3JQAD

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor 2-amino-1,9-dihydro-6h-purine-6-thione (dx4)
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
247
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Oxidoreductase
molecule keywords Pteridine reductase 1
total genus 91
structure length 247
sequence length 267
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jqaD00
3W4JA 1DC5A 1ARZA 5FI3A 1TT7A 3I5MA 4NZ9A 1D1SA 1MB4A 3M1AA 1R15A 4J9UE 5CPBA 4WNIA 1KEUA 1R0KA 3VDQA 4IDDA 4OOFA 3U3XA 1U9JA 2HJSA 1E5QA 1I24A 3PTZA 2BGKA 2EEZA 1WW8A 4XIYA 1HTBA 3FSRA 4FIZA 3CE6A 3MCVA 4Z0PA 1AHHA 3VH3A 3IUSA 1PS9A 3LLVA 1P44A 3QWFA 4U8GA 1TT5A 1BW9A 3H8VA 1N1EA 4M54A 4BNKA 5LDHA 1GV1A 3RQSA 4Q39A 3TOXA 4YT2A 4IQGA 4TZKA 1E5LA 2OFPA 2A9FA 1J4AA 2WE7A 3NDRA 3TL3A 4BS9A 3BTSA 4W4TA 2ZQYA 5ICSA 3GEDA 2B69A 3H9QA 3E9QA 4NJMA 4RO0A 1Y8QA 3EDMA 4DBVO 3D3WA 4WCDA 1E3LA 2DLDA 3IKTA 1LC0A 1B8VA 1R6DA 1EK6A 1LDGA 1V3VA 3VZRA 2HUNA 3HFSA 5BSFA 3H2SA 3T4EA 3GVCA 3UCEA 4BO2A 2DBVO 2IODA 3FWZA 4D7AA 2D0IA 2PGLA 2B35A 2AG5A 4MVJP 3SBOA 3QW2A 3F1KA 1KY5A 2BH9A 4IJKA 4NU5A 1UDBA 3AM4A 1NWCA 4PG6A 5TLSA 2GF2A 4D46A 1F0YA 5COBA 3F5QA 3D3WB 1CDOA 4IS2A 3NT2A 5IFLA 2W2LD 4Y6SA 2CF5A 2HJRA 2YJZA 4W7HA 3IAHA 4U0KA 3NJ4A 2TMGA 1HF3A 4K6CA 4PG8A 1GTMA 5JPIA 1R37A 3VC7A 3ZNPA 1W8DA 2J3IA 3BHMA 2NVWA 4NDNE 1QYXA 1XR3A 3ROQA 3EZYA 2Q1WA 3DMYA 1RM3A 3HQ4O 1B3BA 5L9AA 3GGGA 4J90A 4CM9A 1JN0A 3OP4A 2FSVA 5DCYA 1XQ6A 4RLHA 4F6CA 3K92A 3H9UA 4ND2A 5C7LO 2QZ9A 4CV3A 1LLUA 2PZLA 5I9NA 4BNWA 4XWYA 3ZW9A 4FGWA 2FOIA 4RVGA 1KVTA 4XQEA 2CF6A 3E5MA 1E7YA 4Y6RA 4YBZA 2E6UX 4W82A 5J23A 5THQA 2VWQA 3CZRA 1TEHA 1Z7BA 3WJAA 1SEVA 2C82A 2IE0A 2BGMA 4NH4A 2GLXA 4DREA 5ADHA 4ILKA 4B4VA 4WE3A 5TSDA 1U4SA 5DCWA 5ER9A 4WLOA 2QRJA 5TNXA 4NPCA 1PJ3A 1NYTA 3BAZA 2Z1NA 3U4DA 1HSOA 3U0BA 4CV2A 3MOGA 3ENNA 5B1YA 5C3MA 4PZDA 2P9EA 1QV7A 3OFSA 4WPGA 2IDZA 1HLPA 3GF4A 4OH1A 1ENYA 3H6KA 4R51A 1NXQA 1G0OA 2NTNA 5A3VA 2G1UA 2O3SA 2WE8A 3L07A 1I01A 1I2BA 1GAEO 1ADFA 4RVHA 1PZHA 3NRCA 1SEPA 4KOAA 4XR9A 1PWXA 4GQAA 3DAFA 4O63O 1VJ0A 4FJ1A 3GRPA 2H1SA 1P0CA 2LDBA 3HFGA 3PXXA 2AQKA 2YYYA 1DC6A 3E5RA 3FBTA 3M2PA 5A05A 4WUVA 4HNGA 4YJGA 5L40A 1YL6A 4J7CA 2ZIZA 2VUTA 4KDFA 4YAIA 2QG4A 1BGVA 3ROKA 4W9NC 5JY6A 2WYVA 6ADHA 1NPDA 1T25A 1Y8RB 4E2ZA 2PD6A 4NQZA 3WFJA 4A03A 3GRKA 3L6DA 3I23A 1TI7A 1FDSA 2R6JA 1UZLA 2PZJA 3PIIA 4G65A 4N18A 3ONDA 4L75A 3D1LA 1Y5MA 4UUMA 3LC1O 3GAFA 1V9LA 5BNFA 3L4SO 4CMEC 4YAGA 2CVQA 3AJRA 4CPDA 5L4NA 4E12A 1NQ5A 4RCVA 1G6KA 4ZICA 3QVWA 4NFSA 4CM4B 1UZMA 4OOEA 3QWBA 3WYBA 4KWHA 2PH3A 5DP1A 5BSGA 5IJZA 4QT0A 2VHVA 1GCOA 4J0EA 5MDHA 2EXXA 3L9WA 7ADHA 3HN2A 2FHSA 4ALKA 3IS3A 3WQQA 2SCUA 4AJIA 2I9PA 3TF5A 4RZHA 1A4UA 1T2EA 1EFLA 3JQCA 1FDTA 1FMCA 1Q0LA 3AUSA 3MZ0A 2JAHA 5EL0A 1WDKA 1ZK1A 3FR8A 3JD2A 3DDNA 1C0PA 1HDGO 1LNQA 4GVLA 3ZU3A 2A92A 4CM5A 4IJVA 1V6AA 4YACA 1BTOA 3U09A 3AI1A 3VZPA 1WDLA 3DZIA 5JCJA 3KOUA 3RWBA 1N5DA 1QRRA 1XWFA 1NHWA 3H9GA 1GYQA 1LRJA 5BNIA 5KVQA 1GYRA 5T57A 1PS8A 4BIIA 2NVUA 4D42A 4Z6KA 5U9CA 2O50A 1GADO 1ENZA 5G4KB 3VH2A 4ID9A 4CODB 5A02A 1PJBA 1U2DA 2DTDA 1ZMOA 1JAYA 3FTPA 4ZRNA 3RUIA 5LDGA 4ZHSA 1GQQA 1WMBA 1M67A 1YQDA 4DMLA 2IZ0A 1PGPA 3MOIA 1ZJZA 3UICA 3F5SA 3IJRA 5B4VA 1DPGA 1UXHA 4TRMA 4BL5A 3LT4A 4CJXA 4DL9A 1BMDA 2JFGA 2X0NA 4BO9A 3ANMA 4DQUA 4FR5A 5TT1A 4L0QA 1IYZA 3LC2O 1DC4A 1IULA 2QYSA 3JQAD 4E0BA 2PNFA 1O5IA 3A4VA 1NHGA 1AXEA 3HWRA 5JCXA 2Q46A 1E3IA 1PQUA 4ESOA 1ISJA 2CVOA 3GMDA 3KRTA 3PRJA 3B1KA 4GWGA 1DDOA 2Q1TA 3SC4A 4NFYA 4MVJE 1LI4A 4LRSB 2HSDA 3WGOA 4FOSA 1UXJA 1W73A 2P4HX 1ISHA 4CLOA 3U4HA 5B4UA 3OJLA 1HDRA 3O8QB 1LXCA 3F6YA 4CQMB 1E3SA 1DC3A 2HMSA 3DFZA 2H6EA 4Q3CA 2EW8A 4CMIA 8ADHA 1PR3A 3RVDA 2D5CA 4DQXA 1XELA 3KSUA 3V8BA 3K30A 3E1KA 1V3TA 3OHSX 4EGFA 1AE1A 2BLLA 1GUFA 3T7CA 2VQ3A 1RYEA 1E77A 3OEYA 1U8FO 2C20A 4BKQA 3KLMX 5TC4A 2GDZA 3WGTA 4G5HA 1K3TA 2ZTUA 2FR0A 3JQGB 2WD8A 3FTNA 4PCVA 4LCJA 3VPXA 1IPEA 1T1SA 3ZU4A 3D7LA 5DDIP 2GSDA 3PYLA 5EMHA 3QWHA 2HO5A 2FZWA 3FHLA 1CETA 3HJAA 4HNHA 4XQCA 4BGIA 1YO6A 3RUAA 1U4OA 1ADCA 2VWPA 4OHUA 4XDZA 2J3HA 1NFFA 1YB1A 3WYCA 3W4KA 1DIAA 1WLYA 1YE3A 2W2LA 3WB9A 3CH6A 4HBGA 5KJ6A 3I9MA 4BB5A 4CLRB 3S2GA 3MWEB 2ZTLA 4YRBA 2IEBA 3HADA 2ZQZA 2AA3A 4Q3NA 1E3JA 1UZNA 1B2LA 2GRAA 3JYOA 3S8MA 4YR9A 3DMTC 4XYLA 4RF4A 4CLDA 1ZO8A 5JO0A 1WP4A 2ILTA 4M86A 3WX0A 3OA2A 1EFKA 3V2UA 2BMAA 1P31A 4TRRA 3G79A 4IDGA 4LVCA 4QX6A 4RQUA 2QHXA 4CM9D 2CSUA 4YRAA 1E6EA 3SLKA 1YOVB 4LSWA 1YJQA 1HE5A 1GPJA 4PG7A 1BXKA 1SB8A 3B70A 3LU1A 3O26A 4HV4A 4BGVA 4N54A 1ISIA 3O9ZA 3RUFA 3WGIA 4JBGA 5JDCA 1BXGB 4MO2A 3I9NA 3D4NA 3JD3A 3BTOA 4GWKA 3JQ9A 3NGXA 3U9LA 2VTDA 2I67A 2YHIB 1LLDA 3ZHBA 4QO8A 4LN1A 3DMTA 1E7SA 5A9SA 1ULUA 1T26A 4IUYA 2IRWA 1MUUA 1ZK0A 5BR7A 2A4KA 3H7AA 2JL1A 5I7VA 2OBNA 4BNVA 1JVBA 2O3UA 3FPCA 5T8KA 2VTEA 1CRWG 1OMOA 1PJ2A 2YFHA 3RROA 3F4LA 1LUAA 4IGFA 1GY8A 1E1NA 4BKOA 5CDGA 4I5FA 4TKMA 3G1TA 3RBVA 3HG7A 5HRUA 1JAXA 4CMBA 1VSUA 3OIFA 2NSDA 4OSPA 1ZXLA 5ENVA 3QVTA 1R66A 1D7OA 3V2HA 5EQFA 3JQ9C 1E7WA 1FDUA 3GDGA 2D2IA 3PHLA 3RUCA 1I2CA 4QQRA 3CMCO 4L8VA 5CPFA 4GMFA 2GZ2A 5L4SA 1QKIA 1Z74A 3B6ZA 5DULA 4DRYA 4OXKA 2H9IA 2IYOA 2J5RA 2B5VA 5JXWA 5G0TA 3WTCA 1CYDA 2WM3A 4IDAA 5TQVA 1HKUA 3BMNB 3UCFA 5DOVA 3PJDA 4MVJF 2J6IA 4K6FA 1B3RA 3FNFA 2GYYA 3F46A 3GT0A 4JLWA 4E13A 2W8ZA 3QP9A 5JYEA 4ZD6A 3P7MA 4RPJA 2EGHA 1GUZA 2BFPA 4AJLA 2FP4A 3QA9A 1SC6A 3UW3A 4AJPA 1LSSA 1DIRA 4B8WA 1U3WA 1NQAO 1YVEI 3QLJA 4N5NA 4M1QA 4WGGA 4WOKA 3RUDA 3WS7A 2NVUB 1NVMB 1RYDA 2PKQO 3WBBA 1DIHA 2X0JA 3CMMA 2BFOA 2NTJA 2YV2A 4A0SA 4BO3A 1HETA 1GZ6A 4CMJA 2DFVA 3RJ5A 1NX6A 1DHTA 1PL6A 2UYYA 5IN5A 2YQ5A 4B3HA 1YDEA 2AQHA 1JVSA 1SOWA 5F5NA 3U5TA 1VKOA 1XIVA 5A1TA 2C7GA 3DBLB 3T7EA 3EZLA 1LSOA 2AQ8A 3D0OA 2Q50A 2AEFA 4MKZA 3SVTA 2EP7A 4BO6A 5T8KC 4AJ2A 3AK4A 2HMVA 3JD0A 2HKIA 3AU9A 3ZNQA 3R0IA 1ZKMA 5JCJD 4KMSA 4WLNA 3F47A 4GI2A 2E48A 1Y7TA 5DCUA 3JQ6A 1P33A 3ZU2A 4INAA 4CM1A 1P9LA 3Q2IA 5KJCA 4BB6A 3MWDB 3T4XA 1CERA 3KSDO 4W9NA 5JO9A 3PZBA 4NMHA 4NHEA 4UREA 3C1OA 1I32A 3F4BA 3TRIA 4JK3A 2AEJA 4BO5A 5IDYA 4II3A 4FSHA 4N5MA 4R1UA 1XGKA 5I7EA 1FF9A 3KO8A 1KETA 4Y98A 3ST7A 2HLPA 1H9BA 1LSJA 1PEDA 4ROSA 1OZAA 2OUIA 1JU9A 1VL6A 4B4OA 1S6YA 1GFSA 2PY6A 2YDXA 2DU8A 2PLAA 1DRWA 3RC1A 3WG9A 3CIFA 2DBZA 3FPLA 4FGSA 4HFMA 1TT5B 2JD1A 3PDJA 1UP6A 4DVJA 1ONNA 3TL2A 2B36A 1BW9B 1HDCA 1ZSVA 4ZQEA 3GUYA 3G49A 2C29D 1B7GO 5COAA 4BNTA 4LSMA 4J43A 2O3RA 1YGYA 5I8ZA 3JV7A 4D43A 4HFRA 2XAAA 3GGOA 4N5LA 2D5AA 1HYEA 3D5QA 2WTBA 2OGUA 1UAYA 1XA0A 3PPIA 3WXBA 3FN4A 4XB1A 1NFRA 2Q99A 3JYLA 1HZJA 3C24A 5IN4A 3PQDA 3PWZA 3RU9A 1ZIDA 3ZV6A 4RQTA 4PLFA 1ONOA 3CINA 3L4BA 2BFAA 1KVSA 1ZSYA 5KKAA 2ZB8A 2GR9A 5DNAA 3RBZA 4FD3A 5FYDA 2HQ1A 1C14A 4GLLA 1X1EA 1QMGA 3GEMA 3ROPA 1OC2A 5KOIA 1GV0A 3INGA 1UXIA 4KUEA 4BKPA 3S2IA 4YCAA 9LDBA 2EG9A 4YPOA 5BSHA 1C3VA 4RPKA 4E6PA 3CSDA 4AJKA 3GFGA 4JP3A 2IXAA 3UCXA 5G0WA 2X0RA 3W4IA 4KTVE 2AEMA 4UEKA 8LDHA 4PLVA 1CIVA 2V6GA 1NPYA 1NQOA 1ZMTA 3ZWMA 1Y1PA 1W0CA 3RC7A 3U49A 2YUTA 3E6AA 1SAYA 4GKVA 4WNCA 3I52A 1ZUD1 3ZWPA 4YAKA 3Q9NA 1E92A 1BVUA 5KVVA 2HMWA 2WD7A 5KVSA 3Q0EA 1X0VA 5GZ1A 1YQGA 4UVIA 4E2YA 4DLAA 1R0LA 3PEFA 4P38A 2CVZA 1CQIA 3L6EA 3BYZA 4GMGA 4IY1A 1ADGA 3OJ0A 1I3NA 3CTMA 3I6QA 3JQAB 3W8DA 1H93A 4M87A 4R1NA 1ZBQA 1ISMA 5K0ZA 1X15A 1NVGA 4PIVA 1BDMA 3ASVA 3OM9A 2BF7A 3I4CA 1NTOA 3LVFO 4C7KA 4QO7A 4DC1A 1JWBB 1X7GA 2QZZA 3DAPA 3DZJA 2NVBA 4MIEA 2Y0DA 1SOVA 3ORFA 3JD4A 3GDOA 2Q4BA 2V65A 3TSCA 2X23A 3UXYA 2OL4A 3C85A 5ITWA 4Y9DA 4O1MA 4QUKA 1ENPA 3P2YA 4JX8A 3P19A 5HWSA 3C8MA 1A9ZA 1MC4A 4E2XA 1Q0QA 2Q2WA 5FFFA 3HDJA 4BMVA 5EINA 3RKRA 4JCOA 1X0XA 4UVDA 1N9GA 4WEOA 4KQWA 3QV1A 3GY0A 1A71A 3RBXA 2POQX 1YB4A 2FWMX 1NPTO 1IHXA 3HE3A 4PLCA 1B14A 2DAPA 1KBZA 4YJGB 1KY4A 2BELA 1LU9A 1U3VA 3Q11A 1PSDA 4J7UA 1NQTA 3K6JA 4E5PA 3QSGA 3ZDFA 4PLYA 2EERA 3B1FA 2D4AA 3GNTA 5JDIA 1O89A 2Z1MA 4GPD1 1GZ4A 5KWEA 3AFMA 3HHPA 3R1IA 4JP2A 1CJCA 1JLLA 1HSZA 4KQXA 4L76A 4CLEA 3NT4A 1CQJA 2OXIA 3E18A 3DO5A 1BXGA 4LMPA 1YBVA 1F17A 3QY9A 5H82A 1YL5A 2O3QA 4Q9NA 1PGNA 4CMHA 2PZMA 3LK7A 3GDFA 4GLOA 4J1QA 5AYVA 5IDWA 2CMDA 2HMTA 4L9RA 4QTZA 4BKUA 4BO7A 4BUCA 4A2CA 3V5NA 1V3UA 5G4LA 5CDSA 3KYDB 4M49A 4WLUA 5F5LA 2G5CA 1C0IA 3TNLA 1PGJA 4JBHA 4FC6A 3IQDB 3KB6A 1JKIA 1KVUA 2P5UA 3BMCB 4DPLA 5HS4A 2B0JA 3PHIA 4IQ8A 4E21A 1ISGA 3K96A 3NTQA 1HL3A 4R3NA 5IZCA 5JDIC 3LZ6A 2UAGA 1EEHA 4YB8A 4FFMA 2H63A 1ZNQO 4E5KA 1YKFA 1OFGA 1O94A 1SMKA 1H6DA 2GN4A 2UVDA 4XYEA 4E5NA 5C37A 2JD2A 4H15A 4FFNA 4NBVA 3EHEA 3UFXA 4HXYA 1R0SA 4XKJA 4ONEA 4AJHA 5IZ4A 3I1JA 2CDAA 2JJYA 4BNNA 5CDYA 3DZHA 2UDPA 3U4IA 3MTGA 3SLGA 3JYQA 5K6AA 3GG9A 4QSMA 4DBZA 2X1HA 5EIOA 5DOZA 1IY8A 3CZMA 4I5EA 4LK3A 4AJJA 5A5FA 3BMCA 5CAEA 1EUDA 1YS4A 4RDIA 2JFHA 4PLTA 3ZHZA 1IZ9A 4I9HA 3OF2A 4R5MA 1E6UA 4Y8VA 3JCZA 2GZ3A 3B20A 4BNIA 4MJLA 2GERA 4WK6A 2ZJ1A 3FF4A 4P8RA 1SBYA 3OJOA 2F00A 2NQ8A 3H2ZA 1D3AA 5G4KA 4AJNA 3D4OA 3RAJA 3PI7A 3ICCA 4TKLA 1EVIA 4A7PA 3ZHXA 4BGUA 4XX0A 3SJUA 3OBBA 1GPDG 4DLBA 3KZVA 3LYLA 1I3KA 1DIBA 2GCGA 4CMGA 1PQWA 3OJFA 3H9EO 4J2HA 1DFGA 3NGLA 4KDEA 2RHRA 3JQBC 2DTEA 1KVQA 3EW7A 3F1LA 1LEHA 1DFIA 2ZB3A 1B0AA 3GMSA 1MGOA 4YAEA 3RFVA 4E5MA 3JQDA 3DOCA 5JS6A 4D41A 4PZCA 3WGQA 1OI7A 3VOSA 4Z3KA 1EVYA 3BMQB 1M6HA 2I65A 2FPIA 3CUKA 2Q2VA 3K73O 3S55A 4MVJM 1KEWA 4CMAA 3ZWYA 1A72A 1FDVA 1ZJYA 2BFMA 3MTJA 4GX1A 3VPSA 3JQGA 1HE4A 4PLWA 3PVZA 1M6WA 4R69A 5JYDA 1QYWA 1R4NA 2FR8A 2HRZA 2WWRA 3OICA 2DBRA 1Z75A 1MA0A 3PQFA 1A27A 4XDYA 2C2XA 3B1JA 2ZK7A 1UUFA 2X5OA 1F06A 4YJHB 1ZVMA 3ZH2A 1SB9A 2I3GA 5B4TA 3I9JA 1PL8A 1F12A 3I9LA 2QIOA 1DHRA 3K5PA 4BO4A 4BNLA 5JMWA 1LQTA 1T1RA 3H5NA 4R54A 4BO0A 4LGVA 4WEQA 3D5TA 2EP5A 2PGJA 2EGGA 3INRA 1WWKA 4R9RA 3DXFA 1I10A 3HB4X 4XA8A 5AXAA 4OGWA 3TN7A 1UR5A 2GO1A 3GK3A 5CG2A 1R16A 2E82A 2YZ7A 1ZW1A 4BNZA 4MP3A 4AL4A 1JQBA 3PGXA 1EQUA 5KVCA 1XYGA 4TVBA 4BMNA 4CM6A 4YJHA 1PS0A 1LRLA 3AUTA 3DBVO 2ZCUA 4W99A 4DXHA 2PK3A 5L4LA 4MVJG 1QORA 1XU7A 1DO8A 4UVHA 2Y0EA 3ZU5A 3DZKA 4CR8A 1B15A 3RD5A 5JSFA 1GDHA 4W7IA 2B37A 2PD3A 1GZ3A 2YV1A 4BQPA 2A94A 4CM7A 4R1SA 4PRKA 3GGPA 2C5AA 3PLRA 4CLRA 3WMWA 5HM8A 1AN9A 2X5JO 1NR7A 1J0XO 4IMPA 2TMDA 3VVCA 1SCUA 4RL6A 5MGBA 3W6ZA 2PA3A 3E8XA 1V8BA 3QQPA 4XRGA 4JXKA 3DAGA 1LDEA 3HNPA 4D79A 1O0SA 4ALMA 2I99A 4K1LA 1Y6JA 5CDUA 3DTTA 1RPNA 3ZWWA 1LDMA 1ORRA 2I3AA 1E1LA 3HN7A 4YT4A 3STHA 1ADBA 4YXFA 2NU7A 2O3JA 2YHIA 4GSLA 2RIRA 2YY7A 4OKIA 4X54A 4E5YA 2YDYA 2VZ8A 3JQEA 4EUEA 1OAAA 1DEHA 1NM5A 2D8AA 3FNHA 2W4QA 1KEVA 4GAEA 4IS3A 1JDJA 2EHDA 3UUWA 3JQFC 5C5IA 1X14A 3MJSA 3IJPA 4KP7A 4NJOA 4EZBA 2I5PO 1LSUA 3LDHA 4DQVA 4P22A 5KTKA 4QXMA 2HRBA 4U6QA 2G76A 5F1KA 3JQ7A 3VHRA 3X2EA 3UVEA 3WSVA 4FDAA 4Q3BA 4W6ZA 1TA4A 3HZZA 4S1VA 2PKRA 3H3FA 1YH3A 2VHWA 3VVBA 1U7TA 3RI3A 2GZ1A 4F46A 3NTOA 2VZ9A 4J49A 2DFDA 4J3FA 4CUZA 4ZVVA 4ND5A 3WWZA 3NEPX 4DIFA 1MFPA 2YFQA 1N1GA 1U7HA 1DOHA 5ILOA 2B5WA 3K2EA 3L9XA 2P9GA 3FNEA 3C1AA 1QXSA 4FS3A 3RUEA 4UVEA 1N2SA 2DKNA 2NU9A 1KC3A 1MXFA 2PH5A 1IE3A 1PX0A 1XLTA 3GVIA 4OSOA 5EQDA 5U4QA 4CV1A 4FCCA 4OL9A 2WJPA 3GN1A 3DHEA 3KLPX 2O3TA 1MC5A 1QP8A 3PHJA 3E9NA 4EEXA 1E7QA 2X5KO 2AW5A 1R4MA 1W4ZA 2OHXA 4OM8A 3RJ9A 4BQRA 2P68A 2DPGA 1O95A 2QYTA 3VH4A 1NAIA 4I5DA 2AE2A 2VOEA 4BV9A 1N9GB 2Q45A 5CDTA 3DBLA 1RM0A 3IC5A 1D1TA 5HTOA 1YJ8A 2BI7A 2DM6A 4Q3DA 4PZEA 4BNJA 4OIMA 2O7SA 1FXSA 4EW6A 4IJWA 1VM6A 1Q0HA 2OP0A 4FJ0A 4CMEA 1GL3A 5BQFA 1DRVA 1MXHA 2YQ4A 4YVFA 2VYVD 1GQ2A 1YDWA 3D64A 1KS9A 3ADPA 5G0UA 4B79A 2B83A 4IZHA 4U6SA 1PTJA 5TF4A 1ISFA 3KSZO 5G2OA 1Y9AA 3HSKA 3WMXA 4AJOA 2PD4A 4Z9XA 3G3EA 3VH1A 4IPTA 2B4RO 1T2AA 4QFDA 4CV0A 3AWDA 3RUHA 2GGSA 4Y6PA 4FFLA 1NR1A 5JDCC 4BNXA 3QWAA 1WZIA 3PLNA 5BSEA 3QIVA 2RH8A 4CR6A 4YJDA 4F3YA 2O48X 4JIGA 3CXRA 1H6CA 3BHIA 4UEJA 1LRKA 4FW8A 2VWGA 3E82A 3AOEA 2C07A 2OP1A 2WYWA 5ILGA 3NX4A 3WR5A 4NNJA 1HLDA 3NT5A 3OETA 3ZV3A 2J3JA 1ONPA 2Y1CA 2B4TO 1LLCA 4CUJA 5L95A 2X22A 4BOYA 5G0SA 2VZ0A 2WMDA 3M1LA 1F14A 3NUGA 2JFFA 3GN2A 3LC7O 4XB2A 5T6BA 4MP6A 4GX5A 2CUKA 4S3MA 1I3MA 2AHRA 1YBMA 4B4WA 1VPDA 2B4QA 3UGKA 5BNTA 1H6BA 3VZQA 2G0TA 3M6IA 1HDOA 3QE3A 4NI5A 2NLOA 1SZJG 2ZKLA 3M2TA 3SC6A 3E03A 1BHSA 3PZRA 4HFJA 4BHTA 2QRKA 4IXWA 1CWUA 3AY6A 4TRJA 1YWGO 2O2SA 3F3SA 2GN8A 3A14A 1E7RA 4WLEA 1VLLA 1ZH8A 2J3KA 4XIJA 3WBFA 1B8PA 3TFOA 4O59O 5A9TA 4FN4A 2P4QA 1I3LA 3ZWVA 3IP1A 3BMOB 3JTMA 2ZTVA 3U62A 4CQMD 5FWNA 2GASA 3EVNA 5K6AC 3I83A 4RPHA 5CG1A 1QV6A 3LF1A 3OQ1A 1YQXA 5DT9A 1LC3A 4KWIA 4CMIB 1UH5A 3WFIA 3NDJA 1WNTA 2VT3A 3DHYA 4MVJH 4R5HA 4JN6B 4E33A 1BRMA 2Y1DA 3GHYA 2OO5A 3Q1LA 4RVFA 4UEOA 4DWVA 3UN1A 5DZSA 1P1KA 4A5OA 3ASUA 3OSUA 3ZWCA 1BDBA 3DZBA 4EEZA 5HS6A 3AM3A 4J4BA 4RF2A 4IGEA 4PVCA 3D4PA 4PLPA 4HFNA 1EQ2A 4XD2A 3DC2A 3UF0A 4IDEA 1PR9A 2X9GA 2X0IA 3W8FA 4G81A 3JQBA 1JTVA 4NK5A 4IIVA 1TLTA 4PG5A 1ZFNA 5AXDA 4CLXA 1UXKA 3A28A 2BRUA 5C7IO 4LW8A 5L51A 1I36A 3TZCA 3ZCXA 4ZJUA 1K6IA 1G1AA 2C54A 3R3JA 3AUAA 4WCFC 4AVYA 3WGZA 1J5PA 1K89A 4MKXA 1GQYA 1NAHA 3GVXA 2VNSA 2X86A 4GH5A 4IINA 4IIUA 4TVOA 1PJTA 3ANLA 3IUPA 4EJ6A 1HE2A 2Q1SA 4R41A 1Y8RA 1ZEJA 1E0DA 5I9LA 2PZKA 3H4VA 4BO8A 3AI2A 2Y67A 3JQAA 4ND4A 1UAGA 4JJFA 4F45A 1HDZA 3DBHB 2YHUA 2VYVA 3OIGA 5CP8A 2CY0A 1EDZA 3TZ6A 4FC7A 4EJMA 3BXXA 4HUJA 1ID1A 1X7DA 5A06A 3JYNA 1R4NB 1K0UA 1SNYA 4RGBA 4E31A 1V35A 5I9MA 5F3RA 2BHLA 2HMUA 4IM7A 5JE8A 4DC0A 4CM8A 3ONFA 4MINA 2CFCA 4XGIA 2O4UX 4LRTB 1YXMA 1KYQA 4J91A 4JQCA 2DC1A 4ND1A 4U0JA 2WSBA 3WQRA 3C3XA 1EBFA 4NFHA 1L1FA 2VYND 5JAQA 2F1KA 2XXJA 3VPFA 1GEGA 4WCFA 4Z9FA 3O8QA 4R3WA 1PZFA 4ZN6A 5IDXA 1Q7CA 3EYWA 1K6JA 3DOJA 4TQGA 1KC1A 3GHHA 2R2GA 5L45A 5GY7A 3ZWXA 1BG6A 1IZ0A 1Y81A 3KUXA 1SPXA 4RF5A 2WEKA 3NAQA 4RPLA 2XPCA 4O0LA 5TGDA 3DBHA 5A9RA 3GAZA 1MV8A 4CM3A 3TQHA 2HU2A 3C7AA 1JWAB 2I66A 1K2WA 3BIOA 5IAAA 1EK5A 3ZN2A 4RVDA 2HK8A 3IOYA 3DB2A 2OMEA 4L4XA 3WDSA 2FPPA 4YT5A 5JC8A 1HT0A 3ZGYA 3WGHA 4BV8A 1OBFO 1IHYA 3JQ8A 4LISA 4PRLA 2XOXA 5CHEA 4ALJA 1T4DA 2P91A 4BNUA 4AJ4A 1DB3A 3RASA 3CEAA 1QG6A 4IJUA 5AOVA 1DLIA 4N7RA 3JSAA 1E1MA 2DBQA 2J5KA 4PLHA 2NWQA 4OXYA 3AUUA 4WJZA 3COSA 3VPHA 1EUCA 3ZNNA 3TFQA 4Y67A 4D44A 3GEGA 1H2BA 3SXPA 2IEDA 3PJGA 4I1IA 4EITA 1VL8A 5A4DA 4PFJA 1GYPA 5JW6A 2PTGA 4OXNA 3LT1A 3I6IA 1H9AA 4HP8A 4MKRA 3SEFA 5ENDA 1T2DA 2UV8A 2NU6A 2R00A 2AE1A 4JNKA 4Q3AA 5EN4A 4R9SA 4R68A 4Z0HO 2FMUA 1XU9A 3X2FA 3ZI0A 4CR7A 2JD0A 1MP0A 2I76A 3G17A 3GVPA 4FQ8A 4DIBA 1P3DA 4PG4A 1CF2O 3EC7A 1VJ1A 1C1XA 1P1JA 1WPQA 1ZK3A 4QFCA 5ITVA 2D59A 5KIAA 4P4GA 3H5AA 1PQPA 1AXGA 2NADA 2VRCD 1L7DA 4TZTA 4Z9YA 3KTDA 3WJ7A 4H3VA 1BWSA 5DBFA 4CMKA 3ADOA 4NR0A 2RAFA 1EDOA 1XG5A 4P4LA 3RFXA 3VAZA 1PL7A 4YT8A 2PGDA 2PFGA 5JBIA 3DQPA 2ZCVA 2C2YA 2JAPA 4II2A 5IF3A 3I3OA 2RH4A 4J2OA 4YRDA 4ZGWA 3QVOA 4UUOA 3I9KA 2ET6A 4I08A 3U4CA 1I8TA 4E3ZA 2R00C 3MEQA 4KZPA 1CEQA 1LDBA 1MX3A 2CD9A 4M55A 4XGNA 1O9BA 5FF9A 4D45A 3ETDA 5JNLA 4YJFB 1XCBA 3NTRA 3KYBA 1Z7EA 2V7PA 1BXZA 5TX7A 2DUWA 4HWKA 5T64A 3PJFA 3PK0A 3FCOA 3QVSA 4D3FA 2A35A 4IDCA 4OKNA 1N7GA 3BMOA 2J8ZA 4JJIA 4RVSA 4NK4A 3LT0A 3Q9UA 4NIMA 3ROMA 2FRDA 5FEUA 3TDKA 1H6AA 1KIFA 2JHFA 4ND3A 3JD1A 4J9VA 3E48A 1AHIA 2HCTA 2QX7A 3VDRA 4B3IA 1PU2A 1QSGA 3DFUA 2HK9A 2YW9A 4KTTE 3ZWOA 2P9CA 5THKA 1PZEA 4O6VA 2JCVA 4R1TA 2PR2A 3ZZNA 3FD8A 4IDFA 2Y1GA 2CZCA 3WLEA 1WZEA 3LQFA 4XR4A 1A9YA 1VE9A 2HAEA 3HDYA 1J49A 2OZPA 4MVJA 4MPDA 3DHNA 5A3JA 4C4OA 1O8CA 1N8KA 4GGOA 5GZ6A 1H94A 1GU7A 1EMDA 3TZHA 3VPGA 4QECA 3AY3A 2OBYA 4EJ0A 3I4FA 3WYEA 3FI9A 1P1FA 2EW2A 3LF2A 5FI5A 2Y68A 5DBGA 4UVGA 1P77A 3G0OA 4WASA 5AXBA 3NV9A 4ZQHA 3VKVA 4OAQA 3VZSA 5H83A 2ZB4A 2VN8A 4GSKA 2PV7A 3TZQA 3GA0A 3ZNOA 4EI2A 4CQMA 3MJTA 3W8EA 5IZCC 4ZQBA 1AGNA 1EBUA 5ER6A 4IDBA 1QLHA 4K28A 4LMRA 1LTHR 1QR6A 3ZV4A 5IG2A 3FWNA 1QLJA 1W6UA 3DTYA 4GKBA 4A26A 4UAGA 4RDHA 3PFWO 3UKOA 1D8AA 4RPGA 3KV3O 3L6OO 5GZ3A 1LX6A 3GZNB 4PVDA 3BTVA 3VKUA 1RWBA 4FB5A 1XHLA 4YWJA 4WLVA 4CL3A 1L7EA 1RJWA 2FPGA 4ALIA 4TRNA 1XKQA 2WD7B 5DBIA 4RF3A 2XXBA 3DONA 1JKFA 4MIOA 3KEOA 4GX2A 4WCFB 2X4GA 1WDMA 3ETGA 1E3WA 4FJ2A 5TT0A 4IQ0A 3ZW8A 1DJQA 3EUWA 3O4RA 1IL0A 3A06A 2ZATA 1PJ4A 4M8SA 4XCVA 2GNAA 3QHAA 3H5RA 3INTA 4I9UA 3O38A 1Q7GA 3BZUA 2VT2A 2Z95A 1KERA 4GVXA 2Q3EA 1FDWA 1EUZA 5KJFA 1GD1O 3JQFA 4L4RA 2CNBA 3SJ7A 5AVOA 3S2EA 5K9ZA 2NQTA 1A5ZA 1HEUA 3F9IA 4XQ9A 4D3SA 2O4CA 3OH8A 2X6TA 2C59A 1E7MA 1Z45A 3DZGA 2BKAA 1Y9EA 4WKGA 5COQA 2P5YA 4EUHA 1YOVA 2IZZA 3JQ7B 1TB4A 2JHGA 3IMFA 1LJ8A 4HX5A 4R16A 3MJVA 4I9NA 5A9SB 4RV9A 2W98A 5L7TA 1ML3A 4L74A 3W1VA 3K8ZA 9LDTA 3WGYA 1H0KA 3ULKA 1E3WB 4MP8A 1PWZA 1NNUA 3Q2KA 3KBOA 4U7WA 1K5HA 2AQIA 4J4TA 1DIGA 2DQ4A 3N74A 4OQYA 5T5QA 1JA9A 2OORA 4OYRA 2ZTMA 3KEQA 3DEYX 4IMRA 3ZV5A 3ENKA 2EIHA 1PIWA 1NFQA 1E3EA 4RLSA 4JROA 3FBGA 2Y93A 1ZK2A 1XEAA 5EPOA 4ZU3A 4BNYA 2H5LA 1D4FA 4CM4A 3LSYA 4PLZA 3WGGA 2ZYAA 2DVMA 3CKYA 1PGOA 5HA5A 4NBUA 2X9NA 4FBGA 4DUPA 4BKRA 4D0RA 3Q6IA 2D1YA 5CEEA 2ZYGA 4MOWA 4DGSA 2V6BA 3IDSA 4J1TA 4NBTA 1E1KA 4CL8A 4TMFA 3HDQA 1QYDA 2GN9A 2YV3A 3NJ8A 3EMKA 4B7XA 3L77A 1P1HA 2C7VA 3R6DA 4O5OA 1JKJA 3ITDA 3VTZA 3FR7A 1LQUA 4L73A 3L0DA 4WOJA 1UP4A 4OQZA 5EJ2A 1M75A 4E30A 3OECA 3QJ5A 4PN3A 1U3UA 2VOJA 4XQGA 1R4MB 5JC1A 1I5RA 1I0ZA 3GVHA 4B4UA 3KETA 5TRTA 2QW8A 1ZSNA 1KEPA 4E4YA 3WIEA 3MJCA 1HXHA 3RFTA 3UOGA 2FZEA 3NKLA 1X1TA 1LBEA 6LDHA 1U5CA 3BMNA 5KCZA 4M89A 1WXDA 3ETEA 1EE9A 1C0LA 1T24A 2BD0A 1NP3A 1TXGA 3RC9A 4RZIA 3DBRB 5L7YA 1ULSA 4BNMA 3WQSB 3QRWA 5L3ZA 1I30A 3A9WA 2JKVA 4B8ZA 5B12A 1DRUA 2V6MA 3OQ6A 3JQ8B 4E2WA 3NDIA 2ZYDA 2AXQA 4FOOA 1GR0A 1A4IA 2E37A 2V6FA 4IXTA 3TOZA 4DPMA 4TWRA 3K9QO 2FSSA 1Q7BA 4CMCA 4YEDA 2G82A 1YRLA 4GBJA 3AOEC 2VRBA 2VRCA 1UJMA 3GOHA 2Y1OA 1MG0A 3BHJA 4NBRA 1J6UA 2AG8A 1C1DB 7MDHA 5KKCA 3CPSA 1ZXBA 3AI3A 3NYWA 5CEFA 2IZ1A 1EVZA 2EJWA 3V1YA 1BVRA 2Q1UA 1I2ZA 3AY7A 2LDXA 1DFHA 5JFOA 4NU6A 2WDZA 2FR1A 4CLOB 1P0FA 3PWSA 2EKQA 4QEDA 5I7FA 1Y8QB 1LDNA 4U5QA 4D3DA 1Q2XA 1WMAA 1ZZEA 4KUGA 4ZA2A 5A03A 4BNFA 1HWYA 3DBRA 3EGOA 2EWMA 1U3TA 2JCXA 4URFA 2GUGA 1O6ZA 1U8XX 3IP3A 4EBFA 1IUKA 4GL4A 4RVUA 1F8FA 3ITKA 1WVGA 3WNVA 4YDRA 5C7OO 5L53A 1VSVA 1B16A 1B26A 4A27A 3ZWAA 2NACA 4NG5A 4DTIA 4XJTA 4XEHA 2EJVA 2NUAA 2X58A 1EZ4A 1S7CA 4YAJA 2BGLA 1U2GA 4MVJI 4Q3EA 4R4JA 1YONA 1VRWA 1KOLA 2DT5A 1P1RA 2EF1A 2RBEA 4NJMB 3R3SA 4YYZA 4DA9A 4HKTA 3WNQA 4J0FA 3KM0A 4TROA 1DAPA 1E6WA 3PHHA 5JAMA 4ZQFA 1VC2A 2VWHA 5U1PA 3FNGA 4EUFA 3GPDG 3D3EA 1A7KA 3H65A 2J5QA 2X9VA 1ZEMA 1C1DA 1P74A 1R12A 3ON5A 2Y05A 4YTEA 4F6LA 1FK8A 2PWZA 2Q49A 4PGFA 4D0SA 3W6UA 2JCYA 3DOOA 2W90A 3GPIA 1IPFA 4YQZA 4OJNA 4ZRMA 4HY3A 3GZNA 5IXYA 4JGBA 3DZFA 3ZHYA 1ENOA 5ICMA 1Q1NA 3WSWA 2CDBA 2WYUA 4MIYA 4FPXA 2E4AA 3VTFA 1F8GA 1NASA 3FRJA 1Z6ZA 3DWFA 1VKNA 3ICPA 3PIDA 3PFFA 1MFZA 1UP7A 1DAOA 2VHYA 4XJSA 4YJFA 2EV9A 4B3JA 2IYPA 3ONEA 4J6FA 1T4BA 3PGJA 2FY8A 1AUPA 3IIEA 3WICA 3AFNA 1VL0A 3OEWA 5CEJA 1QYCA 1V0JA 3H3JA 1Z82A 3WTBA 3PYXA 5BT9A 3V2GA 4DYDA 1PJQA 2X7HA 5LC1A 3SX2A 4J4HA 5JAZA 1B8UA 5TS3A 3GNSA 4AJEA 4R01A 3O03A 3QVXA 2Y66A 3HUDA 1GUYA 4GX0A 2CDCA 2XF8A 3C7CB 1YB5A 1VI2A 5DP2A 4UUPA 3AW9A 5JY1A 2NTVA 1FJHA 1DSSG 4XYBA 1GEEA 1DXYA 3N7UA 4ITUA 1OOEA 1MLDA 1XDWA 2Q2QA 2NU8A 4CM8B 1UXGA 4BVAA 5F1OA 4Z0TA 2I6TA 4ALLA 2GN6A 3DL2A 1LA2A 2GPTA 4GGPA 2O2YA 3KVOA 3ZWBA 1NBOA 3N58A 3KYDA 1Y5RA 2FN7A 1DJNA 4Z3DA 2O23A 5KJEA 5LCXA 4IZIA 4AFNA 4HADA 2C0CA 5HBRA 3BA1A 4L4SA 2VHZA 5I8WA 1IB6A 1U28A 5TJ9A 2Y1EA 1HDYA 1SO8A 3QWIA 3PQEA 3TJRA 4YQYA 1PJLA 4B7CA 4DPKA 3RCBA 3AOGA 1HRDA 3BTUA 3LT2A 4E32A 4OO3A 3JYPA 4FFOA 5JAIA 3TPCA 3GQVA 4XYGA 4AJ1A 5KJ1A 3KYCB 1EVJA 5AQ1A 4TSKA 1U1IA 4MDHA 4DIOA 3GG2A 1N7HA 4OMUA 5T67A 5B37A 4BMSA 1ZK4A 4EDFA 1M76A 2VYNA 2PKQP 3AM5A 4UULA 2RCYA 3GNQA 1DLJA 2AMFA 4B7UA 1PGQA 1RM4A 3EAGA 3PHGA 5IXSA 1K6XA 3S2FA 1M66A 4JJGA 4KUHA 3GLQA 3KYCA 4DMMA 1KVRA 4XZ3A 5I7SA 2Y0CA 1HZZA 2QQ5A 2VNAA 4A10A 2W2KA 3TZKA 4P4NA 5EERA 3UH1A 4RJTA 2DTXA 3HDHA 3GR6A 4NBWA 1C0KA 1PZGA 3RU7A 2DPHA 1XSEA 1JW9B 5TJHA 3WIDA 1LLQA 2NM0A 3OMLA 2G17A 2UUPA 4AICA 3KXDA 3OA0A 3PP8A 5ES3A 4ALNA 2RHCA 3PDUA 5IDQA 1A7AA 1Z73A 2EKLA 3G1UA 4J7XA 4C7JA 3LLSA 1X13A 4J16A 4BNHA 4I8XA 3C7DB 2EKPA 5DN9A 3Q3CA 1P45A 2HK7A 3P2OA 3BMQA 2IXBA 4FFPA 3WWYA 2Z5LA 1DBVO 4MVJD 2W2KB 1M2WA 1LDYA 5EESA 4BGEA 5A5EA 4JBIA 3OIDA 3ZWNA 3EK2A 4BO1A 1IOLA 1N92A 5DF1A 4ZQGA 1QYVA 3GC6A 4WLFA 4J1NA 3P5SA 5TIIA 2VUSA 3MJEA 3L4BC 1T2FA 3A1NA 2ZB7A 1ZCJA 4CLHA 3UHAA 3PJEA 3S1LA 2Q4EA 2GD1O 3HB5X 4H7PA 4FFRA 1P1IA 4LVUA 3DR3A 5JMPA 2BI8A 4XGKA 3TWOA 4CUKA 4CQLB 1X7HA 3I9OA 1HDXA 1YL7A 3IL2A 2P2SA 3K31A 4IBOA 3WOHA 2VUUA 1RM5A 3K2BA 5F1PA 1PJCA 3C1TA 3H9JA 1T2CA 3OQBA 3WLFA 1MG5A 1UDAA 3E9MA 3V1TC 5AXCA 1OC4A 3EY4A 4AG3A 2DUUA 4LCEA 4WECA 3PWKA 1WAMA 2E49A 4H16A 3IKVA 3KHUA 5G0VA 2Y1FA 4DYVA 1NVTA 2QRLA 1H2HA 3GZ4A 2HDHA 2UUOA 1HE3A 1H5QA 3ANNA 5A04A 2VHXA 4UUNA 2NNLD 4K26A 5JLAA 1HYHA 4PLGA 4G2NA 3OJEA 3AU8A 1U5AA 4YA6A 1PJSA 2ZJ0A 5KNLA 4EYEA 3RKUA 1UDCA 3RC2A 1G0NA 1EE2A 1YBAA 1VJTA 3MJ4A 2O7QA 2D3TA 3V1UA 4J1SA 4CQLA 3UAGA 3ABIA 3GH3A 4XYMA 2VCYA 3EVTA 2X8LA 5F21A 1BSVA 4K9DA 3GUCA 4I5GA 3GFBA 5H81A 1C1XB 3PYMA 4A73A 1RKXA 3RSHA 1TVEA 2OOSA 2Y99A 2NV6A 4XRRA 4DLLA 1GCUA 1HYGA 1NWHA 1I33A 5L7WA 1XQ1A 4RORA 4BNGA 3RIHA 5CFZA 5GMOA 2C5EA
chains in the Genus database with same CATH superfamily
2FR8C 4WZZA 2C3UA 3ZCPA 4RIHA 3D8UA 4JDPA 5IAEA 4MPJA 1Q2UA 2ZR0A 5BYAA 2AXPA 1VPLA 4QGFA 1KYXA 1OREA 4UM7A 4IZ6A 4WNIA 4PR0A 2VYCA 4G37A 5FNVF 1QPZA 4IDDA 3K4PA 2OKCA 3SZGA 2F1OA 1U9JA 3ELYA 2I2DA 3V6LA 3PTZA 1WW8A 4ISBA 3VHLB 1EVKA 3D2LA 4Z0PA 1AHHA 2A1TR 3PXUA 1RJEA 1LWOA 3VH3A 2J87A 1P44A 3OJWA 2CV2A 4U8GA 2V0NA 3QQ5A 2CCJA 1BW9A 3H8VA 1N1EA 3AETA 3JWHA 3LY7A 5LDHA 2JFOA 3HCWA 4Q39A 3G2PA 4UCXA 4ZDIA 4FHFA 1D6MA 1K4YA 3PNVA 2F67A 3GWGA 2QX9A 1I4LD 4R1OA 1J4AA 2R6ZA 4X6UA 2WE7A 2V59A 3TL3A 4A0HA 2HA5A 4OMDA 5J5CA 4BFTA 4W4TA 3JAMA 2ZQYA 2GTPA 4GMKA 4NJMA 2RGBA 2EFGA 5AI8A 4UTVA 1PKEA 3D3WA 4WCDA 4JMLA 1G291 1Z56C 2PBLA 2YXEA 3L8EA 3LFTA 4PYKA 4B47A 4ENWA 2DULA 1R6DA 3ROEA 1OLUA 3JZAA 3GJSA 3EFBA 2WILA 3VZRA 1Z4QA 1OLXB 3A2MA 3HFSA 3N2KB 1FVFA 2O2GA 4HDKB 3BULA 4AO8A 4B3GA 1QKKA 1NUQA 1T8SA 5IT9A 3ZJUA 2IODA 4D3YA 5EUQB 3V3TA 2C9DA 4DB4A 1ICEA 2D0IA 2P6UA 2RGYA 3NC4A 4GNRA 1Q0UA 3EPHA 2VA9A 3QW2A 4MR8A 3G0BA 1ODLA 2X8JA 1KY5A 1WB9A 4IJKA 3CW9A 3U3OA 1YVUA 3AM4A 3OHPA 4FMDF 1NWCA 3WLMA 1N6RA 2IHUA 4V3BA 1K2VN 2F3QA 3SBXA 4V0SA 2GF2A 1IHPA 1QHHA 2XUFA 1D0SA 1I7PA 4G1VA 3STUA 5KINB 1PFGA 2JLYA 4CEHB 3DHWC 3GGDA 5LKAA 5J5AA 2ASVA 1UPFA 4W7HA 4R2XA 2W83A 2TMGA 1PWYE 1C81A 1XL1A 4ZWNA 3K32A 1L4BA 1W2WB 1GTMA 3OZDA 4PG8A 2XXAB 1R37A 2FRDC 3NNNA 1SRRA 3EXHB 3SIWA 1WMSA 4Y18A 1VE3A 2FWJA 2JCBA 3BX1A 1Y9JA 2UUBB 2DR3A 4MZXA 4ZDJA 3I2YX 4NDNE 1ES9A 4JYBA 3IP7A 2VHUA 3MTAA 1TJ5A 1XRRA 2J0UA 4TQ9A 1XF9A 4RZ2A 3WSTA 5A5DA 2B9VA 3QFFA 3ZCVA 3OP4A 5JNTA 3J80A 4AXXA 4EG1A 1UBLS 2QVGA 1FUIA 4MQEB 2FOXA 4LRXA 3TB4A 1NW5A 3JVIA 3NRBA 3K92A 2ABWA 4XQ0A 2ZIWB 3ZDYB 1E6MA 3DVLA 2IYVA 4K8OA 2QZ9A 3GEIA 1V43A 2GYVA 1WHSB 1X94A 4PPFA 3W2TA 1E2DA 2PZLA 2Y92A 2EX0A 1MVOA 3PICA 3ZW9A 1FS4A 1TW2A 2GJ4A 2FOIA 1USIA 3PQ8A 1JALA 4QUDA 1KVTA 4HR7A 1YMUA 5HX7A 1A9PA 2FJ0A 3CZRA 5K6TA 5FUYA 5B1DA 2G80A 1KU6A 5J2TB 3ZZTA 1A8UA 1HGXA 1OV4A 2GLXA 5BV2P 3ZVMA 1FBNA 2I0FA 5CH5A 1GWNA 4DA0A 3ZXIA 4OMFG 5JD4A 5CCEA 4RSGA 4YC7A 2GWRA 1U4SA 1YK1A 4FLEA 5DCWA 2QRJA 3WGNA 2D7CA 5AKLA 1PJ3A 5FAKA 4U7HA 3VNUA 4PQYA 5JANA 3R7SA 1JDBC 3V48A 4D99A 2FNAA 1V8DA 2JZNA 2TMYA 4L95C 3WRWA 1GN9A 1E1DA 3AERA 3FUXA 5BWOA 2R6CA 4TXMA 2N0SA 5DNWA 1HLPA 3GF4A 2JB9A 1TD9A 1ENYA 2O1WA 4YRQA 1NXQA 1G0OA 2F3TA 3BWCA 5A3VA 5A5VA 5EE9A 4KQ1A 3UPDA 2I4TA 1ADFA 4A36A 1DQSA 2QMHA 3NRCA 1SEPA 4DR6B 1L4LA 1OT3A 1VJ0A 3JVVA 3O90A 4GMDA 4O63O 3WBBA 1A88A 2VJBA 1NBME 2WWHA 3HCCA 1SU8A 2PUEA 3VV3A 2YYYA 5A05A 1JU4A 3IVCA 2IUSA 1Z68A 5J4VA 3OT1B 2Y0PA 4RQBA 5J2UB 4LTNA 3O4GA 2ECFA 2HRRA 1YL6A 3NP7A 3X1ZA 4MZDA 3T06B 5JY6A 1L1RA 2ISCA 4G0QA 4HZGA 4ZDWA 1EB9A 1WCYA 4FNAA 5P21A 3L8DA 2WYVA 5BYBA 2QL6A 4YMWA 5K0JA 6ADHA 1HNXB 1T25A 1Y8RB 2WUEA 3DMNA 4MWDA 3B9RA 4Q6BA 1WXHA 4LTMA 2BKEA 5D8DA 4PYOA 5CVEA 5KAMA 2DXIA 3DAOA 3BRQA 2PZJA 2V54A 2Y2UA 4F72A 2Z8ZA 3MUOA 3D1LA 4IDPA 4UUMA 2QJOA 3CGGA 3GAFA 3BC1A 4U39A 4Z1MD 2GZDA 2RHJA 3D6VA 2BEVB 2Q3DA 4MWTA 4CMEC 4EHAA 4YAGA 3BICA 4JQYA 3UATA 2JDID 2GFIA 3V7UA 3FHJA 3EIEA 4LFBB 4EP1A 1L3CA 5JROA 3SDZA 2C97A 2WABA 3QBEA 4NFSA 1E3TA 5KWVA 1UZMA 4PONA 5IJZA 3SR4A 5DP1A 3MGAA 3DHVA 5TQJA 1L8QA 1K8ZB 2OR3A 4J0EA 1INLA 1M2VB 4KFUA 4OHBA 3PKJA 3D8HA 3QPUA 3L9WA 4MJ7A 1RJFA 3SEQA 1FSSA 1JVNA 1T8UA 1AOXA 2QM0A 4QZVA 3IS3A 3UMMA 2ECOA 2SCUA 4EVQA 4D98A 3H7IA 3GLHE 5HKKD 2PCJA 2AJLI 4C2TA 1EFLA 1YQEA 1Y1RA 4GZ6A 2BW0A 1Q0LA 3O21A 2XCSB 4TLLB 4FYXA 5HEKA 1K63A 2JAHA 1WCWA 2BUBA 1WDKA 1WTAA 1TTQB 1FSGA 1G5HA 2ZIFA 1C0PA 4PSUA 4REQA 2GM5A 5ADVA 2IS6A 4DNOA 2IKSA 2A92A 3I2GA 2XVXA 3HUFA 3SZOA 4CM5A 1I7QB 1PNTA 1BTOA 2VAMA 1QG4A 3UK7A 3S2YA 4KI7A 3VZPA 1WDLA 1DCFA 1TCCA 4Q9DA 4TL9A 1BVYF 2C4KA 1P6UA 1LPSA 3KOUA 3H13A 1N5DA 1PT9A 1WW2A 2YASA 4C3OB 4BXOA 1JBKA 3H9GA 1J5XA 2HQOA 3A0RB 3H1EA 1FFHA 4UJ3A 4OL0A 1YACA 4YIKA 3FGOA 2CSXA 4ZV4A 3H87A 1LPAB 1PS8A 2NVUA 1IDOA 1QR2A 2VPQA 1GADO 2QK4A 1NBMA 2ZI7A 5G4KB 3VH2A 1Z37A 3QEJA 1U7UA 3G2NA 3AKYA 3D81A 3W5IA 1ZMOA 2FQYA 3WMFA 4JLKA 3RUIA 2C7RA 4ZHSA 1WMBA 1F2UA 3RDPA 1CUJA 1TC1A 5IAJA 2JAUA 1TU4A 1F9AA 1ZJZA 2HPZA 3UICA 4YV2A 9MHTA 1T91A 1FPQA 2V0CA 5HF8A 1TAGA 4TRMA 3VBCA 1Z2AA 3DTVA 2AR7A 4RM3A 4DADA 4HUQB 1JEEA 3THWA 3CRNA 4RFVA 3THYA 1RQPA 2JFGA 1KQOA 3CR3C 4DQUA 4JEMA 3AF3A 4TYYA 3O83A 2O52A 4HVTA 3DDZX 4OJQA 2QT1A 4C6SA 3JQPA 1X2EA 5AI0A 4ZOLB 2QYSA 3CF6R 2PNFA 3A4VA 3K0FB 1NHGA 1AXEA 3HWRA 5HF6A 3LO8A 1T36B 3TQSA 2IUEA 4B46A 2Q46A 1AIPA 4BVBA 3TSOA 3ZVNA 3B38A 2CVOA 3GMDA 3GRZA 1GT91 1QIJA 4GWGA 4CIYA 1RRPA 3H83A 5IKMA 3PRKE 4DEYA 1Q1GA 4L72A 3SC4A 1JYFA 1IH8A 5JZBA 3CRMA 4NFYA 4EM6A 4MW7A 2P4HX 2GD6A 1ISHA 5LMUB 5B4UA 3OJLA 4X5OA 1HDRA 3IEKA 3F6YA 3CO5A 2HMSA 2VTBA 4Q3CA 3AF1A 4B2YA 1SUEA 1PR3A 3MGBA 3QLUC 1UFRA 4LVNA 3HZHA 2F43B 2CLKB 3JZIA 1CZKA 2I1LA 3CN7A 5FPSA 4DEVA 2C99A 1A9SA 2QGNA 2J7PD 1AE1A 1ZNZA 1ZQ1A 4QSHA 3TLEA 4URVR 4YIHA 1RYEA 1VCIA 5D00A 2SHKA 4MCAA 5FA6A 4QG7A 1WCIA 1GKKA 2C20A 1KYIA 3NBFA 1EWYA 5LYJB 5TC4A 2GDZA 1FLAA 2H5EA 4BWYA 4IOKA 1K3TA 2DWQA 2ZTUA 3UV7A 3CTPA 3FMIA 2WD8A 3QX3A 4IVPA 3FTNA 2I71A 4LCJA 1TYZA 2WAXA 4KR9A 1Z4NA 1IPEA 1T1SA 3ZU4A 1K6EA 5ALRA 1ND6A 2GSDA 5EMHA 2QZ4A 3ITEA 3JZDA 1RBZA 2HO5A 2PIAA 4OF4A 2C3OA 1CETA 3HJAA 3PUWA 4XOUA 2OHFA 2AUTA 4PAQA 5ALXA 4KVAA 1NNI1 2V7QD 2VWPA 2AI3A 1E6KA 3GU3A 2FSIA 3HB1A 3M9LA 1ESDA 1DJLA 1YB1A 3LNCA 4I6EA 2AC4A 4QVKA 5D6NA 2ZIUB 1S8FA 1W8IA 3CH6A 2BGNA 4HBGA 4JX9A 3U39A 1QIEA 4MKGA 5KJ6A 4YRBA 4CLRB 2PWAA 2W6QA 2EYQA 3KHTA 3MWEB 4GT1A 3HADA 3S2GA 3V1LA 3M89A 3ET4A 3GBPA 1Y82A 4X8HA 4BLUA 2COEA 4YR9A 1A5AB 1PJAA 1GZDA 4F1JA 5HK9A 4BVEA 1WP4A 3ROKA 2BVNA 2A0YA 1EFKA 3OA2A 4TPKA 4TTSA 1XVTA 2B34A 3OCJA 1OW3B 4UM9D 3G79A 3H0KA 3IUJA 3HLYA 4V0OA 3RADC 5CB6A 3FSJX 4M9SA 3WDKA 5EJ6A 5CNIA 1NOJA 2B4KA 4Q1AA 5ICEA 4OQXA 4QX6A 3KJNA 1PK9A 4HH4A 1DCMA 2QHXA 4M2LA 1KKLA 3QLEA 4PEVA 3RS2A 3OKCA 4BUJA 1E6EA 5I4BA 1YOVB 4JP1A 2PFSA 3NR2A 3NLLA 3LZCA 3TAHA 5CD9A 5KSWB 1HE5A 4MS4B 2WZCA 1SCUB 1PR0A 2O14A 1G3QA 5IYZB 1BXKA 1SB8A 1ZP6A 1BJRE 3CUSA 4P2BA 5GJCA 3B70A 2C9BA 3N2LA 3LU1A 3O26A 1X70A 4KN8A 3HU1A 5JQWA 3UJHA 1ZJWA 4RW0A 3O9ZA 5JDCA 3Q3EA 5D2CA 3I9NA 3T15A 2FB9A 3NGXA 2IL1A 4KSYA 1JJ7A 3EXG1 3I12A 1Y37A 1QJCA 2HTEA 5J43A 3JX9A 4LN1A 1WQ1R 3DMTA 5A9SA 5JEEA 2GVZC 1PL0A 1ULUA 1ZJ5A 1A3CA 1O94C 4IUYA 1ZK0A 3K9WA 1SH7A 3H7AA 5BPFA 1YDHA 4RHYA 3VSCA 1MX1A 1PR5A 3OLCX 1IY9A 3MFYA 3WKDA 3BXOA 2LKCA 4BNVA 5KS2A 1NJFA 4S04A 3EPJA 2BM1A 4GYWA 3QK7A 1PD0A 1O58A 3ABOB 4BEBA 3RROA 2AJTA 3SJCA 1VG0B 3F4LA 4BFCA 1JZQA 5HVNA 3AYZB 1YB6A 5D7NA 1WTCA 1MEEA 1Y63A 2CEAA 4TKMA 2WWVD 4TLMB 5CDGA 3RBVA 1MB2A 1DT5A 4RLFA 4B4DA 3RWMB 1QHSA 4KH1A 3HG7A 3SHTA 4DW8A 3Q1KA 5HRUA 2YBEA 2GXAA 2E4VA 2NSDA 2R6GA 4KREA 5MFPA 4P7GA 3RSQA 5EQFA 1E7WA 1UM9B 3HNOA 2FMTA 4C2AA 1SVIA 1L7VC 3RUCA 3PUKA 4BLWA 1AS0A 1NF3A 4RZSA 3VR5H 1ABBA 5CPFA 4GMFA 2XVAA 2GZ2A 1VE5A 3G2HA 4RXUA 1Z74A 2PLFA 5CMLA 2W00A 4DRYA 1BQ3A 4NBSA 5DM0A 2RB4A 2H9IA 1P2BA 1G9SA 5IC5A 1TW3A 4KQCA 4BMZA 1RI3A 5TQVA 4QDKA 4KIWA 4H7IA 2BFEB 1XP5A 2OXEA 5KWIA 1EFPB 3TIXB 1GQRA 5SYNA 1XMVA 2H65A 2CXSA 2IHYA 3H99A 1B3RA 1UT5A 2V97A 5BSUA 1DP4A 3VSEA 2GYYA 3A25A 3AJ9A 4MAMA 3W9SA 2Q9AA 2EQAA 2R68A 4ZD6A 2VJOA 1U7WA 4YUWA 1GUZA 1T8TA 2NGRA 2MYUA 1DWQA 2VTVA 1EXVA 1KHTA 1DZIA 2FP4A 1WBDA 3SPXA 3SS9X 2FFQA 1SC6A 3NHRA 1IFXA 4BBAA 2FZKA 3U44A 2JGKA 3L8MA 1GLVA 3UJPA 1KZ6A 4MUXA 1IN5A 1CNEA 1ODCA 2ZKIA 2QGFA 2HHAA 3CMMA 2CHFA 2NTJA 3Q85A 5KQLA 1HETA 1GZ6A 1E3MA 3A10A 1VYVA 1JH8A 4DDMA 3BRSA 4AW9A 4HAYA 4BQIA 1SZDA 2YQ5A 5T7BA 1NX9A 4YCBA 5F5NA 2WLSA 5E3IA 1QFMA 1WBJB 1E8DA 1VKOA 1W76A 1XIVA 3RVNA 2C7GA 3ELBA 4K9OA 4WKNA 3W5SA 5B30A 4YRGA 3DBLB 5KSZA 4AKSA 2ID9A 3T7EA 3EZLA 3MWYW 4CF5A 1LSOA 5EJ9A 2UUCB 3D0OA 4IX1A 5AJXA 1H4SA 2BIFA 3SVTA 1EP1B 2QUZA 2EP7A 1G6Q1 4WZAA 4BO6A 1JH9A 4GPIB 2HW8A 3AK4A 2DP4E 7AT1A 3VI4B 3IEIA 4L5BA 5JCJD 2CFIA 1BXRA 3BK2A 2DFNA 5FCDA 2AUMA 4MLDA 1M8JA 1T3SA 2E48A 4FFWA 1CUDA 3TLGA 1FNNA 4CM1A 3FFWA 2QB5A 5FBQB 2B20A 4B6OA 1QBGA 4KPGA 4OJMX 4N4AA 3QX7A 1CERA 1SIWA 3KSDO 1WETA 3LP6A 4NMHA 1C2TA 1CUBA 5D3QA 1TLLA 3BGWA 3UOAB 4COOA 5IJ0A 3O2NA 5DGDA 1IEVA 4IAOA 5DASA 5EC8A 3TRIA 2X77A 4PSVA 1YV9A 5BN5A 4JK3A 5KTRA 3TGLA 2XKKA 5IDYA 3A6PC 2ZSHA 2Q8QA 4L9AA 1XTIA 1XGKA 4BJ5A 5I7EA 4P58A 1DE0A 2YVLA 4BEVA 4YV1A 1TTHA 1PEDA 5DTQA 5EFOA 3DL7A 1T5HX 1XEXB 1LB1B 2B7LA 2F64A 4QWWA 3CH7A 3A6EA 5DRYA 3H5WA 4X7BA 3TRDA 4C6TB 1S6YA 1ZHOA 4I55F 2YDXA 2PLAA 3GA5A 4UE6A 1R18A 1G8GA 4E4TA 3FPLA 1UJNA 3UUFA 2WTAA 1F4LA 1PEKE 2A0FA 1TT5B 3A3KA 5AKYA 2QPLA 1UP6A 3PDJA 1Y98A 4QOJA 3TLYA 1ONNA 3W2IA 1HDCA 2GBCA 4HQKA 3FVQA 3QNUA 4OB7A 1A9TA 1IBKB 3KOZA 3NBYC 2DLNA 4HB0A 3OZEA 3FDZA 4RTRA 3RU2A 1YGYA 2GQ0A 4JU8A 3VI3B 3QPVA 4F4JA 2PN1A 1A0OA 1ZINA 2ZSAA 5DGTA 4N5LA 5AW3A 5JR3A 2YJNA 2DFPA 3N28A 3SF8A 1UAYA 2WU3A 1XA0A 3L8YA 3Q8KA 1Y5LA 2W4MA 4MDYA 4UBMA 4ZALA 4B0PA 3H1GA 1HZJA 3UHFA 3LUAA 3IAM6 5IN4A 1A9XB 2EG5A 3LHDA 4X7RA 1RRGA 3RU9A 3IULA 2WF9A 1GVNB 2R5WA 3A11A 3IUBA 3KT6A 3M82A 2VHQA 2R751 3MOSA 4M0UA 4PLFA 3UQZA 3CINA 2FMFA 2AG0A 2ID8A 3L4BA 2R8RA 2AF4C 5FNVB 5CYOA 5DNAA 1QGOA 4FD3A 1Z2CA 1BO6A 3NHBA 3WDMA 1C14A 4GLLA 3ZLUA 1X1EA 1QMGA 3DBOB 2ZBUA 2BGGA 1P91A 5A6SB 4F5YA 5C51B 1T9GS 4QU9A 2BBSA 1AS3A 5KOIA 1GV0A 5LIPA 2XZLA 3TGWA 1T6NA 2KHZA 3S2IA 3HEAA 4YCAA 9LDBA 1SQSA 1QGUB 2EG9A 2IHKA 1C3VA 4YPOA 5SZJA 2VHJA 2DYKA 3DLPX 4X85A 3UXEA 5BQ3A 1II8A 2UYQA 2B2CA 2IT1A 1DTEA 3W4IA 2ZT8A 5BWBA 4D02A 8LDHA 1C7QA 1XTPA 1EWRA 2V6GA 3I72A 3V4LA 2ZUTA 1MENA 1Y1PA 3A7DA 3I45A 1DV1A 2G71A 3QYJA 1W0CA 1OF1A 1XZNA 3PUZA 5CX1B 1NYLA 3DJYA 2OYCA 3RR2A 5LZ4A 4MDEA 1SAYA 2A0UA 3KU4A 4EY3A 3AR2A 1JIQA 3AUYA 5AHKA 1RYBA 2MTBA 4JEHA 5IVHA 2WD7A 4DZRA 4TV9B 3U3RA 4X90A 2HUPA 3TQTA 1U8YA 3Q0EA 3M4JA 2A9PA 4X64B 1UKAA 3E23A 3TR0A 5DKFA 5BXYA 2YWHA 5MF6A 1R0LA 1E79D 1ZY2A 3UPUA 4P38A 2CVZA 1CQIA 2R4QA 2I7VA 3BYZA 1D5WA 1DKLA 1DUVG 4XIFA 3T7TA 3OJ0A 2PLWA 2FMKA 1PFKA 2B5OA 3HRIA 1ISMA 4FWBA 5K0ZA 3OI7A 4QDXA 1BDMA 5AM4A 4ARZA 5DPMA 3KJXA 3LVFO 1WB5A 4QO7A 2BM0A 1J97A 1H2YA 2W37A 3WB0A 1M2GA 1Y3DE 3VYSB 3OOWA 3DAPA 3ZK7A 5C3UA 4MIEA 4GBED 3KKMA 3VSDA 2Y0DA 1DAKA 1E3QA 3C6MA 3ORFA 2QTNA 4PHGA 3JD4A 1TIBA 3TM5A 4YCSA 4US1R 1LLFA 4D9EA 7YASA 5J2TF 3TSCA 1ADYA 2HEIA 1U2ZA 1YUBA 1E0KA 3C85A 4IX9A 1P60A 4KLRA 4Y9DA 4B5LA 1BDIA 1AV7A 3ICWA 2X1VA 1ENPA 1KJIA 5DHTA 3P2YA 5FLKA 2PUBA 1A9ZA 3M1IA 1R9NA 1JSLA 5ISMA 2XNDA 3FCEA 4PGMA 4BMVA 3RKRA 1HTWA 4YDSA 4L5AA 1GGMA 1Z62A 3GLHA 4H0NA 4N0QA 5IC6A 3D6JA 3ZIAA 5MN5A 2RHWA 1A96A 2POQX 2EZ9A 1NPTO 2RBGA 2FMHA 5JOQA 2NZJA 4EBBA 4DR7B 4ZJPA 5DNYB 3HJGA 4PLCA 2HGZA 3OX1A 3ZKAA 3DB1A 3DYIA 4I50B 4PS1A 4AUEA 4NMXB 3RGGA 3EC1A 4YJGB 1MCZA 1KY4A 2BEWB 1LU9A 1YJCA 4F4DA 1AMOA 2OQ2A 1V4VA 1ORVA 4IZOA 5KNBA 3FYSA 3FI0A 1GRNA 3G9UA 1Z8NA 5CXUA 5LWHA 3KSMA 4BFLA 1PSDA 4J7UA 1ZW6A 1GAXA 8AT1A 5CIYA 4FDTA 3EULA 5FXMA 2RCNA 3IR7A 4J7AA 2A0WA 4UHCA 4IEIA 1JHQA 5KHAA 3D59A 2EERA 2F9LA 3MAAC 2YUIA 2CVHA 2ZT7A 3GNTA 2WFZA 5IKOA 2OFWA 3QGMA 4I1UA 1F1BA 3WOVA 3L6UA 4ZO6A 3PGXA 4TWIA 3R1IA 1V1MB 4NZMA 4KQXA 2ZUFA 1ISRA 1CQJA 3NT4A 4WL0A 1C3XA 4KI0A 3DO5A 5HZGA 1YBVA 3SIPA 3MRSA 1GQOA 3U5ZB 2O3QA 1XVAA 2W22A 4G5XA 2IV7A 4AQYB 5IVIA 4DKXA 5IDWA 2P9TA 1OYYA 4G89A 1CC1S 4BKUA 4BO7A 4BP8A 4Q00A 4BUCA 2CBGA 5DNDA 4KXNA 4N8SA 5CDSA 2QQ0A 5EMMA 3M6FA 4M49A 2VK8A 1L5NA 1C0IA 5CLIA 3NHAA 1PGJA 1PFWA 1Q15A 1NVUQ 2R1VA 4FC6A 1SN7A 2P5UA 1DZ3A 3K0AB 3L92A 3MW8A 4ZCIA 1UFQA 1NW4A 5ITZB 4IQ8A 1TQ6A 1LKZA 3OE5A 3HM2A 4PXSA 1UC4B 3OCVA 2R8BA 4YJ3A 2QLNA 4C20A 5IZCA 5GJWC 2UAGA 1EEHA 1IBMB 3UKJA 2IPLA 2JJ2A 3ANSA 4FUQA 1QOPB 2Q5LA 1OFGA 3KT8A 4MCJA 5DGHA 4B31A 1UBOS 1H6DA 4QU0A 4XYEA 4YALA 4BJ1A 4CNBA 5C37A 1KRHA 5H4GA 3BH7A 1WD7A 3DZCA 3UFXA 1Z38A 2C9ZA 1FOEB 3OZUA 4G6ZA 4WJKB 4UAUA 1JAIA 1MB3A 1VXOA 2AKYA 4IKOA 4DR2B 4FN5A 4BQSA 1RRFA 3I1JA 3ANTA 4BNNA 1Q83A 2WA2A 3DZHA 4YV7A 4BX8A 3EDRA 1U2RA 4D8YA 1XKLA 2G88A 1QO9A 1NSTA 3JYQA 5DISB 3GG9A 4QSMA 3CZAA 4DBZA 5DLDA 5IBQA 4LHEA 1IY8A 3DEZA 4FHDA 3UGTA 4I5EA 4AJJA 2IYEA 3BMCA 2FVXA 4K46A 4KXQA 5CAEA 1MW9X 1ORDA 4RGQA 3OIUA 4F9FA 1Y8ZA 2JFHA 4BJHB 5MHTA 4H7HA 3HWX1 4K5QA 3UANA 1SXJE 3GAMA 5IK2D 3I42A 1H2ZA 1TD1A 3ESDA 3KQOA 3LE8A 3ESZA 4N9QA 3SSAA 3B20A 4MUEA 2QUIA 4GDMA 1W49A 2D1QA 2JJMA 1EFRD 1IHUA 2P6NA 3FF4A 2PKWA 4GQIA 1XC7A 4ZT3A 1GARA 5JSYA 1Z29A 2Z0MA 3RJMA 1OIWA 1VQ1A 2QTVA 3DDUA 4BN5A 4HDNB 4TMYA 4LPSA 3ICCA 4MWOA 4TKLA 3KWFA 4BGUA 4TV9F 2IX3A 2WRZA 1NUTA 2QJRA 4DLBA 2QZSA 3LYLA 5LD2B 5LBTA 5D1NA 1X1SA 3ZQJA 2CMFA 1I3KA 2RE8A 5K3CA 4WFJA 2Z2KA 1NXXA 1PQWA 2H4YA 1NVWQ 1FFAA 3NYIA 1DFGA 3NGLA 5KTMA 4KPYA 3IESA 3HB7A 3JQBC 4EG8A 4KO2S 4LC0A 3T35A 3GMSA 1B0AA 4RFSA 5A0TA 1UQTA 3FGNA 5EP1A 1F48A 3G0DA 2PRYA 4INJA 5ETJA 4LZAA 1ZWKA 3EIWA 4D41A 4KE8A 3W06A 3VOSA 4Z3KA 5K0GA 5F76A 3UMRA 4MKFA 5AVTA 4LHYA 2I65A 3OX4A 3ML1A 3S55A 3UWDA 3GJ4A 1CQZA 1XTJA 3DMRA 1KEWA 1R5JA 2WVGA 3KWMA 5HK8A 4E2FA 1FDRA 1ZJYA 2IEAA 3EUFA 2ODTX 1E6CA 1FYWA 1Y4UA 1NZJA 3G8BA 4PLWA 3VPSA 4BQEA 2FQQA 1V8ZA 3OPYI 2DH6A 2WWRA 2IOFA 3OICA 4QDTA 1Z08A 3AB8A 2JA1A 4P36A 4KN9S 3B1JA 4EF6A 5HCUA 1EP9A 5BY2A 2AWNA 1SOUA 5HRCA 4C22A 2FPXA 2O0KA 4G5YA 4XCQA 2RK3A 2TRSB 5F78A 2Q6TA 4ZCMA 5JJBA 3TECE 1ZVMA 3SJBA 3NTLA 2FLWA 2G28A 3OFNA 4POOA 5A0VA 1FUYB 1MRZA 5KPJA 1F2VA 4TS3A 2XQKA 3HJUA 4PHCA 1SOAA 3ASYA 1F12A 1PTKA 4RV5A 3TSAA 1DHRA 4BO4A 4BNLA 1CK4A 2HHCA 4R54A 3B5IA 4QC2A 4DNQA 3JATA 3AONB 4DCJA 3INRA 2OAP1 3LUPA 3PSAA 4B76A 4D9IA 3DXFA 1I10A 2FH5B 4XA8A 2GCNA 5EAIA 4GPZA 3LPMA 3V32A 4OGWA 1OAKA 1BS2A 3D3JA 2GO1A 5BSMA 1G8PA 1BKYA 1VJCA 2QG9A 5AUQA 4QDUA 5CG2A 1QE5A 2FKNA 4EA6A 5JMTA 1DU4A 2JGAA 3LTNC 4ZTBA 5KVCA 1J39A 1KYYA 3LS2A 3VPBA 4Q9HA 1DKQA 3IB6A 3P9KA 4B6SA 1SVOA 1LRLA 3AEKA 3NB0A 4W99A 5L4LA 1R6VA 4KQEA 4MVJG 4LSGA 1CZHA 1XU7A 3AHIA 3GYGA 2V7XA 3RARA 5JNSA 4YQEA 5LBUA 3ZU5A 3OPVA 4E5UA 2AHOA 4Y2SA 3RD5A 1JHXA 2R6AA 2B37A 3BGVA 4GHWA 4W7IA 1GZ3A 1E2KA 1M2OA 1JILA 3AESA 5BN4B 3TLXA 1AKQA 1N2CB 5KYWB 1JQ3A 1VMKA 4UDYX 3O74A 3E8SA 1KDPA 2AN1A 2JIDA 2WD9A 1IUPA 4OHKA 4K9RA 5CBPA 1Z5UA 4QGGA 1Q77A 2QVYX 2P41A 4K81B 3B8HA 2QP3A 4WD3A 3IXMA 1S3FA 4OREX 4XRGA 4UBOA 4JXKA 5GOZA 3FCSB 3CIOA 3H16A 5LSAA 1N0IA 4QBTA 3ZC3A 1EK2A 4ALMA 2VIIA 4NULA 2NIPA 3FMVA 3DTTA 2HL6A 2C4WA 3PIRA 4G1MB 5CDUA 3NXKA 1G8YA 1LDMA 4B45A 1TF7A 4DWWA 5KSOA 1E1LA 2J9XB 3A6ZA 1RS0A 2MIIA 3ZXUB 2XQJA 4BMDA 1D1QA 4LZOA 1USVA 4EHBA 4WESB 4OKIA 1AO3A 3WFZA 2YFYA 4FE4A 4W5OA 1AMUA 3FAZA 3R5HA 4FUTA 3K70D 4KNYA 3WO1A 2VZ8A 1G16A 4A2WA 1UKEA 4EUEA 5T4EA 2D8AA 3ZXSA 2A0KA 3FNHA 4I3HA 2OGSA 3A6DA 4N0EA 2I6QA 3QFCA 4DCVA 4KCGA 4EL0A 1ZC3A 4IKPA 4YRFA 1JDJA 2EHDA 1K7XB 3JQFC 4L15A 5DLYA 3T5CA 1X14A 4YXWD 3IJPA 3KVVA 2HD4A 5TPZD 1MAWA 1SWWA 3TM4A 4DQVA 1M34A 1UBGA 1NC3A 4MQBA 4P22A 4X66B 4ACAA 1IM2A 5F1KA 2C57A 3VHRA 1XRLA 3WSVA 3RNOA 1T43A 4FDAA 1WE2A 2JVJA 1TA4A 4H1HA 4S1VA 4HXEB 2PKRA 3H3FA 3I32A 1F2TA 1CJMA 3W2EA 2I4RA 3CV3A 1BA2A 1T8PA 3RI3A 3RT9A 3Q2OA 5JYBA 2QSZA 3KUKA 5KHLB 3CF4G 4J3FA 2ACWA 2VP9A 3H19A 1Q7TA 3BGOS 4ZVVA 2WG1A 4ZI5A 3AH8A 2NZUG 2RB5A 3A4LA 3T3GA 4WFKA 4G0UA 3LBAA 2H7VA 3GJQA 3ZE1B 2DERA 1MFPA 4BMOB 3NAGA 1YFZA 5L3SA 4MUAA 1U0JA 2V4ZA 3AHDA 3J81A 3ZE2B 1U7HA 4DIKA 2R7NA 1E6LA 3L9XA 2P9GA 1V3QE 1W5AA 4LX8A 1UADA 1ZIXA 3RUEA 1Q0ZA 3FPBA 2VQEB 5CB0A 1KC3A 3MFQA 4LPKA 4V2UA 4UTNA 2O8EB 5EWLA 1U1FA 4IIJB 4OL9A 3GN1A 4MUYA 3DKKA 2JAOA 3PL1A 3IAUA 3MILA 2NTEA 3HBNA 4EEXA 3UAWA 2AW5A 4OM8A 4PNEA 3AC0A 3RJ9A 4C78A 4BQRA 1SZCA 5G3YA 1NAIA 5F2EA 1NATA 1NXOA 3A3NA 4R1PA 3WLHA 2DUMA 5AHOA 1AHPA 1GZSA 5ESRA 3IC5A 5BMVB 1TC2A 2X19A 3KQKA 2HIMA 1U63A 1YJ8A 2Y8EA 2EFHB 4PX3A 4RX1A 3WYDA 1CFZA 2X9QA 4DV0B 2GLUA 4OP3A 3W9BA 2JASA 4PZEA 1S8AA 2GWHA 1N5IA 2DPXA 2ZJ5A 3EMBA 3VBEA 4BNJA 1X7ZA 2O7SA 4JOBA 4BLQA 1S01A 5LLSA 4EW6A 4Z4QA 2CXPA 1BAPA 3TUJC 2W6ZA 1G20A 4IJWA 4LXYA 1VM6A 5KDOA 3G0GA 4G0YA 1ZITA 4FJ0A 2G72A 3T95A 4YREA 3F98A 1WXIA 3K9GA 3PVSA 1HMPA 1KS9A 4B79A 3BFXA 4C3UA 2B83A 3AZPA 4U6SA 4HNSA 5TMDA 3TVDA 3ILSA 1ISFA 1U0LA 1UK6A 4K3VA 1IWPB 4OHVA 3H04A 1Y9AA 5G2OA 2C5LA 3HSKA 2GPYA 5IAGA 4G01B 3WMXA 4AJOA 1SVLA 1E2IA 2PSFA 2PD4A 4MLZA 4Z9XA 3TW8B 2WFLA 3G3EA 4II7A 3EG9B 3LCJA 5D84A 3WRYC 3BD6A 1T2AA 1Y6RA 2IPMA 3RYCB 5JVDF 3AWDA 1XQWA 1NXTA 4L9SA 2QPOA 4ETIA 4G67A 1Z8HA 2HIGA 3GZTB 4KAXA 1TZBA 2VDNB 4LWZA 3MMXA 3GRYA 4KVZA 4U9HS 5BYJA 1WZIA 4AWXA 2D1FA 1NBIA 5ESWA 5A3QA 3EZGA 1H1LA 1JLHA 1OR8A 2SCUB 3Q41A 3Q3GE 1FRQA 2ORWA 3PUJA 4CR6A 4HTAA 4YJDA 4F3YA 1MIOB 3L4KA 3U4QA 1G4HA 2W43A 3DVAA 5GAJA 1AGYA 3O8OA 4IILA 1PW5A 1AF4A 1LRKA 1ZVJA 2AN5A 2VWGA 3E82A 2C07A 4F4CA 3PNPA 1Z28A 2WKRA 3O2QB 1XJCA 2ZRGA 1HLDA 2AZMA 5A6VA 3IP9A 1ONPA 4UW9A 1C30A 4PSDA 4Q21A 4WAUA 5L95A 1BMTA 1AQLA 3C74A 1OWLA 4QREA 5EIAA 2FPIB 3DA8A 3OIWA 1P7VA 3DQQA 4C7XA 3ZX4A 1F38A 5E9JA 1PJRA 5AW7A 3TZLA 3EA4A 2Y4OA 2ZWPA 3U7FB 1JHMA 2CUKA 2NTYC 1NW8A 2ZROA 1XTUA 1GGHA 2ZUUA 3EEIA 1H4QA 4L57A 4LXXA 3UGKA 4YJ2A 2LV8A 2G7ZA 1SK9A 4KVFA 5M34A 2PRJA 3II6X 3QE3A 1KP2A 2Y0BA 3HXMA 4O1IA 2RG1A 4BVKA 5KUTA 4Z1MA 1W30A 3SC6A 4HFJA 3NWBA 3PZRA 3ZHVA 2OK7A 4BHTA 2JVIA 2QRKA 1CWUA 2UZ3A 3VR5D 3FWKA 1YE5A 3CVVA 4WN9A 2HI0A 2XQFA 1RQ7A 1DL5A 3DE3X 5AI5A 4DNPA 1E7RA 4C0LA 4ZU6X 1VLLA 4A8HA 1BKDR 2H5JA 2OEPA 1EIZA 3SD7A 3ZVRA 4W7SA 4O59O 5AI9A 1MC8A 3DEJA 1O5TA 3EUEA 3UWOA 3P9PA 5A9TA 5H16A 2P4QA 4R6XA 1I3LA 4DV1B 3L8CA 3WLOA 4HQRA 1JSRA 4ZVOA 3U62A 2ZTVA 1XYVA 4HSEA 4IRMA 4P35A 5AH0A 1KPIA 4F04A 3NHLA 1LF0A 3A32A 3I83A 1XF1A 5CG1A 4JP5A 2VLIA 2ZRAA 3QMMA 1DMRA 4JLBA 3E5NA 4YMHA 5JHGB 5JS2A 4Z0NA 3ERCA 2V03A 1Y9DA 4V39A 3ZTWA 4PQEA 4UTOA 4H6XA 1QCZA 3WFIA 1MAUA 3NDJA 3QFSA 4MVJH 4KQ6A 4BFVA 4DLNA 5K01A 3UWSA 3G85A 4E33A 3FOCA 2Z5FA 4L0DA 3ZGNA 1C0EA 4JYCA 2OO5A 5DTEA 4JFRA 3U3ZA 2PUAA 3MT7A 3QXJA 3HY4A 3RSLA 3M4YA 1MHPA 1L7RA 3ZWCA 2GYWA 2VTBB 3DZBA 5C5DA 4MLCA 2OORC 3QUCA 4J4BA 2IXEA 4P7BA 1IY2A 1NN1A 4LRUA 3D4PA 2IUFA 4QIHA 3ZCSA 3FHTA 4PLPA 1ESZA 5AW9A 3SXUA 3AJ8A 3HFJA 4ZT2A 2EF0A 4XD2A 1I1HA 3DC2A 4OEHA 1A5TA 1JXAA 2G09A 4IDEA 5DTIA 3TUIC 3UF0A 1QYRA 3CJQA 3H1BA 2BFWA 3ZCUA 1R1DA 5BVHA 3JTEA 4EQZA 1PBNA 1AN0A 2F9FA 2Q3JA 4C7BA 4Y1EA 3LXMA 3WHPA 2F1RA 5FYQA 1EM8A 3SHWA 5HKAA 5KYYB 1AJEA 1JKMA 2X1MA 4U2FA 2BRUA 4F12A 1OT5A 5FULA 2JHPA 3TZCA 3SNKA 3ZCXA 4ZJUA 2QRGA 4UTPA 1VE1A 1YVDA 1M33A 2A88A 1OGJA 1V37A 4AVYA 3WGZA 1K89A 3FUWA 5DH9A 3T3DA 4F4UA 1PJTA 3ECSA 1HE2A 1XVUA 3UG6A 3K6KA 3MTDA 2QPAA 1ZEJA 2PZKA 4E5SA 3A6HA 3H4VA 4HAUA 1MTZA 3R0ZA 4NXMB 3IBCA 1X86B 1UAGA 1XHFA 1U2PA 4JBXA 1HDZA 4YLYA 3DBHB 5CP8A 2WU4A 1NJ1A 3OIGA 4EFDA 1OTYA 4HUJA 3IBTA 3IBYA 4ESHA 3IH5A 1X7DA 3CUYA 4P31A 1R4NB 1K0UA 1SNYA 2WHQA 4O33A 2JS7A 6ABPA 1IXYA 4UTZA 3IV6A 3UJ7A 5I9MA 2WJZB 1P5FA 1S7GA 4B85A 3INNA 1RBYA 4IM7A 5E4JA 4RZXA 5JE8A 4DC0A 2SKDA 3BEOA 5AVXA 4P5PA 4CM8A 4MINA 1RE1A 3C3MA 4P84A 2O4UX 3O4JA 4Z86A 4XVCA 5JMOA 2JH8A 1WPGA 4FYMA 4U0JA 2WSBA 2VT6A 4KQ2A 4IF4A 1J0DA 4FDVA 1UMDA 2BGJA 3G5MA 4WY2A 1Z9BA 2CN1A 3KT3A 4GZLA 2YHSA 4IIFA 3LHFA 3LM8A 4RWEA 3SXUB 4EA7A 4DWJA 4ZN6A 1RVV1 3FIJA 4KLNA 4E5VA 4ER0A 1Q7CA 1QGUA 1V5IA 1K7YA 1JLLB 4WV3A 3P2EA 4OCZA 1E99A 1N0HA 3L43A 4GU5A 4QDJA 2IBTA 5JQGF 1BG6A 4HVAA 2CKMA 3HXPA 1SPXA 3DVQX 5FLYA 1L4KA 1R9GA 3EMDA 3NAQA 4H35A 3GCXA 5DYTA 3TAXA 3R3HA 3VM6A 3TOSA 1I7LA