4CM9A

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
267
structure length
249
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE 1
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 88
structure length 249
sequence length 267
chains with identical sequence B, C
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cm9A00
1HT0A 2GLXA 3NT4A 1UJMA 3VH1A 2VNAA 2XAAA 1MX3A 3VZSA 1XU9A 5KKAA 3PJEA 2B69A 1FDVA 2UUPA 2BKAA 4YAGA 3AJRA 4OJNA 3NKLA 2CMDA 2CVQA 3KBOA 2DC1A 2PZJA 4J1SA 1HE2A 1UZNA 1KVUA 4IXTA 1JQBA 5KJ6A 4PZCA 2ZATA 3GG2A 4QFCA 1NFQA 3V2HA 2H1SA 4OMUA 1NR1A 5IF3A 1DPGA 4L76A 1OOEA 3SBOA 4WPGA 4II2A 3GOHA 5U9CA 3EC7A 4R54A 3RASA 5GZ3A 1JAXA 2A92A 3ZWXA 4PLCA 2BLLA 3F47A 1PJLA 4IGFA 1ONPA 2D8AA 3JQCA 1SOWA 2JAHA 2PH3A 4F45A 2IXAA 3VZPA 4O59O 3Q11A 3GNQA 3I9LA 4KWIA 3PYLA 5FEUA 2ZJ0A 4OAQA 3UXYA 2GASA 1BW9A 5A3JA 1Q1NA 1CJCA 3MJEA 1YE3A 4UVIA 1M2WA 2CDBA 3OJOA 2Y67A 4JNKA 1QV7A 1ARZA 2O50A 2FR8A 3WSWA 4YPOA 1B8PA 1R4MB 2DTDA 4DMMA 1T4BA 5L53A 1Y8RB 3FWZA 3GQVA 4LN1A 2FHSA 1HLDA 5G0UA 3WGHA 4KZPA 3EVNA 1P77A 5AOVA 1WNTA 5GZ1A 3H9EO 3U3XA 1TT5A 3F5QA 4NU5A 3GHHA 4HFNA 4Y8VA 3FNEA 3LT2A 4MKRA 4OQYA 1XYGA 2J8ZA 4N5MA 3X2EA 3PZBA 4CQMA 3AUSA 2GERA 4Q39A 5ILOA 4D45A 3PHIA 1DRWA 1HE5A 1BSVA 4KWHA 4YQZA 3DBHA 3EYWA 4AJ2A 5U1PA 4EJMA 4R4JA 3DFUA 1DO8A 2G17A 1I24A 1YL7A 1GEGA 1W4ZA 3H8VA 5H81A 3RC7A 1NXQA 4B3HA 2DBQA 4DBZA 4U7WA 2HU2A 1D1TA 1YGYA 1V3UA 3S2EA 3NEPX 1X13A 5JXWA 1I01A 3VTFA 4Z9FA 4ROSA 4K9DA 3UKOA 4KUEA 3AY6A 4R51A 4D0SA 5B1YA 3NV9A 2Q1WA 4XQEA 1SBYA 3T4XA 3AM4A 4PLHA 3LLVA 3L07A 4DXHA 1NTOA 2IYOA 3F1KA 5JAIA 4CM6A 5TNXA 1P44A 3E9NA 3WWZA 3QVWA 1P1KA 1Z73A 4CMIB 3OIFA 4MPDA 4FPXA 2DTXA 2G5CA 3GVHA 2HAEA 4FBGA 4MVJG 3TPCA 1I3MA 4ZQGA 3Q1LA 2CF6A 5FF9A 1BRMA 1ULSA 4RLHA 3JCZA 4JX8A 5A9TA 1GPJA 1VKOA 4ID9A 1GD1O 2VTDA 4IUYA 1UXIA 3WG9A 2O3QA 2EGHA 5KIAA 1SB9A 1DXYA 3U4HA 4J0FA 1U3WA 1DRVA 3HDHA 1T24A 2GO1A 3G0OA 5HBRA 2Y0DA 1PZGA 2YHIA 4K6FA 2H6EA 4XB2A 5DBFA 3K92A 3LSYA 1D8AA 4RZHA 1MFPA 4HFJA 5CPBA 1Y9AA 4ZQEA 1I3LA 5CPFA 1LUAA 3SX2A 4J4TA 5F5LA 5AQ1A 4Y6SA 1T2FA 1ZJYA 4NK4A 1X14A 4D42A 4A10A 4XD2A 5TX7A 3FHLA 4AJ1A 4XGKA 1C0LA 3CMCO 4MVJI 4HBGA 2LDXA 3FTNA 4ZQBA 2YV1A 3ABIA 3E82A 4IS2A 3JQ9C 3OIGA 1RM0A 3B70A 3LF2A 4BKRA 2O3SA 3KYDB 4BKPA 2NU8A 2ZB4A 2D0IA 1YDWA 3PP8A 5CEJA 4ALMA 1PGOA 2JD2A 3FWNA 4RJTA 1H0KA 3FRJA 3JQ9A 4ZA2A 1EVYA 3DMTC 2E48A 3H5AA 1DAPA 4RF2A 3GUYA 4YT8A 2ZTUA 2NM0A 2RIRA 4OXKA 1F06A 2VRCD 3UICA 4A5OA 4PLTA 5F1PA 3D7LA 3DMTA 4XYMA 4AJHA 1YDEA 3I23A 4I9HA 1EVIA 1YVEI 1GADO 3WMWA 1F0YA 1JKJA 1TEHA 4E30A 3VDRA 3U62A 3VPFA 2BELA 1DLIA 2Q2WA 2UYYA 4P22A 4BNFA 1EFKA 5TT0A 5LCXA 4R1UA 1CRWG 3E5RA 3ETEA 4H7PA 4Z0HO 1YJQA 4FFNA 1MC5A 3WLEA 2JHFA 2WD7B 2FSSA 3H5RA 4ONEA 1CEQA 4GQAA 4FOSA 4MVJP 1VSUA 4PGFA 1PWZA 3STHA 5HTOA 1U5AA 3I6QA 3AUTA 2WMDA 1NPTO 1IHYA 4I8XA 4TRJA 4P8RA 4B4UA 3WGGA 1NHWA 1DOHA 3GNSA 3WGQA 1KOLA 3P2YA 4EJ6A 3IC5A 4W9NA 1GYQA 3RVDA 2IYPA 2CFCA 3D3WA 3W1VA 3A4VA 3SLKA 2EEZA 5KVCA 3F4BA 4I08A 4R41A 3Q9NA 2CVOA 4IDCA 2WD8A 3RWBA 1ADCA 4PLVA 4R16A 1P45A 4D3DA 1BWSA 1ENZA 3I5MA 4CQLB 4YJGA 2D5CA 3DOCA 2AQKA 4RF3A 5GMOA 3HB4X 4XCVA 3DHNA 1PGNA 4C4OA 5MDHA 2OZPA 3K30A 3VKVA 4FS3A 1MC4A 3ROMA 1GYPA 3C7AA 1HRDA 5IXSA 4LMPA 3C3XA 5CDGA 4ZN6A 3WNQA 1B0AA 2IEDA 4W7HA 3M2TA 1I10A 2VHYA 1ENPA 3QE3A 5C37A 3JSAA 2CDAA 3PVZA 1PL7A 1CQIA 4PVDA 3IL2A 4U5QA 1GV0A 4JIGA 3O8QA 3PYMA 2CSUA 3I9KA 5TC4A 3WNVA 5HWSA 5IDYA 5G2OA 1X0VA 3KEQA 3QWIA 5JLAA 3ZWOA 2DPHA 2Z1MA 1IZ0A 1XWFA 1AUPA 2ZQYA 1KEVA 1OC2A 1DRUA 2HQ1A 3AI3A 3RJ9A 1IPEA 3LC7O 3QJ5A 3ITDA 3INGA 3W8FA 1JN0A 3S8MA 5IG2A 1MB4A 3E03A 2BI7A 1UXGA 1ZZEA 1H94A 3VDQA 1HDRA 3BMQA 3A9WA 4QUKA 5K6AC 5HS4A 5JMPA 1NASA 1QYVA 1K2WA 1NQOA 1PIWA 3JYQA 1KEUA 3LC2O 3NGXA 4FFRA 4L0QA 4YB8A 4RVDA 4UEKA 1TI7A 4AJ4A 5JAQA 4XQCA 5K6AA 1AHIA 4OXYA 5L7WA 4J91A 2GDZA 3BA1A 4OYRA 1AHHA 1BDMA 4YVFA 4J90A 4WNIA 3RU7A 3GRKA 3K31A 4JJFA 4OHUA 1UAYA 2YFQA 3V2GA 1NQ5A 1GUYA 2C2XA 4YAEA 2EG9A 2H63A 1NX6A 3L4BA 4W7IA 4HWKA 5JAZA 1UXKA 2D2IA 1MUUA 3A06A 2FWMX 1R16A 3F9IA 3OSUA 3PGXA 4WOJA 3ROPA 4YXFA 1N9GA 1R0LA 3AI1A 2Q2QA 4GMFA 2EWMA 3HDJA 3DTTA 4LISA 4XYLA 5EN4A 1I3NA 3ASUA 2G82A 4RO0A 5I9NA 4IPTA 3VPHA 3W4KA 3RU9A 5LDHA 4BV9A 2HMVA 2RBEA 4CLOB 1LSSA 3JQAD 1B26A 3C7DB 3MJCA 5I7SA 3DZIA 4B4OA 3IIEA 2YFHA 1A4IA 5EPOA 4IJWA 2DBZA 3GGPA 4R5MA 1P9LA 4QEDA 5JDCC 1PQUA 3AM5A 1XG5A 4IDBA 4RORA 4G5HA 1D4FA 3H5NA 1QYWA 3K2EA 4M87A 4ND4A 2E4AA 3FNHA 1ZEJA 3B1JA 1QXSA 3VC7A 5JDCA 3JQFC 4Z0TA 2AEJA 3ZWYA 3ZWBA 3U09A 1DIBA 2ZTVA 3H9QA 4UVDA 5H83A 4J4HA 5CDUA 5A5FA 2AA3A 3JQFA 3CMMA 1IL0A 1GZ3A 5CHEA 3RC1A 4L8VA 3RIHA 3AI2A 3BAZA 3BHMA 3G49A 1UP6A 3PHLA 3JQBC 3OIDA 4IINA 5THKA 2P5UA 2FP4A 2W4QA 3GDGA 5JY6A 1HF3A 5A3VA 1H6AA 4UAGA 4J7UA 2O3UA 3E8XA 1GZ6A 3JQBA 3E9MA 4ZJUA 3RC2A 1ISFA 2I99A 2B83A 3H7AA 1CQJA 3FD8A 3ZHZA 1NVTA 3LT4A 1P74A 1UR5A 4CR7A 1WDLA 1P1FA 3E48A 4RDIA 1GUFA 3JD3A 4DQXA 4OKIA 3WFIA 5C3MA 1YB4A 2P9GA 5TGDA 3W4IA 5HRUA 2Q45A 1VLLA 1PS9A 1HLPA 3AW9A 1TB4A 1KVQA 2YW9A 4TRRA 3TWOA 4J16A 2DAPA 1SPXA 3BHJA 3ZW9A 5K0ZA 4BNZA 4FIZA 1B15A 3Q2IA 4H3VA 3SJ7A 1YJ8A 1KBZA 4BGIA 4DPMA 4BO1A 4XJTA 4HX5A 4EDFA 2X5KO 3WQQA 4M8SA 3EHEA 1V8BA 2H5LA 5G4LA 3K73O 4DTIA 5LC1A 2QYTA 2EW8A 2C20A 1B8VA 1VC2A 3IAHA 3F46A 1R4NB 1ZW1A 4HV4A 3AFNA 1AXGA 4N5LA 4QT0A 2NU9A 2Y1CA 3JQDA 2OUIA 4JP3A 4CM8B 4JJIA 1I3KA 1ISMA 3B20A 3VVCA 5JC8A 2V65A 1UH5A 4DC0A 3PFFA 1XHLA 3CE6A 4BUCA 4XGNA 4DMLA 2PNFA 2VZ9A 1QP8A 4IZHA 1PJ4A 1SC6A 1TT7A 5L7TA 1PZEA 2Q46A 3PQDA 1RPNA 1W0CA 3DEYX 2BHLA 1DC3A 4JN6B 1JVBA 4AJEA 2O4UX 1NPDA 2J6IA 4IDAA 2W2KB 3IKVA 4C7KA 4U0KA 2B35A 4TZTA 4IS3A 3I83A 2YQ4A 1PGPA 2V6FA 4M54A 2CUKA 3F5SA 2Q50A 4CODB 5JYDA 2HKIA 2XXJA 3O03A 2WYWA 4HY3A 2J5QA 2QZ9A 3DFZA 4XR9A 2J3HA 1MLDA 2R2GA 1DIHA 4J43A 3RFTA 3K5PA 1F14A 4WCFA 4MVJA 1BHSA 4PIVA 3VPSA 3ZU3A 4OM8A 1HDYA 1R4MA 4M1QA 2CD9A 3NX4A 1U28A 1Y8RA 4CLEA 4E31A 2DPGA 4IIUA 5TF4A 1T2CA 1ZMOA 4MVJF 3T7EA 1S7CA 3JQGA 3FTPA 4IXWA 3ORFA 1GV1A 1NVMB 4AJPA 2PK3A 1Z7BA 2DFVA 4BKOA 3MOGA 4Q3DA 3GN1A 2I9PA 4R68A 4NFHA 4N54A 4TMFA 3L6DA 4JQCA 3OFSA 3UVEA 4J1QA 1Y5RA 2JKVA 2VZ8A 3E9QA 4FFMA 1Z75A 4NNJA 1DAOA 4ZQHA 2GN9A 4PLGA 4XIYA 3EGOA 3MJ4A 2X0JA 2D59A 4J7XA 4CLHA 3GZ4A 3GK3A 4HFMA 1CETA 1PSDA 1XLTA 3FI9A 4CM7A 1C0IA 4E5KA 1G6KA 2X0RA 3TOXA 3KTDA 3D4NA 5BSFA 2GN6A 3PYXA 4OH1A 3K2BA 4ZICA 5KNLA 3ZV4A 1ZK2A 3F1LA 4GPD1 3LC1O 4BMNA 3FNFA 2EV9A 3R0IA 3GR6A 4WLUA 1H6CA 3WGYA 4WLFA 4DWVA 1DIRA 2RHRA 3KYBA 1T26A 4MOWA 2OFPA 3OICA 4CMIA 3U5TA 1T2AA 1E7SA 3RFXA 5JBIA 3TFOA 3JYPA 4MVJH 3MJSA 3JV7A 4WE3A 3W4JA 3GY0A 4ALNA 3UOGA 1E5QA 4YQYA 5AXCA 4PCVA 4RV9A 3ZNNA 3N7UA 4IM7A 2BGLA 2X9GA 3BMCB 3PDJA 1U4OA 2HMSA 2YHUA 3GEGA 1J49A 4L9RA 4CPDA 2ZB8A 4Z9XA 2GPTA 2W8ZA 3UGKA 3RUEA 1HZJA 2I3AA 4BNGA 2Y1OA 4E13A 2X23A 1JVSA 4DYVA 2IZ1A 1EK5A 2PKQO 2RHCA 2POQX 3L6EA 2HK7A 4XA8A 3VZQA 1GPDG 5A9SA 4AG3A 5HA5A 2G76A 1YOVB 2A4KA 2F00A 4E6PA 1FK8A 1B3RA 2ZCUA 3I3OA 1T2DA 3DC2A 3H9UA 4G65A 4CMAA 1DFIA 2TMDA 3JQ7B 3D4PA 4D0RA 1CWUA 2P4HX 1L7DA 3KYDA 2PKRA 3H2ZA 1LTHR 1NVGA 3KSZO 5DN9A 2DFDA 4UUNA 4GLLA 3C1TA 1ZSVA 1YQGA 3F6YA 2AHRA 3DZJA 3AY7A 1NR7A 5EINA 1FF9A 2BMAA 3ZU5A 3HFSA 4Y98A 1E1MA 3O26A 1R0KA 5C7IO 1VL6A 2AEFA 4UUPA 1KC1A 1PU2A 1T1SA 1EDZA 2HMUA 3IMFA 1T25A 1XSEA 1ZSNA 4BNIA 2VWQA 3OJ0A 4AL4A 4B7XA 1ISIA 1HTBA 2D5AA 5T67A 1LRKA 1EEHA 3JD4A 2WD7A 3JYNA 4J3FA 4AJNA 1CYDA 1OBFO 1G1AA 3WS7A 4NBUA 2GZ1A 1T1RA 4J9VA 2NUAA 1HE4A 5TSDA 3ZWAA 4B7UA 2JCXA 3I4CA 1PGJA 2I76A 3HWRA 3JYLA 1VJTA 3OJLA 4D44A 2YYYA 4NQZA 4WKGA 1GQYA 2EIHA 3U49A 3A1NA 1I33A 4B8WA 2Q1TA 3HNPA 3KRTA 4YA6A 3WR5A 3TZKA 2OBNA 4A03A 1D1SA 5F1KA 1Y5MA 4Y67A 4ZQFA 2VQ3A 1E3JA 1M75A 1M76A 4OL9A 3WBBA 4YAIA 3ETGA 4ALLA 1AE1A 4CQLA 3KUXA 1ZJZA 1DJQA 3I9JA 1RYEA 4NH4A 4CL8A 4DGSA 3EY4A 2WEKA 2VHZA 1O89A 1W73A 1RM4A 1U2DA 2HJSA 3RROA 3PZRA 4BNYA 1E5LA 4J6FA 3VPXA 3AUAA 3PHGA 2FPPA 4YCAA 1P31A 2A94A 2Z5LA 3NGLA 4WUVA 1KEWA 1YWGO 2ZK7A 5COQA 4JK3A 3EK2A 4I9NA 1NM5A 2JFGA 4WNCA 1NAIA 4BO6A 4AJJA 4CUKA 1TXGA 3C85A 3S2GA 3V1TC 3JD1A 3SXPA 3AU9A 3LDHA 2PTGA 1YQXA 4DRYA 2NU6A 1E92A 2UUOA 4QSMA 4XQGA 2EKQA 3EZYA 4ND2A 3HQ4O 4Y6PA 1V3TA 4R69A 1VI2A 4YEDA 2GGSA 4J2HA 2IODA 4IQ0A 4JBHA 4D3SA 2V7PA 3JYOA 1VSVA 3DL2A 3QVXA 2VYVA 1ZK4A 1P33A 3BMNB 1PR3A 4FB5A 1JKFA 4Z6KA 2J3KA 1E7YA 1ML3A 3IUSA 1GQ2A 5JC1A 4PN3A 4BNXA 3UCFA 4RCVA 1RYDA 3BTVA 2B0JA 3D4OA 4F6CA 3VTZA 4GWKA 3PPIA 1BXGB 1HE3A 1X7GA 2DU8A 4H16A 4EGFA 4H15A 5JSFA 1I2ZA 3G79A 1FDTA 2PA3A 4C7JA 4YYZA 1N1GA 1U3TA 1PL8A 4MDHA 2AE1A 4PLZA 1PR9A 3O38A 3LT0A 5AYVA 3DTYA 1E7RA 2AQHA 3H3JA 4XYEA 3BTSA 3K8ZA 1RWBA 1LA2A 4KTVE 5KKCA 3QHAA 5JAMA 1I36A 4HADA 4XIJA 1ONNA 1T2EA 1YBMA 2CY0A 4OOEA 4Q3NA 2VWHA 5U4QA 1A72A 2RCYA 3DZGA 3R3JA 3GAZA 3PJGA 3CTMA 3DDNA 1LLDA 4CLOA 2PV7A 4YBZA 1K6XA 3KV3O 3DQPA 3UHAA 3KLMX 3ITKA 2SCUA 4XKJA 2EKLA 3EMKA 1LDNA 2NSDA 2O3TA 4NHEA 2EHDA 3MOIA 4YJHB 2I5PO 3OP4A 1YH3A 5TT1A 4UVGA 1LQUA 5JY1A 1H93A 3WLFA 1Y8QB 5F3RA 3KEOA 4CQMD 2PGJA 1ZO8A 5ER6A 4YAKA 4YJFB 3V2UA 5KJ1A 1LJ8A 1UXHA 2NADA 1DIAA 3GEMA 2X7HA 1ADBA 5C7OO 4M86A 1ZMTA 3DONA 1SCUA 1Q7BA 1U8XX 3QWHA 1A5ZA 4QECA 4W99A 5G4KA 3ZV6A 3ANMA 5TQVA 3BXXA 2GYYA 4WEQA 2PZLA 4WASA 4BOYA 2P9CA 3C1OA 2B5VA 1DBVO 1EBFA 4NPCA 3WMXA 3WQSB 3GGGA 5KTKA 3ZWPA 4KUHA 5A4DA 3A14A 4FJ2A 1Z82A 2WE7A 4E5MA 3CEAA 3RQSA 3GUCA 3I9NA 4L4XA 5IDWA 3ADPA 1L1FA 1I32A 3TL2A 2DQ4A 2OBYA 5FWNA 5EESA 1ZBQA 3PQFA 4GBJA 1UAGA 3KOUA 1NNUA 1KEPA 4GGOA 3QP9A 3GFBA 3RJ5A 1QMGA 3VVBA 4RZIA 1DJNA 1N5DA 2IDZA 1MV8A 4GLOA 3DR3A 2EGGA 4UULA 4D41A 4JBGA 2BFOA 4XYGA 2GN4A 3UN1A 1E3LA 3IS3A 2YV2A 3OF2A 4MVJE 4GGPA 2X9VA 4DPLA 3LLSA 1TA4A 4NIMA 5BT9A 5CG2A 2Q1UA 1ZH8A 4E21A 5EQFA 3ZHBA 1YONA 3HB5X 5JO0A 1PTJA 1R4NA 2JD0A 4BQRA 1ULUA 5L45A 3KYCB 3W8DA 1YL6A 1GZ4A 1K0UA 4B79A 4BIIA 2XF8A 4CM8A 3N58A 1W6UA 2G0TA 5F21A 4BNWA 4OIMA 5CEFA 4D3FA 1HDZA 1QSGA 1NHGA 3WJ7A 5EJ2A 1SB8A 3FF4A 2YJZA 1BMDA 2FRDA 4CMBA 1PJ2A 1DC6A 1VE9A 1HWYA 1LDEA 4L75A 5KVVA 3WGTA 2W2KA 2ZQZA 5T6BA 3LF1A 4ESOA 5IDQA 3R1IA 4KOAA 1AGNA 1VL8A 1VM6A 3AFMA 4E5PA 2O7SA 2Y0CA 3WGZA 1NPYA 1DHTA 3GZNB 4Q3CA 3NTRA 4D7AA 3QLJA 3W8EA 2X9NA 2YDYA 1AN9A 4IJKA 4DUPA 3UCXA 3KSDO 5I8ZA 5BR7A 3WQRA 1KIFA 4BKUA 4D46A 2PY6A 1NAHA 4CQMB 3PGJA 4UVHA 3RBZA 3EDMA 3WXBA 5I7VA 4D43A 4NJMB 2HMTA 4XJSA 1C3VA 1E3SA 4E32A 1OI7A 2BGMA 1NP3A 2C7GA 2O2YA 5A1TA 4Z0PA 4UUOA 3GFGA 3TSCA 3GG9A 2C54A 1C14A 3DAGA 4U8GA 4YR9A 3D0OA 1FXSA 3F3SA 3HADA 4YACA 1DB3A 2O48X 3GRPA 3RKUA 1EUDA 1U8FO 1UDCA 2I66A 4J7CA 3GPDG 5JCJA 3U0BA 3VPGA 3K6JA 3I4FA 2X0NA 2W2LA 3JQEA 1E7QA 3GH3A 3ZGYA 3VOSA 3PQEA 4FW8A 4CMKA 3Q2KA 4IMRA 1E0DA 4ZGWA 4CV2A 4FDAA 4K28A 3ZZNA 1QRRA 2X4GA 4GWGA 4XYBA 3S55A 3ZWNA 2J3JA 3KXDA 4O6VA 4HFRA 1EDOA 4GAEA 2DKNA 1Z7EA 3QWFA 4QQRA 4F46A 4A27A 4MKZA 3ENNA 1GCUA 3NAQA 4MIYA 1E6EA 3H3FA 1T4DA 3H4VA 4IJUA 5G0VA 4IZIA 2ZIZA 4BNKA 3VHRA 2Q3EA 4ILKA 1B7GO 4BMSA 2YHIB 4YRAA 4ALIA 2PR2A 3IJPA 1B16A 2NACA 1I2BA 3BMCA 2YZ7A 2GR9A 3HUDA 1M67A 5L3ZA 5AVOA 5C5IA 1HYHA 3OBBA 3Q0EA 3VH4A 2Q4EA 3I52A 4E5YA 4QX6A 1I30A 1VJ1A 2WE8A 1QKIA 2OMEA 3I9MA 1V9LA 3GLQA 4MO2A 1CF2O 5FI3A 3GPIA 1YBVA 4MIOA 1WZEA 3IDSA 4JBIA 3NT5A 1A71A 4YAJA 4BO0A 3NDRA 2VUTA 1P1RA 2VCYA 4BGEA 2X5JO 4PFJA 2IRWA 4J1NA 4CMHA 2HRBA 5A04A 1LSUA 1O95A 3WIDA 4DA9A 1GAEO 4LRTB 4E2WA 2E37A 1YOVA 1LRLA 2B37A 3RUCA 1LDYA 2W90A 3ZNOA 1KVSA 4RGBA 5BNTA 3QQPA 5BSEA 1KETA 1LLUA 2R00C 2ZCVA 2HLPA 3JQ7A 5FYDA 1N7HA 3CZRA 3EW7A 3OETA 8LDHA 4UUMA 4K1LA 3CZMA 3SC4A 6ADHA 2O3RA 3HFGA 2DTEA 2CF5A 1Q0LA 2QQ5A 3RCBA 4NR0A 3NJ8A 4OO3A 4RF4A 1P0CA 1F12A 4IDFA 5A5EA 3JD2A 3AOGA 2ZKLA 1PL6A 3M1AA 3ZH2A 1I5RA 4D79A 4UEOA 3ZHYA 1E77A 2AQ8A 4FFPA 3QIVA 4R3WA 4CM3A 4FSHA 4KUGA 4CJXA 4A73A 2ZTMA 2FMUA 5COBA 1U7TA 3L9XA 4XZ3A 3DBLB 1C1DB 3OECA 4IGEA 3RUHA 5DDIP 3ST7A 1LDBA 3PIDA 1IE3A 4AJIA 2VYNA 4NU6A 1HKUA 3CKYA 4O5OA 2WWRA 2AG8A 3I6IA 2JHGA 3DZKA 2QHXA 3ZWVA 3DAFA 2C5AA 2CDCA 3RC9A 5GY7A 1XQ6A 5KVQA 2Q99A 2ZYGA 2OOSA 3UCEA 3HE3A 3GGOA 4G81A 2Y1EA 4BO8A 1QLJA 3JQ8B 3GVXA 5I7EA 1YO6A 3ON5A 1PJBA 1VKNA 3JQAB 1V0JA 1M66A 3JD0A 1IYZA 4RDHA 1SNYA 2GRAA 2NVUB 3ADOA 5CDSA 1Q2XA 5CAEA 2GD1O 2AEMA 3MEQA 4P4NA 2B4QA 1K5HA 5BSHA 2BH9A 4L74A 3MZ0A 1XGKA 3HZZA 2IE0A 3RAJA 1E6WA 4BO2A 3FPCA 4PG4A 4WLOA 3L0DA 2C82A 1O0SA 4QO7A 1G0NA 3SC6A 2DVMA 1GEEA 5MGBA 3NYWA 5DOZA 1EE2A 4FJ0A 4CR8A 4GI2A 2HMWA 2QRLA 3AU8A 1BXZA 4P4LA 3DOJA 4A2CA 2TMGA 3MWEB 4WCDA 4EITA 3BZUA 4XDZA 3F4LA 1EUCA 5T5QA 2WJPA 4IJVA 1HYGA 3D64A 2QW8A 4JP2A 4KP7A 3VZRA 5A06A 1XR3A 2HJRA 2VHWA 1Z6ZA 4J49A 1JWAB 4PRLA 4MP3A 3QRWA 4YDRA 2YY7A 4GKBA 1D7OA 5DOVA 1X7HA 1ZKMA 4KQXA 3M2PA 4TRNA 3ICPA 2PGDA 3U4DA 2AXQA 4CM1A 1E1NA 1XKQA 4CM9A 1UXJA 2QZZA 4ZRNA 1ZK0A 1MP0A 3BIOA 4ZHSA 5HM8A 3FCOA 1HDGO 3BMNA 5COAA 3H6KA 1EMDA 3AUUA 1DLJA 1P1JA 4WLVA 4RPLA 4E0BA 1B8UA 2OORA 2X58A 1XIVA 3RD5A 4YRBA 1YB5A 2VNSA 1BXGA 1J0XO 4NMHA 4ZD6A 2JFHA 4MKXA 4ND3A 3S1LA 3ZV5A 3O4RA 2HRZA 3Q3CA 1TLTA 9LDBA 1BVRA 5DCYA 3JTMA 2NLOA 3COSA 3INRA 4B7CA 2QRKA 5IZ4A 5JDIC 1LSJA 4TKMA 2QYSA 1PS8A 3PI7A 4CL3A 4DQUA 1XU7A 5JDIA 5B37A 2YUTA 4KTTE 3WTBA 1LXCA 1KYQA 1OC4A 1WDKA 1ZCJA 3OEWA 3R3SA 2X22A 3M1LA 3WTCA 3ASVA 1XEAA 1FJHA 2RH8A 1YKFA 4R1NA 3RUFA 3OHSX 1U4SA 1LDGA 4RPJA 5IDXA 5K9ZA 4GVXA 4IMPA 3DHEA 7MDHA 4Q3AA 3ZDFA 3AM3A 5I7FA 4JGBA 1RM5A 1X7DA 3GT0A 3IP1A 1BG6A 4MVJD 5DCUA 2OHXA 4FJ1A 5LDGA 1H9BA 4XX0A 2EJVA 3I9OA 3ROKA 4XRGA 3CUKA 3GVPA 3WICA 1IPFA 4EZBA 1A27A 5KVSA 5KOIA 2Q2VA 3H2SA 4YT2A 4KMSA 2C59A 5A05A 1YS4A 4EEZA 5BNFA 4HXYA 1DC5A 1JTVA 3PIIA 2EP5A 1NWCA 2FSVA 4TWRA 2QX7A 5FFFA 1C0KA 1JKIA 3ROQA 5B4VA 2YV3A 3DZHA 5IFLA 2UDPA 1A7KA 1PEDA 1Y9EA 4YJFA 4BVAA 1GU7A 1XCBA 3H65A 4CLDA 4AJOA 2EW2A 4R1SA 1UZLA 3ICCA 4K26A 2DT5A 5L95A 3KLPX 3QV1A 2GCGA 2X6TA 3OQBA 4FD3A 4MP8A 3TZHA 4EEXA 4XR4A 1SMKA 1O5IA 1O8CA 1EFLA 1B3BA 2ZB7A 3A28A 3CSDA 1K6JA 4ITUA 4CMCA 4G2NA 3RBXA 1PZHA 2VT2A 2DBVO 4WK6A 1O9BA 3P5SA 4BL5A 1DEHA 1DSSG 2A9FA 3BMOB 3WX0A 3ENKA 2V6GA 4L4RA 4BO5A 1E6UA 4A7PA 4HUJA 2C2YA 5B12A 2NTJA 3G1UA 1EQ2A 3V5NA 1E7MA 2B36A 4DLBA 1AXEA 2Q4BA 3OJEA 2ZYDA 2CVZA 3UFXA 1HZZA 2J3IA 3MWDB 3DWFA 1YQDA 2VUUA 5G0TA 1KS9A 4NFYA 3ZU4A 1K6IA 5DCWA 2JFFA 1K3TA 2XOXA 2BI8A 2DLDA 4RQUA 4BB6A 1EK6A 1WVGA 3OH8A 4MIEA 2C0CA 1ISHA 3AY3A 3C7CB 3VAZA 1J4AA 3CPSA 4EBFA 2FZWA 3IJRA 3U4IA 2PZKA 2EP7A 4U6QA 2Y1GA 4J4BA 5L7YA 1E3WB 1ISJA 1LLQA 1ZK3A 1Q0QA 2NTNA 1UP7A 3ZI0A 5ICMA 1EBUA 1P1HA 5A02A 1Z74A 1QYDA 1OFGA 2O23A 3KYCA 4BKQA 2QRJA 2PD3A 4TVOA 1PZFA 3GDFA 3GMSA 4I5FA 4LRSB 4BMVA 2BFPA 1KERA 4CUZA 1J6UA 3HN7A 3TJRA 4CM5A 1GR0A 1UUFA 1ZXBA 1ENYA 4U6SA 2VOJA 4RVGA 4R9RA 4O1MA 4INAA 3EZLA 3KM0A 2PD6A 4FN4A 3DZBA 4LGVA 1BVUA 4RVHA 3GVIA 2OXIA 3O9ZA 4EI2A 2P5YA 2B4RO 1HSZA 4WECA 1R66A 2Y66A 3BHIA 2D1YA 4WCFB 5DP2A 3TN7A 4CUJA 8ADHA 4JJGA 1SEPA 2PFGA 4R5HA 1IOLA 5ENDA 2X8LA 4IQ8A 1HSOA 3TDKA 3B1FA 3MCVA 3UAGA 2IZZA 1HETA 3TF5A 3GZNA 4M55A 5TJ9A 4YJDA 4PZDA 1WLYA 3ZW8A 3IP3A 3WGIA 1Z45A 3JQGB 4GMGA 3D5TA 1NYTA 4GVLA 4TKLA 2FOIA 3E18A 5TLSA 2FPIA 1NQAO 3RBVA 4FC7A 4PZEA 5ENVA 5CDYA 2FR0A 4NJMA 2Y0EA 3RFVA 1KC3A 3ZWMA 4BQPA 1N1EA 4FFOA 4S3MA 3K9QO 4X54A 2VRCA 2ZB3A 4B3JA 3WJAA 1CERA 1JU9A 1RJWA 4FGSA 4LMRA 2WM3A 2PLAA 3OJFA 1OAAA 4OQZA 2O3JA 1P3DA 3NRCA 2BF7A 4DYDA 4E5NA 3LT1A 4TQGA 1MG0A 4FGWA 3EVTA 4Y6RA 4EW6A 1GTMA 2O7QA 2C5EA 4E2ZA 2OGUA 4IDGA 4ND1A 3E5MA 1ZNQO 2NV6A 4KDFA 1IUKA 1MXHA 4CLRB 2I67A 5IJZA 4CV3A 2GF2A 3S2FA 1QYXA 2UV8A 1EZ4A 1GDHA 1R12A 5IN4A 2R6JA 2C29D 1ONOA 3KHUA 1HL3A 1LI4A 1SZJG 3UH1A 2E6UX 3V1UA 4JXKA 3RSHA 2O4CA 1YBAA 3IOYA 4NK5A 4I9UA 4ZVVA 6LDHA 4Q9NA 3U9LA 5L9AA 3LU1A 4RPKA 3W6UA 1SOVA 4LW8A 3RUIA 1LQTA 1YB1A 4TRMA 4CMEC 2VTEA 2G1UA 4PLPA 4MVJM 4PLYA 1VRWA 1Q7GA 3FR8A 5H82A 1VPDA 1PJQA 1PJTA 2D3TA 3WGOA 4R1TA 3CXRA 3TRIA 4CMEA 4PLFA 4CM4B 4E4YA 4NI5A 4TSKA 3TNLA 5JE8A 3WFJA 4BNTA 5THQA 4ALKA 2E82A 3U4CA 3C1AA 1R0SA 2PZMA 1ZK1A 5A03A 3DBRB 1I2CA 4LSWA 1LRJA 3ZWWA 1UP4A 4QO8A 1UZMA 2B4TO 4LSMA 4F3YA 5A9SB 4FQ8A 3TQHA 2X5OA 2Y1DA 2OP0A 3PK0A 3AK4A 3KZVA 5DBIA 3B6ZA 4AVYA 1I8TA 4FC6A 5G0WA 4L73A 1KVRA 4MINA 3DB2A 4NBVA 4PG5A 5FI5A 3HDYA 3CINA 4R01A 1LC0A 2VYVD 3PFWO 1A9ZA 4OKNA 4W4TA 3WBFA 1C0PA 4W6ZA 1NFFA 3D5QA 1DHRA 1EVJA 2Y99A 5DBGA 3TZ6A 1PQPA 1ENOA 4NDNE 4E12A 3WWYA 5EIOA 5T57A 4J9UE 2BFAA 2VUSA 4GSLA 4UVEA 5KWEA 1C1XB 5BSGA 4RVUA 1GQQA 2Y93A 4LCJA 2IEBA 1Q7CA 2Q49A 3WYEA 1ADFA 4O63O 1FDSA 3WDSA 3CIFA 3R6DA 5CFZA 3HN2A 1H6BA 2O2SA 1Y7TA 4NFSA 4Q3EA 2GUGA 1QR6A 2P2SA 3T4EA 2I3GA 2YQ5A 3PLNA 5ER9A 1PJSA 2GN8A 3KB6A 3K96A 3MJVA 1GCOA 3L4SO 2NQTA 4BNNA 1DFGA 5ES3A 1OMOA 5TJHA 4I1IA 2J5RA 3V8BA 5CEEA 3L77A 1XDWA 1XELA 4II3A 5IN5A 1JW9B 3OA0A 1H6DA 3ANNA 1XQ1A 3LZ6A 3D1LA 1C1DA 2F1KA 1X1EA 3DBLA 4MP6A 4W9NC 7ADHA 5EQDA 2Y1FA 1U7HA 3ONDA 3DZFA 4Z3KA 2VZ0A 1A9YA 2NTVA 1DC4A 1I0ZA 2HUNA 1F8GA 4BNUA 3VH2A 4YT4A 4I5DA 3GEDA 2NVWA 4WJZA 1UDAA 4LCEA 4LVUA 1FDWA 2AQIA 4DVJA 4GX1A 1MG5A 1MA0A 4OGWA 4XDYA 4EUFA 1BW9B 1EE9A 3NDJA 3S2IA 2PGLA 4BNHA 3TOZA 4UEJA 1DDOA 1QG6A 2D4AA 3Q6IA 3JQ8A 2NU7A 3PXXA 4E2XA 1LX6A 3OM9A 3JQAA 4HNHA 4RVFA 3QY9A 2NVUA 4BV8A 3AWDA 3FBGA 3IKTA 1BTOA 2LDBA 4OOFA 4IDDA 3LK7A 4FR5A 4W82A 2Y68A 3WYBA 2P91A 2HO5A 2ILTA 3HG7A 1TT5B 1GFSA 4WGGA 3C8MA 3ZN2A 4GX0A 1W8DA 3UW3A 4WEOA 1GY8A 1X1TA 3GC6A 2FY8A 5BNIA 1NWHA 3ZWCA 3PJDA 4Y9DA 2E49A 4XEHA 1LU9A 3DBHB 4NBWA 4CLXA 3SJUA 4IBOA 1B2LA 1Y1PA 1ZFNA 3H9JA 4R9SA 9LDTA 5DULA 1A7AA 5TIIA 3CH6A 1GYRA 3WIEA 1JA9A 4KDEA 2P9EA 2XXBA 3PLRA 4M49A 2NVBA 3P7MA 3GA0A 1N8KA 3SVTA 4J1TA 3RUDA 3W6ZA 1JDJA 1LDMA 1KY4A 4DL9A 1FMCA 1PGQA 4GSKA 3OQ1A 4OSPA 3E6AA 1P1IA 5EL0A 4WLNA 4BB5A 2V6MA 2JJYA 1ZIDA 1A4UA 3GF4A 1U3VA 5B4TA 3KETA 1TVEA 1HDOA 3EUWA 3G3EA 4PG7A 4IIVA 3GMDA 4EUEA 2XPCA 2OL4A 2H9IA 5I8WA 1WDMA 5JCXA 3OEYA 1KVTA 3QVTA 4DREA 1LEHA 1B14A 2EXXA 1QLHA 3L4BC 3WSVA 5ITVA 1BXKA 1DFHA 1SO8A 4S1VA 1V35A 3M6IA 3C24A 2EERA 3DHYA 1WW8A 1U2GA 3N74A 2JCYA 2V6BA 1LLCA 3PTZA 1LNQA 5T64A 1WMBA 4NJOA 2DUWA 5L4LA 3I1JA 2B5WA 3X2FA 5CDTA 2FPGA 4B8ZA 4BO3A 4N7RA 1PS0A 3HHPA 1QORA 1MGOA 5I9LA 4DLAA 5DNAA 4BGUA 4DQVA 3TZQA 3L6OO 1E3IA 3GNTA 1LC3A 2JD1A 2DBRA 3NJ4A 1WWKA 2BGKA 2RH4A 2VWPA 4QXMA 2WSBA 1ZEMA 2Q1SA 1H2BA 2AW5A 4AJKA 3VH3A 2BRUA 5KCZA 3GAFA 2P4QA 4DBVO 4BNMA 3FPLA 5L40A 2NNLD 2PD4A 3FBTA 4MJLA 3DXFA 1WAMA 2X1HA 1WMAA 3WB9A 4RL6A 4B4VA 1U1IA 4CV1A 1ZXLA 4BNVA 1E1KA 2WYVA 1EVZA 3PHJA 4K6CA 1QYCA 3T7CA 5L4NA 1ID1A 4DIBA 4DC1A 2UVDA 4I5GA 4XGIA 5EERA 2NQ8A 5CP8A 2R00A 4ALJA 2YDXA 1X0XA 4AICA 4AFNA 1JLLA 2ZYAA 5G4KB 3PWSA 4YT5A 1NFRA 4YTEA 3MJTA 1D3AA 4HKTA 3DO5A 1IY8A 3PEFA 4RLSA 3DAPA 3H9GA 5DF1A 4DIFA 1L7EA 2ZTLA 4BO4A 5JCJD 5IAAA 3NT2A 4B3IA 2FN7A 3NTQA 3IUPA 5KJEA 1RM3A 3V1YA 3INTA 2W2LD 3QVSA 4CMJA 1O6ZA 2HSDA 2OP1A 1FDUA 1GUZA 3LVFO 4BNJA 4JCOA 3ONFA 2Z1NA 1PWXA 2EF1A 2QG4A 3GDOA 3KSUA 3PJFA 1V3VA 3QWBA 5AXBA 3BMOA 3NTOA 3ULKA 4DPKA 2DUUA 3AOEC 4J2OA 4R3NA 2X86A 4CR6A 3D3WB 3WYCA 4N5NA 4URFA 3GN2A 1PJ3A 4GX5A 3HJAA 3AOEA 1N92A 2UAGA 3RI3A 3VKUA 5ITWA 1IZ9A 1ZVMA 4Z3DA 4XWYA 2EKPA 1BGVA 3LYLA 2IZ0A 1BDBA 2EJWA 3FN4A 4E33A 4YJGB 3BYZA 3NUGA 2PH5A 4P4GA 1H5QA 5ADHA 5DT9A 2Z95A 1PX0A 4FOOA 5G0SA 3PWZA 1JAYA 1HDXA 5EMHA 5L51A 1ORRA 1RKXA 2VRBA 5IZCC 1X15A 2GSDA 1YL5A 4Q3BA 5HS6A 5ICSA 2FR1A 1ADGA 4RPGA 3QSGA 1E3WA 3PDUA 4RPHA 1VL0A 2QIOA 2Y05A 5IZCA 3KO8A 1O94A 3IQDB 3E1KA 3UUWA 4GKVA 1HYEA 1E1LA 4PRKA 5JO9A 3O8QB 5B4UA 1WXDA 2I6TA 1M6HA 2PKQP 4YWJA 1E7WA 4EUHA 5JYEA 5F1OA 2A35A 3QWAA 3NDIA 4JROA 3ZHXA 5GZ6A 2HDHA 2VWGA 5DZSA 1HXHA 4WCFC 2X0IA 1ZSYA 4M89A 3OA2A 2FZEA 3WOHA 5C7LO 2VN8A 2PWZA 4KQWA 4TZKA 3ZV3A 4E2YA 3QVOA 2OO5A 3ONEA 2ZJ1A 2AE2A 4ND5A 4J0EA 5AXAA 5T8KC 3BMQB 4WOKA 3BTUA 4O0LA 1ISGA 4ZU3A 2RAFA 1E3EA 1H2HA 1NQTA 3G1TA 1F8FA 5T8KA 4EYEA 5KJCA 1GL3A 5I9MA 1UDBA 1IB6A 3GVCA 3ZNPA 2C07A 4GH5A 4XQ9A 3ETDA 1LSOA 3D3EA 4TROA 4Z9YA 1CIVA 3EAGA 1IULA 1U3UA 2HK8A 1EUZA 2VT3A 3QA9A 4HNGA 4IY1A 1F17A 2VYND 4PG8A 4L4SA 4U0JA 2P68A 4DIOA 1KY5A 2VHXA 5A9RA 5KJFA 3LQFA 4IDEA 1DIGA 4PLWA 3TL3A 4P38A 4IQGA 1N9GB 1N7GA 1R37A 3HSKA 1YRLA 4XRRA 4EJ0A 4QFDA 4F6LA 4RVSA 4YRDA 3ANLA 3P2OA 5JW6A 1V6AA 3Q9UA 1WPQA 3FNGA 4JLWA 4UREA 5ILGA 5TS3A 5JMWA 4FCCA 1M6WA 2IXBA 4BHTA 5JPIA 3JQ6A 2HK9A 5AXDA 3OQ6A 4GL4A 1Y6JA 3G17A 4CLRA 4ZRMA 2I65A 5TRTA 1MFZA 2AMFA 4NZ9A 4PVCA 4B4WA 1U9JA 1U5CA 2C7VA 1JWBB 2VHVA 3PWKA 5IXYA 3L9WA 4AJLA 1J5PA 1S6YA 3ZCXA 3FSRA 3SEFA 1LBEA 3ZNQA 2BD0A 4BGVA 3PHHA 4GX2A 2GZ2A 3UF0A 4BNLA 3KVOA 1SEVA 1XA0A 1R15A 2CNBA 2ET6A 2VOEA 4TVBA 5J23A 1NBOA 4I5EA 1Y81A 3MTGA 4YJHA 1G0OA 3P19A 4XB1A 1IHXA 4CM4A 2CZCA 4LVCA 4WLEA 2NWQA 4LK3A 3GHYA 3DMYA 1P0FA 1Q0HA 1OZAA 1Y8QA 4OXNA 3RUAA 3DBRA 2J5KA 2JAPA 4QTZA 2GNAA 4NG5A 1HEUA 5L4SA 1PJCA 3B1KA 3RKRA 3TZCA 1CDOA 3PRJA 3OMLA 5DP1A 4E3ZA 1H9AA 2DM6A 4CV0A 5CG1A 3DOOA 5JS6A 2WDZA 4RF5A 1QV6A 2AG5A 2GZ3A 3SLGA 2JL1A 5BQFA 5F5NA 1SAYA 4CM9D 3FR7A 1N2SA 2JCVA 4A0SA 4DLLA 1R6DA 3QW2A 1VJ0A 2WYUA 2WTBA 3ZU2A 2BFMA 1K89A 4A26A 4FFLA 4CMGA 4N18A 5JNLA 2W98A 1EQUA 4BO7A 1YXMA 1WZIA 1HDCA 1MXFA 3DBVO 4OSOA 4BS9A 1C1XA 2HCTA 3BTOA 1ZUD1 1PQWA 4BO9A 5JFOA 4NBTA 1WP4A 3MTJA 3HDQA 4NBRA 4HP8A 4RQTA 3TFQA 4PG6A
chains in the Genus database with same CATH superfamily
3NT4A 2GLXA 1XL0A 2JI6A 1OA1A 1QHNA 2C42A 5IM4F 2H52A 4RVNA 2VNAA 3SHQA 1U8ZA 2XEXA 3DMNA 5EWMA 2WFLA 3CLTC 4JI6B 4UE2A 1QTNA 2DP4E 5G02A 1RJ9A 1XYVA 3OX3A 1L4EA 3AUJB 2EVWX 1Q6YA 5AKEA 4NENA 4OJNA 3QPVA 2B25A 5C0OE 3MPUA 1F1JA 1OBVA 2H1WA 3F90A 1L5NA 1JR2A 3FB4A 1UZNA 2O2DA 4F04A 3G82C 621PA 2IPLA 5DNYB 1HQKA 3WLQA 3NHMA 4QFCA 2WU0A 1NFQA 3CX8A 4ZALA 2V55B 4ZVTA 5LA6A 5AW2A 1M34B 5IAJA 5IF3A 4QRDA 5EHNA 4E46A 3EQ7A 5TGTA 4CDNA 1MEJA 1A3CA 4CF5A 1QGED 3RRBA 3GEHA 2CD7A 2GKOA 5E1OA 1ZUWA 3TE7A 3L0BA 3W77A 5GZ3A 3KQVA 3R3UA 1FUYB 3ZWXA 2BKVA 1PFQA 1TO1E 1UZUA 2BLLA 1ZICA 1OIVA 1NJFA 1ONPA 1Z2AA 3PGLA 5BV0A 1OWNA 3F6CA 2PH3A 3EBPA 5LZ8A 2GH1A 3QHPA 2P78A 4B82A 2QWXA 3PQ7A 1NUHA 2E0IA 3GNQA 4IV8A 3QBTA 2UVQA 3VU0A 1GPLA 5IARA 2REXB 1G19A 2BI4A 3LT5A 2HHAA 2WLSA 3H18A 4Q1FA 5AK5A 4F8JA 5LJLA 2IHYA 1MAVA 2OD7A 1HKHA 1ZVJA 1QHXA 4AZ0B 4K6HA 2YQZA 2D7CA 1PDWA 1VYHA 3AH8A 4JY7A 4AC9A 1XCOA 2G36A 3ZIAD 3C16C 1C9KA 1T36B 2FR8A 3NWBA 3LGAA 2VNKA 4TMWA 5L53A 4QTYA 4TS4A 3OQNA 5G0UA 1KHHA 3A1EA 4E1VA 1JFTA 1C7QA 3EVNA 2PSJA 4UXJA 2FXVA 1WNTA 2EZ4A 1TCAA 2CB9A 2FFAA 3U3XA 4JMLA 5LZ4A 3VV2A 4U9IS 1UANA 2CNWD 3NM4A 4JJZA 4B3GA 3PXEA 1EUCB 1ZC3A 3TTUA 2AZ4A 3HYRA 1WCIA 2GERA 3RJMA 1DRWA 1BSVA 2OLKA 2ZBDA 3PNVA 4Z1MD 3T1VA 2XODA 4ON9A 3K1ZA 3DFUA 1Q21A 1HL7A 3G59A 3WJAA 3QE4A 2I2BA 2ID4A 1YR2A 4AZ3B 3H8VA 5H81A 1V41E 3REFA 1B43A 1XZFA 2LIPA 4BE7B 4LEIA 2DBQA 1Z39A 5M7EA 1G8HA 3S2EA 1V3UA 4ZOEA 2ZETA 4BVKA 5J43A 4D9JA 2HOQA 1VE1A 5E1MA 4L2IB 5J40A 4MWEA 2R4UA 3ZS9A 4I6GA 5IS2A 3A1DA 4K9DA 5DGTA 4XWGA 1NOJA 2OBMA 4DEVA 1ABEA 4L22A 1VFNA 4KUEA 3KOMA 3PQ5A 2GLTA 3TX6A 5B1YA 2XVZA 5FBWB 4OI1A 2RGDA 3EGDA 1O6FA 3WLTA 3AM4A 1DTSA 4CG0A 3L07A 3LY9A 5J2UB 3UO8B 2QSYA 2IYOA 4B45A 1Z5WA 3LRTA 4B5KA 3K94A 1Z73A 1XA4A 2ANCA 2R5FA 3OIFA 2HQOA 4IIBA 4KGVA 3SSOA 2G8NA 3TPCA 4N6NA 4PE5B 3QENA 5CA0F 1N8NA 1I3MA 4I8IA 2ZRBA 4HVAA 4YMIA 2CF6A 1IG0A 1OXMA 1B6TA 3ZKWA 5LZ5A 1XQYA 3OE7A 4W1PA 5CFQA 4OLAA 1GD1O 2VTDA 4CCWA 1UXIA 4JKIA 1W36D 3JZAA 3O2QB 1O0CA 4NMLA 1ICEA 2QF7A 5KOJA 1JILA 3DZ8A 1SB9A 1XXHA 3KZNA 1CFZA 3VSEA 7AT1A 4UNIA 4MVCA 4J0FA 5E7QA 3JWIA 4P98A 1DARA 4ND7A 3BXZA 1T24A 3G0OA 2CKMA 5HBRA 4UHFA 4YI5A 2IH4A 4EUKA 4K6FA 2H6EA 4QPPA 5DBFA 1OILA 3LSYA 2BMVA 3WAKA 4F5WA 4CEJB 4RZHA 4X1KB 1U04A 4HFJA 1U7OA 2WD9A 2AKYA 4HDSA 5CPFA 3AXTA 5F5LA 4TV8A 3EXHA 1VFPA 3A6LA 4Y6SA 1T2FA 2AF3C 2ZG6A 1X14A 1PCXA 5AJXA 5GJVC 1NJSA 3DTVD 4M1EA 4Q9IA 5K0NA 1KRWA 3SJCA 4DSUA 2Q6IA 3G2KA 1FTGA 2V4ZA 2BE7A 1W76A 4BC1A 2CNLA 2HCFA 1UBOS 3H2KA 4HTFA 2AFIB 3OIGA 2XTZA 2FMFA 1S2GA 4L15A 3LBFA 3L1HA 2ZB4A 2ICAA 2D0IA 1YDWA 3SHTA 4TS1A 5AVUA 5CEJA 3L49A 4FFVA 1QFJA 4QVKA 3FRJA 3OLQA 2GJAA 3UAOA 1TTHA 5EPEA 3GLUA 1GPBA 4RF2A 3GUYA 4YT8A 2VDWA 3BDVA 3LO8A 5EMMA 2R86A 1G16A 2FQXA 3A1TA 3I9FA 4KSYA 3DMTA 4AJHA 1C3OA 5KQSA 1XN1A 4YN3A 2HW8A 2JLVA 1SIUA 1R18A 3JARA 1EVIA 1SUCA 1Z0KA 1G7RA 4LGMA 3JAKA 2HSWA 2IW3A 1CY7A 3CNLA 1EA5A 3SC2A 3VDRA 5H0IA 3LPCA 3VPFA 3MHTA 2BELA 1JJAA 4Q7LA 1A9OA 2R6GA 1JQLB 1HDEA 3NBFA 4GPIB 2XQKA 5EVCA 3AEQA 2IFTA 2QUJA 4BMYA 1P73A 4AS1A 4Z0HO 4Z4FA 4F60A 3B1ZA 2X6RA 3A2KA 3ND7A 4Z7QB 4X93A 4KIWA 2WD7B 1JDUA 2FSSA 4UE3S 3GLGB 2VP0A 2VQ6A 2G80A 1VPTA 3IRVA 1UK8A 4UMDA 1Q91A 3HBAA 4PGFA 5HOEA 4RMJA 4LOLA 3I6QA 5DYTA 4AZWA 2IHVA 4D74A 4B4UA 4IXDA 3NHYA 3TBHA 3DOUA 4H08A 5JVDA 5A7FA 4LOAA 5KHLB 1WDWB 3L04A 2HU7A 4R8RA 2ONZA 2ZU6A 5BQPA 2CFCA 1D9XA 4K9KA 3CVXA 4KN6A 3UK0A 3UMCA 1QRTA 2XUHA 3HCDA 1A1VA 1QNFA 1HUQA 2GN0A 1IDN1 3Q9NA 2CVOA 1NTRA 1Y4DE 3H4TA 4QDZA 5K0CA 5KNBA 4PLVA 5NLLA 2JLUA 2RAUA 2DH6A 3D54D 4DM7A 4EGSA 1BA2A 1BWSA 3DYIA 2J0UA 1CUJA 2NT4A 3QM1A 1RLJA 1DELA 1U2QA 2Q9UA 3I5MA 4U02A 5JRZA 3AM1A 2AQKA 5TS2A 1JHAA 5D5QA 2VDNB 3SXJA 1RHKA 2CXSA 2OZPA 2Z9BA 3CFYA 5IYZB 4MV0A 4P4SB 2QMZA 2CEKA 1MC4A 2R1UA 2QM8A 4PAMA 5T7BA 1Z0SA 1FUEA 4XGRA 1B0AA 4W7HA 4ZEWA 4H7IA 4U2FA 1YJBA 4QYWA 2VHYA 2YXLA 3C3CA 1YDMA 3VM6A 1N5RA 5C37A 5KEIA 1PR1A 4PVDA 4DE5A 2VJYA 3IL2A 1OX5A 3E5NA 2WRZA 4NMXB 1GV0A 4QPZA 2IHUA 3KJZA 4O4HB 3TNYA 2C4TA 2CSUA 3IQHX 4NYMR 4D3XA 3I9KA 5HILA 2Z5FA 2NU6B 1LVHA 1AZTA 2VRWA 3N39C 4KV7A 5B1DA 2I0FA 1VLVA 3N2ZB 4GLFA 4UNPA 3ZWOA 4O2BB 4IP0A 1XNRB 2DPHA 4HNRA 5LBTA 3RREA 4EB8A 4UTVA 1MB2A 1ZRHA 2NIPA 3M6AA 5I5GA 4B40A 1XWFA 1AUPA 2ORWA 3FG9A 1KEVA 1OC2A 3I09A 4AKGA 3C4VA 2AL7A 2BSAA 2NMVA 3E61A 4Q05A 5JTUA 3TD2A 3CSUA 2KHZA 4EHIA 3ISTA 3K7EA 4GI1A 5DHAA 3T54A 3SE7A 3E03A 4LNHA 2H5EA 3A0UA 3BMQA 3BPSA 3M0EA 1W5SA 4QUKA 2DWOA 1K2WA 4BVHA 3LC2O 4Z0PA 2B78A 2VJAA 3TQRA 4ZVSA 4RVDA 2HJVA 4UEKA 3K1JA 3QTBA 5KNBH 5KHAA 2I2WA 5CRIA 1VB3A 1Q1AA 5L7WA 1HFWA 4X1IA 4OYRA 4XSVA 1AHHA 1SULA 1Z28A 4ZJYA 1NW4A 2AC2A 2EJCA 2CXXA 2A84A 2ZJBA 3QHQA 5FX2A 2QTGA 2J45A 2CDNA 5HFAA 4FNOA 1WZ2A 3U5ZB 1PVDA 3K31A 1DKUA 1KFBB 2FN3A 3UK1A 2J67A 3HCWA 4OHMA 2O8CA 4KR9A 4YASA 1SC3A 1PR6A 2EG9A 1R6UA 2ZSHA 1BWRA 1MUUA 1V7QA 4IG9A 3GP8A 1F51E 1I9CA 3AINA 4QNNA 2P90A 2C8KA 4MDEA 1C9YA 1Q1EA 1R16A 2FWMX 4WOJA 1N1DA 5D51S 1L5QA 5AFSA 3HDJA 2FUNB 1O6CA 1DOAA 3DTTA 1JQDA 4WXMA 3ASUA 1B41A 4TTRA 5I9NA 3CU5A 1PKXA 1RAIA 5GVRA 4MUFA 5K3AA 2OHOA 3RU9A 3VKFA 2HMVA 1MDBA 2FPWA 2RBEA 2AWNA 1V47A 2IY7A 1WIWA 3JQAD 2AMVA 1B26A 3ADDA 5CXSA 5LD2C 2GVDC 5I7SA 4B4OA 2YFHA 3N8NA 2SCUB 2BGRA 1I4LD 2DBZA 1T0IA 2IF0A 4EB3A 2XDAA 4WMLA 4EL5A 5HHTA 3FOBA 4FI3F 3MWFA 5JDCC 1PQUA 3VR5H 2IPAB 3TTXA 3T3MB 3UB3A 4UU8A 4G5HA 4D80A 2L69A 3H5NA 2EG5A 1QYWA 1DTWB 3GAMA 2NUTA 2J3MA 1UKZA 1CIJA 2ZJYA 2D7DA 4JYMA 3KJEA 2V9CA 2G5GX 2YZNA 4JI4B 2YZMA 2PNJA 1Q50A 1DIBA 4J7AA 2ZTVA 4KQHA 4LWZA 3C8UA 1CJKC 5CDUA 1CF9A 5A5FA 4HQNA 1XFDA 1AQUA 2AA3A 3JQFA 4R2LA 4IH4A 5TF0A 2NXNA 4B3DA 1A69A 3NPMA 3RC1A 1NSYA 4FWIB 4MA0A 4XUCA 1A9XA 2P2YA 3DLCA 3FOFC 2CJYA 2UKDA 1IEWA 1UOOA 1OWPA 4MPJA 2P65A 3OLVA 3S0JA 5B2EA 1QUFA 2BW0A 2HSZA 3JQBC 5D6OA 1JPJA 2ONCA 3EXEA 4B8YA 2GK3A 3AI7A 1FS5A 4O3MA 2FP4A 4J94A 1VKJA 2QL5A 4IEFB 1HF3A 4H6XA 4Q16A 1BZYA 3QVJA 4XCXA 4ZJUA 3RC2A 1PK7A 3ILVA 3VZDA 4CL0A 1QFMA 1M72A 3FD8A 1EZZA 3LT4A 1SCAA 2VDKB 1CUCA 1SVSA 2I29A 1P1FA 1X1BA 1BMTA 3DEKA 3E48A 3ZXXA 2YBEA 4R2WA 2P7IA 5EIHA 4LYHA 2GN1A 2GM9A 3IDQA 5TGDA 2H92A 2Q45A 1PS9A 4TT3A 1HLPA 4WACA 3OSZA 1KEZA 3TWOA 3AR3A 4IVQA 5KWVA 4UCWA 1KI8A 3W5AA 2DAPA 2JVIA 4JT9A 3T99A 3BC1A 5K0ZA 3FCXA 4FEYA 1BC5A 2WUDA 3O94A 3OPXA 1SXJA 4FIZA 4N9WA 4Q4HA 1JSXA 4D5GA 2TRSB 1MX5A 2PCJA 1NP6A 2XUZA 4PHGA 4BO1A 4XJTA 3T1HB 3WO0A 4MRMB 4DR4B 1ZCZA 3GLHE 3HY4A 3S40A 2IZ6A 1KP2A 4O4JA 2DMRA 4R6WA 2EW8A 1HYBA 2FLVA 1TMGE 3G0CA 1HFKA 1D2EA 1WLSA 5IC6A 4F3KA 1EUYA 4ZWNA 3F46A 1M33A 3I04M 2BGTA 1R4NB 1ZW1A 3G7UA 3K20A 1M1UA 3QBJA 2ZE7A 1C8KA 3CVJA 2I8AA 1YQTA 2QNRA 1AKRA 3DVRX 4JP3A 1PNVA 3EFBA 1G9TA 1I3KA 4D6PA 3RRFA 2FN4A 3B20A 2WUWE 3CZCA 4CCSA 5E6RA 5JC8A 1K92A 2C5HA 2V65A 2W6PA 2H7VA 1T43A 1SWWA 2WQ6A 4BATA 3RU3A 4RXMA 3PFFA 4B09A 1UL1X 1XHLA 2ZUFA 1JEQB 2O7NA 3Q7RA 1E6MA 2C61A 3FUVA 2VZ9A 4DV1B 2RGAA 4PYRA 2R7AA 2EJTA 4KQ6A 2P2NA 1PJ4A 3WIBA 1TT7A 1C7ZA 1MTOA 1T0UA 2CK3A 2VDLB 3PQDA 2PRZA 4KXFB 2WWYA 1W0CA 2CXTA 8AT1A 4I4TF 2J6IA 1WB5A 1Z6XA 1OHHD 1BX1A 2B21A 3BSSA 1DCFA 1L5MA 1NQVA 2Z2XA 3KT0A 2BM0A 4U0KA 3SLRA 3O8RA 5K8CA 3L0PA 1PGPA 1Z17A 4M54A 5K8VA 2C4MA 2UXDB 2XMQA 2KLBA 3AFOA 3L0ZA 1A4RA 2AR0A 2PLRA 4V0KA 4XPIB 4CODB 5JYDA 1CEEA 2WPNA 2I6FA 3N2NA 1OPXA 3AF3A 3Q4GA 3O03A 2ETVA 2I4RA 2J5QA 2JGDA 2QZ9A 3AF6A 2J3HA 2CHGA 1DIHA 2GFQA 4WGFA 3K5PA 4Y6LA 4D02A 5J2TF 2FG7C 3A2MA 1BHSA 5A6SA 5ALJA 1N57A 4PIVA 5IK2D 3C3AA 3K0CA 1OYOA 4M1QA 1YVRA 2XRZA 1G1MA 2CD9A 3NX4A 4GYKA 4LGYA 5DHQA 4R31A 2E9SA 2DPGA 3KQUA 3U1TA 2JJQA 1T2CA 2XOEA 1PBNA 2Q6OA 3T5TA 5K3OA 5D6NA 3T7EA 2QP9X 3A9TA 5FRDA 2QI9F 4Y0VA 3AVOA 1ZD1A 1P17A 2SKEA 1GUDA 1E62A 2RIPA 4GM1A 2PK3A 1YA8A 4TMXA 3A3OA 2YMLA 3MOGA 3F7MA 3GN1A 4GP9A 1L5GB 3FOEC 2GYWA 2AXEA 2I9PA 5CB0A 3R24A 4H27A 3T7AA 1YRBA 5ALDA 3RYFB 3PKJA 1J99A 2VZ8A 2JJ1A 2OKGA 3CJQA 5DYWA 2ABWA 3UK2A 5REQB 1M8GA 2ZWAA 3FH0A 2OWDA 5CVVA 2RGXA 5LUBA 5JTTA 1D2CA 3G2NA 4XIYA 3EGOA 3MJ4A 4G8JA 2X0JA 4H1WA 1O7JA 3IHKA 3AVQA 1MAAA 2QXUA 2XB2A 3W1EA 2O0MA 1ATIA 1XRRA 4MR7A 3VUEA 1W36B 3T3NA 1E6CA 1XLTA 3FI9A 2FN8A 4U2EA 1SBZA 1WKCA 3K0EA 5DE3A 5AVKA 3Q7QA 3SSMA 2OUKA 3D4NA 3WLJA 1Z0JA 2GN6A 4Y9UA 3E3MA 2XLCA 2VO1A 5DBOA 5TQ0B 3G5AA 3EGIA 3NM5A 1QQ6A 2KI5A 2ZVJA 3LC1O 4Q6BA 1G7CA 3FNFA 1Y1KE 2EV9A 4RK0A 1BFUA 4EVSA 3W8NA 2VT6A 3B2QA 1QNLA 1R0WA 3WGYA 1FFGA 5B3AA 1GRQA 5KYVA 3TIVA 2H57A 3QLUA 3TAXA 5CJPA 4CMIA 5EE0A 4IKOA 1T2AA 1Z36A 3VU1A 3FVWA 3A6HA 4DLPA 4ZJZA 4ASUA 2IK8A 4WOCA 1NV8A 2GBFA 3D9QX 1HK7A 1WU7A 3K5IA 3D81A 4N8DA 3D6MA 3EUFA 4IWNA 3GROA 3L0OA 4J0HA 3RS3A 2FLWA 2VP9A 4CYMA 2ZWVA 2NAFA 4LK2A 4KPGA 1BIFA 3NGMA 2W2TA 4IW3B 1QG4A 2X9GA 3CRNA 1KQ3A 5CX1B 3EC2A 1U4OA 3USCS 3HKBA 4EUNA 3OE1A 3GEGA 4MR9B 2IXEA 2FPRA 4CPDA 3KR2A 2ZB8A 2EQBA 1T5OA 2WTXA 3TJZA 1H8EA 4BFWA 1FRZA 1HZJA 1UKEA 1UINA 2JIPA 5DLQC 5A2QA 2Y1OA 5LMCA 5LP6F 4E13A 1TIPA 2X23A 3IAM6 3WQBA 1R9JA 4PSAA 1EK5A 2QRVA 1XZMA 2ADOA 2POQX 4PO1A 1T0HB 3L6EA 5HIIA 3HCRA 2PPLA 1F0PA 2W6JD 5AJUA 5JWHA 4AECA 2G76A 2C9DA 2O6LA 3IHLA 5HDBB 3M83A 2J5XA 2R47A 3U56A 3GGCA 4R1QA 3AY0A 1IJEA 3DE2X 4N01A 1AKWA 1T2DA 4N6OA 4X95A 1A9SA 4Y2VA 3HYTA 1I4WA 3DC7A 2TMDA 3PNMA 3UGTA 1PFUA 4TYQA 4D0RA 4K6MA 1TM2A 1ZGCA 4BGDA 3M81A 3LH5A 4TTPA 5CB6A 1GT6A 1LTHR 2QJTA 3OOSA 4PW0A 4FS8A 4KFRA 2G4CA 4UHBA 2O8FA 3F6YA 1O4VA 3HVHA 3G8DA 3MS4A 2BSXA 1R64A 3LZDA 4UMEA 2ZSFA 3QX8A 2A0XA 2HJWA 1FF9A 2F3RA 2BMAA 1YRHA 3M4JA 3DNFA 1OLUB 1UBUS 3I53A 4IYJA 2TECE 2Z4SA 3O26A 2DGDA 1BGWA 2CHFA 1JQ3A 2P4EA 1Z8FA 3OFND 1VL6A 4P35A 5BYJA 3WL6A 4XWKA 4ABTA 2AEFA 4UUPA 2L82A 4BRWA 3P9CA 5E1BA 1TE2A 3EOBI 4GEGA 1AKYA 3GQBA 3IMFA 4NOMA 1T25A 1XSEA 1FYDA 2HCRA 2IP1A 2L19A 4A0GA 5KTTA 1XPJA 4B7XA 2IEIA 3OOJA 2FW8A 1GTG1 5T67A 2G63A 1LRKA 2JC3A 3IBYA 3CNOA 3M5WA 2FETA 3JYNA 3K72B 3MTEA 2OB2A 1CYDA 3DDWA 4XJVA 4GBGA 4X8MA 1G1AA 2FWPA 3WS7A 5UKDA 1WB4A 4NBUA 5B7NA 1I7SB 2FH5B 1T1RA 4AIIA 4MRRA 1YR3A 1I5EA 3MBKA 3ZWAA 1EWRA 1RE0A 4I9GA 4LC1A 5FOSA 1DP4A 3T5AA 1ELOA 2XCLA 4ZV9A 4DR3B 2I76A 4CIWA 2JIMA 1RC8A 4DXAA 4IFIA 1RKBA 4RMNA 4NQZA 4WKGA 5FTWA 4GE0A 2WTUA 2C9MA 1EFVA 3IEIA 2IU4A 1J23A 3OZDA 4B8WA 3HNPA 5CVEA 1V26A 1XU4A 1MH9A 5I4IA 4PO8A 3VR4D 1S4MA 3EVFA 2OXEA 1VP3A 4Z9BA 5F1KA 1Y5MA 1Q3KA 3DCJA 2OFWA 4WKNA 4IDQA 2VJOA 2VQ3A 2E85A 2VF8A 1M76A 2XR1A 3BX1A 2XA1A 3N0TA 1SRRA 1V1MA 4P33A 2I8CA 4LXTA 2NNWB 5DNEA 1B76A 2VHJA 5LXTF 1FSZA 1JT9A 5ECDA 1YE5A 2PVCA 1ZJZA 4ZK2A 1UJNA 3HYLA 3NASA 4DJ5X 4WJLA 1W36C 2GCEA 2VHZA 3KVRA 5B3LA 1QQAA 1O89A 2W83A 1SUAA 4KW7A 2DT8A 2J30A 1KMMA 1IEQA 1WP9A 4L8WB 4ENSA 5DHRA 2JGLA 3RVOA 1IWBB 1LB1B 1NM5C 3S2YA 1CYEA 3PHGA 3X1DA 3EXIB 3FVRA 3FYUC 3P52A 4M9UA 3K15A 3NGLA 4PQFA 4RHEA 1KEWA 2ZK7A 1FYFA 1YMUA 1R0CA 2QUIA 4I9NA 3ZEIA 1W52X 4I3FA 4WNCA 2G9RA 1GNQA 3ZGZA 3QG5A 4AJJA 1NYQA 4CUKA 2VF2A 3GYGA 5BYAA 1FIUA 1AK1A 4PWYA 4YJ2F 2CLMB 2QSJA 3JD1A 3L6RA 4UZEA 4EM6A 1P7VA 4M0KA 3SXPA 2IGBA 4MMZB 1IZ8A 1P2BA 2QTTA 4LXIA 3NOXA 1YQXA 1FBTA 3K0HA 4O5AA 1PD0A 1E92A 2UUOA 4J3JA 3U44B 3RS2A 4GKJB 2QB5A 4ND2A 2FQYA 2I03A 3CR3C 1V3TA 4N0EA 4P3PA 3DR5A 4LI3X 5DHFA 5DM1A 1FTWA 2OV1A 3CJRA 4UHJA 3HJHA 1E2GA 1HG0A 2V7PA 1E6KA 3JYOA 3ZDDA 4MS3A 3BJIC 3I92A 2B8JA 2CJPA 4RHFA 3NH9A 1CUDA 4IXNA 4MV9A 1P33A 4WDQA 4H17A 3THYA 4LJ7A 4PY2A 2XMSA 4NXNB 5B7QA 1PR3A 1L7QA 4FB5A 2J3KA 1NBHA 4HEA6 3N53A 2H0AA 1TCBA 1PT6A 3KOZA 3TPZA 3W05A 3QMWA 4UCFA 1CCWA 4PTLA 5A0TA 4BNXA 1Q83A 1FYXA 3NHPA 5A3RA 2RARA 1K9VF 1BKSB 5AVJA 4WY8A 3LY5A 5B36A 4H16A 1HE3A 3K70B 3RYHB 2QLTA 4AI6A 1I2ZA 1NXSA 3G79A 3K6KA 3NG1A 4V3BA 1CRPA 1G3UA 1X9IA 3FSJX 4YYZA 4L6CA 1X80B 1U3TA 3K0AA 4PZYA 4KHZA 2AE1A 5GOTA 3GJRA 2FYTA 2JGJA 4JGIA 1ZIPA 1PR9A 2QTHA 3HXMA 3ENVA 3PGKA 4PSKA 3LT0A 1V96A 2EFCB 2QMQA 1T35A 2QR3A 1MPXA 2IDJA 5DN6D 2AQHA 4WESA 2FUG1 5AJTA 3T38A 5EE1A 5GIPE 1IQUA 3K8ZA 4PV7A 4U9HS 1ZM3A 1DAEA 2ZIWB 1JLHA 3HN6A 3UHOA 4JL6A 1UBLS 3KQWA 4FYVA 5C2JB 1WHSB 4LDQA 4HNAA 5IWAB 2ZLBA 4PO3X 1M2NA 1YBMA 3CN7A 4P36A 4KYVA 2W2NA 3RTGA 2V7BA 4Q3NA 4BV3A 1O0BA 1A72A 3DPSA 4AY5A 4DCSA 1N9ZA 1O03A 1TQ6A 3EG9A 4A6DA 4AY6A 5FUXA 3TLBA 1DWPA 3GAZA 4JJEA 5ALUA 4NS4A 3W2GA 4CKYA 2PV7A 4YBZA 2XDQA 2CBZA 3KV3O 4MLPA 3DQPA 3UHAA 4XX0B 3KLMX 4NE7A 1AA9A 5JAHA 1P0QA 1IJBA 3EEFA 2EKLA 2A1UA 2NSDA 4Z8XA 5FIUA 2QLNA 4NHEA 3WLOA 5BN4A 1IZYA 1QJ4A 2I5PO 3OP4A 1XVAA 3UXHA 2ESRA 2ZREA 4UM9B 1C30A 3FHOA 2CNOA 4HDMA 2FX3A 4RTNA 3WLIA 2CMHA 3T12A 3QG1A 2B1IA 3KEOA 3VNQA 4JITA 5E4FA 4YRSA 3PLAE 3EIUA 3LDFA 2PGJA 1X86B 3GEIA 3DAOA 5CT8A 5JSZA 3CEHA 4YAKA 2AFVA 1RBYA 3ZGOA 4D4LA 1LJ8A 1JI0A 1WUHS 1XNGA 4C4TA 2D4HA 2WKQA 4OJTA 3ZR4B 3D31A 2WWHA 1RCUA 5JEEA 4MCAA 3OUUA 1CC1S 4OHBA 4RC9A 4GPTA 1Q1QA 2BWJA 1ZMTA 3AJEA 4DF3A 4U63A 3EOZA 4Q24A 3N8DA 1VG9B 4MPPA 1JYSA 1Q7BA 1SCUA 1U8XX 4MO9A 3LECA 4RJLA 4UQOA 3VBEA 3V6LA 3CLSC 4C6HA 3F7NA 3JALA 4WEQA 3LX6A 3KKPA 4PHHA 4WASA 3J81k 4NAVA 5KX5F 4ZO4A 1OI3A 1DBVO 3WQSB 1D6NA 2Y3IA 4OGGA 5ENZA 1C29B 1P0MA 3FROA 5J4VA 5KTKA 2AD1A 4HLUA 3TX2A 1B0ZA 2H8GA 1QIHA 1MO3A 2MT9A 4V3CA 1Z82A 3X1XA 3HBFA 4Q1VA 3LHKA 3MQ4A 4B6JA 5KNCA 1ABBA 5IDWA 1L1FA 4KBYA 4KKXB 4Y1RB 5JFGA 4JLDA 3QEMB 2EP8A 1ONBA 1T9HA 2GF0A 2Q4DA 3UV3A 4EY3A 3UFXB 4ZZ0A 5K20A 2J4DA 3PC6A 3KOUA 4HCJA 4B2IA 4GGOA 1ZN9A 3QP9A 2RI1A 2BMDA 4M9XA 3R7BA 4FIDA 4HQ6A 3S2UA 3MFYA 4LZNA 3RJ5A 3LQKA 2CMFA 5AW7A 1FLAA 2WHPA 1N5DA 4RY0A 2AKAB 4OB8A 3DR3A 2QAGB 4Q4JB 2P3LA 4RV4A 4JBGA 5EZQA 2QQGA 2ASVA 1UOQA 2VH1A 3HCOA 2RE8A 4CHTA 4PQYA 3UAWA 4KQ2A 2YC2C 2YV2A 1XDBA 1U6KA 2BC9A 1EWQA 1XMVA 1PTJC 3LLSA 4NIMA 1GGJA 3OQIA 5CG2A 5KDLA 1QCZA 1ZH8A 4Q0MA 4EMBA 1DJMA 4W7SA 4C9BA 5AWFC 1UPTA 5JO0A 1MQ9A 1H8HD 3O8BA 4K9NA 3AHHA 2C3MA 5K3FB 2JD0A 4X94A 5T4HA 3HL0A 3A27A 4V0LA 1G20B 3M49A 3B6EA 3RRXA 1K0UA 4DLZA 3N58A 3ML1A 3IAS1 2G0TA 2Y0PA 3FSGA 5EIAA 3ZLBA 4B76A 3EJ6A 3OEEA 5F21A 4BB9A 5JALA 3UH0A 1RAAA 3TINA 2PIDA 4BNWA 4CCAA 1S5PA 1UJ2A 4ZYZA 5GADl 5HF6A 4NRDA 1N0WA 4D3FA 1T9DA 3BG5A 5J5CA 4JMPA 3WJ7A 2PGXA 2JEYA 4LJKA 4YWHA 1XZDA 3BL6A 1YHYA 1BMDA 1II8A 2YJ6A 3IEKA 2YVQA 2GYVA 3IRUA 1VZ2A 2XVMA 1VE9A 1GRCA 1WUIS 2WOOA 1HWYA 3PR3A 4OY3A 5EJ7A 3UMJA 5K0BA 3BDIA 5KVVA 5EAIA 3J81A 1KPIA 3Q7IA 4Y2PA 3PDWA 5C8YF 4HLCA 1Z9BA 2J08A 1NU8A 5DXFA 4GKKB 1QDEA 1N2ZA 4V1CB 1VL8A 4LHSA 4E5PA 1J06A 4POAA 3EQ2A 4GE3A 1YUMA 3FDXA 2GJ8A 3NTRA 4Q3CA 4YO7A 5P8WA 4YCNA 3F6PA 1IFXA 1UT5A 4JQSA 3QLJA 4UBMA 4X71A 2X9NA 5DMHA 3W8EA 4IJKA 3IJEB 2UYOA 2V7QA 3AP1A 3MWYW 4TT8A 4AS3A 2BAGA 4MPTA 3RVRA 1GZSA 4X00A 2YMQA 4BKUA 5BR7A 4BWVA 2FPIB 4TM7A 4CQMB 4UVHA 3CE9A 4F84A 2V9ZA 4D5EA 1JDZA 2ZDQA 4NJMB 2HMTA 5B53A 2WICA 1SXPA 1C3VA 1K97A 1K6MA 1ZR4A 2V3WA 4AMGA 4B3RB 2EF0A 5LZ9A 2W43A 2X0EA 2FX5A 4XIIA 1YQ9A 2BGMA 2JFZA 2BISA 1KFCB 1YU6A 2O2YA 4ESEA 3TLKA 1G8FA 4MLCA 1N2XA 1Z62A 1OKKD 1L7VC 2J7PA 3BEOA 4IVPA 5BURA 1WF3A 5CB4B 3S1SA 1LFAA 4XW2A 2JGAA 4U8GA 1NBEA 3N2GB 3SG0A 3USZA 4YR9A 3O7MA 4EL0A 4JWKA 4FOPA 5JU6A 1L7PA 1JU4A 1TW3A 2P27A 4YXWA 3HLYA 3A2NA 2ONYA 4OQPA 3RVLA 3K8OE 1O9HA 3LCUA 1GRNA 4GZLA 1SCIA 5HJ7A 4J7CA 3VPGA 1N2CE 3THRA 2P6MA 2QSZA 821PA 3I4FA 1GLVA 5GONB 2W2LA 4DZZA 4PZ9A 1E7QA 3WNCA 4FGJA 2X4DA 3GRCA 3CF0A 3ICQB 3UOWA 1LJUA 1EWVA 3LK6A 2AMJA 4HZGA 3RRJA 1K3UB 4S35A 3QLVA 1EDDA 4CMKA 4MRSA 2A5DA 3Q2KA 2Z3ZA 4ZGWA 1H2YA 4Q4LA 4OQFA 4CV2A 3OIYA 2Y8EA 4FDAA 2QTMA 2WR8A 1QRRA 2FPKA 1Z56C 3CHYA 4QARA 5ALFA 3NHFA 2JF0A 1KWKA 2FOLA 1TAUA 2ZYRA 4BBJA 1ICIA 2J3JA 4HFRA 2IA5A 1S9HA 1U8CB 4GAEA 5FBQB 1RZ3A 1F5NA 2JJ8A 1L4GA 4BAUA 2BEWA 2R25B 3ENNA 1GCUA 1YR8A 1NRIA 4EI9A 3LDAA 4LJRA 2E18A 1T9CA 4MUAA 4XWTA 5T6MA 3SAJA 3ER9A 2RKOA 2PJZA 3GP3A 4B6PA 2Q3EA 3NMUF 4ADSG 4MRNA 4P5DA 4BMSA 1SXGA 2EJUA 4HS9A 1IM8A 1GU0A 1SQ5A 5B2ZA 2C2HA 3HUDA 1M67A 1OX6A 2XGGA 1RWNA 3FGOA 5L3ZA 3V1LA 5IBRA 4GI5A 2CMGA 3OBBA 1TX4B 4RYLA 2DR0A 4E5YA 4C7MA 2CLDX 1QQTA 1TA0A 1VJ1A 1JFLA 3CUEF 3WI7A 3RHTA 2OMEA 2V7VA 3PEYA 2AN4A 5FI3A 4WOBA 1OB5A 1W46A 1ODJA 1P9NA 2VF5X 1USIA 3IDSA 3NT5A 4BO0A 4YAJA 4EB6B 1L8QA 1VBKA 3DMPA 2MR5A 5AI9A 2X5JO 3EEYA 3N8GA 2F1RA 3WO1A 5AK6A 4ARZB 4E70A 4CMHA 4JI1B 2HRBA 3NBXX 5A04A 1LSUA 4P86A 4E2WA 3ACCA 1GAEO 4O2LA 3UJPA 3P2IA 1M10A 1LRLA 4P6VF 3ZWDA 1TO2E 4X60A 3ROFA 2WZDA 3N86A 3ZNOA 4RGBA 3KFVA 2YRWA 1LLUA 5KOHA 1DRJA 1W34A 1KJWA 1XRQA 2A86A 2CXPA 4IHJB 3CZRA 3HL4A 4NH0A 5FYDA 1W6RA 8LDHA 3OETA 5JHGB 4UUMA 1I14A 6ADHA 1Z25A 4V0OA 4LRWA 5E7JA 1L5HB 4M1WA 5AVZA 1RC1A 1QHGA 1AC5A 3RADC 2D6FA 2XECA 4Y2JA 4V24A 2PXHA 4IDFA 4G1FA 5BN5A 5HKBA 4Z4IA 1SR8A 4CU2A 1IJKA 1I1QB 2ODWA 2ZSEA 3EPRA 3KOOA 1YB7A 1E94E 1UEXC 2JIZD 4LJ9A 1J90A 1L5OA 1TQDA 3G9TA 4R0VA 2Z8YA 4FNGA 4WXEA 4Y6QA 1PP4A 2HWWA 4L02A 1E9DA 4D79A 5JCOC 3TG2A 5IRCD 4X6YA 4ZAFA 5FNVB 2IKQA 2O1SA 5BNWA 4JUAA 3HUEA 4KVAA 3KQMA 1L7OA 1NNEA 2O8BB 4LZLA 4I19A 2ZTMA 4FHZA 4R3UC 4BJHB 1NSTA 4ZCPA 1L4UA 5COBA 5JQGB 1FLVA 4KIUA 3T5PA 3DBLB 1C1DB 4DLUA 3TQIA 3W5VA 1J2EA 2X0FA 4ZCIA 3M9WA 3RUHA 4HJRA 1AT1A 2P2LA 2CBGA 2PR7A 1LDBA 3DULA 2WJ6A 1BFKA 3PIDA 4HGOA 4AJIA 3KJQA 4GXTA 3IEXA 4FMDF 1IHUA 2CDRA 3CKYA 3THWB 4F9FA 2X76A 3AF0A 4N03A 4JT8A 3NUZA 4TUYB 1NUPA 3AVXA 1M8PA 1CUIA 1PVOA 4LY6A 1NVBA 3WXMA 3WZMA 1MR3F 2CDCA 1GNLA 5GY7A 1XQ6A 3P2EA 2IXTA 1VP9A 3CF4G 3GU3A 4JCCA 5LQKA 1JL3A 1MU0A 3HE3A 5FWAA 4E03A 2IXGA 1HMYA 2Y1EA 1BH6A 3MT9A 4FFBB 1VKNA 4NCAA 1V0JA 4URXR 3LKBA 5C5DA 5MN6A 2Q0XA 3L7BA 4TL8A 1EFPB 1Q0RA 1CB7A 3T3PB 5CDSA 2NSYA 2OGTA 3PQ6A 4P93A 4ZIRA 3MEQA 2B4QA 4LFAB 4TQAA 5EQJB 2IE0A 5LQCA 4AMYA 5FA5A 2MMCA 3G8YA 2C99A 1XMPA 3QELA 2RBKA 3UOAB 2I2FA 4DIEA 4H3KB 1K5DA 4M0UA 4HL6A 2BFCB 2EQ5A 1EE2A 1YRAA 5KC9A 3IEVA 5B6PA 2GTHA 1Z8HA 4GI2A 4D9GA 1XKLA 4R2KA 4YRIA 3DOJA 4KXMA 5WRFA 3BWCA 3ZU6A 2WA1A 3MWEB 1QZ3A 1CPYA 2BGIA 2ZAIA 4U2GA 5DNDA 5CNJA 3UNXA 4RHCA 5T5QA 1DG9A 5CCEA 4QNMA 3HYCA 4IJVA 3UAYA 2O5RA 4ZXFA 2GKSA 4KP7A 5A06A 1I2AA 1KO7A 5C32A 1Z6ZA 1SQFA 4HWPA 1CVIA 1JWAB 1IIRA 2XGOA 2PX4A 4MGHA 4JP1A 5AVSA 1CFJA 1Z4MA 1TGYA 3VBCA 5ICEA 4MWBA 1ODCA 4E1BA 4M7OA 1ZIYA 2OV4A 3CY6A 3W6NA 4YCSA 4YCLA 4UDOA 1DBQA 4DB4A 4LF8B 1RLUA 2WVJA 4M38A 1M2OA 2NYUA 3ZLTA 4EHNA 1J09A 1Z33A 3DTNA 5B58T 3U4DA 1E1NA 1XKQA 4P5PA 2CCKA 4H0CA 1UXJA 4JBWA 4M83A 4TKUB 3VR2D 4QLBA 1ZK0A 3BIOA 4ZHSA 1HX7A 1NQUA 4KGDA 1TYCA 1HDGO 1UODA 3BMNA 3Q5DA 2NZJA 1Y9ZA 1YACA 1H2RS 4NBSA 4RFSA 5AM5A 1EMDA 1DLJA 3BSWA 2QQFA 3PJRA 1N3BA 4V2UA 1T5HX 5FUVA 3WWEA 4F72A 2OORA 3C0KA 3IJ5A 3LQYA 3U7QB 4B17A 4JYCA 1T5LA 2O6HA 3BUSA 4L51A 3RD5A 4CBVA 4EJSC 1OZFA 3FXAA 3C3EA 1U3CA 1YB5A 2VNSA 4JVMA 1BXGA 4G2TA 3GOQA 2REQA 4KBGA 2X8AA 1ILWA 3G5UA 4N49A 4R2HA 1CLUA 1NN0A 2GZSA 4KQ1A 4M60A 3ZV5A 1ZR2A 1NR5A 1TLTA 3D0RA 1JXMA 4IR7A 3A6PC 1KYYA 2CZQA 3AEKB 2NLOA 4GZ3A 4XFKA 4OFWA 4LMAA 5JDIC 4DR7B 3AP3A 5JJBA 3HJBA 2HGZA 4CL3A 4L5YA 3WY9A 2I62A 3ORSA 5M04A 3U3RA 5ECYA 4EH1A 4DQUA 1XU7A 3MB5A 1ZGAA 1QP4A 4LF4B 1TCUA 1X3SA 5EJFA 4YS6A 3ZBUA 1LZLA 3GLIB 1ZCJA 1NNSA 1Z6PA 4M1ZA 3R3SA 1T9BA 2IBSA 1OXKB 1UWCA 1XEAA 2KJQA 3FIJA 2RH8A 1YKFA 3T5DA 4R1NA 4UASA 1YUBA 1JLKA 3ISJA 4TV9A 1U4SA 4UFOA 1XEFA 3NWJA 4F1KA 3AVUA 1V71A 1LNSA 5BW6B 3MJHA 3R3XA 4Q3AA 3H1GA 3UT0A 4QM6A 1GZ7A 1G7SA 2Z2ZA 1X7DA 3IP1A 1S1CA 5DCUA 4BVFA 4EECA 4KXNA 2EQAA 4JEIA 3IUJA 1WS6A 2EJVA 4ETMA 1AKNA 4XRGA 1Q3TA