 1B6TA 1ZZEA 2CBXA 1PT9A 3SE0A 3WP0A 3O8LA 5CUQA 2R8PA 3QU9A 2FFHA 4BLUA 4DG8A 1HYHA 2E5LB 5EL0A 1YJCA 1U9IC 2HHCA 2VBFA 1AGRA 1U8EA 3V4PB 4RM2A 1OYYA 2XVZA 4L8YA 5TLSA 2AUTA 1D1TA 3OQBA 2ZM5A 1PBTA 4PYJA 5IHXA 1L4FA 1VYUA 2E3JA 3CRVA 3MJ4A 1D7AA 2X19A 3OT5A 3PPIA 4M7RA 4MP8A 4RELA 3FCSB 4BTEA 1ZWKA 2ZITA 1CUAA 3CZQA 3F73A 4NU0A 1XNQB 2I33A 3L4EA 2GD0A 1UMBB 1YZTA 4WK2B 4FSHA 2O8NA 2PZJA 3QITA 4WBSA 2R4UA 5FTWA 4KUEA 5E9WA 4TKMA 3VSBA 3I9KA 1Q0TA 4YT2A 2Q1TA 2QA5A 1CUUA 5CU7A 3CKLA 3ORSA 2FE4A 3W6OA 1LD3A 3STVA 3H1TA 3ZZMA 4CIXA 2IUEA 2VQ3A 3OZWA 4FDMA 1WV0A 3JX9A 2BGKA 5AI8A 3OEHD 5DYYA 3OO0A 5HS6A 5IFKA 4MP3A 1NBOA 1O9GA 3OJFA 4JBLA 5JPDA 1R12A 4XWOA 2NXJA 5E1OA 3JXEA 2FRDA 2GZSA 4JJ4A 3EUWA 3QTBA 4YCMA 4KXMA 4YP7A 1ORDA 1VSUA 2QN9A 4K9MA 4OFWA 1GP2A 2XMDA 2ZIGA 1E1KA 2AR7A 1QVRA 2W6CX 4YROA 4F11A 1WOYA 2ZTHA 2P3SA 3TGPA 2P3QA 3VYUB 4PZLA 3KYDB 3AJ8A 1GU1A 2HO5A 2IIVA 1XK6A 3UHOA 1X8JA 3ZY4A 2VSQA 1T4GA 4HN4B 5CHEA 1MA0A 1MF7A 4KWIA 5HW0A 1UOOA 3NEJA 4CMKA 3K0FB 3HQ4O 4JEHA 1CY4A 1NSTA 2EJVA 3KP1A 3QU5A 2D59A 4XPIA 3TPZA 1TCCA 5E3HA 1FA9A 4JA2A 4DN6A 4UFPA 5CBPB 4K03A 1IWOA 1OAOC 3QVSA 1CY8A 3H9CA 1S2IA 1FDWA 3D1JA 2HGSA 1Z26A 1HTBA 3H99A 2FEWB 3ONVA 3H05A 4QYSA 5HHTA 2FWAA 1D7OA 3KSUA 1YWGO 5ADVA 4J9UE 1UWVA 2GOYA 3NWOA 2AOTB 2VDWB 1P19A 4BVAA 2P62A 3CT4A 3HMKA 5D3MA 2V59A 1UANA 3LYLA 4RL6A 5AW7A 2OTCA 3K71B 3IRVA 2XD9A 2YY7A 3FCXA 3P9CA 1U9ZA 3PDHA 2Y1DA 1FRVA 3KKEA 4ZT7A 4D44A 2GF0A 5EQTA 1DFHA 2QRQA 4UMVA 2FPGB 3GOHA 4B34A 5AMXA 3VVMA 2X1HA 2NPOA 3K6SB 3BS4A 1EE9A 2B8NA 2DX7A 3HPQA 4PGAA 4Y6PA 4XFDA 3TTWA 4FB4A 4QFBA 3WISA 4E12A 1FLAA 2JCVA 1UH5A 1IK4A 2Z6VA 5IC5A 3SS8A 3FHTA 2AZDA 4ZHSA 2QYTA 2FLWA 2EYQA 3PXGA 3ZI7A 2B1QA 3VBEA 4AUNA 1WKVA 3AF4A 4DXHA 2CGEA 2P77A 4EKYA 4FEGA 4LJSA 3AUYA 1E7MA 1U8ZA 2C00A 4R5HA 1YJXA 4WMLA 4ZOAA 1RWKA 3OLWA 4LPKA 2I2FA 4O1MA 2XAUA 1CQJB 4TYQA 5HF6A 4ND1A 2MIIA 3IBFA 1PX2A 5MN4A 5GADl 1N5LA 1Z12A 1KEZA 2D13A 2V7PA 3KB2A 4PYLA 1HDYA 5CLQA 1YRQA 4LYFA 3DOIA 4RLFA 4TYYA 2BZSA 4BRSA 3TR6A 1Y6FA 2OILA 1ABBA 1XP5A 1NNSA 1N8TA 3CSDA 4TM7A 2FHPA 4L4SA 4KNYA 1XJ0A 1ZA1A 1K5PA 2J33A 2G8NA 4D82A 1V1MA 1UZLA 3DOUA 2O2HA 4FZRA 2X0IA 1XZCA 3GRFA 4PC7A 2DU8A 3UAWA 1DRVA 2ZRDA 4NC9A 3MBIA 4Q3NA 5IEJA 2PUHA 5L3QA 1D07A 3OZFA 4HRVA 4LGVA 4D6XA 4Z9XA 1RZUA 2ECOA 5JCOA 4AK9A 1YJQA 1PQYA 3ODPA 1NV9A 4IKPA 3N7TA 3ZLJA 3B6JA 4J1NA 3BRSA 4MYUA 1CK4A 2QTVA 3IMKA 3N6VA 1U80A 2XI4A 3FLMA 2RHCA 4QC2A 4DDUA 1M6EX 1V8OA 1DEAA 1W46A 3LQFA 3RT9A 1USVA 1C29B 3GP3A 4XCQA 1F0NA 4AXBA 2C4MA 2G06A 2QLJA 3GR6A 4Q03A 4A10A 3I1YA 4J3JA 4RZQA 4BQNA 4N0DA 1VHQA 1JFVA 1H0SA 1KYYA 1SUSA 3DE6X 3A4IA 1Q1EA 2OORA 5JYDA 3O7MA 3NZEA 4FMDB 4WLFA 3T7TA 3G1WA 3QHPA 4V0RA 3UOAB 2F17A 3I8SA 3QWIA 4RIIA 3MWEA 2CLMB 4A8JC 1M1XB 1TU3A 3BD8A 4HDAA 5KTKA 1OKKA 1ZCZA 1BOFA 2YVAA 1T1RA 2QZPA 3U3MA 4EG4A 3NB0A 5DP2A 1IXKA 2IL1A 2R00C 4FOOA 1E61A 1W581 1WQ1R 1R9JA 4B2YA 2Z3VA 2FVYA 2BGUA 2Q5CA 3IMFA 3QEMB 2CN1A 3ABSB 5CDSA 3IFSA 3FNFA 4XARA 2FX3A 2R48A 1W73A 3W3ZB 5KVAA 4RV5A 5G3YA 3ADOA 5JDCA 5SY9A 1DT3A 4O3MA 3BORA 1KFBB 2CJPA 3B70A 1CUXA 2P9HA 5KNCD 1JA9A 3DF9A 3FGNA 4O08A 4OHPA 2PZGA 3CYFA 1T91A 4I4TA 4NE2A 1BEUB 2J0QA 4QGFA 3D6TB 5JLAA 3UY4A 4I55F 2GM3A 3O2QB 3K9NA 1MP0A 2X9LA 2ZTSA 2ENWA 2XYQA 4FZ5A 4MS1B 2D1QA 5DNWA 1HSOA 2XBMA 3N07A 5E2BA 2G5GX 3REOA 4Q66C 1FDOA 3PC8C 4DE5A 4ZI7A 2H2IA 1V95A 2I6XA 3K16A 3AR3A 1AK1A 4WBNA 4AWXA 2BR3A 2O1XA 2YN2A 1EUDB 4R7TA 5FL7A 1ZGJA 2PX5A 1Z7GA 1E3SA 1HT2E 3RSHA 3VU1A 1RRGA 2GBLA 5EQFA 4M7PA 1YA4A 2ZIXA 1Z6YA 2AI3A 3CZRA 3PCTA 1KMMA 4XQ9A 3BB4A 4L5IA 1XF9A 3R0QA 4V02A 3PXCX 4E4RA 3SIRA 3HU3A 5AESA 2ZZKA 3P9YA 3A36A 3QZUA 4RVCA 2CD7A 4HVTA 4KLAA 1NBMA 1YUNA 2EZ4A 1Y5IA 2I4LA 3NIGB 3RNOA 4L5BA 3T3EA 3OQJA 3AF3A 1YFJA 4ANFA 4EY8A 1FW6A 1E0KA 5JAMA 1ZEMA 2BRUC 4FE3A 2RHOA 2MINA 1NV8A 2CXOA 4R1MA 5HTKA 2G3YA 4GGOA 2HM7A 3DMTA 3SXPA 2IHTA 2PNFA 2VIIA 1DO2A 3NBQA 4MW5A 5C81A 3AUJB 4AUMA 4Q01A 2D3WA 4NYMR 3C16C 4OM8A 1G8SA 1XZHA 1RVV1 2WSLA 5U9CA 2XKKA 1P6XA 4KV9A 1VI2A 2JD0A 2HHLA 1CZKA 1PL8A 3KZ1E 3S4YA 2DYKA 2WAXA 1X1QA 1QQTA 2HIMA 3ND7A 1N7GA 3MK31 3QVMA 3PHJA 3M6VA 1ISRA 3QUQA 3WKAA 5KIAA 2WMNB 3ZHZA 4CHTA 2OC4A 4RDHA 5EHZA 4KQIA 2AI2A 2YFKA 3O2JA 1R8SA 4LG1A 5F3DA 1JALA 3DTYA 4JYPA 3TXYA 2WJAA 5JQGA 3QXGA 2XOXA 1BROA 4IY1A 4PG7A 4EY3A 1I0LA 1TAGA 2W2QA 3BRCA 1YZUA 2B8JA 3RYHA 1YS4A 1UPAA 3D4PA 2X2EA 4NEHB 2HWWA 2JCYA 1Y1TA 1FJGB 3GFVA 4YMGA 1C4WA 2PPVA 5H1YA 3ZDFA 4NPAA 2QE7A 1I4EB 2YUIA 3U48A 4OHYA 4RDIA 3OF3A 5BRJA 3C45A 4HX9A 4QDTA 1D0IA 3E0XA 4GSLA 4K5QA 3F5SA 4J7UA 4W9RA 4MQLA 1QV7A 3OY2A 1XE3A 1FCJA 1RPNA 4RJKA 4B5KA 4CKWB 4LQDA 1CYDA 3M5PA 4R1TA 1AN0A 2Q2NA 1NW3A 3KBOA 3ZY5A 3U7HB 4ZJPA 2IHKA 4G37A 5F12A 5AHXA 3LQ1A 2DP4E 1SVOA 3U4IA 3NGXA 4OAPA 3NVMB 3AR4A 5T3YA 3FIUA 4EYGA 2R79A 3VH1A 2G5CA 2IGTA 2QVGA 2WZBA 3DFIA 4JELA 3D8NA 2HH9A 1YI1A 4KOAA 3N86A 4CG1A 4E2WA 5CNKA 3P7MA 4RMJA 3O9VA 1UPCA 3OQIB 4XEHA 3THYB 2WTMA 5LZ9A 1N5OX 3EXFA 4UAVA 1LV8A 4Q4HA 1T0UA 1CUZA 1EWYA 1IHOA 5IH7A 4FNOA 1Z2PX 3UBTA 1ZAYA 4BQPA 4BNYA 4D92A 3IIKA 2HRQA 3VC3A 1CUIA 2AD5A 2MT9A 4MUKA 5E1DA 4RJTA 1PT7A 3HMQA 2WB2A 1M2OB 4KRFA 1XTKA 3AJDA 3B3QA 2QOEA 3UGTA 5KQSA 1JHPA 1JQJC 3K92A 4D0GA 1OZHA 2GK6A 2JEOA 3K7EA 2J08A 5BMVA 5FWYA 2XR1A 5JSZB 2F9LA 3H1FA 1E5XA 4CNQA 2AMYA 1KA9H 3EFEA 1LFDB 3F74A 1WDMA 2B4AA 2VXCA 1VBKA 1OXSC 4OF4A 4EKGA 2J9FA 4IIXA 4NECA 1P33A 2KHZA 5BNTA 3DLBA 4HQLA 3OCXA 2JI6A 3IAEA 4NABA 5CGQB 3SFZA 3V7WA 4F8YA 1C9NA 1FDRA 3X0DA 4FVTA 4PAWA 1K7FB 221PA 1U8TA 1IHDA 1QMGA 1XP8A 2FA9A 3E9MA 2RKWA 3H4VA 2VYVD 3M4NA 1OV6A 4YIHA 4LYJA 1K9VF 2NM0A 3UZUA 4C7KA 3ETDA 3Q1KA 3MTEA 5DOZA 2DE0X 4YJKA 3ZTYA 5IYZB 2FZCA 3EY9A 3FFWA 2GLUA 2VJYA 1SJ9A 3THXA 5K0FA 5KSZA 2IVFA 1MC5A 4HDRB 2ZB7A 3S44A 5M04A 5HKKD 7YASA 2WLTA 4ZVMA 4YQEA 3AW8A 4L72A 4ZQGA 2QX6A 4L2IA 4U2DA 3W3AD 4A8PA 1GQQA 5GV7A 2L2QA 3K31A 4B7XA 5KC9A 3INGA 4EVQA 3GLFA 2GFHA 1DKPA 4I1VA 1DMRA 1BXRB 4NFSA 1SHLA 3I45A 1E1MA 1MX9A 4Y0AA 3ZWQA 4YUAA 3RSGA 2SBTA 3VJMA 3N2IA 1OFHA 2R8BA 5EMMA 1QKIA 5JECA 5GJVC 3PJRA 1ZIXA 2OGUA 1THTA 4IHQA 5EE3A 3CVWA 3LWDA 1USGA 2X7JA 1MU0A 1MAVA 4DIBA 2PO5A 5IAKA 1DQRA 3I01A 4MLDA 4MR7B 3FHCB 4KX3A 1G20A 5IEBA 4N7RA 1AOXA 4MPTA 4IICA 1T9HA 2D4HA 3ZJVA 1DMSA 4FHCA 3TZLA 1YI0A 3K9CA 4ND7A 3ZHQA 5JAOA 1TYCA 1UP7A 2IXDA 3OESA 3ETEA 3PDWA 4B84A 3H6HA 3HA7A 2HJHA 1PSWA 3PX7A 2BIFA 2AUMA 2VBGA 1WUKS 4MI3A 4JSYA 5JNRA 1WPQA 3MG9A 2Z43A 3UC5A 3TQIA 4DS3A 1F6BA 1UC8A 1RCTE 3L04A 4KSBA 3N5CA 4I1OA 5CLLA 1X1DA 3BERA 3GVHA 2DZDA 4ZVLA 3RYTC 1EXVA 2C07A 3UT5B 2JGDB 5CDTA 3JD3A 1E3QA 4YXWD 1SZDA 2HQOA 2UVPB 4QU5A 2HYIC 4L8WB 3FNGA 4B3HA 1UJBA 2JGIA 3HBMA 3JQQA 1IULA 2QLMA 4ONEA 2MSEB 3HEMA 4ZO8A 3HWSA 2HCTA 2P40A 2VTBB 2RHHA 3TQQA 1SMKA 2G04A 1CV2A 1Y6QA 3C5WP 4FYYA 4LDPA 4V0QA 4FT2A 2UUCB 2ZRLA 721PA 4S3MA 2IHVA 4TOIA 3HBLA 3MRSA 2B7LA 2BH2A 4FHEA 4BMOB 1MN6A 5KTYA 3UG7A 5JYCA 1E66A 5FQNA 3IVGA 4BTLA 4DCUA 4AXXA 5EJ7A 2F8SA 1JIIA 3E4DA 3JQAB 1KERA 2HKIA 2ID7A 3A1EA 4B8YA 1P2FA 4HVAA 5A5VA 4Z9YA 1XTJA 2A84A 1YKGA 4HKTA 4C4AA 4QEDA 4EKNB 4ZHQF 5IBCA 2GEDA 5IFLA 2OO5A 3PENA 1ZHFA 2VQSA 3H2IA 1ETHA 2X6RA 3VOAA 3ACCA 3DNPA 5A3VA 2FF5A 4MV9A 4OXQA 2FX5A 2PT6A 3FYUC 2JEYA 4KPYA 1NTRA 1SCQA 4Z1MA 1ZI8A 2ASEA 2CJFA 1K0UA 1SO8A 4REOA 1OPXA 2GXAA 1RZRA 4I4IA 5IDQA 1KOFA 2P6UA 3NBAA 2Q2WA 1JH8A 4RH0A 4RGYA 2W98A 4M36A 1XCOA 1W0JA 1OA0A 2BBOA 2XUAA 3IT1A 3DBLB 2EGUA 3GZTB 3A1CA 5HOQA 4GNKA 4I8IA 2NTYC 3TFOA 3C85A 4RQBA 5JZ9A 3DBHB 4X61A 3LTNC 2VTDA 3IAUA 2AR9A 2H1FA 3HI4A 4HNAA 1UQRA 3ZD7A 1GZVA 2YWHA 5KAPA 4KZPA 3PFGA 3U4QB 3B1XA 1BA3A 2NZWA 4V03A 2QAGC 1DO0A 1VBMA 1BMQA 2WPDA 3OKCA 1O94C 3B6KA 4GPAA 1L6RA 4UULA 1OASA 3W6NA 1KZ6A 4EY6A 1JAXA 1P2SA 3OPYI 1CEXA 1IY0A 1FE8A 4AY5A 1K75A 2CLOB 5FBHA 2V7WA 3QUAA 1RC8A 2VNIA 1W6UA 2BGJA 3HHEA 2H4JA 3CNLA 4JLBA 1S02A 4W8GA 2FW8A 3VSDA 4EG0A 5JASA 3FVQA 3PHHA 2I2CA 3PVCA 5IN5A 4DOMA 4QUGA 3LVBA 1FVOA 1O5IA 1U3CA 3O3MB 4FGKA 5JOQA 4GMGA 2ZRQA 4IIYA 5DEIA 2FWBA 3GP5A 2VF8A 1H23A 1DC8A 3DZ8A 4UDXX 5JJCA 1JPUA 4RS4A 3STUA 5LQDA 1XTRA 1GSAA 2V7QA 4LYAA 5CT5A 2IYYA 3ND8A 2BAGA 4Q1AA 3CCCA 1VLVA 1HFKA 1KDTA 2PNJA 5I3CA 5IULC 1RPAA 1OV4A 1PTKA 2ZUBA 3GFSA 4ZEXA 2C94A 1Y8ZA 1KO4A 1LNSA 1EX9A 2VNAA 5IHPA 1BSVA 3TMYA 1SBZA 3TXXA 3GLGB 3GLIB 4O0LA 1QPGA 2K2WA 2FZLA 4P4SB 3J81A 1Q0ZA 4GBGA 1A50B 3E81A 1CHNA 1FS6A 2YTZA 3RFTA 3A6ZA 4GHWA 1F8UA 2A7XA 2TMGA 3DBRA 3QPAA 2W6QA 4MGEA 5ARCA 4BO4A 3U6BA 1IQPA 1EZ4A 1DHTA 1TM7E 2OAP1 1P5FA 1VSVA 5LNK1 2AZXA 5TV2A 2VLBA 2BHLA 5HE8A 3RBXA 1XWIA 4C4PA 5FH9A 4WK0B 3FI9A 3VGPA 4MVJF 2Q3LA 3A4MA 1OBVA 4GPBA 3SE7A 2PGXA 1CY1A 2XIJA 1MLDA 2PXHA 1I2DA 4GOKA 3U26A 3LIIA 1VCOA 2PS0A 4F1JA 2BFWA 4RZ2A 2GO1A 1QZXA 2V3WA 4MZDA 2H8KA 3PQ7A 4IZHA 3WJ2A 2ZJBA 1ZK0A 3DKRA 4HQ0A 2C7VA 1WKCA 3EGXB 2HA7A 4G1CA 3U49A 2J4CA 4KNWA 2NO7A 2GZHA 3DVRX 2NOAA 4M8KA 3C5CA 3JAWB 3TLEA 4Z4IA 3A25A 1ADYA 5CG1A 1OXKB 4NJMA 4OYYA 2INGX 4YO8A 3TB4A 1GEEA 1NJ1A 4UM8B 4Y9TA 2N75A 2P1ZA 3G88A 1X13A 4WDRA 1E1CB 4FYIA 4LBZA 3BT7A 2ZR9A 3T61A 3JAMA 4LHEA 3TI7A 3JCZA 2I3BA 1X86B 1LX7A 3VNSA 5ITSA 1YRLA 2O3QA 2NYAA 2WIAA 5AJVB 2VK8A 4YRLA 1LLQA 4EFLA 2ZM6B 1WUHS 1H8HA 4I3HA 2I0FA 3GDFA 2ZJYA 2ZBQA 1T2VA 2QM3A 4G67A 1VIVA 2AJTA 2PKWA 4IWXA 4JSTA 2YMQA 4FGZA 1GRRA 1C3OA 1M9NA 5TPZD 2IUUA 2WJIA 4OKNA 2ID9A 2XADA 4RIGA 4Y2JA 1RABA 2VQFB 2O8CB 3MC1A 1LBSA 1HQCA 3BGDA 2J0SA 1B1AA 3ZWAA 4D43A 3K20A 3LHSA 1OXUA 2RARA 5HG0A 1TF7A 1F60A 2I3AA 3BB1A 4J8PA 4OLJA 1QVWA 4WZAB 1ZCJA 1QG0A 4KDCA 5CT9A 3RIXA 1ZSVA 2VAVA 4I50B 1QAOA 1CEEA 3A31A 1ENPA 2O19A 4QXAA 4WKNA 1YVDA 1J20A 3PCRB 3V8PA 3CLRD 4C4XA 3AO0B 5FLYA 2YL2A 1T5BA 3LY5A 3QW4B 4TS4A 5KYVA 1V3UA 1J8MF 3MT0A 4KFRA 1Y8QA 2OCIA 4D25A 4CCYB 4LOJA 4QTTB 4QBFA 4BMZA 1LJUA 3P9NA 2I65A 1ORHA 2J87A 4YRQA 1HQDA 4NMHA 1NFRA 3KTAA 3PX2A 1TO6A 3RF7A 2ESRA 3BPSA 1XRLA 1WU7A 1FSSA 2A30A 5H4HA 1L1RA 1NRXA 3ZCUA 1C1XB 1T36A 2OCGA 1BCRB 1FYXA 3EQZA 2P7HA 4R0VA 4AX4A 3QVWA 1SIWA 2G07A 3OSZA 2FEXA 2TMKA 2WU4A 2C7QA 4A36A 5IBPA 1JZTA 1Z0JA 2G5PA 2NSLA 5KSOA 1P1FA 4UTOA 4XR4A 4C08A 1N1EA 1S8OA 5F5NA 3FDXA 5HF5A 3WQRA 4BO8A 4J3FA 4BX3A 2JLYA 5J3JA 2IEDA 4MKXA 3R8XA 5IAOA 4K0RA 4PE5B 1RYHA 1UKYA 1T10A 5CH8A 3KQKA 1K3FA 2ZVPX 1SK9A 4EHAA 1B0ZA 2PGJA 5IJZA 4D56A 1WTCA 4DTCA 1M5RA 3ENVA 1I2CA 2PL3A 2Z95A 4CM9D 3OPXA 5J1TB 1NLUA 4BAZA 1KY5A 2UUPA 5A4IS 1F4VA 4IDEA 4PGFA 1EBBA 4ZIRB 5KCMA 1N5IA 2JBAB 5EZ5A 4AM8A 1PDWA 4LFBB 2QTWB 3BXGA 2FUNB 1I5RA 2R5WA 1GV1A 1JQLB 1RLTA 4HNTA 5FBWB 1U7DA 1GTSA 2YY6A 1MJGA 1YU6A 3RFXA 5EZ6B 1KTIA 4LZNA 2G1PA 4D8YA 5B4UA 1YRBA 4FYWA 1YCGA 5JEDA 1YCFA 1W87A 3V7UA 3K5HA 3Q11A 2GZ2A 3JD0A 4KQCA 4K87A 1AQLA 5ALYA 5CM2Z 3RAJA 3O8OA 2CXSA 5KDOA 1G291 3H5IA 3P9QA 4BO5A 2EG9A 1BE6A 1FNSA 4NBSA 5EIBC 1ECCA 1NUAA 3H9BA 4JP8A 2AW5A 2A33A 1BDIA 2NO4A 4YRZA 2YJ6A 1OJ7A 1BE1A 1OT3A 4RD1A 2GPNA 5JQWA 4HNVA 4RMHA 1FDSA 4JJ7A 5TEWA 1CRPA 3IQWA 3W1EA 2D1FA 1HF3A 4EO9A 2NO9A 4JI4B 1Z0UA 2UAGA 4H16A 1IL0A 4S0XA 2QUHA 4G0VA 4ZP1A 1N57A 5H83A 5EJFA 4W99A 3UOWA 2WB4A 2REBA 5AM0A 3R0JA 2FW7A 3A9SA 4L9SA 5E7QA 5BWMA 2AN3A 3Q10A 4XIFA 1JHXA 4JQSA 5KVVA 2F4NA 4MB0A 2V03A 3QF4A 4EDFA 2Q2OA 1UPFA 2QVLA 5F7JA 4WTOA 2XXAA 5KWJA 5KPDA 3KRTA 4KYVA 1I4DD 2MHCA 2O05A 1LPNA 3OTWA 1A4UA 2D0DA 4L9WA 2HQSA 3D6FA 3DO8A 3FDZB 5E2IA 3RBVA 5A0TA 4LCBA 3Q6IA 5FB3A 2EKZA 2Z9CA 4M2LA 4Q00A 4ZAFA 4ODIA 3AKYA 1T4CA 4ENTA 2Z6UA 3GLUA 1VPWA 4Y0VA 4M0PA 1T6ZA 3T7SA 1Y9EA 1P73A 3K0HA 3I76A 4C5BA 1P39A 5IRCD 3CUUA 4OQPA 4ZZ2A 1J5EB 1ZP6A 2P9YA 1H1DA 1XUOA 3OTQA 4MQEB 1GM5A 3ICVA 4GGPA 5DKFA 3W4KA 3I52A 2GCPA 4MMXB 2VP4A 3G2JA 4QGSA 3RRYA 2R85A 2AVNA 3LQQA 4ACAA 5BWBA 3KJFA 4XVHA 5C35A 4OP1A 5KTMA 3FJ1A 4TT8A 1QYWA 3IV6A 5EE0A 3B7GA 2L82A 2JJ8A 4FZJA 2EKPA 1O89A 3LZDA 4NE7A 4NPCA 3RRZA 5IU6A 3RU2A 4DLTA 2O2CA 4U00A 5LDDC 1M1UA 2NZVG 2AS0A 5BVHB 4LN1A 4UDYX 3E82A 4TVBA 2A9JA 2O5CA 4JU9A 1GQ2A 1VFPA 5C80A 1II8A 2BFDA 3WYCA 1E8MA 4DDMA 3OUZA 2WIFA 5ERYA 1CX9B 4LV5B 1GARA 1PWEA 2HF2A 2I5PO 2NO6A 1NY5A 3KUUA 3QYPA 1H2ZA 4RLSA 3VO9A 3W7VA 3P2JA 4FS3A 3CPEA 1I1HA 1MMFB 3RUPA 5ICSA 5M34A 1QP4A 2HRDA 3KR0A 2BMWA 5J9FA 1Y8AA 1VSQA 4FQ5A 3K09A 1O57A 4EBFA 1DC7A 4X9XA 4IFEA 5KTSA 3U44B 2D7JA 1DXOA 1ZU4A 2XCTB 3M1AA 4I1SA 2H2GA 4OHKA 3CH5A 5AHRA 5I7RA 4UARA 4BAUA 4XI9A 3LGSA 3FKSA 4RSGA 3S0JA 4A6EA 4TLAA 3WK9A 4PVDA 1YAHA 3ZHXA 1HEIA 3QBTA 3KEMA 3SBOA 2EFDB 2HSEA 4IHJF 4R8LA 3KSBC 4MOWA 3VXKA 4N7JA 4NS1A 1W88A 3U4HA 5JAQA 2B98A 3V4OA 5AVVA 4WXRA 2PQ6A 4G0NA 2HMAA 4ZQHA 3AVUA 2BZ0A 3FMIA 3DE0X 4EABA 5GM1A 2SKEA 3O1JC 5AP9A 4CL0A 4KXFB 3S7TA 1JXQA 3O2SB 1IFXA 1KQPA 2AG8A 3CFYA 4Q47A 5TVKA 2JBHA 1CZHA 3B7PA 5C52B 4LBWA 4HYYA 1E5TA 2JCBA 4PAQA 4Q05A 5LA6F 3WSTA 3A6JA 2JLZA 5ALUA 4D57A 2XGJA 2GN8A 7AT1A 1QHHA 4POAA 5ELXA 2CYCA 2P2LA 4JEMA 3ZKWB 4PNEA 3PXUA 1JEYA 2OBLA 3MNFA 2MCFA 2F9MA 3L8CA 1RHMA 2Y6VA 3SLRA 3S5UA 3U37A 2GBPA 1KMHA 5B2EA 4MQ4A 2FMIA 5CJJA 3C8MA 3KE9A 1NYRA 4WN9B 3TKYA 4L8GA 2OECA 4J29A 2OAQ1 3U62A 1GZ3A 3HUEA 3WQSB 3FTQA 1MNQA 3PTLA 5M29A 5HP4A 1S5PA 4WN3A 2FUG1 1OFUX 1N1GA 2G6TA 3NV9A 1C3EA 2ZI3A 4LOHA 1RAAA 1DADA 3EYAA 5D84A 2H1SA 4HVLA 3QP9A 2C7OA 5IS2A 4FD3A 2NMVA 1MRNA 1SA0A 3KAPA 4GF5A 4ITRC 2DOKA 2Q28A 4QU8A 1U4OA 1N5KA 4FLMA 5L7YA 5HOEA 1Q11A 1YDMA 3IT0A 4QICA 4DLNA 3COJA 3SR3A 3JVVA 1SVLA 1AE1A 2BISA 3EG5A 2NVUA 1NVWQ 2ZAMA 2ZJ1A 4ZU1X 2YY5A 3JWPA 5FTJA 5DXFA 1KI7A 3P94A 5M7EA 2JIMA 3N2KA 2XT9A 4YV7A 3FGOA 5LWQA 1N33B 3G8DA 4QFCA 3BKXA 2P6RA 3AVYA 5KYUA 5BNIA 1T6XA 3SYNA 3DDCA 4BFYA 2VHQA 2PX3A 5GWXA 1J2RA 3KELA 1A9TA 2NG1A 4RABA 5C1DA 5CB4B 3MCZA 2Y2UA 4IL5A 4KREA 3H8VA 3HEBA 5LKRA 5EPUA 1EIWA 3QLVC 1I7PA 2IOFA 4HDCA 3DLIA 1SC3A 2EP5A 4BNVA 4N3NA 5EZYA 3T9BA 1UXIA 3HL0A 4OIFA 2RGYA 1BWSA 5TJHA 1NBEA 3CX6A 4RHEA 5DBGA 3Q8LA 2ZPTX 4JFAA 1AIPA 1ONBA 5G1OA 3KTOA 3SD7A 2EFGA 3TZ6A 2B5OA 2Z5LA 3DC7A 3EHEA 1Q19A 2OUKA 3IUBA 3UJDA 3GJ7A 3K5WA 4P3YA 3U7JA 1RLUA 5KQMA 4UUNA 2Z56A 3PD7A 3HZOA 5EHGA 4MWEA 6LDHA 2DHEA 3QU2A 1FLVA 2AZTA 4MULA 3P5SA 3AKZA 2BFEA 3ZGYA 3N2LA 4PLCA 4Q4JB 1Y34E 4R41A 1BX1A 4W7HA 5LOVF 1G5IA 2PZFA 4XCVA 4H08A 3VYWA 1GNLA 2XE6A 4OLHA 1KH3A 3WYNA 4FMPA 1GXSA 2I6QA 1Z06A 3R6LA 1XEXA 1KI3A 3IO5A 4B47A 3DULA 5EPEA 3U56A 4WESB 3JVDA 2AL7A 3NR2A 4YJHA 1GL9B 5C3UA 2CSUA 521PA 3CNEA 4NBRA 2DFTA 1TYDE 3KV3O 5JY1A 1QJ4A 2GKOA 2WWIA 2QN8A 1FTYA 1J6UA 1KO5A 2GRAA 2YHBA 4X45A 1NW7A 2PKYX 2HB6A 3BJRA 4O2BF 5G0TA 1AV7A 3DMYA 2MSDB 1Q1ZA 3FFAA 4KJZA 4M1QA 5L8VA 1KXJA 2ZUDA 3L46A 2EJBA 4MI6A 1L7VC 5FPSA 1ZUWA 5CITA 1MG5A 3B6IA 2D2VA 5B64A 2A14A 4NATA 4OMFG 5JZBA 1KDPA 2B8WA 2P79A 4EPVA 2VDLB 1E0AA 5A9RA 4LRUA 2QUJA 1RNLA 2A67A 1GGJA 4KIWA 4D4KA 5C7YA 1NJ5A 4FFBB 4P7FA 5DF1A 5I8PA 2M6LA 1ESMA 3AJRA 4I3GA 3FUVA 3RRBA 2Q21A 2BFBA 4ZQEA 3EDQA 2IU0A 4MGZR 3GFOA 2E1RA 3QOFA 1NVMB 3I9MA 5A3JA 1HKHA 4O2AF 3SIXA 4PLPA 1K8YB 2XB8A 3FDJA 5IWCA 2QGZA 4R1PA 5EKSA 4TT3D 5CP8A 2JK1A 4EYEA 5DNVA 1GKKA 3L4JA 4OFXA 3WKEA 3RSFA 3QE0A 4Q9LA 3O4FA 2XUIA 1Q0UA 2LWIA 4LDAA 4Q0MA 3PC2A 4RCVA 5EP4A 5BOVA 2Q7OE 4UTRA 5CD9A 4BB9A 4PZZA 1I3NA 4QOEA 4NAUA 2I03A 4CEIB 4Z0PA 4K86A 1PLJA 5T67A 2H57A 5BYJA 2C5GA 2WPNA 1QIDA 2YNMD 2ZLBA 4L4XA 1EUYA 5IT9A 1E20A 1I14A 1XLVA 2IYQA 2Z8YM 3CKMA 5JC8A 1P5HA 3TAHA 4TMTA 3IRUA 1AO0A 1DOZA 4NZZA 2R1ZA 2AKEA 1RHUA 4MO9A 1XC7A 3SS9X 2GR9A 4UTNA 2WZQA 3COSA 1ZLXA 3EHDA 4GM4A 4R2KA 3AKEA 1G5FA 4ZVSA 2WYOA 3ZGZA 2VZ9A 2P27A 3IBSA 3OTIA 4TV8B 2CDBA 3HP1A 2MSWA 5M5BA 2FLKA 2RG1A 1IQRA 1XZLA 4ARBA 4YJ2B 4Q9AA 4ZVNA 1GLVA 2ZYVX 3PE6A 5JHGB 1WDTA 3FOWA 2O1EA 4NMLA 3W5DA 1J4AA 3CRZA 1TCBA 5HE9A 1E5LA 2HZBA 1U5AA 3O74A 3AR7A 3T9CA 2XUJA 1EFPB 2D0OB 2O48X 3P2OA 5C7IO 5HUQA 3AONB 2RGXA 4WZZA 3U0BA 3EIOA 4YGYA 3TGWA 3V6MA 1ZJZA 3C3EA 1COWA 3QKRA 4S1WA 1E0JA 4KAXA 3U80A 2Z2JA 1YB1A 5EFOA 3LTEA 3QG1A 4XDHA 3IEUA 5E4TA 1ISMA 4TWAA 3F7TA 3I9NA 4LRTB 1KDVA 2MSNA 2PZMA 3RAGA 1YDFA 1SBQA 2E4XA 2GPTA 1DC3A 4X94A 4F9FA 4KTTE 1UT8A 2EX4A 2PKXA 3OC6A 5THKA 1WX1A 2VPXA 1T1EA 2CUNA 1X15A 3E23A 5EIWA 3ZXUB 5JJBA 4HQ6A 3C6QA 1AU9A 1R15A 2V65A 4P7JA 2Y9PB 3A14A 3RU7A 2EEPA 3B52X 4CMIB 3HR4A 1FC0A 2LD4A 3HDVA 4Z3KA 4OPMA 3QELB 1DJMA 3L0SA 4HCJA 2QKYA 4UU1A 1JL3A 2R0QC 1V25A 1WQ3A 1QE0A 2DWQA 1A4IA 5BNZA 3K4PA 4W9NC 4D4IA 4IMRA 3V4LA 4NICA 2RH8A 2EJCA 2H51A 2PSEA 1UMBA 1S1CA 2AG1A 3NW9A 4KGVA 4O02B 4LGYA 5CAEB 5IK2D 1U1GA 1I0IA 2LV8A 1AY0A 1LTHR 2V0NA 3EOAI 3O4IA 4GBJA 1S1MA 1RRFA 4F85A 1D2RA 3UTCA 3AFHA 2UYQA 3BBPA 1FFDA 2VNJA 4MQ5A 4OJTA 2AVDA 2PJRA 4PRLA 3PNYA 5EGSA 5GJWC 3B82A 1HYGA 1DEXA 1Z29A 1N25A 1VXRA 5D85A 3TM5A 4V0MA 3B89A 4QPPA 2CFRA 1H2WA 1HC7A 3ORYA 4PG5A 3T5BA 3OOSA 5IW8A 3V2HA 5B3LA 1PCXA 3R4CA 2BEKA 3AEKA 2AK3A 3OIDA 2EZTA 5AJWA 5I9IA 2UXDB 2B1JA 2HWYA 3EODA 4INJA 3TLZA 4BFVA 4CQNA 3KYDA 1EVJA 1ZGBA 2H59A 4XQ0A 4EGFA 1Q57A 3AINA 1H05A 1KC1A 3IDSA 3IQIX 4NS4A 4EY5A 2ZZNA 1IHPA 5EKUA 3WGNA 3M6LA 5EP1A 1OLXB 1PWZA 2B9VA 3KXDA 4CE6A 1ZD4A 4MV5A 4EHIA 3H2JA 2BBWA 3U81A 2R7KA 2AI1A 2I62A 4REMA 4RY9A 1ODFA 1RLOA 1YR7A 4QNRA 3W5JA 3HJTA 1FF9A 4Z99A 1KK2A 1J0DA 4Z7QB 5CBPA 5KEIA 1QP0A 4Q7LA 4Q1DA 4HX2A 5FUYA 1IVNA 4OKIA 3OJEA 5K8UA 1QIHA 2AFHA 2VZ0A 1P2VA 1OBCA 4XFJA 2ZBVA 1MEJA 4LHZA 5FOUA 5EAIA 4K6OA 5I45A 5LPNA 3FOFC 1USWA 2WWYA 1ITZA 4NXNB 2AOTA 4OI4A 3PXDA 2XKAA 1SCUA 1U9JA 3EVBA 2RCYA 3ZDZB 4R01A 4C0WA 4NH0A 2ETVA 4Q24A 3HEAA 1FUEA 5DNCA 1H8ED 1S96A 3PGVA 1WXGA 2V9ZA 2ZAOA 3GFGA 4FSXA 4GPTA 5DCWA 1I7QB 2PUGA 3JWEA 4TLMB 4MGHA 4UAGA 3I9V6 1GAJA 3ANLA 1W19A 3OIWA 2WJJA 1E3DA 1TPZA 2FPGA 3NO4A 2J8ZA 4IV0A 5FD8A 3WK5A 3K6SA 2IDMA 4LEIA 1Q77A 2DQ4A 3MJFA 1R3UA 4M21A 4B7UA 2NT3A 2VP5A 1TD9A 4S35A 4E15A 3HL4A 3LUAA 3K1YA 4CV1A 1WUYA 4OI2A 4J7CA 4R1NA 4B6GA 5CXQA 2VUIB 3F0TA 1OGJA 3O5AA 4LV8B 3BJMA 2DERA 4LYEA 1FTNA 1M7BA 2C5AA 4L1KA 1OJLA 4IO1A 1P9LA 5CXUA 1GLGA 3LRTA 1MCZA 8ABPA 1CQJA 1U5CA 1ZH6A 1QXSA 5IKOA 3RK0A 5CDGA 5IBQA 4CVNA 1YTUA 1BE8A 1ML3A 1UBRS 4PCVA 4C4SA 2WFAA 3L3BA 3N2EA 1HSZA 4XSVA 4NESA 3RREA 4DMGA 3SX4A 4IUDS 1RI4A 1NL3A 1NQUA 2N0SA 3NWBA 3HR8A 1CB0A 3OE4A 2WTAA 2WUFA 2HU7A 4ASUA 3R6TA 2WWFA 5IAGA 4CCAA 4Z2AA 4QDUA 2O52A 2BEUB 2I8LA 3D02A 3NRCA 3CKYA 3RAPR 1JDBB 2VHJA 4BNJA 4JLSA 4W5NA 3TK1A 1E1QD 3O9ZA 3ER6A 1RE0A 2FTKE 3H5LA 3I53A 1GQSA 4ETNA 4HYEA 3KKQA 4KSCA 3ER9A 3N74A 4MQUA 1J2JA 1S2GA 3HNRA 4RZIA 4CV2A 3QFTA 1K7XB 1GL6A 4YRCA 1BDJA 3O8QB 3PPXA 4JOCA 2H54A 4HXFB 4MW2A 1MQSA 1JMVA 2VTVA 4R16A 2EVWX 2PLAA 2W6IA 5JPIA 2HCJB 2WUEA 1UADA 2CVQA 5K8TA 1T24A 2W8ZA 2YJ5A 3C8ZA 1DBIA 1P81A 2CYBA 1IG3A 1ZR2A 4OQYA 1Z0SA 5LC1A 1BWQA 4N8EA 3HUUA 1WCYA 1FYFA 1LVHA 3KVVA 4U0JA 3O84A 3U9SA 3U6KA 1Q50A 4PNZA 1V8FA 2C5BA 1HNXB 2XRFA 4OLFA 1PQ4A 2ATXA 4D8VA 4DA8A 1PJRA 3CLUD 3IS3A 2AYXA 2QRHA 1U2DC 5IDXA 3UJBA 3C39A 3DVSX 4EW3A 3EDRA 3L1UA 2W83A 1P9OA 1PJQA 1QFXA 4LWOA 1C0KA 1E79D 3UIEA 5JATA 1FMTA 1L5LA 1PV4A 4F3CA 5FF9A 3AGPA 3VNUA 3OMXA 2NO5A 2LBPA 2H4HA 3QEMA 5FOSA 3G9UA 5K2MA 1VKJA 3TUIC 2HJWA 3FLEA 2F90A 4DXAA 3FAKA 2QIPA 3G2HA 4AKHA 1JQKA 3EJWA 1F8GA 3TCNA 3RFCA 4XVCA 4I1UA 4MWOA 3F97A 1AXRA 1AQIA 1UAYA 4GPD1 4RD3A 1Z4NA 1N2EA 1Q17A 4TSFD 1IXYA 1GG2A 3D7SA 5LYYA 2HK6A 2QQEA 2BEWB 2YQ4A 3NHRA 4MCAA 4RZSA 3BXFA 3R5FA 2XMPA 3GEDA 5D6OA 1QU2A 3TX6A 2FQQA 1GPMA 3ZD6A 3TRHA 2HFKA 4M46A 2BR5A 2R6GA 1KIAA 1PKEA 2H4WA 1XD9A 2JHGA 1T1SA 2VKQA 5AKKA 5ALKA 3SC6A 3WB0A 1JJBA 5I5EA 2X40A 3LWBA 2NU6A 4MS1A 1MOZA 1U0HC 3VR2A 4YMTA 2NU7B 4L50A 2D7CA 4WVFA 3SK0A 3PRJA 1JQ5A 1XJQA 2FK7A 1P72A 1JLSA 3WGOA 3IHKA 4QOHA 3DPIA 1E8NA 3LDAA 3VR1A 3RD5A 4QBTA 4NMWA 4QKQA 4WECA 3B1ZA 5CPFA 3EA4A 3FPFA 1FX0B 1ENYA 1KF0A 3UMFA 4H1WA 5MN5A 2XWQA 4GE3A 4TV9F 1N7HA 3T9AA 3MPOA 2CHEA 4OHMA 3HN7A 4ZV9A 4NZMA 4B6FA 3C14C 4E03A 2I29A 4KG7A 3E8MA 3RS8A 3VAYA 1XDBA 4HC4A 1I6KA 1KAGA 1FVFA 1EQ2A 5AI9A 2FEPA 3ZY3A 3QXSA 1DINA 3I2IA 1S7GA 3LY9A 4Y7CA 2PUJA 4EKDA 2OXRA 4MRNA 3VKFA 3HFGA 1YB2A 2QTLA 3DZIA 1A7JA 2YZKA 3K6JA 3M89A 3G0BA 4G4IA 3V46A 2Q9CA 3NT5A 4IFTA 3OZAA 4XVQA 1E2PA 2DLNA 1U3TA 3KJGA 4KRXA 5A7HA 1MD9A 3DLHA 1HMPA 3HVUA 2ZRJA 2A5GA 5FKJA 3ZWDA 2GH1A 3T5CA 4YRJA 2A9VA 1QIKA 2TRSB 4OGLA 4AJ4A 2GPAA 2DTEA 3OWXA 3HJNA 1KAEA 2RHJA 1QORA 2FUEA 4PBSA 4XA8A 3I42A 3MERA 3OE5A 2ZYSA 1QLJA 1YZHA 3AUXA 4ZT6A 1XF1A 2J09A 5FWDA 3VBCA 3FOEC 4BXOB 1BFUA 3TRJA 4YJDA 1XPJA 3EF0A 3P2YA 5J47A 4MV8A 5JJIA 2WY2D 1FK8A 1Z0KA 1LDNA 3UW1A 1JAHA 1IZ9A 2X4DA 3SF8A 3EMKA 4HSEA 3KK0A 3HABA 1DWOA 2IOYA 5BR1A 1O1YA 4M9RA 1X19A 2ATCA 2N3ZA 3D7MA 2ZBDA 3FPBA 1JG7A 4QYIA 3OT1B 1MEEA 2WSMA 5GJCA 5K1ZA 4JNKA 3TXAA 3D54D 4L8LA 3UUEA 4AY4A 2J46A 4F4HA 4LRSB 3VTZA 1KJ8A 3CR7A 3UAVA 4F3TA 1VGRA 4MARA 4M49A 1WW2A 1I1OA 3L0ZA 4URUR 1RKQA 5J2TB 2HBQA 3NALA 2H00A 3S68A 3OY7A 2E49A 1ULSA 2OBNA 4N3CA 4B9EA 4E88A 1HR0B 3OX1A 1MUUA 2J6CA 1BXGB 1FOEB 2WNIA 2PLWA 3ZEIA 5HRCA 1Y7LA 1VI6A 1W9MA 2XB6A 2JGAA 3L77A 3DZHA 5HF9A 5FV4A 1S2NA 2IA5A 2QY6A 4YREA 3ABOB 3R0IA 3PEFA 1L4NA 3SY8A 1KBZA 5KPJA 2DHCA 4ZYTA 3ZVNA 2OHGA 3PLNA 2MYNA 4BPBA 4IIJF 5ALQA 3HRIA 3F98A 4IXMA 1ULZA 4MCJA 4H7KA 1FRFS 1Z6TA 2BC9A 5LL6P 3THYA 5EUCA 3RODA 2I99A 5A06A 5BPHA 4TKUB 1N2SA 1H85A 4N5NA 4RU1A 4DLXA 5BRAA 3UHPA 4FINA 2QVYX 2QE6A 4IDAA 3ECCA 4X95A 1DC5A 4GKBA 2CVOA 4ENUA 3GA0A 2C4TA 1JIKA 3C3MA 5ALGA 1TVEA 4HTAA 1L7AA 3BH7A 3DV9A 4JCCA 4MB2A 2Z9DA 4MUHA 4JJFA 4LZWA 2N9UA 3R7FA 2NP6A 1IM2A 3IJRA 2GS9A 4LTMA 3NVAA 5ISMA 2XX3A 3OIYA 4IUCS 5JSZA 3TZCA 1DTSA 1G3QA 5I5GA 3UM9A 2LP4Y 3ZYCA 4BGVA 2QM8A 1SKBA 1Z0DA 4E6PA 4B76A 4A16A 3HJRA 4D4LA 2NTEA 3LT2A 3V34A 5CHYA 10MHA 4X20B 2F7SA 1UC4B 1MB2A 3BSYA 1OX6A 2JLRA 1OB5A 3TSZA 3V5NA 1OB2A 2SKCA 1XDDA 3ILSA 4B6EA 4EMUA 3KAKA 1EVLA 3A06A 4CQLB 4ZYYA 2WD9A 4KO3S 3VMMA 2R1TB 3OD5A 1UIRA 3L6OO 3MXOA 1N0WA 3J81k 4FZVA 5B57C 3LPMA 2OP0A 2OGTA 1FFCA 2VK1A 4Y7DA 1BXRA 4OO3A 4L6AA 5U4QA 3HBNA 2C3OA 1WSAA 4BATA 4II7A 2DJ5A 2JH3A 1X9HA 5DX8A 4EFKA 3ZY2A 1JWBB 3LBFA 1CIVA 3P9RA 3HKDB 4MVJA 4V0KA 1U2GC 3RIMA 4MR7A 1M1YA 2PSFA 3PFFA 1GG9A 5JAIA 3ZE6A 5BQOA 4BLVA 1HWYA 1YF3A 2VHEA 1D2HA 3QXCA 4JDUA 1B8VA 3JZIA 3KEGA 4XRGA 2KWIA 3R20A 2JFQA 4NNJA 1ADJA 2QEQA 1KQOA 2Y0BA 4ZQBA 4E5UA 4KFCA 3OLCX 4XYGA 1ADCA 4MYRA 5BQ5A 2WU1A 2E4YA 2XNKA 3IUJA 1H65A 1LBEA 5TPWB 3UK6A 4IDQA 4MROA 1G9TA 2GN1A 3HJAA 2V8OA 3IUMA 4OHUA 2J3QA 4QT0A 3UT5A 5IXYA 2JGDA 2GEUA 1QIMA 1W1IA 4R8RA 5EESA 3VGJA 4F4CA 4BKOA 1SOVA 4RY0A 1J9GA 3H65A 2RI6A 3JU3A 2QT1A 4Y1GA 5KSWB 4HH1A 2KLBA 3K0CC 3KT8A 5A7GA 3HUDA 2CB0A 4QDKA 4XD2A 2VTBA 2YWBA 1R6DA 2ZJZA 1KJQA 1QIEA 1CETA 4ARUA 1HORA 2ODBA 3U3KA 2YVUA 1X1RA 1XQ6A 2GCOA 3NM4A 5FPQA 3AUUA 4KBGA 1WXWA 1KO8A 4PO3X 4G09A 3DD5A 4YCNA 1X80B 3P0IA 4J0IA 1DQYA 1XZ8A 3D6JA 4F6RB 4EB8A 2QW1A 3FN4A 2HBYA 1OFGA 1KYWA 3DHVA 5F7ZA 4E5SA 4PPFA 1Z47A 3H0KA 2R6R1 3PDJA 4J0JA 5JVDF 2P6MA 2WJWA 4BN4A 1C3JA 2G4LA 4FCCA 1U8FO 1XIVA 2J7PA 4JP3A 1Z82A 3SICE 2YWXA 2YQ5A 1D03A 1U7PA 3IP8A 3UJNA 1G21B 3ZWXA 1INLA 2J6BA 2QP9X 4IXDA 4X7BA 2XITA 1YL7A 3AH8A 1SCNE 2X4LA 2G80A 3NUQA 3QTLA 5K0ZA 5GV8A 4H4CA 3VYVA 3UW3A 3HCBA 1P8JA 2EDCA 2GF9A 3C1TA 3ILVA 4JITA 5D7NA 1V5GA 4FKZA 3KDSE 4L02A 1O6FA 1ZCBA 2WF6A 2QLNA 3LX6A 4TXHA 1LSSA 1WHSA 4EO7A 4WZ6A 1B26A 1FTQA 2OLJA 2P9CA 3DBLA 3KKLA 2AE2A 4XJXA 3AVWA 1YIDA 3I9FA 2V7XA 4WGGA 5DP1A 3KQLA 3S2ZA 2JCSA 2CE2X 4C7BA 2F4VB 2C99A 1TRKA 1DTWA 4CUZA 2UYGA 1YQWA 4GFDA 2YX1A 5DHSA 3KO8A 3UJ7A 3QXXA 2ZYAA 1UXOA 5KVQA 1MTZA 3TZKA 4ALNA 5JBQA 1AZWA 3L1KA 2EIXA 3MELA 4EKEA 4ZYZA 2QBYB 1GG5A 1RYYA 4ND8A 3I4FA 5EWLA 4Q7MB 1AZSC 4KE8A 3DAFA 4HZGA 3KPVA 1E7RA 1Q7BA 4Y2YA 3LC2O 3EIQA 5CVJA 3KUCA 1HEYA 5I9BA 1GGNA 1ML4A 4CQMB 2IS4A 3VO1A 2VPZA 4BLQA 4QSHA 1KBQA 5CJ2A 3FSGA 2C8LA 3H0EA 3O83A 1E1NA 1B0AA 2C2GA 2I87A 1JPJA 2OO3A 4JZYA 4Q9IA 4ZEVA 2XH8A 1BYIA 2WK1A 3C8UA 1FP2A 2Q6OA 4MWCA 5E7IA 1HE2A 3T94A 1LKZA 2OB2A 1OHHA 4OXKA 1C50A 1HYEA 1LLCA 3CG0A 4ZVRA 2R87A 3C3PA 5JO9A 4TKVB 4G1EB 3CLRC 3H8SA 4Y6RA 3PEYA 3L7KA 4MNTA 1MIOB 2NAFA 2JJ1A 2VK2A 1W94A 3OFND 3PQCA 1R6TA 1LC3A 1P5ZB 4I2NA 4OBEA 2BR4A 4AC9A 3U60B 4RKWA 1RQGA 1SBTA 1SC9A 3PUXA 4N6NA 2H5LA 3WAGA 5F2OA 2LTAA 3G9ZA 4NPHA 5DN6A 3GLIA 4DM7A 2GJAA 3A3OA 3TSWA 3D31A 1N32B 4PXSA 4K6KA 1JR6A 3FI0A 3LE8A 4XLLA 2QYSA 1IXZA 3PX3A 4DBVO 4DSZA 4AI6A 4O4LF 1I51A 4RANA 3TPCA 1WV1A 1K8XB 4HNQA 4A2WA 5C8YB 4YPFA 3RKRA 1S3GA 2E5FA 1M73E 5A04A 2A1UB 1FFWA 4H0CA 4J76A 4Q1BA 3EPJA 1US8B 2DR3A 2REXB 3DVLA 3UGJA 3SVZA 4PHTA 4MITA 4TMVA 4WFQA 5JO0A 1GVHA 1L5KA 3B51X 3KQWA 5KDLA 3DXZA 3AFOA 4XKJA 4KGDA 4J0EA 2NZ2A 5IPFA 5EERA 1XAIA 1SRRA 3LFTA 5LMZA 3EGXA 3FOZA 1OLOA 3TVTA 2GARA 4MLPA 2ZYDA 1G4UR 3P32A 1QF7A 1CTQA 1UT5A 3EVTA 1X7YB 4GRAA 5IM5A 4J3NA 3RCBA 4TUYB 2I2WA 5B53A 2D5BA 1U0NA 1YBHA 1Q2XA 2FLVA 2M2IA 4J03A 2QZJA 3BJEA 2QG6A 4TYPA 5U4XA 2XGSA 1U1DA 1FNMA 1HG0A 4DM4A 3WYDA 2ZRBA 3UUWA 3C15C 5DK4A 3JQ7B 3ZS8A 3CNBA 2IYXA 2ZI5A 3UXEA 1XMVA 2BKVA 3OZCA 5DLDA 2FDCA 1A2OA 1NW4A 4INAA 4DL9A 3F6EX 5BOSB 3D7LA 1HXHA 1ZUIA 4MGKR 1YHNA 2ZDHA 5ULLA 4DM3A 2ECKA 4YECA 1ZQ1A 3G8CA 4Q4AB 4WKCA 4GYKA 4IZOA 1VJ5A 1MJFA 2QLTA 3LC7O 5ED0A 4X41A 1EK6A 2PQ0A 2WUGA 3D1VA 3QXJA 1AZLA 1A82A 1VDZA 4L74A 4TWBA 3F4BA 3VV2A 2JJ2D 4FMDF 3U9LA 2XF8A 1RJDA 1T26A 2CHFA 3N7UA 4HVCA 3GIWA 3KL2A 2MSCB 4X7RA 4Q3BA 3QPWA 5FR1A 3U2QA 5JYBA 3T7KA 4HXGA 4NCKA 5CT6A 3WJ7A 3IO3A 1XDGA 1KZYC 2HYDA 4I50A 2XOKD 3IEVA 4CI0B 4GC9A 1GRVA 3EIFA 3MWDA 2BMEA 4YT5A 3T3PB 5H3HA 4B4DA 2ODQA 4MR8B 1KO1A 2Y1KA 3GUYA 4HWRA 1B8NA 3TIIA 3CURA 3NTOA 3VX3A 5GINE 4CCYA 1JGTA 2V7VA 2CD9A 3WWOA 3UJAA 1RHJA 4QXRA 2D3TA 3AKCA 3LW7A 1V8ZA 4ZCPA 3UH1A 5EJAA 2Y0EA 3VNRA 1HA3A 4MQBA 1LGYA 2HEGA 3E7WA 1U8CB 4LDJA 4RWZA 3ETLA 3LXUX 1N6PA 2WMYA 4G1UC 4NX2A 3RSQA 5LUAA 3CEJA 1VXOA 2IYVA 3EZXA 4G8DA 1OC4A 4L5CA 5IH3A 2GEBA 3PZBA 4Z5XA 4RTSA 4P3PA 5CIWA 1PYGA 2YJTD 1DJQA 2HMWA 2YZGA 1WLYA 5HGJA 4AJPA 4S24A 1XZPA 4MYHA 3BMNB 1CG6A 3SJCA 3P71T 1FTWA 3VC7A 2PCJA 5EJ5A 3HLYA 4U7DA 2PUAA 3GLFE 4A8HA 1TKBA 3ZK9A 5IZCA 4JQYA 1AKRA 1TKRA 4BNDA 4RULA 4JMPA 4CKEB 2FR8A 4EEKA 2XTAA 1Q21A 2G67A 2GESA 3SOPA 3A1WA 5L3SA 1Y4UA 3V1LA 2D6FA 1K3UB 4JBNA 3PSHA 5LA6A 3PNPA 5CCEA 1L4KA 3ZN2A 3EIEA 4JY7A 3RKSA 3VHQA 5AW8A 4U3JA 1E0DA 4ZIRA 1RW4A 1G20E 2PD6A 2O5EA 4ID9A 1NXXA 3Q88A 4CT0A 1XZBA 2FW1A 1F4PA 5TF4A 1RBMA 2VFAA 4RVGA 2AJ8A 2FI1A 3K3PA 1MX1A 4MV0A 3VNVA 3ITEA 4Q9NA 4E5NA 2WTXA 1G63A 4TWZA 2Q1SA 3VR4H 5C5EA 3IV7A 1OBOA 5LKAA 1J0CA 2GB4A 2B6HA 2HO4A 4P7KA 3C3KA 2OXTA 1LQUA 1Y8RA 3PIRA 4PM4A 3TINA 1H4SA 1F4LA 3W2GA 1CY7A 3KUDA 2LR0A 3P52A 4JLOA 3WNBA 1OI4A 3D8TA 3CB2A 1R88A 4GW3A 1SNYA 4JVOA 4DLSA 4O29A 1IB6A 3ZKAA 1M8PA 2Q0HA 1CFJA 4JBYA 4EHLA 4RZUA 1R4ZA 1QZZA 3MM4A 1U5BB 1N2JA 1SVMA 5EY5B 3KKOA 4K3UA 5LMNB 3NG1A 5HM6A 4HXEB 3HVRA 5EN4A 1BN7A 2JZOA 1KI4A 1KZ7B 4UHFA 3WLOA 1O95A 4B9AA 2PV7A 3L6EA 2OM6A 1MGPA 2GAIA 2V0CA 1HZZC 3QKSB 4JLPA 3U0VA 4BLWA 1V45E 2SHKA 4INPA 2B2NA 1IN6A 1ONPA 3JRXA 3VM6A 4CU2A 2R2GA 1Q1NA 3FDFA 5TARA 3OZSA 3AOEC 4MCHA 3KOMA 1J33A 3CZ5A 4LQ4A 2BF7A 3PFCA 5JJKA 3Q3JB 3SHTA 2FZWA 4DJAA 4JR1A 2X8WA 3ZCRA 2C1ZA 1B23P 1A69A 4LJ4A 4B8ZA 3JR3A 1XN4A 1GCGA 3FBGA 3WLNA 3P4XA 3KUXA 3KVOA 1QDEA 3LBHA 5LSAA 3EC2A 2OKCA 1P4AA 1ZWLA 1D6JA 2I7DA 4OK3A 4CTNA 3G3EA 4DRXB 1FS4A 1BEZA 5H4GA 5IN4A 3ZHUA 5CCXA 3MCWA 3DTVB 4OHZA 1CP2A 4MQEA 4ARIA 4DDTA 3ND9A 3P0JA 1IWBB 4KL8S 4OUKX 2WUDA 4XJSA 3RTGA 5A5DA 1MHTA 5DI3B 4AY2A 1U6IA 2XNJA 5ARDA 4K9KA 1KR2A 3E9YA 3HC7A 4GS5A 1DIBA 4N49A 5CLGA 1M2JA 4KVGA 2WABA 3AZOA 3NNDA 4MA0A 4FHDA 1Z45A 1OZAA 1YOBA 4IDNA 4UFNA 1W36B 2NLOA 1O9HA 1XDZA 1UC5B 3QVUA 2GM9A 5CT8A 2RGNC 5BVHA 2WTBA 3H11B 2CCGA 5HZKA 1P1KA 3DNMA 4QPZA 1U0TA 2C77A 1OIXA 4YFVA 3CBGA 3OFJA 1FBNA 4BVBA 3SM3A 1WXDA 5J2UB 1AK9A 2BUCA 2C58A 2BJWA 2FJ0A 2JK0A 3T3GA 4CM8A 1II0A 4TL9A 3FYUA 3ZWYA 1OI2A 1VCHA 3DDHA 1K4MA 3U44A 3ZDQA 2OCAA 3W9BA 4X6XA 3NDJA 2JLQA 1E5QA 3E9ZA 4KH0A 5EE5B 3AHEA 1RJ9A 3LQRA 5KNBA 3B9QA 4B8WA 2XZDA 3B3AA 2IHYA 2R7AA 3KOUA 4BO3A 1L7DA 1Y1KE 2JI4A 5F1YA 2PEZA 3IHLA 3N9IA 4O1IA 4PLZA 4I1PA 4N48A 1IWPB 2V7EA 4KXVA 4HFNA 3JD2A 3HCDA 5EP3A 4IRMA 4E5DA 4INZA 3TIGA 3TZQA 1YZGA 1KI8A 5TQ2A 2JLVA 3ZW8A 3HO6A 4IV8A 5DWDA 4C0KA 1J70A 3D7RA 3AL0C 3P20A 3FZGA 4KK3A 2FWNA 5I8ZA 1G2IA 2EP7A 4ER5A 2QAGA 4WK4B 1K98A 2CMFA 5K0SA 4DV5B 4N03A 5IYZF 2C5SA 3G0OA 2IS2A 3HNOA 4O2AA 4RK7A 2A4MA 2W2LA 4Q3LA 1DL5A 4F7DA 4WXMA 1X14A 3BIJA 3WMRA 3H1GA 2VSOA 3N87A 3KXKA 4TTAA 1E7QA 2R84A 1UFQA 1QX3A 2UYOA 1NOJA 2Y1CA 2VYND 3PHBE 4OJKA 4DDWA 4JSRA 2HV8A 5HZGA 2IXFA 3T4XA 3BB3A 1JTFA 4BX8A 3PVSA 3ZKWA 3DOFA 1O03A 2CFIA 3GEGA 3C6YA 3OJWA 4A27A 2FPUA 3T7AA 3A2NA 5BSTA 3WQBA 4Y9SA 3F49S 4G5OA 4KMOA 1R1DA 4NULA 4DBLE 4UUQA 3FR8A 4LZJA 1NXPA 1XJCA 3D0KA 3UNXA 5LBUA 3U3OA 2V6GA 5BT9A 5DEOA 4DCTA 4MVCA 1APBA 1Z6QA 4O4IF 4JC0A 2QTBA 3GYBA 5JNVA 3DAGA 2NXCA 3VR6H 3IUQA 4BEWA 1VLJA 3V8NA 1JIVA 3VHLB 3CVXA 1UC9A 2A1TR 2D06A 4P3KA 4FYHA 2LXNA 2P0YA 3MWGA 3QNWA 4L75A 3MJHA 3WC4A 3TTSA 4EPTA 1GFSA 1O8CA 3G85A 1I6MA 3RVRA 1LPOA 4P4NA 4G2TA 4XWYA 5L4LA 4FONA 4M98A 2VP0A 4PZUA 3W2HA 4OY3A 1J07A 3G6KA 3WRXC 3RYIA 4ECEA 3VX4A 4B2LA 5JXGA 1ENOA 4MYCA 3WLQA 2AEEA 4HO1X 1VSBA 3SOZA 4EB0A 5JI2E 4DARA 2IBTA 4OU5A 1W49A 3MRXA 3HZZA 1DPFA 4IOJA 5CX1B 4BLPA 2J0VA 1PJ3A 2QD3A 4NE9A 4XLTA 1JDVA 1YUMA 3X1WA 2LVBA 5L3ZA 5BW8A 3I4LA 5KTNA 1II9A 5GMOA 2E4WA 4O4HA 3OIFA 1KZGB 1ZJYA 2X7HA 5CB4A 4GR4A 3KB1A 2Z8ZA 1UT6A 2RH9B 1SQSA 2O2EA 1X7GA 2WE8A 3CPHA 4IVNA 1KHTA 4L5YA 4OHRA 3QWAA 1CCWA 3ACBA 3F78A 1S2DA 3PDCA 1A71A 1MAAA 4FWTA 2G1AA 1W93A 3GF4A 4MW0A 2PXAA 1F12A 5C8ZA 1N9GB 4IEIA 4PTZA 4PZAA 3DOCA 3ZJUA 4RM3A 3P96A 2YOGA 4HLDA 3OE1A 1QV9A 2YNMC 4U7HA 1Q74A 3DW3X 5TMDA 3C87A 2P4QA 2E4VA 3K8OE 2R8OA 3ENKA 1G0NA 1E1YA 1J00A 2F48A 3ZLUA 3LIPA 1Y7PA 3RR2A 1KSGA 1QB8A 2HW8A 4XGRA 2G70A 2DSTA