4JWKA

Crystal structure of the complex of peptidyl-trna hydrolase from acinetobacter baumannii with cytidine at 1.87 a resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
193
structure length
193
Chain Sequence
MSNISLIVGLGNPGSEYAQTRHNAGFWFVEQLADKYGITLKNDPKFHGISGRGNIEGHDVRLLLPMTYMNRSGQSVVPFSKFYQIAPEAILIAHDELDMNPGVIRLKTGGGHGGHNGLRDIVPHIGPNFHRLRIGIGHPGSKERVSGHVLGKAPSNEQSLMDGAIDHALSKVKLLVQGQVPQAMNQINAYKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Peptidyl-tRNA hydrolase
publication title The Mode of Inhibitor Binding to Peptidyl-tRNA Hydrolase: Binding Studies and Structure Determination of Unbound and Bound Peptidyl-tRNA Hydrolase from Acinetobacter baumannii
pubmed doi rcsb
source organism Acinetobacter baumannii atcc 19606 = cip 70.34
total genus 61
structure length 193
sequence length 193
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2013-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 4jwkA00
3V2IA 4DJJA 3NEAA 2MJLA 2JRCA 4JX9A 4OLJA 4JC4A 4QT4A 5IVPA 4ZXPA 3TD2A 3KJZA 1RYMA 4IKOA 4Z86A 3OFVA 3VJRA 2NAFA 4FYJA 4FNOA 2Z2IA 4QAJA 5EKTA 4HOYA 2Z2KA 5IMBA 4FOTA 3TCNA 4DHWA 4ERXA 4JWKA 4QD3A 3P2JA 2PTHA 4JY7A 3TD6A 3KK0A 4YLYA 4FOPA 1RYNA 3TCKA 2LGJA 1RYBA 5B6JA 5IKEA 4LWQA 2Z2JA 4P7BA 4QBKA
chains in the Genus database with same CATH superfamily
1Z6PA 4I4NA 1MB4A 4EPXA 5EJ7A 5JCOC 3VBCA 3JQ7A 1EWRA 1YZNA 2IP2A 4JJFA 4NYIR 3CZAA 3LHIA 1FK8A 3OQIB 3LQ4A 3PC3A 4MROA 1RBZA 4I4LA 4KDEA 2LKDA 2BAGA 3J7TA 1WZEA 2UUPA 4N5HX 2X5XA 1IFXA 1R6VA 3IAFA 5FLXA 1K0FA 2P3QA 2DHEA 2VUIB 3QM1A 2R11A 4BWVA 1XYVA 3RTDA 2H11A 3SQWA 3U7JA 2NUAB 3PJEA 4QO7A 4JBHA 5KJFA 3EBPA 1ST2A 3SHQA 3D8BA 4DIDA 1FJHA 2PAFA 3RVNA 4I1YA 5IP5A 1WWKA 3HSKA 4CTMA 1K66A 2YZGA 4QA9A 3TIXB 1G8GA 2ZJOA 4LXYA 1C29B 1KP2A 5F3DA 2QJFA 5THXA 4JC4A 1J8MF 3NBMA 4TS3A 1XKQA 1ZHFA 2UZ0A 4QOJA 5K8LA 1J09A 1JLKA 2GFIA 5FOWA 1H6DA 1HLFA 5FDFA 1J49A 4R7GA 3BHNA 2J3LA 1MO2A 4GT1A 3T5CA 3VH3A 3WLSA 4Z3DA 4KNYA 3BORA 5A6SA 2FPLA 2QENA 4YMUA 2NXNA 1D8TA 2VKQA 3E2MA 2ORED 4GSLA 3BUSA 2C2BA 3WICA 1CY0A 3IE0A 2Q6IA 4GZMA 1HO3A 3BGIA 4CNBA 1Z88A 4XW2A 4UBKA 1GVNB 1H1LB 1CXZA 2PKQP 2WJHA 1GA6A 1VZ3A 1D2RA 1H4VB 1M54A 1MB0A 1J8VA 3OMLA 4A8PA 1W76A 2QLNA 3CZ5A 2B0CA 2G5TA 3K71B 1AQYA 5ALXA 1L4KA 1S89A 1EK6A 2PWBA 1P3Y1 1R16A 3E8XA 3PA6A 1U0RA 4LJLA 1UL1X 2HA0A 1MCZA 2PH3A 3CLUC 2WSSD 1UMDA 4J0EA 1WY7A 3WL6A 2G67A 2XF8A 3N1UA 4RTPA 1G66A 1RXUA 1SVNA 4RQAA 3RUEA 2FF7A 1SU7A 1J56A 5LP6C 1DT5A 3E15A 1MIOA 5MN4A 1NI4B 1U0GA 4KIGA 5DGXA 2C7OA 5IUKC 2AEFA 2A5YB 4EPYA 2JFFA 3JZAA 1KMHA 2R3SA 3CWZA 3TL6A 3WTBA 3D1JA 3GLHA 5KHOC 3ETLA 4MV6A 4N40A 4WADA 1MGOA 1IN5A 5LR6A 4I6JA 1GZ7A 3V1KA 3DKIA 2WABA 5TJ9A 2J30A 4Q66C 1G18A 5HOQA 1NX9A 3FDFA 1POXA 4BO1A 4C7KA 5A02A 1B8OA 3AGQA 3K20A 1JDJA 3B9PA 3QVXA 1O0BA 1BMFA 2EZUA 2J0QA 1GCGA 5EL0A 2EYUA 1EK1A 2O0JA 3RU3A 4B5KA 5AM3A 3NHRA 3L49A 3T3EA 4NU8X 1E5VA 4A0FA 1RKBA 4R1LA 1DKRA 1U9IA 1KJNA 3OX1A 4X3OA 2DETA 4MWEA 2AG1A 1EWVA 1NBHA 2Z43A 1E2HA 3CZPA 1A8SA 3HY6A 3N0VA 1SN7A 4JWKA 5IC6A 3GJTA 4H1HA 4PXSA 5IN5A 1GAEO 1RHUA 5WRFA 3TDNA 2CLHB 3UK0A 5AKLA 1P1FA 2HV8A 2G9UA 3OC6A 2ZT6A 3BXPA 1QX3A 3AEQA 2EX1A 5AKXA 5E3JA 5LQSA 5B36A 4S04A 4LF8B 1YAJA 1A9OA 2PJDA 2XADA 3TE7A 2VRCD 1HZZA 3HZOA 3KR9A 4U7PB 4RF3A 3ONDA 3G7UA 2ZATA 4OHBA 4BP8A 4EVQA 1ULSA 3VA7A 3WMEA 2H6EA 4PIMA 2EF0A 2H00A 3SJ7A 1IDOA 3LLSA 3Q3VA 3U56A 1Y4DE 1T4DA 2DU8A 3M82A 5DKFA 1VRCA 2GZHA 3GIDA 4ZD6A 2A86A 2WD7A 5G1NA 4E32A 2V03A 9LDBA 2OM6A 3GNTA 1KI6A 2XITA 4EF4A 1HQDA 3KV1A 1VG8A 4DV5B 2V7QA 3S55A 3KETA 1CJTC 3I6BA 1GPUA 2OYCA 4XB2A 3SK0A 1F0YA 3LX4A 1PFQA 1KEZA 4JMPA 2X15A 5TT0A 2OO5A 4KFCA 1HWYA 2E4WA 1E1QD 1PL7A 4ADSG 1L8XA 4DT1A 1IONA 3LC2O 4ARBA 1JRLA 1OWNA 4H3SA 1S5PA 1Q12A 3F6EX 3K4HA 1BVYF 1OH5A 2WYUA 3UT6A 2OGZA 1FMLA 4GXQA 1I6WA 4KV9A 4BQPA 1G5QA 4BCBA 4C4YA 2QK4A 3L0PA 1G38A 1J5PA 3ICVA 3FOCA 5LDGA 1QFXA 4YR7A 2QTVB 4K1XA 4A73A 2ZU6A 1QLJA 1XC7A 2Q1TA 3L05A 4IQFA 3KUKA 2Q5JA 4N5LA 3TLGB 2BGJA 3VPBA 3PXGA 1PT7A 4CTJA 4IMIB 2ARKA 1WB9A 4AO8A 4C4RA 1OC2A 5DYGA 3UB3A 3GEBA 4AJIA 3IIKA 1S96A 2O20A 3PL5A 4AUEA 4BMZA 2FW7A 3PV0A 4I99A 4JQYA 2HSWA 1CE8A 3GG2A 4OP1A 3RSFA 3U3JA 5CYGA 1U3TA 4M49A 1KMMA 2O0LA 3LUHA 5DM0A 1WRBA 1LV8A 4HR7A 4JBGA 4CCWA 1B6SA 2P7IA 3OZEA 2IUTA 1E7WA 4NE9A 5I7UA 3RS4A 1Z75A 1AQUA 2BGWA 4JYCA 1J23A 4U3JB 3LUDA 3O26A 1N1MA 2BF7A 3CX4A 4FFBA 5DSTA 5B4VA 2HDWA 1N7GA 1OTXA 1JU3A 3QFRA 5J4HA 3HH8A 2WWVD 2OXFA 2YIDA 3MFYA 4X61A 3B1XA 2WSSA 4OHYA 1NUPA 4IWNA 1F8GA 3B1KA 2R1ZA 2MMCA 1ENZA 4KC0A 4JBWA 4OL9A 2YYSA 4IF6A 5EWJB 2O8FA 1LF5A 3LM8A 4EG4A 3P7MA 3S1SA 2JI7A 3U4MA 1ULBA 1IVNA 2EL7A 2FRDC 4Z7QB 1O9GA 4FKZA 1U2TA 4L7QA 2YWFA 3PUIA 3OQVA 1KZHA 2Q1SA 1QP8A 3G2PA 1SCUB 4C4OA 4GVPA 3MVEA 2VRWA 5C3MA 3K9FC 4WFJA 3DFIA 2R65A 4FCWA 3EA0A 3H5NA 1QQ5A 4I1SA 4ZAWA 4BFUA 4XR9A 2EFYA 3BD7A 4H7DA 1H2AS 1WO8A 1XCLA 1X8LA 2C20A 3FZYA 4X94A 521PA 4R83A 5FUBA 5BR4A 5K3CA 4NMHA 3M6AA 4K87A 2FLVA 5ITZA 1ZEJA 2XUJA 3OKCA 4QFDA 1NDUA 1U81A 1ZVQA 2VJBA 4G6ZA 5G4KB 3WLTA 2WM2A 1W4CA 2TRSB 4WNYA 4A6DA 1Y3HA 4BE4A 1L3IA 1ZRNA 4TXLA 3MAGA 5AT1A 2A58A 2VBGA 5SZIA 2GGSA 1O6BA 2WF8A 4MVJF 5F35A 5JWHA 3C7CB 2Y4NA 3EIHA 3V8RA 4BQFA 3GF4A 1T2AA 3QMPA 3INYA 5GV8A 4A0QA 4IXNA 1EINA 4EYKA 4EJ2A 3VR6D 1OI4A 4JU8A 5HSGA 2O59A 3QEMA 2PL1A 3GUUA 4LPSA 2XQGA 4LCEA 1ST3A 3L92A 4C05A 2VRCA 1NSFA 1BMTA 4RW0A 3S44A 4C43A 3R8FA 1W5BA 1Z0IA 5B1HA 3ZWMA 1ISHA 3HBNA 2YHIA 3M9LA 3UPTA 3TZ6A 2VZ0A 5G4LA 5JU6A 3Q1KA 1H2EA 2GJAA 1M2JA 4I3FA 4JYMA 3GN1A 3ZCSA 1A5AB 3VAZA 5I4BA 3M89A 4JBIA 3IAEA 2C57A 2PVCA 2OC4A 2EFDB 5EUBA 3HKCA 3K72B 4Q1FA 1T15A 2G6BA 4IFIA 3VNVA 2VSXA 2JL1A 1N32B 3IPXA 3LNTA 4KDFA 5DM4A 2YWRA 1A5SB 2EQAA 2P9HA 3U31A 1GRQA 3E35A 3GA0A 1MKYA 3Q88A 4IGIA 3L0ZA 5C0OE 1E1QA 4EB0A 1K1EA 2GHQA 1IN7A 1ATIA 1UWLA 1VLVA 4YB8A 3LT5A 5IXSA 2QUZA 4LJRA 1YI0A 1ECGA 4DMCA 1O54A 1TU4A 2N3ZA 3Q0IA 4AJOA 1K7SN 4GM1A 2R0QC 4TROA 4NATA 2E37A 2ZKLA 4YVFA 3LUJA 5J4YA 1XDUA 3Q1LA 2FPXA 4YT2A 1WNTA 1TM5E 2CXQA 3RVKA 1E99A 1E5QA 4R3WA 5IWCA 2BYTA 2JI8A 1YMUA 2X0RA 1B0PA 2YC4C 2Z56A 3HXKA 2QROA 3KKOA 3PDCA 4G5XA 4L4XA 1B14A 2C9YA 2XB6A 2G0AA 1BEEA 3BA6A 5KYUA 3ZOZA 3DLAA 2R1VB 3A6HA 3K6KA 5JHGB 3THOA 3SJBA 3RR2A 4XTCS 3RANA 1OT3A 2EJWA 3K1ZA 4W9RA 1JXQA 3RG8A 1C3XA 1VDZA 2L19A 3CLUD 4HAYA 4Y6LA 1CF4A 5I9MA 3EQ9A 4IJKA 3ZH2A 4N9QA 2I33A 3KC2A 3V00A 2PUJA 5CDFE 2ZI9A 2VC2B 3MEQA 2HRCA 4HDRB 1KKMA 3R0QA 2X6RA 2MYPA 4Q1DA 4R2IA 1AE1A 5LFAA 2C7QA 2F3PA 1DWUA 1S2LA 3CVOA 2IHYA 5AVYA 1I7DA 1CETA 3WA6A 4EW1A 1NRIA 4EYOA 4HDKA 3R74A 2HEGA 2HZ7A 1UWCA 2HB6A 3WGVA 3MT0A 3O74A 3DBOB 1ETHA 2ZOSA 5F52A 2ZRNA 1XCGB 2XIQA 2YXPX 3KT3A 2J9GA 4PNEA 2GERA 4Y1FA 2FPGB 3OPYA 3SHWA 4HTAA 4LJSA 3DOHA 3KTAB 2BSQA 2WTEA 5EYPB 1N1EA 4IICA 3M4JA 5B1YA 3PC7A 1ZISA 4OJKA 4MRPA 2XE8A 4NECA 2CJXA 2A9QA 1UBTS 2IU3A 1E6KA 4QD3A 1Q0PA 2JVKA 4KK4A 4M1ZA 3T0FA 1RQ7A 3UTDA 3B13B 1A5ZA 5FPKA 1Y3FE 1SH7A 4RIIA 4N12A 1S0UA 4J4BA 2D0OB 4NCKA 3R9KA 4C0AC 5FR2A 4YREA 3UY4A 5AW1A 2JGAA 4XWGA 1LZKA 4N9WA 3MOIA 2JLXA 4H1TA 1EM8A 1KARA 1YRBA 5KQPA 4UULA 2BJVA 4E5MA 4KQGA 4M60A 1Y6QA 5JH7B 1N77A 1UEXC 4JI3B 5DHAA 2YINC 2BI7A 3PQCA 4HDQB 1D0IA 3P9PA 1NFQA 1DKPA 2CMDA 5CH5A 1IZ7A 5DIZA 4BU0A 1QVWA 2HA6A 4EG1A 1OLXA 1PTJC 2BMWA 3KQSA 3O1LA 3GX1A 5JLAA 5E95A 2FSIA 1F1BA 4ZMRA 4EHBA 1Q92A 3F8TA 1NFFA 3DONA 1IK6A 3I1JA 5JCOA 1RFLA 4QJ4A 3LPNA 1WM1A 2H0AA 4RJTA 3E3OA 1DQZA 2M2IA 2BR3A 2XRMA 3G3EA 2DZDA 3UB2A 3WMWA 1W5FA 3AIMA 4B32A 2IOFK 5AFSA 3CYFA 3GRAA 1P6QA 1CEXA 3VZPA 3B82A 5L8VA 2PGJA 1UOEA 3WGMA 8AT1A 1F3OA 2P0EA 4WUTA 2UXDB 2RI6A 1DDGA 5J1SB 1LJUA 1TI7A 3DE6X 3HP4A 2H08A 3KOUA 1Y6JA 9ATCA 3GJ8A 4AJ1A 2I2AA 3H2IA 3THWB 5JZMA 5EGNA 3E7WA 5JMOA 1GEEA 3LX6A 3S7ZA 4RD1A 3R4VA 3EXHA 3MBIA 1P4AA 3OKAA 4EBFA 3N70A 2JANA 1S2MA 5DDIP 1U7HA 2FN8A 3RUDA 1IQPA 4JQCA 2HWXA 4G5QA 4DV3B 1HMPA 1NUHA 4HAUA 1OGJA 4NV0A 1M2OB 3RTGA 2J9XB 3NCHA 3PFHA 3H9QA 4O2AF 1FVHA 1Z2EA 2DKOA 2XWJI 4Y2XA 2YVQA 4LYFA 3KT6A 4WGGA 5HIJA 3HCWA 2EJBA 2ZIVB 5CNJA 3RVMA 5IJ0A 1DELA 2PX2A 3SJCA 4BLWA 4CQMD 4MUKA 1G8MA 3PNPA 1RYYA 5JXJA 3EC1A 3IUEA 1W9MA 1W29A 2Q9UA 4PBTA 4D9BA 5JNVA 1T2CA 3EIFA 3ZHXA 4G0OA 3EXG2 1ZDMA 4G9GA 1NQVA 3OLZA 4MICA 2BMAA 5EG5A 2XUIA 4R0NA 3D6VA 2QVXX 3P2JA 1AOXA 1DAGA 1NLUA 2NTNA 4ZAVA 3B52X 4B83A 2HK6A 4MQUA 1W2WB 2P6PA 5TS2A 4LZPA 3LCVB 3PXEA 1W5EA 4DBLC 1L1QA 4EGQA 1THTA 1ZAKA 5LP6A 2XCTB 2GM3A 1M8GA 4R2JA 2UZAA 1BDBA 2PZMA 3R9XB 1TVKA 4KR6A 3NGLA 4DQLA 2X23A 1C5KA 3AVXA 2NP7A 2ONYA 5M34A 2RARA 2XOEA 4KVGA 1TNDA 2WQZA 3NXSA 4L08A 3IKLA 2F1KA 1Z25A 4DPKA 4CEHA 1GD1O 3I9OA 5FF9A 3UWKA 1CDOA 4L4YA 4FMDB 5JJBA 1S7CA 1YWGO 4HN9A 3ANLA 4BDTA 1M9NA 1GRRA 4HNHA 3B3AA 4Q6WA 2NZYA 4DLLA 3ABRB 1SCAA 1H8ED 2FFHA 1SXJB 4EFNA 3WRXC 2HRBA 1H05A 5ESDA 3RUIA 3WV4A 1LQ2A 3UNXA 3D31A 3X1WA 3TOCA 3CJQA 3ZIDA 4YRZA 3G0GA 4QYSA 2FEWB 5G0UA 3RADC 1XPRA 2OCGA 4G8BA 3HV2A 4XSGA 4WW0A 3D0RA 2IY9A 4RD3A 3AV0B 1KDZA 3DZDA 3EXIB 1M6YA 1VJCA 3DKPA 3N5KA 4UE6A 4O4HF 3ZXUB 3ZVMA 1PZHA 4UBLA 4YQYA 3WYCA 4WCFB 3VH2A 3ZZUA 1E4EB 1FA9A 1WR8A 1YVPA 1NULA 3OSZA 2Z0MA 4GOND 3WL3A 2JH9A 1OBCA 4FUTA 2XW6A 4Z8YA 2FUNB 3MS2A 3LUGA 4N7RA 3WDLA 3NYRA 3KDSE 2ZJAA 1OU4A 5KVQA 4NULA 3JY6A 4KEAA 4UHBA 3RM3A 1Y3DE 2BFEB 3GJRA 2DQ4A 4M0PA 5EZYB 1T43A 4DL9A 1IL0A 1SCDA 3UHOA 1P9LA 3NVKI 4KQ2A 3NHZA 1ULZA 4DJJA 1SKYE 4CG0A 4IX9A 6YASA 3AU8A 3H99A 3GJXC 3VNRA 2GEKA 3QWAA 1N9KA 5CX4A 2I5PO 4L4UA 3FYDA 3ZD8A 4F93B 3AF3A 2Z3WA 5LOVB 2BD0A 1JIIA 3LKDA 4I19A 4MUIA 5CX1B 3LT2A 5D51S 1TKAA 4X92A 5CLJA 1R9GA 3FUWA 3MZ0A 2DBYA 3P71T 4M89A 3SOZA 3UAWA 4F86A 2V6FA 2ZVJA 2XHEA 1JW9B 1S6YA 3LBAA 1DJPA 2CLDX 3M8KA 3OX4A 3W2GA 3WNBA 3IAUA 2XECA 2PCJA 1ES9A 3CH4B 4BWYA 3V4SA 4A92A 3WKBA 1B0ZA 1YASA 3CRVA 4JFAA 2XDAA 3U3ZA 3VV2A 1LDBA 1P7YA 1S2OA 1R4ZA 2FRXA 4C5AA 3WB0A 5DSXA 1P1RA 5JCPA 2DCUA 4DJDC 2XUPA 3JYLA 4WBNB 3AWDA 2HF9A 3OY2A 2GLXA 2DQZA 4GE3A 2XTMA 3N3AC 3DDUA 3OLXA 4Y8VA 3TIVA 4D9IA 4K0RA 3CVUA 5M2QA 1A8UA 5C4IA 3RI3A 5KVAA 1XMVA 2ZM6B 2CNLA 2GHTA 3RYIB 3AL3A 3F6CA 3C3DA 2AFHA 3A27A 1BKYA 1P5HA 1ZZEA 2LXNA 1RLMA 1N5OX 5L95A 3CUWA 1YFLA 4CQMA 1UC4B 2PX8A 1YCDA 2WTBA 2ETVA 2R7LA 5DMXA 2PUHA 4DRXA 4FNMA 1KZ6A 1OSNA 5HRCA 4EPTA 4P0TA 5AVSA 2IZ5A 3MIIA 2F90A 2VIIA 3GLHE 3VO2A 1KBQA 1XNGA 4YDQA 3TBHA 3GNSA 5I3CA 1FP7A 1ZCBA 3ND8A 3F6PA 3NJRA 2N9UA 1JG3A 1QE3A 2W2KB 2P9ZA 4QGGA 3BZUA 5CBPB 3RIHA 4YQFA 1T9CA 2HU8A 2CCGA 5CH8A 4KBGA 2JCYA 4DFDA 1YDHA 3RVSA 1QK4A 3WDSA 4GKKB 4F5YA 3A11A 5MDHA 2WYHA 4QU0A 2OP0A 1DU4A 3EFHA 2JG3A 4FE4A 2VK2A 4TM8A 2WNHA 1W6UA 2PUTA 2FRDA 2RHLA 5CVTA 4P5EA 1CUHA 2OECA 5IXJA 1NQ5A 2H2GA 4FYWA 3T52A 2YN4A 2AVNA 3OFJA 5JD6A 2FSFA 1JA1A 4ALIA 3QIAA 1DUIA 3ENVA 3NGXA 1E5XA 2CCKA 2YHAA 1O7JA 2O2XA 4D99A 3SP1A 1MMFB 1VI6A 2B5VA 4WLFA 1NTRA 1H8EA 4AMGA 1M1YB 4RV4A 1NP7A 2R9VA 3VMMA 3KSZO 2G70A 3NFRA 5FYQA 1KBOA 3A7EA 3GUHA 4ECAA 4GPZA 3T9FA 3IQZA 5HIAA 3T3DA 4GM4A 4Y2GA 1TA9A 1LI5A 2Y1GA 4FJ0A 3TR6A 2V98A 5BUZA 1GEGA 4DIMA 1XDZA 3PFGA 4LXXA 4UMFA 5ARCA 5JS1A 4MIEA 2DPHA 1Q50A 1FUEA 2ZRAA 5A04A 1MZVA 3O4RA 4RD4A 1SCQA 1MC1A 2B1IA 2FI1A 2XH8A 2IYFA 3C7DB 4I08A 3WYNA 4C0LA 4YP9A 2VJOA 3NUZA 4EF5A 1LFDB 5CD9A 2HMSA 2AI3A 1B15A 2BBWA 2C78A 1NMSA 2NU6A 4OQNA 4O4IA 3BGOS 1SBCA 2VRNA 3OMXA 3RKUA 5TPWB 3EGWA 4MB6A 2XUZA 2H52A 3KLOA 3CZMA 5I8ZA 2HC9A 1K6XA 4YK7A 4TV8F 1RWMA 1VG1A 2HRRA 3EZ7A 3W2TA 3E5NA 4YMTA 3DXZA 4DN6A 1T3ZA 3QYFA 1X87A 3BMOB 4C1BA 1ZICA 2YR0A 2VKTA 3HGMA 3P0IA 5D84A 4WCVA 3IUMA 2H5EA 2CLCX 3KAKA 2RGYA 3GGPA 1WOYA 1NC1A 1KJJA 1PEAA 2YHSA 5HE8A 3RVOA 1DWOA 3GH1A 3ZW9A 5K8JB 4M8NE 2PT7A 1HFKA 4FFSA 5KYXA 2NUPA 4CLDA 2NACA 4IOKA 3G49A 2AKYA 3PR1A 3EXEB 5BSGA 2EWWA 4RZUA 1JIQA 3IJ5A 1V1MA 2XYVA 4JLWA 3R7WB 2AG0A 3ZQ6A 1E8DA 1YJAA 3MHPA 3B36A 4RFSA 2PMWB 4IINA 3HUTA 1JBKA 2YYYA 1KAEA 4BNDB 1AQJA 2QPLA 4R8MA 5G40A 3FUXA 3FGZA 1ZBQA 5LJLA 1RD4A 1H8HD 1OLUA 1XZEA 2IXEA 1VPLA 1WZCA 1ZSNA 1E59A 1DBPA 1JTEA 2Q8PA 5TE9A 2BEUA 4PZUA 1Q1QA 4LHYA 2EKLA 1JA9A 1TO2E 1XTBA 2OHIA 4R9RA 5JD3A 3SHVA 3X0DA 2Y05A 4BWGA 3VZBA 1APBA 1QQTA 1W96A 2IH2A 2I3GA 3KQHA 5LYJA 4WDQA 2EGUA 1EWQA 1NQTA 3A4NA 1RRPA 2G1PA 3TB4A 2GZSA 1AQLA 1GGNA 4GDMA 5AI6A 1ZINA 4D9HA 3M6MD 4KVFA 5K8VA 1YCGA 4ZO9A 3THYB 1ISPA 1Q1AA 3G9XA 3IKVA 4G56A 4H4DA 1GL7A 2GCOB 5DNAA 1Z8DA 1M0TA 4I9UA 4B4OA 3ZIUA 4BASA 3DMGA 4B6FA 1GTRA 1RVV1 3V2GA 4EEZA 1KZ4A 5FI1B 2OCAA 3RC7A 3SEQA 4QVIA 4ER7A 1S8FA 3VVLA 4D0NA 3ER8A 3HVUA 3TNYA 2WIJA 1GTG1 2BE7A 3WYGA 4BMNA 2GARA 1FDVA 3UG6A 3IJPA 3QVUA 4HLDA 1L2TA 3U4GA 1YC2A 5ALHA 1R15A 3TNDA 5HK9A 5JZBA 2ZVQX 4POOA 5LOVF 2UUAB 2HT1A 1OVGA 4G1UC 4TMYA 1B7GO 1Z29A 1QGED 4R68A 2ATIA 4DZTA 3RAPR 1SUIA 4CMEC 3MRTA 3W5HA 3P32A 1GN9A 3F6RA 4FFNA 3RK1A 4O2BA 2OA0A 1AF7A 1U98A 4XWOA 3KKMA 4GU5A 1GL9B 4EA8A 2MHCA 2AZ4A 1KVTA 2Q7XA 1LC3A 4CIVA 1T26A 3BF7A 3JQ6A 3DUFA 1ESMA 4XUEA 1X2EA 1ZI8A 3NTRA 4BO2A 3JVVA 4EQ6B 4EX7A 1WKBA 2O52A 3OMWA 2D13A 1LQUA 3I23A 3IBCA 1PWZA 2CXNA 2UZ1B 1KBZA 3A1NA 2X41A 3MT7A 3UAYA 3PTAA 5HKOA 1CIVA 5CGQB 3ITEA 5A9SB 1ITZA 2AZMA 1PTJA 3MLAA 4IEFB 4MVWA 4BNTA 1NMZA 1NVVQ 2B1RA 2KBFA 2B61A 3FOBA 2ZB3A 1VBMA 2ZUDA 3T4EA 2GYUA 4AJPA 4BVJA 2QR5A 3M1IA 2LVBA 4OIFA 4CLOA 3LWBA 3F5FA 2Q29A 3F5SA 1X92A 2FKNA 2WHXA 2P6NA 4AWXA 3L7AA 1UEIA 3VKUA 4J03A 3W2FA 2YWGA 3NETA 1ZH0A 1XZAA 2WINI 4QQNA 5GONF 2G9NA 1A9TA 1J22A 4FDVA 2PQMA 4MS3B 4RHTA 5JDCC 2WSBA 4BMVA 3BICA 2PKWA 4ZZ0A 1T13A 3KJNA 3LZCA 5BUQA 3IR5A 3RFUA 4HTFB 2IH5A 1LDGA 2CUZA 2GPSA 2C2XA 4KACA 2G08A 1S4QA 1R6AA 3L7JA 1Q1BA 3JQFC 3ZX5A 3NHPA 4Z5XA 2IUYA 1Q83A 3SQDA 1QR2A 1XAHA 2DFDA 2W6ID 3OURA 1N0WA 1YA4A 1T36A 3H4MA 2HX1A 1CUBA 2NV6A 3GFOA 4B3JA 4EX6A 4LE1A 4CEIB 4OHPA 3A2KA 4YRJA 4AX8A 1VFPA 2DKFA 3L8HA 1A27A 5LXTF 1PJ4A 3D8HA 4G1BA 3FB4A 3PQ8A 3HGQA 3DE5X 4RVFA 1LNQA 3RARA 4LBZA 3AJEA 3ANSA 3UJDA 4Y2RA 3DYBA 3L0DA 1VMEA 3VPXA 3SMQA 2F8LA 3PQ6A 1N0HA 4GI3A 4U2GA 2JFQA 4XD7D 5AUQA 1LVUA 1Z4OA 2R4QA 4MLDA 2AX3A 1RIFA 2BI8A 2PGIA 1Y1SA 3V4ZA 4D0LB 2YZKA 1ZP6A 3RS7A 1O94D 1Y3IA 4FLEA 4MUYA 3L9XA 2X9NA 4BNYA 1CB7A 3Q8KA 2ANBA 4YJ2F 2CNBA 4UOZA 3WWPA 2IEBA 5J59A 3QA9A 4JENA 4KO2S 4O8CA 3FWKA 4HGNA 2DR0A 3ERCA 4M1OA 1T29A 1ISSA 1Y1RA 2BZSA 3L82B 3NBYC 4JASB 3T5GA 4LHWA 2ZYDA 1UDBA 1E61A 4H27A 4LCBA 3TZKA 2O19A 1K8RA 2FG5A 3MGAA 2EWVA 1JAIA 1C4WA 5L3QA 1TZBA 5HJEA 1AD2A 4H1VA 3CUYA 1R8YA 3PJRA 4X20A 3H11B 4B0OA 2G8LA 3G89A 1U9JA 2ECFA 2Y68A 4KIUA 3GP5A 3OBBA 4Y2VA 5FIUA 1XN4A 1T3LA 2ALJA 1X7ZA 4DJAA 1YQTA 4S0XA 5AH0A 1Y9EA 3GLSA 4YXWD 2I2BA 1T9DA 2GZ2A 1TM7E 3CNEA 3G2QA 4ZMBA 1MT3A 3NC1C 2VAVA 3ZGVA 2AXPA 3BQNB 4M9UA 3RB8A 4B8YA 2VF7A 1XTIA 3TJZA 2JJ2A 5C1PA 3WRXA 3JWHA 2XGMA 3BQMB 2CSUA 3A1TA 1NY5A 1KVRA 2V7UA 4ZRDA 3HKBB 2IS2A 5LM3A 1U28C 3FDZA 2I66A 2PS0A 2AN5A 1EFCA 2O2YA 5DP2A 4M54A 1JB9A 2C3OA 3AHHA 3PX7A 1Z5GA 1PNTA 1MV5A 4Z9XA 1ZD9A 3NDRA 4EKEA 1JDBB 1RM3A 4DUZB 3GUVA 1SVOA 3Q7RA 2W6PA 3EF1A 5KOHB 2RH9B 3MXOA 3SZ3A 3A3PA 4OJTA 2IUFA 2RHTA 1AY0A 4K6FA 1WHTB 4DLKA 3MUEA 2EQBA 5AW6A 1Z45A 3BFXA 1GGHA 1XFDA 2DHQA 4DLVA 4Z53A 1Q7TA 4YONB 1JU4A 4HJRA 1GG2A 1LY1A 3KKEA 2YOGA 3ANXA 3NHLA 4X1IB 1GGVA 1JQ5A 2FP3A 3OF5A 3OEHD 3ZN2A 3BE5A 3ZCVA 1DDOA 2JCSA 1W35A 4PEVA 5BWMA 3DMFA 2R85A 1EGQA 2LV8A 1L4UA 3QVVA 3KHUA 4LI0A 4Q4JB 3R76A 3TNJA 1PD0A 1KZ1A 2NZUG 3LUAA 4KWHA 2ZJ8A 3K70B 3VO1A 1RPAA 1VSBA 3C4QA 3H3XA 4JUCA 3CWCA 1VMDA 4OL0A 4LFCB 3VISA 1NXQA 1EVLA 1XVLA 4Z0TA 3OZRA 3X1ZA 4GMFA 1QIEA 2AC4A 4M1EA 4UOQA 3EHEA 4RVSA 2IUSA 3JQ8B 1DCMA 1CR4A 1JDTA 1IHYA 1PV1A 2ID7A 2NAFA 2FK7A 2PFSA 4J1NA 4F04A 3WL5A 1AB5A 3RSOA 2PX6A 1G3UA 1U0TA 4GR4A 1PKEA 1MAUA 3PKJA 2Q7DA 4C0SA 1PWEA 1MNQA 1PZGA 3MSXA 3FRJA 4HF7A 2E4AA 2W6IA 3C3AA 3QKUA 3ORSA 5K3AA 1UC5B 4C21A 1HDYA 1N5RA 1XRJA 2AYZA 4AI6A 2AE2A 2FNAA 5A05A 2J0SA 4GYWA 1W5TA 4JSTA 4KTTE 4MRMA 4FWBA 4MVJG 1GRCA 1M1NB 4LZOA 8LDHA 1HUQA 1GGFA 1MQAA 2RSLA 2WIBA 1Y98A 3D3WA 5HF5A 5DNVA 4FN4A 4DBZA 4TXNA 1CZNA 5JVDB 1RT9A 1NN5A 4R8RA 2ILTA 4MS1A 3ADBA 2GO7A 1MVOA 2ZWMA 3I2JA 3OO1A 1B16A 1QHEA 1U7DA 4NNJA 3KB1A 1JA0A 4BNUA 4YRNA 3FSGD 4ONEA 1CS0B 2EAUA 2ZIUB 1IIRA 1D3AA 4FBMA 2Y1KA 4XD7A 3H2ZA 3JAKA 4MHSA 2N47A 1JPUA 5DHUA 1R0WA 1R9JA 3NAMA 4WY2A 4KRFA 2NVBA 4JEUA 4ND3A 4MYHA 5EIBD 4CIBA 3ZKAA 3TXAA 3O8OB 2EKDA 4FIZA 4CTNA 5F3WB 2C4VA 4DKXA 4QGSA 1V4VA 1RKQA 5KC8A 5IWAB 2BEWB 3AQIA 1XTVA 3GFSA 3AETA 4EDHA 2WNIA 1RIIA 4AK9A 5LQUA 3Q6IA 3GQBB 1X0XA 3V42A 4Z6KA 2DHRA 3HXMA 1T5BA 2IYAA 1XJ5A 4UEKA 1G98A 1R27A 5C1IA 3K16A 1L5FA 5HF9A 2C94A 3M7IA 1MRSA 3HVHA 4RM3A 1Z4QA 4B3HA 2VO1A 3EIOA 1F2TB 1KZYC 1ZGJA 3O94A 3PZRA 5GM1A 2QXYA 3F73A 1ADBA 3EWAA 2P41A 2HBZA 4GEKA 1A9ZA 3PFKA 4I3GA 4IWXA 3BWCA 3V7NA 4YXWA 1CZOA 1W49A 4TMXA 3AF1A 5DOZA 4FNGA 4UNQA 3TPZA 3GLUA 1RKUA 2HZBA 3GCDA 1J20A 1PBTA 5H5JA 3DT6A 1BXZA 3GARA 4E7PA 2ZJBA 3LD9A 2ZS7A 3CVWA 1U63A 1LPBB 4JLUA 1QOZA 4ZU1X 4PVCA 3NBUA 1GA1A 3JQEA 3RS9A 3U62A 1E1LA 1NV9A 1BKSB 2OC9A 1QP7A 2QGZA 3OLCX 2CUKA 1Q7EA 2QN2A 3JTMA 3ETCA 3JRXA 5EMJA 1HQKA 3T95A 4J3FA 4Q9LA 4LCJA 5TMPA 3AUAA 3F1LA 1TAUA 4B3MB 1WY5A 1TAHA 3TDKA 3RYCB 3U13A 3MSCA 2A5LA 1CUGA 1K89A 2CT8A 4CMIB 3HO1A 2NX2A 3DBLA 3LFHA 2QVLA 4TQGA 2H8KA 3M70A 5T57A 2V7VA 3VVBA 4I5DA 2QORA 2Q3HA 1HDZA 3E0XA 1BTOA 3MF4A 4CQNA 4BB5A 5BMVF 5HS6A 1K5HA 1DCTA 2AOUA 5FA8A 1VBKA 2PBFA 2CLIB 2MSWA 4NFLA 4XCQA 2F7SA 4Y6OA 2IYUA 4AG6A 1JX6A 5FR1A 4EVSA 3IVMA 3AVWA 2EKQA 2QM0A 3NANA 3B3FA 3QXSA 4C22A 1BCSA 1OROA 1QZXA 1U8AA 1VJTA 3OEHA 3W9YA 5EVCA 5CEFA 1K7CA 13PKA 3OESA 3KKKA 4IIBA 4Y2JA 4ZOBA 16PKA 1E2IA 5B55A 3QLVC 4E31A 1MFZA 2E9SA 1NPYA 4M88A 2G72A 3DM5A 4C9BA 5C2JB 3ONWA 4LHSA 4DSUA 4CRWB 5DLPA 3RV3A 4EKYA 1GWNA 4P33A 3DO5A 5EXTA 4N8DA 2VJNA 4GBGA 5LU9A 1GU1A 1XROA 3BXOA 3O8QB 4DLZA 4JY7A 4ZV4A 1W19A 4GP7A 1ZXXA 1I2DA 3KQVA 1S8NA 3O84A 3PUJA 3C8HA 2WZQA 3U19A 3GLIB 5CTAA 5AW0A 3K0FA 4MS4B 5CB4B 2QW0X 4EHAA 1XAJA 2A5GA 1NW4A 2J4DA 4MVYA 3S1AA 3X1MA 2O8EA 1SOVA 1AK1A 5C5EA 2QQ0A 3NKFA 4L0DA 4TS4A 1PQUA 2NO4A 3SGLA 5FLYA 3VR4H 2UZ4A 2YN2A 1TAGA 2Y0EA 3JS5A 1SG6A 1KQOA 1RP7A 3D7LA 4AYTA 2R7AA 3MUOA 2EP7A 4LSGA 1H2HA 1OH8A 3ONFA 2C84A 1UPTA 3NAZA 5JO0A 2PD4A 1T4CA 1A9XB 1AX9A 4TVKA 1R10A 1OD6A 3RSHA 4AW9A 3SQXA 4L4SA 3D3KA 3WHIA 2LBPA 1YZGA 1HDIA 1BN6A 1A69A 3JWPA 1R12A 1ZFNA 3KPUA 4Q7JB 2HQBA 3DEJA 3FSGA 5F1OA 3BAZA 1GJRA 5GM2A 1YZVA 3WS7A 4ETIA 4JODA 4NU5A 1N2CA 3I76A 5DI3B 3EZGA 1BWRA 3ZNPA 4ZI7F 1XTTA 2PS9A 4Y1RA 3K5WA 4DCNA 4NS1A 4A1OA 3DMYA 3COJA 3INTA 4AVYA 4NJEB 1E7MA 3KXIA 3LCCA 2Y1CA 3C5EA 3NM4A 3PD7A 3JD0A 4FHDA 5ADWA 4Z51A 4W5NA 4IQ0A 4RY9A 4J8PA 1QH9A 5E0OA 3I12A 2X14A 1EHYA 4HNAB 2JGRA 4ZYVA 4HRAA 4UEQA 2FKAA 2QQFA 3B6ZA 3OHSX 4D45A 1PWYE 2UYQA 4UAVA 2BCGY 3DO6A 5KAPA 2AB0A 3FOZA 1FNSA 3C3KA 3ZV7A 3KPVA 2PUGA 4GL4A 1ACMA 4H3HB 3IHTA 2CKMA 1JEQB 5EJ8A 5K01A 5HVNA 1Y5NA 1YQDA 3SSNA 2FZWA 1KI8A 1L5OA 2IC5A 3CRMA 3PLAE 4V0SA 2AS0A 4CMEA 1TM4E 1KO1A 3PPIA 3DC7A 4HH0A 2JA1A 3CN7A 4S1WA 1U4NA 4Z86A 1FLAA 5BQ3A 2Y1LA 2ODNA 1MAHA 2YY7A 4INOA 3ENKA 4QPJC 2BFAA 3EQZA 4QQFA 1Y80A 1J7KA 2GXUA 1M1UA 5GZ6A 4J4HA 1NZFA 2FE4A 2QT0A 2J5KA 1R74A 5EGSA 1YZUA 1XXHB 1K8QA 3T1OA 1WCV1 4PQEA 1SR8A 2NVUA 3HU2A 2PANA 3WLKX 2P9TA 1P2GA 4GX0A 5IT9A 3GZNB 4P2BA 5AICA 1GRVA 1Z26A 3QF4B 4V02A 1H9BA 4F6CA 3AVOA 1IZ8A 2DF8A 2IOFA 2ZK7A 3ELDA 3N0XA 3AP1A 3UJ7A 1G5IA 3OD5A 4PN7A 5KWEA 2ONZA 1XMJA 1P72A 3D5EA 4F4DA 1T2VA 5KTYA 2WFMA 3MGKA 3HY4A 3BPSA 2OPHA 4MV7A 2D5BA 1NMXA 2QBYA 3BSWA 5JDCA 4TLBA 4PGMA 2O06A 2PY6A 3LW7A 3PG5A 2VNSA 5K4HA 3ZJTA 1ZCJA 2WWYA 1FS6A 3IMFA 3KSBC 5JAUA 3U3DA 1L8OA 2E6KA 3EF0A 2GD0A 4FX2A 5TMBA 1DKOA 3PFCA 3T41A 4ZI5A 1EVQA 1Z0UA 2G7ZA 2WRZA 2WSMA 4FUQA 2C77A 2RHGB 3TR0A 3JQFA 4IGAA 4LWQA 3TLAA 4OD0A 2JVIA 4GRAA 3EAQA 4L0CA 4V0RA 1RWWA 1Z7GA 4DDUA 2C9DA 2IPAB 4AAYA 1IBKB 2C7GA 3C3WA 1N57A 2OAP1 1H65A 3LLUA 4DSZA 2Q5EA 3CLVA 1HMYA 3I6MA 4HVTA 3TNFA 1X7WB 2YX1A 5E1DA 1ZR4A 2FY8A 4ER5A 3LY5A 4CEJB 3QVGB 4LQDA 1QGOA 3OU2A 4V0NA 4FHZA 4OV6B 2J32A 3RWBA 3HLKA 5KIAA 1RRGA 1FFXA 2J3MA 3B1JA 3R5SA 1FZTA 4FFLA 4QRIA 3MT9A 5GVSA 5G3YA 2FFBA 2RAPA 3AEXA 1T6YA 4HJXA 1SGWA 3FI0A 4OOEA 4WLOA 2PU5A 5GOTA 1W4RA 4GI5A 2QSJA 1WEKA 4EY4A 1L1RA 4JJ6A 2YBDA 2XJ4A 4FQ5A 2A0UA 3BJIC 5CTJA 5LKRA 1QM5A 2PKRA 4C5CA 4MYTA 3L8ZA 1LBIA 2QI9C 3JAWA 1PP4A 3LHDA 3WLAA 2NSYA 4TZ6A 2CY0A 4FQ7A 4KWEA 1W2GA 2ID4A 4G1CA 4LE2A 5DCYA 1FQKA 3UGTA 5EZ6B 3SN6A 1TEHA 3GA5A 3ZGZA 1OKKD 2HAEA 3COWA 3GDWA 2FJ0A 3MYRA 1CEQA 1D6JA 1ECPA 2OE2A 2YS6A 3H97A 2SKDA 4OXKA 1QGUB 4XOUA 4DBVO 3SX0A 3F97A 3JZDA 4DM4A 2ZPTX 4FK8A 5BWLA 1KC3A 2PZ8A 3C6ZA 4OHRA 2CC2A 4AXXA 2MR5A 5AW8A 2X5KO 3WDMA 2G4VA 3TQFA 1XTJA 1QUEA 1WV0A 1XP5A 5G0SA 3Q7SA 4IIJB 3QWFA 3H1GA 3VHXA 4QWMA 2XQVA 2E2WA 4WNIA 1TECE 3P4UA 1R7RA 3CJRA 3UUFA 1E96A 4JH0A 3NDBB 5E1MA 4D97A 1BS1A 1YH3A 2RGXA 3FMFA 3IR7A 2YW9A 4R51A 3HNRA 1PJ8A 1LB1B 1PUIA 2H07A 4JJGA 3ISJA 3KVRA 4ESVA 2KLBA 3O4VA 2ZUVA 2YJ5A 2AN1A 1T4GA 1XCJA 2CNDA 2ROQA 3IPCA 1KQNA 3VNSA 1Y8RA 5KWIA 1VPVA 2FEKA 4L6AA 1TYDE 4C6HA 1V48A 1CZUA 1LBHA 2E3JA 2AUTA 1GZHB 3HABA 3L01A 1JR3D 1Q17A 1G3MA 3ANNA 4UUPA 3TE6A 1F3LA 2I1LA 2JH8A 1ADFA 1N1DA 1UXOA 1FX0A 1RXSA 3P9NA 5AM4A 1A98A 4OXIA 1USVA 4X7PA 2HNBA 4ZVKA 3H9JA 4B1FA 4B31A 2FN3A 2HJRA 2Q2NA 2JGDA 3CRRA 3AP2A 5B58T 1QV7A 4BIMA 4QYMA 4RMNA 3L2OB 2R8ZA 3N8GA 4X1YB 5EKDA 3WGLA 3QUCA 5KVSA 2GI4A 3B2QA 3OLWA 4M87A 4D44A 1PJCA 2P0YA 3NH6A 2G0TA 2NO6A 5H82A 5KNCH 4L1KA 1M83A 4CMJA 1P7VA 4B3CA 1G9TA 2CEAA 2V7PA 1P2BA 2J3IA 2ZRCA 3CR8A 3HWWA 4A10A 2GMWA 3GWGA 1P62B 3I9LA 3I04A 4NBTA 5AXAA 5FI5A 3G7SA 2WJ6A 4KKVA 1XKXA 2GBPA 3L7OA 5IDWA 2B2CA 1JJVA 1U0HC 5ES4B 1N3IA 4HQFA 3GFQA 1BQEA 2XZDA 3FN4A 4HMPA 4IVNA 3W2HA 5A4KA 4X7BA 1JIKA 4MHOA 1OFUA 2H92A 3LY9A 5FCDA 5KINB 4QREA 3FSEA 3V48A 4I0WB 1N8TA 4MUBA 1T0HB 2X9GA 4V2UA 2Z83A 3P8ZA 5E0KB 3IPRA 3W9UA 4TKUB 1KU6A 3MS7A 4DCOA 1R8QA 3LX8A 3K0EA 1AZTA 4RHYA 5LQKA 1DIAA 1BHQ1 4U7DA 3ZK7A 2GVNA 1U7XA 4UHCA 5FKJA 3NRCA 3VPAA 4ABTA 5CNIA 3HVRA 2C2YA 1JDVA 1YUNA 3AFNA 3H42B 4WAUA 5TQ0A 1BO6A 3PRYA 1SJ9A 4L3WA 1WSWA 1W59A 1R8XA 2WWWA 2XE4A 1FTQA 2ZYHA 4UCFA 4CG3A 1B0UA 2VRBA 4DBLE 2EW8A 3EIEA 4C0JA 1ZW6A 1IJFA 3DP9A 5D5PA 5AMXA 3TTXA 2VJPA 3SYKA 5BSMA 1XGKA 3PX2A 3H9EO 1KEEA 1MVLA 1E18A 1QC5A 2BGKA 1T5HX 2HMWA 1GNVA 3KPJA 3PIIA 4MVJH 3SX4A 5C51B 1W88B 1NRXA 3JTEA 1I2ZA 4D92A 3EPKA 3DFMA 3HA2A 4U0JA 4KUGA 5E6RA 4EP1A 4YRSA 3LDUA 2I8CA 4QUGA 4F2WA 1EBFA 3QI7A 4XDYA 2C3UA 3X1DA 4DILA 1XUOA 4YMHA 1ZA2A 1KQFA 1HEYA 2C7PA 2ZWOA 2DFKB 2QQEA 4Z4HA 1IG3A 3HRIA 4HNQA 4Y67A 5F9HA 1OKKA 3JQAB 1AS3A 2RHDA 3BEDA 1UPXA 3UMRA 3I5AA 4OHKA 5EHXA 1TFUA 5IXYA 5KX5A 1KA9H 1VRWA 2JRCA 2G5CA 5JEEA 2E7ZA 1EB8A 4Q24A 4J3NA 3MJCA 1A82A 3ORYA 4KVZA 1KZ9A 2P7HA 4CMBA 2WJ3A 1L5HA 4DE5A 4EB8A 3B3JA 3GD5A 3AXTA 4NHEA 1V6CA 1ZUD1 4R1MA 2OFFA 1C1DB 2XKAA 3A31A 3FLEA 4PCUA 3DHWC 4BRSA 3HJTA 2N0SA 1GDHA 1RCTE 5CXQA 3BTVA 1N7IA 4PONA 2VH5R 1Q3KA 1L3BA 3R7AA 1N2ZA 1NJGA 3D8RA 3RREA 3QXGA 2G04A 3I42A 3COYA 1JLHA 3Q0TA 4K88A 5IAAA 3GPIA 3KK0A 3PEWA 3QKSB 1WPGA 3AM4A 4JP3A 2PGOA 4ZJZA 4GOJA 3U4IA 2L42A 1BFUA 2JDID 4YJ3A 6GPBA 2LPMA 4JAVC 3C5HA 2Z4TA 2VUUA 4JJAA 4O4LF 5IVKA 1XZJA 1VL6A 3WLNA 1VHQA 4LTMA 2VNJA 4YAUA 3T5TA 3AW8A 4G8CA 5J47A 1J90A 2VQDA 1DC6A 4BNIA 4KB5A 3GLTA 1JR3A 1WLYA 3UWSA 4CV0A 4D8TA 3TG2A 1E3JA 2YWBA 3N8KA 5KSZA 1RFGE 1UODA 2H1WA 5IF3A 1NR7A 3RHFA 3O2SB 5GIPE 5DX8A 4MUFA 3M4XA 3TJRA 4DIBA 3PJFA 3ED1A 3B7GA 4ZAGA 2J5QA 1XU7A 1Z2CA 3P0FA 4PX3A 1GKUB 4TV9B 4X60A 4C08A 3CVXA 3EXFB 3U4QB 2X2OA 4MCHA 3CLHA 1N2XA 3QIVA 1OY1A 1J0CA 3CZRA 2NAPA 4CIDA 3QLVA 2CHEA 3F67A 4PCVA 1USUA 4RKFA 5I4IA 2P78A 2UYGA 4PYIA 4G2NA 2J9FB 2ZBVA 1JALA 2P62A 5CIWA 3OQMA 1ZS9A 4KODA 1R0BA 2FLKA 5E38A 3CX3A 3LLVA 5ITWA 1B1AA 1I3MA 2H5JA 2ZCVA 2E48A 4JEIA 3WA7A 2NU7A 2Q5FA 5K0FA 4AZVA 1FB5A 2OCYC 3V3TA 2WF7A 1AV7A 2FQ1A 4R1SA 5HFNA 3REQB 1A7UA 3W9SA 2BZGA 5LIPA 1IOVA 4JT2A 3LPLA 2XGOA 5GOZA 5BNIA 2EBUA 3MWFA 5E6SB 1GT91 3G0IA 4LXGA 3WK5A 2GK4A 4M9QA 3BE6A 5IMBA 4AN4A 4YR9A 1K2WA 4I36A 4HAVA 4QBGB 3RYHA 2YIMA 5FBZA 3N7TA 3IKTA 5F2KA 3KX2A 5TR9A 2DH6A 3A3KA 3B51X 1P1IA 5K9ZA 1P7PA 2X40A 6ABPA 1WHSA 4CUJA 2TECE 2QW1A 1BHJA 4RPHA 2QRGA 1II0A 3DM9B 4O0MA 4TWJA 5K0TA 4LN1A 1WKVA 3N76A 1N6PA 1PR2A 2VPQA 3ORRA 4EYGA 4OB7A 5SY6A 3RUFA 5K8TA 4CV2A 3KSAC 2P9JA 3N8HA 3H7AA 1KJIA 2HPAA 1PK9A 2QY9A 4RF2A 2AYYA 3P0HA 3AEUA 2REQA 3DHNA 3JATA 4L2IB 4MUNA 3JPWA 4PZLA 4OQDA 1VE3A 1W0KD 3OZFA 5EZYF 3R44A 1QHFA 4CU5A 5FWYA 1NBME 2XVYA 5LCXA 2IS6A 2JGMA 2HPVA 1G6OA 2C00A 1QG2A 2GKOA 3DT8A 4HD8A 1YCFA 5AVOA 5TPZD 3KZMA 5JXIA 4WY8A 4MV0A 3C0KA 1CY4A 3WIBA 5DBGA 1R9NA 1XWWA 4HH1A 4ZV7A 1YIOA 4RENA 3WGZA 2GOYA 2UXBB 4UNPA 3OPQA 3FVTA 3L7LA 3ZNOA 4C14A 1AK2A 5F3RA 4OTZA 2VFAA 1QF7A 2IDMA 3D6HA 3E70C 3I1IA 2JIBA 4HBZA 4MWSA 2I71A 4MYRA 3W1WA 4B76A 2HPZA 2GQ0A 4HEA6 4OEHA 3DJYA 3S2YA 4UE2A 1X1CA 2Z2IA 4LWOA 4PNZA 1XU9A 1Y37A 2J0UA 3V8MA 2J41A 1G20A 1K8YB 3EVAA 5F1YA 3TW8A 3I6IA 1QGZA 4M76B 4Q4HA 2YMPA 1YV9A 1PTKA 3H0EA 2XGGA 3KL4A 1T9BA 3E48A 1DZIA 2YFHA 4R2LA 3VNBA 3GQVA 2IPLA 2AOTB 5AD1A 3SHFA 4DYDA 1O5OA 1M75A 2QD3A 2X9QA 3SG0A 3QVOA 3WMRA 2GFQA 5C1OA 2HHLA 3BL5A 4UTNA 4XVQA 1MAAA 4OMFG 2W11A 3OCCA 3PNYA 3TTSA 4WSOA 4HNRA 4FR0A 1EI9A 4Q3BA 3OZUA 2P65A 4C03A 3KJIA 4WOKA 4U2CA 2UZ3A 4HVLA 3B1FA 3VU8A 5CLFA 2GEBA 1FX1A 4IRXA 3TZLA 5JNWA 2JDIA 2XLCA 4LWPA 5EKUA 3HLTA 4JBLA 1OX5A 3CXRA 1B8VA 2PBRA 4TWBA 4UUOA 3VU1A 3TSOA 1ZGHA 1TKBA 1NC3A 1SA0B 2Q8QA 2QTCA 3ET5A 3GD7A 1CEEA 3CF2A 3UA3A 3DCYA 1O77A 4H7HA 2O7SA 3G8CA 4GXTA 2K6GA 2XCOA 3BMXA 3DVAA 3ZK8A 4EWLA 1V41E 5K4AA 3RK0A 3CB4A 1JFTA 1NKTA 2FP4A 5JRJA 3TXXA 3H75A 1OTYA 1V3UA 5FEMA 2PIAA 5TSDA 3UC9A 2CHVA 3IPLA 2Q3LA 3OJLA 4NTZA 4RL4A 4WESA 3K2BA 5CJPA 5ALKA 1TC2A 2V45A 2W22A 3JU3A 4G0YA 3E7DA 3WGIA 1AGXA 4MR9B 4XJTA 1TCVA 3CMCO 2GB4A 3D0OA 3QUSA 3O4HA 4IJQA 1M72A 1WXXA 1T8YA 5FNVF 1JJIA 3G02A 5JS7A 1SIUA 1WDKA 1P45A 3NAQA 3WYAA 1ZA1A 3ETHA 4P3OA 5ALSA 5AHOA 3HEBA 4PZEA 2VDWB 3DNMA 4E5UA 1X86B 1HNNA 4ZOCA 4URZR 1A88A 2BMVA 5MF6A 1I0LA 2VTBA 2YHBA 3OIDA 5CHYA 4ZT4A 4OH1A 1LU9A 3STVA 1SK8A 2AJDA 3DEYX 4C0BA 3RIXA 3Q9SA 1DC3A 2J33A 1IU9A 1B41A 2R7KA 4HWKA 4IQ4A 3WIOA 4B73A 5CH3A 2HV9A 3ZBPA 2OK7A 1P18A 4Q4LA 5KSWB 1R9MA 2V6IA 3GW8A 4FBGA 3ICQB 1M6NA 3BWDD 1RW4A 3SI7A 4D4GA 1X80A 2Y27A 3QH4A 1JUDA 3GEIA 1XDBA 2RHHA 3O5AA 2ZJ5A 4PTLA 4Z9YA 3P0EA 4CM5A 1ENOA 1I32A 2PX5A 3WKAA 4F3NA 1XCMA 3I83A 4X8OA 2IYEA 1L7XA 1R0CA 3DW1X 2EKBA 2AMVA 2WP8J 1Y5MA 3A4MA 1C7JA 3HYLA 4GX2A 3LC1O 4IFTA 1KAHA 3IOBA 4GAEA 4N54A 1Y8CA 2O57A 2VG8A 5I7SA 3QLTA 4CPDA 4B6JA 3N2ZB 4GOKA 2O8VA 1H2XA 1E6CA 1W0KA 1ZJJA 2RJ3A 1SB9A 3TLZA 4ZCTA 4OAQA 2X9VA 3AH8A 4QOFA 2J9RA 4K28A 4NZMA 4DIFA 3BILA 4YO8A 3INRA 1J5XA 5TPZA 5A0FA 3K6RA 1FTYA 3T61A 5HKKD 3UGKA 1KJZA 3K0AA 3CY6A 3F4BA 4NQZA 4XUGB 3UJ6A 1EIZA 2LDBA 4DLSA 5ALDA 1TEVA 3HYRA 3TWOA 1D7OA 4G0UA 1LDMA 1VL0A 1RCUA 3QVKA 1GPMA 5KYKA 2FFQA 5M3BA 5HNKA 1D6SA 1ZHHA 5FO0A 2NTEA 3ZGYA 1A2KC 5AOCA 1HEIA 2E21A 1DTSA 2E5WA 1JKJB 2ZWPA 1Q7GA 4R9NA 4P32A 4REOA 3ZWQA 3U4CA 1XNQB 2OZPA 3EZ2A 4ZK6A 2EJVA 2CNNA 1Q0ZA 2WJPA 2IL1A 1C9EA 3E22B 1LK0A 3JARA 5ICSA 2EOAA 4RC9A 3LK7A 5IHXA 3L4BC 1XAIA 1IXZA 3MJTA 5IAGA 3SXPA 3VNUA 1CP3A 1JJFA 3DEAA 1E77A 5AYVA 1CJSA 4TL7A 5U1PA 5FH9A 1WCIA 4MULA 3F9IA 2FFJA 3NP7A 1XRSB 2P8JA 4TMKA 1RMTA 3EPHA 3KOMA 3FUTA 2F9LA 3AY6A 4IQGA 4BFZA 1Z0AA 1TL7C 2C58A 3G85A 3NT4A 4HN4B 5IF9A 1NW6A 2A9OA 1ZGAA 1OXTA 3AHDA 2PRYA 3PEFA 3AL0C 3DS8A 1NX6A 4GE0A 4BNLA 5KOIA 3V4VB 3OQIA 1SIOA 4K9RA 2COUA 4C04A 1AUQA 3TTWA 3AVTA 5ITSA 4EFMA 3FNGA 4NCNA 1H5NA 4KH0A 3V8PA 4XB1A 1X7XB 2QTNA 4D9CA 5JS6A 1WCYA 1P0PA 2VAMA 3R7NA 2I2DA 1SZJG 4MTLA 4R9SA 3CISA 2OHOA 2XQJA 3GJQA 1NXXA 5DNWA 5BY2A 2PXHA 5LVAA 3SMVA 2Q8NA 1ZGGA 2NUAA 3CG0A 3P20A 4IDFA 1POWA 4PSCA 5CMLA 5IW8A 2QKYA 4MSUA 3G6KA 3ZW7A 5CB6A 1I4TD 1YZKA 4GLOA 4PRKA 3T5PA 4L95C 4JJKA 2D54A 1XZIA 1B8PA 3V4FA 4ASUD 4ZC8A 4CHTA 4OQZA 3R9WA 2P2LA 3NDIA 3ODGA 5IEJA 2BKUA 3I8SA 4KIFA 1DKMA 2CV0A 2C5AA 5IBQA 4LMAA 4YCJA 1F4PA 3OF3A 4RWZA 1SULA 3R0ZA 1XDGA 5I7AA 4QYTA 4RJLA 2R5FA 5J40A 3FJ1A 4B09A 1KAOA 3FKQA 4BNMA 3COPA 4OMUA 1U0BB 1CWUA 1NLMA 5EIFA 5TY0A 3K0BA 3LPCA 1TIBA 3RJ9A 4AKTA 4R54A 2B99A 3GEPA 1FXWF 1GGJA 3P96A 5ALIA 1G64A 4G5SA 5HCUA 3BJRA 1QQBA 1ADYA 4BC1A 3G8DA 1H1LA 3UA4A 1FP4B 2HN9A 1QPBA 3IIIA 3CBQA 3H9GA 3Q9LA 1Y1KE 1U8FO 2XNHA 3TFQA 3USZA 3C5VA 4K8OA 5JADA 2HMUA 3LXRA 4DUYB 2FQXA 1XEAA 1PLJA 3MLBA 3V8NA 5JNTA 3WGKA 2VUTA 2GCIA 2PKYX 4R5MA 4E08A 2I3ZA 4OFXA 3ECSA 3HO6A 1NI4A 4H1UA 4L22A 5BSFA 2VSQA 4YV2A 4Z0PA 4IXTA 4TWIA 4GPBA 3DA8A 2YDYA 1PFUA 3OECA 4ZIRB 621PA 3OOSA 3QQ5A 2H3EA 2ET6A 1SNYA 4G8JA 5DLDA 5DNDA 3MJFA 4E07A 1K7YA 1IMOA 5DM60 1IPEA 1E8NA 3MS4A 4YT8A 2QYSA 4NI5A 4Z54A 5A1TA 5HKKA 1OX4A 3B1ZA 5DK4A 5TIIA 2WV9A 2NTVA 1WMDA 4LJ6A 2WHEA 5HQ3B 3LECA 1Y7PA 3DTNA 3FTEA 1CC1S 5FO1A 2XQKA 1SXJC 4H9GA 3L1VA 3ZD9A 2DJ5A 1AXRA 1NVDA 4L07A 4YV0A 1B73A 4QWWA 2GZAA 4EUNA 4EB3A 2EJTA 1NVMB 1RU3A 1TU3A 4CFZA 2XYHA 4YO7A 4Q1EA 3L43A 1SXQA 2PLRA 1D5CA 3K35A 4Q7EA 4ZARA 3CONA 3FFAA 1U9YA 1OXVA 2OUIA 4P93A 4LSWA 2R6AA 3PGKA 3ZCPA 2GPAA 2X42A 5BOVA 4I6GA 2OHFA 5TNXA 3ZZMA 2XMBA 4KAJA 2FEMA 3ER6A 1UBCA 3TGWA 1EXNA 3WLMA 2PT5A 3VDMA 1KO7A 3H5VA 1JDSA 4YFVA 2C1ZA 5CT9A 1XDDA 4L9WA 1CY1A 1DAHA 1NWHA 2JEZA 3FMIA 5J2TF 3NALA 2R00C 1NUAA 1RLUA 1F0NA 1X3SA 1S2NA 2QLTA 3A1EA 3HKEA 3K73O 1AKQA 4IUBS 3RIYA 3F5QA 3KYBA 1ISJA 1MGPA 1K6JA 1RYBA 1R0RE 1TKRA 2DPGA 4J0DA 5IKEA 5A62A 3HFSA 2ZLBA 3DULA 5HGXA 1KO8A 4H7FA 1BE6A 1WXIA 4F3KA 5K0CA 2HJ9A 5IRCD 1LQTA 1X38A 3PB3A 4PANA 3OZTA 3IPAA 2IYTA 4MH0R 4OUDA 1HE3A 5EHGA 1FFCA 1W34A 1G8KA 2Y0BA 3EZ6A 1PQWA 1G21B 5T4BA 4ECEA 2YFQA 1YZHA 3R7FA 3EDOA 4BVEA 4XYGA 2CHFA 3F4LA 2JI6A 3Q6NA 3AM1A 1NF3A 3SEAA 3EDYA 3G1WA 1OZGA 4O4JB 1I9CA 4KKXB 4DLPA 5T8KC 3GHHA 1JPVA 1ZN9A 3K9QO 4BVFA 4PZZA 2JZNA 4Q4DA 4RY0A 5BSRA 2CLOB 3VR4D 5J43A 1QHSA 3G5MA 3MBOA 4QUKA 1GCAA 3WXMA 2ZQYA 4LZWA 5C4GB 3ZLVA 4WY5A 2SBTA 1FW6A 4LF9B 3HWX1 4C5BA 1PFWA 3A4YA 4R8KA 4OKNA 4GLJA 3R9IA 3NV7A 2OAQ1 1V8OA 2OILA 2WMYA 3TJMA 5FHRA 3WWEA 4ASUA 5HQTA 1UUFA 3UMMA 2O8NA 3V1TC 4X64B 1F8XA 4KITB 4WD3A 4WNAB 4CUZA 1H94A 3ZDZB 3TLGA 1XCBA 2PWZA 2HWUA 1FEZA 2OHHA 5EC8A 3IO5A 1AKEA 5ER9A 4LV6A 2C4UA 5F9MA 5AVVA 2QMZA 3O1HB 2AT1A 2AUNA 4G5RA 5JBQA 5IT5A 3ZV5A 2GF9A 3FKSD 4Y2TA 3KOYA 4Z7NB 5CU7A 2QE7D 5CPBA 3UJNA 1SQ0A 2PKXA 3B8EA 4IF4A 3DTTA 5IMSA 3NDPA 1JDPA 1HFEL 4JJIA 5JECA 3KSRA 4LQCA 1OZFA 3HKDB 5HBGA 5BN5B 2WJ4A 3E05A 3W06A 3EIXA 2VP6A 4JKIA 3WYBA 3ABOB 4U3JA 2GA8A 2VQEB 1WJGA 3LGAA 3T8YA 1Q84A 2VTVA 1THGA 3ZHVA 5HRAA 4OHZA 1TPZA 4U9HS 1J0DA 1S8AA 3D7NA 4Y2YA 2FPSA 4G4GA 5TARA 4DLWA 3ZJUA 2W6MA 4Z4FA 1QMGA 5LIRA 2CJYA 2WOJA 3AHCA 3IS3A 4XX0A 4MV1A 5TEWA 4HWGA 4CN8A 4MQ4A 1PQPA 2BGGA 1UBLS 2V74B 3B20A 4XUCA 1NJSA 1ESZA 3NNDA 4TS1A 2O3JA 3O0DA 3QWIA 2Q1WA 4NV1A 3M6FA 4XQ0A 3VYUB 2M9MA 4EMTA 2Q49A 4MI6A 5JARA 1II8A 1U8EA 1RC8A 4PVDA 5J5CA 3TFOA 1AT1A 2Q3BA 1H2BA 1UQRA 1C80A 2X4IA 4B3RB 1W75A 3ADOA 1DG1G 4XUDA 4B9AA 4P9NA 4IXWA 2IHTA 4P38A 3H2GA 3OPXA 2CNWD 1AU9A 3T7KA 2HF8A 5H80A 1YXMA 4RF5A 2G09A 4YX9A 3FX2A 1II9A 5KYUB 4YXFA 3ZKWB 4G97A 1JR3E 3EQ7A 3FBTA 4Y98A 5G4KA 2QMUA 3LA6A 2OXCA 4L5IA 2VJCA 4LY0A 5DT9A 4E5SA 1G2PA 3AG5A 3BIFA 3IJEB 5CXUA 3LDAA 4O25A 4QGHA 1G4UR 4DV2B 1GPKA 5EE0A 4NBWA 2ZDGA 5D3ZA 5B1IA 1Z9BA 4FR2A 4OLHA 1BKDR 1DRKA 5LA6F 5GVRA 3A28A 1WTAA 3L1HA 5A4FS 5A5FA 2H4JA 3KSUA 1T6XA 5GZ1A 3UIEA 1E2LA 5EHQA 2YWEA 4RSGA 5BSUA 5K3SA 1F06A 2B8JA 1CDDA 3SKXA 1IHDA 1NJ2A 1NU8A 3K2QA 4PQYA 5C32A 4A8JC 4EHHA 3CCBA 3DL7A 5TGZA 3TMYA 3O21A 4UNIA 3EGXB 2IH4A 5IKOA 5ULLA 5JLJA 2YRWA 3LVBA 2YS7A 3INNA 2H4WA 3IT0A 1PKXA 4L74A 3SY8A 3ZE2B 4LGCA 4Q9NA 2PLAA 5CA0F 5JWOA 4OQLA 4M99A 1JBQA 2CFTA 4YJDA 3WISA 2JI9A 3T94A 3ZS9A 5IDXA 5KTPA 2UUBB 3HYCA 4U8HA 3PCRB 2EZ4A 4YJHB 2JGEA 1QBGA 1JEYB 2ZT8A 1UFKA 3U81A 4C2TA 3PGA1 1W5AA 1SUSA 5E3HA 3CKKA 1WP9A 1N8KA 2ZULA 4FI3F 4OJYA 4QLAA 4CM9D 3GVHA 3S0JA 3WNQA 4EG6A 2ZXEA 2Q5IA 3LXXA 4IIGA 4COKA 3PEYA 2GYWA 2HSEA 3D2BA 3VR4A 1N2SA 4I1PA 1DV2A 1XMPA 4HCJA 3SYLA 2J7PD 4KAFA 4M37A 4CMGA 3DZFA 3Q8LA 1P6XA 1FJ2A 5C31A 3MWDA 2WUGA 3O38A 2P35A 3IAM1 1XDSA 2CD9A 1FTGA 3G0CA 3KFVA 4MP3A 2WWXA 1PJTA 2YIVX 1WQ3A 4LHZA 1V9CA 3DBIA 3QU2A 2HU2A 4QQKA 5JOQA 2HADA 1QRDA 1J8DA 2EWMA 4J0CA 1US8B 2DHDA 2CYAA 3PUHA 3RFCA 4FYMA 4GNRA 2OCKA 1CRLA 1SUFA 1A71A 2XT0A 4RH0A 1OF1A 2PSHA 2R1VA 1QVRA 2VDJA 2ZBQA 4RKRA 3PR2B 2P2ZA 1ZEMA 2HIMA 2P69A 1WMEA 1KJ9A 3FKSA 1QS0B 2CCJA 3UENA 1K5PA 2QE7A 1QQ6A 4PLWA 5DGHA 5I5EA 1W48A 5HA5A 4J6EA 4KQFA 1QG6A 1PGQA 4H6PA 2QRHA 4H7PA 1U1CA 4FOOA 4V24A 1T8RA 1A2QA 4HDRA 2DY1A 4ER6A 1K9SA 3EDRA 3E5MA 3FRIA 3JQ9C 4G81A 3FLBA 5ILOA 2FGKA 3SEZA 4EI8A 4KQKA 4KR9A 1PL0A 4W5TA 1G20E 2NPIA 3V6LA 1ZJ6A 2IXAA 2VZ8A 3T1TA 5G0WA 1I01A 1HSZA 4KFUA 2X1HA 2FPGA 4NAUA 1SXJD 3X1JA 3KTAA 2PX3A 1FZQA 3GAFA 5KPJA 1KI2A 4G4SP 1EA5A 3B6EA 3WLIA 2R6R1 4A2CA 2ZRIA 3HA5A 1JFVA 2FOXA 1BIFA 1Z7YA 3AINA 3CRW1 2SCUB 3Q10A 5HZHA 4V1CI 3LT4A 2ATXA 3K1YA 3N2GB 4EENA 2NQ8A 4KQ6A 3R3UA 1CRZA 1ESCA 1JHZA 2CNWA 3I3SR 2FUG1 3HCCA 3H2HA 5JCJA 2Y77A 2Q6LA 3L4BA 5I7WA 3Q85A 4TYNA 7ABPA 3I9KA 3KEOA 3FRHA 3D8TA 3O0TA 5FA5A 2RHRA 3I92A 2VPXA 5JH7A 1FBTA 1BCRA 2DFVA 3FOWA 1NXTA 1ZNWA 1L4MA 1E7RA 2HLHA 2IA5A 4PHCA 2H7VA 4UAGA 4WOBA 3DDOA 4RVNA 2FZEA 4K9MA 1VYUA 1NYLA 2G9VA 5FXMA 5J2UF 4P3PA 2FAXA 4I50B 3ZDEA 2CBGA 1GFZA 1BYUA 1JHXA 4OUKX 2M6KA 3GVCA 4D4IA 4DR5B 4LOAA 5FWAA 3VRHA 3IDZA 1KGSA 4MNTA 4MKRA 1HQYE 2YMMA 4IPTA 1AUXA 2CW5A 1Q7BA 4JDUA 3N39C 3RUAA 4EQ6A 3J7AC 5F9FA 3KTDA 5CP8A 1Q0UA 4DQ0A 5LQMA 4XYLA 1IM2A 3HQ4O 4CEHB 2W6JD 3G2HA 3ABZA 1NONA 1XJWA 3IA2A 1U2EA 3IUSA 3QUTA 4Q3EA 3X44A 4BBPA 2V97A 2I2WA 5ALUA 4HDOB 4WT7A 4JIMA 4GZ3A 4M8KA 4YLEA 4PO8A 5LZ2A 5IM4A 4KBFA 1B6TA 3L5OA 4GC9A 4F5WA 4MDEA 3JXEA 3QVJA 5K03A 2A4MA 1W85B 1MX3A 1EAYA 3HN6A 3PSAA 4G37A 4QYIB 5C8YB 4C0QC 2ZM5A 1RXEA 1QO0D 3SKYA 4CM9A 2CFCA 5JD4A 1ZSYA 5M5BA 2RE8A 2VYQA 5EIAA 3PYMA 1M2OA 3C85A 1T9KA 1UJCA 1XHLA 2J7PA 1VZ2A 3HSYA 3L7IA 3OM9A 2J8ZA 3OOEA 5BR1A 1DWQA 4CM1A 5I3ZA 3QEOA 1VSUA 2IHUA 1XV5A 3G0HA 2CXUA 3DLCA 3IQWA 1HE1C 4FU0A 2PMDA 4F5ZA 4F71A 4XFJA 3ZLTA 4RHCA 2QZJA 3IUQA 1XF9A 2AKAB 2X0IA 3O3MB 2OBXA 1GPDG 4RK7A 4RVCA 4ZVQA 3KQWA 3N8NA 3OEWA 1KC1A 1Y1PA 4GS5A 2P68A 1IQUA 1L7AA 1RWXA 4MYCA 1DZ3A 3FR7A 3VYRB 4AKHA 1EVYA 3AU9A 4H7IA 2YBEA 3M2PA 3PCTA 5J4VA 3K0HA 2Y1XA 3VI4B 3R77A 3MINB 4UZFA 2J5RA 3MJSA 2O2IA 3N28A 2VSOA 3NI2A 3VUEA 2FMTA 1DINA 2D1FA 3GJ4A 1BFDA 1L4LA 2AEJA 2CVQA 4GIBA 2V5VA 4BMYA 4DMLA 5C8VA 4LZNA 1KEUA 3NH9A 4HP8A 4FFDA 1DT3A 3I30X 4PFQA 4PRLA 2PQ0A 4LOKA 4JYZA 3ZWYA 4XQEA 4IDCA 4M55A 1LWOA 1FMFA 4LNHA 2OK8A 4KZPA 3SLKA 3THRA 3UV7A 1KI3A 3QUQA 2OOKA 2QTLA 4P7KA 1SXJA 2H5IA 4BNJA 3ONVA 4M9CA 4Q9AA 1OJLA 2W8BB 3N6VA 5DCLA 2EBWA 3GWZA 1UAYA 4EBBA 4E70A 2IP4A 1EHIA 3ETDA 4NYIQ 4QUJA 2IU0A 1P39A 1Q5PA 1VJGA 3E4CA 4EFDA 4KV7A 3IDAA 4EZEA 4PINA 3ND9A 2CL0X 2MYTA 4CV1A 1FU7A 2FV8A 3WKDA 3EXIA 1ETUA 2I6XA 4DRXB 3WIEA 2Z8YM 3V1YA 4JLBA 2EXXA 3IO3A 3QBTA 4RYDA 4WNCA 3W4IA 4WCFA 1JDBC 4A2PA 5JNSA 1CUAA 3VH1A 1E4EA 1KOJA 3QFFA 4FGUA 4TKVB 3WVNA 2R6FA 5KTMA 3AFGA 1OLSB 1KDVA 3ZH9B 4E2ZA 4AICA 4LXTA 4EA6A 1C8VB 1Q44A 5FYDA 2R00A 1MUUA 3BREA 3JALB 4IKEA 1TO6A 4P3NA 2J08A 2BFEA 3KKLA 4QAJA 1AS0A 4DPLA 3BX1A 3A6PC 2B30A 5JROA 1F20A 4NC9A 1D7AA 4C88A 2WTXA 4F2PA 3JD1A 2IYQA 4TSKA 1J25A 1KRHA 1SEVA 1AKVA 3C70A 3LGXA 2ZR7A 5DZSA 3WDKA 3CO0S 3ZHQA 3OFKA 4DJ5X 1SU8A 1NQWA 4OI4A 4Q7MB 3LFTA 4TZTA 4ZOLB 3FNIA 3R20A 3DKRA 3VVCA 1OI3A 1LPAB 1V7ZA 1KEKA 2HA5A 4ZKEA 4BFSA 1YBAA 4UM8B 3CZCA 3K70C 5U9CA 2QN3A 4RGVA 4LRUA 2MJLA 1KDOA 4LY3A 1R4MB 2NT4A 3QPDA 4N7BA 2QLJA 4NBSA 4IH1A 4XCXA 5CX1A 5LBUA 2Y2UA 4RV5A 4QOGA 3VGJA 2W6JA 4CYMA 1FJXA 2ZJ0A 1U7PA 3L04A 2PS1A 4BYMA 2ACKA 3U3KA 1EUYA 1BS2A 4I4TF 1AA9A 4K26A 2FPOA 3ZNNA 1RJWA 5KOJB 1WLSA 8MHTA 3T6KA 3IE1A 4NDZA 4JP2A 3ZDYB 4MRSA 1IHXA 4W4TA 3ETNA 1Z07A 4HX9A 3ZJ4A 4PGGA 3CN9A 4YUWA 4J6FA 1QCCA 1DEXA 1QO0A 3KCNA 3TLXA 4WBNA 2AD1A 1DJNA 4F72A 1SRQA 2J5BA 2NZ8A 4IRMA 4LC9A 1OXMA 1BHSA 1OYYA 1TUEA 3MJHA 1YIAA 2CLSA 4EL0A 1ORWA 1DGQA 3RYIA 3ZR4B 3EC7A 2ECOA 2NU6B 1EJBA 1YT5A 2XYQA 2V9PA 3D3JA 4W6ZA 2I6TA 3FPLA 1M1XB 1K4KA 1XHFA 3FGOA 4AG5A 1QQ7A 1Z36A 2GYVA 5FPQA 1NF8A 4Z9AA 5K0ZA 4DAOA 1QV6A 4MDHA 1NBOA 1TF7A 1RACA 5BR8B 3I62A 2HJHA 2VP5A 3PP8A 1EFTA 4CWAA 1EGAA 1L5SA 2KX7A 4Y9DA 1FF9A 1T0PA 4YBZA 3HUDA 3MELA 5BN4A 2W2KA 2X77A 1P81A 2N1MA 4E46A 1IWPB 3AERA 3CRNA 3TUIC 4ZODA 4LDQA 2WPNA 2JAPA 3H8JA 3EEIA 1L7PA 1I14A 2Q5OA 3X1YA 3TECE 2VATA 2HSJA 2E4XA 3EX7C 1JJBA 1Y5RA 2RHCA 4PHFA 1GUZA 2H2HA 1M8KA 2NUPB 3RKRA 4URYR 4CUKA 5H16A 3ZXIA 1PZEA 2WD8A 3OJOA 2D6FA 2UZIR 4NR0A 4RIFA 3LQFA 4HH4A 4N7JA 1OAAA 1JFLA 3W6PA 1PR5A 4RFSB 2Y0CA 2NPFA 2WR8A 1I5EA 1J9GA 1XWFA 3RVDA 3VXKA 4DHWA 5JXWA 1ZJYA 4UDYX 5CW1A 1P9OA 4U9IS 1B6RA 1F7UA 4JROA 2AVDA 5ICFA 3IQIX 5BRNA 4EG8A 1VBNA 2F00A 5FA6A 1SZPA 4PZPA 1MD9A 1BNCA 1OLUB 1OUMA 1GYQA 2CV1A 4P7BA 4ZVPA 5BQOA 1JLMA 1X9HA 2ID8A 5DYIA 4S3MA 1ZH8A 2DUMA 4I9GA 1Z8FA 1EVKA 2FUKA 7ADHA 4G09A 4UXIA 2JB9A 4FJ1A 3WWOA 2FDCA 4D6PA 2C59A 1NDQA 4M36A 4ZZ2A 4E51A 4Q3DA 3CIOA 1N7JA 1WAMA 2ZDHA 3BBLA 2QJWA 4UUAA 3S2FA 3WWZA 2Y67A 6NULA 2E5LB 3UGJA 3KSMA 5FBQB 1ABFA 3QE9Y 3M33A 4BNNA 2A1TR 2ZYWX 2ZSFA 2XI4A 1NLFA 1JG7A 4J91A 4PXAA 2VJMB 5EUCA 2E82A 1XO1A 3PDIB 3ZS8A 1YJQA 5TPWA 1IH8A 2O3UA 1EQUA 1G1AA 2FWNA 2R1TB 2I6UA 2XUQA 3DAHA 3W6UA 3ZG6A 3DLHA 3CNBA 3OEYA 4A8JA 3TGLA 4UM7A 1EA7A 1U8ZA 1L3CA 1Z7BA 2XRYA 3ESZA 3A4IA 3HR4A 3D3NA 3OWHA 2IEIA 3ESAA 4IV8A 3G5TA 4B4DA 5A5VA 1ZUIA 2IWHA 3MPOA 5AKYA 1GL3A 4LF5B 3GAMA 5JFOA 2R8RA 1CUYA 2PO7A 3JRWA 1VHWA 4BKMA 3ZVNA 1KIAA 3I4FA 1U04A 1MV8A 1ICIA 1JHPA 2X2EA 1QHNA 1E3DA 5FP0A 1P61B 1V16B 1VLLA 2JJQA 4BBZA 2G9ZA 1VXOA 3HHPA 3QFSA 4OQXA 1PS9A 5KQSA 2RKWA 4TPKA 3OZ7A 4QZVA 3EXEA 2IYXA 5KQLA 2XD4A 2WFLB 5T67A 3R7WA 1M67A 4BRZA 2JW5A 2Z2YA 2GR9A 4W1RA 5EZSA 2Y2VA 4Y9TA 1Z17A 4DR6B 2IXBA 1EB9A 2ORWA 5K3BA 1TKCA 4BNDA 1SXGA 1U6IA 4AJ4A 4IHJF 1Y5LA 4MUHA 1USWA 1DQRA 3T1VA 2QL9A 2B6HA 2E5FA 4QFCA 2EIHA 1JLRA 3WRYC 1EXMA 4MUAA 4X6YA 4B35A 4RADA 3OKFA 1I7QB 2XJ9A 1QZTA 1JN0A 2CLKB 2RBKA 1JG2A 1SBIA 1XZLA 1EXWA 1E9AA 5K4GA 1TD9A 5FBRB 2V7GA 3T35A 1O5TA 4II7A 2YICA 1ABEA 4CV3A 4JOQA 3VOAA 1K63A 1PT5A 2H4XA 1VG0B 3OTOB 4AZ3A 1RNLA 3LQKA 3L7NA 4IJMA 1Z5NA 2VPWA 5AKKA 4D6YA 4FSDA 3P9SA 4GFDA 4L5CA 3F46A 3D2AA 1OFHA 3THYA 1AZWA 4E4RA 5K6RA 4RD0A 2BGIA 3JQ9A 4IDHA 1ZK1A 2GCOA 3PQ2A 4BV2A 1GG9A 4Z3KA 3C8ZA 4BV3A 1E9CA 1HT2E 1GQ2A 1XD9A 3LYHA 4OU5A 2QNIA 4X63A 1LUAA 1W93A 3UCXA 5H4GA 3LTNC 3T9CA 1XD8A 4ESHA 1A2OA 2IYRA 2XWSA 4HHEA 2HJSA 2I3AA 4LGMA 5HMMA 4DMUB 3W5BA 5DNUA 1YKGA 4UXJA 2A3RA 3ZUPA 1ZR2A 2GEVA 2NYAA 1A97A 2PPLA 3LI2A 4UZSA 5AM0A 1LC0A 1EFRD 1SBYA 2I62A 4MIYA 4CF3A 3UHJA 1KFBB 3MLEA 5AW5A 3PQ7A 1NNUA 2GNAA 1SQ6A 1UZLA 3EDCA 1CNMA 1DFHA 1PIWA 1GZ4A 2WUVA 4MPRA 4S1VA 3VHQA 4AZWA 4CTKA 1TM2A 3AHGA 2X0FA 4S35A 1PVVA 2LZ0A 3EN0A 2ZIGA 4Q93A 2W71A 4X45A 3A9SA 2ZVPX 3DQZA 2JLQA 2BUAA 1HL3A 2UV8A 5AUNB 2YH2A 5HUJA 4N8SA 2ABWA 2ZIFA 3GGJA 4JI6B 2ZUFA 1M0WA 2UZ1A 2QXTA 2SHKA 1JSRA 1TB4A 1UJ6A 2BC9A 2BJHA 3SD7A 5BN4B 2DR2A 2YZ7A 2COEA 1KVSA 2IPOA 3E61A 4UTOA 4XZ3A 5A9SA 1CJBA 4DG5A 2O6HA 4R7TA 4B2YA 2Y1WA 4PSVA 4UPVA 4B3FX 1IAVA 1V5EA 2AR0A 2W00A 3AOEC 3LAWA 4R5HA 1FUYB 4KRGA 1COZA 2RH4A 2CBZA 4LJAA 5CXXA 2ZQZA 4AUKA 2QG4A 4TOIA 2DCMA 4DC0A 3LXMA 4G84A 4BN0A 4YCAA 4X20B 5KBYA 3K70D 4TTIA 2DLDA 2ZUEA 1IY8A 2GDJA 3S7TA 5BW8A 2R48A 2BHNA 1U94A 4MS3A 5HM8A 5AW4A 3KJHA 3GYBA 1NG1A 4XWYA 3ANTA 2GBFA 4JSYA 3RUHA 3MA0A 2MWMA 2F62A 3KUCA 4DHEA 1R6UA 1G4AE 3AILA 5AVRA 5JYCA 1TYAE 4HTFA 2P4UA 4D0GA 3IDFA 3LYLA 4GPD1 4BLVA 4NRDA 1W6RA 2C82A 2VUHB 4MPJA 3SBXA 2VH2A 4Z4CA 1T34A 4X1OA 4DDHA 4JVSB 2I65A 3W0LB 3SFVA 3WLPA 2HRDA 1RSZA 3A3NA 1ZOOA 2JFVA 3VAAA 2W2LD 4CF4A 4V1CB 1I94B 3HJCA 4IZIA 5KHLB 4CM3A 4MB2A 2BISA 2BKEA 1DAMA 1EP2B 3P27A 1SQSA 1N9GB 1UOPA 1OYVA 2J4FA 5K0EA 3I6QA 3IGFA 4QUHA 1NQUA 4M1WA 3UATA 1XRQA 3QX3A 2C0PA 2X0KA 1G5HA 1K6EA 3GRKA 3TPCA 2J9ZB 3NTXA 3LS2A 2Q5LA 4KREA 2TMDA 4LV5B 3ZV4A 1I2BA 2DRIA 3NHYA 5I9SA 2LWIA 2BR5A 3DOEA 1Z5ZA 4K9LA 1UF9A 1T9AA 2Q1XA 1XA3A 3ZHBA 1X1AA 1NF2A 1V7CA 3BTSA 3NIDB 3UYLA 4G24A 4ENSA 4HI0E 3HNPA 3Q2IA 2V7EA 4W63A 2B9VA 3OUTA 4M0MA 5JPIA 4OU4A 1AM4D 3TI7A 3AVYA 3IVGA 2AK3A 4HO1X 3GL9A 3PKIA 5JMWA 5BW6B 3KR2A 4AIIA 4R05A 2B8NA 3I53A 1UMCA 3ELWA 2B1QA 4KP7A 5CCDA 2WY2D 2HNKA 3EVEA 3U7IA 5IX8A 1G59A 4Z7OB 4YPFA 1T8SA 2GWRA 4FEGA 2VTEA 3GJ7A 4HZUB 3L4EA 2JFGA 2I29A 2NYUA 3EBLA 1N5LA 4IH9A 1GU0A 1BZYA 3HZHA 2WT4A 4G89A 3JX9A 3O91A 1U2PA 3H11A 3H2KA 3HWRA 3USCS 2AFIB 5FULA 1QWOA 4DWJA 3EGVA 1UBKS 3M6IA 4QGBA 1YE8A 4XOIA 1YNSA 4HXGA 5D7BA 5DLQC 3D1LA 4RU1A 1Y7IA 1MOZA 4JVLA 3QPUA 2Q2QA 3A9VA 4TQ9A 2FW6A 1JDUA 4HFJA 1PU2A 3TSWA 1MABA 3OUUA 4NBKA 3HCEA 1KK0A 1EFRA 1ODTC 1SURA 1UDXA 2FW9A 3FJOA 3G17A 3L0CA 1JE1A 2XUGA 3ND5A 4G0ZA 5CVVA 3HKBA 3Q5EA 1LPOA 1T24A 3D3WB 4OA5A 5C1DA 3RNOA 4ENWA 1ILWA 1ZVJA 3TRIA 4MS1B 3RRXA 2A1TS 2N42A 3OZCA 4DNXA 3M4YA 4K6KA 1TK3A 2PZKA 2XZLA 1GARA 2VTKA 1KP9A 4K9PA 5DNEA 4F2GA 5JD5A 3EQ6A 1HOXA 1PR1A 4JI2B 3V4PB 4PZ9A 5KOHA 5F1KA