3JQAD

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor 2-amino-1,9-dihydro-6h-purine-6-thione (dx4)
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
247
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Pteridine reductase 1
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei
total genus 91
structure length 247
sequence length 267
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jqaD00
1E3WB 1UP7A 2VHVA 3KSDO 4YJHA 2YDYA 3WMXA 1C0KA 1NFQA 5CPBA 4GVLA 4KTTE 1MP0A 3E18A 3RJ5A 4U7WA 1UZMA 2O3RA 2VYVD 3K92A 4L8VA 1FDVA 3ZHXA 1Z7EA 1VPDA 1UXHA 3PZBA 4YJFA 5AXCA 3I23A 5CDUA 3OJ0A 4KWHA 2B69A 1YVEI 2G5CA 4L4RA 4E5KA 4I9HA 4CM3A 1W73A 5JDIC 3UH1A 1ISIA 3ADOA 1ZMTA 3TZKA 2OBYA 2Q49A 4GMGA 3W4KA 1R15A 1X0VA 2G17A 3MWEB 5BSGA 2VN8A 4N7RA 4ZD6A 2G76A 4RLHA 4W7HA 5L51A 3ZH2A 4F3YA 4YPOA 3AU8A 5JDCA 1XIVA 4UUOA 1LA2A 4UUMA 4L76A 3B1FA 4ZRNA 4B4OA 2O4CA 2O3QA 3GUCA 1HL3A 4K9DA 3WYBA 8ADHA 4QUKA 9LDBA 3C8MA 3GQVA 1DEHA 1X1TA 1IL0A 3E82A 3RUDA 3JQBC 4E5MA 3UUWA 2NVWA 4EJMA 2DLDA 3I1JA 2ZB7A 5JMWA 4KMSA 1GYPA 2H1SA 2HJSA 1DIBA 2FWMX 1KEWA 1IY8A 3VH2A 2GLXA 2V6FA 2JHGA 3C7CB 3DTTA 3S2GA 4NBVA 4IJUA 4JBIA 4AJOA 4B3JA 3IDSA 1HYEA 1A4UA 3AOEC 3NYWA 2IYOA 3AUUA 4P4LA 5F1KA 2HRBA 4KQWA 3UCXA 1J0XO 5B1YA 2Y67A 1I3MA 5JLAA 4CV2A 1LLUA 3RBZA 2UYYA 5AOVA 5A9SA 3D4NA 1JWAB 4XJSA 2DBQA 3DFUA 3ENKA 1DC4A 3RBXA 3H3JA 4W4TA 2BLLA 4DVJA 3QP9A 1HZZA 3O8QB 4GX2A 3ZCXA 2AE1A 3DHNA 3NKLA 4JJIA 5HBRA 4D79A 4LK3A 1VM6A 4FIZA 3SJUA 3FWZA 1J5PA 3ONEA 4BB6A 4H7PA 3FR8A 3EC7A 3PWKA 3CTMA 2JKVA 2QRKA 1K89A 5DCWA 2FY8A 3DBRA 2EW8A 1A7KA 2CDAA 2E6UX 3L07A 3KXDA 2NADA 1ZMOA 4EEXA 4ND2A 1HKUA 1P45A 4WCDA 3Q9UA 3VVBA 3T4EA 2X8LA 1B0AA 5JO9A 4J4BA 3JV7A 3GRKA 5JAZA 2O23A 4R01A 4TKLA 3UN1A 4G65A 1ZZEA 3QWHA 1CYDA 4FCCA 3HUDA 5T5QA 1ZKMA 3AY3A 3U0BA 2C2YA 1EQ2A 1JDJA 3QWFA 5F21A 1ZIDA 1ADCA 4GQAA 3K2BA 1ZJYA 1NPTO 2NTJA 1H6AA 4XYLA 4KUGA 5L7TA 1GCUA 3FN4A 3PIIA 1V3UA 3H6KA 1VL8A 3C3XA 1HXHA 3PGXA 2Y1CA 4J4TA 1C0IA 1NQ5A 1P1RA 1U2GA 4PCVA 1JU9A 4RL6A 1NXQA 4FFPA 5TX7A 3QVSA 1Y81A 1T4BA 3ZV3A 2C5AA 1UAYA 4IJVA 2IEDA 3ZV6A 4MVJA 5IDYA 3JQ8B 2V6BA 1UDBA 5TQVA 3ROMA 4B4UA 3HG7A 1AE1A 1OC2A 1H2BA 3PHHA 1PJ2A 3EDMA 1CQJA 1C1XB 3VPSA 3WGZA 1ZFNA 2I5PO 2DAPA 2EERA 1DOHA 3BTUA 3MCVA 5BNIA 5DDIP 4E21A 2VHYA 5F5NA 4BKPA 3H5NA 3QQPA 3W6ZA 3FBTA 4ND4A 3EY4A 1MC4A 2HKIA 2GR9A 3WSVA 5AXBA 1XQ6A 2NLOA 1N7GA 3K31A 5KOIA 4XGIA 1LDMA 2GD1O 3R3JA 3KUXA 5L40A 3NDJA 3ETGA 3JQGB 2D5CA 1R12A 3JYPA 3IC5A 1VL0A 1DIGA 1R66A 4CMEA 2ZTMA 5DULA 4H15A 1SEPA 1HDXA 1Y9EA 5HRUA 3ZW9A 4NG5A 1G6KA 1KYQA 3GRPA 1X15A 2ZB4A 3JYLA 4XKJA 2B4RO 2RBEA 3DZJA 3QIVA 4GI2A 1PR3A 3ZWBA 3VZQA 1DHRA 2VRCD 4NI5A 4Q3BA 1ONPA 4R41A 5H83A 2VNSA 2X5JO 5JY6A 1R37A 3KLPX 3P2OA 4NJMB 1Q1NA 2VZ9A 3PJGA 4OOFA 4LSWA 1YONA 4CMEC 1QSGA 3QY9A 3HNPA 3S55A 3LU1A 3H9EO 1PZFA 2Y0EA 3W6UA 1V8BA 4DC0A 4E3ZA 5GMOA 4UREA 4PRKA 4QEDA 2I76A 1R0SA 2VT2A 3HB4X 4NHEA 1SMKA 1HEUA 2Y99A 2WD8A 4J1SA 5I7FA 1Z6ZA 2GGSA 5KKAA 2R6JA 3EVTA 4F6CA 1CERA 4FR5A 1KOLA 3V2UA 1QYXA 3T7CA 2Q3EA 2QW8A 4YT4A 5HS4A 4KQXA 3JQ7A 4CM9A 3RU9A 3I4CA 5EN4A 3I5MA 2Y1OA 4RF3A 2AG8A 1PZGA 5L4LA 3UF0A 4WE3A 4F45A 3WS7A 1EVZA 4URFA 5F1OA 3H9QA 4L74A 5C37A 4U6SA 1ZK2A 1WWKA 4TKMA 4EBFA 4PG6A 1LSJA 3GG2A 5DBGA 2EJVA 5L9AA 4IZHA 2QX7A 1ML3A 2EXXA 2LDXA 4HADA 1FMCA 3WJAA 3N74A 5B4VA 2X7HA 3LDHA 1LRJA 1AHHA 4ZGWA 4IMRA 4XYMA 5COAA 1XU7A 4LRTB 2CVZA 3E03A 3CKYA 3ICCA 3V8BA 2ZYGA 5EJ2A 4YAJA 4XGKA 5A06A 5IXSA 3E5RA 2B35A 3PYMA 3JQ9C 2C54A 3PI7A 3ON5A 4QT0A 5AVOA 5G4KA 4AJLA 4RVUA 1OZAA 3KOUA 1F8GA 1H0KA 4IDDA 1X13A 3V1YA 4CLRA 4A7PA 4IBOA 2XOXA 2OGUA 2V6MA 3TSCA 2HDHA 1Y6JA 4U8GA 4DYDA 1B16A 4RV9A 5IFLA 3CSDA 1YE3A 3GGGA 3A06A 1KC1A 3KM0A 4WLUA 1R4MA 2RIRA 3DZFA 3IP3A 1CEQA 3NTRA 4YRDA 1E1KA 1T25A 2WM3A 3UW3A 3BTVA 2Q2VA 2D4AA 2Q1UA 4YRBA 2ZK7A 3G1UA 4AICA 1PU2A 1ULSA 2Q4EA 2FZEA 2JFFA 1ZXBA 2BGMA 1DIRA 3B6ZA 4XB1A 1RKXA 2X9GA 2DFDA 4XB2A 2BRUA 1K6XA 3AU9A 3DEYX 3GEDA 4CMGA 3BMCA 5JNLA 3AM3A 3AJRA 4NBRA 5CDTA 4CLOA 3AI2A 3FHLA 2ILTA 5JY1A 3L6EA 1M76A 3AK4A 1ZO8A 3I9MA 4BGIA 3S2IA 3ORFA 1UXJA 1X0XA 2D3TA 1ISJA 3HDQA 4GPD1 1HWYA 1ZBQA 4ONEA 4YACA 5AYVA 4CM4B 2O4UX 1ZCJA 2Y05A 4AG3A 4L75A 1RM0A 3BYZA 3GK3A 1I2ZA 4J1QA 4ND5A 2G82A 4EGFA 1L7DA 1J49A 3SLKA 1D7OA 3PFWO 3V5NA 2AXQA 3GDFA 3RFVA 5BNTA 3RWBA 4ALNA 1CRWG 2PK3A 3DC2A 4DPMA 3U5TA 4LISA 5JO0A 1R4NB 4WNIA 4N5NA 3PQEA 2DBZA 4TVOA 4WKGA 1EMDA 2WTBA 3GZ4A 3Q6IA 1WAMA 3M2PA 1NBOA 3STHA 3VPXA 4U5QA 3NJ4A 4AVYA 3L9XA 4HUJA 4I5GA 3C24A 1E1MA 4KZPA 4FFRA 4D45A 5BSFA 3JD4A 1YKFA 5IDQA 4PG7A 2CMDA 3VHRA 3DBHA 2JAPA 1AXGA 4BO3A 1WVGA 4ZU3A 5BQFA 1GUFA 4D43A 1PJLA 1U8XX 2UV8A 4FJ0A 4YJDA 4OJNA 4E12A 2WYWA 2OOSA 3V1UA 5TF4A 3PGJA 1Y8RA 1WDKA 3UVEA 4BB5A 1GZ4A 3TL2A 4ZN6A 1K3TA 1EE9A 3WFJA 2CVQA 4CV3A 2WYUA 1BVRA 1Q0LA 1E1LA 4Z6KA 1VC2A 1WMBA 4GGPA 4DL9A 1NTOA 4ND3A 1U2DA 2DPGA 1O8CA 1GL3A 4Y6RA 2JFGA 3ZDFA 3EZYA 1YDEA 4PLPA 5ENDA 1Z82A 4C7KA 2HRZA 1EEHA 4B8ZA 1EVJA 1JVSA 3MOGA 2YV3A 4OH1A 4CM5A 1MXHA 3UGKA 2P5UA 1CETA 4E2WA 3VC7A 3ADPA 3ZV5A 2P9GA 2IODA 1G1AA 1MB4A 2GZ3A 3QSGA 1YDWA 4RZHA 3JQFA 3DBLA 5JBIA 4EUHA 3PPIA 1GUYA 1I10A 1M6HA 1O5IA 4WLOA 3QHAA 5F5LA 2CUKA 5CDSA 5G0UA 4BNZA 5C3MA 1I2CA 4E13A 1Q7BA 3UCFA 4YT8A 4J7CA 3GVHA 3IKTA 1U3WA 2Q1WA 4Q3EA 4I5DA 2PZMA 4EUEA 4P4GA 1EUZA 1P0CA 4J0FA 2VNAA 3ONFA 2YHIB 2GNAA 4R9SA 5TT0A 3R3SA 1MA0A 3H9GA 1ENPA 3VKUA 3BHIA 3GZNA 3ZNNA 2W2KB 4OSOA 4P8RA 3TDKA 4J3FA 1AUPA 4EI2A 3LC2O 1T2FA 1P9LA 2G1UA 3GVIA 3U4IA 1WNTA 5TSDA 2I3GA 1E6EA 3H4VA 1GCOA 4BKRA 1U3UA 4E5NA 3PTZA 3NAQA 1Y8QB 2DQ4A 1DJQA 1LDNA 2FRDA 4BUCA 2A35A 2AEFA 3IUPA 3TFOA 2HO5A 1N5DA 1MV8A 3KSZO 1RM5A 1BG6A 1N1EA 1VKNA 3FNFA 4XIYA 2P9CA 2PD3A 4WK6A 5HM8A 4R5HA 3OBBA 3KB6A 3SXPA 1KVTA 1YQXA 2PGDA 3FBGA 2TMDA 3JQ6A 3GAFA 3DZBA 1YB5A 3BHMA 3I6IA 1F0YA 1GPDG 1QLJA 4J1NA 1D1TA 2C2XA 2ZTUA 1GQ2A 3ANMA 4W7IA 1NYTA 4CQMA 3GAZA 1DC5A 1EUDA 1EZ4A 1BXKA 1GFSA 3COSA 3JCZA 4CMCA 4FJ2A 2NUAA 4ALMA 3LYLA 3ZWNA 3JD3A 3QVTA 3G1TA 4PLWA 1SCUA 2RH8A 2DPHA 3INTA 2CY0A 3DWFA 5B12A 1O95A 4EDFA 4DIBA 1PJCA 2YY7A 1FF9A 3FCOA 1Z73A 3PDJA 4BNHA 1Z74A 2FZWA 3QRWA 2AG5A 2DBVO 2R00A 4BNFA 3QV1A 1OBFO 4CR7A 3BIOA 3LVFO 3K6JA 4OKIA 2C20A 2Q45A 2Q2WA 2UDPA 3KV3O 5TLSA 4DLLA 2B4QA 4DYVA 1HYGA 2YV1A 3VTZA 3OIDA 2IRWA 1FDTA 4PG4A 3H2SA 2VOEA 4RVHA 3I3OA 4KTVE 4BO4A 1IPFA 5A04A 3O4RA 1T2CA 1I36A 2BFPA 5JMPA 5IJZA 4HBGA 4R1SA 5ILOA 3MJEA 4IIVA 4WCFA 3GY0A 1X7HA 2BGKA 3LK7A 3C1TA 1DFIA 3SC4A 5KJ6A 2H9IA 4NQZA 4BO2A 4BO9A 5ER9A 4EYEA 1P1HA 5K6AC 2O3TA 2GDZA 2JCXA 4IDBA 3OICA 3RKRA 3VZSA 1LEHA 5G0VA 1FDUA 3VZPA 5KVVA 1T4DA 2YW9A 3WDSA 2WD7A 3NDRA 1H9BA 3ITKA 1R6DA 1KETA 5IDXA 1N9GA 2EJWA 1SOWA 2CFCA 2YV2A 3NTOA 4TVBA 1U7TA 2A9FA 4WLVA 4BGVA 1B8UA 1KERA 4CM8B 5IZCA 2CSUA 1PR9A 1X7GA 3BMQB 3IOYA 4P22A 2XPCA 2UUPA 4CM7A 4DTIA 2E49A 1D1SA 3I9LA 2PKQO 4JIGA 2D2IA 2O7QA 4LCEA 4B79A 2WMDA 5U9CA 3WFIA 4BMVA 1HDGO 1NFFA 3BAZA 3LQFA 4XJTA 1W4ZA 3VZRA 4BMSA 4BV9A 4YR9A 4J1TA 4J9VA 3SC6A 4AJ1A 1Z7BA 1IUKA 5JFOA 4TMFA 5JCJD 3GN2A 1NPDA 2I99A 4RCVA 5IZCC 2VOJA 4TRJA 2HJRA 4KUHA 3ZWCA 2VRCA 2WEKA 5IAAA 1U4SA 1U28A 3RFXA 1YH3A 3RQSA 4GSLA 1BRMA 2GRAA 2W8ZA 1NQTA 3RCBA 3B70A 2X9VA 1BVUA 1N8KA 1WXDA 1NQOA 3IMFA 1CF2O 4CPDA 3MEQA 3AFMA 4I8XA 1O0SA 3EZLA 1M75A 1P1KA 2WYVA 4Y9DA 4WLNA 1C1DB 1NR1A 2IZ0A 4R4JA 1OMOA 4W99A 4XCVA 1ISGA 5A9RA 4RPHA 1S7CA 2ZTVA 3HQ4O 2J3KA 3NUGA 3ZU4A 3QW2A 1DXYA 2FOIA 2NVBA 4BO8A 3IAHA 4YJGB 2WSBA 4RJTA 4CLEA 5TT1A 4OXYA 1SB9A 5THQA 2A94A 2H63A 2X22A 3HZZA 1EVYA 3OM9A 4IDEA 3LT0A 1QLHA 2EG9A 2QZ9A 3JQBA 3P19A 4CQLA 4L4XA 2DFVA 4HV4A 4FFNA 4G81A 4ZQGA 5L53A 4MKZA 4B3IA 1PWZA 2VCYA 2DTEA 2X6TA 4TZTA 4GLOA 3JQCA 3L0DA 3GR6A 5GY7A 2CVOA 3RKUA 1BXGA 1LU9A 3D5QA 5TNXA 1GDHA 1OFGA 1GZ3A 4OAQA 3U4CA 4EITA 3AOEA 3PQFA 4UAGA 4Z9YA 3L4BC 3RUEA 1U5AA 5IF3A 5H81A 1E3WA 2DC1A 4YWJA 3WGYA 5I7VA 4GX0A 4UEJA 4E2ZA 2GYYA 3R6DA 4GKVA 3CXRA 2GN6A 3E5MA 7ADHA 3R0IA 4DMLA 3WB9A 5JS6A 1OOEA 4XRGA 3TOZA 2GO1A 5CFZA 1MXFA 1UZNA 1I33A 3TQHA 3DTYA 1PZHA 1HYHA 5CG2A 1PWXA 1NAHA 3E48A 1LDEA 3F3SA 5T57A 2BGLA 4XEHA 4ZQBA 2ZJ1A 2ZQYA 1PGQA 1PS8A 2C29D 5ENVA 1LQTA 4AJ2A 4B8WA 5TC4A 2VHWA 4PLZA 1IYZA 3HDHA 3IJPA 4J9UE 4BO7A 2BF7A 4WLEA 1GYRA 1IB6A 3AUTA 5JW6A 3FNGA 1NQAO 2PZJA 2IEBA 3ITDA 3RC1A 5A02A 5KIAA 4HXYA 3IQDB 4FFOA 3VH1A 3KYBA 5IXYA 3LC1O 3OEWA 5KTKA 4RF4A 2Q2QA 4RZIA 2CNBA 4JNKA 4LVCA 1VSVA 3QWAA 5JCXA 2DTXA 3W4IA 2B5WA 3L6OO 3TZCA 4WNCA 1UDCA 6ADHA 1KEPA 4G2NA 2HK7A 3KTDA 1PGOA 4EJ0A 1SBYA 1AN9A 2J3HA 1E7MA 1OI7A 2ZQZA 2IZ1A 2NSDA 2Z1MA 4ZQHA 5KJEA 3F9IA 4TQGA 2ZJ0A 3F4BA 2FR0A 1SZJG 2A92A 3T4XA 4BIIA 2O2YA 2OORA 2OUIA 3TFQA 2PD4A 3GPDG 3DAGA 4JXKA 3GG9A 1ZSNA 4BNWA 5DF1A 4DIOA 2WE8A 1A5ZA 4PG5A 4QO8A 4TROA 1GD1O 4CR8A 1GR0A 1NVTA 3PP8A 4IDCA 4QECA 4RPJA 3PVZA 5KJ1A 3ZW8A 4O1MA 2R2GA 4R69A 1PJ3A 2F00A 4FOOA 3WBFA 1UXKA 2YQ4A 2VWGA 3O8QA 2EHDA 1BMDA 3JTMA 5JAMA 3GGOA 1KVRA 1M66A 1ZK4A 2FPIA 1FK8A 1YXMA 5CP8A 4GWKA 4D3SA 2BH9A 2IDZA 4FPXA 1XDWA 3DZKA 1QORA 3RUAA 4BGUA 1HZJA 4YAIA 3FRJA 2IYPA 2CZCA 2GN8A 3I9KA 3PIDA 2VZ0A 2CF6A 5ES3A 2ET6A 1GYQA 4YQZA 5IN5A 3INGA 4KWIA 4AJPA 3U62A 2Q99A 5A9TA 2X58A 3ZWYA 4YEDA 4XDYA 1SNYA 5DN9A 1P0FA 4NDNE 4Z3KA 4Q39A 3TF5A 1XA0A 5L45A 1EQUA 2ZB3A 1NWHA 2RH4A 1YJQA 3TN7A 5BSEA 4UVGA 5CDYA 3ANNA 2YUTA 4E4YA 1U5CA 3JQAB 1BGVA 4FC6A 3PK0A 5DZSA 2NVUB 3P5SA 3SVTA 4XDZA 2I67A 2NU9A 3TNLA 2GCGA 2HUNA 1ORRA 4PLHA 2OXIA 2CF5A 1PQUA 3MOIA 4HFMA 1I3NA 4I1IA 2Y68A 5JE8A 1OAAA 1IOLA 1ONOA 4BNLA 4MVJM 1I30A 3RC7A 1LDGA 4MDHA 1B15A 2FP4A 5MDHA 3PRJA 4MKRA 1P1IA 1VJTA 4AJKA 2OBNA 5I7EA 3JQ8A 3ZWPA 2B36A 1F17A 4GVXA 5L3ZA 3WGHA 4YBZA 2QHXA 3B1KA 4PIVA 5ICMA 1QMGA 4JP2A 1MUUA 1XSEA 1EBFA 1C1XA 4NMHA 3W8DA 1WMAA 3HFSA 1GV1A 4K6CA 4PZDA 1KY5A 4PZEA 3VDRA 2AW5A 1I3KA 5DP1A 5TIIA 3MTJA 3UICA 1VE9A 4ITUA 2Y0CA 3VPGA 1CJCA 3JSAA 1LI4A 1T2EA 3SJ7A 1ADGA 2Q50A 4C7JA 1LDYA 1FDWA 4FBGA 1WDMA 3UAGA 1NHWA 1N2SA 1M6WA 3H2ZA 4MP8A 3D64A 1U8FO 2X86A 4IGFA 1RYDA 3QWIA 4YTEA 4QFDA 4CLXA 3ZU3A 1E1NA 1N92A 1RYEA 3JQGA 1LRKA 2DM6A 4Q9NA 4TRNA 5A4DA 3WGGA 1XYGA 1JAYA 1YOVB 1QRRA 2ZCVA 4BL5A 3WGQA 2O2SA 4H3VA 4MVJP 1B2LA 1WDLA 4B7CA 3WWYA 3KEOA 2NWQA 3JD1A 5FYDA 2FR8A 4QSMA 2CDCA 4FJ1A 5ER6A 3JQ9A 3I4FA 2PLAA 2ZIZA 4DQUA 1MC5A 3SEFA 4AJJA 1E3JA 1NR7A 1VKOA 4AJEA 4D44A 4PRLA 5AXDA 1EDOA 3FPLA 4NJMA 1PJBA 1TVEA 4PLVA 2ZYAA 2HLPA 1P74A 4CM6A 4GBJA 5C7OO 3GMDA 1DRWA 2I3AA 4MO2A 4RGBA 1QYWA 4PGFA 2PY6A 4RQUA 1PS9A 1WZEA 4UVEA 1XG5A 1RM3A 2VQ3A 3JYNA 4U0KA 4IDAA 3CPSA 1TI7A 1RJWA 2QRJA 1YQGA 4NK4A 2D5AA 1XU9A 1WPQA 4IUYA 4CUKA 3DAFA 2O7SA 3GH3A 4J2HA 4PVCA 5A03A 4LW8A 2AMFA 3MJSA 3WIDA 4MVJE 1NWCA 4FGSA 4QXMA 4N5LA 1CIVA 3DO5A 3LT4A 4BV8A 3DXFA 1E5LA 3S1LA 2W98A 1YJ8A 5COQA 4LCJA 5LC1A 5IZ4A 5DCUA 3RJ9A 4BNKA 2D0IA 1E3IA 3EHEA 2AE2A 1XGKA 4II2A 1NX6A 3AFNA 1HRDA 4D3DA 3NJ8A 3TZQA 4OO3A 1JKJA 3X2FA 4D0RA 1HLPA 2GSDA 2QYTA 3AOGA 3EYWA 3GN1A 1HE5A 2CD9A 2HMUA 4M87A 5FF9A 1U4OA 3DMTC 3KLMX 5BSHA 1UXGA 4IQ8A 4N5MA 1MFZA 1VSUA 1V3TA 4DMMA 3RFTA 4NK5A 3MJCA 4XR9A 1E3LA 3WQQA 3PWSA 3S2EA 4PLCA 3QVWA 4XYBA 2E48A 1QP8A 4WEOA 2X5KO 4GGOA 4TWRA 3GGPA 1F12A 1HSZA 3GVXA 1X14A 1XELA 3GOHA 4BO6A 2PKRA 4FFMA 4KUEA 3RC2A 3U4HA 3Q2KA 5KKCA 4I5FA 4G5HA 3F46A 3LT1A 1EFKA 1H93A 2FSSA 3GUYA 3G79A 2BELA 2PGJA 4ID9A 5DP2A 4JCOA 4JJGA 3E9NA 2DU8A 1ZVMA 4R5MA 3NT4A 3MZ0A 1LQUA 2OZPA 1IZ9A 2ZB8A 3LSYA 3ZHBA 4LMPA 4HKTA 1OC4A 1V3VA 4DC1A 1NAIA 2GF2A 4OQZA 4XGNA 1N1GA 3RROA 4DA9A 2LDBA 5JCJA 5IN4A 3FD8A 3GT0A 2FSVA 1YL5A 1PSDA 2O3SA 3GC6A 1K2WA 3GDOA 2HMWA 4GKBA 4FGWA 4RVSA 1DO8A 4AJIA 5C5IA 2FPPA 4TRRA 2HMVA 1YB4A 3IKVA 4JGBA 4XIJA 2VWHA 2BI7A 3PHLA 3WBBA 1B3BA 4OL9A 3K8ZA 2XAAA 2H6EA 2VHZA 1ZEMA 3D0OA 4CM4A 2BFAA 3SX2A 3GFBA 4DREA 2VYVA 3AY7A 3NX4A 5HWSA 3GNSA 1QYDA 5K0ZA 4BNVA 4E0BA 2ZATA 1Q7CA 1YBAA 3AM4A 2WDZA 4YA6A 3NV9A 1DRVA 3H9JA 4RVFA 2PGLA 3V1TC 3D3WB 1R4NA 5FWNA 3OJEA 5DBFA 4W9NC 1H6BA 5T64A 2E82A 1KY4A 3HN2A 3PYLA 1U7HA 4M89A 4WEQA 3I6QA 1HLDA 1DFGA 3FF4A 5CEEA 1J4AA 4JBGA 4E5YA 3DBVO 3BMOB 2QZZA 1ULUA 4LVUA 3RSHA 5AQ1A 2RAFA 4ESOA 1V35A 3B20A 4PN3A 4XWYA 1VJ1A 1KVQA 1D8AA 3ASVA 3MWDB 4O5OA 4YCAA 4LGVA 2OP1A 3KO8A 1JKIA 3ZWXA 3BHJA 4BNYA 4BO1A 4OKNA 5DNAA 5GZ3A 3A14A 3GVPA 4FN4A 2X23A 1C0PA 1PIWA 2V65A 1H6DA 3UOGA 4B4WA 2H5LA 4U0JA 4NBWA 5FI3A 3VVCA 3F6YA 5DOVA 5KVSA 1RM4A 3C7DB 3CEAA 4MP3A 5COBA 1C0LA 2RHCA 4NJOA 4WOKA 5A1TA 3VPFA 1T24A 2C5EA 3CH6A 1YB1A 2VTDA 1Z45A 4PVDA 3E9QA 4ZHSA 4J6FA 8LDHA 2B37A 4YAKA 2BFMA 4GSKA 2PZLA 1LC3A 3JQAD 4E33A 1AGNA 1H5QA 2J5QA 3DR3A 4R3WA 4GL4A 4D3FA 2NQTA 4YAGA 4NU6A 1BDBA 4OSPA 2CDBA 3T7EA 2Y1DA 1TB4A 3HHPA 4BNTA 3SBOA 3U9LA 3RAJA 4E6PA 4R68A 1GQQA 2Q46A 3GFGA 1R0KA 2GZ1A 3JQEA 3HDYA 3KYDB 3D4PA 2J3IA 5CAEA 4F6LA 4WPGA 4R1UA 5FI5A 5KWEA 4NU5A 1B8PA 1ADBA 4D7AA 2W4QA 4QO7A 4DRYA 4Z0TA 1QV7A 3NEPX 1A4IA 1ZW1A 2JCYA 1A72A 4XZ3A 5KNLA 2C7GA 2PD6A 2Z1NA 3CZMA 5CDGA 4R1TA 3D1LA 4NFYA 1ENOA 2HCTA 2YHIA 3KZVA 5EL0A 4DIFA 4HWKA 2VUTA 1HTBA 3UFXA 1VI2A 3VTFA 5EPOA 4YT5A 4O0LA 3N58A 3QVOA 3H5AA 3OH8A 4BKQA 2W2KA 4DUPA 3GLQA 4N18A 3DOCA 4BVAA 4H16A 4AL4A 1A71A 2AHRA 4NR0A 3ROPA 2NV6A 2UVDA 1PJSA 2JAHA 1HDYA 4BHTA 3KRTA 1V6AA 4CLDA 2HU2A 3IS3A 3KYCB 3D5TA 4TZKA 4A73A 3M6IA 2YHUA 3L4SO 1DIAA 2DTDA 4EW6A 5IDWA 1CWUA 5LDHA 2E4AA 1Y8QA 3GA0A 1C14A 2JFHA 2YFHA 1I24A 3D4OA 4J91A 3RBVA 2FR1A 4IDFA 2Z95A 4XRRA 5K6AA 3PLNA 1XHLA 4HNGA 3ICPA 5DT9A 5CEFA 1Y1PA 1ENZA 1B7GO 1G0NA 2BKAA 3LF1A 2VZ8A 2VUUA 1W6UA 1O6ZA 4WJZA 1E0DA 1KIFA 3Q1LA 3DZGA 1XR3A 3WSWA 4NFHA 1HDCA 3BXXA 1TEHA 2EGHA 4CMIB 1YRLA 1Q7GA 3KVOA 1LLCA 4S3MA 5G4LA 1I3LA 3VH4A 1KBZA 5L7YA 2DKNA 3Q11A 4QFCA 2FPGA 5TRTA 4ZJUA 3CMMA 5BR7A 3BMNB 3GMSA 5L7WA 1I01A 3EAGA 3LZ6A 3M1AA 4UUPA 4XD2A 1LBEA 3HDJA 1UXIA 4OGWA 3ZNQA 1GPJA 1QYVA 1K6IA 5ICSA 1BSVA 2BFOA 4FQ8A 1ISMA 5L95A 1LX6A 1I32A 4Y8VA 2GERA 3ZHYA 1U3TA 5JYEA 3OA2A 3KEQA 5CPFA 1TT5B 5A5FA 1CDOA 2D1YA 2FMUA 2O3UA 3AUSA 4BOYA 4A26A 5A3VA 1WZIA 4YJHB 1W8DA 3ROKA 3PQDA 3NTQA 4MINA 4RO0A 2PV7A 4J0EA 3RUHA 3WX0A 1A9ZA 3DZHA 2VRBA 3GPIA 4GX1A 3DQPA 4IQ0A 3H8VA 1BWSA 1PS0A 3WTCA 4YT2A 3TJRA 1JAXA 4MVJF 2E37A 1BTOA 4W6ZA 4YJFB 4WASA 2J6IA 2PH5A 3ZI0A 2AQHA 1AHIA 5CEJA 1T2DA 2UAGA 1FXSA 4QTZA 2OO5A 3I52A 2ZYDA 4M54A 3N7UA 2BD0A 2AQ8A 3FTNA 5JAQA 3DDNA 1K5HA 4JLWA 2HAEA 2I65A 5GZ1A 2SCUA 2X9NA 1IPEA 1IHXA 4J90A 1ISFA 2VUSA 3DOJA 1IZ0A 3EW7A 3P7MA 1SB8A 4J43A 4NNJA 3ZU5A 4YAEA 3ZWOA 4BNXA 1NP3A 2X0IA 2Z5LA 3F5SA 3Q0EA 4HY3A 3RI3A 4CM8A 1PX0A 1HE2A 2PA3A 3BMQA 2PZKA 2JD2A 2PFGA 4BMNA 1SAYA 2XXBA 4RF2A 5BT9A 4ZQFA 3OJFA 2O3JA 3GNTA 2HMSA 4JJFA 3Q3CA 4Q3NA 1PQPA 2RCYA 3KHUA 5A5EA 4IINA 2Y0DA 4HFNA 3F1LA 3L4BA 3F47A 3GEMA 2EF1A 3DONA 1L1FA 1JLLA 2JJYA 4BKUA 5EESA 3S8MA 2ZTLA 4CL8A 1ISHA 1XLTA 4XQGA 1PGJA 1F14A 1E6WA 2UUOA 1E7RA 1NNUA 5G2OA 5H82A 3UCEA 4IIUA 4HFJA 4OHUA 3BTOA 4CUJA 2WJPA 4IM7A 3RU7A 5T6BA 4I9NA 1ONNA 4EZBA 1GEGA 3PHGA 3WGTA 4IJKA 1JWBB 5A9SB 4J7UA 4NZ9A 1EK6A 4OYRA 1RPNA 3AWDA 1HDRA 1C1DA 1NPYA 4JQCA 4XA8A 5TS3A 3L6DA 3WQRA 1P44A 4RF5A 3DOOA 1U9JA 1TXGA 1ZK0A 4R9RA 3JD0A 1HDOA 1V0JA 4ILKA 3RD5A 4YJGA 2W2LD 3K5PA 3EVNA 4MPDA 2B4TO 1EE2A 2OP0A 1EDZA 1TA4A 3DBRB 4RDIA 1HSOA 3H3FA 1HDZA 3OECA 4IDGA 4E2XA 1DIHA 1E7QA 1P77A 1PGNA 4QQRA 4GH5A 1GUZA 1YBVA 2QQ5A 5JDCC 4CMBA 1XWFA 4NBTA 5I9MA 5B4UA 1ZK3A 3H9UA 5TJ9A 4DXHA 1DLIA 4WGGA 1BXZA 4I5EA 3O26A 1QXSA 3FR7A 2P9EA 4IQGA 5F3RA 2QRLA 1Y7TA 2FHSA 4UVHA 3ZV4A 3ZU2A 1QG6A 1P1FA 2I6TA 5G0TA 4IPTA 2I66A 3AUAA 3ZZNA 3QLJA 5KJCA 3WOHA 1FDSA 1PL6A 4HX5A 4JX8A 1PL8A 4XQCA 1E3SA 1KEVA 4AJ4A 1SPXA 3KBOA 4ALKA 5JC1A 4CR6A 3WR5A 4ALIA 4YB8A 2NU7A 4DLAA 2BHLA 3WYCA 4TRMA 2IXAA 3WXBA 4K26A 1X1EA 4J49A 4KDEA 1DC6A 4JROA 1GZ6A 1TT7A 3HWRA 1MFPA 4IS3A 4DPKA 1MG5A 4K28A 2GN4A 2IZZA 4CJXA 2P91A 3K96A 4CQMD 1SO8A 2Q1TA 1DAOA 3QE3A 1E7SA 4EJ6A 1PJ4A 4CL3A 3PJDA 3Q2IA 4WECA 1XKQA 3FNEA 1ID1A 3ANLA 2JCVA 3LLSA 5DOZA 4BGEA 4RDHA 1K6JA 2HMTA 1B26A 3NRCA 4E30A 5CHEA 3DAPA 2X1HA 1F06A 3WNQA 3WGOA 4HFRA 3C1AA 4ZQEA 5G0SA 2DUWA 2XXJA 1WW8A 4E31A 4CV0A 3ETEA 2VWPA 3JYOA 1RWBA 3GHHA 5K9ZA 1HETA 2V7PA 4M1QA 4IXWA 1QR6A 4IZIA 3F1KA 2PKQP 1E3EA 3PHIA 1ZK1A 2P4HX 4B3HA 3GDGA 2NM0A 1P1JA 2OHXA 3OFSA 4II3A 4MIEA 2AQIA 4RVDA 4UVIA 3ENNA 3WYEA 2VYND 4MJLA 4A0SA 2EWMA 2IXBA 1H9AA 4NIMA 1SC6A 1MGOA 3GVCA 1Y9AA 4PLTA 2P4QA 2J5KA 1JQBA 4DLBA 4CMJA 4RPLA 3WWZA 3PJFA 1YS4A 1NFRA 3U09A 3FWNA 5C7LO 3V2GA 4FW8A 4BNJA 4P38A 1DB3A 3DL2A 3ETDA 4K6FA 1LSSA 1E7WA 4D0SA 1KEUA 3MJTA 1YBMA 4KP7A 3UXYA 1EBUA 1M2WA 3OETA 1Y5RA 3ABIA 4HP8A 3DB2A 4O59O 3NT5A 3JYQA 2PR2A 3LF2A 5G0WA 2DVMA 5ADHA 3AY6A 3JQ7B 3AM5A 4A03A 2EP5A 3W8EA 4DBVO 2AEJA 3TPCA 2EGGA 1DRUA 1VLLA 3ZNPA 4AJHA 4PFJA 2P68A 2B0JA 3NGLA 5JXWA 1GEEA 1N7HA 3EUWA 3JQAA 4ZRMA 2NVUA 4M49A 3PXXA 3IIEA 3I83A 2X0RA 4ZICA 1BHSA 3TRIA 1KS9A 5MGBA 3HE3A 3ZWWA 3PDUA 5EMHA 3P2YA 4CM1A 3OQ6A 2X0NA 1HT0A 3ZNOA 4FB5A 3WJ7A 4PG8A 4OXNA 5LDGA 3U49A 4UUNA 3MJVA 2DT5A 3UHAA 5JC8A 4D41A 2YFQA 4R1NA 1S6YA 3I9JA 1R16A 4DQVA 4O6VA 5G4KB 2VWQA 5JYDA 4BO5A 3PHJA 1LNQA 1LLDA 4B7UA 4CLRB 1NASA 4CMHA 3VAZA 1XEAA 4I08A 3JQDA 2HK8A 1EFLA 1J6UA 4ALLA 3VDQA 4XX0A 2NTNA 1JTVA 1LC0A 5EINA 3OA0A 2EKPA 4JBHA 3NDIA 5A05A 4CLHA 3GEGA 1GADO 4XYGA 2PTGA 2HQ1A 2ZKLA 1AXEA 3G17A 4INAA 2IE0A 1R4MB 1DPGA 4F46A 3RUIA 2B83A 5U4QA 4UEKA 1G0OA 4RVGA 1ZH8A 4A5OA 1T26A 4M55A 3W4JA 4FDAA 2BMAA 3HSKA 2NTVA 3L9WA 3JD2A 1K0UA 4E32A 3RIHA 4BNGA 4DQXA 1M67A 1ZUD1 2HK9A 3NGXA 1SOVA 2PWZA 2RHRA 3QA9A 3CZRA 4DGSA 4E5PA 3DMTA 1DAPA 5EIOA 1YOVA 3BMCB 5TJHA 5ILGA 3F5QA 4O63O 4CLOB 4WLFA 5J23A 4YVFA 3IL2A 1MG0A 3INRA 1YO6A 5I8ZA 5THKA 6LDHA 1U3VA 3FSRA 3KETA 4GX5A 2YJZA 1Z75A 2BI8A 2NQ8A 4LRSB 5L4SA 2YDXA 3WTBA 4FD3A 3PJEA 1P31A 1DDOA 2NACA 1NVGA 4RPKA 4Z3DA 5T8KA 3OIGA 4XQ9A 4M86A 1O89A 4C4OA 4U6QA 4CODB 4XYEA 2WWRA 1R0LA 5KJFA 1P33A 3BZUA 3E9MA 3A4VA 2AEMA 1PQWA 2V6GA 3QVXA 3DFZA 4WUVA 4Y6PA 1VRWA 5EQDA 3ASUA 1ZXLA 3BTSA 1WP4A 9LDTA 2VT3A 4IJWA 5T8KC 2B5VA 1WLYA 4ND1A 5BNFA 2EKLA 4PLYA 3RUCA 3DZIA 3OMLA 1LJ8A 4UEOA 3SLGA 3X2EA 5L4NA 5C7IO 5IG2A 2Q4BA 4TSKA 3K30A 1UAGA 1BW9B 2A4KA 3LLVA 5EERA 2GUGA 5JSFA 3TOXA 3G49A 1PGPA 5LCXA 3DBHB 3TL3A 2EEZA 4NH4A 3IJRA 5DBIA 1H94A 1O9BA 2VTEA 4NFSA 4S1VA 4CMAA 3G0OA 5JPIA 3MJ4A 1Y8RB 3GHYA 3K73O 4MIYA 1ZSVA 3C85A 1QKIA 3VPHA 1IULA 3O03A 4CV1A 1FJHA 1NVMB 4ALJA 3F4LA 1GV0A 1A27A 4FS3A 3DMYA 3G3EA 3I9NA 4XQEA 2W90A 1UUFA 4Y98A 4MVJI 4R16A 5B4TA 4ZVVA 1I8TA 2GPTA 2Y66A 2O48X 5TGDA 3WGIA 4OXKA 4W9NA 2JD0A 1ENYA 5HTOA 1X7DA 1E77A 4UULA 3WLFA 3HFGA 4HNHA 1YGYA 3FNHA 4KDFA 3DBLB 2QIOA 4N54A 3OIFA 3FPCA 4Y6SA 3OQBA 3VKVA 5FEUA 3O38A 2O50A 4IY1A 3W8FA 1GAEO 1PL7A 2WE7A 4NBUA 1BW9A 1V9LA 4BQPA 2Q1SA 4E2YA 4MVJD 3V2HA 3ZWMA 1HE3A 1VL6A 3PWZA 3RC9A 1W0CA 4J2OA 3PZRA 4YDRA 3WNVA 2Y1FA 5T67A 2QYSA 4YQYA 5HA5A 3AI3A 3O9ZA 1TLTA 3NT2A 2EP7A 4P4NA 4YYZA 3WICA 2HSDA 4IGEA 3H5RA 3OSUA 1ARZA 4RQTA 1T2AA 1DLJA 2FN7A 4OQYA 5KVQA 4M8SA 5KVCA 1SEVA 3WLEA 3CIFA 3GZNB 5JAIA 2C7VA 1EK5A 1UZLA 2C0CA 1Y5MA 3PLRA 4OIMA 4YXFA 4BS9A 1LTHR 1B3RA 1YL7A 4JN6B 3RUFA 5KCZA 4X54A 3U4DA 1UDAA 3AI1A 4LN1A 4FC7A 2GASA 2OMEA 4RPGA 1H6CA 4PZCA 3ROQA 4WOJA 3IUSA 1IE3A 5F1PA 3CMCO 1JKFA 2P5YA 3CUKA 3EK2A 3ONDA 2NU6A 4D42A 3HB5X 3OEYA 2YYYA 3ZGYA 4BO0A 4DPLA 1HF3A 4D46A 5GZ6A 2JHFA 3R1IA 3U3XA 1DJNA 1LXCA 1KVSA 2C07A 3ZHZA 3A1NA 3K2EA 1DBVO 3BA1A 4R51A 3D3WA 3FI9A 2DUUA 5HS6A 4AJNA 4LSMA 4YRAA 4GLLA 3WG9A 2J5RA 1NHGA 1PTJA 2EIHA 1PZEA 2W2LA 4PLGA 1PJQA 3IP1A 4CQMB 2GZ2A 3CINA 3JQFC 3BMOA 4OMUA 1XCBA 3DHEA 1I0ZA 3E6AA 4B7XA 1PEDA 1E6UA 4IXTA 4OM8A 3KSUA 5I7SA 4BNIA 3Q9NA 4J16A 3H7AA 1E5QA 4RLSA 3A28A 2AQKA 4GAEA 2POQX 1HE4A 4J4HA 1O94A 1EUCA 3TZ6A 1VJ0A 2OL4A 3GNQA 3QWBA 1F8FA 2AA3A 3ST7A 4A2CA 1T1RA 2G0TA 2PNFA 1CQIA 3DHYA 3WQSB 4I9UA 3ZWVA 1ZEJA 3M1LA 1JN0A 1DSSG 2VHXA 4A27A 3ZN2A 3EGOA 1Q0QA 4Z0HO 4CM9D 4W82A 3VH3A 3PEFA 2Y1EA 2P2SA 4MIOA 4BQRA 2YZ7A 3LT2A 4KOAA 3UKOA 4OOEA 3C1OA 4JK3A 5ITVA 1GU7A 4CMKA 2OFPA 4ROSA 4XR4A 4K1LA 1H2HA 4Q3AA 1Q0HA 4IMPA 1KVUA 2GN9A 2Y1GA 4ZA2A 4Z0PA 1D4FA 1ZJZA 3VOSA 4WCFB 1D3AA 3ZWAA 3KYDA 3M2TA 2NU8A 3QJ5A 4Z9FA 4MKXA 3D7LA 1UP6A 4EUFA 4MVJH 4BKOA 3L77A 2QG4A 2C82A 3OHSX 2WD7B 1NM5A 1EVIA 5I9LA 1IHYA 1DHTA 3HJAA 4R54A 1N9GB 4L73A 4LMRA 3HN7A 3CE6A 4CUZA 1XQ1A 1I5RA 1LSOA 5ITWA 1A7AA 2ZCUA 4DWVA 2I9PA 3OP4A 1QYCA 4PLFA 4JP3A 3S2FA 1B8VA 1L7EA 2JL1A 1UH5A 1UP4A 2X0JA 5I9NA 3RASA 1I2BA 2J8ZA 3HADA 4RORA 4DBZA 3W1VA 1C3VA 3KYCA 2EKQA 2X4GA 2VYNA 5A3JA 1YL6A 2R00C 4B4VA 1KC3A 4L0QA 4BNUA 3OF2A 2X5OA 3AW9A 4Q3DA 1T1SA 3K9QO 2D8AA 3PFFA 1YWGO 1LLQA 1Q2XA 3C7AA 4MVJG 4GMFA 3GF4A 5FFFA 3OQ1A 4UVDA 5DCYA 3E8XA 1GQYA 4FOSA 3A9WA 4Z9XA 1LUAA 2DBRA 1QV6A 1A9YA 1JVBA 1UJMA 2YQ5A 1ADFA 1LRLA 2TMGA 4BNNA 3E1KA 3B1JA 3I9OA 4MP6A 1GY8A 4FSHA 4AFNA 1JA9A 4WCFC 1UR5A 1B14A 1LDBA 5U1PA 4CMIA 2JD1A 4GWGA 1YQDA 4A10A 5I8WA 3FTPA 1DFHA 3PYXA 4L4SA 4J7XA 3OJOA 2PH3A 3BMNA 1DC3A 2D59A 4NPCA 1LSUA 1PJTA 2NNLD 2J3JA 1BDMA 1GTMA 3WIEA 4R3NA 3MTGA 5CG1A 3TWOA 1ZNQO 2Y93A 3RVDA 1E7YA 3LC7O 4CQLB 5EQFA 2EV9A 2C59A 1MLDA 3H65A 4MOWA 4FFLA 3ULKA 4QX6A 3TZHA 2EW2A 2F1KA 5B37A 1MX3A 4Y67A 5AXAA 1P3DA 4IS2A 4L9RA 7MDHA 4BNMA 1JW9B 1BXGB 3OJLA 1E92A 3EMKA 2XF8A 1TT5A 4Q3CA 3D3EA 1U1IA 4EEZA 1ZSYA 3WMWA 5JDIA
chains in the Genus database with same CATH superfamily
4N9QA 1OLSA 1W2WB 3KSDO 3EMBA 4CE6A 3JZMA 2YQZA 4WOPA 5GADl 5HQ3B 4KTTE 3AM1A 3E18A 2QLBA 1UZMA 3SDBA 1U0NA 4L8VA 3OE1A 2ZR7A 3D4LA 2HA7A 1ZW6A 2PSJA 3ABRB 4MQUA 3LGXA 4FDLA 3ZHXA 3WLQA 5AOCA 1IHDA 4Q9JA 3LXMA 3LL7A 1D6JA 1HFJA 3I23A 4MRMB 4NENA 3NS7A 5CDUA 2EATA 3FNQA 1YVEI 1BDHA 2F1RA 2G5CA 4E5KA 4I9HA 2ENUA 1F51E 1W73A 3AEZA 3QVKA 1SBIA 4X91A 1XF1A 1ISIA 1CUAA 4ARSA 4QHSA 4DWOA 1XKLA 3A4NA 2VH1A 1R15A 4O4HA 5CW1A 4KV7A 4YLEA 2E4VA 1WX1A 2Y92A 5BWBA 2OLJA 4UBIA 3LO8A 1VHTA 5IXJA 4ZD6A 1OJ7A 2C96A 1ABBA 4RLHA 3TPFA 4YPOA 4F2GA 1OAKA 3MGCA 5TB5A 3ZS9A 2H2AA 3DS8A 4D74A 1EM6A 1UM8A 3VV2A 2YNMA 4QVKA 4UUMA 1PNTA 3GMIA 3HYLA 2F1HA 3MN1A 4ZRNA 3WGUA 5AW8A 1T0JB 2DWPA 1RZUA 2CL6X 2FK8A 2O3QA 2O4CA 3GUCA 4PX5A 1ZRNA 2CXTA 3B36A 3CNQS 4Q4JA 5CJ2A 3L84A 1AK9A 4GW3A 1HPLA 4D8WA 3RYIB 9LDBA 4A6DA 1W7AA 3ELUA 3BCUA 3GQVA 3E82A 3Q5EA 4N65A 1W88A 1OW3B 2RKBA 2DQSA 4YHHB 3O82A 3CZPA 2P69A 2ZB7A 5JMWA 1JDNA 4C20A 3EF3A 2XH8A 4GQIA 3QPAA 4I1UA 2FWMX 3FMIA 1FNDA 4EHAA 5SY9A 1GSIA 3V46A 1I2AA 2GLXA 2V6FA 4AZ0B 1DGQA 4RACA 4XGQA 1RQ7A 3ZS8A 4C7OA 2DHQA 1L5FA 2G6BA 3QPUA 3NYWA 4L57A 2BISA 3AUUA 4P4LA 2RH5A 2R8OA 1IMJA 2J4DA 4ZAZA 3A04A 3UMFA 4EHKA 4OJKA 2C83A 4TKVB 4YRTA 3OU2A 4BFWA 4A8TA 1J0XO 3IV7A 3TXYA 5B1YA 3O4GA 3HXMA 2NW6A 2QRUA 2KSQA 2VHEA 4LHVA 3L1KA 4LZOA 2R6HA 5DLYA 5A9SA 5KTSA 3NDPA 4ZGGA 2PZAA 2ZULA 2QTTA 4Q4HB 3OLWA 1DC4A 1D4AA 1LBQA 2Z9CA 3DVSX 2PT6A 4N3CA 2BLLA 4NV1A 4D4JA 5KZMB 4GHWA 3UT5A 2DJIA 2EKDA 2VXYA 2PG3A 4ZI5A 1UPXA 1V8PA 2QR5A 1BS1A 5K3OA 4ARCA 3QTLA 1E2HA 3DHNA 4JJIA 1PV2A 1DKPA 2FUCA 3JASA 1UKEA 4D79A 4F1JA 1Y9DA 1CK4A 4C08A 4H7PA 4ZV4A 2FLKA 2GBCA 3EC7A 3F3KA 2F4NA 3K1ZA 1Y7LA 3ESRA 1XMXA 3IVCA 2FY8A 3DBRA 3KUUA 4Z8YA 3P9RA 4DMCA 4DJAA 1A7KA 1YRYE 2CDAA 2R1ZA 1GKLA 4MV5A 3R7SA 3LUHA 1XLWA 2NADA 3IMEA 4BFVA 1ZMOA 1U8CB 4EEXA 3KAKA 1HKUA 4WCDA 2UUCB 3Q9UA 2XB2A 5DHUA 3VVBA 2X8LA 4Q7KA 1SHTX 1YQWA 2G08A 5DI9A 5IAEA 1A95A 3LCVB 1ILEA 4NF2A 3ZLBA 3AUJB 4Z1OA 4MS1B 1XAHA 1DBQA 2PUTA 3Q3GE 2B7CA 1XXHA 4G65A 1RXCA 1M2OB 2DY0A 2QTZA 2YRWA 2KMLA 2O06A 3KLOA 5EP3A 5BO5A 2AGVA 1JDJA 2ZRNA 3OI7A 1YVUA 3QWFA 1YAJA 5CLJA 3DL4A 3TTXA 4XI9A 2V54A 4GQAA 3H1PA 2G77B 3EWIA 4MA4A 3C39A 3H99A 4G24A 3ZR4B 4XYLA 1PLJA 2H2GA 1A77A 2QL7A 2V7VA 1NBHA 1STOA 2HA5A 2I03A 1DBWA 2QRVA 4HEJA 3PIIA 4IWYA 4PC3A 4JXZA 4LYJA 1VL8A 1L7QA 3ZDXB 4AS3A 4K7JA 1MB3A 4LXGA 4UQPA 3RSCA 4DMGA 3KFLA 5KSWB 3SOZA 3SIWA 2L42A 1XMVA 2RGCA 3FWHA 4UCQA 2E18A 3ZCPA 4B6OA 4UOEA 3U61B 4QXPA 1OI4A 3Q8LA 2DH6A 3BL5A 3IEVA 4RTSA 1J0EA 4EJSB 1EG2A 2PZBA 4MVJA 1WEHA 2DQYA 3I76A 4LNUB 5JS2A 1R8SA 4YUVA 1UFKA 2XGGA 2A14A 3O0TA 1MOSA 1UDBA 1CRZA 2V6BA 3M5CA 4UDYX 3ROMA 4UJ5A 1OC2A 2IPMA 3KCNA 3SFVA 1W34A 2VPTA 2D5BA 5JFGA 2QUHA 1EHIA 3DZCA 4EYSA 2VUIB 1TEVA 2G1PA 4H1UA 3DO6A 4J07A 1UBHS 1Z08A 3BTUA 4OBXA 4MQMA 2IOQA 5DDIP 1KDTA 4NH0A 3U1VA 5F5NA 4YP7A 1W2HA 3H5NA 1KRXA 3FBTA 5CFQA 1TJ3A 2RK3A 3W6OA 1MC4A 1TJNA 3AV0B 3E05A 1EDEA 2NLOA 1N9KA 4NX2A 1BJTA 1Z5WA 4JB3A 3K31A 1NBMA 4MUYA 4RKEA 1JQLB 4URZR 4XGIA 3T3GA 5KOIA 2Q5IA 1CQZA 5L40A 3SC2B 4XUEA 2A1TS 3OPQA 5ELLA 4E6EA 2D7DA 1MT0A 4R7GA 2O19A 4NPAA 1FBNA 2JAXA 3WHKA 3L40A 3F6SA 3I3SR 1E9BA 4X24A 5FWDA 3H1GA 1DIGA 1R66A 5IHPA 1SQGA 2PZ8A 1JXOA 3EQ8A 4CMEA 2ZTMA 2N1MA 4N6GA 1UDRA 3AESA 3R6TA 1HDXA 1Y9EA 3P96A 3ZW9A 3T3HA 2AXPA 5FXMA 3GRPA 4I3FA 2YX1A 3MQ4A 4G07A 1JF8A 3OEHA 2RBEA 1XZDA 3DZJA 3QIVA 1I4TD 1I6MA 4XVCA 2HRRA 4NI5A 1U0SY 1ONPA 3LRTA 4R41A 1G7TA 4IHJF 3RK1A 2VNHA 1LW6E 3IBGA 1KP2A 2PZEA 4QJ5A 5H3CA 1GDTA 3ZX5A 3KLPX 5LOVF 3NNNA 4OOFA 2EFYA 1XD9A 1JYSA 2QLJA 4C0KA 4WXHA 4XOUA 3TQFA 1RC1A 4AB1A 1J06A 2E0IA 2OV2A 3HNPA 4K6GA 3GU3A 3LU1A 4MUBA 3S55A 4EYQA 2W70A 4PHHA 3THRA 1R5NA 5FAXA 5LU9A 4E3ZA 4X1OA 2KJQA 3GFPA 3LOQA 4EJ2A 4PRKA 1Z88A 4EOGA 5L6LB 1SUDA 4L6AA 2H00A 4NHEA 4RY9A 4OQLA 2WIKA 5UKDA 4C0HA 4MS3A 1UK9A 2WD8A 4J1SA 6YASA 1Z6ZA 3GLRA 1IZ8A 1WVMA 4F6CA 3G2KA 1OWLA 4GEGA 1VXRA 1VBMA 2V4MA 3QKSA 1QH8B 1ZI9A 3MWFA 3ROEA 1ZINA 3QKRB 3RU9A 4CM9A 3I2YX 4EPRA 3K20A 2CLKB 4QDUA 3ET4A 1AG9A 2XNDA 3WJ1A 4D57A 1PZGA 1UMBA 5ALQA 1QFYA 5BRJA 1X7YA 4GT1A 5I4KA 1VCIA 3BQNB 4WE3A 2WDPA 2IGTA 5F1OA 4OLJA 2PXAA 2R60A 5C37A 1L4YA 4G2TA 4S1OA 4O4IF 2OUKA 4XGRA 4PG6A 4EBFA 1NVEA 2FW0A 2ZRMA 1JR6A 1S89A 1EA7A 2DKFA 1ML3A 3OVMA 3EZ2A 4R6WA 3W78A 2I6SA 1DP4A 4ZHQA 1TEZA 6CHYA 4DMHA 1ITZA 1HL7A 4ESVA 5ALIA 3LDHA 1G18A 1PW5A 3A1WA 4XYMA 4X1KA 3AWIA 2J7PA 2O2CA 3P97A 2CVZA 2CXNA 4RK7A 2IOYA 3CKYA 3ICCA 4FMDF 4UNSA 5EZSA 3UMJA 1FRVA 4UU1A 1T3ZA 3PYMA 4RABA 5AVOA 1LZLA 3IVMA 3ON5A 1KKLA 3R5JA 4QGHA 1CC1S 5CGZA 4Q01A 5F64A 3RVPA 3TMAA 3VU3A 2IU4A 3I4LA 1BRTA 1FS5A 3UQYS 2FPWA 3K0FB 4EA6A 3UTCA 1NI5A 1W47A 4NNPA 3HVHA 1H05A 3QNMA 3RT1A 4P83A 4FYWA 5WRFA 3TUZC 4MEJA 4K5QA 4U8GA 2G40A 1B16A 4FU0A 2B6HA 3G23A 4Q1CA 5JECA 1XBTA 4H31A 4A91A 3GGGA 2BFDB 2MMCA 1JEQB 2GD2A 4OHRA 5ICEA 1SXQA 2C8KA 2R84A 1UJNA 3EVAA 2OAP1 2QE6A 5LA6A 2I62A 1CEQA 5I7AA 4HAOA 4YRDA 3SBEA 4CKBB 2DT8A 3QHPA 3EEOA 3CT4A 1PU2A 3QOFA 4YJ2B 1BU5A 2JFFA 2NUPA 1OROA 1THTA 1ZXBA 2BGMA 1Z15A 3BD8A 4IYRA 3B6ZA 4MICA 2EJCA 2O8FB 3CTPA 4FHEA 1XD2B 3NYQA 2EL9A 2X9GA 2DFDA 2ZJ5A 2BRUA 2Z5VA 3LPAA 4EY6A 1K6XA 3AU9A 4OXQA 3GEDA 3MB5A 4JC4A 4HH1A 3NFYA 2JHPA 1FU8A 1HOXA 4K8OA 5HIAA 2WV9A 3A1FA 3C98A 5IJ9B 4NBRA 1YS6A 4LPSA 1U2ZA 2QLFA 1Y80A 1BX1A 3EULA 3SG0A 5K1ZA 4CF4A 5CX4A 5AKZA 4DLPA 4HT3B 3TINA 5JY1A 2F9FA 3AK4A 1ZO8A 3GLGE 3WK5A 1IH8A 1UXJA 3GAMA 3GRZA 5ICGA 4LF4B 5AYVA 3IOCA 3BD6A 2VTBB 1VXOA 2XWPA 3H1TA 3HYRA 3HBMA 4V3BA 2AF3C 4MRRA 5AOBA 3SC3A 4Y0NA 2FFRA 5LQRA 1NUQA 3QPBA 3VKHA 3REOA 3ZDAA 4ND5A 5EKTA 4Z4FA 3L7OA 2P6NA 1J49A 4U2DA 5JYBA 3PFWO 5M29A 2WC1A 2AXQA 1EM8A 2XKJE 2C4KA 4OYLA 1XF9A 2ATEA 1JR3D 5DU2A 3RWBA 4KX3A 2EOAA 3HLTA 3SDSA 4LISA 5JO0A 3QVMA 4WNIA 3U5TA 4N5NA 4B3RB 3PQEA 4G4IA 4IRMA 4WKGA 2WKRA 4M9UA 1XTUA 3Q6IA 1NG1A 3I9V6 3M2PA 1XYYA 4Q93A 1BFKA 3CKMA 4LBVA 4U5QA 5C8YB 3NJ4A 2X0FA 1CNFA 4CI0B 2JIOA 3KD2A 4HUJA 1H9CA 2YYSA 3DWEX 4PCLA 1T35A 3C24A 1R0BA 4LOAA 4KZPA 1VA4A 4DV1B 1ULHA 3KZOA 4JI8B 1BWRA 2RSLA 1IBRA 1OXBB 5LQDA 5LP6C 1CZRA 1R0ZA 1DINA 2ZBUA 1OGJA 3K4QA 4EZIA 3DBHA 1M1XB 4D3XA 4BO3A 1RI1A 4QYXA 1EESA 3NCTA 2P2YA 1FX0B 5CLLA 4OJNA 3CVXA 2O0HA 5AI5A 3PXCX 3V1UA 1BQEA 1K5GA 2BC9A 3AF6A 1WDKA 3UVEA 3V8NA 4BB5A 2RHHA 2NT4A 2FSVC 3HNRA 2XGSA 4DZRA 3HXQA 1RBZA 1R0CA 3D8RA 4LGMA 3G2PA 2WYUA 3EPJA 4D98A 2XTAA 2O14A 1NXSA 5HPYB 1WMBA 1ZX1A 1UQRA 4ND3A 4X6UA 2JJ2A 2QMHA 2DPGA 4KNVA 2Y27A 1H0HA 4QU9A 2G9NA 5HW0A 4HAXA 1SKYB 1D2EA 3BCRA 3W06A 1P7CA 1E4YA 2WUFA 2Q0QA 2QIPA 3QM1A 4UQLA 3IHTA 2MOKA 1RI2A 4YCJA 3M3PA 1KZ6A 1SUWA 3WKBA 3ZTWA 5BQ3A 2F1JA 3BICA 1NUHA 1H23A 5C1BA 1CE8B 1CUWA 4O29A 4R83A 1LPNA 4XOIA 5BW5A 4RZUA 1CETA 3ZVNA 1MZVA 4TT3D 3VC7A 1DMRA 3ADPA 2HHAA 3GX1A 1TGVA 3ZV5A 4E2WA 3MAAC 4IUDS 3FIUA 3K9HA 4TTIA 4Y1RA 1H0RA 1NW6A 2GZ3A 2Q8QA 1YDWA 3W9UA 2CNDA 3LTNC 2GHQA 4RFSB 4RIIA 3DBLA 1W4BA 3I30X 3REQA 2BFBA 3S2SA 4ZMBA 2Q5OA 1QOQB 1G60A 1I1NA 4MNTA 3TD9A 5JBIA 4C0JA 3F9RA 4UQOA 3HXLA 3UCFA 4YT8A 2ZOSA 1X1BA 4J7CA 2E7ZA 3IKTA 3WSTA 4NESA 1FXUA 1MPXA 2BJHA 3NIFB 4FYHA 4I5DA 3FG9A 2BM9A 1RZVA 4UXHA 1P0CA 4G1EB 4J0FA 2HM7A 2C58A 2VNAA 2XD4A 4HPWA 3OTOB 1PK7A 2PU5A 5CLGA 4TLDA 4WTOA 5TT0A 3I61A 2LD4A 1MA0A 4OHWA 3VKUA 1X1CA 3BHIA 4ANFA 3G13A 4AIIA 3W8RA 1KYZA 1G7SA 2A5LA 1QO0D 1T34A 3GZNA 3ZNNA 2IX3A 2NXCA 4ZALA 3AVTA 4XIFA 2VZLA 4HGPA 2HGZA 1GTG1 5IC4A 4RETA 4UM7A 4TTAA 2O7VA 1BQ3A 2AYZA 1AUPA 2HLDA 2BE7A 1ZGHA 1NRWA 2ZPTX 4R31A 4OHZA 1M83A 1U90A 4EI2A 2J6HA 5C1IA 1YR7A 2Q29A 2V0CA 3U4IA 2P41A 2RGWA 3RRBA 1KQOA 2I3GA 1E6EA 4X63A 3H4VA 3UZUA 3WWCA 2RBGA 4L9AA 2XJ9A 2WWTA 3SZ3A 4FP9A 2FPOA 4F96A 3LJKA 1OREA 1YR8A 4IRUB 1GPLA 3K1JA 5E9WA 3X2SA 1YZVA 3WZMA 3IUPA 4WFKA 1G98A 3VGPA 4KQCA 3TR0A 4AMZA 3KSZO 3IEMA 1QFSA 1BG6A 3P9CA 1N1EA 1YKGA 2JHAA 3AFGA 2WIAA 2QA5A 1S1MA 1E0SA 2YOFA 4UMVA 1KQFA 1QHGA 2ZE8A 5AUQA 3LIIA 4NAUA 4Q37A 4UASA 3ZE7A 2OSVA 5LBTA 4AMGA 3JQ6A 1CZHA 1YB5A 3BHMA 1F0YA 1GPDG 1SUBA 2CLDX 2ZIGA 2WWFA 4HGZA 2B4AA 4J1NA 2RK6A 5DT2A 3PQ7A 3ANMA 2GJAA 3BCSA 3KDAA 4RMJA 5ITZB 1EWKA 2PVPA 3DFIA 4HQFA 1ODJA 4L8FA 5I45A 1JFRA 1XZKA 4V02A 3JCZA 5E6SB 1UQUA 2G36A 1PRYA 4TLCA 2FPGB 1XZEA 4JVMA 4QQ8A 4RJ2A 2NUAA 2DR0A 1MOZA 4O1HA 4ALMA 1WE2A 3HLKA 3LYLA 3Q7IA 4JJ4A 4MTLA 5AI4A 2ATIA 3CRW1 3N0WA 4PLWA 1EUQA 5F3WB 1SCUA 4QSHA 4Q4CA 5HNKA 1AHPA 2CY0A 5JNTA 2P9HA 1SN7A 1O95A 2YWBA 4EDFA 5CVDA 2PAAA 4Q9KA 1NOKA 3RHSA 2BIFA 2X76A 1XZBA 3UMCA 2BP7A 4P3XA 4BNHA 1KXZA 3ZLTA 5EFZA 4YLGA 2Q0SA 2H7CA 2ZI5A 3FNBA 3QKUA 3X1YA 3G0CA 1MBZA 5JZVA 2DBVO 4LF8B 2R00A 2ECPA 2HNKA 4OSPA 1E32A 3BIOA 3HHEA 3LVFO 1P5FA 4OREX 4C7VA 4LGCA 5JIBA 1VB3A 1R5OA 2H51A 3NEJA 2B4QA 5ERYA 1RTKA 3OZFA 1HYGA 2I2BA 3VTZA 3OIDA 2WU3A 1X8XA 4N9WA 4PXAA 4UMDA 3NRBA 1FDTA 5KX5B 4ZOLA 3R3WA 1DJOA 2JAUA 3UFBA 2R6GA 3MILA 4PCUA 3FI0A 4K8RB 3ZBPA 3ZV7A 3O4RA 4EYKA 4EFLA 1K8ZB 2BFPA 2XTNA 2X2PA 3S7TA 4B4KA 2PXCA 4MYDA 3QE4A 5AKJA 1ODIA 4HBGA 2OCIA 4S2EA 2RHWA 4D2IA 1J9GA 3D81A 4KAJA 4XSGA 2AB0A 3AR3A 3LK7A 3BWVA 3CNNA 4QQFA 5M7EA 2HCFA 2SNIE 4NQZA 3YASA 2AFHA 4BO2A 5ER9A 3DBIA 1P1HA 5B6PA 5KNDH 1OBOA 3B3GA 3OICA 3H6HA 3ZCSA 3DDOA 4UTNA 5KVVA 1T4DA 5JCPA 1W5AA 2FUG6 1X2BA 5K01A 3WDSA 1FLVA 2D00A 1EDDA 3MW8A 1TFRA 2FWNA 2R4QA 2XNSA 2BR3A 1N9GA 4XIJA 5AHXA 5D86A 2IYLD 2Z2ZA 3Q9SA 3SYTA 3ENZA 4P80A 4BGVA 5J4VA 1X7GA 3IOYA 3ZBTA 4P22A 2ZITA 2NSHA 4LXHA 3EZ6A 1WW3A 2W6ZA 3NHMA 5EWLA 5CYOA 2GPJA 4IVRA 2JFVA 3TOCA 5JYCA 4F2PA 3I09A 3EPPA 2WICA 3BE8A 1LF0A 1W4ZA 2H11A 4XJTA 1KJWA 4KJZA 4BV9A 5KYKA 4J1TA 3W5HA 1O57A 2JFNA 1FL9A 3I32A 2DWOA 4J9VA 1KOJA 4N47A 4P3YA 2VTKA 2FHPA 2CC2A 4AJ1A 5F9FA 1Z7BA 3B9BA 3WYNA 1ZN7A 4TMFA 5JFOA 2AVNA 3DP7A 3WISA 3WLAA 1PQ4A 2I99A 3PXAA 4RSMA 2PS0A 4KBYA 1SBTA 4B48A 2EG5A 1J1UA 2HJRA 3ZEIA 2X9QA 1RU3A 1J2RA 2EF0A 2XHEA 2MINA 1GG2A 1G8AA 1U4SA 2HMYB 4HDMA 5GPBA 1U28A 1U2QA 2E2WA 1NDUA 1XTQA 3K1AA 2IQ5A 5FWXA 2Z1DA 3B9QA 4O4LB 3WZLA 3MMSA 1J2JA 4GECA 2HF9A 1TZJA 2GRAA 2QD4A 3AZPA 4NFLA 4G8CA 4PS0A 2HCRA 2NUTA 4ZFNA 1ND6A 1ZHFA 2HA4A 3LOPA 4KZKA 3RUAA 4C0SA 4XAQA 1EEXB 3IMFA 1CF2O 1T8SA 1Z4MA 1ZD3A 3AY0A 3GFOA 3AFMA 4K9RA 3EZLA 1RHQA 1P1KA 2WYVA 4DT1A 3KWFA 4JU9A 4WLNA 4D1YA 2GEKA 3D8TA 5IBRA 1CZKA 1ISGA 1M6VA 5IRCD 1KY2A 1T5HX 2RB4A 3SQWA 4BGDA 2BL4A 4RPHA 3B9PA 2ZTVA 3NORA 2OO5C 4RD3A 3F73A 2XJ4A 4IO1A 3K5WA 3O21A 4MUGA 3QW2A 3SYKA 1L5OA 2RGNA 10MHA 1PZXA 1HTWA 1KZ4A 1YR6A 2IVFA 4OJMX 1CJSA 1WDTA 2WSBA 2D2XA 4FINA 4ZYVA 2VJYA 1KYXA 4I8IA 4NJEB 5TT1A 3L7IA 5THQA 3FYUB 2A94A 2H63A 2V96A 3KB8A 4LMBA 2JH9A 3JQBA 3A3OA 3LT0A 3CCFA 3CF2A 2CFSA 3P19A 4AKHA 4L4XA 2FSIA 2PEYA 4G81A 1DC8A 2FF5A 1BKDR 4GOOD 4A3SA 4B3IA 2VQDA 3K32A 2HQOA 2FMKA 2Q3JA 1CUSA 2DTEA 4TZTA 2O8CB 1NA5A 3RSZA 3JQCA 4U9UA 2Y2UA 2CVOA 3C97A 3NIDB 1PG5A 5E4YA 1LU9A 1THZA 4Y9UA 3ZY5A 1YOBA 4DQDA 2OOKA 3U44A 1GDHA 2AJCA 3EDYA 4RHFA 3U4CA 2VDWB 4UAGA 3AERB 5HFNA 1AKMA 2Z6VA 1P7WA 2DCMA 3BSFA 4B9AA 4HVCA 3I62A 1U5AA 2O52A 3G8AA 4GOMD 4B3FX 1HNXB 2J9GA 2OCXA 2ZS9A 4BMZA 1E69A 1E9EA 5EJ4A 5HQ3A 3BXEA 1W0KA 1WXEA 4IGIA 3IKMB 1XLTC 3VUFA 4EGQA 1KZYC 2PANA 4L51A 3I2KA 2NU7B 1L5KA 3HB1A 2A0FA 3NWBA 4IHKA 4K40A 2DE0X 4RPIA 4BAZA 1I5OA 3CRMA 3R0IA 5AK4A 3VYTB 2QJTA 5AJTA 4AKEA 3ESXA 4XRGA 5K8TA 4YS6A 4MRMA 3ICWA 1MZPA 1MXFA 1UZNA 3QX8A 3DTYA 1TUBB 1PZHA 3INYA 2HOQA 5JCOA 2I7VA 1IN5A 2YVKA 5ALRA 4ZAVA 5DTMA 4B75A 1KEKA 1RMTA 3L8EA 1W49A 4QHYA 3KJNA 3G5UA 3WDLA 1XNRB 4G4SP 1Z0AA 3MQFA 2FPUA 2WQZA 4ZQBA 1RABA 2ZJ1A 4B87A 3LW8A 5ENVA 1VHJA 2RGXA 2XSZD 2OY0A 4LZWA 2ALJA 4AJ2A 2FWJA 5TC4A 1YF3A 4E51A 4PLZA 5J2UB 4K81B 3V4PB 1E2NA 4J9UE 3DT6A 2AR9A 1GYRA 2H16A 5BT9A 3FFWA 2QM8A 3FNGA 1GLNA 2YIDA 5CH5A 4BX3A 1JPUA 4B43A 1VHLA 3RYIA 2L69A 3IQDB 5IJXA 1AZSC 3OEWA 1UBNA 1IPHA 2AWOA 2PQ6A 3L8CA 1IDN1 1R0RE 1WB5A 2IYQA 4MZXA 3EA5A 3QWAA 2DEUA 1FMJA 2DTXA 4DNFA 3HFRA 1T9HA 4XXHA 1UDCA 2QAIA 3P2IA 4G2NA 4JT9A 5AM1A 3GJRA 1X1QA 4HX2A 3WE7A 4FB4A 4PPFA 5FPSA 1E7MA 1ZH0A 2BFNA 2IZ1A 5ULLA 2Z1MA 3RJMA 1X8KA 3MHPA 5KJEA 1W4LA 3DXYA 4UBMA 3EVFA 4HS9A 1Z06A 5FHRA 1K2VN 2JH8A 4TTSA 3F4BA 1BWPA 4JH0A 1SZJG 1XTZA 2A92A 2JW5A 4HF7A 5J9FA 1ZH2A 4H60A 3TFQA 1XNJA 3BH7A 3DAGA 1UPTA 4L9WA 1VMAA 2W9XA 4TKVA 2QRNA 1E2EA 3T9CA 4DIOA 1R6XA 1PR1A 4B76A 3TGLA 1CJVC 2YRXA 3JX9A 5CYFA 4AUMA 1JQKA 2ODAA 2ZWPA 1GT6A 1RYFA 1BS9A 3G2HA 3O7WA 3N5KA 2YMPA 4Q21A 5DK4A 4JI3B 4CR8A 5CA1A 5TDHA 1E99A 4AI6A 4Q4HA 3OT4A 4R69A 2CKMA 2F00A 4V3CA 2ABWA 1N2OA 5IDVA 3TLYA 3S4YA 2VWGA 1GZDA 3LHSA 1FUEA 3OE5A 2GF9A 4OAPA 5BUQA 1YI8A 2L19A 3JTMA 3F2IA 2QY6A 2JFUA 3FYDA 4Q02A 4CF6A 5B3LA 1T8PA 3GBPA 2VJAA 4YALA 3WLKX 1LX7A 4WK0B 5P21A 4JYPA 4POOA 4P82A 4TQ9A 1GTVA 1SUCA 1O87A 2EBHX 2I6QA 2IDZA 2YL2A 3EOBI 4JLKA 1TIKA 1IOZA 2EX1A 1B6RA 1NOJA 3GJ6A 3MLAA 3OPNA 4RUKA 1E9CA 4UCXA 4TSFA 2ODWA 3AR6A 3CX6A 1B4DA 3LPDA 1FLNA 1HZJA 1TVKB 2Q3CA 4X00A 3S2ZA 3TIFA 3VTKA 3PIDA 2V3CC 4N0DA 3W2GA 2G25A 4OI4A 2Z3VA 3SX0A 4BMDA 2HF8A 2XY4A 3OZXA 1P4JA 4AJPA 2HI0A 4EZEA 2Q99A 1D2RA 1SCDA 5CMLA 2ZZNA 1URPA 4YEDA 4OL0A 3JZAA 2GM9A 5D1HA 4Z3KA 5HF5A 5L45A 4GRAA 1M2OA 1H65A 1N9ZA 4RENA 3UUEA 3WADA 2WHXA 5FOUA 5IX8A 2GM4A 1RDFA 3I5XA 1BGVA 1KMIY 3PK0A 4FC6A 4KWCA 3KD3A 5ALNA 5DZSA 1V4NA 2NVUB 4EKNB 3KHKA 3PS9A 2JLXA 3WL6A 5AWFC 3TNLA 4PX2A 2YWXA 4PLHA 1JHRA 2WSSD 4Q5IA 5DNVA 5K8UA 2CF5A 4HFMA 3PV0A 4M9RA 4QOEA 2BTEA 2ZAYA 3T0GA 4OQEA 1BC5A 5HHTA 2BUAA 1RW4A 2EZ4A 1M5RA 5JEDA 1XE3A 4MVJM 1QQAA 5F3DA 4X1IB 4KVAA 1F1BA 1LDGA 3UH0A 1B15A 1X42A 3QOYA 4EJSA 1FB5A 2YINC 1DXHA 1P1IA 4LNUA 4MKRA 1VJTA 1O4WA 1ZUNB 3E3MA 5EUCA 1IQ0A 2ONJA 1ZA2A 3ZWPA 5KQGA 1F17A 1OLXB 4YBZA 3TOVA 4Q1VA 4YUYA 5LJIA 3P9XA 3H17A 1OWNA 4NMHA 3VNQA 5JI2E 4W5WA 1WMAA 3ZLVA 3CUEF 2IJGX 4Q1EA 4BECA 4KOEC 5TIIA 1YDFA 3MTJA 5LL6P 3AG6A 4KPYA 1A7JA 1K98A 1KO5A 1ZVQA 2Y0CA 5FL3A 3VPGA 4B6SA 4GZ5A 1LI4A 1Z83A 1II8A 2H4ZA 2PDAA 3CX4A 4X95A 3T8YA 1FJ2A 3MCTA 3WLMA 4C7JA 4KXMA 1E0JA 1Z13A 4FBGA 4ZVRA 5AVTA 1NHWA 2W6OA 1M6WA 1J9EA 1Y33E 2NZ8A 1U8FO 2PYZA 3Q8WA 1XTIA 2X86A 2YC4C 3WGNA 2WP0A 1RYDA 4WL0A 4YTEA 1E1NA 1N92A 4MLPA 3SC2A 3EXAA 1LRKA 4Q9NA 1IBKB 2VDQB 3LX4A 1D03A 3WGGA 4M6WB 3EFEA 2E4ZA 1I2MA 1Q0ZA 2EQBA 4RKRA 1YCDA 1QRRA 1XTBA 3NM6B 3UANA 1V5EA 2VJKA 3GBVA 3UY4A 3TLBA 3OFVA 3UG7A 3VR5H 1NN3A 2Z4SA 1GKUB 4EG5A 1B2LA 2WV7A 3ZD7A 1TTQB 4B7CA 3FVQA 2P7IA 1MJGA 2NWQA 2ZSHA 2OCYC 3R5TA 3JAWB 2OBLA 1L5YA 4NV3A 1WD5A 3PNYA 4IILA 4MITA 2FRVA 4P4SB 3HGTA 3JQ9A 4I5IA 5D5PA 1DC7A 3HR7A 1GRNA 1XXHE 3I4FA 1T91A 4I1VA 3PR2B 3EIUA 3HA7A 3GNLA 3VHLB 2CUTA 5JSYA 4MUKA 3O1HB 2BKUA 1FQOA 1NR7A 2A1UB 3G9XA 4K6KA 4AJJA 5B1EA 4RYLA 3GI1A 4MIKA 4PRLA 1EDOA 3FPLA 4ABTA 3PUVA 3BRWA 1PJBA 1RWPA 3ND6A 3R0XA 1V41E 2AW3A 1L5NA 4JBXA 4CM6A 4RWZA 5C7OO 4C5BA 2JB9A 2ACWA 1ZP6A 3GMDA 6REQB 1XQVA 2H2FA 3K9CA 3M33A 4HAWA 3PEVA 2AZTA 3C14C 2PY6A 3QELB 4PGFA 2PX0A 1KORA 3DMNA 4YREA 4QYTA 1XG5A 4DILA 2NZXA 1RJWA 3NZEA 5JZ9A 5AICA 3NVKI 3DMGA 1EINA 2QRJA 1XCGB 3KT3A 3ZLJA 1S02A 3LVRE 4I3GA 2QJRA 1JSCA 4OJQA 4E88A 3GH3A 4PVCA 4LW8A 4L07A 2AMFA 2QORA 4MVJE 4I4TA 1F8XA 4QXMA 3ZQKA 1UBJS 4N5LA 1CIVA 1KBQA 4GOKA 1QH8A 3KQQA 4RZSA 3QKRA 2HWKA 2PO7A 3A1SA 5CK4A 1E5LA 3TSWA 3CZ5A 2A7QA 2W98A 1ISPA 1YJ8A 3UXHA 2DR3A 1JR4A 3OCYA 3OQIB 2WUWE 5JZBA 2TYSB 3CEHA 4XTRA 5E4FA 1NXVA 2P77A 2Q07A 2VAWA 5DCUA 4C21A 2D0IA 2GCIA 4ZXPA 1RPZA 4M9XA 5EJ6A 3WC4A 1XGKA 2VAXA 3B3JA 4DLVA 1R7RA 3TZQA 2QG9A 4OO3A 4UOQA 2X2FA 1ADJA 3T1QA 2CD9A 2HMUA 4M87A 3U48A 5LXTB 1J20A 5DM60 1NBME 3FCSB 3W90A 1UXGA 4YP0A 1FP1D 1NW7A 2HSZA 1SIOA 4FQ5A 2W6ID 5CA0F 4QL3A 4G0MA 2A8YA 4KLCA 1YR2A 1WZNA 3KJXA 4PLCA 2HZBA 4XYBA 3P9YA 1NMEA 1W9MA 3I6YA 2OVFA 2E48A 5CFLA 3AIOA 3EJWA 3GGPA 1F12A 4AYXA 1PP4A 1VCMA 1TJ4A 3K0FA 1N57A 5E6RB 1X14A 3F3YA 1SHLA 3PC3A 2C94A 3D2AA 2WSYB 4BO6A 1SUIA 3ZYCA 5AM0A 4C6RA 1UEIA 1VHQA 2JBAB 2B4YA 4R9UC 1PJAA 1C30B 4LG1A 3LT1A 1QFJA 2B25A 2ZBRA 4YNBA 1KDZA 1G8KA 1E0AA 4KPFC 2ESRA 3G79A 1ODKA 1DQNA 3I2FA 3OQJA 3WWDA 2PMCA 1Z22A 3WDKA 1YE8A 4BQQA 5J1SB 2JEYA 1PCXA 1YRAA 3GROA 3NEYA 2BFDA 4AS1A 1VRCA 3NT4A 3P26A 1LQUA 4Q0MA 1Y9ZA 3EF1A 3M1IA 2BVNA 2ZI6A 4NMLA 4Q03A 1TAHA 1K88A 5GJWC 1E96A 4CFYA 4LMPA 3LRPA 4PQYA 2VDUE 2VF5X 3EUFA 4IW3B 1V3VA 1P81A 3LBHA 1WSAA 1NAIA 2GF2A 4PRYA 4JLAA 3VC3A 4CKBA 1N1GA 3RROA 3OOWA 4DBLE 4DIUA 4LF6B 4Y1FA 4YJ2A 4C4ZA 9ATCA 1V7ZA 1VKJA 5E9QA 4ABYA 1Y7HA 3FD8A 5LSAA 2OZLB 2O3SA 5ALJA 1XD2A 1RJFA 3T3MB 2YHAA 3GDOA 3R77A 3C5WP 2IHKA 1K63A 3KT0A 2XAUA 5F7OA 2C04A 1ETHA 4RVSA 1C3OB 1DO8A 1PEKE 1NW5A 3NIWA 5EE0A 1VLJA 4AJIA 2OV1A 4PYMA 3KLBA 5IJ9A 3JR3A 4YV0A 4ZI7F 3UM9A 2VWHA 1NXPA 3HUFA 1V11B 4HS4A 1B74A 1ZS9A 2PJDA 4IGKA 4V0SA 3WBBA 4FIDA 5JSQA 2BJWA 2HQRA 4MVCA 5EP1A 3A7EA 2JASA 2QQ0A 1AQNA 4MVYA 2VHZA 2E1RA 1JQ3A 4B6RA 1ULTA 1XZAA 1I2DA 4JDUA 2VTBA 4OLAA 4G9EA 1UINA 3UBMA 4KR2A 1TZMA 2GCOB 2P3SA 3EXG1 2JFXA 1VBFA 3AY7A 2HTEA 5HWSA 5IABA 5IT4A 4R8KA 1Y6FA 1KKMA 2HC9A 2ZATA 4Q4AB 4A1OA 5BR4A 4UATA 2VKQA 1HV8A 2ZWOA 4JYBA 4X8HA 4YA6A 4TL7A 4RVFA 2IIQA 2PGLA 1SGWA 3KE8A 3NFRA 4PHFA 1WCWA 3HA5A 1IBCA 1F9AA 1PT7A 3EN0A 2XIQA 3EZNA 4OGFA 2E82A 3HN2A 3PYLA 1TRHA 1U7HA 4M89A 4WEQA 3I6QA 1E98A 5IANA 1HLDA 4KACA 3VNUA 4C6TB 1X9HA 5H3LA 4JBGA 3RIMA 4E5YA 1SC9A 2JIDA 4GBMA 4LOLA 3MWYW 5C8YA 1JIUA 1COWD 4ESOA 1U98A 3B20A 2I6XA 4XWYA 1KVQA 4YCAA 2BSXA 2UVPB 1TZCA 2RGGA 1YB6A 4DJDC 4MJ7A 3DQQA 1UK8A 2C77A 2P27A 3KALA 3VR6D 3AKZA 3IT0A 1AXRA 3A14A 3DM5A 1VDZA 2GQ0A 2J9FB 4V1CI 2J3QA 2OK7A 1H6DA 5HG0A 4J0GA 2AJLI 2H5LA 1FYFA 1FX0A 4NBWA 1YMVA 3DTNA 3M5WA 1RVDA 3F6YA 3O2SB 1L5GB 5CLFA 1WF3A 3C7DB 5AVKA 1PT6A 2RHCA 4O2BB 4WOKA 4ZOQI 4NHOA 2QENA 4LFBB 2CXQA 1J2EA 1IMOA 3DPUA 5IKXA 1Z45A 3M0EA 4RHCA 5IJ0B 4ZP1A 1Z2NX 3U7JA 4GKKB 3LCCA 4LTNA 5DTQA 1NBEA 3CUWA 3H86A 3SI7A 4YAKA 2BFMA 2WTAA 2OXCA 1PR0A 3JQAD 3VM6A 1QE5A 2FNAA 1KY3A 1N5KA 5DIFA 2NQTA 3UUFA 3L8MA 4NU6A 1UT8A 2IP4A 1BROA 2V5AA 2CDBA 1CE8A 3CFYA 3IQIX 1P5RA 2ETXA 3MIZA 2FJUA 2VSQA 4JYZA 4EUKA 3HHPA 4O4HF 4H7IA 3OHPA 4EHIA 4ENWA 5LB2A 4E6PA 4KYVA 4B73A 4KC0A 2R86A 2AFVA 3GFGA 3T3DA 4RFSA 4EHHA 3HDYA 1J9ZA 2CXPA 3G0HA 2I2AA 1IQUA 4GG1A 4GZ6A 5CAEA 3I37X 5K5EA 1XMSA 4R1UA 5KDDA 4NU5A 4ZREA 3X3HA 2JGAA 1B8PA 5F98A 1N2CB 2IPOA 2RHJA 1AJEA 2JVIA 3JARB 3OU7A 4DRYA 1TM5E 2PYDA 3F8TA 2XCLA 4GBED 3IQGX 3NEPX 5BW6B 2Z6UA 1Z0IA 1H66A 1U11A 2MJLA 3MCAA 1PTJC 4P2BA 1J0BA 4WRRA 5ALFA 3WOVA 4EKYA 1SVNA 3IQFA 2XDQB 1SCNE 4Q19A 4ZKEA 3AR5A 3DOIA 4DIFA 3L6UA 4YRMA 5J5CA 4WINA 2VUTA 1HTBA 3K5HA 1L3IA 2AHOA 3G89A 4NOKA 3KCQA 1ZH4A 3U26A 2C0QA 1AVTA 5EPOA 4O0LA 2QZSA 3IPXA 3QVOA 1P3JA 3H11B 3ER6A 3QLEA 1YS7A 4QRHA 1O94C 2J5XA 4CKEB 1JZQA 3PNOA 1VB5A 4N18A 4QUEA 3TW4A 3UHJA 4BVAA 3U7QB 3RK4A 3WHPA 2ZUSA 2QYHA 1K9SA 4ZARA 3LG2A 3EW9A 5EXPA 1RRKA 2VF4X 1PFKA 2NV6A 4QDOA 5K3FB 1OV6A 3QF4A 3VR3A 1F8UA 4KQHA 1G3UA 3S7ZA 4CLDA 1T2VA 2GEDA 2N1BA 4F4FA 3GLFA 1QIGA 1EG7A 3C5EA 1KK1A 4OI2A 3RIGA 1J90A 1L5ZA 3L4SO 1DIAA 1TRKA 4EW6A 5LDHA 1CWUA 1JHOA 3A1DA 1UJ6A 3GA0A 1AS2A 3Q12A 2CV2A 2H5EA 1JP7A 3SQXA 1NRJB 1E2MA 1KHHA 4JDPA 3R7LA 4TTQA 1DQRA 3RBVA 1CY2A 3V33A 1TQ6A 1FDOA 4JSRA 3S8EA 3A6JA 4XRRA 3LD9A 2XKAA 2G8LA 3GFQA 5LJLA 4A2QA 5CEFA 1Q0TA 1B7GO 1E5DA 1G0NA 5I5EA 3FGOA 4BRWA 1CP3A 4F4JA 3U6KA 2VUUA 1Y4DE 3MS4A 4ML3A 5I4CA 3QBJA 3RABA 1J2TA