4CM9A

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
267
structure length
249
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
total genus 88
structure length 249
sequence length 267
chains with identical sequence B, C
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cm9A00
1V3UA 1Z7BA 2CMDA 1C1XA 2FSVA 2EHDA 4D79A 4BKUA 4I5FA 1RYEA 2A9FA 4MVJP 4PLGA 5G0SA 4BO3A 1QLJA 3BHJA 4IIUA 1LDBA 4CQMA 3ZV3A 3VH2A 3EHEA 1LC0A 4CMBA 3RU9A 1BHSA 2EV9A 4Z0HO 1FJHA 3WX0A 7ADHA 5KCZA 1U5AA 3U4CA 3RI3A 4MKXA 4PG8A 4AJPA 3WIEA 1WDMA 2AA3A 3RUHA 3EVTA 3IUPA 4NBRA 5JCJA 4PLPA 1N1EA 4E21A 3GDFA 3W1VA 5A4DA 2YQ4A 4ALKA 2Y0CA 1DIRA 1I8TA 2VYVA 3IL2A 4JN6B 2VT3A 1GR0A 4BO7A 2EKQA 3AY6A 4U7WA 4QO8A 1WZIA 4M1QA 1PGOA 4G65A 4ND4A 1B14A 1SNYA 4I5DA 4D7AA 5BT9A 3TZHA 2Y1EA 2GNAA 4JLWA 3H5AA 1IY8A 3T7EA 1LNQA 2HKIA 3TJRA 3ZWVA 4DQVA 2X8LA 5JE8A 3DMTA 4P22A 3W6UA 2NU9A 1LDYA 4R68A 2ZJ0A 4N18A 1JA9A 4XYMA 1EEHA 5ILOA 3IJRA 4HV4A 1NFFA 3ANNA 3CUKA 4Q3CA 1CQIA 2EJWA 4YTEA 3B6ZA 3S8MA 5IN5A 3QVTA 1PR9A 2VRCD 5JFOA 3H4VA 4FN4A 2PH5A 3P19A 3AU9A 5I9MA 4ZVVA 3JQ9A 4OSOA 2WD7B 1YBVA 4DYDA 1NP3A 3UCFA 2QZZA 1JVBA 1EFKA 1NPYA 2VUTA 3BA1A 5B4VA 4ZQBA 3C8MA 1BG6A 1H6CA 3S2FA 5KJFA 2I5PO 2W98A 1MC4A 3V2GA 1HDZA 3LF1A 1E1NA 1YH3A 1MUUA 2DLDA 4IJVA 3VTFA 5AVOA 4TVOA 4PLWA 3WGHA 4DYVA 3VDRA 4G5HA 1DC5A 1QG6A 1BXGA 1MC5A 1ISMA 1ONNA 1Z75A 2FWMX 3A28A 3G1TA 2IEDA 4IDAA 3L0DA 4B79A 4JXKA 3ICCA 3FCOA 3DBHB 4BO6A 1YWGO 3GT0A 3LQFA 3WOHA 4CMKA 5L3ZA 3VVBA 4C7KA 3INTA 3JQGB 1VE9A 4RLHA 4TZKA 1ZK1A 4F6CA 3MZ0A 1CYDA 3TL3A 3Q11A 2XOXA 3RCBA 3X2EA 3NGXA 4PFJA 1YL7A 2ZIZA 3AM5A 1LLDA 4PRKA 1NVGA 2POQX 2VYNA 1JKFA 1NNUA 3N7UA 3LK7A 1HYHA 3EK2A 1WVGA 3IOYA 2VT2A 2Y05A 3ORFA 2UUPA 3FBGA 1U7HA 3C7CB 3LYLA 1GFSA 3PJGA 2PFGA 3BIOA 2DBRA 3ZWWA 1LI4A 3ZV5A 2LDXA 4CLHA 3K2BA 4J9VA 3DBRB 1CF2O 3F4BA 3AJRA 3JCZA 5T64A 2QHXA 1X0XA 3PDUA 3K73O 1YB1A 1ZCJA 5HTOA 3OBBA 1DHRA 3QQPA 4OKIA 4CMIA 1Q7BA 4LCJA 4M89A 1DOHA 1EUZA 2JFGA 2RH8A 4FGWA 1SZJG 1BW9B 3GUCA 3MEQA 3Q9UA 2EF1A 3GVXA 2NUAA 5KKCA 4B4VA 3E18A 3O38A 1M6HA 1PL6A 2YY7A 5DULA 3I3OA 4CLRB 3WBFA 3UH1A 3ZHZA 2VOJA 1CJCA 1I33A 3HDQA 4U6QA 2XXJA 4J0FA 1ENPA 3QWAA 3L6EA 3F1KA 3D5TA 3C7DB 3KZVA 1X7HA 1E1KA 1XG5A 1LSSA 4PLFA 3GAFA 5TIIA 4CMEA 5TT0A 2HAEA 2EGHA 4RF5A 3DZKA 3ZHXA 5JDIA 3ONDA 3NYWA 2VCYA 3EW7A 4O5OA 2R6JA 4IXWA 2PNFA 4CM4A 1H0KA 3HSKA 4ID9A 2BHLA 3BHMA 2IE0A 1OC4A 4UUPA 3RUFA 1RM0A 3OM9A 1PGNA 4K6CA 3EZLA 1T2FA 3KEOA 4JQCA 3CKYA 1MP0A 1CDOA 2JD0A 1PU2A 3DBLA 1ZBQA 1GPDG 3TOZA 3Q3CA 4WNCA 4KUEA 1ENZA 1D7OA 3JQDA 3PTZA 4P38A 3GN1A 1ULUA 3OEYA 4XB2A 1K2WA 4BKRA 4BIIA 3LVFO 4BOYA 1MV8A 2AQHA 2EERA 1K6IA 4KP7A 4YDRA 2FN7A 2O7QA 4BNHA 1F06A 5K0ZA 4YT2A 4CM8A 4D45A 1PZEA 1WMAA 1DFIA 2J5KA 5A9RA 2DT5A 3MJEA 8LDHA 4DLBA 1GADO 1N1GA 2WSBA 4JIGA 3E48A 4BNWA 1E0DA 2JHGA 3WIDA 3KLPX 4IZIA 2GDZA 4F45A 3RUIA 4ESOA 3B20A 2IXBA 3I9MA 4MP8A 1P44A 5JMPA 4P4LA 5DT9A 3ZU2A 4XYBA 4DBVO 2IDZA 1BDMA 2UDPA 3JQFA 4KTTE 4CMCA 1IZ9A 4LMRA 1DBVO 3ZI0A 4E5MA 3N74A 1BWSA 5A1TA 5DZSA 1LU9A 5EL0A 1JQBA 1PQUA 3JTMA 1R16A 2Y1GA 4DPMA 5L51A 1PSDA 1DEHA 1C14A 2Y1FA 4ALMA 4CQLB 4FFNA 3BXXA 3HB4X 4FPXA 2BF7A 2W8ZA 3DFUA 1YJ8A 3PFFA 4RVFA 3PHJA 5A3JA 4HFJA 4LSWA 4GAEA 2HMWA 3VC7A 4YJHA 2C29D 2B4TO 3HUDA 4XYGA 1H6AA 3GPDG 1K0UA 2GZ1A 1OOEA 2Y0EA 1LSUA 3H8VA 1E3IA 4BNLA 1N7HA 3TFOA 1ZK4A 4B7UA 5JY1A 3HDJA 5B4TA 2IYOA 1UDCA 3QWIA 4M87A 5JLAA 2Y68A 5COAA 1A27A 3WWYA 2Z1NA 2Y1DA 1IE3A 2W2KA 3IAHA 5A04A 4BNZA 1OFGA 2YV2A 4Q3AA 3DBLB 1DXYA 1H6BA 4E4YA 3U3XA 1WW8A 1E7RA 4TSKA 4QECA 5A02A 1GUYA 2X9VA 3JQAA 1W73A 3V5NA 4B3HA 3OECA 4UVHA 4IGFA 4JK3A 3OIGA 3NV9A 2Y1OA 1WDLA 2IODA 5EN4A 3ICPA 4N5NA 2V65A 3NT2A 4BMNA 4DLAA 4ALIA 1A7KA 4UUOA 4U8GA 4BKQA 1E77A 4B8WA 4DVJA 4XR4A 4U5QA 2Q2WA 1B16A 4J4HA 3F5SA 4W7HA 3IKTA 4ZQEA 1XGKA 3EYWA 1R0SA 2VWPA 4PGFA 4RPKA 3U49A 1J6UA 1EVJA 3IMFA 3BMNB 5KOIA 2VTDA 2O3JA 3M1AA 1PEDA 3O26A 4CLEA 4D3FA 5C37A 3PK0A 1T1SA 1RM4A 1LRLA 4JBIA 3ZU3A 3OIFA 2YDYA 2PA3A 1R4NA 4NU5A 3HE3A 3KM0A 4PRLA 3ZWAA 4GH5A 5I8WA 2X5JO 3D5QA 2DBQA 3UXYA 4LMPA 3WNQA 4IINA 4QX6A 5AXAA 5IZ4A 1UP4A 5HM8A 1T1RA 1YL6A 2CVOA 1ZSNA 5G4KB 5I8ZA 1EUDA 1M75A 3EDMA 5C5IA 5EPOA 3WLEA 2HK7A 2DKNA 3W6ZA 1ADGA 1HDYA 4DQUA 4MVJD 1M2WA 2NTVA 3OJEA 1NWHA 4Q3DA 3U0BA 1D1SA 3PGJA 4EUFA 2TMDA 1SEPA 4GMFA 5L45A 1JWBB 1XWFA 2GUGA 3ETEA 2VWGA 3VZQA 3TZ6A 4J2HA 3WMXA 2PGJA 1DIAA 1KOLA 1BRMA 3FNHA 4LRSB 4AJLA 5JYEA 3AUAA 4KDEA 5L4LA 4YPOA 3L9XA 2P9CA 2CDBA 3HADA 3GVHA 1MG0A 2YQ5A 4OKNA 2D2IA 2OHXA 3RUDA 2W90A 3WSWA 1DPGA 1ZW1A 4CM9A 3DHNA 1WAMA 2OBYA 1P74A 5KVSA 2AMFA 4J43A 2JL1A 1GU7A 4NIMA 4BB6A 4EI2A 5MGBA 1YVEI 1LSOA 4TZTA 2QZ9A 4OYRA 4F46A 3QRWA 5JDCA 3IP1A 1ZXBA 1L1FA 3SJ7A 3JD3A 2VN8A 2C7GA 1DSSG 1X1EA 4QFCA 4YEDA 4R9RA 4ND3A 3H9EO 4TMFA 4BNUA 5L7YA 1R0LA 1B8VA 3S2EA 1C0PA 5H82A 3JV7A 5DP2A 1GUFA 4BNIA 2CUKA 1PGJA 3PHHA 2NU6A 1I01A 4LN1A 1G1AA 4CMAA 3UVEA 2EXXA 1KETA 3ONFA 1KY4A 2PZMA 5G2OA 1GPJA 4AL4A 3ZGYA 3H9UA 5EMHA 4CMEC 6ADHA 1KBZA 1V9LA 3DOOA 3KSDO 1B3BA 1I24A 1TVEA 1RKXA 1LSJA 2YFQA 3HWRA 4AG3A 3IIEA 1VSVA 5CDUA 4E12A 2GN4A 2BGMA 3I52A 3P2OA 2EIHA 2OP1A 1NAHA 2X7HA 3ZWCA 1TI7A 2CVQA 3AUSA 4PG6A 4CM5A 4W82A 2ZYGA 1R12A 4YT5A 1Q0HA 3JQ9C 2V6BA 3PVZA 3GEGA 1OC2A 1YDEA 4H16A 1NVMB 4PZCA 3F6YA 3JD0A 1BSVA 4RO0A 5AXDA 1KC1A 3KB6A 3WSVA 4IJUA 5EJ2A 1WXDA 2UV8A 4TROA 3W8FA 1JLLA 2ZB7A 5B4UA 3RVDA 4AJHA 1MLDA 4RVUA 1PGPA 5FFFA 5I7FA 2G0TA 2PWZA 1NQOA 4XB1A 4AJ1A 4DMLA 3COSA 5L53A 5JAQA 4YRAA 5DF1A 1E1LA 3GFBA 3S2GA 4EITA 1E7YA 4YT8A 2NVBA 1VKOA 3K5PA 3U62A 4E5PA 3Q2IA 4WGGA 3NT4A 3PXXA 1W0CA 1T4BA 2GLXA 2VHVA 4BVAA 3ZHYA 5GZ1A 3OQ6A 5T5QA 2OO5A 6LDHA 3PWKA 4IUYA 4WK6A 3TQHA 3ZWXA 3VPFA 3JSAA 3F1LA 3Q0EA 5JAMA 4YR9A 1UAGA 4RVGA 1E3LA 1XYGA 4XA8A 2ZQZA 4F6LA 5CDTA 3GEMA 2F1KA 3JYOA 5IDQA 4FOSA 2VRCA 3QWBA 1ZK2A 3GGOA 3KEQA 2EEZA 5KVQA 2BRUA 2DUUA 3H5NA 3QE3A 3W4JA 3WR5A 1E7WA 3DZHA 1PJQA 4EDFA 1R4MB 1QRRA 5JC8A 1T25A 2GZ2A 3KUXA 3T7CA 5THKA 3VDQA 2ZCVA 4BQRA 4CQMB 1Q0LA 1K3TA 2HK9A 4CR7A 4KQWA 4K28A 1PJTA 1BW9A 1BMDA 3W4KA 4BGEA 1C0KA 5L4NA 4YJGA 3DR3A 1KVQA 1JKJA 1UZMA 4E0BA 3VH1A 3NDJA 3PIDA 3H6KA 4BUCA 2FR1A 2GO1A 4XWYA 1JAXA 4A0SA 3WNVA 4JJGA 5L4SA 1FDWA 3D3WB 4NJMB 3C7AA 4GWKA 4YRDA 3LC7O 3GDGA 1CERA 5HS6A 3MWDB 1Q2XA 4E13A 4DPLA 1SC6A 5F5LA 2B5VA 1P3DA 2PY6A 1P9LA 4BL5A 1T4DA 2DPGA 1PQWA 3E8XA 2X4GA 3GVIA 4FOOA 1VL6A 4RF2A 4CM6A 1B7GO 1XU7A 3GG9A 1F12A 1NX6A 4LRTB 4XX0A 2BMAA 5TX7A 5LCXA 4Z3KA 4A10A 3PYXA 1ZXLA 1NWCA 1HDOA 4KUHA 3BTVA 4CUKA 2AE2A 1ZFNA 4BKOA 1GQ2A 4D46A 1FDUA 4WOKA 5IXYA 3Q9NA 1EK6A 5BNTA 3ASVA 4Z9FA 4XQ9A 5CG1A 4LISA 4CMGA 2NTNA 3IQDB 3BTOA 3N58A 3JQ8A 2P5YA 4NK4A 1PJ4A 3GFGA 2Q1WA 3ZWBA 1QYVA 1UXHA 4OQYA 3ZV6A 4Y6PA 1QYCA 5A5FA 5BSHA 1JAYA 1H2HA 2QG4A 4Y6SA 4MO2A 2J3HA 2FPGA 1HL3A 4IBOA 4J91A 4ZQFA 3ANLA 5JC1A 3AK4A 4XEHA 1V35A 3DAPA 3S2IA 3JYQA 4DQXA 1BXGB 3PHIA 1H2BA 3SJUA 3GZNA 4DC1A 3GC6A 1H5QA 2J3KA 5DBFA 4CODB 4MPDA 1Y8RA 3DAGA 2VUSA 5HA5A 2BLLA 3FR8A 2O3TA 3OFSA 4C7JA 4DMMA 2W4QA 1IPFA 1Y8QB 3LDHA 3GH3A 2VZ8A 2HMTA 1V6AA 1PL8A 5DOZA 4AICA 1ZVMA 1Z73A 1EDOA 4J4BA 4M49A 1E5LA 1U28A 1YS4A 3JQ8B 5TNXA 4E6PA 1HE2A 1Y7TA 3QLJA 2BFOA 3LLVA 3AFNA 1W6UA 2CDCA 2G17A 3HFGA 2HK8A 1E3SA 2B83A 4J3FA 5IXSA 1I30A 1LRKA 3CIFA 1LEHA 1HT0A 3FN4A 5JPIA 5CDYA 2PZJA 3WS7A 3M2TA 4FDAA 3RKUA 2DQ4A 1ISHA 1XCBA 3TNLA 5JO0A 4TWRA 3AI2A 2QYSA 5LDGA 5IG2A 5CFZA 1Z45A 2RHRA 2Z5LA 4IGEA 4MIOA 4R9SA 5TT1A 4EJ0A 2C5AA 3HQ4O 5K6AA 3CXRA 5JO9A 2J5QA 4UVDA 2H6EA 2OUIA 1VJ1A 3G1UA 1PZGA 2JD2A 3RJ5A 1LDNA 4AFNA 3GNQA 3ZH2A 5ITWA 3UCXA 3SEFA 4ZN6A 4B7XA 1P1FA 1VRWA 3AI3A 4B4OA 2DM6A 2PR2A 1N8KA 1ISFA 1F8GA 5A5EA 3LZ6A 2HRBA 1BXZA 2HLPA 3NUGA 3KHUA 3IS3A 4MP6A 4XQCA 2P9EA 4Y98A 1VM6A 1GYQA 2J3IA 1B3RA 5A03A 2BELA 3DC2A 3HDYA 4HNGA 1HDRA 1HZJA 1EE9A 1OAAA 1YRLA 4I08A 4RQTA 3WGQA 4E2XA 3IKVA 2RH4A 1I2BA 2WMDA 3LC1O 3RUCA 3GG2A 3NJ4A 4DGSA 4L4RA 3VKVA 4CR8A 1EK5A 4YAJA 3SBOA 4L74A 4GVLA 2D0IA 4PCVA 2O4CA 2WTBA 3K6JA 3KYDA 3PI7A 3SVTA 1VC2A 1XIVA 1QYWA 4TRNA 3W8EA 2VNSA 3QIVA 5DCWA 5DNAA 2QIOA 5F21A 2R00C 1ZJZA 2V7PA 1FF9A 1PJ2A 2I66A 3EMKA 4K26A 3PLRA 1PJ3A 3AY3A 3K30A 4FR5A 4WJZA 5IDYA 1YOVB 5CDSA 2JFFA 1X14A 3GNTA 4KUGA 4DPKA 3V1TC 4A26A 1YGYA 2PTGA 2V6GA 3DO5A 3PFWO 3VAZA 4NFSA 3O03A 2WD7A 3D3WA 4NJMA 4WCFB 4YQZA 4G81A 4CL3A 4CM9D 4EBFA 5HRUA 1OI7A 4BGUA 4MVJM 4A27A 1IZ0A 4RGBA 4DIBA 3E9QA 4GPD1 3L4BA 3GF4A 3PQEA 1YE3A 1AHHA 2JFHA 3I9JA 4J90A 4BMSA 9LDBA 1O95A 3SLGA 1CWUA 1LXCA 4RPLA 3UW3A 5GY7A 1P1IA 1T2AA 4NFHA 3VKUA 2AEMA 3RUEA 1ENOA 4EEXA 3MOGA 4GKVA 4IDDA 3B1JA 3WYCA 3SC6A 3D4OA 5HWSA 3GNSA 1O5IA 2QW8A 3KVOA 3BAZA 2DTDA 3WXBA 3BMCB 1NYTA 3NTQA 3U5TA 3BMQA 4MVJE 5JDCC 5COBA 2O23A 1FDVA 3RC1A 1PGQA 4RZHA 1LC3A 4EUEA 1I2ZA 3ZU5A 4BO2A 4PVDA 3FI9A 3I6IA 4FJ0A 1X1TA 2O50A 2G82A 3ABIA 2X5KO 4CLRA 4OL9A 3JD2A 2PKRA 3JQAB 1I36A 1DIHA 2AE1A 4DIFA 1DRUA 3PRJA 2YJZA 3VHRA 1IL0A 4FSHA 1LUAA 4OXYA 2EG9A 3RWBA 4RL6A 3TRIA 3ULKA 3LT2A 1ARZA 4A7PA 3E6AA 1U3TA 3KO8A 4NR0A 4R4JA 3ZHBA 5FEUA 1XHLA 4YB8A 2GZ3A 4NBTA 3WTBA 4DRYA 4W6ZA 2E6UX 4XZ3A 3GQVA 4WLFA 5L9AA 4R54A 5KJ1A 4M8SA 3WQQA 1HF3A 5A9TA 4NJOA 1QSGA 2I3AA 1R0KA 3H5RA 3ROPA 2NVUB 3RC2A 3OETA 3QHAA 1O89A 2F00A 3WJAA 3AOEA 4RDIA 2NU8A 1C0LA 2Y99A 3GR6A 3WQSB 3JQ7A 4EYEA 4GLLA 1HXHA 3VVCA 1DHTA 1ISIA 3DTTA 4J1QA 2C59A 4ALNA 3CEAA 3OMLA 4YVFA 4FGSA 2O4UX 3W4IA 1ULSA 4FFOA 3WFIA 4ZICA 5JSFA 1U1IA 4YAGA 1E6EA 3F4LA 3G3EA 3TL2A 3ZW9A 4EUHA 1VLLA 4E5NA 3RASA 2GD1O 4YJFB 4WLUA 5CP8A 3INRA 3D4NA 3INGA 1A4UA 3FNFA 4G2NA 3JQAD 1A4IA 3VZSA 1ZSVA 2WM3A 3L4SO 4GSKA 4EEZA 1DLJA 4L0QA 5T6BA 2G76A 3RROA 1PJSA 2J5RA 4BNKA 2OOSA 1JVSA 4WEQA 1B0AA 3GN2A 4MVJH 3B1KA 2FR8A 3UGKA 5MDHA 4UEKA 1O9BA 2NLOA 2PLAA 4K1LA 3QW2A 4L73A 2YV1A 4B8ZA 1NFQA 4TRRA 4WLNA 1I3LA 1JU9A 1WZEA 1P1HA 3F9IA 1NAIA 3FSRA 4FJ1A 5JYDA 3FNEA 5IFLA 1E3WB 2E4AA 4WE3A 3DZFA 3FWZA 1SAYA 3QWFA 5JDIC 1GD1O 2QQ5A 4O59O 2V6MA 4E31A 4PLZA 2JCVA 2H1SA 4ZQGA 3HHPA 3NDRA 4KQXA 4J49A 3T4XA 2Y0DA 3OJLA 3VPGA 4FFMA 1DJQA 1ZMTA 2X0NA 1HE3A 3TZKA 2ZYAA 4AJJA 4CLOA 2OP0A 1NTOA 4RF4A 3K92A 1SCUA 5EQFA 3GDOA 5CPBA 4LW8A 3ADOA 2QYTA 3A9WA 2Z95A 5T8KA 5I7SA 1JWAB 1WNTA 3DQPA 3AFMA 4KWIA 2VRBA 4Q3BA 1E92A 3OQ1A 4HWKA 3RU7A 4W99A 1IB6A 4RLSA 3FPCA 1PWXA 4XD2A 2AHRA 3PLNA 4DWVA 2FPPA 3SC4A 1E3JA 1HYGA 5A3VA 2DC1A 2PD6A 4BS9A 2ZKLA 4GGOA 1ZH8A 1NM5A 2CD9A 3V8BA 1GL3A 4I9HA 3OICA 4II3A 3PJDA 3KSZO 3CZMA 1E3EA 5ICSA 4NH4A 3WJ7A 5J23A 2UVDA 1Y1PA 2AQ8A 3GA0A 4NK5A 3PJEA 3K2EA 1BVRA 3C1TA 4FC7A 2X1HA 3NEPX 2PD3A 1RPNA 3DBVO 4O0LA 3MJTA 5ES3A 3GGGA 1PR3A 1O8CA 4OAQA 4YRBA 2E48A 5LDHA 3D1LA 1DFHA 4FS3A 2HU2A 5EERA 3ZWPA 3C1AA 4BNTA 3JQ6A 1NR1A 2YFHA 2VWQA 2GR9A 5CEJA 3BZUA 4EJMA 4ZU3A 2FSSA 2JD1A 4CM7A 3U9LA 4GX0A 2C7VA 5CPFA 1DDOA 3LT0A 3ZU4A 2PKQO 3ZCXA 4U6SA 3GPIA 3WGGA 4GWGA 1HDXA 4RV9A 5CG2A 2AQIA 5B37A 3TN7A 1H9BA 2ZATA 1DIGA 3L07A 2I6TA 2JAPA 2B35A 3JD1A 4D43A 3HJAA 1EFLA 4WASA 3BHIA 3CINA 2ZJ1A 1KVUA 1ZSYA 2GN6A 2VTEA 3LT1A 4IDCA 3TSCA 3WGTA 1IPEA 4HFRA 3QVWA 5BNIA 4CJXA 5HBRA 4MKRA 2J8ZA 1C3VA 3GGPA 3QSGA 3I9LA 4BV9A 1UXIA 2YHIB 5DP1A 4BO8A 1VJTA 1M6WA 3MWEB 3E1KA 1UXJA 3NAQA 4LVCA 3LLSA 4I1IA 2Q1SA 3WICA 4MVJI 3BMOA 4R51A 1I32A 2YHUA 2NVUA 2E37A 5DN9A 3DOCA 3FWNA 1YQDA 3I23A 2VHZA 2JCYA 3I1JA 3GVPA 4DA9A 2AW5A 2XPCA 4UUNA 3QWHA 2RCYA 5KJ6A 2PH3A 3F47A 2VYND 1GV0A 2A94A 3RFVA 2AG5A 1GY8A 5IF3A 3RBVA 4ZA2A 1SBYA 3DOJA 4IM7A 2B37A 4TRJA 4II2A 1CEQA 3L6DA 1UUFA 1F17A 1L7EA 2NM0A 3DZGA 5AQ1A 5CEFA 3I9NA 3KBOA 1YB5A 3M1LA 4WUVA 3UOGA 2EW2A 4KZPA 3GZ4A 3GVCA 1O0SA 2WDZA 3DTYA 4WCDA 1LDMA 1Y9AA 5G0VA 1UAYA 2IZZA 3I4FA 4TVBA 3SXPA 3VOSA 1I0ZA 2NQ8A 2Q1UA 3HN7A 1FK8A 1AHIA 3PHGA 3TOXA 2Q3EA 4PLVA 1ID1A 3FF4A 2AG8A 3G79A 1ADCA 2DAPA 5DBIA 1PZFA 4CPDA 1KIFA 2LDBA 5F1KA 1HKUA 3K96A 4I8XA 1Z82A 2GERA 3U4IA 4IDFA 2D4AA 7MDHA 4XJSA 4FIZA 1XEAA 2VNAA 1HETA 1S6YA 2OMEA 1QV6A 3UN1A 3DDNA 4YCAA 3PWSA 1QR6A 4R16A 3UICA 1N92A 3ANMA 1LDGA 2OORA 4UVGA 2AXQA 5JMWA 2QRKA 1GYRA 4HXYA 2DBVO 3PZBA 1SMKA 4NFYA 2GSDA 3AOEC 5TSDA 4R1UA 1UJMA 3MOIA 4B7CA 5JCXA 2C2YA 3K31A 4NQZA 2CDAA 3KRTA 1LDEA 1Y81A 3H3FA 4YJDA 4HADA 4CMIB 1LLUA 3DBRA 3SX2A 1W8DA 1MG5A 4O63O 3AUTA 4BNXA 4R1NA 5TS3A 3AU8A 3ZNNA 4DBZA 1DRWA 1DC4A 2Z1MA 4HY3A 4M55A 1ZK3A 2EP7A 1XLTA 4MINA 1NHWA 4IDBA 2NTJA 1TLTA 3NRCA 4WNIA 1UDBA 3VZRA 3DZBA 4GQAA 2IRWA 2B69A 1MA0A 2RIRA 5TRTA 3TF5A 1KEVA 3WLFA 3JQBC 4FD3A 4OOFA 1QLHA 5ITVA 3F46A 3K8ZA 1ZMOA 2Q46A 4EZBA 5AXCA 2CY0A 3ASUA 1DAPA 1FDTA 4OH1A 1QORA 4LVUA 2ILTA 1DIBA 3MJCA 4KOAA 1F8FA 1EUCA 1PS0A 1IULA 1JKIA 4DLLA 1KVTA 4QSMA 3DL2A 3GLQA 2O7SA 2V6FA 4N7RA 8ADHA 4L4XA 4ROSA 4H15A 3O8QB 4BV8A 2WYVA 2ZQYA 1GUZA 4UEJA 1WWKA 4IJWA 3EY4A 3HB5X 4XR9A 4Z0PA 4IQ0A 4BNGA 4JBHA 4JJIA 4Z9XA 4JJFA 1JDJA 2CZCA 4N5MA 1GZ6A 3GMSA 3KYBA 3ZN2A 1MGOA 3KV3O 4GX2A 3R3JA 4XCVA 4J7XA 1BDBA 5DBGA 3OF2A 4LCEA 2WE7A 3ZWYA 3E9MA 3PJFA 1E7MA 4A5OA 1Y8QA 5C7OO 5JXWA 1Q7GA 3IUSA 4Q3EA 3L9WA 4INAA 5CEEA 1EE2A 1HDGO 2X5OA 4ND1A 1OZAA 5I9LA 3MCVA 5IDXA 4IQGA 2FOIA 2BI7A 4L75A 1VPDA 1R15A 1YDWA 3EAGA 3JYLA 1N2SA 5JAIA 4YJGB 2C54A 2TMGA 4OO3A 4PG7A 3GMDA 4PG4A 4Z9YA 4ZJUA 1PJCA 3CMCO 4OQZA 4A2CA 3KLMX 1PL7A 4PLHA 4AJNA 4XIJA 2WD8A 2NWQA 3WYEA 4B3IA 2ZK7A 2ZTUA 4BQPA 2IZ1A 3PDJA 1K6JA 4Q9NA 3UAGA 5FI3A 1XELA 3WMWA 1GZ4A 2VOEA 3NT5A 1P1RA 2D1YA 1RYDA 3WTCA 3Q2KA 2NVWA 4QQRA 2HDHA 4CV0A 4XYLA 1ISJA 2Y67A 1YONA 4XRRA 1HE5A 1TT5B 1IHXA 4JBGA 3T4EA 1TXGA 3C1OA 1ZNQO 4JP3A 1E7QA 4E32A 3P5SA 3JQBA 2DPHA 5EINA 4EJ6A 5KJCA 5BNFA 2XF8A 1U2DA 2Y66A 3ROKA 1ISGA 3NTOA 1E5QA 3MTGA 4J7UA 4YXFA 1QP8A 4GGPA 2EJVA 4UEOA 4MKZA 4XIYA 3RBXA 1HSZA 2X9GA 3JQFC 4CV3A 1E6WA 5KKAA 5U1PA 3ST7A 2QX7A 4LK3A 3RQSA 3QVSA 2Y1CA 4YWJA 2O2SA 3JYPA 4OM8A 1M76A 1JN0A 2PGLA 4ZD6A 5FYDA 3ZNQA 4DREA 4E3ZA 2C0CA 2DTXA 3RKRA 4Z6KA 2BKAA 4HUJA 5K6AC 3QY9A 1Y9EA 3RD5A 1YQGA 3ON5A 4KDFA 2W2LD 4UULA 5AXBA 3EUWA 3TWOA 5I7VA 4CV2A 3DEYX 3L77A 5KTKA 4JX8A 3OIDA 3OP4A 4NPCA 4R41A 4FFLA 4KMSA 4BNJA 3AWDA 1PWZA 1IOLA 5KVVA 2OFPA 2B0JA 2GGSA 1A5ZA 1U3UA 3ZWNA 3BYZA 3FRJA 3HN2A 3WG9A 4NBUA 3C24A 3OJOA 4BNYA 2GN8A 1LBEA 2I9PA 3BTSA 1U7TA 5EQDA 4P8RA 2JCXA 4PLTA 3HNPA 2J3JA 4XDZA 4HNHA 3RAJA 1FXSA 4K9DA 3RBZA 1ZJYA 4BO9A 1T2DA 4QFDA 2X9NA 1F14A 1KVSA 4RQUA 1HWYA 1NXQA 4ZGWA 3WGIA 2W2KB 1KEUA 1EZ4A 1WDKA 3HFSA 4OMUA 4CMHA 5JCJD 4WPGA 2ZTLA 5I9NA 3KOUA 3LT4A 2FRDA 5B12A 1YBAA 2H63A 1P0FA 3C85A 3NTRA 2GF2A 4GX1A 3S1LA 3K9QO 1YL5A 4MVJF 4A73A 1BGVA 3R1IA 1B26A 3ROMA 2X23A 1HRDA 3WGYA 4WCFC 2CVZA 1NQAO 1GV1A 3I9OA 1ONPA 4GL4A 1CIVA 1T26A 3V1UA 3WQRA 3ZV4A 1PJBA 4BMVA 1GQYA 1C1DB 1A71A 2PZLA 1G0OA 3AM4A 4BNNA 4D3DA 1R37A 4L9RA 1VL0A 1YKFA 4NNJA 1H9AA 1IHYA 1HLDA 1HEUA 3JD4A 3Q6IA 3AY7A 4FW8A 1NFRA 2Q2QA 2WWRA 2FP4A 1U8XX 4RPHA 3ADPA 3ETDA 2BH9A 2C20A 1G0NA 2ZTMA 3AM3A 3DHYA 1Z6ZA 4ND2A 1UH5A 2Q4EA 2WYWA 2X6TA 4KWHA 3TZCA 1NR7A 4GMGA 5A9SB 1D1TA 3JQCA 3U4HA 1HYEA 2B5WA 1RJWA 2I99A 3ETGA 1A9ZA 3MJVA 1AXGA 4AJKA 1SO8A 2HRZA 3DBHA 4FCCA 3RFTA 3RC9A 3PYLA 4Y8VA 3GY0A 3STHA 4DXHA 2E82A 3ZNOA 2UUOA 4BGVA 2W2LA 1MX3A 4P4NA 4C4OA 4R5HA 1B8PA 3OJFA 3FPLA 4E5YA 2VHYA 1MB4A 2G5CA 4QEDA 2H5LA 3W8DA 1B8UA 3NJ8A 3UKOA 3EVNA 1X7DA 2DFDA 5TF4A 3ENKA 3IJPA 4L4SA 3G49A 4NDNE 4XQEA 1XU9A 1QKIA 1EVYA 2FZWA 1PIWA 4A03A 1HZZA 4GI2A 1G6KA 4XGIA 3DONA 4YAKA 1LLQA 4NI5A 2P9GA 4GBJA 1R4MA 4QO7A 5G0WA 1YOVA 3P2YA 2FMUA 5EIOA 4ZRMA 2QRJA 4OIMA 1H94A 5TGDA 2Q1TA 2YHIA 3GK3A 5JW6A 3VH4A 2HO5A 3R0IA 2CF6A 4IXTA 2X58A 4I9NA 4NZ9A 3QP9A 1EVIA 4ITUA 3QV1A 2FPIA 2P68A 3OA2A 4OOEA 4YYZA 1A7AA 4WCFA 3CH6A 3BTUA 1MXHA 1I2CA 2NU7A 3H65A 4IS3A 1SB9A 5ICMA 1N7GA 4FFPA 3FTPA 1Z74A 4Z3DA 1PS8A 2GASA 4CR6A 4D41A 4D0SA 4IPTA 4GKBA 4E5KA 1HSOA 2RAFA 4NG5A 2HMSA 1BVUA 2EP5A 2UYYA 1NHGA 1NPTO 3F3SA 1UR5A 4YAIA 1LTHR 4J6FA 2EKPA 1EBUA 1QV7A 2BD0A 3UHAA 1LA2A 1RM5A 5IDWA 3NX4A 1A9YA 5JY6A 1F0YA 2VHXA 3ZZNA 1PTJA 1TEHA 1Y6JA 1E7SA 3L6OO 3PPIA 3GEDA 2I65A 1FDSA 4L8VA 2D8AA 4FFRA 4HKTA 2JKVA 3VH3A 2GPTA 2NADA 1MXFA 1DJNA 3P7MA 3RSHA 2YV3A 3WDSA 4FBGA 3LC2O 3JQEA 4AJEA 4Z0TA 3B70A 1U5CA 3I9KA 4LGVA 1I3NA 2DTEA 4FQ8A 3ZDFA 1BXKA 5BQFA 4ZRNA 2IXAA 4CM3A 3GUYA 4L76A 4RVDA 3E9NA 4IMRA 4BHTA 4EW6A 5KNLA 2O3UA 4OGWA 1XQ6A 3G17A 1ADBA 2EWMA 5IJZA 4R5MA 4XJTA 3MJSA 3WBBA 1I3MA 3L4BC 3F5QA 5LC1A 2PZKA 4IDGA 4M54A 1U8FO 3TDKA 1CRWG 1EVZA 4R3NA 1FMCA 1H6DA 2A35A 3ROQA 4Q3NA 4D3SA 1KEPA 3GRPA 1U9JA 1HLPA 2EKLA 4OHUA 1EDZA 3DMTC 3RUAA 4CUJA 4PVCA 5TJ9A 4R01A 1GTMA 5BSFA 1NPDA 3CZRA 3DZIA 4RPGA 4I5GA 4Q39A 4W9NA 4WLEA 2HJSA 5GZ3A 3UCEA 4MDHA 1GQQA 3NDIA 4NMHA 4PLCA 2FY8A 1UP7A 1VKNA 2P4HX 1GCUA 1K6XA 1GAEO 3MJ4A 1DB3A 1HTBA 1XDWA 2J6IA 1J4AA 1V3VA 3HDHA 1DO8A 3FR7A 3PQFA 3E82A 3JYNA 4YACA 1AUPA 2Q45A 5A06A 2OXIA 4PZEA 3AUUA 3ENNA 4Y67A 5B1YA 1UP6A 3WWZA 3PWZA 2NV6A 2NSDA 1I5RA 2CNBA 1D4FA 1DRVA 3D4PA 1T2EA 1WLYA 4U0KA 5IZCC 2X0RA 2ZB3A 4ONEA 2Q2VA 4WLOA 5ADHA 4BO5A 4ND5A 5C7LO 3D0OA 1NVTA 2HJRA 1E3WA 2EW8A 2HQ1A 2B4QA 3R6DA 2NQTA 4FJ2A 1EQ2A 5IN4A 1KS9A 2AEJA 1PQPA 1SOVA 1I3KA 3Q1LA 4J9UE 5F5NA 2VHWA 4MJLA 3PQDA 4BNFA 3G0OA 4H7PA 4WLVA 2I3GA 5L7TA 1KY5A 3FTNA 4PLYA 3O8QA 4CQLA 1D8AA 1GDHA 2WE8A 2Q50A 4DUPA 1Y5MA 2ZB4A 4CUZA 2B4RO 5T8KC 5K9ZA 1QXSA 3VPHA 1D3AA 1BTOA 1X13A 1YXMA 4J4TA 5JBIA 2X0JA 3OEWA 4B4WA 2DU8A 4XRGA 2HMVA 1XQ1A 1YBMA 2WJPA 3X2FA 4CMJA 4RDHA 2DUWA 5A9SA 3O9ZA 4E30A 1ZK0A 4R3WA 1N5DA 3H2SA 4H3VA 3RIHA 4R1SA 1PJLA 5COQA 3OHSX 1N9GA 3PP8A 2IYPA 2PD4A 4J7CA 3PGXA 2D3TA 4I9UA 4RZIA 4JROA 1DC6A 1E1MA 2E49A 1Q0QA 5T67A 1LLCA 1M66A 3KTDA 4YBZA 5DCUA 4D42A 5EESA 1EBFA 1GYPA 4XYEA 3B1FA 1QYDA 3OH8A 1V0JA 3D64A 1ZEMA 1AGNA 1X15A 4M86A 1ORRA 3PHLA 1PS9A 1YB4A 1IUKA 1LQUA 4HP8A 1B2LA 2C07A 4ZQHA 5JNLA 1UZNA 1VJ0A 2YW9A 3H3JA 2HMUA 1VSUA 2WYUA 4MVJA 4QXMA 4IZHA 3FD8A 3D3EA 1R4NB 1B15A 1AXEA 2R2GA 5FF9A 4FC6A 2BFAA 2O48X 3H9GA 4DC0A 5IAAA 4URFA 1ONOA 2FR0A 1T24A 2WEKA 4QUKA 1N9GB 5A05A 4MIEA 4WKGA 4GVXA 5FI5A 1QYXA 1LQTA 3I4CA 4ALJA 1YJQA 2BFMA 4Y6RA 1ZO8A 4CM1A 2PK3A 3GHYA 3TZQA 4NU6A 5KVCA 2ZTVA 3PYMA 2ZYDA 2B36A 1XR3A 3PIIA 3V2UA 5TLSA 4W4TA 4E2ZA 1E6UA 4CM8B 2DFVA 1KYQA 5G4LA 3WFJA 3CSDA 3OQBA 5G0UA 3WYBA 4BNVA 2I67A 4TQGA 1ENYA 5L40A 5L95A 1UZLA 2IZ0A 3NGLA 4LSMA 4CQMD 3BMQB 1YQXA 2PKQP 4IMPA 5T57A 3M6IA 4CV1A 3JQ7B 1P77A 3GOHA 2AEFA 3VTZA 4AJ4A 4IQ8A 4NBVA 5F3RA 3GRKA 2D59A 3PEFA 3KYCA 4DL9A 1P45A 4O6VA 3RJ9A 3E03A 2VZ9A 1KC3A 4PZDA 4O1MA 1RWBA 4WEOA 3EC7A 2CF5A 3ZNPA 5C3MA 3QVXA 3BMOB 5G0TA 1GZ3A 3CE6A 4AJ2A 2QRLA 4GSLA 1VL8A 4FB5A 4MIYA 1Z7EA 3WB9A 1HE4A 3I6QA 1WPQA 5DCYA 4W7IA 4IIVA 2EGGA 5KIAA 1U4SA 1TB4A 4ZHSA 4X54A 3DHEA 4PN3A 2PGDA 1DAOA 2R00A 5CHEA 5ENDA 5U4QA 4JP2A 3ZWMA 2P91A 2VUUA 4MOWA 2BFPA 5C7IO 2OGUA 3UUWA 3WGZA 1L7DA 4J0EA 1R6DA 4DTIA 4N5LA 4WOJA 5DDIP 4RVSA 2O3RA 4B4UA 2XXBA 4YT4A 1LRJA 3EZYA 3R3SA 3AOGA 4R1TA 3IP3A 3KSUA 3DWFA 5AOVA 4YQYA 3AW9A 1Q1NA 1C1DA 2VZ0A 2Y93A 4J2OA 2RHCA 1X7GA 1Q7CA 2A4KA 3DZJA 1Y5RA 2JHFA 5DOVA 3QA9A 1NQ5A 4K6FA 3IDSA 1U3VA 1DLIA 2C82A 3AI1A 4CLDA 1U2GA 2ZCUA 4TKMA 1AE1A 4OSPA 3A4VA 3CTMA 4EGFA 1V3TA 3VZPA 4HX5A 4BB5A 4MP3A 3UFXA 3I5MA 3U09A 3V1YA 1NASA 2I76A 3OSUA 1C1XB 1LJ8A 1O6ZA 2FZEA 5FWNA 2YYYA 2PV7A 1ZKMA 1U3WA 4JNKA 2JJYA 3A14A 3IC5A 5G4KA 3GZNB 5BSEA 1UXKA 2X0IA 4PG5A 2RBEA 4GLOA 3OJ0A 1X0VA 1OMOA 5GZ6A 2C2XA 3SLKA 1P0CA 3KYCB 3ONEA 2XAAA 5ENVA 1OBFO 4E2WA 1TT5A 4HFMA 4RORA 2OL4A 2O3QA 4ILKA 5F1PA 1ADFA 1IYZA 1TA4A 5F1OA 5ER6A 1XA0A 4HFNA 3MTJA 4BO1A 4UAGA 4NHEA 3RC7A 2AQKA 1CETA 2C5EA 5L7WA 1SPXA 4J1SA 1EQUA 4RF3A 4OXNA 4B3JA 1K5HA 4R69A 5KJEA 2GYYA 4D0RA 2O2YA 2JAHA 1CQJA 3H9QA 3O4RA 1C0IA 1P1KA 4IDEA 1I10A 2DBZA 3FNGA 5TQVA 2DVMA 2BI8A 2P2SA 3A1NA 2Q4BA 4U0JA 4J16A 1XSEA 3DB2A 4RPJA 4RJTA 3RFXA 2CFCA 3LU1A 4TKLA 1LX6A 1P31A 1UXGA 5IZCA 2D5CA 4D44A 4IJKA 5JAZA 1T2CA 1WP4A 4J1NA 1YO6A 1ZEJA 1J0XO 3NKLA 3ZWOA 5I7EA 3KXDA 5TC4A 4YA6A 1JTVA 2GRAA 3E5RA 2ET6A 2SCUA 4XDYA 1GCOA 1H93A 4QTZA 2HCTA 3DFZA 1NBOA 1P33A 2HUNA 3ITDA 3ITKA 2GN9A 3U4DA 2P4QA 4JCOA 2UAGA 4RCVA 3LF2A 1SOWA 5GMOA 2YZ7A 1P1JA 3JQGA 3TFQA 4AJOA 4S3MA 2Q49A 4XQGA 1QMGA 2X86A 4Y9DA 1HDCA 4CL8A 5JS6A 2VQ3A 4DIOA 3UF0A 3HZZA 4TRMA 3EGOA 4YJHB 4N54A 3D7LA 4WECA 2Q99A 1GEEA 2HSDA 2GCGA 4IS2A 1ZIDA 3H7AA 4MVJG 4AJIA 2D5AA 4ALLA 1W4ZA 1TT7A 5H83A 2VWHA 3DMYA 3I83A 4F3YA 4W9NC 2IEBA 3VPXA 1S7CA 4J1TA 3ZW8A 5BR7A 2OBNA 2FHSA 2BGKA 3H2ZA 2BGLA 2VYVD 4RVHA 2YDXA 1PZHA 1R66A 3FHLA 3GAZA 2OZPA 5TJHA 2A92A 5AYVA 3OA0A 4S1VA 5THQA 4HBGA 3FBTA 4BO4A 4UVEA 4JGBA 1KERA 4QT0A 5CDGA 4AVYA 3BMCA 4GX5A 3H9JA 4CLOB 1EMDA 4BKPA 4UVIA 3M2PA 1O94A 3V2HA 2YUTA 1UDAA 4NBWA 1XKQA 1KEWA 3GHHA 5CAEA 1MFZA 3QJ5A 2H9IA 3BMNA 5HS4A 1ZUD1 1ZZEA 5ER9A 5H81A 4CM4B 2NACA 1J5PA 4KTVE 2G1UA 5U9CA 1NQTA 4BGIA 2CSUA 4E2YA 1J49A 1ML3A 3KYDB 3TPCA 1MFPA 3C3XA 2NNLD 3PZRA 4XGNA 3VPSA 4P4GA 3WGOA 1K89A 1SB8A 3DAFA 1RM3A 4CLXA 1DC3A 3HG7A 1DFGA 3LSYA 4XGKA 4BNMA 4OJNA 4BO0A 1V8BA 1SEVA 5KWEA 1M67A 4UUMA 1PX0A 1A72A 3S55A 3CPSA 3CMMA 4YAEA 4IY1A 3A06A 5BSGA 2ZB8A 1JW9B 2O3SA 4OXKA 3KETA 3E5MA 1GEGA 3DXFA 4UREA 4XKJA 2P5UA 3QVOA 4E33A 1Y8RB 4YJFA 1AN9A 1U4OA 5ILGA 9LDTA 2X22A 1VI2A 1KVRA 1WMBA 4I5EA 4PIVA
chains in the Genus database with same CATH superfamily
1VSTA 1Z7BA 2CMDA 1C1XA 3FNIA 3EBLA 1XA4A 1V16B 2J7PA 4BKUA 4D79A 4POAA 9ATCA 3VYWA 1Z16A 1Y8CA 3TRHA 3L0ZA 4E1BA 4GXRA 3WL3A 3R5JA 2R6DA 3FLAA 1I94B 1QLJA 5F12A 4KHZA 3ZV3A 2NX2A 2Q27A 4MRMA 3VH2A 2BPOA 4CMBA 4YCDA 3RU9A 4BFUA 1Y3FE 3KXLA 1FJHA 3UV3A 1YSCA 4Y2XA 4B6PA 2PUFA 2C3MA 4PG8A 3PU6A 3USES 5I48A 1J56A 3PFIA 5KQLA 2FPMA 3LKBA 3WIVA 4LYAA 2WAXA 4NBRA 5AK3A 3BRWD 4U7HA 2VJAA 4BYMA 2IUTA 5LQJA 3ZD7A 1Q0ZA 1GPUA 4ALKA 2A5GA 2QT9A 1DIRA 1OYWA 2FOLA 1ULHA 2YYAA 4Q4LA 5TQ0B 3KTFA 1GTG1 3IL2A 3NAGA 4EY7A 4QSHA 3NG1A 3X1WA 3AY6A 3PBKA 3AHDA 4EEKA 3RVMA 5ISMA 1W4RA 2B78A 4D98A 5EHZA 4G65A 2DB3A 1SNYA 1KDVA 2AMLA 3TOVA 4RHTA 1TMOA 3TZHA 5AW0A 1RIFA 4JLWA 3H5AA 3WMFA 2NV2B 1JJVA 2W93A 1N32B 2J5BA 2YHBA 1BOOA 5TGTA 3MRSA 4DQVA 1OXMA 3D81A 2X8LA 3TZBA 1U8YA 2GEUA 1NONA 1JFRA 2MSDB 3D5EA 3DQQA 4QYXA 3EFEA 3NXKA 4FYIA 2C9OA 2J3QA 5BR1A 4JWKA 5ALSA 2YR0A 3PUIA 3UGJA 2NU9A 4MCIA 4R68A 3MS4A 2ZUCA 2GOYA 3AFHA 5AD1A 4KNWA 5J63A 2HO4A 3RTEA 2ZBFA 1KMHB 3RHSA 1EEHA 3E9CA 4LYGA 4CZ2A 1KSGA 3CUKA 4LHEA 3SCZA 1CQIA 2EJWA 1GN8A 1E3TA 1RWVA 5AJWA 3B6ZA 3O1LA 1FUEA 4NCXA 5IN5A 4CG0A 4QFBA 3QVTA 2Z9CA 4YCNA 2PH5A 4L51A 4QG3A 5CXUA 1OKKA 2H2HA 4EKIA 3DTVA 2WD7B 1SKMA 5E6RA 4DY4A 4V0ME 3DPIA 3GFVA 3UCFA 2QZZA 2F43B 1PR4A 5JNSA 3ZDQA 4F04A 2Q5EA 3VU0A 3AKDA 4MW0A 5KJFA 3AKZA 4K03A 1DWQA 1E9RA 3BGVA 3V2GA 1B23P 2Q8PA 2I71A 4N7MA 4C21A 1E1NA 3KPUA 1GFIA 4IJVA 4LWZA 3M81A 4UPVA 3KKPA 4XDHA 1DC5A 2Y71A 3RHTA 1BA3A 3W1EA 3L2OB 2ZRFA 5SYNA 4DHWA 4IDAA 1A3CA 1Z5VA 2IEDA 2UZ0A 1XTPA 2AL7A 3D7RA 4P34A 4C7XA 5EJ6A 4FMCF 1H65A 3TYXA 2NP7A 3VRHA 4TYPA 5T7BA 4PZZA 1NF3A 5L3ZA 3INTA 1KI9A 2P9FA 1IG3A 3DL4A 3HKDB 2Z2ZA 2OESA 4PYRA 1P72A 2NYRA 3CSSA 2WJ6A 4NH0A 5IBRA 3RFFA 1YL7A 3EZFA 3PNQA 3BFJA 4B3XA 2RGYA 5KYTA 4PRKA 1EAMA 5ALPA 3WLPA 3N7UA 2YASA 4OQNA 3EK2A 1WVGA 2IYRA 3IOYA 4X3CA 3U7JA 1THGA 4DYHA 5K45A 4X65B 1GFSA 2QK4A 3BWEA 3ZPXA 1A4RA 1RI4A 4FR2A 1RC0A 2QTNA 1LI4A 3ZWWA 2QBYB 5T41A 4UD6A 1N8SA 3KZOA 1OGYA 4QRIA 1E59A 1QIJA 2P2YA 3RADC 3K2BA 1V7ZA 5C9ZA 4LA4A 1OTXA 3DBRB 1MRSA 3AJRA 4WNYA 4DZRA 1UBHS 2BEUA 3BGOS 2JGMA 3OKCA 3PDUA 4RKQA 3LIIA 5HTOA 3OBBA 2J9FA 2NUPB 4G4IA 4PAWA 2Z43A 2ASEA 1LY1A 1OWOA 2D0PB 1BWRA 1Q7BA 621PA 5IT0A 1BDHA 1NE2A 4M89A 3KB2A 2RH8A 2D7DA 1D2NA 2I2AA 2VCHA 3DW1X 3GUCA 5B1IA 2PZBA 4HDNA 2D3WA 3GVXA 2MOKA 2NUAA 1SUBA 3NWPA 1I14A 2GCNA 3GXBA 3IALA 1DTWB 4B4VA 1PL6A 4C5BA 3L7JA 1YVRA 2FEWB 3I3OA 4ZMSA 5JS8A 3DKVA 2CXTA 3VSDA 3ZHZA 3QV2A 1EK1A 1V39A 1V5FA 3P9ZA 3H2GA 2VDNB 1P5ZB 1CNFA 1I33A 3HDQA 3I05A 4U6QA 5ULLA 4J0FA 1AM4D 2NTEA 1JIQA 2B1GA 3L6EA 4UEQA 5SZJA 3TSOA 3D5TA 5JRZA 4ARZA 1H5UA 1TQ2A 1ZGBA 3BK2A 1N2IA 4L1KA 1CEXA 1W75A 4ENRA 2WQZA 4CMEA 3QXXA 5TT0A 3MUFA 1Z4LA 1Y3IA 1P0PA 1Y4ZA 1Y3DE 2CL0X 1YD7A 3OX4A 4LZAA 2XUIA 3ONDA 3ZHXA 2VCYA 1WZ2A 1QHNA 4XM1A 3SYNA 3VI4B 5LMCA 3V42A 1HA3A 5J4KA 4YRQA 1R1DA 1U0FA 3HV0A 4TMZA 4D99A 3GLFE 4IXWA 5B7PA 3IMEA 4EHJA 2XRMA 2ZRLA 4EJSB 4Z4QA 2ZW9A 2ZAYA 3PI6A 2O59A 5B1SA 4F9GA 3G6KA 3GLHE 2A1TR 4ID9A 3SIRA 4YXWD 1AH2A 3RIEA 1BGWA 2J0VA 1Y4AE 2OHVA 2QY9A 2IE0A 3BHMA 1GILA 3MBKA 3NBZC 2Q0XA 5CVVA 3OM9A 4K6CA 5J1TB 1RJ9A 2X1VA 3GX1A 3ILYA 3B9BA 3TUIC 4A8JC 3PGLA 1EWKA 4N6NA 4RKYA 4TSFA 4DR4B 2PR7A 2QE7A 5HBGA 5BSMA 1BCRA 1CDOA 3PITA 2JD0A 2OPHA 6PFKA 5KYWA 1PDVA 3RVBA 4UHDA 3OZ7A 1Q57A 2YXPX 2PRKA 1A95A 3MK31 2PEZA 1NXTA 3JQDA 3PTZA 4P38A 4OJKA 1ULUA 1CUAA 2KX7A 4BNDA 1N5JA 4BIIA 1JXAA 2QP3A 2AQHA 3W34A 1K6IA 1L7BA 4FFDA 1YFLA 2O7QA 2ZJ6A 4NAUA 2ZRKA 2V9PA 4DG9A 1ZISA 3CVYA 1MEJA 1W34A 1PZEA 4NOJA 2J5KA 4QQKA 4C43A 2YZ2A 5A9RA 2PUAA 2BUAA 3IMGA 5ESWA 3BOSA 4DLBA 2HUPA 1N1GA 2WSBA 2NGRA 2Z9DA 3QEOA 3LVRE 4M76B 4KRYA 2ONJA 4EY4A 3KXPA 5EFZA 1AMUA 3RSQA 4B3DA 4GDFA 4ESOA 1BS1A 5HKKA 1BNCA 3B20A 3I9MA 5KYKA 4O3MA 4P4LA 3TTVA 1JB9A 3RV3A 4KQIA 5JS1A 3MAAC 4C29A 2R66A 2G7MC 4ZCMA 4HLNA 1XRMA 3AQIA 1WJGA 5ESDA 4DBVO 2V7WA 2Z58A 3SE0A 2I4LA 1JLLB 1QX4A 3REQA 4Q6BA 1ZD1A 3QFSA 2GILA 3L3BA 2SNIE 2AKAB 4D9NA 5A1TA 4B73A 4FXPA 3E3NA 4AU1A 5B6IA 5AVKA 1JQBA 2JFQA 2QTZA 3HVKA 3L0SA 4JXJA 4I1VA 1R16A 2Y1GA 4DPMA 1YRWA 2EYUA 3IAAA 4J76A 4MJ3A 4WADA 1DEHA 4EAQA 4CQLB 4FFNA 1IEVA 3BXXA 2MR5A 3UUGA 1TA0A 1BE6A 3W8RA 1KZYC 2GJ9A 3DFUA 4RYLA 1Y3AA 4ZXPA 1QH8B 4HFJA 4JEMA 2CLCX 2JBHA 2VP2A 4LHZA 2C98A 4RK1A 4JI6B 3VC7A 3LFTA 4XYGA 4PXAA 4RZQA 3RIMA 2Y0EA 3OEHD 4N3CA 4XVCA 1FLVA 5CA0B 4PGAA 5J4YA 2QOEA 2QS9A 3B1YA 4UCXA 1E3IA 5HFNA 1OKKD 4O2LA 4AKGA 1IRXA 1RP1A 5JY1A 3NVKI 4S35A 4HZUB 4BN0A 2F62A 2IZ5A 3V48A 3L5OA 3RRZA 5D87A 2H2WA 5DHUA 2G1AA 1PT9A 3WLIA 3J81k 2CYAA 2I2FA 3OKAA 4NZZA 4L78A 2WFZA 4FE3A 4PR3A 5A04A 3IKMB 5FPQA 4OREX 1EESA 2AJDA 1OFGA 2V7TA 1M0SA 2HZ7A 2ZUDA 1EB8A 1P75A 1ZUWA 2YV2A 3BK7A 3HO1A 1S8FA 1JL3A 4WKCA 2DPMA 3D6JA 1KKLA 4E4YA 3KSRA 2QZJA 5EZSA 4QECA 5K6TA 2EFEB 2VQSA 3AZOA 4US0R 5FR2A 5H7XA 4A16A 4LBYA 3G2KA 4ZEWA 2Y0BA 4C2BA 4FLEA 3NWJA 2V3VA 1JEYB 1HM5A 1NXSA 5KWVA 4YNBA 2JGDB 4MQFB 5K8IA 1R74A 4UBIA 1IM8A 3NV9A 1QO7A 3NB0A 4JASB 5BR4A 2Y1OA 2H1HA 4IV5A 1ECBA 1KH2A 1U8ZA 2JIZD 5NULA 2IODA 5EN4A 1BRTA 2A9PA 1K4KA 2HPZA 3I34X 2A5YB 3JARB 3IR7A 1N0HA 4BMNA 3FKJA 1EUCB 2XYGA 3LBNA 4U8GA 1QIEA 1NMZA 2B1QA 4NNPA 4P82A 4ZT3A 4F60A 2DQKA 2JCSA 4LGMA 4YMTA 4ZQEA 5KTPA 3NONA 2QB5A 2BR5A 4HH1A 2EW1A 2Z5FA 2BCGY 3D6HA 4IMJB 5IPFA 4YY3B 3E3LA 4HZUA 4L8GA 2PCLA 3TQTA 4C7OB 2AK2A 1PEDA 3O26A 4GBGA 4CLEA 1IK4A 2DECA 3DO6A 3CLRC 2F3TA 2FG7C 3D8BA 3MW8A 3PK0A 4QGGA 4NC9A 1RYNA 2FPRA 2YDYA 4WXHA 3KVNA 3RSCA 5IMSA 1DKQA 1EZZA 3EFOB 3OQIA 5GADl 2VHQA 3UQYS 5IJXA 2R6FA 4C3ZA 1GZUA 3LL4A 1TEVA 4LMPA 1P7CA 1FRNA 2IK8A 4IINA 3L40A 4PSCA 4QX6A 2AZMA 2WTAA 5IZ4A 3G2IA 1Y8AA 4M9CA 4KXMA 1T1RA 1YMVA 2WPDD 3CLSD 4RPIA 2CVOA 4B83A 1U2DC 2GMWA 4G24A 5BNWA 4I19A 1W85B 4YHHB 3BKWA 3WLEA 4KL8S 2JZNA 4CGZA 5F2KA 4F86A 4LRYA 1ESMA 2WIJA 1OLSB 1BQ4A 2VHEA 1M2WA 2FQYA 2IIVA 4EMSA 5CB8A 2I87A 1DBSA 4UM8B 5MN5A 1RQLA 1BE8A 2GAIA 2Q4DA 3GMIA 3KALA 1MJHA 3KOXA 1A82A 2QUAA 3C8ZA 5DBEX 3VZQA 4AG5A 1II9A 1EWTA 2I0FA 2C9MA 3LCJA 5HCUA 1DAMA 4JLKA 5BSKA 2RK6A 3V1KA 5L4LA 3L9XA 3HP4A 1FUKA 3U4QB 4C4YA 5I5EA 2XMRA 4IFIA 1MNQA 3AEUA 3MJFA 2GXQA 1JU4A 5REQA 1E0KA 1FU4A 4II7A 1D6NA 1ZW1A 4C2AA 4CM9A 4YHBA 1ZW6A 1UPXA 2E89A 4ZEOA 4JP8A 3PX3A 1P74A 5CYOA 4XM2A 5KVSA 3AV0B 4J43A 1I3CA 2G4LA 5DBHX 1GU7A 5IAOA 1S3IA 4YPVA 1IHUA 3NWBA 2QNBA 2FPKA 1XWWA 1YVEI 4I6GA 5FAKA 3DBIA 5EHGA 4OYRA 3FPJA 1CE8B 1NVEA 1TU4A 3GJYA 4ZTUB 3NW9A 4ZCRA 1N2XA 1Z5OA 4IZOA 4DA4A 1JMKC 3SJ7A 4Y9UA 4YEDA 3T3DA 3SYMA 5FBVB 3H9EO 1X7WB 3E3AA 3IXLA 3P4UA 4AMZA 1B8VA 1K5DA 3S2EA 5B58T 1CY7A 2WHPB 3CZ9A 4HB0A 1ISRA 4QEKA 1XHFA 5H82A 4KIWA 2Q07A 2CFRA 4JLVA 4G3XA 2G1JA 4BNIA 5AUNB 1DMSA 4O2AA 3E9ZA 5HF8A 1I01A 1KTIA 4A4DA 2EXXA 1UWVA 4PZ0A 2PAFA 3PSAA 2WWYA 1KFKB 3G89A 1I4EB 5LZ4A 3ZGYA 2G63A 1UT8A 4KAAA 1KFBB 1KDTA 3FDZA 3H9UA 3CVVA 5REQB 3MCAA 4ESHA 1LSJA 4W5JA 5BV0A 2B6HA 4BCCA 2BGMA 1Q22A 3I52A 4O2RA 3CS3A 4ZEMA 3WB1A 1CY0A 2QMHA 2CVQA 4PG6A 3D6FA 3M6MD 2ZYGA 4UTPA 4NV1A 2C2GA 4BQNA 2WWGA 4UTZA 3PNYA 3QPUA 4QDXA 3SZRA 4H4CA 1AUXA 3K15A 5C46F 4RLFA 5A3RA 1TYBE 2FMHA 2IPLA 4GR9A 1BEZA 4EKNB 3SYLA 5D3KA 1O4VA 2OTCA 3H1BA 1CY8A 4KPUB 4F97A 4DV4B 4N0QA 3C3DA 1U2EA 1QJCA 1U0OC 4I4IA 5D2CA 3G2QA 3HK2A 1E4EB 2V7QA 1O95D 3KB6A 2A5DA 2ORYA 1C1YA 3PA8A 5AO9A 4TLDA 3W2GA 5HGXA 4AECA 2UV8A 4MDFA 4AN4A 4HWOA 4PIVA 3QNWA 3RVDA 5EZ5A 2VT7A 4X3OA 3WL7A 2XUOA 2BTQA 2IYEA 1AGPA 3OTIA 5DGTA 1MCZA 5IC6A 2IS2A 3UA4A 1QIFA 5LP1A 3COJA 2YN2A 5I7FA 2HV9A 4XB1A 3PF9A 2WVAA 4MW5A 4RFVA 4TSRA 5F2EA 4DEYA 3EDQA 4NENA 4DMLA 5AKIA 5EE9A 4P33A 1KMQA 3JQRA 1UJ2A 2MHCA 3OZWA 2BKXA 1J33A 2F1HA 1E1LA 2L69A 3EGEA 4H1VA 2BR4A 3VGPA 2QRVA 3ZU6A 4CIAA 4LE2A 5JQGA 1JDVA 4YT8A 5IJ9A 1V7PC 1DL5A 1Z7GA 3K5PA 2JLVA 2ZE5A 3NT4A 1TK2A 1TF2A 2VBCA 3AUJB 4BVAA 1RLIA 2WSIA 3UJNA 5GZ1A 2VDQB 3LWNA 2BM9A 1WXXA 2P65A 4F4FA 1ST3A 1XQVA 2FW0A 5JAMA 1U0SY 1XTBA 4Q12A 2A9RA 3H4TA 5SZKB 4YR9A 2V45A 3FOEC 1I6MA 1YJXA 1PN3A 1YMQA 2ZQZA 3U81A 4F6LA 1EGAA 2C7QA 1O57A 2IU4A 3DLHA 3OT1B 3NFYA 4DIKA 3AUXA 2VSYA 3JYOA 5IDQA 2VRCA 1C3OB 1ZK2A 4JITA 5DNDA 1E8NA 1Y1SA 2NU6B 1KEEB 3AW8A 3KJZA 3NBFA 4X7PA 3IVAA 5CJ2A 5I45A 1FTGA 1R0CA 3QE3A 4JSRA 3VFDA 3WL6A 5K0TA 4NPAA 3T4PA 5IC4A 3DZHA 1D1PA 2CXQA 2ZRCA 1VYHA 1WHTA 2O9JA 4RIIA 3NHRA 3T7CA 3O8LA 3ZKAA 4CQMB 4OATA 2B4AA 4OHOA 1TTQB 3R5FA 4KQWA 4K28A 4H7IA 3DMPA 4X6YA 4PZ9A 1BW9A 3B48A 1Z25A 5HPYB 5LKAA 4G5SA 3HBNA 3IUMA 3W4KA 4AS1A 4YJGA 1VCIA 3DR3A 3LUCA 2DPXA 1DBPA 1JKJA 3U60B 2C78A 3HI4A 4MGZR 4BUCA 3KUDA 2FR1A 1YDGA 3M5DA 2ASVA 3ASYA 1ZBDA 5ES4B 1MAUA 4NJMB 4YRDA 1GXSA 3T5TA 3DOHA 3D4IA 4RETA 1UM9B 3GDGA 3R75A 1CERA 3GFTA 1CVIA 3CJQA 3QXGA 1BMTA 1SHKA 5HNKA 2Q6IA 3JQQA 4Q4HA 1X80B 1DPFA 2B5VA 3S2SA 3TQCA 3EVDA 4A0HA 2QRNA 1T4DA 1XAHA 2DPGA 3D6AA 3OG9A 4M6WA 3E8XA 3BL8A 4Y2HA 2WZQA 5KHAA 1Y1LA 5E2AA 4CM6A 1XU7A 2B6NA 3PUXA 4G0ZA 3L0PA 4GICA 5KTTA 1ZJ5A 3BE8A 1DBQA 1C3OA 2RB5A 1MIOB 3BUSA 1K5PA 2JA1A 1ZXLA 2QENA 4G1UC 1V41E 3FYTA 4CUKA 2AE2A 5B1DA 5B53A 4FINA 4OYYA 4KXYA 4LXXA 1JECA 3TPZA 4X00A 1O6CA 2OG2A 5IXYA 3IRVA 3L7MA 3Q9NA 1RPAA 1ZI6A 3QENA 2IDKA 1HT2E 1KFEB 5ALQA 1Z8NA 4XQ9A 3UW1A 4D8VA 2ZI9A 4D4KA 3BTOA 3IEUA 3CNQS 3AL3A 4PC1A 4Q47A 3UMRA 4EY5A 1N2HA 1P2UA 4DFDA 3B3QA 5CVTA 1Q0RA 2NZJA 3GFGA 1XCGB 2GVZC 2Q1WA 3IDAA 3ZWBA 3MGKA 5LUBA 4OQYA 2QP9X 1GCAA 2Z8ZA 3PG5A 2PPVA 1J8FA 4Y6PA 3MGCA 3UV7A 5ADUS 1WMFA 1WBJB 1L5HA 4Q24A 3FOFC 1N3LA 2EJCA 5BSHA 5LR6A 1PV4A 1JAYA 3A6PC 2FPUA 1QH1A 3I30X 4TV8A 4BLSA 2IP4A 1BX1A 3GLTA 5HQTA 3PDIB 2B5OA 5I7OA 3JYQA 2IOFA 4DQXA 4KO8A 2EATA 3NV7A 2DF8A 4DC1A 4W7SA 3VR5D 1OFIA 1H5QA 3C8HA 5DBFA 5FNVA 5CDFE 1XMIA 1Y8RA 1ATIA 1COWA 1XDZA 3IBYA 4RMHA 4PNEA 4GC5A 4PHTA 3GROA 4AI6A 1K8XB 1D2EA 4BLPA 1T1GA 4ZJZA 2ZBQA 4HMOA 5LA6F 1RQNA 2HMTA 1H42A 4O4LF 1N57A 1IK6A 3B78A 1EDOA 1KNXA 1QIHA 4J4BA 1U28A 2XGJA 4TV9A 3JWGA 1UWLA 1TPZA 4JI4B 2JGRA 1Z12A 3ENQA 3QK7A 1HE2A 1Y7TA 2FYTA 1E4OA 3LLVA 3AFNA 4JT2A 1Q14A 2QN2A 2QZ4A 5FEMA 1VB3A 2B83A 3V4SA 1Z4QA 3DD5A 5IM4F 3VR5H 3JVUA 3CZPA 4PRYA 1GQOA 2KHZA 3BDAA 3CIFA 4Y1RA 1UZAA 3EY9A 1SXJC 3JVEA 4EJ2A 3GRYA 1Q84A 4MV8A 3WBJA 2W6MA 2JF0A 2PZJA 3NM6B 2XGSA 3AVPA 3NP9A 2V74B 3RKUA 3WS7A 5IULC 5LMNB 1HY3A 3DAOA 4TWRA 1VBMA 3FCCA 3FLMA 4P7BA 1YQUA 4HOYA 4BN4A 3EQZA 5CFZA 1JR2A 1BFDA 4MIOA 1CZOA 4R9SA 1DS6A 1GKLA 2C5AA 5BQ3A 5JO9A 2J5QA 2WVJA 4UVDA 1CQZA 2OUIA 4AZSA 3GW8A 4Q21A 5FYQA 4DCNA 3RAFC 1K98A 2IEZA 1PZGA 3GI1A 2HRCA 1VIAA 1F9EA 3O8OB 5EE1A 5JXHA 2Z6QA 4QWWA 4AKHA 2MU1A 5CUQA 3HCPA 2RE8A 5DSTA 3CWZA 3UCXA 4Z8XA 1TC1A 3HBFA 3SHFA 2RBGA 1OBOA 4ZN6A 1XZ8A 1Z6GA 4OGKA 5EUMA 3WO0A 3HKBA 4IZ6A 3GP5A 3OO1A 1FVOA 3UJDA 5KYGA 4KJZA 1U9ZA 4LJLA 5LB2A 2W70A 5EXSA 1Q0SA 4MUMA 4OL0A 1Z5ZA 1ND5A 2YXBA 5FBQB 3W5IA 1SD2A 2PKYX 1N8KA 4FSDA 1F8GA 1M2OB 2ZRBA 3RQIA 1BXZA 2HLPA 1LK7A 3RG8A 4MWOA 2P79A 1MJFA 3WZMA 4K6KA 4A6DA 4Y98A 4K9QA 1XP8A 4X8OA 1EJ2A 2I3ZA 5A03A 1HFJA 3BM5A 3HDYA 4WV3A 2R87A 3SKYA 1H2YA 2C0QA 2W83A 1NUUA 1OAAA 5EGSA 3VO9A 4E2XA 4MTCA 1RXEA 4XASA 1Y6FA 5CFMA 5DNCA 2F4NA 1KJ9A 1NA5A 1V26A 3ET4A 3M3DA 4DGSA 2WAAA 1HG1A 3VKVA 4CR8A 4CTNA 4YAJA 3DLAA 1DEXA 3KHKA 5CHYA 4L8FA 3ZKWB 5T6MA 1ELOA 4GVLA 4MKFA 1KAEA 2ZXEA 3KYDA 4QPPA 3T1QA 3SVTA 1GL7A 4NEQA 1JG1A 1Z5GA 2XTMA 4Q01A 5KNDH 3B38A 4JVSB 1E6KA 1T1JA 5DCWA 4I4NA 5F21A 1Y1QA 4ZO4A 2C9ZA 3RIXA 2I66A 3BXZA 3EMKA 4AF7A 3IE2A 4FR5A 5AUQA 4B6RA 1B93A 3OJWA 4WJZA 5GONA 4N3NA 1YOVB 3Q7RA 4WZBB 3RT9A 3O74A 3T5CA 3GNTA 4YV2A 3E23A 1T3SA 1QHHB 1ZUNB 2BR3A 4DPKA 3V1TC 4A26A 2AF3C 1YGYA 1RE1A 2FWBA 2V6GA 2BBOA 3DO5A 4EKDA 3VAZA 3LUJA 4NFSA 1VKHA 3MWGA 4KVAA 4MICA 3A32A 3D3WA 5CLGA 4EBFA 3HDTA 5C8YF 1Z0UA 5EVCA 1K7YA 2A0UA 3FTCA 1JLSA 3HPQA 1AHNA 2Q3FA 3U1BA 1M2GA 4RGBA 4DIBA 3E9QA 4GPD1 3E70C 3PQEA 1YE3A 1LTQA 2A78A 2IIBA 2JFHA 1IY0A 4J90A 1O95A 2XMBA 4BMSA 3SLGA 2HGZA 4AS2A 1NG9A 1IIBA 2B9VA 1U0GA 3G1WA 3RB8A 1U0TA 4IFTA 5GVRA 1T2AA 4NFHA 1I13A 2AEMA 3KD2A 1ENOA 3VKUA 4LDNA 1NSYA 2JG3A 1ZN8A 1NLZA 1YQWA 4D4MA 4J16C 3ACCA 1LNSA 1NUTA 2WF6A 1MU0A 2QW8A 3BAZA 3WXBA 4BE7B 3BMCB 3TI7A 3TLJA 3U5TA 1SULA 2BZ0A 2PDAA 2XAUA 3SOPA 2UYOA 5COBA 1JDUA 4WZ6A 2VXYA 1FDVA 1PGQA 4Z7NB 3ZU5A 1GT6A 3FI9A 3O4HA 3I6IA 4YYEA 4FJ0A 3O94A 3KQHA 5LD2C 2FMTA 4X1IB 3D3JA 2F17A 2X5KO 2AMVA 3PKZA 2AOVA 1I36A 2AE1A 2OZVA 3IPYA 4DIFA 4ERNA 3TRJA 2DR2A 4GL2A 1K4YA 4OXYA 1LUAA 1OQAA 2C1XA 2CC2A 2GEKA 3B8EA 4ZYUA 3R5TA 3SX4A 1I7PA 4RTRA 4A7PA 3E6AA 1U3TA 3SDSA 3ZHBA 3H2IA 5J47A 2VP3A 3DCIA 1NKSA 2GZ3A 3BFVA 2WFLB 3HV2A 4RIFA 5FR1A 3B3AA 2LCQA 3RJMA 3WTBA 5K0EA 1RTKA 2FA9A 2RDMA 3N75A 4LXHA 4QQNA 3WRXA 3Q12A 4WLFA 5IH3A 1RC8A 4M8SA 4QTXA 1TYZA 1R0KA 2J9ZB 3DF9A 2AYYA 4M9XA 1PUJA 1ZLYA 2NVUB 3QHAA 3RC2A 1O89A 1ZNWA 4LXGA 3IXMA 3L8EA 3WJAA 2FUKA 3M82A 1YRHA 3AOEA 4JIMA 4RDIA 5GPBA 4EK9A 5ELXA 3TX2A 4GLLA 3VVCA 2G8LA 1DHTA 2HNBA 1WUJS 3M3PA 4M8LA 2AOTB 1H3NA 1U2ZA 4ALNA 3T9FA 5JRDS 3R7BA 1RQXA 1WCWA 3W4IA 1YR2A 2P2ZA 4YAGA 1L8AA 3HJGA 1MGPA 1ZRSA 2HW8A 3DPSA 1VLLA 4OI2A 3N86A 3SYRA 1KMHA 2FFQA 1GGFA 3ECCA 3INGA 3FNFA 4ETMA 2JAWA 2H2IA 3VR6D 1Z6YA 1A4IA 1KJ8A 1AK9A 4CF3A 3PDWA 3L4SO 4GSKA 3C41J 5CLJA 2OHOA 4L0QA 1G6HA 3IYLW 5T6BA 4MV1A 1GG9A 1YBHA 2WYIA 3EH2A 1K1EA 1JVSA 4P81A 4U7GA 4DM7A 2INGX 3OLYA 4BFTA 4FE4A 3GJQA 3QKTA 3WJ1A 1IN6A 1ZU5A 2ZCJA 3B1KA 5GJVC 2ZVJA 3PA6A 1K3FA 3LXRA 4O2BB 1O9BA 2NLOA 2NPOA 4K1LA 4UEKA 3NVDA 2QDKA 3A9RA 1RRCA 3FMFA 2XDWA 3GLUA 4KYTA 1NFQA 2VYFA 1I3LA 1UOQA 1SU7A 1VZ2A 1IG0A 4QDTA 2IGTA 2WIKA 2WYOA 5DX0A 2H51A 1FNNA 2CL7X 3C3KA 3N9IA 1NAIA 1SOUA 1EYZA 4WE3A 6ABPA 1G64A 4OI4A 3QWFA 3WGJA 4IV8A 4PPYA 1EUDB 4GKJB 3N6VA 3A9UA 4UBJA 5KMGB 1B4DA 2XNDD 2C2KA 2ADOA 4LNUA 2QQ5A 1XFDA 3KT3A 4Y2QA 1OBVA 5FQNA 5K3SA 1A1VA 4HTFA 2JBAB 3E7PA 2QL6A 2VAPA 1UPUA 3MELA 1E66A 3C97A 3V6LA 4B45A 2FLWA 5ALVA 4ZQGA 4OLAA 3FYUC 1OFHA 1JV2B 1SUSA 1WZCA 2P2GA 1IBRA 2R4TA 1UT5A 3E0XA 1SC1A 2Y0DA 3NBAA 4KQXA 5ESXA 3VPGA 5BOSB 1Z5PA 1DJQA 4CTMA 2X0NA 1HE3A 1U7UA 1NJGA 3CBQA 1TUBA 4L9AA 4QDOA 3TZKA 1Q50A 4CLOA 1OT3A 5LSAA 1E4VA 1NTOA 4O4LA 3UG6A 5AUOB 3FFXA 1KKMA 1SCUA 1TU3A 2KJQA 2ZSBA 3GDOA 3ZXYA 2VTVA 3ADOA 2PWPA 2BEVB 1VE7A 2I6XA 2QYTA 2RARA 2Z95A 3A9CA 4I55F 4PF1A 4PYJA 3ORYA 5KC8A 5I7SA 4B3TB 3HUFA 4LZOA 2JJ2A 3IP5A 5LQNA 1NNEA 3A6HA 3HXOA 2X1LA 4CCYB 1PNRA 4JZKA 4WTOA 5IHXA 4Q3BA 5HKBA 2WW8A 5BV2P 1UADA 3VV2A 3H2BA 2JGEA 4D82A 3E61A 2FDRA 3BJRA 1RP7A 4RLSA 4AYXA 5HIIA 1NP6A 3FPCA 2Q9BA 2AFVA 2IXGA 3MT9A 4XD2A 3PLNA 3TLBA 1WW2A 2FPPA 2PH7A 5EIEA 5LOVF 4AKEA 3ZQ4A 3OAAD 1P7YA 3N2KB 4B74A 4MV0A 4BS9A 4HSGA 1M83A 2BMDA 1YRQA 5HIMA 1ZJ6A 1ZH8A 2FN9A 4J0KA 1AU9A 3V8BA 3OICA 3PJDA 3Q2OA 3KSZO 2QAGA 3CZMA 3SZGA 4CCWA 4NH4A 5E6SB 1ISPA 2I2WA 4KLCA 2OY0A 4LIPD 4Q18A 2ETXA 4W6QA 3WJ7A 1RXUA 4NK5A 3PJEA 4BEJA 3K2EA 3OE1A 1BVRA 2WQ7A 2RGGA 4O02B 4DA8A 2PYDA 2PD3A 2VPTA 1Q91A 2QMEA 1TM1E 1S4MA 1QK3A 4U7TB 2Y1WA 3DHVA 1KJQA 3KR2A 2P6NA 2HT1A 2J9FB 2VJOA 3UB4A 5LDHA 4WX2B 4ENWA 1F9AA 1NGSA 3H5LA 3JVVA 3ZWPA 4BNTA 3DC7A 3TLGA 4R0NA 5CEJA 3PXUA 4YRFA 3KPJA 4EJMA 1G21E 3ZG6A 1D09A 1E1DA 3G2OA 3WP1B 4XWAA 3U9LA 3E3OA 1CUHA 3Q3IA 2C7VA 3FF1A 1PNQA 2ZJ4A 1DARA 4G0PA 2YXDA 5CPFA 2F55A 4YASA 3LT0A 1EHIA 3OIYA 3P0HA 1MOZA 5NLLA 1E4YA 3DDWA 1JR3D 2B3DA 3BN3A 3D59A 4GPEA 5F2OA 4B9EA 2JLAA 5FJIA 4G4SO 1WPRA 4WW0A 2GCIA 1U8AA 2AQIA 4U2EA 3Q5DA 3RSOA 1E94E 2Z3ZA 3IKLA 1V4BA 1H9BA 2HCJB 4E3WA 1NW6A 5AFSA 3EUFA 1PJZA 2I6TA 4QTTB 1RPZA 1JDPA 4D43A 1Q1BA 3KAJA 2UZ4A 4G0NA 2EX0A 5EGNA 1RQGA 4FX2A 2ZJ1A 3V1LA 1QIMA 4TTAA 3LT1A 1BHJA 2H8GA 4UD2A 3KVYA 2FZCA 1X7XB 2FFRA 1N7IA 4LPSA 4RGQA 3RS7A 4YONB 4S1PA 4M22A 1YZNA 5BNIA 4EHHA 2HDNB 3BX1A 4IEIA 4OVKA 2ODWA 5HBRA 2J8ZA 2A0KA 1G5QA 2QA5A 3MMXA 4UTOA 1RU3A 3G0IA 3I9LA 4U5XA 2YBEA 1UXIA 5DP1A 4MQEA 1NBME 5EOVA 5F23A 3MWEB 1UXJA 3NAQA 4RWEA 3EQ7A 2Q1SA 4Q7EA 3RW9A 3NHAA 2P8JA 1VG8A 2QRHA 5B6JA 1USUA 1N0UA 1RWMA 2ZRNA 3JATB 5FPKA 4F4UA 3UPUA 3Q9LA 5DN9A 1A7UA 3DOCA 3FWNA 1OU0A 3L05A 3ETJA 4GMDA 3IH5A 4RFSB 4IHJB 4EVIA 5FWYA 2EHJA 2JCYA 1DEOA 3CNBA 4DA9A 3ZVRA 2XPCA 2VRWA 4F11A 4KWCA 4LHXA 1J90A 1QGUB 2VPIA 4DB2A 4C06A 1GWNA 2G7ZA 3BCRA 3EXFB 3RT7A 4C87A 3BKXA 3U9TA 1BHO1 4QNNA 4QLOA 1SWVA 1X42A 1Z47A 2CWWA 2IOYA 4ZA2A 3L0CA 3IDOA 3DOJA 4UUAA 3ZGVA 2G67A 3G0DA 2B37A 2HBQA 4TRJA 3WHPA 2IPNA 4II2A 1SQ0A 2Q3DA 2ZG6A 1XZCA 1U8EA 4CIXA 1MO2A 1MO4A 3SR3A 4YI5A 4EJFA 1UUFA 4KE7A 1L7EA 4HLQB 1OZHA 1XRLA 2VC2B 1GTL1 1PE0A 1X74A 1TQHA 2NUBA 3M1LA 1IJKA 1YB5A 2ODBA 3PNLA 4MULA 1XWIA 2RGBA 5DWQA 1GG2A 4ZVSA 4WXPA 3GZ4A 1M8KA 3GVCA 4D0NA 1O0SA 2WDZA 3E9DA 4TWIA 4JLPA 1EM8A 1PDWA 4HNQA 3I4FA 4TVBA 3SXPA 1H4QA 4B46A 3IB6A 3ICOA 2Q1UA 5IKEA 4QEZA 1NR5A 3PHGA 1ID1A 3C74A 2W2MA 3N07A 1QTNA 2C77A 2QT0A 3FUCA 3H0CA 4JI0B 1FC0A 4C5AA 2Y4OA 1KIFA 5F1KA 3INYA 3ND7A 4HN2A 1M1NA 3NHYA 2L2QA 1PWHA 2E4VA 2IXFA 4J29A 1DDIA 4ZV4A 2R5NA 2X8WA 4MPTA 1E9CA 1JILA 1EXVA 2D4AA 3MLAA 4QJIA 4GLFA 5CU7A 5K6RA 2FR8C 1U0RA 1W25A 1S6YA 3UB3A 1U3DA 4L0MA 3IPCA 3BEOA 3I2YX 3DDNA 1CUEA 5KPDA 4LC9A 4YCAA 3TAXA 4R16A 4OQFA 5IJWA 2FRDC 3KJXA 3ANMA 2P2CA 1CUWA 2CVHA 4WH0A 1E79A 4UVGA 1AO3A 4ZGBA 7AT1A 5AW3A 1W8IA 1GYRA 1SMKA 1SQFA 1CK4A 3NRJA 2X42A 5AM0A 1UJMA 1FX0B 1XZBA 4KXVA 5EPEA 4A2QA 5AW4A 4XUGB 1RYMA 1OWPA 1GGNA 2JBAA 1DCFA 1N9KA 3EGIA 1LDEA 4GVPA 3FUUA 3C14C 3EWNA 1PJAA 4HADA 2HHLA 4Q7LA 2JW5A 2WF9A 3DBRA 4MWSA 4D56A 5F4ZA 3W06A 3TR5A 2NMVA 2W2TA 5E1BA 2G06A 4O63O 3AUTA 3U4GA 1OR8A 1E4EA 1P5HA 1E1RA 4R1NA 2XCLA 4JZYA 3ZJVA 3ISJA 4B7ZA 1DRWA 1DC4A 2X4DA 2OZEA 4GXQA 1X94A 2L82A 1NHWA 4IIGA 4MINA 1PX2A 1UDWA 2NTJA 2OV4A 3VR6A 2PX8A 4DCVA 4V38A 3VZRA 3A0UA 3QW4B 1AZLA 1QNFA 4GQAA 4XD7A 2IRWA 4UJ5A 1FOEB 3A7DA 7YASA 2FWAA 2PRZA 4XTRA 1NZDA 4B2LA 1KEVA 2MYUA 3JQBC 4MQFA 4B75A 2O2JA 4C0SA 5I3CA 4YO7A 3J81A 5F3WB 3F46A 1P2VA 5I4CA 1BWQA 2LIVA 2XEDA 1XNRB 3FPEA 4M99A 5AXCA 4K9PA 5BYAA 4HQNA 3KFVA 4RDCA 5AJTA 1GLGA 1DAPA 2XZTA 3K1ZA 1O96A 1KARA 1QORA 1O2DA 2Q0SA 1A9OA 1DKRA 3MTAA 3KTAB 3MJCA 4OBEA 3FYDA 5LN1A 3MFQA 2H8KA 3RWOA 4EG6A 5LYJB 2AI1A 4J0JA 4QSMA 4ZKEA 2AUMA 1UC9A 4ITVA 4X45A 3DL2A 1R8XA 3GLQA 2QY6A 3PE6A 1FDOA 4G1BA 3JARA 4N7RA 3SFVA 4D6XA 2O8DA 4A0RA 1E2IA 3QH4A 1UDXA 1YVUA 2EFGA 4EMUA 2JGAA 4BV8A 1N6OA 1YV9A 2JGFA 4UEJA 2P9QA 5JAQA 3UM9A 5HRAA 5DYNA 1UFVA 2O8FB 3ETHA 4Z9XA 2WIGA 4PSKA 5L3SB 3BXPA 1IDN1 2PANA 3EWSA 4N5MA 4PRZA 1MGOA 2YV4A 3KV3O 3G85A 1SQGA 4FOLA 3BSFA 3OBIA 1TIBA 2OKGA 4EA9A 1UJ4A 3PJFA 4QT4A 3L1JA 1Y8QA 1W4CA 2IPMA 3QIAA 1RHMA 4RTLA 4CE6A 1ZD5A 1AKVA 1FYVA 4EFNA 3H1PA 1HDGO 5CA1A 2PBLA 2X5OA 3CU5A 1OZAA 3GT7A 1K6EA 3TTXA 4H7EA 4GPZA 5TARA 4DLKA 2O8CA 4IQGA 5BVHB 4MUGA 5JMTA 5HUJA 3MA0A 4JEIA 4EPWA 4X8HA 6YASA 1N2SA 2C03A 2ONCA 3O4JA 4YJGB 2DSTA 2IHKA 2C54A 4OO3A 5AR1A 5IAEA 3AF4A 2C7BA 3GMDA 4PG4A 4XWTA 1PJCA 3M6XA 2IUUA 4ZJUA 2R1VB 2X9QA 1Y1RA 3G2MA 3KYJB 3QG5A 1T5BA 2NWQA 3I2HA 4XIJA 4B3IA 1FS4A 2IBMA 3U4AA 3FAZA 5DM2A 4DGQA 2N75A 2X3YA 1SA0A 4Q9NA 5JD5A 3OLXA 5D7NA 2WBLC 4MUIA 3TCNA 4QC2A 3W6NA 1GZ4A 1TRKA 4CDRA 4JI1B 5DHAA 1FE8A 1UBRS 3KSAC 1SD5A 2VOEA 4KJXA 1CF4A 2VJYA 1RZUA 1A76A 4HGRA 4N0PA 1RYDA 2W6ID 3Q2KA 3A9TA 4V0MA 4QQRA 1FQJA 2HDHA 4CV0A 2XIJA 1HE5A 3PNSA 3KPYA 2QLFA 3RSFA 1TXGA 3C1OA 3WSTA 3NP7A 4DWJA 1ZNQO 5IEJA 1LW7A 4JP3A 2COKA 3N3AC 1MIOA 2A30A 2I2XB