4JWKA

Crystal structure of the complex of peptidyl-trna hydrolase from acinetobacter baumannii with cytidine at 1.87 a resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
193
structure length
193
Chain Sequence
MSNISLIVGLGNPGSEYAQTRHNAGFWFVEQLADKYGITLKNDPKFHGISGRGNIEGHDVRLLLPMTYMNRSGQSVVPFSKFYQIAPEAILIAHDELDMNPGVIRLKTGGGHGGHNGLRDIVPHIGPNFHRLRIGIGHPGSKERVSGHVLGKAPSNEQSLMDGAIDHALSKVKLLVQGQVPQAMNQINAYKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Mode of Inhibitor Binding to Peptidyl-tRNA Hydrolase: Binding Studies and Structure Determination of Unbound and Bound Peptidyl-tRNA Hydrolase from Acinetobacter baumannii
pubmed doi rcsb
source organism Acinetobacter baumannii atcc 19606 = cip 70.34
molecule tags Hydrolase
molecule keywords Peptidyl-tRNA hydrolase
total genus 61
structure length 193
sequence length 193
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2013-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 4jwkA00
4FOTA 2JRCA 5IVPA 3KK0A 4QBKA 4HOYA 2Z2JA 4FNOA 4LWQA 4OLJA 5IKEA 4FYJA 3TD2A 1RYBA 4JWKA 3OFVA 4JY7A 4DJJA 4ERXA 2Z2IA 2PTHA 4Z86A 4QT4A 3TCKA 4JX9A 4QD3A 2Z2KA 3TCNA 2LGJA 2MJLA 2NAFA 4QAJA 3P2JA 4DHWA 1RYMA 3V2IA 3NEAA 5IMBA 4YLYA 5B6JA 1RYNA 3TD6A 3KJZA 4FOPA 4JC4A 4P7BA 4IKOA 4ZXPA 5EKTA 3VJRA
chains in the Genus database with same CATH superfamily
3AMVA 1YI0A 3KZOA 3P52A 2BTQB 3QFCA 5E9AA 2OBMA 4KAXA 4F6LA 1Q1BA 3TQHA 2D59A 1WETA 4OLFA 4P4UA 3T4XA 3IULA 4EATA 2CB0A 3NM6B 2GCGA 3PS9A 1RRGA 1G38A 4FC6A 4KMOA 2HKIA 1PFWA 2Y93A 4LZJA 1DDOA 3VOTA 1PZXA 2FN4A 2X4GA 2YS7A 3E9RA 4JB3A 1JJFA 2VZEA 3NTLA 4PPFA 1EP9A 5A9SA 1I7NA 4ITRC 4FMDF 3RS5A 2YJTD 3K6SA 5DXJA 2WZBA 3DMHA 4K7JA 2O8NA 4MVJM 3S99A 4BQEA 2F62A 3SJBA 4HGNA 4RUKA 4RWEA 3P0FA 2VEOA 5DNVA 3ILYA 3F49S 3RIEA 4EUFA 4M98A 2PGAA 1CUYA 1FQJA 2EIXA 3W2HA 5D7NA 3SOPA 2H4FA 1YC2A 5ILQA 3U40A 5AK3A 2PM8A 6REQB 2MU1A 5JBIA 3PGKA 3W3AD 2P6UA 1M10A 2Z56A 3E7DA 4EX6A 1XBTA 2V7XA 3JQQA 4PY2A 4CM4B 2G9NA 5CLJA 9LDBA 1J0DA 5FWDA 3QVGB 3RUDA 3U3KA 4PONA 1C0KA 4C3OB 4CF5A 1KO7A 4F9EA 4UMDA 4YJ2F 5H3HA 1JDJA 2CDRA 4LSWA 1JAYA 1XLWA 2B6HA 3IPLA 5EUQB 5JZMA 3OPYB 1EWVA 1PJ2A 4RTSA 1RVV1 3D4BA 3UATA 3GT3A 3DVAB 4F92B 1IHPA 5JQGF 2WUEA 2Q0QA 5F3DA 1HLDA 1QVAA 2GCIA 3DCJA 5HE8A 2OQIA 3CZPA 3LQ1A 4L8LA 3KVOA 5CHEA 5EJIA 4LZAA 4EHIA 4N7BA 1E9BA 2A78A 1Z0SA 3GMIA 2P41A 3QITA 2YJNA 3V42A 5DB4A 3PLNA 5E8JA 3H5AA 3GEDA 4PG7A 4YI5A 4ZAZA 4YNBA 3SHTA 1OI7A 4FZJA 2JLSA 2F3TA 1S9HA 2EYUA 3L0OA 4BTEA 3BMOB 2Z3VA 2V7VA 2PGOA 3H75A 3IH5A 5LXTF 2RSLA 2REXB 3OPNA 1WUHS 4YR7A 4YWJA 3IPAA 1OT5A 5JSUA 4NAVA 2JZNA 3DPUA 4LW8A 1OREA 3LOQA 4F5EA 2OHJA 3QBJA 1TM7E 3DBOB 2I91A 4RL4A 1J5PA 1W93A 1OX5A 3AZPA 4DV0B 3ZU4A 5EKDA 3OF2A 5CU7A 3B1ZA 5EXPA 4ZYVA 1ULBA 2QQ5A 1K7SN 3BWCA 2QRNA 4Z99A 3DM5A 3ZD6A 1U0BB 5B1DA 3WS7A 5BORA 4K9PA 4OVKA 4NMLA 1U0NA 3H9JA 3N6XA 2JHPA 3CJRA 4FYJA 4HK4A 3ZLBA 4UBKA 2ZR9A 3BXPA 3ZZMA 3L7MA 3TTXA 2VTKA 1CQWA 3UOWA 3RI3A 1YL6A 2WIFA 3FLEA 5KPJA 4EEZA 5EIEA 3ND5A 2IHKA 2H1IA 2AR7A 3CCBA 3H9BA 4HS4A 3WOVA 2G8LA 4OAOA 2K87A 5JY6A 3QE2A 2I7TA 1T0BA 2CY0A 3NCHA 3B38A 4O0MA 5FOWA 4GLOA 2I62A 9ABPA 3PJEA 3MQ2A 2QE7D 5B3JC 1JA0A 1SGWA 4UZFA 3MWKA 5KQLA 3UKJA 1XDWA 3L7CA 2PX4A 2D5AA 4XIJA 1DT3A 3BKWA 3L1UA 4I08A 2Y6UA 3QLVC 4ZAGA 3RSLA 1A71A 4LHSA 4JUAA 1MRZA 1EFUA 2QM3A 2QQFA 1T0UA 2BEVA 3JRWA 5KKNB 5YASA 1NPTO 5FFMA 1WR8A 4B46A 3NPAA 2C78A 1I3LA 1NN1A 3QLUC 4MVWA 4EBFA 5AVSA 1EK1A 1J0CA 2XCSB 2WU3A 1W85B 3MERA 4C2BA 1P18A 2P7IA 3AIKA 4WA7A 5HZMA 1J9EA 1K4KA 2HMYB 5AXDA 3W5JA 1G3IA 2LCQA 3MWEA 2BI4A 4P1ZA 3EISA 1W2HA 1R0CA 1T2EA 2W6JA 1F5SA 4RE6A 2FQXA 4O4HF 4TQGA 2X5OA 4YMWA 5E1MA 4ZYZA 3DVSX 4H3SA 2QMHA 4Y2PA 1L4FA 5FUQA 5HCIA 2QMYA 1E7SA 1HL7A 2ZJ3A 2JFWA 1DWOA 2O23A 2VAXA 4HH3C 1QGUB 4XVRA 4QUBA 4A0GA 3W7AA 1O95A 3OOEA 2AOUA 4B3MB 3GXOA 2ZRLA 3K15A 4KDCA 5CFZA 4WBNA 5LNK1 2DGDA 4OTZA 3WNQA 3BGVA 3PLRA 4ZPJA 1PV4A 2FK7A 4YT5A 1CEEA 1G2QA 1UQUA 2C2WA 1M75A 3BHMA 3BTSA 4UC0A 3UHAA 4YUWA 2FQ1A 5EL0A 5F4BA 1I9GA 3KQHA 1EH5A 3E1GA 1XI2A 3HYTA 4MKGA 3UM9A 2IBSA 3VVBA 4M1SA 4ETMA 3WMGA 1SQ5A 4HRYA 4NBVA 4U1RA 2HWXA 3D7KA 4KXLA 4AKSA 3X2EA 5C8YB 5HRUA 4IDBA 2GCOA 1VPEA 2HHCA 2E4ZA 4BGIA 2Z6AA 4ARUA 4BRZA 3K9LA 1KRXA 1USGA 3E58A 3U19A 3D3KA 2HA2A 3R4CA 3DPIA 2Q45A 1K8ZB 2NYVA 2KHZA 3BWMA 5DGDA 3TB6A 4WBNF 5A3QA 4BKRA 2I80A 4YJGB 1E2JA 2EC5A 2Q99A 3EXEA 4HEQA 1BDMA 1RHMA 1CRZA 1QPBA 2E5WA 4JP3A 3KEFA 3V00A 2CUTA 3D0KA 4CN9A 4LF5B 4D92A 4L0MA 3REQB 4E13A 4EPWA 1NULA 4IQ0A 4ZU6X 4P22A 1A4IA 2WWFA 1ZITA 5BQFA 2QS9A 3FHOA 4DC1A 2YS6A 3K0CA 1GRRA 1RWVA 4J16A 1TT5B 2Y0BA 3IAUA 4NWIA 3O83A 1FDVA 1ODJA 2WWVD 1WV1A 3OOYA 3EFHA 3QNUA 2J0QA 5L7WA 2UYOA 3N59A 3WTBA 5T3YA 4EY5A 1LLFA 1TVCA 3V8MA 5AVQA 3HDQA 1NMSA 5DLYA 3V4PB 2KLHA 3IHTA 3RGGA 2W2KA 1BHQ1 1SC4A 5KREA 1KZ6A 1Z75A 4IHQA 3RT7A 4Q7EA 1ZHHA 1DUSA 2HWWA 3PL1A 4NS1A 3TLXA 1PLLA 4II2A 4JL8A 3TQFA 2P4QA 4IV8A 3I30X 4UM7A 5BXYA 2D2XA 4JQSA 1SM4A 4BX8A 3U0BA 2NWQA 3VKHA 1E7RA 4DTIA 1KIFA 2NYAA 3A3OA 4G1CA 1TEZA 4IGAA 3PNQA 5BO5A 4ZOBA 4TWJA 1FP7A 1KVUA 2O1WA 3VC2A 3EWAA 3TIGA 3UC5A 3WGVA 5ED4A 2VYVA 1NJ5A 4B4UA 2WAYA 2UYQA 3LRXA 4F71A 4HDSB 2PUJA 1ZMOA 1P4SA 2FW0A 4JJKA 4AJOA 3MN1A 4PAGA 4MI1A 4CT0A 3NXKA 3L2OB 1KVQA 4NESA 3PFNA 4Q9HA 4O33A 1U8XX 5JNSA 1L4KA 3ESQA 1T0PA 1YHZA 4X41A 4K0RA 2WQ6A 1I5EA 3G2QA 2FF7A 3NORA 2G1AA 4KI7A 1NU8A 2B7BA 2FSPA 2QGFA 1PE0A 4KOAA 2BGLA 3OIVA 1XFAA 4YFVA 5KNDD 2AEFA 3KOUA 3EEOA 3ZCPA 3ZJTA 3IUYA 1BHO1 2NSHA 3RARA 4LF6B 4M1QA 1P44A 4YRBA 3FOZA 4RAOA 1SQ0A 1RZRD 1XTRA 5AQEA 1XSEA 4I14A 2GBIA 2V4MA 2WU0A 2JK1A 2Z4TA 2J30A 3SF0A 3TNJA 1NF9A 1X1DA 1C7JA 4V0QA 4Y2QA 4KPFC 1PTJA 4F8JA 1BQEA 3NM5A 3TLMA 1R6BX 4P34A 4UXIA 4M37A 2WJ4A 4Y2RA 5ER9A 5T6MA 4WCFB 4CFYA 6REQA 3OEHA 1A8PA 4RIEA 3D3NA 1I6LA 3H7AA 1LK5A 4QDKA 1Z4LA 2BUCA 3CNBA 4AZ3B 1JNYA 2NV0A 1E4YA 2YR0A 4GHWA 3KJNA 4PR0A 3UVEA 1IN5A 4RGYA 1B76A 2NW6A 3EMBA 4P92A 5AQ1A 3GHYA 1OPXA 2PZFA 3KEGA 1V8OA 4MWSA 1S9DA 4UFPA 1V5GA 3ZDZB 2OAGA 1O03A 4JFAA 4V0NA 1Z4PX 3IERA 2YJ3A 4JLUA 4O2BA 2NZWA 4JZKA 2IF0A 1OZAA 2TSYB 4R69A 2Y3IA 3DLPX 4H31A 2O8EA 2IOFA 4PHFA 1SNYA 3H8VA 5C1PA 5BVHA 3QY0A 1W36D 2CFIA 3GPDG 1XRNA 2Y92A 3X3HA 1IMOA 1RI4A 2V3CC 1FS4A 2QRVB 3DYIA 3HVUA 1O87A 4HAWA 2WQZA 4BNZA 4NR0A 4MRPA 1Q14A 2NZ8A 1PUXA 2C77A 2JANA 3ZW8A 5IANA 5LD2B 1FP4A 4QTZA 4C21A 4ZI7F 3UO8B 4YJDA 4C9BA 2WJAA 2HGSA 2R7MA 1QYVA 3O4GA 2JAQA 3EGIA 2PMEA 3UAXA 3ZE1B 2P1DA 5F7ZA 2JGFA 3M7IA 2PJDA 3WRYA 2ACEA 2DE0X 2EJCA 3TLJA 5LFAA 1W5BA 1JXOA 2J9GA 5LA6A 2RAUA 3I01A 2QD1A 5I9SA 1CJTC 2P9EA 1P8JA 3AF4A 2QY6A 2QNIA 2R86A 3QWIA 4GWLA 1GNSA 4RY9A 4E2FA 4KNWA 4HAIA 3W06A 2AQIA 1EK2A 3U4IA 3IBYA 4OSOA 2AFRA 4D3ZA 4INOA 3ACBA 1XXHB 1E5TA 3M49A 4CT5A 2YWXA 3VZQA 2WP8J 3G0GA 3NT5A 3ENWA 4OQMA 2P3OA 4U2BA 3M3PA 3DHNA 1JLHA 5FF9A 3A58B 2QQEA 5BSMA 3CR8A 3RK1A 3N86A 3QW4B 3TQCA 2N46A 4B0OA 2YXNA 1I6KA 2VP6A 3HUEA 1RJGA 4J0FA 4KX5A 1LBEA 1G20E 3R7NA 1J07A 3R8XA 4JJAA 3B6KA 1W29A 2V3VA 2AMLA 4HN9A 1VL1A 2VRCD 5KYGA 1ICEA 3GLSA 2XUIA 4G84A 4R4JA 3L04A 3LCMA 3STWA 4PYJA 3KSBC 1WBBA 5ALMA 5EE9A 1YB4A 4PZUA 4AUKA 2BM9A 2E21A 2YYSA 3OD5A 1NG9A 3TTYA 3DL4A 2WG1A 1NM5A 2VF5X 4RKWA 1HDCA 3TTTA 3HBJA 2WD8A 1VJCA 1I5RA 5CT6A 4KPUB 3TNLA 1N7JA 1PS0A 5AM4A 2YC4C 4ALLA 3OCXA 1Y6FA 2DUJA 5EZQA 3EAGA 5FOSA 1QDLB 5C7LO 5JXGA 1PJAA 2J5XA 2ZJFA 2JI6A 3IT3A 4OHUA 4AAYA 3FZNA 2ONKA 2E6UX 2NO6A 2NX2A 4DT1A 4O4IF 4RV4A 1CZNA 3LY7A 4PHTA 3JX9A 3TZKA 4DJTA 3UWOA 1JQLB 3BGSA 4DLAA 2AB0A 3PYLA 5TNXA 4WZBE 3SDBA 4A91A 2XWPA 4JWKA 2XTZA 1T9BA 2HCTA 3K4QA 4MP8A 4IKPA 3WLRA 1W96A 2JH8A 3GZ4A 3HN7A 4RKQA 1EM6A 4Q6BA 5L4SA 3LNTA 3MPOA 1D2RA 2PT5A 3FTDA 4P36A 4DGSA 1ZAKA 2OO3A 4LMBA 1L4UA 1AKYA 1YDHA 3R0VA 5CCDA 5E3HA 3DBRA 4GUAA 1QZ3A 1E7WA 4IH1A 3WJAA 2YVUA 1VMKA 2A9OA 3FMOB 3A6DA 1J90A 4Q7JB 5EFZA 5FEUA 4QPJC 5LLDA 3ETLA 4L8WB 4O1HA 1ISSA 5FBWB 1LD3A 4R40A 4B6OA 3A6PC 3OCZA 3W2FA 1Z5WA 4UARA 2HO5A 4XM2A 2OPHA 5JZ9A 1I7PA 3WK5A 2HT1A 3ULKA 2IX3A 1MMFB 3P9RA 5AJXA 1S2MA 2CB9A 1OWOA 2GSDA 4XM1A 3UIEA 1WB5A 1WXDA 3DQZA 5E2AA 4BBZA 2OO5C 3B1XA 3UPTA 3ETHA 3FZEA 1OA0A 1PX2A 4S05A 1ZN9A 2JLAA 4DA9A 4IIEA 3NT4A 3P0JA 4QTUB 1Q17A 3F3YA 5DOZA 2D3WA 4OJMX 2AC2A 1BWPA 1X7YA 4P3YA 3D7RA 3C1AA 4KBGA 5CDFA 1I4TD 4QBFA 2XGGA 1ENYA 4DLKA 1OC4A 3T61A 5DNYB 4DB2A 4PXYA 3IAM1 3S2YA 1ZH0A 2CDBA 3QEJA 2HSWA 2X2PA 4EG7A 4KTTE 3HN2A 2FXIA 3JALB 1YJQA 3OZSA 3R0XA 4JR0A 4PN3A 2HSGA 3B36A 1LW6E 3KWLA 1GCAA 3H13A 4RDCA 2XUKA 4RJJA 3SDZA 3ZV6A 5JYEA 2QT1A 3R23A 4CI9A 2ZIEA 4BWFB 4PNEA 3QFTA 1F48A 2HHHB 3MIZA 3NYQA 4AUNA 3NH9A 1QP8A 1R1DA 5KVVA 4LRSB 2H52A 2JASA 1MJGM 2QW1A 3UFBA 1LPBB 2Y2UA 3T52A 5TLSA 4ASUA 3EF1A 1C1XB 1U9CA 1QH1B 2VF2A 3WDKA 1DRKA 3VR3D 2IEZA 2JDIA 4JC4A 1XTJA 1W0KD 2Q4RA 4FFBB 4B74A 5FQOA 5JS8A 1CUIA 5FBVB 3LQFA 1Y1KE 4LHZA 2GLTA 4WD3A 2HEIA 5KNBD 2OBFA 3HVHA 4GMFA 5DE3A 4LOIA 4PZEA 4AP5A 1ZXBA 1TO1E 1W8DA 4ZOLB 3U3MA 3O3OB 4HDNB 5DP1A 4F1WA 2HA6A 3NWBA 4MTCA 3VVCA 4UMEA 3UEOA 4DW8A 3WO0A 2BH9A 2VHXA 4O3FA 5A1TA 3LIPA 3WWPA 3DMTA 1VI6A 4NCBA 2FZKA 1YWGO 4L7VA 1Q0LA 2P8JA 4JQCA 2G0AA 4ZGGA 2IITA 1LSSA 1Z6AA 1XLTA 2ONJA 2W6ID 4J0KA 4YRGA 5SYNA 2QLTA 2G77B 1TNDA 2R1TB 3A1FA 2F1JA 2Q2NA 9GPBA 3R0QA 2FOIA 1XVTA 3KXPA 3U4MA 3KQQA 2A9KA 4BU0A 2HADA 1P5HA 4UVEA 5GM2A 1ZCBA 1HDGO 1Z9BA 4G1UC 1FDIA 4OM8A 4Y1EA 5CVCA 2BFBA 4WZBB 5B1YA 1A5TA 2A5GA 2BMFA 1F9AA 3VDXA 5FPTA 1USIA 2FHPA 1IDOA 1RLJA 2IEIA 3DONA 3GAMA 2FGJA 2VAVA 3C3KA 1ADYA 2FZCA 3E2PA 4QTYA 2E4XA 2WHPB 4MRMA 4ND3A 4XVQA 1J1UA 3SXPA 4NCXA 3V1UA 1PIWA 3WWCA 2AN9A 2P35A 1ISFA 2G5PA 1N8TA 3JYOA 5BN4A 1COZA 3U44B 4ML3A 1MEEA 3E8SA 4C3VA 1BN6A 2VSYA 4W1PA 4LXIA 3ELYA 3AR5A 4LZOA 1V7CA 2V54A 2WG2A 4HUJA 4I55A 4OQXA 5HIJA 3K0EA 5LUBA 1B23P 2XITA 2X6RA 3OZTA 1J8MF 1C7EA 4DIUA 3MG9A 3VR4A 2OYSA 4LKRA 1YRBA 5G41A 4HZGA 2HQRA 1FTYA 2BMDA 5DW0A 3GJ3A 1HXHA 3RRZA 1RJDA 5CT9A 2ZW9A 4D1YA 4F85A 1ATZA 2OA0A 4FFRA 2WEKA 1IVSA 3E9MA 2ZUTA 3EVTA 8ADHA 1ZK3A 3OTOB 2BKVA 7GPBA 1U3WA 3TL6A 3ZR4B 3IEIA 2CJFA 4P83A 4D0GA 2CLSA 2BZ1A 1E3JA 3BTVA 4H16A 3ZJ5A 3AI7A 2QU7A 4N54A 3OESA 3SEFA 3SM3A 3FX2A 3BH6A 1YRHA 3QMWA 2VRWA 3OX2A 4OXIA 4R0MA 2ABWA 3QEKA 4UDYX 3SNHA 4LDPA 1T5BA 2ISQA 2Q3DA 3E2MA 2VTBB 2VL7A 4N48A 1QB8A 4EUSA 2PVPA 1A5SB 2J3IA 2W2OA 2X7XA 4Y2JA 1R9JA 4PTYA 3OPQA 1BDJA 1TJYA 2EJVA 1UCFA 2REOA 3GBPA 4XIFA 3RAFC 5SYMA 1VGQA 4ROTA 1ULTA 1FBNA 1XV5A 3Q85A 5EYPA 4DM3A 4KQWA 4EI7A 2OAP1 2G28A 3I5XA 3TAHA 4PYQA 2PLFA 2VOJA 4W5RA 1HMYA 2WSSA 3H1EA 2VOEA 3R3YA 3KUDA 5TEWA 3L1IA 3U3RA 2WZDA 3DHYA 1NVWQ 3MELA 2NZUG 2PYZA 4LHWA 1P7ZA 2X9GA 2XW6A 2O2GA 3ITDA 3O94A 5JS7A 4LBYA 3COZA 1IRXA 1E6LA 2A8YA 3HA2A 1FDUA 5F73A 1JB1A 5FOUA 4TV8B 5BPHA 1UWLA 1PN3A 3IO5A 3LYLA 1VPWA 2G5TA 4MUKA 1IU9A 1H8HA 1NWHA 1ZIXA 3UYKA 2H59A 2PX3A 2GM5A 1BRTA 1LC3A 2XNSA 3SBOA 4FWIB 1PUIA 2GB4A 4KUEA 4WI1A 2Z1NA 3Q9NA 1PW5A 2GBCA 2WSIA 1F20A 1ZESA 3OMLA 4J4HA 5AKJA 4N9QA 5FBZA 3OAAA 1SUIA 2B5WA 1U0LA 3KDAA 1F9EA 1LU9A 2JLZA 2AC4A 1EDDA 3MINA 3A4NA 4L3VA 5ENDA 4V39A 2BBSA 5EMNA 1NJ2A 2XRZA 2B37A 3RVBA 2EKPA 1AD2A 2AJCA 5EUMA 1V39A 4YO8A 5KI6A 1LVUA 1XMPA 4GZMA 1B8UA 4QPDA 1GG5A 1SG9A 4CGYA 4BQFA 5I47A 2A84A 3U48A 2J9ZB 4GKBA 4G0WA 3WGQA 3EXFB 3WL5A 2WSBA 3MLBA 2W2VA 4F4DA 4ZGBA 1SC6A 2RJOA 4L78A 5E7QA 3H7IA 4CLRA 1T9GS 4R7TA 1KEVA 3OZBA 1EUZA 2PJUA 5AW1A 1JFTA 3ZU3A 2J41A 2V8OA 3DHEA 3I2FA 5IDYA 1NATA 1PWHA 5AI4A 1E6KA 1HFEL 3BK1A 1A4RA 3DS8A 1J8VA 4WZAA 4DMCA 1P74A 2GPBA 1U7XA 5DNWA 3LLVA 4JROA 2WSMA 2XMPA 3K72B 2IU0A 4EKEA 5IXSA 1TJNA 3TLEA 4CTOA 1CYEA 1YR8A 1YZNA 4NZ9A 4EYGA 2I4RA 1P60A 1R27A 1Z5VA 3A6ZA 2PWBA 3H2IA 3B6ZA 1NLUA 2F3UA 3JQPA 3PQ3A 4B31A 4CTKA 2A3NA 4M46A 3STHA 5A62A 3AUKA 3G9UA 2VS1A 4RY8A 1U81A 2WKSA 2VK8A 5K3FB 3M2TA 3I9JA 1SU8A 1LRKA 3GCDA 3HWWA 4KDRA 1DG3A 1OAKA 1R9MA 1SKYE 2D7CA 1Z17A 2GF9A 3I6BA 4IDGA 1ULUA 4LRTB 2ZTVA 1E6CA 1PTJC 2HWKA 3VO8A 2F00A 3NC0C 3WQBA 1B1CA 1CZRA 1BWSA 3O2NA 1A9QA 4EELA 3DTVA 3NHFA 1EINA 1Y3CE 2PEYA 3EYAA 3ROTA 1H2BA 2PL1A 4DLSA 3OU7A 4X5OA 4XEUA 2NO1A 1AKQA 4AWXA 3BIOA 1PDOA 2AE1A 4HX5A 4QOSA 2ZYDA 3RC1A 5DK4A 1Q5PA 4KPEC 2PTHA 3P2IA 4MH0R 1VC2A 1WCV1 1NC1A 2KPOA 1YS7A 1ENPA 1VJDA 2XQFA 4O08A 4YT4A 1CY1A 2GPNA 4J9VA 1NXTA 4ESOA 1QIEA 1J4AA 1NUSA 2DPMA 1JG1A 5BT8A 1UJBA 5JY1A 3VU0A 3TRKA 1SJ9A 1IIBA 2BKUA 4JLDA 2B30A 4FHDA 3ABQB 3HU5A 1FU7A 4Z3DA 4F12A 3N3BC 4KEAA 3EGOA 2Q4OA 2VNSA 4LWQA 5JXHA 4PWZA 3JQ8A 1FFYA 3IPYA 4DRXA 4HX9A 1NU6A 3NRCA 4CUJA 1RMYA 2B3DA 2AG5A 1G5FA 1MO2A 4R1NA 5J59A 4LPSA 3HDHA 2UUCB 2W8ZA 3G8BA 2Q0HA 3LQKA 3NX4A 4KO1S 4ZI3A 4EZEA 1PNOA 3CCCA 4E14A 3V4RA 1K75A 2R8OA 3A4YA 4F6RA 1VIYA 5CB0A 4OSEA 1KI4A 2G07A 3A6HA 1N2GA 1P72A 3M4ZA 3NIGB 2PUDA 1CZLA 1Y3IA 3C2QA 3WGYA 3DH0A 1DPGA 3T9DA 1WZ2A 2ZAIA 3WGJA 2XCOA 1U65A 3RUPA 4DF3A 4OG2A 4RIHA 4RK4A 3VX4A 1ZD4A 4RPCA 4P93A 2YIDA 4X9XA 3ICQB 1CQIA 1H66A 1PQWA 1BVUA 1JG3A 5ED0A 5LJIA 3WDMA 4FN5A 1ZD2P 3A0UA 3B2NA 5D3MA 3TQSA 3B20A 5FNZA 3C8UA 3I5MA 2FW9A 4FPXA 1V8BA 3CVOA 4NZYA 4OGGA 4ESHA 3QVWA 4RF2A 2JFPA 3BOSA 3VR4H 2CFTA 2ZU6A 4M7OA 4RIIA 1C4OA 1JDBB 3KS9A 4RVHA 4C3ZA 2M6SA 2AOWA 4DCUA 4MV6A 1DEHA 4YJKA 1WY7A 4MGYR 3H2KA 2JCGA 5B58C 5BR1A 2NNLD 4HDAA 3QOFA 1WCXA 2DECA 3D31A 4NBRA 5IYZA 3UANA 2XMCA 3KZ1E 4BLWA 2MSWA 3BRWD 4UTVA 1NBMD 3K7EA 3O38A 2ACKA 4KYIB 3TEMA 4B4WA 1P2GA 1C5KA 2YCBA 2EXXA 2ZDHA 3N75A 3V1LA 4UM5A 3PZBA 1Q7RA 2OB2A 3NQ41 2BJHA 1QPGA 5A4FS 3GRYA 4WXHA 3FCCA 4JSTA 1YTLA 4HMOA 1WTCA 1WW8A 2FEXA 3HA7A 3PC4A 4OQDA 1Y37A 2ZJOA 4INPA 4LF4B 1F0YA 3KSMA 1E60A 1Z4NA 3TECE 4RSRA 1KYTA 3UCEA 5EXTA 3Q6IA 1KZ4A 4N41A 3ONVA 4BO5A 4DV3B 4B73A 2O19A 1FNSA 4RFSA 3RFFA 3QIAA 5IH3A 4YAKA 2K7FA 1OVGA 2B98A 5DLQC 2GK3A 5DWVA 5LCXA 1F38A 4DLPA 1GSAA 2RBKA 3A26A 2QAIA 5J1SB 4Z4CA 2R6R1 2X2FA 3AVQA 4KXFB 4QQ8A 4NNPA 2IHBA 1HQDA 2O54A 3UJ6A 4R1PA 1X42A 3KBBA 5F2EA 1ZGCA 1WS6A 5MGNA 1WOMA 4NK5A 4H6VA 4DRXB 2PKQO 1VBMA 4MQFA 4QC2A 3EPKA 1NQXA 3WGNA 1D6JA 1RSZA 2YVQA 3TCXB 3PEUA 5GV8A 1QDEA 3FNEA 3GAFA 1VGVA 2PX6A 5LJLA 3NOVA 1NBOA 4Z7NB 1CUAA 3AJAA 1EUDA 1MX5A 2AKAB 4L6AA 4FBGA 1Q1NA 3K9CA 3VDQA 2NV2B 2N1BA 2XQGA 3RS2A 2AF4C 2V0CA 4N6GA 3KK0A 1Y1QA 2GF0A 3K6JA 4JBYA 1UEJA 5NLLA 2A7QA 2FSVA 4H1HA 5IPFA 4M0FA 5ERYA 5KUTA 1RWPA 2FEWB 2QX7A 2XGJA 1SEPA 1KNXA 2LCIA 3MRXA 1KZGB 2IPMA 2OV8A 3OUUA 2VUUA 2CMFA 3JQGA 4GLBA 1S3SA 1MJ5A 4XLLA 2ZB7A 2AFVA 4GT1A 4CN8A 4EHBA 1NI4A 1ZJYA 2HIHA 3EVNA 3DJYA 4DLNA 3J7AC 4OU4A 1R7RA 1TZJA 4P58A 2R85A 4PSKA 1OH7A 1QTIA 2KBEA 4TL9A 5HOQA 3OMXA 2GPAA 3BRCA 3DV2A 1USKA 2J7KA 4UDXX 4URVR 3PRHA 4AX4A 5FTKA 5J58A 2COEA 4DR7B 2MYNA 3WA6A 4G4JA 4YCCA 5TQ0B 5CH3A 4XZ3A 3N2KB 3AGQA 3AJ8A 2H2GA 2VLIA 4B6RA 2ZBEA 3WLAA 4A2QA 1RZ3A 3H5VA 3O8OB 4O2AF 3RYHB 5AI9A 1RQLA 4TMKA 2YXLA 2HUPA 2DG2A 3JALA 2XEDA 3S7ZA 3JVDA 2DWPA 4XASA 1CRQA 4GKAA 1Z38A 5F9MA 2DAPA 3EG9A 3U7IA 2ZULA 3Q6MA 2XZLA 1N2CA 2D5IA 4FOOA 3E3AA 3VR2A 3V8EA 1L5HA 4EJ6A 1E92A 1RVDA 1YAHA 2ILTA 3T3HA 4BEWA 3CUYA 4YECA 2BGMA 4DG8A 2YVLA 2Z8ZA 4ZC1A 1LQTA 4IQ4A 1JMYA 5AVXA 5KTMA 1FMFA 2O50A 4A03A 4W1RA 5KNDH 3IV6A 3OPXA 2DWQA 3W5CA 5G4LA 1QWSA 3JR3A 2QQ0A 2DT8A 2VCEA 4N9WA 3UFXA 5K6RA 3O1LA 2B4AA 3UQZA 3RDPA 3CZCA 2YHAA 4C20A 3SF8B 4BV9A 1QRSA 1QH0A 1C9EA 4NLLA 3M6WA 2PHZA 2R00A 4D0NA 5C9ZA 1ECGA 1YI8A 1SD2A 3KLPX 4K40A 2H5JA 4Q4AA 1HDOA 2RCNA 5CTJA 4QARA 1RKXA 1NOJA 3ABRB 1NUPA 3FLMA 5LBIA 3T0IA 3G0OA 1A1VA 4BFLA 4G0VA 1DWUA 1E2EA 3NHLA 2WUVA 2F8SA 1G4UR 5KJ1A 2VRCA 4PNHA 3PQCA 4MGIR 4M21A 4IYJA 1U2GC 1RWMA 4KWEA 4N6OA 5M2QA 5G1PA 2VJKA 1X80A 4MYCA 1UKCA 4H27A 4NKRA 3RANA 4B75A 3UAYA 5FQNA 1A7KA 1J5XA 1KO5A 1M2JA 2JS7A 2D4AA 2W4IA 3RFXA 1AGXA 2PRKA 1TM3E 3TGPA 1PFVA 5DM4A 3F3KA 3RABA 1XWFA 1G8MA 4MQ4A 4FCCA 1JEDA 3T3EA 5CAEA 4PLTA 4JEMA 3QWHA 5AK0A 2QL9A 4BN4A 1PDVA 5ALHA 2PUTA 2O5EA 1QORA 2AMYA 3BT7A 5LQMA 3T3NA 4KRGA 4Y6QA 2C5BA 3QA9A 1ARZA 4J7CA 1KSFX 2O7SA 4XYLA 1PU2A 3EMDA 3U81A 3HEBA 4R2JA 1QG2A 3JQ7A 4CQMB 4EECA 5JWRA 3ZHQA 1GRCA 3DA8A 3W6NA 4RFLA 4OXYA 3NFYA 1Z47A 3ORFA 3Q72A 4IQFA 2IH5A 1N5KA 4E07A 2DKNA 3CF2A 4PS0A 2ZREA 4ZN6A 2HHAA 2IBMA 3U49A 4OGLA 5FPHA 4IIJA 2RMKA 4CF7A 1GLVA 3TVTA 1GN9A 3DD5A 2C0QA 1C8KA 2UVPA 2DWCA 4GXNA 2HRZA 2IYTA 4EJMA 4PSUA 4JUBA 5CK4A 1XB2A 2EFGA 1Z7GA 1ZGGA 1GL6A 3WLFA 4M7PA 4FNAA 1E2NA 1FP2A 3AILA 3GJZA 5KJEA 3JD0A 1HEIA 2VYVD 3NYRA 3WOHA 4N5LA 1FNNA 3ZLVA 4CXMA 4O29A 3TIXB 1JWLA 3GT7A 4OQFA 2XGSA 1NXXA 2BBWA 4WNIA 5FI0B 1QBKC 1WWKA 4RF4A 2OOSA 4WNAA 4HDOB 3BF7A 2YMLA 2FA9A 1BA2A 4TN1A 2EG5A 4ILKA 1VG9B 4X1YA 4B8WA 1SFRA 2F8MA 3JYPA 3D4PA 4RPJA 3ZBPA 4B7CA 1R6AA 2B7CA 2XB9A 1GAEO 1WU8A 3HWSA 5EQJB 2B99A 2XE8A 3C6YA 4X71A 3SFZA 3OZCA 3S7TA 3ZHCA 3GP5A 2GZRA 3B1WA 3O8QB 1NXVA 3D0RA 3KYCB 5ES3A 5HSGA 4KLCA 3EBPA 3C24A 4P9NA 5CLQA 2HJVA 4L5CA 4Z86A 2V9CA 2JGDA 5G1OA 3KT8A 2F7SA 9LDTA 1ILWA 1ZMRA 2VWGA 3OPVA 4MX8A 5LZ5A 4A16A 10MHA 1N5MA 1ZKMA 2R60A 3FDXA 1T3GA 1F6BA 4IZOA 4LUCA 4PBTA 3RO7A 3DXXA 4JR2A 1TCAA 4AN0A 3A1VA 4PRYA 1G8PA 4TTQA 1N2CB 1UOOA 3ASVA 1ABFA 1NRWA 3JD2A 4HNGA 2WNIA 4NHOA 4QFBA 5E6RA 3B1KA 1KRWA 4H6XA 2EBWA 3AG5A 3ROEA 3NYWA 2QR2A 2J9YB 3VMFA 5AKKA 2ZJ8A 4FWBA 1OAOC 3R3JA 3P9IA 2QG9A 2WV9A 5K05A 1OTHA 4G8BA 2ID4A 1G55A 3IPXA 2YDYA 3I2YX 3X2SA 4BMXA 3KELA 5FWYB 3PQ6A 2RGCA 2FDCA 1X87A 2ZSIA 1GTZA 4MB2A 4MVCA 4QUAA 1G6KA 3Q8XB 1LNQA 5DM1A 1ZYUA 4LZNA 3HUFA 1WHSA 3C3CA 4XGQA 1Z6XA 5E6UB 2V5UA 2OLEA 2RHCA 2PH3A 2CXHA 4PGHA 5KWJA 4CLXA 4PPGA 1AHIA 1S4MA 3QVKA 4OI4A 4RMJA 4L4YA 3TWOA 3G2PA 5ALYA 2OV2A 2QPAA 3KJZA 4PYMA 4Q7MB 4TS1A 2A9QA 1N5IA 3BB1A 4MV8A 1IN8A 3MTIA 1R0SA 4WLVA 3BQMB 1XLUA 3HL4A 4YBZA 4WW0A 3GRPA 1A7UA 4IRXA 4ND1A 5CTAA 2DXIA 3PE3A 4Z51A 4BUJA 4OFBA 5HRCA 1WMAA 2QTMA 3ESZA 3M5CA 3RSQA 1UQTA 1K7FB 3QPBA 3W79A 5I9LA 1E7MA 3FTQA 3TBKA 4ZAFA 3FPCA 4JBHA 4WKOA 3WBKA 1AKMA 1WAMA 2MSLA 3CLUD 3QX8A 2UU9B 4UUPA 3MK31 4MPRA 1FFSA 3HKBA 3RNOA 4DR5B 4E5MA 1BKSB 1T9CA 1VG0B 1C7FA 3E5MA 1XX6A 2XLBA 2C88A 3MSCA 3U4DA 3BD9A 2NGRA 1SMKA 5FOQA 4A0SA 4MQEA 1UJNA 3ESXA 2QK4A 2VDKB 4E3WA 2ZJBA 3HM9A 5K8TA 2GN9A 4UUNA 1DAEA 2JGRA 4MWDA 5HMMA 2IZ7A 3D8HA 1Z07A 3V4VB 1QLHA 1DB3A 2GPWA 2BHLA 3RUIA 3PJRA 5D6NA 3CTMA 4D41A 1FLVA 3E9ZA 4MLZA 3ZIAD 4Q3BA 5KYYA 3UHJA 4DM4A 3JWIA 3EVDA 5D51S 3F6EX 4LNAA 1WU7A 1QKKA 2LRHA 4OXKA 1ODIA 2LDXA 4EHKA 2GR9A 2GYWA 2ZYSA 2H17A 1QFSA 2BDTA 1ADCA 1D1SA 2IOQA 2IXAA 3GFTA 4GW3A 4MR8B 3AR9A 5FI1B 4C7JA 4DIEA 2FSHA 3V2UA 1BS2A 2GXUA 3K32A 3KNZA 3F67A 3KZCA 4EENA 5JAOA 4ITVA 4I46A 5LD2C 3NBUA 1RHRA 1OH8A 5JLJA 1TUGA 5IS2A 3K5WA 2FP3A 5JDIC 2GCNA 4Y9TA 1IJBA 2HWUA 1NPYA 2PFKA 4U5QA 2PGDA 3IC5A 5CHYA 4WY2A 3CRVA 5A4DA 1WPXA 3WMFA 5DGIA 2WR8A 4B47A 4AIIA 1YL7A 4ZVLA 3H6GA 1QJCA 1XDZA 5GGXA 4FSHA 4W4TA 2FCAA 4TKMA 2ZQZA 3L5OA 1VYHA 3LPCA 1FTNA 1PZNA 1VZ3A 3WK7A 1XA0A 2BKLA 3OJWA 1L7QA 3O3NB 3AF2A 3LL4A 3SZLA 3DOEA 4GX1A 1MV8A 2QLJA 3VHXA 1TA4A 1SVLA 1UODA 2OSVA 2QUZA 3BWDD 4AZTA 2HMWA 1U9IA 1RM0A 1RADA 1WP4A 3ESCA 4PXAA 4YMIA 1U2DC 1MIOB 3W3AH 2V8BA 2MT9A 3GIWA 1OF1A 3O2JA 3PU6A 4IDPA 4Z2AA 3DZBA 4BP1A 2UZ1B 5CYGA 2QYOA 1G42A 3QPVA 2UZ0A 1XWIA 3KKEA 1RC8A 4PQRA 2OD7A 4PLYA 2FB9A 1YTUA 3PHIA 4EUEA 5CW2A 3U7QA 4WOBA 1PS9A 4DLZA 1N92A 3F9IA 3CNHA 4U7HA 5KPDA 4PLPA 3FWPA 1Z3CA 3QPCA 1TZ2A 3FIUA 1Q0SA 5K0CA 4QRIA 4X8HA 2QL7A 4G5HA 3IP9A 5F5XA 1J49A 2W2QA 3DZGA 4YROA 1UL1X 1T0JB 5CLLA 1WCWA 3O9VA 5FIUA 1EDOA 1HFKA 1QTNA 2DY0A 1P29A 3BXGA 3HSYA 4BUZA 4DQUA 1OAAA 5J2TB 5BWOA 1TO6A 3VYWA 4MCIA 4C0LA 4C22A 1XZMA 4AK9A 3ZCSA 1TVKA 5KMGA 3NATA 3OG9A 1C14A 1Y7IA 1Z83A 4ZHQB 4HRAA 1ZMTA 1WBJB 3BERA 1NTOA 1JSLA 5F9FA 1PNTA 2X5JO 3TL2A 3I9LA 3UOGA 4F38A 2WYVA 4MYRA 1Z5UA 1IE3A 1IG3A 2WKQA 4HAVA 2CWDA 4B1FA 2RGGA 4ND5A 4ZWNA 2QTLA 1AX9A 3GHHA 4FWTA 3RH0A 2IV2X 1K6JA 2XE6A 4KXYA 3LKZA 4AICA 5BNTA 3K8ZA 1QYWA 4NCIA 2P9JA 3VMMA 1FK8A 3FLBA 2DM6A 1DUIA 2BR3A 4QU9A 2NPOA 1VCNA 1AQIA 1IM8A 3ED5A 1JR3D 4PF1A 1UPBA 2QGNA 3F97A 2G6BA 1H0HA 4OI0A 1MN6A 3D1VA 3DOUA 3RV4A 5MF6A 1LBHA 2ETVA 4G5XA 5BXQC 5DCUA 1X19A 3A6JA 1XZEA 3LP6A 1NVUQ 2Z8YA 4QYSA 3VSCA 2ZT7A 3GLGA 4H7PA 3WV4A 3HKDA 2DEUA 2PV0A 5TT0A 1C7IA 1K9SA 3IUBA 3QM1A 4J1TA 4W9NA 1BHJA 3HJRA 3G6KA 1RYYA 1KWKA 2C2BA 4D9NA 1MOSA 4PZ9A 4A92A 4E5PA 5KTSA 2CZQA 4EHFA 1KAQA 5JXWA 1MAHA 1P0QA 1EUYA 3SXUA 3UV6A 1IUKA 2R3SA 4X1IB 4I1PA 2PUCA 4R1LA 1A96A 4RELA 1U0RA 1UKBA 2JIZD 3A4MA 1JSCA 5ARDA 1RWBA 1UC9A 1UZAA 2YHBA 5A4KA 3NVKI 2IS4A 3KKKA 4JI4B 1ZJWA 2ZYIA 5I7EA 1I0ZA 2PU7A 1ZUD1 2ZB2A 1SCKA 1PL7A 4O02B 1UZNA 2BM1A 1X38A 4OKNA 4TSRA 2FUEA 5DP2A 5KYKA 4LE1A 2R97A 2W6ZA 3PQ5A 3ITNA 1AF7A 1FVXA 1N5DA 2WVJA 1R8JA 1PJCA 2G80A 4MQMA 4P80A 5FLYA 2HBQA 2NMVA 3OT4A 3DM9B 1PJZA 1VBKA 3DE6X 5I51A 4X7MA 5ALOA 5CA0F 3DT6A 3C15C 2ZB8A 3KTDA 1E79D 3Q5EA 4Q7QA 2ZZKA 3QBTA 1DOHA 2DKOA 5FR2A 5EGSA 4DKJA 5JHHB 1RBMA 1CEQA 2PUBA 1JIQA 5AH0A 2G71A 1HM5A 4P3NA 4YIKA 4O4IA 3GF4A 3DEJA 3SSOA 4F9FA 1TQ6A 1TLLA 3IBTA 4D46A 3CF4G 5GPBA 4WY5A 1LF0A 3D6MA 4QBKA 4AJ4A 4BASA 2F1IA 1WSWA 3JD1A 5JNRA 2PVCA 3AEKA 1VJ1A 3FGNA 2NSYA 3X2FA 2X8LA 3K0BA 3MGAA 4AMUA 3OEYA 2G67A 4C1NA 4UJ5A 5CXUA 1EK5A 2OXRA 3L6EA 1SCDA 1T26A 3EDMA 3PL5A 4R2KA 3TO5A 3VOAA 5L3SB 4IDHA 4B82A 2ZANA 1BXGB 2AWNA 1N2XA 3ZJUA 2PFGA 5D85A 1RHQA 2EJTA 3N7UA 1M2VA 1V3QE 1RYNA 2QMZA 2PGNA 3I42A 1ABEA 1EE9A 3EVGA 1OLUA 2J08A 2ZRMA 3PFBA 3PQ7A 4R9NA 3QG1A 2A5DA 2GZSA 3COWA 4CM9D 1ISHA 4ESVA 2DMRA 1IRIA 3LQ4A 4HDCA 3MCZA 1DJPA 2JLXA 1TK9A 3JAKA 4IOKA 4RL6A 3IMEA 2WVGA 1EX6A 2FRDA 1AHHA 1ZK0A 2AKYA 5JD4A 4YUVA 1DV2A 5F64A 4Z1OA 3RSHA 4L76A 4EAAA 1CUVA 1SULA 3KOWA 1PEKE 1ZPDA 1YU9A 2R7AA 5J40A 1FUKA 1HQKA 1U2ZA 3R76A 4WXPA 2BD0A 4CFSA 1HE4A 1XLVA 2A5JA 4LJ7A 4YGXB 1QMGA 3JQ6A 3L1KA 4C4TA 4QRDA 1LWOA 1PX0A 2A9JA 4RHXA 4B3JA 4WKNA 4NBSA 2WJGA 1MF7A 1C9DB 4IXDA 4YUZA 2GEVA 4XPIB 2QROA 3ADPA 1BXRA 2ZBQA 3SHOA 4Q3CA 3G49A 3D8RA 2H07A 5IC5A 5JG7A 1KSJA 4UVHA 3TBFA 1E9RA 1Y3BE 3L06A 3DT8A 4HLNA 2D2IA 3R3ZA 4JL6A 4O2AA 5F7XA 4MP3A 1RT9A 3A1WA 3BILA 3CNEA 4HQFA 1KXZA 4C30A 2NP6A 1ZIOA 1QS0B 2AC7A 1EE1A 3BIWA 3CGWA 4CQJA 5IMSA 1JQBA 1ZO8A 4NZZA 1TQHA 1P1KA 4IOMA 3KWMA 2REQA 5EWLA 5BSRA 5KOHB 2C7PA 4QUIA 1BEEA 4F2HA 5MN5A 3GJ5A 2VJOA 2FAXA 4GLFA 4OQ4A 1MAWA 5EZYF 3L8ZA 1NN3A 2PNFA 3BF8A 1U8CB 1OZGA 3KEMA 3N87A 3B2EA 3RRJA 3V8VA 4EX7A 3ZDAA 3B48A 4ZC8A 2EERA 3MBOA 4QUEA 1XU4A 4RVDA 3RVDA 4TRNA 1U5CA 1I13A 4X44A 2VHQA 2WC1A 1HTWA 1IMJA 3I83A 4X6XA 3I6ZA 1ENOA 4DJ5X 1UDCA 2WWGA 1KNQA 1T43A 2GK4A 4YCLA 1Z16A 3ET5A 4MWCA 3B3GA 2OKGA 5F12A 4V2UA 1YRLA 1HGXA 2PSJA 4E09A 7MHTA 3TUZC 2VF7A 4AQYB 3SHVA 2XUFA 4QUDA 3U6BA 3FPLA 3AETB 2CLCX 1W5TA 3G0IA 1KKUA 4S1VA 1IB6A 3RNLA 2HPZA 5LMUB 3KFXA 4K9OA 4DN6A 1KZ9A 2QVBA 1KU6A 2GBLC 3UWMA 3GLGE 1L5VA 3N0WA 1LS6A 1BX0A 3DBHA 3PT9A 2IYYA 3AB8A 5HX7A 1B74A 3ABSB 2WT9A 3KTFA 1U4NA 4H35A 4LIPD 1KWGA 5BR8B 3AEYA 4BLRA 2J45A 2CXPA 2OBLA 1LJ8A 4QU5A 3GRZA 4P5DA 1HDIA 2X4IA 4TM7A 4URWR 3TH5A 3ZWNA 4YPVA 1C41A 2EWVA 1KZ1A 1NBHA 2VI5A 4KZKA 4ATNA 5J4HA 4EJSA 4Q18A 2P5SA 4AKEA 4N5IX 3RSFA 1UOQA 4LY9A 2G72A 5CXQA 4ZMBA 2WTAA 4CQNA 3L4EA 4OB7A 1DGQA 1NVDA 4XQGA 3ENQA 3UGTA 5KOJA 1DQSA 1MTZA 3TXXA 5C34B 5TRTA 121PA 1M1XB 3IKLA 1T36A 2YVAA 5H9VA 5JHGB 3GX1A 4E5KA 1YDMA 5TARA 1JHYA 1A9XB 3CINA 1M9NA 1PGOA 1W85A 4TKVB 4FS8A 2Q50A 1JPUA 3OLZA 2HPVA 1RR6A 1GT6A 4FBLA 4BFZA 4EI2A 1LV8A 3RD5A 3H1PA 1ACMA 3SAJA 3T5GA 3JAKB 4UE6A 5FUXA 5SV2A 4D0SA 4C0BA 2OQ2A 4E4YA 4LF9B 4NMWA 4C0JA 3Q11A 2VA8A 3DT9A 1N2CE 1Z0DA 3C45A 5SYAA 3VZDA 1LSJA 3M4NA 3QU9A 3VDNB 2F90A 5KYUB 2ZUUA 3OHPA 1BJTA 2F3SA 2LKCA 4QTXA 4ZYUA 1TD9A 5FDFA 1D2AA 1LNSA 3R74A 3TQRA 4TTSA 1MO3A 2ZYWX 5ALDA 9MHTA 3K9BA 1CK4A 5HFJA 4BVLA 5CFLA 1DCFA 2G4CA 3DKRA 2ZTLA 4XSGA 4AG3A 3SX2A 4TQ9A 1EA7A 4ZQGA 4MARA 3RC2A 3AJEA 5GY7A 3ROQA 1HX7A 1GKUB 4FK8A 3DFUA 5LZ4A 1OB2A 3FR7A 2HDNB 3H6KA 4WV3A 1JFFA 2WU4A 3DDNA 4IIDA 5JVDB 5C2JB 1BH2A 1XDBA 3OE7A 3UJBA 3N2GB 3DYVA 1N2OA 4DWVA 4YV7A 2G7ZA 1S89A 4Q0MA 2F1RA 2XWBF 4YV2A 5I7WA 2OENG 1N1DA 1AU9A 3CSDA 3FVRA 3Q15C 4EL5A 2XR1A 4PHCA 1JEEA 2CNBA 5J2TA 3BJEA 1N6PA 3BYZA 3OJLA 4RA9A 5KSYA 3NHPA 3CJQA 2WD7A 3CRRA 2VF8A 2AK2A 3PQ2A 3H0EA 1T8YA 3ND9A 1NPDA 5D1NA 5EEGA 3FUCA 2XT9A 4E2ZA 5JDCA 1ACJA 4K9QA 2C9ZA 2ZDGA 1KFCB 5BQXA 2V58A 1UAGA 2VPXA 3GJ4A 2FG7C 4XAQA 1MAVA 4GIBA 1NI5A 4B2PA 3VO9A 4TQAA 5JMPA 1NM5C 1W73A 2HN9A 4YUXA 5KYXA 4F7DA 1JKXA 1XEXB 2XNCA 4QWMA 2D1TA 5BMVF 1WNFA 4Z1MD 821PA 3LUBA 3DE7X 3L05A 1QGDA 2GF2A 3I2GA 4DMGA 3EC2A 5DSXA 2JEYA 1R88A 4FIDA 4CRWB 4DCPA 2IDMA 4RNCA 3R7SA 1X1CA 1G64A 2X76A 4ND2A 3TZEA 1EFHA 1V7ZA 3WMWA 3N3AC 5CDHA 4LX8A 3G2IA 3C3XA 4CKZA 1J2RA 2XTAA 1IZYA 3N0TA 2TMKA 4N03A 4G4GA 2HD4A 4WLOA 4Y0NA 1O94C 3RU3A 4Z6KA 3VYRB 3GA5A 5F3WB 4JJ7A 3RS7A 3BB4A 3IP6A 4NCKA 1G5TA 2VP0A 3L8HA 4BGUA 1CP3A 4DEYA 2EBHX 3I04M 3ZOZA 3I4FA 1XXLA 3N2IA 2NXJA 3H9GA 3IIIA 2JZCA 5AW4A 1IBRA 1R3DA 1W0CA 1R6DA 2FV8A 2J3QA 2PMBA 3CW8X 5H81A 3TKYA 4DIMA 5BURA 1JDSA 1NT4A 2XDYA 4NAHA 4B85A 5GVSA 5I9MA 1EA5A 2AMJA 1YJXA 1G3QA 3DXFA 3NGXA 1DZ3A 4OUKX 3BFKA 4GYKA 3CF6R 1K4MA 4GGMX 1GZVA 2R6CA 1E6EA 5G0WA 4A5SA 2APJA 3BWBA 2FEPA 1WZEA 2H2WA 2D3TA 3IP7A 3BE8A 1OX4B 1F12A 2JW5A 4UHDA 2ZJ0A 3NWEA 3GUYA 4ER5A 1EBFA 3BRSA 3K73O 1XALA 4IKOA 4PAOA 4BVAA 2HSZA 5DDIP 4DDVA 5AFSA 3JYNA 3PQ4A 4GSKA 4C4AA 3CR7A 4AF6A 4DL9A 1ID1A 3DDWA 4LXUA 5G0TA 4R81A 3TLYA 2G09A 4C7OB 4F6RB 1DHTA 3N0VA 1NLYA 5AKIA 1M1NB 2G9VA 1SG0A 1P0MA 3IHWA 4C29A 1ZI9A 2BFBB 4WZBA 4XJSA 2J0UB 1LPOA 4CM6A 3O26A 2H65A 5FUYA 1GZDA 1B93A 2V65A 4H15A 3VC7A 1KBOA 1UFKA 3NEYA 2C2ZA 1ZD5A 2X4LA 1XPOA 3UB4A 1ORVA 1LQUA 4XRGA 1NVKA 5EY5B 1VZ2A 2QDXA 3QVMA 2WHXA 4QBHA 3D3EA 2VQ6A 3DTTA 4UAJA 4HD8A 1Q3HA 5EXDA 2QSUA 4GM4A 4UHJA 3ZCXA 4TLAA 1VIDA 1K7EB 2GJKA 1T8RA 2VJPA 2XSZD 4FUQA 5JZVA 4JGBA 4MO9A 5E7IA 2PQ2A 5BVGA 1BAPA 5JAPA 4RM3A 1H2EA 4ENSA 3SC2B 3G88A 3ZV7A 1I7QB 1XA4A 3N07A 5IXJA 1Z63A 2HREA 4CM7A 4BATA 5JSZA 1COWA 5J4KA 5DGXA 4PTLA 4JITA 3WY9A 4ER0A 1FLDA 4Y2VA 3THYB 2B61A 3QPAA 2Z5GA 1E98A 4YAFA 3J81k 2NIPA 3AYXB 4LY3A 1K27A 3CVXA 4ZV9A 1GO2A 2REQB 5EWLB 4RZXA 1AQJA 1KL7A 2HYIC 2N47A 4HQ0A 4IIYA 1Q74A 1LBSA 2O0HA 1JECA 1GNPA 3MWYW 4HY3A 4LOAA 5HRAA 3VJRA 2BFOA 5AUQA 1DBQA 1KH3A 2A30A 4GAEA 2E5FA 4IGFA 5KQPA 1E8NA 3SXJA 3DNFA 3NOQA 2RE8A 1XPUA 2DWUA 4N65A 4X1KB 2GNPA 3W5DA 3HL0A 1MIHA 1A76A 1NNSA 2XXJA 4NEQA 2P2SA 1MUUA 3FBTA 3KP1A 3N28A 2H29A 4LE0A 4RFVA 2RIRA 1XCBA 3OU2A 3FCAA 3KXLA 1OXXK 3H8SA 2OT3B 3OQPA 4MP6A 4E94A 3LA6A 4BB6A 5K9ZA 1GZ4A 3VUFA 4ARCA 4N76A 3RWBA 3DAGA 1B1AA 1L1RA 3WICA 4N0DA 5A7HA 4A82A 1XQ9A 3DV0A 4QEZA 1X7XB 2ORED 2PL3A 1UR5A 3LM8A 4HKTA 4BQNA 2Y4OA 1IC6A 3CX6A 3PHLA 3E3LA 1T4GA 1X1RA 1TF2A 4WXRA 4ZT6A 3R5KA 5F52A 1W4BA 5TPZD 5IARA 2NO7A 5EQDA 1YBFA 2E48A 2NYRA 2GRUA 4V02A 2JJ1D 3OZDA 2W2KB 1WG8A 3O8LA 2UXCB 1EWQA 1IVNA 1QRAA 3O1JC 4KB5A 1PF7E 1QHHA 1Y8RA 1ODSA 2I2FA 2BFCA 2VBCA 4WN9B 4BYGA 3NIDB 2FJ0A 3DEKA 4MI9A 4TRJA 4V0ME 5GQSA 5KJFA 1T2AA 1R50A 1RBQA 1F0KA 1U0EA 3N76A 3QUBA 2DR3A 4OQPA 3B1VA 5AK6A 1PSWA 2VSXA 5JZSA 4FDAA 4QA9A 2G8NA 2OXCA 4QGFA 1KKMA 2PKYX 4M8NE 2J32A 2ZRQA 4QLOA 3LVFO 4RK7A 4I36A 4BLPA 5BY2A 2NXWA 2ATXA 5ALXA 4Q1AA 1MQ8B 3VM6A 1IONA 5E7JA 1G9XA 1H3FA 4AO7A 1KDTA 3TTUA 3IOEA 4DIBA 1W36B 2P9TA 4BO2A 4C7OA 1N1MA 2IDKA 3BSSA 3DXYA 4PIPA 1XD8A 1OI4A 2O5VA 3QENA 4QXPA 5TQ0A 5KSPA 5ITZB 2JFHA 2JIBA 2WIJA 2WKWA 3ZW7A 2QOEA 4C4YA 2P5UA 5CT4A 3DWGA 5FFFA 2H48A 4GWGA 4AG6A 4QUKA 3TQQA 2FZWA 4QYIA 5KNBA 3T06B 4PYLA 3K2EA 3UH1A 3DP9A 1SOMA 4KO2S 3NHWA 1V5FA 3AW8A 2JFFA 2ZVJA 5DKFA 4ESEA 2IHVA 4XDGA 2H6EA 2TECE 4TXNA 3G13A 1MD9A 4ME6A 4H9GA 2I7VA 4O63O 4WL0A 3FZQA 1T4BA 2GZ2A 2W98A 2HCFA 2RI6A 3DMTC 3KL2A 1HZJA 4MMZB 1E2MA 4ENQA 4Z4IA 3KKQA 1E79A 2WRZA 1E3QA 2KE5A 3GLHA 3T12A 4RKEA 3FOFC 3BZBA 1AKEA 1X8XA 3T5TA 2P5TB 2K6GA 3DCNA 1AZWA 3DEIA 4H77A 3UXMA 4F2PA 3HXQA 2XA9A 1CUEA 1NQ5A 4XI9A 1N32B 3ZXYA 1RWNA 3L77A 4QUGA 1XNGA 2WFZA 1SRRA 3ZHSA 1U3UA 3BHNA 5EESA 2RH8A 4ZVQA 1RABA 2QLLA 4MVJD 4A8PA 3EGEA 1G5HA 3DWFA 2C7RA 4RH3A 3PIIA 4QKQA 5C3UA 5BSWA 5ILOA 2F8TA 4ARSA 1DX6A 4NP6A 4G4SP 3CKYA 2I65A 3ZHRA 3N8IA 2H7CA 4BLTA 1SBZA 1KPGA 4BLQA 4DMHA 2YVKA 4L85A 5C1DA 3DMFA 2P11A 1EQAA 2CNWD 5IT4A 1MHTA 3UK6A 1D6MA 2XWSA 1GUDA 3TX6A 3ZU2A 1NOKA 4AKIA 1PT6A 4U7TB 4YJ3B 4DMLA 4N6NA 1C3OA 1G6Q1 3AJ9A 4GM1A 3LG2A 4II3A 4RVSA 2H2HA 4ZVRA 5JISA 4K6FA 1JHOA 2ID7A 3TW8B 4F2DA 3NKVA 4GZ6A 1UMCA 3NHJA 1PQ4A 2FLVA 2IYEA 1PG2A 4R1MA 4H2DA 3LHKA 2YNMA 3CKLA 3DF9A 3R09A 2CXRA 4JLNA 1UBRS 5CEJA 2WBLC 5IH7A 2Q29A 3L6RA 4LWPA 5DBEX 1G7TA 2PZ8A 1T34A 2VT7A 1REQA 4GVLA 1B43A 3ZZUA 1T5TA 1E1CB 3LUAA 1WDWB 2YRXA 2RAVA 3DAPA 4R1SA 3GJTA 3AY6A 4TUYB 3T4UA 4L02A 3D3WA 2X9NA 2Q21A 3MQFA 4NX2A 4FFBA 1PSZA 3WC4A 4DR4B 1F2VA 2GJSA 3PITA 2P9YA 4RH1A 3T4EA 3EIUA 3FWKA 5EJFA 3UICA 4MEAA 4OHVA 1ZH4A 4DPKA 2P77A 2X1LA 4HFRA 3RYCB 2WF6A 1SZPA 1U31A 1RBZA 3OMWA 1NQAO 2R7LA 1GSIA 4G85A 4KPGA 1L7BA 2A3RA 1KQFA 3T7AA 4MS4B 5K4GA 2YWHA 2VUIB 3QXJA 1D2HA 4PGGA 5AYVA 5TGZA 1LPAB 3SDSA 4QLBA 4KLAA 1F2TB 4RZQA 5B4VA 3RJZA 1J8YF 2QRQA 4FKZA 3NHMA 3UY4A 2NSLA 1NBAA 1PL0A 1W5FA 2C9BA 4RCVA 2ICAA 3NDBB 1LEHA 1XYYA 2DBRA 3OEEA 1SXJE 5FORA 5KTOA 2I2WA 4XFKA 2FPRA 1YQUA 1ADFA 1JEOA 1QGYA 1NG1A 1XTVA 2EBFX 3QU5A 3VYSB 5SZIA 3W8DA 4CMIB 1H1LA 2PTGA 3OLVA 1N9ZA 1N5OX 4HNVA 3WL3A 5IT9A 1E2HA 2EKDA 2IP4A 4BIMA 4GMGA 4IY1A 3IB6A 1Z2DA 2C8JA 4GVPA 4F6CA 3L4BC 3FTCA 2CWWA 2XAAA 4HWKA 4DY6A 4O4HB 1PP4A 1GHTA 4HB3A 2FMTA 4HCJA 1B15A 4QGAA 4II7A 1IEXA 2E4WA 1XCLA 2HRDA 3C5CA 5DGTA 2JIDA 4DQDA 5JTUA 1NVXQ 5EZYA 3QMPA 4XGNA 5BN3A 2UUAB 2HJSA 3MRSA 5G1NA 4L5BA 1X86B 1TCUA 1J97A 1VL0A 1ETHA 1C7ZA 1ODFA 2LCFA 2NU6A 1F3LA 2IYLD 4LHXA 4WCFC 2C5HA 2PWPA 2HF9A 3GZNB 3NDRA 4Y6RA 4E31A 1SIUA 4ZOEA 5IMBA 1W4ZA 4L15A 1US8A 1DTWB 2OORC 4H08A 3BD8A 1H65A 4PX9A 3USES 1EHCA 4TRRA 4JQYA 3LHSA 3PGMA 3JXEA 5B3LA 1GARA 2CJWA 5KYNA 2QYSA 4LCJA 5JADA 1I2MA 5DFAA 1L5NA 4LYFA 3K92A 4HF7A 4JJFA 5KDDA 3WGZA 1CU1A 2O59A 4BP3A 2W6IA 4ALMA 3ZWQA 4JA2A 1E18A 1YRAA 2EEZA 4RTNA 3NIWA 2TMYA 3FNRA 2BBTA 5TSDA 4E7OA 5BRNA 1AUQA 1H6CA 5IBPA 1I6WA 1Z74A 3U39A 1JR6A 1V35A 4OXRA 4REQA 4YHHB 3GVHA 1CW2B 2MSNA 5EJMA 4A2PA 3KKPA 5IYZB 4CR6A 5EVJA 3N5CA 4AB1A 5GINE 2YV4A 1UWCA 2X22A 2Y1DA 2G04A 3L43A 1JG4A 3HA5A 4HFNA 4N3BA 4QPNA 1YZKA 3TTSA 4C7XA 4ZCTA 3A14A 5K3BA 3AKYA 1A7AA 1Q83A 4WNYA 4YYZA 3CG0A 2UAGA 3BBLA 1GLGA 3G0BA 3N2EA 2FPGA 3PDUA 4A27A 5F35A 4Z54A 4EHJA 2HI0A 1J23A 3I5UA 3ZDXB 4DQKA 3A4LA 3E9EA 4BQOA 4GNRA 1IOVA 1R0LA 2DFTA 1AA9A 1K8RA 3I28A 2V4ZA 4MS4A 4BZXA 1NKSA 2AJDA 1O8BA 2J9RA 2O2CA 5DRYA 2OBXA 3NOOA 5TPZA 3SHQA 2PYIA 5JOQA 3MS2A 3K4PA 4QASA 3RSOA 1N6NA 3MYRA 5KBYA 4CL0A 5ICMA 4EF5A 1E1MA 3BFJA 2RHLA 4DNPA 3QEBZ 3G59A 1B00A 2CV0A 3Q12A 4V38A 1WXQA 3ZWVA 3U7JA 5CFPA 3EF3A 4B3DA 3EXG2 3AKZA 3RRNA 3WRWA 1AQNA 1L7EA 4R6XA 2VDWB 4RX1A 1KMNA 1W52X 3TOCA 2CFSA 2IPNA 3PXUA 4CKEA 1EP3B 2DFDA 1G8GA 1U2DA 2FPXA 1F06A 1W88A 3BFXA 1QHYA 1QCDA 1KU0A 2VWQA 4FQ7A 2J9XB 1II0A 2V6GA 3MCVA 4F8YA 4TS4A 4ZVKA 3LYUA 4YRLA 2O8EB 4XXHA 1ODCA 3REFA 1QRDA 3FA2A 4MRVA 3E5NA 5A4AA 2X41A 2XVZA 3T35A 4PG6A 5IUNC 1TB4A 4DR1B 3PCTA 4PO3X 3KOXA 2ZUVA 1SVWA 1OTXA 1VECA 2PZKA 3B89A 3DG9A 2XCLA 1G3MA 3PUHA 4YO7A 3U7EB 5IVIA 1L7RA 2JFBA 1SPXA 4UPDA 4X7BA 1JR2A 4I50A 1MJNA 3EGCA 4JI3B 3CLTC 2ATIA 3FGPA 3CSSA 3FBGA 3H1TA 4UD2A 1TTHA 1XRLA 4RVFA 4ZZ2A 2GD1O 3Q9LA 2FOXA 2C31A 2YYYA 4NYIQ 5JDIA 4JI1B 4KXNA 1XJCA 2XYQA 3P8ZA 5KTNA 3FPBA 1NHGA 4OX9B 2GWHA 1NFQA 4IKEA 1ES9A 3VZCA 1DKRA 1FMCA 3LUKA 4BX2A 2GEFA 3ICVA 1D04A 1JKMA 5D3ZA 1U28C 2RG7A 3CZ5A 3PYMA 2ATEA 4ZGWA 1Y1PA 2CGEA 1DBVO 3MBIA 2FDRA 5NULA 3IDOA 4JLPA 5KIAA 1UXJA 2I7CA 2J09A 4LWZA 1USUA 1Q0TA 4G0QA 2C4HA 2QW0X 1IY1A 2RH4A 3MAAC 2ASVA 4D5GA 3S68A 4WMLA 3HU1A 4ZANA 4BU1A 4EG0A 1S01A 3PXDA 1OOEA 2OFFA 4OHBA 3FMGA 2VT3A 3LT2A 2JL1A 4MW5A 5LYJB 1LSOA 1GPLA 1FE8A 3EEFA 4N0PA 1HOTA 3G5AA 1AZSC 1C9YA 4HWGA 1XEXA 1GCOA 4Q3LA 3WRXA 5LQRA 1YKGA 5ALJA 1ULZA 3ZI0A 1AGYA 4GSYA 4BFXA 5I7SA 2X42A 1OWPA 2A58A 2P3SA 3K6KA 1GZ5A 3OZVA 1MPXA 2BFEA 4D81A 4ENVA 1W19A 3E05A 3CX8A 3LWNA 1RQ7A 5HIMA 1CR0A 5AJWA 3V97A 5CAEB 1DAIA 2XUAA 3ZUGA 4E51A 1CHDA 5T5QA 2YX1A 2ZLBA 4G0PA 1ZNQO 3VC3A 4CBVA 2FPKA 3R9WA 4PX2A 4X20B 4AURA 2JGNA 4OK5A 3COJA 5FJIA 3E82A 4DA6A 3T9AA 5JCZA 2IUEA 3KOYA 3FCYA 1GU1A 4TMXA 1V11A 3WRXC 3MYYA 3PA6A 2O6HA 1E0KA 5DH9A 2L69A 4TWBA 3N2GA 5EXXA 3HCOA 1BVYF 1TIKA 3EGDA 3ETDA 1VTKA 1O95D 1J56A 5KU7A 2QV7A 3DMRA 2NNWB 3D4IA 4DOMA 1WMSA 1SO8A 3L7JA 4S2EA 2BR4A 4ZVSA 4IYRA 3UAVA 2AX4A 3HCNA 3N2LA 3EQ9A 4GO1A 2D62A 4PQFA 4Q1VA 5LQAA 3Q8KA 1NVGA 1QQ5A 3FBWA 1PKXA 3IKMB 3ZWPA 1BRMA 3HBLA 2BGKA 1KIAA 2FQQA 5SY4A 1NY5A 1ZJZA 1PWYE 1VMEA 3KLNA 4P3PA 3QLTA 3C39A 1YE5A 2NUBA 3L7NA 1P7WA 1YDEA 2JHCA 3VR6H 1NIPA 1Q7EA 1OAOA 4OQYA 2IEDA 1Z6PA 4X6LA 2FUKA 2PZAA 5JEDA 3I62A 4LRUA 3SCZA 3T9EA 4CV2A 3VR6A 3WA7A 3X43A 4G5OA 1QRUA 3KWFA 3VH3A 2E82A 1PJSA 1ADGA 2LDBA 3HEAA 3SE0A 4CEIA 2OZLA 1G8YA 3NVDA 1H4VB 2D0IA 4G67A 3TNDA 3SP1A 1GPJA 1XRMA 1QQ6A 2IC5A 2RGNA 2WB4A 4X1KA 3VKUA 1R64A 1Y9ZA 2CUKA 2ZETA 3HB1A 4X90A 5HKLA 1M66A 2CNLA 2RC5A 1A72A 3OPYI 4RD6A 3GRVA 3QY9A 4E6EA 2VBIA 4EKYA 1XMOB 1K6XA 2AFIA 3AIMA 4DXAA 2J9FB 2JIPA 3KDSE 4M7WA 4HX2A 1CUBA 2W43A 5B6JA 1CKEA 1WUYA 4KQ9A 3FCSB 1RAFA 1TT5A 3GJ8A 5DMXA 1UBEA 4FJ1A 5G02A 3EBOA 4MRSA 4KXMA 1S3FA 4A8JA 2GN1A 3T8YA 1T3HA 4TL8A 4OLJA 4PAQA 4N7MA 4R1QA 3TMAA 3KBOA 1HR0B 5JATA 2I7XA 1NDQA 4TTIA 3ESDA 1H85A 1L1QA 1FJ2A 2GT1A 2I1LA 2HRRA 3PC3A 1N2HA 2C95A 5SZJA 4BVFA 4NDNE 5E8RA 5ALVA 2RGYA 3OZIA 3R3UA 1MVLA 5TIIA 2GSWA 2EOAA 3PIDA 4HBGA 1ZC3A 2F64A 4J7AA 4AN1A 5H4HA 1GYRA 4FQ8A 3BCSA 1I2AA 2CXOA 2PIDA 5KQMA 3E2IA 2ZITA 3MEQA 2QTGA 1J20A 1NQUA 1Q6ZA 2NV6A 3EOBI 2Z8YM 1Z6QA 2FMXA 4LG1A 2EP8A 1T9DA 2VXOA 2ZCJA 5J4YA 4AMBA 2VPWA 3MB8A 4EFKA 4JT4A 5ANRB 1Y7PA 2AMVA 3KO8A 2JBAB 4G0XA 4L95C 5L4NA 4I4TB 3E81A 4Y2XA 5L95A 1DZIA 1UADA 2BSQA 1OV6A 1XRSB 4ISCA 3UUGA 1B0ZA 2NOAA 5GZ6A 2OCXA 1SC9A 1W4LA 4XDZA 2QTAA 1WOYA 1JDVA 2A5FA 5KHLB 2PKEA 1QZTA 3RBXA 1YQTA 3BS4A 3GV0A 1R18A 2BKAA 3AL2A 3HRKA 3INNA 1MQAA 1IZ8A 1GA4A 3UGJA 1UT8A 3HP4A 5FKJA 3TLBA 2HLNA 2GO7A 3QX7A 4L75A 4ER3A 3R7WB 3H5NA 3ZYZA 3EODA 2AYXA 3WRVA 3LO8A 5DT2A 1L1FA 2QP4A 3I0ZA 4NEHB 2AG1A 2Q8PA 1JQ5A 4E3ZA 3EIWA 3A9WA 3WYAA 2X13A 3AIIA 2CHGA 1YIOA 2XJ9A 5IN5A 1WRBA 1Q22A 4WESB 5HJ5A 3UMMA 2Q3MA 4XWTA 2DRIA 1NF3A 1U2GA 1N6IA 3ZNQA 5LMCA 3AP3A 4DEVA 2FPGB 4WCFA 4UVIA 5I7AA 4BBAA 1OBOA 2FFHA 3E4CA 3QYFA 2IT1A 4IGIA 1C50A 2OHGA 3DE5X 3O95A 3QBDA 2EL7A 3AF1A 3W1EA 3CLRD 3OO1A 2I34A 5K4AA 4D44A 2P65A 2UYGA 1M0SA 1M2WA 1NV8A 4DYHA 1HNWB 2JK0A 4I9UA 4MWGA 2AT1A 2GEBA 4KAAA 3KQPA 1F17A 1UAAA 1G8SA 2EF0A 2A86A 4X94A 3ZVKA 3K3PA 3CX7A 3EA5A 5JNLA 1HTBA 2Z3ZA 1ZA2A 3OF3A 4JKIA 2FWPA 2CLKB 3EQ2A 1L4MA 4O0LA 3A3KA 1LX7A 2HBRA 2J3JA 1NUQA 2B83A 2BRUC 3PJGA 4LSMA 4MUMA 2Q41A 2RHRA 4JJ4A 3DKKA 2BP7B 3F1KA 4XD7A 1ZVKA 2R84A 1QHSA 2IVZA 1NI3A 3CNLA 3GRUA 3VPCA 4YR9A 4PE5B 1IBMB 4CEIB 4ONEA 4PC6A 1O94A 3VAAA 2OCYC 3FSJX 1CS4C 4RTKA 4N82A 1ZH8A 3I2HA 5EE5B 4IVPA 3CXRA 1OIWA 1FUEA 4P3OA 3ED1A 2O1EA 1ANKA 1V16B 1JHPA 1VRWA 4PICA 4XWGA 2BN4A 2VUSA 3C97A 2N42A 1NDUA 1NJFA 2GLUA 3QX3A 4KQ6A 1QOQB 2CN1A 4ZDJA 5KYYB 2WNSA 1FTQA 1SCUB 3DBVO 1JEYA 5LIPA 3KT0A 3VUEA 4BY9E 3VHLB 3L0YA 3RTGA 3UJPA 3DOCA 3EVCA 1Q77A 3O92A 4K81B 3VR0A 5K3OA 16PKA 4MR9B 1FX0B 2YJ5A 4DDUA 3AKEA 3MQ4A 1V3UA 2Q2OA 4P53A 3T0GA 1B2RA 5M7EA 1OLSA 5MN4A 3I8XA 1EDBA 3SLKA 3QVVA 5LXTB 1VHDA 4JYAB 2EGHA 3ZXSA 2RGNC 4UEQA 3PV0A 1GTRA 2SCUA 4D9GA 4DGQA 4CQLB 4U5XA 3OOSA 5E1OA 1QV9A 4DSZA 5GMOA 5A6SA 3L6OO 1QGZA 2H1FA 1QG0A 3HM2A 1LDGA 2WIDA 1S2LA 3GO4A 221PA 4UNPA 5IZ4A 1GRNA 2VPQA 4FDTA 4DCNA 4NYIR 4P81A 4B5KA 4F04A 1ZCJA 4LC0A 4A15A 4WESA 3DDSA 3EUWA 4YAJA 2A7XA 1UANA 1BNCA 2BGUA 1ZN8A 1ZVJA 3FKSA 4HNAB 4IDCA 1BEZA 2FZGA 4JCCA 1VM6A 5H68A 2VDPB 3SX4A 1ORIA 2ODAA 3MHPA 1P2UA 3C7DB 3HCDA 1F8UA 4IIVA 5GJWC 3UJ8A 4C4RA 4HZUB 1WSBA 1KEEB 1KK1A 1OTYA 3L01A 4HNRA 2A1IA 4CDRA 1USVA 3DZJA 1P4JA 5IASA 2P9HA 2R4TA 3SGLA 3EY9A 2BMWA 2FZVA 5LC1A 4D3FA 4EMUA 4IAOA 3R7LA 3WO1A 4GZ5A 2RGAA 4BWVA 2BEKA 1EIWA 3KZXA 1G2IA 3Q40A 1M2GA 1KHHA 3TB4A 4BECA 3LVBA 4QXOA 2BH2A 1O3YA 2X58A 4RF5A 1M8GA 2NM0A 2P9BA 3OM8A 5JJBA 4DJDC 2XMBA 5FI3A 2VJYA 5COAA 3B5JA 1W2GA 4R5MA 4QOEA 4CLOB 1L7DA 3F6SA 5KDOA 3D2CA 1DCTA 4E2XA 2ZBFA 2GN6A 1JR3E 3OHSX 5AVRA 2O0JA 1ODTC 4WCDA 1Y4DE 2YHIB 3SKXA 1IQRA 2P62A 1KXJA 4MV7A 2J07A 5LQNA 2Z8XA 4LDJA 1E9VA 1HE3A 1VA4A 1UJ2A 3EN0A 1HLFA 4JSRA 3CH5A 3QUQA 1E8MA 5U4XA 4BFYA 4CLRB 2C98A 3W9YA 2XBLA 4HWRA 1MDBA 2ZBDA 1C9MA 4DYVA 5HDBB 2XRYA 3LF1A 4PS1A 4JMLA 5ECWA 2SBTA 3DAYA 3HNPA 4S2UA 4E1BA 3FTEA 4JVOA 1TD1A 5EJAA 1BG6A 2OM2A 5KQSA 4O6VA 3M4XA 1I7LA 4HQ6A 4CV1A 3R44A 4DCCA 5IWCA 1Z68A 3OETA 2P1ZA 3WB9A 2FF5A 4Q3EA 3D64A 1RIIA 2AH5A 2BTOA 3KKOA 4U39A 3SXUB 3T3IA 1V4NA 4C87A 1QHGA 3LX8A 2J9FA 4EM6A 3U2QA 1JQAA 3B70A 1TDJA 4L4SA 2XVAA 621PA 3L8GA 4QOIA 3PEFA 1GFZA 3QKIA 1M2HA 2GJ4A 3NH6A 1LDMA 1KMHB 4KQJA 3SEZA 5A4JA 4OHKA 4D9HA 2O0MA 1PL6A 4BKUA 4BAUA 2W6CX 4FR5A 4W9MC 2VAWA 2J4DA 3S3TA 2H08A 3ORSA 2X0KA 3TPFA 2P69A 2Q3LA 4RTPA 3I09A 3ZCRA 2H5LA 1JYFA 4PO9A 4RQUA 2AUNA 1KBQA 1YR2A 1P6UA 1E89A 3KCQA 2RI0A 4ZYXA 3PNVA 1FJHA 3CC8A 4ZCMA 3NJRA 4JU8A 4E12A 3X1KA 3PUKA 3FWNA 2OV6A 3OA0A 1KOGA 2Y0CA 3EXHC 1C7QA 3MS7A 2MCFA 2NUTB 4UE2A 4CF4A 2QYTA 5JJCA 2GHQA 4C6SA 1L4HA 3VYUB 4EFNA 2VZ8A 3IT1A 3ZY2A 5EIHA 1KGDA 1XF9A 1M2VB 1RW4A 2GTPA 2LBPA 3SC6A 4RDIA 4C01A 2ISCA 3BIJA 1L5HB 1QIGA 3MFYA 3ZH2A 3HO1A 3OU6A 3WYBA 3ZI4A 1D7OA 1FFHA 3FDFA 4A0QA 2ZSEA 2Y99A 4J9UE 4D9JA 7REQB 4G0UA 4R0VA 1TX4B 2I1WA 2D5BA 1ITZA 3IUNA 3G1WA 3KV1A 3P32A 5DMHA 3AEQA 3PNBA 1UEXC 1VGRA 1YOBA 3D5TA 4NATA 4BMSA 3QYPA 3K70D 1NUTA 4MDFA 1IG0A 4JQZA 5KX5A 2GBPA 4ZU3A 4ECAA 4INAA 3ORRA 5FUWA 4TRMA 4YCMA 2J3HA 3KXIA 3U9SA 1OGIA 2P9CA 1R4NA 3G17A 4ZZ1A 1ML4A 1LS1A 4NRDA 1Q3TA 1UXGA 1PT8A 2JGJA 1N3YA 3FYUA 4ZT7A 4GLLA 5CXXA 1OLUB 2PUWA 3O9ZA 1D7AA 3EIEA 2V9ZA 4IH4A 4M1WA 4Q4AB 3UWDA 3JQAB 4D9BA 1XZFA 2MINB 3CZ9A 3LC1O 3PHJA 4DXDA 3SR3A 3PDWA 4EB0A 2ZWMA 4FYPA 2YXDA 3IV9A 4BZWA 3O6VA 2OQVA 1O08A 1ZW6A 1K3FA 1TZCA 4GP7A 2HMTA 1O5OA 4DMUB 4Q15A 3FNIA 2EIHA 4URYR 4UPEA 3PFCA 4QBIA 3EWIA 1E2IA 4G63A 1KEWA 4FNMA 4UU0A 3WLNA 5T6BA 3LRTA 2DOKA 4E0BA 4MUJA 1EEXB 3FI0A 3WGLA 2WW8A 2E4VA 1IHYA 2B8EA 1W9HA 5I8ZA 4R41A 4B3SB 4KVAA 1LZKA 1Z2EA 4A26A 4AJ9A 4HSEA 4BBJA 4S1NA 4EHNA 2FR8C 3DMNA 5FCDA 3VPBA 1B26A 3NHUA 4BVHA 3AHHA 4F60A 2FN7A 3ZJYA 1E1LA 1VFPA 2K2QB 5CXSA 1NA5A 1CZHA 4GPBA 1CVRA 1TM4E 4GC9A 5IF9A 1IPHA 5EMMA 5F7JA 1M3SA 1NQVA 1W1IA 4J0DA 1Z62A 4U2CA 1TLTA 2BFDA 5K8JB 5CGQB 4D8XA 1M6HA 4JB0A 1FYWA 3I45A 2ZUFA 3AVWA 2Q5LA 1QE0A 2IXGA 3AF3A 4B87A 3M1YA 2AOXA 5AVKA 1Q7GA 1VLJA 1YKFA 3EULA 2GAFA 4UD6A 2AOUB 2GS9A 3RHZA 5CA1A 1U9JA 1OH6A 4YCSA 1MC4A 1XQXA 5AW0A 5UKDA 2UVPB 4LBWA 1N1GA 1TW2A 5GONF 2WAXA 4B48A 2IIPA 2W22A 5LLTA 3C14C 1TADA 3A1NA 3ZTYA 2A6PA 2AD1A 3CU5A 5CFOA 1Z7YA 4H6PA 4HQOA 3CUEF 4X20A 1E1RA 1EWTA 1ZNWA 2VYCA 4AU1A 4CM9A 5K5EA 2B20A 1G9SA 3FRJA 4BTLA 4JOCA 1CJKC 4GOND 4YB8A 3FW1A 4HYTA 5C8YA 4AMZA 4MQ5A 5JC1A 3U4HA 3H2GA 1NP3A 3L7DA 4KKVA 2GTIA 3F6RA 1ZRNA 2B25A 4QHTA 1YA4A 4Y2SA 4ITUA 1LVGA 4C07A 1VIMA 1OIXA 4D97A 1EESA 1IEQA 2G1PA 3D3WB 5CD9A 1U8AA 2NTYC 1HYGA 1C0EA 4PINA 1Y5LA 4XWOA 4J3JA 5IAGA 2NU9B 1ODKA 3D0OA 3C1UA 4OHOA 2VHJA 4EK9A 7REQA 5FAXA 4Z0NA 3WLQA 4OLAA 2PT7A 4YH1A 3BM5A 3N39C 1QHXA 2EATA 3W77A 4RWZA 2J59A 1QU3A 3W4JA 1BQ3A 4DNOA 1D8TA 5KOJB 1MBZA 2AFIE 3IUPA 2C7OA 2FWIA 4IIJF 5HILA 1ORWA 1C8LA 2W6JD 2UYCA 1KAGA 2JRLA 2O2YA 4AECA 3L0DA 1Z4JA 1KI8A 1XTBA 1M1ZA 3HC7A 1L5OA 3FKQA 4OBBA 4HS9A 4RD1A 4W9NC 4EY6A 4YMGA 5DHAA 4RPIA 1DP4A 4BNJA 1R6UA 3PSHA 3H8JA 1VE9A 2C3PA 1CYDA 2DUUA 3LK7A 3PQ8A 1CJMA 4G01B 4UQPA 4ZOAA 3ONDA 2EX1A 5JJLA 1MRNA 1YULA 4X62B 2XD9A 3E18A 1QVWA 5DHPA 4HDKB 5A04A 3IMCA 1ZJ6A 4QOFA 1RFLA 5TVGA 3UW3A 1NYLA 4QSHA 3HZZA 5G4KA 4CMEC 4WHMA 3AETA 2C97A 1RCTE 1FDSA 4RCYA 1Y82A 1I3NA 1WMEA 4NYMQ 2OXIA 2IYQA 2HK6A 4PBSA 4MK4A 1W34A 1VIAA 1JKJA 3QE3A 2BDUA 3NWPA 3PK0A 4FFWA 5E4TA 2QLBA 4PW0A 5EFOA 5IJAA 2IDJA 3FROA 2FXVA 4PZZA 2VNJA 2CVQA 3PSAA 1DBPA 2WMYA 1N0IA 3UAOA 3RFCA 2DPLA 5AI6A 5FLKA 1JHQA 4BNKA 4G2NA 2L0XA 1CUCA 1VE1A 2OZPA 4L9RA 4PXSA 2G63A 2AYZA 1YAJA 2H0RA 2DP4E 4DILA 1NIJA 2MJLA 1TZKA 4YDRA 2PWAA 4EG5A 3OIFA 4EQZA 3IOMA 5AXBA 3OOHA 3UXHA 1Y9AA 4M1ZA 2UVQA 3DW3X 4O4LA 1O77A 1Z06A 5FPPA 4O3MA 2PXHA 2YASA 3SIXA 3HLTA 5TQVA 4EOGA 1QIKA 2JI9A 1CUSA 2P0AA 1EHYA 1H2XA 2PAFA 3B13B 1PYGA 1KA9H 1IY8A 1P1HA 2COUA 2VDOB 4RA9B 3VI4B 3LZCA 2I3AA 2DBQA 3NFRA 3ICWA 3ZD9A 2H11A 4K8RB 1A8QA 4NH4A 4ILEA 1T8PA 2XSZA 4Q93A 3FOBA 3OEWA 1QLJA 4RHYA 2NTVA 1M7BA 4JX8A 4LOKA 2NZVG 2O7VA 3Q1LA 4GU5A 1NR1A 1GNRA 3JQGB 1QHFA 2IWRA 3R7BA 4F84A 5IWAB 2Q9UA 2MMGA 3DHVA 3JU3A 1VCHA 4FYKA 1IQ0A 4HNHA 3BJMA 4K3VA 4M8KA 4B6PA 3RS8A 4HN2A 4BNDB 1O4WA 2HXGA 4MQUA 1YZUA 3EFOA 2OVFA 1LRLA 3OTIA 4OMCA 4EPTA 3AVTA 3NPMA 1GUBA 2OE2A 2NSJA 3COPA 1ZLXA 4UXJA 3ILSA 4KGVA 3L7IA 4JCOA 4CL3A 3F6CA 1AMUA 5DCYA 3AFMA 2JFGA 4BE7B 4AROA 2DJIA 3B3FA 2NT4A 1FZTA 1E5LA 4WQMA 1ZM3A 4B3TB 1LPSA 4GDMA 2R79A 1E9DA 1U6IA 4JWTA 4LWOA 1VMDA 4IWYA 4UTNA 3OVMA 2BHTA 4TZ6A 1OILA 1QFMA 3KQVA 3ORYA 5GJVC 3MF4A 4B40A 4ZI7B 3K6SB 3Q87B 2UUOA