4CM9A

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
267
structure length
249
Chain Sequence
b'EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE 1
molecule tags Oxidoreductase
source organism Trypanosoma brucei brucei
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
total genus 88
structure length 249
sequence length 267
chains with identical sequence B, C
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cm9A00
3WTBA 1FDTA 1I30A 2VT2A 1I0ZA 3TL2A 1BW9B 4YQZA 5AXCA 4NK5A 4FN4A 3IS3A 5DT9A 1EUDA 3HN2A 4Q9NA 2RH8A 1YBVA 4CM5A 2EP7A 4HY3A 1YDEA 1MA0A 4W7HA 4IDCA 3IIEA 3E82A 1A72A 4R69A 3ITKA 3TNLA 4DIBA 1E3LA 4CMBA 1U3TA 1M66A 2G17A 3JYQA 3IOYA 4PRKA 4WASA 1DXYA 3VZSA 5L9AA 4MO2A 2WYVA 1G0NA 2X86A 3PK0A 3L77A 5G0VA 3V1YA 3NDJA 4RPJA 4BNGA 4D3DA 2B83A 1Z7EA 1V0JA 3QQPA 3HFGA 1GYRA 4YJHA 5TJ9A 3JYPA 3ZV5A 3HSKA 3K73O 3GQVA 5G0WA 4I08A 2Y93A 3B70A 3GDOA 3NRCA 2EEZA 2X8LA 1V6AA 4DA9A 1ISGA 2OUIA 4BO4A 4DL9A 1NFRA 1DC5A 2AMFA 5F1OA 1PL6A 3AUTA 2YFHA 1CWUA 5H82A 5U9CA 5A9SB 3U49A 4B4OA 3JQAA 3IAHA 4R51A 5A5EA 1GZ4A 1SAYA 2R2GA 2PFGA 1PGNA 2X9GA 1HETA 1ZEJA 1YBAA 3E48A 3WDSA 4ZQHA 3AOEA 3X2EA 3GDFA 3I9LA 1X7GA 2Y66A 1LSUA 4WOKA 3WB9A 1T2AA 3QVXA 4AJLA 1W6UA 3KYCA 2JD0A 1MG5A 4MIOA 4CODB 1FMCA 2VHVA 3BYZA 4OM8A 2HDHA 4AG3A 4QUKA 1P31A 2G0TA 1PJ4A 3B20A 3FTNA 4RCVA 1I2ZA 2BHLA 1U7HA 4XR9A 2POQX 4W9NC 4NBVA 5KNLA 3AY3A 1ZSYA 4ZHSA 4WUVA 3GLQA 4E6PA 4K6FA 1DAOA 1ZXBA 4NFHA 4RF3A 1ZMTA 1NVMB 1ZKMA 3ZH2A 4BQRA 1G0OA 3WLFA 1C1XB 3WIDA 4BKRA 3S2EA 4HKTA 3BIOA 4DBVO 3D3EA 1E3JA 1ZZEA 1H5QA 3OEYA 5KJFA 2Q2QA 2GD1O 4TVOA 3NYWA 1L7EA 2DUUA 3GVPA 5BNTA 3ENNA 4WE3A 4J7UA 4IGEA 2ZYAA 2Y1DA 3T4EA 4DC0A 1SB9A 5AYVA 2J5RA 1QXSA 4G2NA 1H6BA 2H63A 3COSA 2O48X 3OIDA 3OECA 3ETEA 3U4HA 1N8KA 4FFPA 2AQIA 3GVIA 1SO8A 1P1HA 4MPDA 3PHIA 4NBWA 3I5MA 1OBFO 3JQAD 4XA8A 3KOUA 4HFRA 4ALMA 3OH8A 1C1DB 4GKVA 1K6JA 3KRTA 1E5QA 3M1LA 4CV1A 4CM9D 4R68A 1NQAO 3PLNA 4Z9FA 1KVTA 3ZGYA 3TDKA 3H9UA 5CHEA 2W98A 2C5EA 3QHAA 2PLAA 3DFZA 4MKRA 3MJVA 1W0CA 3AM4A 3VKUA 4H15A 3L4SO 4R41A 3NUGA 5A02A 5FEUA 4LRTB 4Z9XA 2CVZA 5J23A 3BMQA 3QJ5A 5LCXA 4BNWA 1R16A 4EZBA 1VJ1A 2OHXA 1QRRA 5BR7A 4QQRA 4PVDA 3S2IA 4ZQEA 3QWBA 3ZWBA 5I9MA 1WAMA 4BNMA 2YHUA 2NSDA 3WIEA 3DHEA 1FJHA 1CJCA 4XYLA 1DRVA 2A4KA 3FTPA 5H83A 5JAMA 1EQUA 1YJ8A 1ADFA 4P22A 4WCFA 5G0TA 4OXKA 3ZHZA 1H6CA 1N1GA 2AQ8A 4E13A 3AI2A 1LSSA 2CVOA 3U62A 3BZUA 1DSSG 3K92A 4L4SA 4E5PA 3PWKA 3LLSA 1V9LA 2OFPA 3I1JA 3Q6IA 1S7CA 3O03A 2VT3A 4N5LA 1T2FA 3C1AA 2CD9A 3GMDA 1Z82A 5GY7A 4JXKA 5B4TA 4L4RA 1LNQA 1Q7GA 2G1UA 2GZ1A 4BO8A 4CR6A 3QVSA 4FIZA 3WSWA 1RYEA 4PZDA 2X0JA 2O4CA 4XRRA 4DIOA 1I24A 1O89A 3QLJA 2WSBA 4GPD1 3MJSA 5IF3A 1P33A 1BXKA 2WWRA 2YV2A 3JCZA 1IY8A 1XR3A 2IXAA 1CRWG 1E7RA 3KSUA 4ZRMA 2C2XA 3TFOA 3RBZA 2VOJA 3PJEA 4RGBA 2HSDA 3OA0A 4F46A 4YAKA 4YB8A 4TKLA 3ST7A 1AXGA 1E1MA 1ENOA 1GYPA 4GL4A 1L7DA 3U4IA 4XZ3A 3LT2A 1J5PA 2EW2A 3JV7A 4TMFA 4E12A 4FR5A 4NQZA 4U7WA 2C29D 2GYYA 4WLFA 4NFYA 4OIMA 4F3YA 3PQFA 3ZV3A 4PG5A 5F5NA 3UOGA 3UCEA 4Z3KA 2O3RA 4IDGA 1VPDA 3BXXA 2Q2WA 4PLCA 2C54A 1YRLA 1O6ZA 4J91A 4W7IA 3DBVO 1Z7BA 4KQWA 3RWBA 4YT4A 4IIUA 2D8AA 2VYNA 1JWBB 3NEPX 2BRUA 8LDHA 2V6MA 1ZMOA 5BNIA 1LTHR 4KOAA 1QYDA 1N2SA 4B3JA 3I9JA 3KHUA 3GNSA 2C2YA 4KUEA 4P4NA 3C24A 2ZTUA 2I3AA 2LDXA 1XKQA 3PQDA 3VDQA 3OQ1A 4E5YA 2PKQO 4TZKA 1NXQA 3AFMA 4NK4A 4ZA2A 2AA3A 3TL3A 2OL4A 2J6IA 3JQ7B 1E3EA 3G79A 3PI7A 1BSVA 2X0NA 3GVCA 1GR0A 1H0KA 4YPOA 1C14A 2FPIA 3D4NA 4U8GA 2EWMA 4CMEC 3HN7A 2BKAA 1GZ6A 3AFNA 4WECA 2Q2VA 3OF2A 3C8MA 2PA3A 4DPLA 4KMSA 4HNHA 1UXGA 4AJNA 1E3SA 4KDFA 1LDEA 1GY8A 3E8XA 4E5MA 1UAGA 2D1YA 2NU9A 2VWHA 5COBA 3FBGA 3SX2A 1CQJA 4YJDA 1QP8A 1HE5A 4WCDA 3KZVA 4ZQBA 4NBRA 1QV7A 1ZIDA 2ZJ0A 4J9UE 4QEDA 1KC1A 4FQ8A 1N7GA 1KOLA 1ISJA 2W4QA 1U5CA 2GRAA 1LDNA 1VSVA 4YWJA 3RBVA 2GN4A 2R00A 4LGVA 5TS3A 4A0SA 4ALNA 5IDWA 3KO8A 1GAEO 1X15A 3QY9A 2J3HA 3OP4A 4MVJF 2PZMA 1ZK0A 4D43A 2VWGA 2W90A 1OI7A 4ZRNA 2DTXA 1IZ9A 1EBFA 3WGGA 1LRLA 1R6DA 2V6BA 1EVJA 4RVSA 1EK6A 2ZK7A 3GHHA 3L0DA 3PJGA 3TFQA 1CQIA 2B5WA 3MTGA 3Q1LA 2DQ4A 3PHHA 3TPCA 2VHWA 4TROA 1YL5A 1NTOA 2XF8A 4YJFA 5EMHA 5L53A 1I2CA 2C07A 4RPHA 5TT1A 3RIHA 3D3WA 1SMKA 3K2BA 3L4BC 4BOYA 4M49A 4XYGA 3BMNA 1JDJA 1O9BA 1YOVB 4HWKA 3WLEA 1D1SA 3GGOA 2GNAA 1PJSA 1M6WA 1KIFA 3I9OA 1E92A 3RUAA 5LC1A 4JJGA 1KS9A 3EZYA 4RVHA 4M55A 3DAPA 3GPDG 3GEGA 1SC6A 4O59O 4KWHA 3WS7A 4DTIA 3H6KA 3OHSX 1PWXA 3TZ6A 1YXMA 4CLOA 5HA5A 3LQFA 5CAEA 2VCYA 2WDZA 3C1TA 4I9HA 1DBVO 1CIVA 2ZYGA 4AFNA 3OETA 2Z1NA 4O1MA 3I9NA 4JBGA 3VPFA 3DAGA 1TVEA 3WYCA 1UDCA 2OORA 3UW3A 3E9NA 1S6YA 2IE0A 3DBLB 3HFSA 4IS3A 4Z0PA 3WMXA 4ZJUA 4Y9DA 3D3WB 4OOFA 4GSLA 2DC1A 3DL2A 3E5RA 3JYLA 3PPIA 5IG2A 2ZB4A 5JAIA 1PGQA 3IDSA 5COQA 2UAGA 1N7HA 2AE1A 3Q11A 4IS2A 1WNTA 3A06A 6ADHA 3EY4A 1Q0HA 4J1QA 4D41A 4FS3A 3RUHA 4MDHA 3DZFA 1VJTA 4KDEA 3WGZA 4B7CA 1RJWA 2X7HA 1VM6A 5I8WA 1KVSA 1R4MA 3JQ9C 3AY7A 5ENDA 3W4KA 3EYWA 4CM4A 2RH4A 2J5QA 4FCCA 3JD2A 5JXWA 5ENVA 2Q49A 3OQBA 5CDYA 4BNVA 4LW8A 1GU7A 1YB5A 4JLWA 1ZXLA 3HDYA 3ROMA 1B8PA 2OGUA 1ISMA 2E37A 3VZQA 1X1EA 1I3NA 4OGWA 2FZWA 1PL7A 5JDIC 1GTMA 1ZH8A 4FJ0A 5TRTA 3GY0A 2Y1GA 5G2OA 4PZCA 1U8FO 3M6IA 1NPTO 4MIEA 1ULUA 1E1KA 4YAGA 3QSGA 1LLUA 1U3VA 4RQTA 3CINA 3QP9A 1LLDA 3JD0A 5GMOA 4NR0A 1LX6A 3GNTA 5JCXA 4HP8A 4IDAA 4FSHA 1E7QA 4A26A 2V6GA 3QWIA 5A03A 4EJ6A 2B35A 4IQ8A 3CPSA 4CM6A 4I9NA 2PV7A 1DLJA 3H9JA 3RUDA 3OJOA 4G65A 3MJCA 5C5IA 1YDWA 3WYEA 1EEHA 1AHHA 1BW9A 4Q3CA 4JX8A 5JLAA 4R9SA 9LDBA 2VUTA 4J90A 2D3TA 3L9XA 3UUWA 3WNQA 5ILOA 3GHYA 1N1EA 4PGFA 1MC5A 4XIYA 4PG7A 1ZCJA 1MLDA 2YYYA 3DZHA 3R3JA 4U6QA 4ZQGA 2EW8A 1R0SA 1WMBA 3A28A 3E9QA 5TT0A 4BNHA 4CLOB 3KVOA 4WEOA 2GSDA 1BG6A 5DF1A 1HDXA 4XB1A 3R6DA 3PIIA 3JD1A 1VL8A 4NJMB 1JU9A 1EE9A 1PGOA 2O7SA 1TLTA 5CG1A 3PHLA 4OH1A 5HM8A 5JNLA 3O8QB 1HKUA 1XIVA 4C7KA 3Q9NA 2FN7A 3QW2A 2CVQA 2PGJA 3FI9A 4FPXA 4Z6KA 4CUJA 4CMHA 3RC7A 2Z1MA 1XELA 3A4VA 3KYBA 2VTEA 1EVZA 3H7AA 4N5MA 2B69A 2P68A 1LLQA 4HV4A 1X13A 1NR1A 5CP8A 4B3HA 1GZ3A 1MX3A 4O6VA 5L7YA 4AVYA 1ZEMA 1QYVA 1UXKA 1P45A 1LDGA 1ISIA 1QLHA 3H65A 5DBGA 1QV6A 3SC6A 1BDBA 4IJWA 1GPJA 2JCXA 3WXBA 4MVJE 3V1UA 1X0VA 4IY1A 1LQUA 3GA0A 3ZNQA 4DIFA 2HQ1A 1ZBQA 2UDPA 1FK8A 4BNZA 1AUPA 3WNVA 1FDVA 4FD3A 5IJZA 1HZZA 4TRJA 3ZDFA 2JHFA 3WTCA 1GPDG 1TEHA 4Y6PA 3AWDA 4R3NA 3D5TA 1ONNA 2VRCA 4WLOA 3JQFC 2YQ5A 2JFGA 5MGBA 1WW8A 4RPLA 1ZW1A 1ISFA 2AQKA 2CZCA 4D0RA 4DGSA 3GUCA 1M2WA 1H6DA 1U3WA 3GMSA 5IDYA 4YDRA 1UP4A 3GC6A 4PLZA 2YV1A 4IDEA 4I9UA 4LMPA 3KEQA 3G17A 4E0BA 1I3LA 1ZFNA 4AL4A 4RVGA 2NU6A 2EJVA 4FFLA 1DDOA 1H2BA 3RJ9A 4R16A 3ZU2A 2BI8A 1LC3A 1NPDA 3WFIA 4RLHA 4BIIA 1GCUA 5IZCA 3KSDO 1AXEA 1DOHA 4M89A 4BL5A 2IZ0A 1J0XO 3VDRA 5THQA 1SB8A 1EVYA 1YWGO 7ADHA 2QIOA 2Y1FA 3PYMA 1IZ0A 3F4LA 1HDGO 4MJLA 3FNEA 5KOIA 5L4NA 2WM3A 1PS8A 1KVRA 5L4LA 1F14A 4MP6A 1ZK4A 4S1VA 3ADOA 4BO1A 1D7OA 5DBIA 4WLVA 5AVOA 1HL3A 5JO9A 5L95A 4Y6RA 5G0SA 2BMAA 5L7TA 1HEUA 3HZZA 2ZIZA 4HUJA 4CR8A 4FDAA 1HLDA 5B1YA 4MKXA 2P5YA 5TGDA 1H9AA 1DRUA 1CF2O 3GGGA 4GLOA 1VL0A 2EG9A 2X0IA 3GFBA 2NVUA 4LSWA 5ES3A 4DVJA 3BMOA 5KVCA 2WJPA 5H81A 3WSVA 4M86A 1LDMA 2JL1A 3CH6A 1HYGA 4Q39A 4GSKA 4BGIA 2BLLA 3AM5A 3RVDA 3NT2A 3TN7A 4E33A 3OICA 1NQOA 3EDMA 2Q1WA 3GRPA 4PLHA 1BXGB 4EGFA 4P38A 1ID1A 4B4UA 3DMTA 3ZU5A 1LJ8A 1BWSA 2XOXA 4UEJA 2Y1EA 4JGBA 3KSZO 3R3SA 5GZ6A 1UZLA 4A7PA 5ICSA 4CM1A 5T6BA 3AUSA 1J6UA 3U09A 3VOSA 3IJRA 1E3WA 3NDRA 2Q50A 5TC4A 2D0IA 1HWYA 2IZ1A 2DVMA 3PDJA 3W1VA 5JCJD 1K89A 3KYDB 4CL3A 3WWYA 2HK8A 4J9VA 1A71A 3AM3A 4PLYA 1PS0A 2VYVD 1XQ1A 2XXJA 3JQFA 1DPGA 5U4QA 4U5QA 5CFZA 4JN6B 4CM4B 2I9PA 4EBFA 3FNHA 1W73A 5A04A 1SZJG 1FF9A 1ADGA 1DIHA 4HXYA 3IJPA 4R54A 4XYBA 1CETA 3OJEA 1RM4A 1VKOA 1NASA 2EJWA 3BA1A 1PJTA 1A5ZA 2VHZA 4ZU3A 4ZD6A 2I76A 1U28A 5AQ1A 3H5AA 1K3TA 1UP7A 2ZYDA 4RF2A 5EN4A 4HFMA 4DC1A 5JYEA 2UUOA 2EIHA 1MC4A 3AOEC 4O63O 5FI3A 4BV8A 2EP5A 5IAAA 2O7QA 3FPCA 4BNJA 4FGWA 4C7JA 4N5NA 3O8QA 4CJXA 3C7CB 2VHXA 4X54A 3W4IA 5KJ6A 1Q7BA 2ZJ1A 3QWFA 4YTEA 2C0CA 3WG9A 5HS4A 2HMTA 1V3UA 3LC2O 2Q1UA 4XGNA 4DQXA 4CQMB 1ZK1A 3BTUA 1ZK3A 1OFGA 3DTYA 4L76A 4IDBA 4EDFA 3GZNB 3U3XA 2HK7A 4A27A 5KKAA 3PFWO 1SCUA 4EEZA 1LDYA 1OAAA 1NPYA 1T2DA 1P0CA 2A35A 4WLUA 3T7EA 1LUAA 1RPNA 2DLDA 2DM6A 4ZICA 3AUUA 2PY6A 4HBGA 4BNIA 4BGVA 3RUFA 1SNYA 4KWIA 5CDTA 4EJ0A 1F0YA 3JSAA 1ZUD1 3AJRA 4QSMA 3EHEA 4W4TA 2Q45A 5IDQA 3SVTA 3A9WA 1T24A 1N92A 2DAPA 1B3RA 5HWSA 3TQHA 3F1KA 2VNSA 5TX7A 2ILTA 3GAZA 1P74A 3FRJA 1H9BA 2HU2A 3MTJA 5T5QA 4KTTE 1GQYA 1B3BA 3LK7A 3GF4A 2R6JA 5DOZA 1ZJZA 1LI4A 1D4FA 1C1DA 4E2XA 2CDBA 4AJHA 3QIVA 2B0JA 4DLBA 4II3A 1C0IA 2ZTLA 1ISHA 1YH3A 3KEOA 4MOWA 3D64A 4RVFA 1HYHA 1WWKA 3OFSA 3W6UA 4J7XA 4CLRB 3FR7A 5KIAA 2DTDA 3NTRA 4J16A 4D3SA 1NX6A 3BTVA 1B16A 4YJHB 2FMUA 1E7YA 4BHTA 3UFXA 2ZQZA 3O9ZA 1E0DA 4D46A 1R4NA 2C7GA 3JD4A 4ALKA 2YUTA 2X22A 3D7LA 3ZHBA 2WEKA 3ENKA 8ADHA 1LXCA 4J2OA 2NVBA 3INTA 5EESA 4B8ZA 2JJYA 1GDHA 1WZIA 3UVEA 1U2DA 2ZB3A 1KVQA 2NWQA 3EC7A 3CIFA 5C3MA 2AG5A 2YW9A 4BO0A 2NVWA 2RHCA 4RDIA 4YCAA 4EUEA 1XCBA 4P8RA 5ICMA 2FPPA 4FJ1A 4YT2A 4EUFA 1E7MA 3RUCA 4BVAA 4L73A 5F21A 1P1IA 4YRAA 2PZJA 1ORRA 3LLVA 3M2TA 3F3SA 1ARZA 1EVIA 2DPGA 1PQWA 2GN9A 3TF5A 3F5QA 4LISA 3I9KA 1V35A 3QVWA 3NV9A 4E4YA 5HTOA 5BSGA 3WBBA 4RJTA 1NVTA 4AJIA 3M1AA 1U3UA 4DPKA 1VL6A 3PGJA 3D4OA 5A1TA 3ROPA 2W2KA 5FWNA 1NFFA 5EINA 2WTBA 4YA6A 2Y0DA 2HMVA 5I8ZA 4CLEA 1YQDA 2FY8A 3L6OO 3QRWA 4R3WA 3RU7A 2BFOA 2P5UA 4DLAA 3JQBA 2X6TA 3CZRA 3PIDA 3GVXA 2BH9A 1LRJA 1WP4A 3PRJA 1KEVA 3AY6A 4DYVA 1T1SA 5EL0A 3H5NA 1EQ2A 4PG6A 3Q9UA 5JSFA 4YRDA 2Z95A 1DLIA 1YJQA 2F00A 3PP8A 4BKOA 5AXDA 1HF3A 3H3JA 4GBJA 5C7LO 4NNJA 2PKQP 1NQTA 3JQAB 4NZ9A 3E1KA 2EKQA 4FOSA 4CV2A 3WQRA 3NGLA 3DTTA 4P4GA 3RCBA 3H9QA 4Z9YA 4ZQFA 5G0UA 3SEFA 4ZGWA 1W4ZA 5JY1A 4MVJP 3ICPA 1XQ6A 1IPFA 4H7PA 3WX0A 4YAIA 3CEAA 1HDCA 1JKJA 1A4IA 2CF5A 3DBHA 4CUZA 1K0UA 1UJMA 1NWHA 2ZB8A 1I01A 4XJTA 1PJLA 5AXAA 5C7OO 5L7WA 3RQSA 2D5AA 4WKGA 4EUHA 1Y6JA 1E1LA 1GUYA 1H6AA 4J49A 1NR7A 5G4LA 5TF4A 1LSOA 2D59A 2YY7A 2A9FA 1XU9A 1YS4A 2E6UX 2JHGA 1T2EA 1E3IA 4J43A 5K6AA 3GRKA 3PVZA 3DBHB 1ML3A 2B4RO 2GASA 1PSDA 1PL8A 3ZW9A 2Y68A 3B1JA 3CZMA 2G76A 3JQCA 4DPMA 4OHUA 2DTEA 4ZVVA 3VH4A 4FJ2A 2ZB7A 2QQ5A 2VZ9A 1E1NA 2W8ZA 2GLXA 1Q7CA 4XJSA 3HDQA 5BQFA 2YQ4A 1YL7A 3MJ4A 2O4UX 3L6DA 3I4FA 3OSUA 3LT1A 4R9RA 4BS9A 4DREA 4CM8A 2I99A 1A4UA 5L40A 4J3FA 1YO6A 3PQEA 4RVUA 5CEJA 4OYRA 2YDYA 5EIOA 2BF7A 4IQ0A 1OOEA 1NHGA 2JFHA 2UV8A 3H9EO 3FCOA 3D5QA 2WD7B 2V7PA 3FNFA 2VZ0A 6LDHA 4D44A 1GQQA 1EK5A 3QWAA 5JMWA 1DFHA 1C0PA 3WMWA 5FF9A 4XDZA 1OC2A 4IZHA 5TNXA 1BRMA 3WR5A 2BD0A 3ITDA 3WICA 1I10A 1QKIA 1NNUA 1NP3A 1DC6A 4NH4A 2X23A 2YV3A 2OOSA 1IL0A 2IYPA 2OBYA 5U1PA 3FSRA 5I7EA 4WJZA 4J2HA 4M1QA 4BNXA 4R1TA 2QRJA 1WDLA 2X5KO 1LLCA 2Y1CA 1ONPA 3JYNA 1GCOA 1A7AA 1JQBA 4O5OA 4YACA 2PTGA 3FNGA 5L3ZA 3ROQA 4IM7A 4L8VA 3PWZA 4CM9A 4OOEA 1ZJYA 1RYDA 3EGOA 3KETA 5K9ZA 3SLKA 3GG2A 2SCUA 1UDAA 1Y7TA 3GFGA 1SOWA 3LYLA 3F5SA 3DBRA 2PD3A 2DBZA 5EJ2A 1UP6A 3TOZA 1ULSA 5KKCA 3R1IA 3HJAA 1N5DA 4JROA 4LMRA 4JJIA 1BHSA 1W8DA 3ETGA 5K6AC 1VJ0A 2BFMA 1B8VA 2FR1A 3DQPA 1T4DA 3MCVA 5CDSA 4NJOA 4QO7A 2I5PO 3JQ8B 3HE3A 2BGKA 5JMPA 4E21A 3NTQA 5LDHA 1R37A 2BFAA 3GUYA 2PGLA 2VYND 1NWCA 2X1HA 4LVCA 4NPCA 4WCFB 4UAGA 3OMLA 1YBMA 3ORFA 2HAEA 3NJ4A 3UN1A 1ZK2A 2VRBA 2IEBA 3K30A 4E3ZA 3ZNNA 3DXFA 4OSPA 4AJOA 1PZEA 3JQ7A 1BMDA 4OAQA 1B8UA 3DZJA 2PD6A 1NAHA 4UUNA 4R1SA 2C82A 4ILKA 4BUCA 1QG6A 1U7TA 2B37A 3NGXA 2FHSA 4J7CA 1VRWA 3F46A 4CMIB 3RUEA 5JC8A 1BXGA 4DQVA 3F9IA 4IQGA 1VI2A 1FDWA 2HRBA 4YT5A 1B14A 1X1TA 3CXRA 3KM0A 3Q2IA 4A10A 1H94A 1FDSA 3FWZA 3BMOB 4NU6A 2Z5LA 4UVDA 4E2ZA 2TMGA 1GL3A 3NJ8A 4BO6A 1A7KA 2E49A 2HKIA 4HADA 2NV6A 1E5LA 1EUZA 1Y81A 3BMQB 3H9GA 3STHA 1DO8A 1UXHA 4UEOA 3ZNOA 4RLSA 1PGPA 5KTKA 3TRIA 1QMGA 3VAZA 1GD1O 1UDBA 4E2WA 2QW8A 1E77A 3ZV6A 2JCYA 1JVBA 1HTBA 2Y99A 5A05A 3ANLA 4WOJA 3OM9A 3R0IA 4ND4A 2VUSA 3TWOA 2DBVO 4Y8VA 1EBUA 4EYEA 3GZ4A 4Z3DA 1HDRA 4MVJH 3INRA 4MIYA 2NTJA 4GX1A 4WLEA 2I67A 2I65A 3RROA 2B4QA 2QZ9A 3IC5A 3VVBA 3S8MA 2NADA 1R4MB 4QX6A 3D0OA 3SJUA 2RBEA 3DOCA 3T7CA 3CMMA 4RO0A 3F6YA 4K9DA 3BTSA 3JQDA 5IXSA 2HK9A 1D8AA 4RORA 1NM5A 4UVIA 1BVUA 2X58A 3FPLA 5A5FA 2P9CA 3ZWXA 1Q0QA 4YJFB 4GAEA 5JDCA 3CUKA 3NAQA 4ND2A 2B5VA 1XYGA 4TWRA 4LSMA 1UH5A 3BHMA 3D4PA 4K1LA 2HUNA 2Y1OA 3JYOA 4YRBA 2PZKA 3NX4A 5KVQA 4RDHA 4YAJA 4FBGA 3I6QA 4YR9A 3GOHA 1E6UA 3PGXA 2CDAA 3PFFA 4QFDA 4U0JA 1UR5A 1U1IA 4NBTA 2P91A 1C1XA 1T4BA 4CLRA 4FGSA 1CEQA 3OBBA 2AE2A 3LC7O 9LDTA 5KCZA 4Q3DA 2NQ8A 4E5NA 3PLRA 3DDNA 3WOHA 2QZZA 2UVDA 4CQLA 5COAA 3C7DB 4YYZA 4KUHA 5TQVA 4U0KA 3RAJA 4B7UA 3QE3A 5C37A 2ZATA 3KB6A 1B0AA 2H1SA 4OJNA 5JFOA 4KP7A 1FXSA 4B3IA 3FN4A 4CMJA 1P1KA 4FFRA 1KC3A 2WYWA 2VZ8A 3K8ZA 2H9IA 2QYSA 1LDBA 1YVEI 4A5OA 2EGGA 2PK3A 5IZ4A 4I5GA 5TJHA 4BQPA 3BAZA 3EUWA 1X7DA 3K5PA 2NM0A 2O50A 1JW9B 5MDHA 2GERA 2P4QA 4XIJA 2V65A 2HMWA 3L9WA 1LSJA 4XKJA 3WFJA 1RKXA 4GMFA 4Q3BA 2IZZA 3IUSA 3EVNA 3BHIA 2O3JA 3P5SA 4ROSA 2H6EA 2LDBA 3PEFA 1JA9A 4GKBA 4B8WA 4G5HA 1WXDA 1R12A 3FF4A 5JE8A 1JWAB 1KERA 1Z75A 1I3KA 4KQXA 1P9LA 3VPGA 1KEPA 2EGHA 3SLGA 1BTOA 1WVGA 2PH5A 3DWFA 2EF1A 1I3MA 3S2GA 2WD8A 3ZWOA 4K26A 4XEHA 4TRNA 4Y6SA 1ADCA 2I3GA 3PYLA 1G1AA 3AK4A 4R01A 3GEDA 5EQDA 2C5AA 4CPDA 2FOIA 1UZNA 5L45A 4OQZA 2E4AA 2GO1A 1B2LA 4GGOA 3A1NA 4BGEA 4UREA 1MFZA 2EXXA 3I83A 4L9RA 4E5KA 1BGVA 1DIGA 3O26A 2D2IA 3V8BA 3ZU4A 3BMCA 3RJ5A 2GF2A 3DC2A 3TSCA 1T1RA 1BXZA 1MXHA 2O3UA 1R66A 5CPFA 4JCOA 5DOVA 4BO2A 1ENZA 5JAZA 2CSUA 3GT0A 3KUXA 3VZRA 2OP1A 5CEEA 3HHPA 3TZKA 3DZBA 2EKPA 3DONA 3RUIA 2GDZA 3C1OA 2XPCA 2CMDA 1Y1PA 3A14A 5A06A 2A92A 4CMAA 2BFPA 1OMOA 3ONDA 3B1KA 1Y8QA 3H8VA 4WK6A 1B26A 2NTVA 4B7XA 1YGYA 1O8CA 1OC4A 4BNUA 1BVRA 1QYCA 4INAA 4NG5A 4NHEA 2GZ3A 3L07A 1P1FA 1AN9A 3JQEA 3PTZA 2DPHA 2BGMA 3EZLA 1R15A 4OL9A 3RI3A 3DZGA 3N74A 3VH1A 3QWHA 2P4HX 1NFQA 4DMMA 3LT4A 4R5MA 5FFFA 5BSFA 1RM3A 1IHXA 3RKRA 2JD1A 3ZWAA 1TA4A 4ONEA 3IUPA 4CMIA 1P0FA 4RPGA 3VC7A 4N7RA 2IDZA 1HRDA 4FFOA 3DOOA 3S1LA 1YQGA 5KJCA 4U6SA 2J3JA 5FYDA 4PIVA 4BO7A 3U0BA 1ADBA 2NU7A 4MKZA 2HCTA 1DFIA 1QSGA 1BDMA 2Q99A 3PYXA 5T8KA 1NYTA 1XDWA 4R1NA 2PH3A 1LQTA 3N7UA 2DBQA 2RCYA 3U4CA 4CM8B 2WYUA 3F1LA 4JBIA 2AG8A 4A2CA 2B36A 1WDMA 3H2ZA 4WNIA 1CDOA 1I36A 4W6ZA 2UUPA 4RF4A 1XEAA 3E5MA 5L4SA 4M54A 3W8EA 2Q1SA 2AEJA 1GYQA 4GWGA 1PS9A 3HB4X 4MP3A 2NU8A 2NTNA 3DAFA 4GI2A 2P2SA 5EQFA 3SJ7A 3WGOA 4MVJI 2ZTVA 3RSHA 1DC3A 1XU7A 2OZPA 4RZIA 4CMEA 1CERA 2F1KA 4CR7A 1DRWA 2NVUB 4ND5A 5ITVA 4F6LA 1E7WA 2IODA 2V6FA 4PFJA 1A9ZA 4CQMA 3P2OA 2CNBA 5G4KB 3UXYA 1QYWA 4Y98A 2OBNA 2AW5A 1QYXA 1J49A 4GWKA 5DCYA 5BNFA 4J1TA 2Y67A 1PWZA 1PQUA 4WNCA 3ZWMA 1PJCA 1AE1A 1JAYA 2YHIA 3L4BA 1TB4A 4A03A 2YHIB 1GFSA 1DB3A 1V3VA 4ESOA 1F12A 4B4VA 4CQMD 2QYTA 4E30A 4EITA 3GN1A 3GG9A 4URFA 4Z0HO 3GGPA 2NNLD 3RKUA 4RQUA 5DDIP 1M67A 2CDCA 1IE3A 1LU9A 4OKNA 3P2YA 2Y0EA 2VWPA 2W2LD 1M76A 3E6AA 5DBFA 3DOJA 4TVBA 4FW8A 1KVUA 1PU2A 2FZEA 4PVCA 1YE3A 3DBRB 4IPTA 3JQGB 5IZCC 2VNAA 4F45A 1VLLA 4NU5A 3V2UA 3JTMA 4XCVA 2TMDA 4JJFA 4P4LA 3ZWCA 4D79A 4OSOA 3FWNA 3ONEA 1PX0A 4N18A 4IXTA 3I9MA 2X0RA 4BMSA 1R0KA 3Q3CA 1DC4A 2I66A 3HB5X 4OMUA 3AU9A 3S55A 4EI2A 4UVEA 1PZGA 1Z74A 2VYVA 3GVHA 3QA9A 5JDCC 2Q3EA 2XXBA 1XGKA 1TXGA 3PZRA 1DEHA 1SBYA 3RD5A 4BMVA 4PLFA 1WZEA 1GUFA 4IJKA 2XAAA 1LC0A 3VH3A 1IUKA 3ASVA 1WPQA 3G0OA 3MOIA 2X5JO 2ZTMA 3V2HA 3EAGA 3QVTA 2OXIA 2BELA 4NMHA 3WQSB 4E2YA 4AJEA 3WGIA 3DZKA 4CMCA 4CMGA 1PR3A 2CF6A 2GR9A 2VUUA 4AJKA 1JTVA 4J4TA 3T4XA 1J4AA 3HDJA 4WLNA 5CG2A 1N9GB 3ONFA 4TRRA 4BNNA 2X5OA 3BTOA 1K6XA 3LT0A 5JC1A 3ZWNA 4D0SA 4MVJG 3KLMX 4QXMA 1IHYA 3LF2A 1H93A 1HDZA 3G49A 4J0FA 3E9MA 4EW6A 3PHJA 4CL8A 3RU9A 1EDOA 4MVJA 3UCFA 3W6ZA 4KTVE 3TZHA 5T67A 3FD8A 3ZW8A 1Y8QB 1O95A 1F8FA 4IGFA 3H2SA 4UUOA 5JAQA 3WWZA 5CEFA 1ZVMA 4B79A 1IPEA 4FFMA 4JBHA 4FOOA 3BHJA 2QRLA 5GZ1A 1HDYA 2EKLA 4AJJA 1ZSVA 4ALJA 3RC1A 3PXXA 1I33A 3JQ9A 4KUGA 4GX5A 2YJZA 4LCEA 2QHXA 3MWDB 1MB4A 1HE2A 4AICA 1AHIA 2CFCA 3E03A 5CDGA 1X7HA 2VTDA 4OO3A 5G4KA 2FSSA 1DHTA 3INGA 3VZPA 1MXFA 1F06A 2VWQA 3GEMA 3HDHA 3GH3A 4PZEA 1TI7A 2GPTA 1PTJA 1ENPA 4Q3EA 3IP1A 1HYEA 2GN6A 3KTDA 3QVOA 1E6WA 1KEWA 3DMYA 3VTFA 1KEUA 4D45A 5A9RA 7MDHA 3K31A 3UGKA 4QO8A 1P3DA 1VKNA 2RIRA 5A9TA 1NHWA 5EPOA 4GX0A 3UF0A 4DYDA 4BKQA 4PCVA 1LEHA 5ER6A 2NUAA 1R0LA 3OQ6A 3VPSA 2JAPA 5A9SA 3ZZNA 1TT5B 1Y8RA 2JAHA 4GVLA 1P77A 4YXFA 2RHRA 3MJTA 1EE2A 4QTZA 5HBRA 4KZPA 1Z73A 4I8XA 5GZ3A 4HX5A 1Z45A 5I9LA 4BO9A 4M87A 1M75A 1DHRA 3EK2A 4BKUA 1IOLA 4YAEA 1PEDA 3B6ZA 4DQUA 3DO5A 2DU8A 3RBXA 1G6KA 3VTZA 5IXYA 3IMFA 3LC1O 2O3SA 4YT8A 3ANMA 1H2HA 2IYOA 3TZCA 1DIRA 4G81A 1Q2XA 2HJSA 3OIGA 5THKA 2P9GA 1T26A 2Y0CA 3JQGA 1C0KA 3ICCA 4ITUA 4JIGA 4BNKA 1DAPA 3PJFA 4W99A 1RM5A 2OP0A 5DULA 4XQGA 3DR3A 3MZ0A 1ZO8A 1M6HA 1KETA 2QG4A 2HMSA 4I5FA 3OJFA 4D42A 5HS6A 1V3TA 5DNAA 4K28A 4QT0A 4XDYA 4XR4A 1WDKA 1KY4A 1O94A 2C59A 4WEQA 4XQEA 2OO5A 4GQAA 3IP3A 3CKYA 4ND3A 4NBUA 4H16A 2W2KB 4PRLA 2G82A 4CV0A 4PLPA 5I7VA 4XD2A 1UAYA 2P9EA 5FI5A 4CLHA 2OMEA 1E7SA 2NACA 4NI5A 4RF5A 3V2GA 3I23A 2GZ2A 1MP0A 4I1IA 2Q4EA 4IIVA 4TZTA 1EMDA 5CDUA 1E3WB 1P1RA 3GDGA 1YL6A 2YDXA 4PLTA 3PDUA 3UHAA 3OJLA 4CM3A 4FB5A 4BMNA 4GGPA 2X4GA 4AJPA 2EHDA 4HNGA 5B4VA 4J1SA 4PLVA 1YONA 2H5LA 5KVVA 5TIIA 4F6CA 3SBOA 2DBRA 1GADO 2UYYA 1JAXA 3WJ7A 3I6IA 1EZ4A 1K2WA 2Q4BA 4TKMA 4IINA 4XRGA 5DN9A 5DZSA 4IJVA 1VSUA 2I6TA 1F17A 3KYDA 3ROKA 3OIFA 1ZSNA 3WQQA 3W8FA 1EDZA 4LVUA 2JKVA 4FFNA 3IKTA 2PNFA 1XHLA 4J0EA 4BNYA 4M8SA 3I4CA 2FPGA 1C3VA 3JQBC 5EERA 1HSZA 4RV9A 2BGLA 1UXJA 2VOEA 1PJQA 3ASUA 4YEDA 1Y5RA 4UULA 3JQ8A 4L74A 3DEYX 3OJ0A 1YB4A 4W82A 1ONOA 2JD2A 4J1NA 4JQCA 4ND1A 3HQ4O 2AXQA 3KLPX 3LU1A 3V1TC 2J8ZA 3F47A 2J3KA 3VPXA 3ZHYA 4NIMA 4XQ9A 5JO0A 1PGJA 3H3FA 4JP2A 1U2GA 2PD4A 4IJUA 2W2LA 3RASA 3ZWVA 3IQDB 1A9YA 5IDXA 1CYDA 3V5NA 4JNKA 3F4BA 1IYZA 2NQTA 2HRZA 3GR6A 3RFTA 3IL2A 5I7FA 2JCVA 4YVFA 3G1TA 1QORA 1XLTA 3O4RA 4GVXA 4K6CA 4OXNA 4MP8A 4A73A 2DFVA 5KVSA 1VE9A 3IKVA 1GV1A 2NLOA 1GUZA 4GH5A 3BMCB 2Q1TA 3MJEA 3TZQA 2EERA 3DFUA 4OQYA 4AJ1A 1U8XX 5ER9A 3I52A 1GEEA 4DLLA 4E32A 1IULA 4EEXA 5JY6A 3NT4A 3ULKA 2IRWA 1X14A 4CM7A 4BKPA 3C3XA 3ETDA 5K0ZA 2WD7A 4R4JA 4Y67A 5I9NA 4FC7A 3UH1A 4WPGA 1DIAA 3VVCA 4BNFA 4XB2A 3CE6A 2PGDA 3WBFA 4CMKA 4UUPA 1R4NB 4CV3A 5JW6A 5F1KA 4Q3AA 3U9LA 4UEKA 2HJRA 4YQYA 4HFJA 4AJ2A 2O23A 3LZ6A 3RFXA 4I5EA 1MFPA 5JCJA 5BSEA 3ADPA 1U5AA 4JK3A 4WCFC 3WJAA 4L75A 3ABIA 4C4OA 3OA2A 3GAFA 2GN8A 3K2EA 4BV9A 1IB6A 3WGHA 3TOXA 1L1FA 1PJ3A 3PHGA 2FRDA 5JPIA 3ZWYA 3G3EA 5JBIA 3NDIA 3DZIA 3HNPA 3AI1A 2PWZA 1PIWA 2CUKA 3S2FA 5DP2A 3U4DA 1U4SA 3ON5A 5IN4A 5L51A 5BSHA 1P1JA 2HO5A 2HMUA 3HWRA 1D3AA 2VRCD 1HT0A 2RAFA 4CLXA 4ALIA 4YJGA 3DB2A 5A3VA 3VH2A 4IXWA 1JLLA 1PR9A 3K96A 1P44A 2O3QA 4CLDA 2AEFA 1GQ2A 3H4VA 5IN5A 1TT7A 3HUDA 1F8GA 3AI3A 4IDDA 1UZMA 2D5CA 4O0LA 3GN2A 5TLSA 4J4HA 4AJ4A 1B15A 5T57A 3W4JA 3NTOA 1YQXA 1KBZA 5DP1A 3GNQA 3UAGA 1NBOA 1VC2A 3L6EA 3NT5A 3P19A 1SEVA 4N54A 4J6FA 2EV9A 1KYQA 5ILGA 4DUPA 1K5HA 4QFCA 5T8KC 1T25A 3MWEB 4Z0TA 1DJNA 1XA0A 3PJDA 3W8DA 1QLJA 3ZI0A 2GGSA 3D1LA 3KV3O 2GCGA 3DHNA 4L4XA 2O2SA 1QR6A 3H5RA 1O5IA 2BI7A 4ID9A 4R5HA 1LRKA 3RFVA 1NVGA 1LBEA 2DUWA 3GK3A 4XQCA 4S3MA 3WYBA 4YJGB 3ZHXA 2WE7A 3DMTC 2C20A 4RL6A 1HE3A 1SPXA 3ZN2A 4E31A 3GPIA 4QECA 1WLYA 1K6IA 5C7IO 2ZCUA 4UVGA 4BB6A 5JDIA 3AOGA 5KWEA 5B12A 4L0QA 1Q1NA 3GZNA 1I2BA 1N9GA 1D1TA 3O38A 1HDOA 1Y9AA 3ZWPA 3KBOA 2G5CA 5B4UA 2DT5A 3P7MA 1B7GO 1PZHA 2VQ3A 2X9NA 4GX2A 2FP4A 4GMGA 3HG7A 3B1FA 2FR8A 1UXIA 4XGKA 3TJRA 3ZV4A 5BT9A 4PN3A 4IDFA 1OZAA 2CY0A 1YOVA 4DRYA 1GEGA 1FDUA 1LA2A 1XWFA 4ALLA 1PZFA 2VHYA 4XGIA 4WGGA 3CMCO 4IUYA 4J4BA 4LRSB 3MOGA 4NFSA 1I5RA 1YB1A 3FHLA 5I7SA 2C7VA 3WGQA 3WGYA 1MV8A 4IBOA 1E6EA 4NJMA 2B4TO 1C0LA 3WGTA 2PZLA 1PJBA 2FWMX 2ET6A 4RPKA 4RVDA 2WMDA 4DMLA 4I5DA 3E18A 4PLGA 5HRUA 2Q46A 4YBZA 3LDHA 5F5LA 4BB5A 2YFQA 1EFKA 1Z6ZA 2D4AA 3RC9A 4DWVA 2R00C 1X0XA 3ANNA 2O2YA 4D7AA 4CUKA 1EFLA 4IZIA 1YKFA 3K6JA 3QV1A 5F1PA 2A94A 4MVJD 4PG4A 1O0SA 4UVHA 3DHYA 1DFGA 3EW7A 3FR8A 3I3OA 1I8TA 2E48A 2IEDA 3JQ6A 5DCWA 1V8BA 4MVJM 3ZCXA 4UUMA 2E82A 3UICA 5AXBA 1XSEA 2FSVA 3LSYA 4EJMA 2ZCVA 3EMKA 5F3RA 2GUGA 2PKRA 2DFDA 3ZWWA 1HXHA 5LDGA 2YZ7A 4LCJA 3SC4A 1Q0LA 5T64A 3LVFO 3PWSA 5IFLA 3BMNB 3C7AA 3K9QO 1GV0A 3KYCB 1Y9EA 4RZHA 4XX0A 1JKIA 4HFNA 5A3JA 2QRKA 1RWBA 1WMAA 3Q0EA 3N58A 3VHRA 2HLPA 3JD3A 4GLLA 3VPHA 5ADHA 1JVSA 1UUFA 3NKLA 1XG5A 5ITWA 1A27A 4BO5A 4LN1A 1DIBA 3DBLA 3PZBA 3HADA 4JP3A 4R1UA 1MG0A 2AQHA 1HSOA 2J3IA 3UCXA 3ZNPA 3U5TA 4XWYA 4FC6A 4D3FA 1T2CA 2DKNA 2PR2A 1Y5MA 3FBTA 3OEWA 3Q2KA 4BNLA 2QX7A 4Q3NA 4B4WA 1AGNA 1MGOA 1U4OA 3AU8A 3AW9A 3KXDA 4OXYA 4XYEA 1HZJA 4MINA 1HE4A 2ZQYA 5B37A 3G1UA 5A4DA 2WE8A 1U9JA 1SEPA 5DCUA 5JYDA 2AHRA 1EUCA 2Y05A 4TRMA 3C85A 4IMRA 4PG8A 4TQGA 3CTMA 2JFFA 3ZU3A 1MUUA 3LF1A 4NDNE 4H3VA 1ENYA 5AOVA 1HLPA 1RM0A 5KJEA 2IXBA 4DBZA 3X2FA 4IMPA 3AUAA 4BNTA 3EVTA 4BGUA 2FR0A 1JKFA 1NAIA 1NQ5A 4LK3A 3VKVA 5TSDA 4II2A 3CSDA 4OKIA 1DJQA 3MEQA 1I32A 1PQPA 1PJ2A 1SOVA 1JN0A 1ZNQO 1KY5A 4PLWA 5CPBA 2X9VA 3SXPA 3RC2A 4CQLB 5JS6A 2ZKLA 2VN8A 3UKOA 5KJ1A 4ZN6A 2J5KA 4W9NA 1TT5A 1Y8RB 2AEMA 4BO3A 4TSKA 3M2PA 4XYMA 2O3TA 4DXHA
chains in the Genus database with same CATH superfamily
3K2IA 1FDTA 1QGOA 2VT2A 4EKDA 4XCQA 4NK5A 3UAXA 1BS1A 1U5BA 3IS3A 3BQ9A 2MOKA 2JIDA 1YCFA 1SVIA 1Q92A 3L5OA 2PVSA 3PCRB 3GJ4A 3MD9A 4KKXB 4F5WA 1H4QA 3L46A 1KDRA 1ESCA 3IIEA 4IDCA 1Z17A 3MIZA 4KI0A 3M5CA 4LQ4A 5HF6A 4EVQA 4R69A 4LVOA 4MUFA 4BBAA 2PUTA 3R7DA 1YV9A 1DT3A 2YWXA 1CZKA 1QJ4A 4WASA 4ZI5A 3IBCA 3IAAA 1C3EA 4JSYA 5ECWA 1T29A 2WYVA 4KXQA 1PJAA 2X86A 2OORC 4PNPA 3V1YA 3P9NA 1XDZA 4D9MA 1S2DA 1O6FA 2B83A 2FN8A 3E1GA 1MJHA 1HE8B 1OFIA 1QIJA 2C8KA 3BWXA 1YHNA 3K53A 3ZJ5A 4E03A 3DH0A 3JYPA 3QVKA 4MUGA 3HSKA 1NLYA 1ECPA 2J4FA 1MU0A 1IZYA 1FVXA 3K73O 3MTQA 3ZDQA 1SU4A 3GQVA 4LNUA 2RHMA 5D5QA 4I08A 2NOAA 3BXPA 3FSJX 2X8LA 3OT5A 3VR2D 1IXKA 1GRNA 1V6AA 4DA9A 4YYEA 2Z8XA 4BN0A 3UHJA 4WL0A 3SQMA 5JNRA 2YHSA 4BO4A 1PD1A 1GXSB 2AMFA 3BCRA 4ZOEA 3W2IA 5C1IA 4BE7B 2R7KA 3EVFA 4I66A 4KFUA 3MSXA 1PFQA 3GJ8A 3JQAA 1DRJA 3FKQA 3IAHA 3JWHA 4R51A 5K2MA 1ZX1A 4AY3A 3EIWA 4C9BA 5A5EA 3ODPA 1D4ZA 4DV2B 2EBUA 2HCFA 5ESDA 1Y82A 5FO1A 3RB8A 3N8KA 1BA3A 2HBZA 2VDUE 2X9GA 3TLGA 2R0QC 1LK0A 1PR6A 2BMJA 4ZQHA 3WDSA 3H5VA 4DSAA 2IW1A 1K27A 3I9LA 2Y66A 5BN5A 2HEGA 1PUIA 1A4XA 5FUBA 2Q21A 5BY2A 2BZ0A 1BKSB 3GFPA 3P2IA 1SUWA 1W88B 1NVKA 1EVKA 2NUTB 3OEHA 2ZXFA 1GWNA 1M1ZA 1RFGE 2HQBA 3FNBA 4OM8A 2ZEJA 1GIAA 3FETA 4YCMA 4F4CA 1KO4A 3HCAA 5JH7A 1E4VA 1Y5NA 2G0TA 2WVAA 1PJ4A 1QHEA 1X7ZB 3IJ5A 3M49A 3N3BC 3TQCA 1KS2A 2X40A 3P9CA 5FA8A 1VPEA 2G9RA 2IOYA 3G2PA 4B7AA 5KYXB 1QAOA 4NBVA 1GQOA 3RTAA 1PL0A 3BFJA 4ZHSA 5KNLA 3GOQA 4E6PA 1C3JA 1DUVG 1GR1A 2V55B 3IQHX 1H9CA 1HH4A 2WICA 2CLCX 1DAOA 4Y2GA 4RA9B 2BZGA 1JBKA 4B74A 2P2ZA 2ZWPA 1FYXA 3A8TA 1K7FB 2YUIA 4GHWA 3CUWA 4M83A 5G3ZA 4D4JA 2C7PA 1IXSB 4YR7A 1QFMA 1Z2PX 4NV1A 4L28A 1WPRA 3WLFA 1XZ8A 4JV5B 4KSCA 4KQ9A 4OBWA 4BKRA 1Q0PA 1GKLA 2EG5A 3TRJA 4TQUS 2HOQA 2ID7A 1CY1A 2RJOA 1X8KA 2P3SA 3NNSA 2XZPA 4PAWA 4Z4QA 3JWJA 5ADVA 3FNQA 2I6XA 1UFRA 1UBFA 1MEEA 1JT2A 2IEZA 2PG3A 4OLBA 3ESZA 4G37A 3NYWA 3ODGA 4PPGA 5TMEA 5TXGA 2EBWA 3GVPA 4CVNA 3Q9SA 4S1PA 3EDOA 2ONCA 3QVGB 3T4EA 1DKLA 1V41E 4DMGA 1WE2A 3K0CA 4YHBA 3BULA 5ICFA 2NPFA 4DC0A 4EPRA 5AYVA 3E8MA 5SY4A 1V9CA 1IIRA 1SHJA 2QL7A 1CZUA 2GKGA 4HQOA 3F74A 5JWOA 2XQKA 4FYWA 4P3YA 1ZM9A 4KU4A 1CRPA 2O07A 2TRSB 4IHJA 4R6WA 1KU6A 1V5IA 5IJ9B 2VP9A 4O33A 1AQLA 1N8KA 4LTDA 2F67A 5K3FA 2WJAA 5J4KA 4YFYA 1ZI6A 1M6NA 2NZJA 4MPDA 1FTQA 4LHEA 4ZHQA 2EJUA 2IYAA 1EHIA 3EA5A 1N0WA 3H2GA 3KOUA 4G1VA 3OH8A 1K86A 4HDRA 5ALQA 5J2TB 2JARA 1YRWA 4ZYVA 1S4QA 1LW6E 2O8NA 3MGBA 3RYIA 3QKTA 1ANKA 1NQAO 1AUQA 1LV8A 1KOFA 1VCMA 4QOJA 5CHEA 1L8XA 3KXIA 2ZUBA 1A9TA 3KZKA 1C9YA 3EVEA 4KEAA 4A8TA 3KR1A 4DC9A 3FZEA 4Y7CA 5TVGA 3VKUA 1W0CA 2ZRCA 4WA8A 3NUGA 1BX0A 1V7PC 3IMCA 5SZJA 3W2GA 2CVZA 2M1ZA 3BMQA 5LCXA 4EZBA 1VL2A 4REQA 1VJ1A 5AI6A 1H1DA 1MT0A 2LP4Y 5HW0A 4IEIA 4D57A 5CA1F 3AX6A 5DTQA 2AZ4A 4Z4CA 1O2DA 4LY0A 2VL7A 4PVDA 3S2IA 1U0RA 3QWBA 5I9MA 4BNMA 1IJBA 2QI9F 1B2RA 2OHFA 4EB0A 4LHZA 3ESQA 1IBKB 1SXJC 5FDFA 4RJIA 1EQUA 1YJ8A 1DG3A 1U7UA 2QMUA 4Y2SA 4OXKA 1T15A 1PQ4A 2AQ8A 3E7DA 5DLQC 1H4SA 4KWEA 1LSSA 1R74A 3BILA 1E2EA 4L4SA 3DUFB 4E0BA 1NBIA 3OPYI 1QRAA 3GFOA 1V9LA 3W6PA 4HYEA 1I2DA 4EFKA 4M53A 1S7CA 4RTOA 2VT3A 3D2LA 5AK0A 2VRWA 1T2FA 3TUJC 3BJIC 3C1AA 2PO7A 3H42B 3GMDA 3R9IA 4J0QA 5K0JA 4LKRA 4LQCA 4EJFA 3CF6R 1CDDA 2B1IA 4L4RA 5HF9A 3UMYA 3GJTA 1BWPA 2XHEA 1Q7GA 3BL5A 4JXZA 3MCWA 1K7SN 2EP8A 2GSWA 2P6OA 3A04A 3AJ8A 3M6XA 4N5HX 3C3AA 1LWNA 2OBXA 4L5YA 3MGAA 2WILA 1O89A 1DTWA 1WR8A 3C3EA 2VHCA 2WSBA 1HI9A 4FHGA 4DLTA 1HNZB 1QYRA 2PUCA 3TW8B 1AO0A 4BE4A 1E7RA 2B4YA 2C2XA 2OC4A 5IW8A 2IV7A 4OHFA 1PD0A 3QHPA 2YOFA 3TFOA 3KQOA 3PJEA 4LSGA 4YAFA 1R5JA 3WP1B 3BSYA 4YAKA 3HFRA 2PNJA 1L5ZA 4LE2A 5H70A 4EI2A 1JSCA 2IOFK 3ESBA 1GYPA 1ENOA 3ST7A 2AF4C 3F5DA 4GL4A 1L7DA 3U4IA 4XZ3A 5HPYB 5E9QA 3LT2A 3OMXA 5J4HA 4BMOB 1J5PA 4CTNA 4BP1A 3JV7A 1RSZA 1VMIA 2OLJA 1SM4A 1TTTA 4RFSA 4BFLA 5KX5B 1YR3A 3D8UA 2ZI3A 1RYYA 3U3OA 3WL3A 5MN4A 4U4AA 5SY9A 1RHQA 3TMYA 4ZCQA 1DARA 4EJSC 1TECE 1S1CA 3ZCQA 3PQFA 3AT1A 2Q9CA 1T6BY 4HWPA 4N01A 4PG5A 4WIAA 5DWDA 5F5NA 1LPMA 1XLWA 1VECA 4DYHA 2H1IA 4Y1EA 4WFQA 3S4YA 3ORHA 1YDFA 3CR7A 3B5JA 3FGPA 4PLCA 4F96A 2AFIA 3GJ7A 3OCXA 4J91A 4PANA 3DBVO 3T9AA 1T4GA 4FHDA 5K7SA 1A7UA 3IEVA 2BRUA 3IAM1 3K9NA 5K1ZA 2V6MA 3O2NA 4ML3A 4U7HA 1ZD1A 3W0LB 4ZV9A 3IDZA 4KOAA 1JQDA 4OH7A 5JZMA 4B3JA 4D0GA 4WFKA 3OPQA 1GQFA 5GJCA 3VV3A 2GHQA 3P94A 4KUEA 1V1MA 3WL5A 4BEVA 2ZTUA 2LDXA 1J00A 3AR5A 1IM2A 1JG4A 5JXJA 4OUKX 4MS3A 4E5YA 5KVAA 3SS9X 2F8TA 1I4TD 4Y2RA 2HV9A 3HEBA 2AA3A 3TL3A 4E4TA 1K4KA 1JHPA 2J6IA 3QU5A 3NYQA 8ATCA 5KNBA 2RDMA 2ZI4A 2BJWA 1RXEA 3LY5A 1U1EA 1Y1KE 2QL6A 2LIPA 2QJFA 4HDSB 3QEKA 4UMDA 3GUUA 4U8GA 2GEKA 2FMFA 3G2JA 3LBYA 1FRNA 1GZ6A 1EX6A 2R7AA 4I46A 1XVUA 5EIHA 2PX0A 3NZEA 3C8MA 2PA3A 5LVAA 1RT9A 5IEBA 3LDUA 3PEWA 4XOUA 4HNHA 3QPUA 3O1LA 4D02A 3IUYA 1U7ZA 1RVDA 2QM3A 4EMSA 5CCDA 5JSHA 2NZXA 1M1NA 5IBQA 3E8XA 3MT9A 1UJ2A 5MF6A 1II8B 1UAGA 1WBJB 3CLSC 2I4LA 3IVXA 3JALB 2D1YA 3PD0A 4RBNA 4DCOA 2VWHA 4RVOA 2WT8A 3FBGA 2CXXA 4BEJA 1QP8A 4DIDA 3HU2A 4OB6A 4XGRA 1DEAA 4Y2PA 1QJCA 3PF8A 2M6KA 3C43A 1ZIDA 1QKKA 4QEDA 1REQB 3U48A 2C4NA 3DE5X 1WCWA 4QZVA 2XMPA 3U39A 2GRAA 2W4QA 3J81A 4TXMA 4N1AA 4GR4A 5HTKA 3ABSB 4ERNA 2VTBA 3HXOA 2HRQA 2J3HA 2JZOA 3F67A 3OP4A 5JADA 4F7DA 4H3SA 4PYQA 4UD6A 1XN1A 4D43A 1X80A 2W90A 1HO3A 4X91A 4ZRNA 3LXXA 5CTJA 4KQMA 3SWWA 3E9ZA 3OPNA 3WGGA 1R6DA 3M33A 1ZG3A 1EVJA 4RVSA 4NQRA 2IOQA 3LM8A 1NW6A 3GHHA 3SHVA 3PJGA 1CQIA 4ZTBA 5BOVA 5LZ2A 3AESB 3W5AA 1OR8A 3Q1LA 3LCMA 4CF4A 2O8BB 1A2BA 1S89A 1M10A 1SXIA 2VF4X 4YJFA 3M9WA 4MRMB 3VSBA 4KQGA 3OOSA 4E08A 1I2CA 2FQXA 4BEWA 1VIAA 2HJGA 4HQNA 3CZQA 4Q4AB 1U4NA 1SMKA 3DFMA 1POXA 4B3FX 4BOYA 1Z5PA 1F51E 3BMNA 1O9BA 4W8OA 3WLEA 4LVNA 5CIWA 4YI3A 1YNOA 1T9AA 3OZEA 5TQ0B 2KJQA 5LP6A 1Q5PA 3WRYA 2H7XA 5BVGB 3NJRA 3LKBA 4P7JA 3M82A 2Z6AA 2GJ4A 1JHVA 5EC8A 4OB8A 1E92A 4LOHA 2IQIA 5EIBC 3RUAA 4XSVA 3EZYA 3DUWA 4IKOA 2VHEA 3M5PA 4O59O 3GEGA 2GZHA 2NZ2A 3OM1A 3WS7A 4IIEA 3SP1A 4HXGA 3CPEA 1CUVA 1TPZA 1GLNA 2H48A 3B9PA 3CX3A 3CEHA 3LQFA 3C1TA 1IATA 1YFLA 2GN0A 1CUIA 3OETA 4JGGA 4Q16A 4AFNA 3VJRA 3FUXA 4I55B 2ACKA 3THXA 1RMQA 3S1SA 3VSAA 2P78A 1PKXA 2PQ6A 2C99A 2ZRDA 4JBGA 4KN8A 3KS9A 3UKDA 2A9KA 1UDCA 3FGNA 2AJBA 3VVMA 5DHSA 3CVXA 3UW3A 1E60A 2EEPA 2HA2A 3VYSB 3LVBA 2WIJA 2IE0A 3DBLB 3TQSA 3HFSA 3UMBA 3FVTA 2JIZD 4FB4A 4Y9DA 1KSJA 1TD1A 4N03A 1G8YA 3NBZC 4GSLA 4I14A 2DC1A 3PPIA 2ATVA 5FXMA 5JAIA 3HL0A 1HNNA 5COQA 4DMRA 3KAJA 4ENVA 1ZGGA 1C3OB 4OU5A 3A06A 6ADHA 4B5LA 3FUCA 4DA0A 3RUHA 2JFOA 4MDHA 3L8FA 1U7WA 2JJ2D 4KDEA 1Q15A 2Z8YA 1XA4A 5AD1A 5HIKA 1VM6A 5CB8A 3OY2A 4EX7A 5ENDA 4NYIQ 5FR2A 3F7NA 2OXEA 5BPHA 4FCCA 1IJKA 3K15A 3JD2A 5JXWA 2W0SA 1DWPA 2QEQA 3HJUA 3CS3A 4IHKA 3OQBA 5HQ3A 1USKA 2I4RA 2ZJZA 1ZXLA 2WPNA 1HORA 1LK7A 1Z2NX 1KDPA 2MSDB 1JSZA 1BMQA 3HRHA 1XXLA 3VRHA 1QTQA 1RWWA 1RLUA 1ISMA 2OGUA 1Z39A 3VU9B 4DW8A 2PZBA 4EQ6B 2I8AA 2XGGA 5G1NA 1DUIA 4EVRA 5K8CA 3CJTA 1YSCA 1TPYA 3H2HA 4Q6BA 1LFAA 2Y1GA 2R8OA 4EB6A 4EUNA 2NIPA 2YHAA 3ZLTA 1U8FO 1WB5A 2ZI7A 5BW8A 1NPTO 5BV7A 1W44A 5JRDS 3UPTA 2FPLA 3A9VA 1E1KA 4YAGA 1MD9A 4TKUA 2W37A 3B9QA 3LXMA 2Z30A 4FP9A 1LLUA 2H4ZA 4YDSA 2GPNA 4C7OB 4OIFA 2IYRA 3SHFA 3JD0A 2Y76A 1GGNA 2NUPB 3AONB 1LX6A 3BK1A 3GNTA 4NR0A 1ODIA 3IE1A 1G8JA 4HP8A 3U40A 3IQGX 3LBIA 4P7KA 4A26A 3PTAA 2UU9B 4EJ6A 2AHOA 1ONBA 1Q3HA 2JBAA 5FNVA 4Q1BA 1ZAKA 4F2DA 3L7NA 3WB2A 4I9NA 1Z2EA 2UYCA 2ZIEA 5M5BA 3PLAE 1I2MA 1M8KA 2LNDA 2PX8A 4NC9A 3OJOA 3MJCA 3DE6X 3F78A 1EEHA 4YLEA 1BW9A 3DUFA 4JX8A 1RPZA 4J90A 3AV0B 3WNQA 3KZ1E 2J9XB 1EFRA 3GHYA 5AICA 4BV3A 3FYUC 3R3JA 1MLDA 3DZHA 1N8SA 3IEXA 4QPNA 3GZTB 4DDMA 3RC8A 2RGYA 3WK8A 1CQPA 4KFSA 3NB0A 2B9EA 1AK1A 3PNLA 3FCAA 4TWZA 4WEOA 3V33A 2GSDA 4KPFC 3MLAA 2QG9A 4E5NA 2FPIB 1DKPA 4NZNA 3AVUA 1EDBA 1TNDA 1E58A 4CNBA 3PU6A 1SQ5A 1PGOA 3LPDA 1HT2E 4AKHA 2AWOA 3F6PA 2H29A 5KNDH 1CCWA 2D2VA 2B1GA 4OH1A 1VIYA 3H9BA 5HM8A 1HMPA 2Z08A 3O8QB 4YUXA 5JNLA 5J59A 2FN7A 3VO8A 1FSGA 1OHHD 3FI9A 2GD0A 4KJXA 4OBEA 4Z9AA 3X1KA 1ZL0A 3CNLA 3RC7A 4JLMA 1XELA 1JQJC 3S29A 3KYBA 3OQPA 2VTEA 1EVZA 1U9CA 2V4MA 4HPXB 3FHTA 1AA6A 4Q7MB 4B8YA 1T1GA 2B69A 2P68A 2QMYA 4JYBA 4HV4A 3NHKA 1BA2A 5L7YA 1YULA 3MINB 5HR5A 1YZNA 5BVHB 1OXBB 1P45A 3EXAA 3E8SA 2UXDB 3WYGA 1TJ5A 2H2FA 1H2WA 3A26A 1SXJD 3DNPA 1VG9B 1W4RA 1YIAA 2V74B 3MRXA 4GRIA 4C6TB 1V6CA 4LUCA 4DMFA 3L7YA 4C4PA 1KO5A 1K68A 1PW7A 4LV8B 1CY0A 5KYNA 5F76A 4MVJE 4CT5A 2ZITA 4DIFA 3KDPA 2VNHA 4RKRA 3M1YA 1GZ5A 2J0EA 2SICE 2FUEA 3EISA 4B9EA 4YV2A 1CZNA 3MWJA 5FBQB 2GPYA 4FD3A 1RYZA 5HIMA 4PCUA 4KH0A 3ZDFA 3A6DA 3L04A 4ZOAA 5DLEA 2R85A 1ID8A 2GAAA 1ONNA 2FE4A 2QQFA 4MQ4A 4FKBA 3JQFC 4IDHA 5MGBA 3O8DA 3W9SA 4RPLA 3D6FA 2VBFA 4DGSA 1Y7LA 4NBLA 3B3JA 1R10A 4EMBA 1U3WA 2W2OA 4RY9A 4CFYA 3GC6A 2IYSA 4XJVA 3KYIB 2PUGA 2MU1A 3U31A 4AECA 5H9WA 1I3LA 1HNXB 1H1TA 1YAJA 3T7RA 4AL4A 4DV1B 2NX2A 1XMOB 3D4BA 1JEEA 5HNKA 2HA7A 4UQLA 4JJ8A 1NVDA 4OQLA 4YAWA 1X94A 3ZU2A 1LC3A 3ZY3A 2XXAB 3DPUA 4MEAA 1GCUA 4ZOLF 3I2IA 3X1XA 5AM3A 5LKAA 4F4JA 1C1YA 1H3EA 1SXQA 2R87A 4XPIB 1G42A 3VDRA 4EO9A 3IEKA 4CCAA 1QPZA 2QUAA 1YWGO 5E8RA 1J8YF 1WOYA 1UWKA 2BGRA 2FR8C 2HBRA 1Z8DA 2QIOA 2Y1FA 2Y77A 1IZ0A 3F4LA 4QWWA 4UMVA 4TZ0A 2VDPB 4JLNA 2MTBA 4JSTA 4MJLA 4NCJA 2GEUA 1SC4A 1F14A 1UT8A 2EOAA 1FXWF 3FGOA 3EBPA 3OLCX 2C83A 3CKLA 5AIAA 1T6NA 3R0ZA 3R44A 3BH6A 1UPAA 3QKUA 4G0PA 3DYBA 4M0FA 1D7OA 3ZTTA 1HL3A 3KKLA 2F3UA 4Y6RA 5FOTA 4HVAA 4JLDA 5L95A 3FFWA 2CJWA 3UAWA 3PDIA 4R2WA 3KOWA 1JT9A 3REFA 1JHOA 1B76A 2YS6A 1IB0A 1U2PA 3N2YA 1SCJA 1T4MA 1M6EX 2P5YA 3TNYA 2REQB 4K9QA 4DLSA 1CF2O 2XYPA 4GLOA 2GB4A 4P84A 3CVJA 3GFBA 1G8SA 4NJEA 5EUBA 2YXEA 2WB4A 3V4OA 4AD8A 3BMOA 4MTCA 1BNCA 3OZIA 4OGGA 2ZAMA 3ETJA 3NETA 1JYSA 2V9CA 3SYNA 1CR1A 3A4YA 3W5HA 4GSKA 1TGYA 2BLLA 5FNVF 3TN7A 3NT2A 4BGIA 4E33A 2FMTA 4QU5A 4HNQA 2W2QA 1ZGZA 4YI5A 5H68A 2H8GA 2CJWB 3K1ZA 5EZYF 4P38A 1ID1A 1NXPA 2ZW9A 3C48A 1AJEA 3ZU5A 4EBBA 1VPVA 2JGLA 1B1CA 3ET4A 3ZY4A 4UEJA 3NBXX 3BSFA 3UJ8A 3NFYA 1THZA 5GZ6A 5ICSA 3ECCA 3L02A 2B1JA 3A9TA 4CM1A 5CA1A 3C70A 4MVCA 2PKEA 3AUSA 1J6UA 4FHCA 3U09A 2IXTA 1KQNA 4ESEA 1IU9A 1N33B 2G5GX 3ACCA 1E3WA 3TL6A 1QPBA 2Z2YA 4H1UA 1DEXA 4ZDIA 1HWYA 4K05A 2EQAA 3SE0A 4JZYA 1N2CA 4TLAA 1TM3E 1A77A 4TLMB 4JI3B 2G28A 4KXFB 3KYDB 5EGSA 3DZ8A 3UT5A 1UPCA 3R7AA 3WWYA 2AW3A 3OTOB 4J6EA 2XXJA 4UNSA 1T3HA 2ZVPX 5U4QA 5SYAA 1AKWA 3U17A 2CXRA 1H65A 4US2R 1C8LA 2V7TA 4DAOA 4XD7D 3A32A 3UMFA 1STOA 3QK7A 1ZD9A 4RVNA 2FG5A 1W1WA 2L19A 1EK2A 5A04A 1ADGA 1E0SA 2ZE7A 3FI0A 1DIHA 2CXHA 3RK4A 3G5AA 1XCPA 1J8QA 3IJPA 3QF4A 4P9NA 4ZAZA 3OJEA 1RM4A 4RM2A 3BA1A 2ZJFA 4MQMA 5ILQA 1VKRA 4QJ5A 5FTMA 1BROA 2BEUB 1MC1A 3DDSA 3DOHA 4EWLA 3DR5A 2DUJA 4AP9A 1U28A 5FBWB 1K3TA 1UP7A 2ZYDA 5EN4A 3S44A 2IFTA 2I1VB 3G7SA 4RA9A 3KVYA 4DMHA 3C6KA 5AFSA 4JYAB 4JC4A 4BZPA 1MC4A 1NBHA 1JA1A 4W1QA 1NOIA 3WAJA 2K4MA 5K3BA 2ORWA 9ATCA 4D92A 1WKBA 4KPGA 2O7QA 2XNJA 3ZZ1A 4H3KB 4C7JA 3K35A 5AVKA 1NLFA 1DGQA 3T3PB 1ESNA 3ZXXA 4X94A 3BC1A 5KJ6A 2ZJ1A 3AHGA 5M7EA 2XMGA 2WJYA 3LFUA 3J7TA 3LLUA 1X3LA 4MGYR 5HS4A 2HMTA 1MH9A 3N3AC 1V3UA 5A4AA 1QIEA 1SIOA 2Q1UA 4XGNA 4DQXA 5FT9A 4HT3B 2VCHA 2XE4A 3OUUA 3FPBA 4B3XA 4DOMA 3GZNB 2AI1A 3KSRA 1WXQA 1M2VA 1JLRA 3HCBA 2XWBF 1FPMA 1NA5A 4RXTA 2C00A 4WLUA 3T7EA 5MHTA 2IV3A 5IKPA 1IUOA 4F11A 3AUUA 1RLIA 1MORA 2QX6A 4Q37A 4KLRA 3H13A 2HJVA 3PFIA 4R1PA 1ZUD1 4W4TA 4C7MA 3EHEA 3JR7A 4MYTA 1W36D 2FQYA 3HCCA 4HYQA 4KC0A 1B3RA 1C9KA 1T8SA 2JPDA 1NW4A 2P3OA 3GAMA 2VNSA 2YN0A 5MFZA 3GBSA 3GAZA 1P74A 3FRJA 3JARA 3P27A 5T5QA 4IX1A 1MW8X 1Z6AA 1U7PA 1ZONA 4Q93A 4WXRA 4PZYA 1UFVA 2YXLA 4A0GA 2GN2A 1SK9A 3FIUA 3UJ7A 3CWZA 4LQLA 4E2XA 5J2TA 1EUCB 1FFAA 4B33A 2B0JA 5JRJA 2A5DA 1G5IA 1YZLA 2ZYRA 4GQBA 4HDRB 3KEOA 1C41A 4JEMA 4PC2A 4RVFA 3UJPA 1IWPB 1HYHA 3WL4A 1PR5A 5AO9A 2CJXA 4J7XA 3K16A 4CLRB 5KIAA 1U1GA 2WU0A 8GPBA 1WCYA 3HXKA 2DFNA 1CTQA 3JWGA 1VHJA 3SBEA 3W6OA 2CC2A 2FMUA 3NH6A 4WN9B 3UFXA 4QFBA 1NJ8A 3EODA 4JD5A 4RK7A 5I7OA 2PXCA 1E0DA 5LUAA 1VMAA 3NWEA 1A9QA 2UZ0A 3O82A 1XAGA 5BMVA 5T7BA 4G0MA 1TAQA 4ALKA 2W2PA 2YUTA 2WEKA 4LA4A 1CJBA 2B82A 3BXOA 1X42A 1LXCA 1M6VB 5CT6A 3UM9A 4B09A 2ONZA 8ADHA 3INTA 3HBAA 2V3WA 4HGQA 2JJYA 3GLGE 5TE9A 3RJTA 1GDDA 1BEUB 1ZGCA 3MMZA 1IY9A 1KTIA 4XDHA 3S7ZA 4CI0B 1GNVA 2ZLBA 1SG9A 3EC7A 3PC8A 4N49A 1XA3A 4WINA 3CIFA 3GYBA 1J8MF 3JZFA 3HKBA 3NPMA 4BO0A 3PX3A 4C05A 5CX1A 2WW8A 2Z2JA 1JH9A 4X3OA 4YT2A 5IVKA 2I4MA 1E7MA 1UJNA 1VB3A 3S8YA 3AO0B 4I1RA 3RUCA 5IHXA 3JQQA 1R3DA 4LDRA 4O2BA 5K0LA 2IVFA 1IPHA 5FOXA 5BXYA 4GYKA 1P1IA 4YRAA 2H5JA 4BN5A 1VOTA 1PEYA 1RD4A 2DPGA 3F3SA 3KZXA 1KKUA 3RIYA 1PQWA 3KXKA 3ZK9A 5CIYA 1C7JA 1EM6A 1OHHA 2L82A 3WVNA 4D81A 1V35A 2W93A 2XVZA 3I34X 3RHZA 1AQJA 1KH1A 5HQ3B 1VXRA 4OUDA 2R7MA 3R77A 3E58A 1VL6A 4O8ZA 1IXZA 1UQUA 3BRWD 1A95A 3D4OA 4DR6B 2CXUA 3A1SA 1S2MA 4JOBA 5A1TA 1EEXB 1NFFA 1Y3DE 2WTBA 3QU4A 4QNNA 3R9KA 5A1JA 2VH2A 4CLEA 4AJ9A 1WCXA 3ZGOA 3ORQA 4R3WA 3RTCA 4R8RA 3RU7A 4JI7B 2W4IA 2F3RA 4G6ZA 4PYKA 1W88A 5KBYA 1YS9A 1AMUA 3UB3A 1Q0SA 1RQGA 2ZJ6A 2PSJA 3DMDA 5EKSA 1Z0ZA 1WP4A 3G89A 3PRJA 5CB4B 3H1PA 2ZJ3A 1M6YA 3TSAA 2QI9C 2YV4A 4I4LA 4RK6A 4FWIB 2BMVA 3SQWA 1EQ2A 3EGXA 3Q9UA 2Z95A 4OY3A 5CB4F 4E07A 4RJKA 2F00A 5K8JB 1HF3A 2P9YA 1DAHA 2GUWA 3DDUA 4KR6A 4L50A 1E2NA 1NW3A 2E7ZA 2O2JA 4UQOA 5CXUA 2AKEA 3JQAB 2QXUA 1FFXB 1D04A 2E85A 2R4UA 1AQIA 1VI5A 2ZI6A 4Q4HB 3WI7A 2VR1A 2A1TS 3DTTA 3HSSA 3OBIA 4GC5A 4R05A 2WF9A 3H9QA 4PYIA 5E9AA 4CKXA 1XZLA 5G0UA 4Z2AA 3ESRA 4ZGWA 2H51A 4TXNA 3TUZC 1N4DA 1IPFA 3WX0A 1JKJA 1A4IA 3DBHA 2B6HA 2FPRA 1K0UA 3E3MA 4CUZA 5DYIA 4DLZA 1N5IA 1UMBB 1YACA 2IELA 4ZI7A 4JI8B 4BWYA 2UYOA 5BRNA 2QVXX 3T4PA 1XTTA 1YJ5A 3D2BA 5AXAA 3U7RA 4AC9A 4GXQA 1HLGA 3T5BA 3P9QA 3Q5EA 3QVVA 1TKCA 3G8AA 2VPWA 2XCIA 1Y6JA 1CQXA 1L4KA 4WKGA 1EFDN 4E5UA 1AC5A 1M2NA 4R40A 4POOA 1LPAB 3EIQA 1Z3IX 4WXMA 5AUPB 5K8TA 1E2LA 1GUDA 2JHGA 5IT4A 4JT9A 4QXQA 4QOHA 2A1UA 1B6RA 4JB3A 1ML3A 4DF3A 1ZC4A 3NATA 4PNEA 4ZO7A 4V0RA 3AI7A 4TMYA 5BSRA 2WTXA 4OQMA 3SZOA 2Z58A 3C3JA 3O8BA 4FJ2A 1U99A 3IOEA 2HU8A 4JB2A 1TZMA 5A0FA 2QSYA 3BH0A 1N5OX 1QGUA 3GW8A 4XJSA 1TKBA 4DDUA 2BUCA 3IBTA 3GP8A 2FTKE 3EFHA 2O4UX 1J06A 4R9RA 2FSGA 3RF6A 2HPZA 2HWWA 3B6IA 2Z8YM 3R2JA 1T8UA 1PN3A 2VK2A 3PQEA 1HQDA 1VIVA 3A37A 4OYRA 1WXXA 1C3OA 3GLKA 4FOTA 3P71T 3UUEA 5ALOA 3USZA 1NJ2A 2UV8A 1B42A 1Y63A 3H9EO 3FPAA 3MFYA 4MYDA 3JQPA 3L5KA 2PSFA 5DWVA 3FOBA 2VZ0A 1V2HE 1AKVA 3GMIA 1SKAA 1GQQA 3H7IA 2YVKA 1CUCA 1DFHA 4IR7A 4JNCA 1OC2A 4YBRA 1GFZA 1U11A 2HHHB 4MUXA 3WR5A 2BD0A 5CYFA 3ZGVA 1GJRA 2ZSIA 4LDJA 5J3JA 1OVMA 3SXUA 4J07A 1FB5A 1O8BA 5FLYA 2YV3A 3VMFA 3SJZA 1X38A 5TY0A 2IUYA 5I7EA 1NIJA 1FPQA 1DTSA 4G0YA 2QN2A 4V03A 4XQ0A 3VR6H 3CPJB 4BNXA 1Z2CA 1CUEA 1J42A 3SU8A 4EZEA 1WDLA 3EX7C 3OZXA 2X5KO 4X1YA 4N76A 1ULAA 4F12A 3A2MA 4UDYX 1UPTA 1QIHA 1VHWA 1WZNA 1OLUA 1YRYE 2FFAA 3AB8A 3PC7A 3AJAA 1Y9JA 1ZPDA 1CDEA 1JI3A 1GCOA 2XNDD 2NUBA 3ASYA 4O5OA 2IXEA 4M1OA 4UMFA 3DOUA 1JI0A 2G1PA 2QRNA 2VZEA 1XDSA 4KQFA 4WCVA 4WADA 1KDYA 4OOEA 1D2AA 1G20A 2OD2A 221PA 3H97A 4NFLA 4P31A 2VDRB 4G1MB 3V7FA 3SLKA 3WC4A 4D80A 1QX3A 3Q88A 1ZKDA 3WRWA 4Q47A 1O1YA 3ZX5A 2CZQA 1HMYA 1ZICA 1F4PA 2WTAA 3LQKA 1OWOA 3TOZA 4JUDX 1EVEA 1RI4A 4H0NA 3R1IA 3U0VA 3LDAA 1J8VA 2IZ7A 3HJAA 3JRXA 4JJKA 4QGAA 1W8DA 1BWQA 1A9RA 1N6IA 2JGAA 4XWOA 4IXNA 4RWZA 5C8DA 4MRRA 4NJOA 1TW3A 2I5PO 3JQ8B 5EKDA 1RWMA 4H7JA 1W9MA 2CCJA 2BFAA 2VC2B 3GUYA 4M3NA 2PGLA 3KFVA 3DE3X 2Z8ZA 2X1HA 4I4IA 5LKRA 2JLWA 1I1OA 5CLIA 1W19A 1YBMA 3H1FA 4UAJA 3LDFA 4PX3A 3GLHE 2UZ1A 4E3ZA 1ZNZA 1P91A 1JMKC 1U0JA 5JH7F 4KQ2A 1CS0B 1UWCA 3DXFA 2FZVA 4K6OA 1HDIA 3O21A 1CJMA 4GM4A 5P21A 4HQLA 3NHSA 1CXZA 2R7LA 2B94A 1B8UA 2WAXA 2AC4A 3IMGA 3JQ7A 2WY2D 3ZPXA 2PD6A 4RPIA 3FFXA 4R1SA 2ID9A 5EGNA 4ZTZB 3AIKA 4MGEA 3NTXA 2B37A 3NGXA 2BHTA 2WTEA 2PRIA 4GNKA 1QBGA 3F46A 2JEYA 2XCTB 3EDCA 5DNCA 1OZGA 1NZFA 5JC8A 1BXGA 2QE7A 2HHCA 1VI2A 1ZOPA 3IV9A 2CT8A 3EWSA 1AA9A 4L85A 2GHRA 2FB9A 4OQDA 4QQFA 2NT4A 3EE6A 3CXRA 3WY9A 2ETXA 4JU9A 2Q8PA 3CCBA 3Q0TA 1ZNXA 1DX4A 2QNBA 3O93A 3IBSA 4NU6A 1SQ0A 4QODA 5IKMA 2TMGA 3KJIA 4HGYA 1GL3A 4JMPA 5ARDA 2NU9B 4DLNA 2PMFA 3GRAA 4HADA 1E5LA 1Y81A 3TJZA 3RRMA 2FNAA 1V39A 3NHAA 3NHPA 4F5DA 4IX9A 3ZNOA 3QOWA 2YYSA 2W6OA 2D7JA 2PZFA 5KTKA 1U2RA 3Q6MA 4MKGA 1MOZA 3ZV6A 1Z4PX 2AXPA 4JBYA 1HURA 3JAWB 2YR0A 2R8PA 1GZ7A 2OHJA 4S05A 5JCPA 5CXXA 2SBTA 1ZZGA 3KAKA 1SOAA 5DIFA 4MMYB 1FX1A 5C80A 4GX1A 4WLEA 5CLJA 4BQFA 4LWZA 4MAFA 2WV7A 1A5BB 1C8KA 1G8AA 1RJ9A 4FDVA 4KLAA 1SUIA 4XLLA 2ZUUA 4ZANA 2HRCA 2ICAA 3H6HA 4UZFA 4N47A 1I14A 2B25A 2ZT5A 1R4MB 2G04A 1PV4A 4BN4A 4LX8A 2BTEA 3DOCA 4RUKA 2M6SA 3T7CA 1NMYA 2WTNA 3F6YA 1UBSB 4K9DA 2CFRA 1GU0A 3BTSA 5GM2A 3WAGA 3D5EA 1FBNA 1FTWA 1QWSA 2JHAA 2LR0A 3BBLA 3QMPA 4V3CA 5E0OA 4FQ7A 5EOVA 3RM3A 4B4DA 2VHUA 4BLVA 2JIMA 3SMQA 1ZDMA 2FCRA 5A5FA 4B3DA 4NCBA 5KQGA 3ZWXA 2IXDA 4YJFB 1IZ7A 3TAXA 1G7SA 1LW7A 1DL5A 3NAQA 4ND2A 3NHYA 2CL0X 5FEMA 1UL1X 4LSMA 3TJMA 1PEAA 4HATA 3V8PA 2OVFA 1F5SA 2FFRA 1N2JA 1LNSA 2HUNA 3VPCA 4INZA 2XF2A 2IEAA 5KVQA 1RLOA 4GXTA 2IT1A 3I6QA 4FBGA 4YAJA 1E6UA 1L7MA 1SVOA 5AW1A 3PFFA 5ES4B 1YF3A 1U3DA 4TX1A 2TYSB 2OCDA 3HWX1 4U0JA 4S0XA 4WV3A 4CG3A 2YIVX 5DM1A 3RFUA 5BN3B 1G3RA 2IYFA 5K05A 5B58T 1UOQA 2VDOB 4Y1RB 1T4BA 2Q3CA 1W52X 1CEQA 1FLNA 1W5BA 3NYIA 2HB6A 4BBJA 1P5JA 2BKXA 1RWOA 2NQ8A 3CEJA 3NC4A 2C8VA 3C7TA 4Q3DA 4B6OA 1NDUA 2QZZA 2G7ZA 1CRLA 4BVHA 4C0HA 3PGMA 4OXQA 1YCGA 3QUTA 3C7DB 4WKPA 4ZPJA 3RYTC 2FHPA 5JZSA 1HT1E 2PX3A 1ZIOA 1Z5ZA 4U0KA 1KZGB 3RAJA 4B7UA 2I71A 4JP5A 1GUAA 3F6CA 3LA6A 1TJPB 1A5AB 1USUA 1R27A 2XA1A 4O02B 4ZYTA 5AJTA 4G07A 1KTVA 2WIDA 5M2QA 4G5XA 1CRZA 2QD5A 3FN4A 4HBZA 4B3IA 2WQ6A 1JFTA 2VZ8A 1OXUA 1EXNA 1YVEI 3RSQA 1TQHA 4LC9A 2EGGA 1GCGA 2FWIA 1JV2B 4YONB 2YOHA 2ZSFA 2OK8A 3IA7A 4MQFB 4I5GA 4UC0A 5IZ4A 3BSSA 3JASA 1F1JA 4ZI7B 2I29A 1C2YA 2DFPA 1TM1E 3KC2A 3GPBA 3KPWA 3F5FA 3E2MA 4ARZB 3ZCTA 2O50A 4IIJF 2HWUA 4E09A 5AW5A 1RAIA 2I3BA 2AOUA 1KI6B 5MDHA 4WY2A 2P4QA 4C07A 2HQOA 3K1JA 3TYXA 1XAJA 2HMWA 1G9XA 1W25A 4GYWA 3PCXA 4G0WA 3O7WA 1NI5A 4GMFA 5I9IA 3RARA 4BU1A 2PXAA 3BHIA 1JGTA 2O3JA 1G21A 2R6R1 2W6JA 3EVGA 3OT1B 1FJXA 1GPWB 2RHJA 2H6EA 1RNLA 3LH5A 4B83A 1IN1A 3AP1A 1JWAB 1E6CA 4PQGA 1P9LA 3TBHA 2L2QA 2EGHA 2UYGA 3IULA 2P35A 2J31A 5CA0F 1I3MA 2YZKA 3PC2A 4IH9A 4EG6A 2GTHA 4PYRA 2IU3A 2F43A 2ISCA 5JR3A 5C4MA 4YIHA 4KQKA 3ILHA 2IYVA 2VA8A 1A96A 1G1AA 2YVLA 3AK4A 1W4AA 2BY4A 3OP1A 4FDLA 1A9XA 2H4JA 5ALZA 1MO4A 1P5HA 3F6EX 4DMUB 4Z51A 1UZNA 3O8CA 2XADA 3COZA 3R6LA 4HJXA 2Z5VA 4IKPA 2I6UA 2E4AA 2GO1A 2ZSUA 3ND6A 4J0DA 4LBVA 3A1NA 4EABA 4RZQA 4AKSA 1JLKA 2ZIVB 3TLGB 1X1RA 5JCOA 4E5KA 1FMLA 2D2IA 1J7JA 4ZJYA 4HDKB 1DQNA 3V8BA 3U4MA 1QVRA 2X5XA 5EE0A 1A82A 3LRXA 4HRVA 2GESA 1DMSA 3NONA 1KDTA 2XJ4A 3WYFA 3BGIA 4BO2A 1MPTA 4NE2A 1ENZA 3MMNA 3NOQA 5JAZA 3OQIA 4H77A 1OB2A 2RJ3A 3OFJA 5DBHX 7GPBA 3JVEA 4B6JA 1KZ6A 1T10A 1N1DA 3OZ7A 2EKPA 3DONA 3C7KA 3PD1A 3T5CA 1XMSA 2FUCA 2F7SA 3W2TA 4LZPA 4HS4A 4ER7A 1OMOA 1Z7WA 2O2GA 2QZSA 1ZOIA 3GFSA 3RWMB 3EPPA 4WK6A 2AI2A 3QENA 1M2GA 1E98A 1YGYA 3ESCA 4DR1B 1WMDA 1UC5B 2QORA 2JK0A 4KE7A 3NG1A 1S2NA 2O7RA 1BC5A 1FA9A 3RT1A 5IPFA 1QYCA 4NG5A 2XKKA 2PUFA 4NHEA 1TMYA 1AN0A 1VBFA 1B41A 1K4MA