3JQAD

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor 2-amino-1,9-dihydro-6h-purine-6-thione (dx4)
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
247
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Oxidoreductase
molecule keywords Pteridine reductase 1
total genus 91
structure length 247
sequence length 267
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jqaD00
1QKIA 2AQKA 5FYDA 3CZMA 5BSEA 4QT0A 3MJTA 4GPD1 5T67A 4E33A 4XRRA 1P1FA 4EZBA 3IAHA 5AXDA 1X7GA 5THQA 1A9ZA 3R1IA 1WNTA 3U4CA 4IM7A 2PZKA 1R0SA 3QSGA 4WOJA 4MVJM 3UOGA 1IL0A 2Y1DA 4PLGA 4JBHA 2EGHA 4CMJA 2HMVA 1U2DA 3IDSA 4CMIB 1PGNA 2UYYA 1E3LA 5F1OA 5DCWA 4URFA 1P33A 1AXEA 1P44A 3L6DA 3W8FA 3WLEA 1YJ8A 2Y68A 3COSA 5CEEA 1LDGA 2O3JA 1E1KA 3M2TA 3UN1A 1YOVB 3E5MA 3PP8A 4GKVA 1UDBA 3QP9A 4ALNA 4PZCA 2YYYA 4CMGA 4EJMA 1D3AA 3GAFA 4DPKA 4MKRA 3DZBA 2RHCA 9LDTA 1ISIA 4PRLA 2EJVA 3RUEA 3TFOA 1E7WA 1RWBA 4XIJA 3OJLA 2AA3A 3ADOA 3E9NA 2Q4BA 3K31A 3HB5X 4FC6A 3CEAA 4NBVA 3DMTC 1PGOA 1Y8RA 4M87A 1GPDG 1GFSA 1I3LA 4BB5A 2OUIA 5A3VA 4OH1A 4BV9A 4RVSA 3T4EA 3KETA 5ER6A 2EKLA 3PFWO 3VZRA 1BW9A 5A9SA 3GVCA 4U6QA 4CMKA 4I9NA 2JL1A 3GVIA 1PJ4A 5AVOA 1KOLA 1Q0QA 3TQHA 1YL5A 1F0YA 3SVTA 3WS7A 4N5NA 3D1LA 4BB6A 4L76A 1TLTA 2GN6A 4IJVA 3SBOA 1E7RA 3BMOA 3KUXA 5JO0A 1LSOA 1LU9A 5FFFA 1E6WA 3IP3A 3ZWNA 5IN4A 3KVOA 4J7CA 4YRAA 3QE3A 1ONOA 3U5TA 1HLPA 4UEKA 3TDKA 3ETEA 3IS3A 3I1JA 3DWFA 2D4AA 2AQ8A 1TEHA 3RBVA 3K2EA 5IXYA 5B37A 4MVJH 1T1RA 3JV7A 4IBOA 3OICA 1GYPA 4PLYA 4JBGA 1ENZA 1HEUA 3K92A 1PS0A 1DIGA 2HJSA 2C5AA 3WNVA 1YBAA 4CPDA 3D3WA 1PJCA 2YV2A 5L7WA 2FPIA 4XZ3A 3UW3A 5U4QA 2AXQA 4IQ8A 4B3HA 3PRJA 4Z0PA 2X0IA 3EDMA 1F8FA 1QXSA 2RIRA 3JQFC 1KERA 1TT5A 5EMHA 3PHJA 3MJEA 4WLFA 2Z1NA 3NAQA 4L4SA 4LCEA 3UUWA 2D2IA 4R5MA 3ICPA 4YAEA 1ML3A 1VSUA 4TMFA 3VPGA 2C07A 1ISJA 1OMOA 1PL6A 4JX8A 4ZVVA 3FRJA 3IOYA 4HUJA 3NTQA 5I9LA 5IDWA 3GVHA 1PIWA 2PTGA 5F21A 3DBLA 2CDBA 4CM5A 4CR6A 1PL7A 3CINA 4YACA 4DUPA 4QTZA 2IZ1A 3HQ4O 3U4HA 1K2WA 3PFFA 4ESOA 3MJ4A 3ABIA 4BL5A 1RYEA 4H15A 2DBZA 3TF5A 3AM4A 5BNFA 4A27A 4IGFA 3LT0A 2DPHA 2V7PA 5B4UA 3ULKA 3PIDA 3BMNA 4KMSA 5DBGA 4Z0HO 4UULA 1ONNA 2NQTA 4WNCA 2HJRA 4YAKA 1WDLA 2WEKA 2Y1EA 4IINA 1F17A 4QSMA 4JN6B 4IIVA 1V3UA 1GZ6A 4XDYA 4J90A 3SJ7A 5FI5A 3PHHA 1RM4A 3LT2A 4KWHA 3ZW8A 2AE2A 3L6OO 4JBIA 2X9GA 1QRRA 4ALIA 2JAHA 4QFDA 4FW8A 3TJRA 3H9JA 1WW8A 1PQWA 1A4UA 2G5CA 4AJ4A 3AUAA 1ZZEA 3GGGA 1ARZA 2DUUA 2EJWA 3WJ7A 1UUFA 3MTJA 2HMTA 3SLGA 3G79A 4J1NA 5H83A 3VC7A 1PJQA 1AXGA 1X13A 1I0ZA 4QX6A 4AJ1A 2HRBA 4DC1A 3KYCB 3OFSA 3UFXA 3RUIA 4GWGA 3JQ9C 3L0DA 4D3SA 4BNTA 1PZHA 3SX2A 2OBNA 4YT2A 2QIOA 5I7SA 4GQAA 3IIEA 1P9LA 2BKAA 4DMMA 4HXYA 2X0JA 3D4NA 3EUWA 3GN2A 5EERA 4GX1A 4KWIA 1P1RA 1OC4A 1VC2A 3LYLA 4AFNA 4ALKA 1DC3A 2B36A 2B4QA 3LSYA 1KEUA 2YDXA 5CDUA 3ZZNA 4F45A 2YHIA 1CEQA 1X7DA 2BFMA 5JPIA 4AJIA 2NUAA 1ZKMA 1GAEO 4CM8B 2PD3A 1NNUA 3MCVA 1KY5A 2TMDA 4Y98A 5MDHA 4RQTA 1SZJG 4PCVA 1JN0A 2EF1A 2JFGA 1UJMA 1LJ8A 2E37A 2OP1A 4RF4A 3VPSA 5KKCA 3GZNA 4PFJA 1R16A 3GHHA 3K73O 1YOVA 2P5YA 4BQRA 5FI3A 3HFSA 4NFSA 1N7GA 1KIFA 2IE0A 4FJ1A 1CF2O 2D59A 4N5MA 4FD3A 1O89A 2ZK7A 4J4TA 4J3FA 3HWRA 2FSVA 3ZWPA 2JHFA 1JAXA 4EBFA 1J4AA 3HB4X 3EAGA 4IUYA 4UREA 4NU6A 1LX6A 3RU7A 1I01A 1HDOA 4B4UA 1NFFA 4N18A 3NKLA 4Z0TA 1SOVA 1T2FA 3BMOB 5CDTA 4AJPA 2EKPA 3ETGA 3ANMA 1R66A 3O4RA 2NVWA 3QWHA 4NU5A 3WYBA 3LT1A 4KP7A 3WB9A 2AMFA 4WNIA 5F5NA 1MUUA 3JCZA 1N9GB 4C7KA 1IPEA 3DZJA 2O50A 5IN5A 2IYPA 3F5SA 3Q9UA 1UAYA 4IZIA 4DXHA 2AE1A 3RKRA 3EZYA 3U4DA 2ILTA 2DFDA 3VVBA 3PJGA 1O9BA 2NLOA 3LT4A 3VPFA 4BV8A 4UUMA 3UGKA 4PLVA 1NASA 3OIDA 4R1NA 4XR4A 2GR9A 1FDWA 5CPFA 3GOHA 2Y1GA 4GMGA 2BI7A 1X14A 4NHEA 3DB2A 2Y67A 1LRJA 3SLKA 3AWDA 2A35A 1P74A 2FRDA 4Z9YA 5EQDA 1K5HA 2WD7A 1SC6A 1JVSA 3G1TA 5EIOA 4YJHA 2G1UA 4HADA 1XU9A 4OO3A 3INRA 3BHMA 2VHXA 3OMLA 5JYEA 5C7OO 4Y6PA 5L51A 3F46A 3U49A 1O6ZA 4ZQHA 4XD2A 4XJSA 2HAEA 4TROA 1U7TA 3AFMA 2GNAA 4D3FA 2AW5A 2ZCVA 3W1VA 1QR6A 2Q3EA 2QYTA 3CZRA 3D3WB 1P1IA 3GNTA 4BNLA 1KVTA 3DTTA 1MFZA 1JKIA 2X22A 2JCYA 4DL9A 1JW9B 1ZO8A 1YL6A 1T2AA 4LRSB 3W8DA 5ENDA 5IAAA 2I67A 4E2ZA 4BNUA 2Y0DA 3WSWA 5DCYA 5B1YA 1MG5A 1BDBA 4W9NC 1MV8A 2IYOA 5JLAA 4XGKA 2GZ3A 4HFJA 1I24A 4S1VA 5C7LO 3TN7A 3GHYA 5B4VA 5TGDA 2X58A 5AYVA 1U28A 1XYGA 1PQPA 3NTOA 4YJHB 3LF1A 3KHUA 4RV9A 1IPFA 5EINA 1B26A 3PGXA 5KJEA 3TOZA 3H8VA 2C29D 1I2CA 1A5ZA 3VZPA 1LI4A 2PZLA 2J3KA 5DP2A 1N5DA 2O7SA 3QVSA 3I9KA 4XEHA 3RIHA 3DBRA 4MINA 3ZWOA 4FBGA 1VJTA 3PWKA 4LN1A 3ZU4A 1JWBB 1SAYA 3KTDA 3GH3A 1PS9A 1IHXA 5LDHA 1YBMA 1W73A 3C7AA 1E5QA 2WYVA 3ZNNA 2VNSA 3FPCA 3HG7A 2IXAA 1JKJA 3NEPX 4D45A 4GAEA 3RUDA 2B5WA 3PWSA 5JXWA 4R16A 2C0CA 3GUCA 4O63O 2VTDA 1UDAA 2XPCA 3HN7A 4P22A 4E3ZA 4Q3CA 1ZIDA 3AY3A 4FSHA 1Z74A 4AJHA 4TZTA 1E3SA 2ZQYA 3IKTA 1W8DA 1JVBA 3BIOA 3S2FA 2E48A 1Y5RA 3E8XA 3F6YA 3MJVA 3I83A 3DL2A 3PJDA 4BO6A 3RAJA 4K1LA 4BGUA 1WPQA 3OH8A 5L4NA 5L40A 1X7HA 2JD0A 3E48A 4FR5A 1R15A 5JDIC 2YFQA 4BNVA 3VKUA 3LC1O 5HM8A 1H9BA 2J5QA 4KZPA 2AQIA 2ZATA 4O6VA 4BMVA 4CQLA 2YHUA 4IDEA 3QVWA 5I8ZA 3G3EA 1B2LA 1TXGA 4R5HA 2QZ9A 1P45A 4IQ0A 4KUEA 5I7FA 1ZBQA 3K96A 2Y1CA 3AU9A 5A9TA 5I9NA 4D41A 5LC1A 4CV0A 4BIIA 4MOWA 1NXQA 3PVZA 3C24A 4OOFA 4TZKA 4DRYA 3OETA 5EJ2A 2PA3A 1M76A 4EGFA 2UAGA 5BSFA 1E3WB 1Z7BA 1R4MB 5CHEA 2CF5A 4BO4A 2PKQO 3PYXA 3ZWMA 3QWFA 4HFRA 4E6PA 2W2KB 1FMCA 3JQDA 1L1FA 1ZNQO 4RPGA 3GY0A 3P2YA 4YB8A 5CPBA 3VZSA 3U0BA 3F4LA 4I5DA 1UR5A 4PIVA 1LRKA 4YQYA 4EUFA 2Q2WA 1QLHA 4Q3BA 4XWYA 2F1KA 2FOIA 4A0SA 4J91A 4E30A 4NPCA 3ST7A 4M8SA 3UH1A 2NU6A 2CDCA 2J3HA 2O3TA 3CKYA 3QWBA 4XYGA 4R1SA 5JCJD 1BXZA 2DFVA 3FR7A 3GMDA 1EE2A 1S6YA 1ZVMA 5GMOA 2VHWA 1VJ1A 3GN1A 2NU7A 4XGNA 4A5OA 1PR9A 2VNAA 3I23A 3NT2A 1Q7GA 2QYSA 4CODB 4XYBA 3GFGA 4ITUA 2NVUB 4ALLA 3OF2A 5EN4A 5T64A 1PJSA 1LRLA 3WGTA 3UICA 5JC8A 4PG8A 5G4LA 2W2LD 1NQTA 3TZKA 5JYDA 4RZIA 4RVUA 4TVBA 5KNLA 4WCFA 2HK8A 1UZNA 3TZCA 3NDRA 2OL4A 4E21A 4U8GA 3QIVA 3DZFA 4RPKA 1V3TA 4WLOA 3WG9A 3U3XA 4RPJA 3WMXA 1V9LA 1LLCA 1NFRA 3JQ8A 5HS4A 4GMFA 5G2OA 4N7RA 3H9EO 2FN7A 1V8BA 4HBGA 1UXGA 3DHNA 3ETDA 3GEDA 4PZEA 4UVGA 3LVFO 3ICCA 2GD1O 5ILOA 2GF2A 1NWHA 2OHXA 4DBVO 4XRGA 4FFLA 1QP8A 2X5JO 4BKPA 2HK7A 1EVZA 2C54A 2FZEA 3STHA 1RYDA 2DVMA 2I5PO 4CLEA 1WP4A 1BVRA 4E2XA 5JCJA 5G0UA 3AU8A 2V6FA 4WGGA 3IUSA 2FPGA 4ND5A 2VWQA 4RF5A 3QVTA 1SOWA 1P1HA 1YB1A 4E2YA 1NQAO 5CEFA 4I5GA 1SEPA 2B69A 1B14A 5JDCA 4R9SA 2VTEA 4CMEC 6ADHA 4KUHA 5FWNA 2VHYA 4AICA 3B6ZA 2NSDA 1DLJA 1ENYA 3NDJA 4YPOA 3IKVA 4NG5A 2UUPA 3JQBA 5L4LA 3AOEC 1PZGA 1P1KA 4IS3A 2B37A 1DAOA 4B8ZA 2ZYAA 2VHVA 1M2WA 1NAHA 2CVZA 4XQGA 1ISHA 2VQ3A 3W4KA 1NR1A 1U2GA 3EZLA 5IZCA 3K30A 4L9RA 1H5QA 1GZ4A 5A1TA 1E6EA 4DIFA 1GL3A 3QVXA 3I4CA 4K28A 3BAZA 5CEJA 3CMMA 1EVYA 3VPXA 1GEGA 3PZBA 3GVXA 3JQ8B 5I7EA 3PGJA 3SJUA 1E7SA 1GQYA 1OI7A 2NNLD 1ADFA 3PLNA 1EBUA 4A7PA 1N1EA 2FP4A 3H4VA 4ID9A 2O2SA 1E1MA 4QQRA 1C0LA 1D1TA 4PGFA 5F1KA 4GLLA 4TRJA 4OL9A 1K3TA 3ZHBA 3FN4A 5C37A 4I1IA 4IDBA 2IEDA 4NK5A 3GG9A 3A9WA 1J5PA 5JAZA 1T4BA 3BTSA 5C7IO 2RHRA 2VWHA 4ZQGA 3ANNA 1AGNA 2JD2A 3B1FA 1NPYA 4NFYA 2PKRA 1HYGA 4FJ2A 1KBZA 3WSVA 2YZ7A 2JHGA 1QYXA 1ADCA 3QY9A 2GO1A 1DHRA 4YWJA 4HWKA 2HMUA 3VH1A 3GC6A 5CG1A 2QRLA 3W4IA 2QQ5A 4D0SA 1X1TA 3HADA 4CQMB 1DOHA 2PZJA 3G0OA 4PLPA 2BMAA 1MX3A 1JWAB 5L7TA 2GDZA 3JYPA 4AJKA 5TC4A 3ONDA 4BMSA 1CYDA 2XXBA 1BSVA 2ZJ0A 4ND3A 3V2UA 3R3SA 5FF9A 1VKNA 5IG2A 2ZB3A 2P9GA 4BNXA 2PR2A 4G65A 1JDJA 5DBFA 1C14A 5F5LA 1KEWA 2GSDA 1M67A 4P4NA 4ZQFA 5GZ3A 4BNHA 3KSUA 3O38A 4IMPA 1J49A 1I33A 2WM3A 5JDCC 4CMCA 3JQGB 3ZI0A 2VCYA 2AEJA 2VHZA 3X2EA 4DMLA 3FR8A 2DUWA 4J0FA 3WX0A 5TIIA 1DJNA 1NM5A 4R9RA 1DIAA 2GERA 4RLSA 3ZDFA 5IDQA 3HDQA 1RM5A 1B8PA 4DLBA 4GSKA 3AOEA 4IDGA 1PEDA 4CM7A 1E7YA 4GI2A 4R01A 2J3IA 2EV9A 3NDIA 4FC7A 4HP8A 2H6EA 1B8VA 2POQX 5FEUA 3PYMA 3ROQA 4YT4A 1PX0A 4Y6SA 4IGEA 4WLNA 3AI3A 4BUCA 1AHHA 1YVEI 1KETA 4KDEA 2VYNA 1NVGA 3OIGA 1HSOA 4IJKA 4MVJP 3NJ4A 4EW6A 2NTJA 2X7HA 2ZB7A 2VUSA 4FFMA 1EK6A 3WIDA 1BHSA 4U0JA 5A9SB 4YJFA 2PNFA 1VLLA 2FHSA 3KXDA 2VRBA 3UCXA 5A04A 2PH3A 1LC0A 1SB8A 1VKOA 4CLRB 1C0IA 3FWNA 2JFHA 4IDCA 2B5VA 4AJJA 3TZQA 4DIBA 3ZU3A 2GGSA 4NH4A 4E5NA 1JA9A 3BHJA 3H5RA 1NR7A 2Y0CA 5CAEA 2R00C 4CQMA 2J3JA 3UF0A 3W6UA 1H2BA 2Q2QA 3RC9A 3KYDA 3CIFA 2CZCA 3H2SA 1GV0A 1XIVA 3ZHYA 4DVJA 2P5UA 3BXXA 2NACA 3MJSA 4I9UA 4B4WA 3VHRA 2IXBA 2JCVA 3ITKA 2D5CA 3FWZA 3WDSA 4LSWA 1PS8A 4TKLA 1I2BA 3BTOA 1VE9A 1NQ5A 3PZRA 4ZHSA 2Z95A 2QX7A 1NQOA 5G4KB 1MB4A 1A9YA 1UZMA 3FPLA 4TKMA 3ZWXA 1T24A 5KVVA 4J2OA 1T2EA 4J4HA 3DZGA 3MOIA 1GYQA 4XR9A 3F1LA 1KEPA 4P38A 1VRWA 1XDWA 1UXHA 1R6DA 3HDJA 2Q1UA 3C7DB 5TQVA 4JQCA 1Z75A 3Q3CA 4GBJA 4J7XA 3TFQA 3DDNA 1R37A 3KRTA 1DRUA 4WCDA 4RLHA 4L74A 3DHEA 5K9ZA 2FWMX 4Q3DA 1ZK1A 9LDBA 5KVSA 3PPIA 1P0CA 4MVJA 1HXHA 3TSCA 5K0ZA 5JW6A 4CM9A 3G1UA 2J6IA 3S2IA 1HDXA 4PG6A 4OQZA 1W6UA 3IJRA 2C2XA 3ADPA 4K6CA 3VH4A 3ZWVA 5IZ4A 4R68A 3I6IA 5KWEA 1LLUA 1YQDA 4RZHA 4D3DA 4MVJG 3VKVA 4D43A 1ZMOA 2CFCA 1GQ2A 3ZV4A 3U9LA 3CMCO 4FFNA 4KTVE 4O5OA 1VL8A 4B7CA 2O23A 3WWYA 2X9VA 5F3RA 1Y6JA 2NTVA 5L53A 3GQVA 1Z82A 3RI3A 1O0SA 2QZZA 4BNIA 5A5FA 4PG7A 1YE3A 3TL3A 3LC7O 1NP3A 4DIOA 3AJRA 2JJYA 3NT5A 2ZB4A 3ZW9A 1TI7A 2I76A 2WTBA 3L9WA 3OSUA 4HX5A 5EESA 4CM1A 3AI2A 1XG5A 4GKBA 4BO2A 3DZKA 4AJ2A 2WMDA 4U6SA 2ZYDA 1ZK3A 4BNFA 4YVFA 2PLAA 1T26A 1WZEA 4DYDA 1H93A 2C82A 2VYVD 3A14A 3OHSX 4W82A 4OSPA 2BGMA 4KTTE 3OJEA 1L7DA 4CLOA 3ZNOA 2A92A 5L7YA 3LU1A 1WXDA 1XA0A 5G4KA 1GTMA 1WLYA 1XQ6A 1ZSVA 4Q39A 2V65A 4ZD6A 2B0JA 4FOOA 1FDSA 3H3JA 1HZZA 1B3BA 2G82A 1U3UA 2BFPA 3GNSA 3KV3O 1IOLA 1D4FA 1FDTA 2YW9A 3MWEB 5AOVA 5A06A 1DBVO 4WPGA 4JROA 1EFLA 2BHLA 2I3GA 5JFOA 3VVCA 1OC2A 1O94A 1C1XA 4IDDA 1LUAA 2X5KO 5A05A 1HE3A 4OSOA 4UUNA 4P4GA 5DOVA 3NT4A 3JQCA 1J0XO 3QQPA 4P8RA 4A03A 1DLIA 3EK2A 2EGGA 3RFVA 4OGWA 4Y6RA 1Y8QB 4KUGA 3JQEA 3ZGYA 1CETA 3QV1A 1ZSYA 3UCFA 3LDHA 1SEVA 4WASA 4BGEA 3AK4A 3A1NA 2IEBA 1I3MA 4I8XA 3A28A 5CP8A 1W0CA 4YR9A 1ULSA 1O95A 4GL4A 3W4JA 1YQXA 1ISFA 1NHWA 1ORRA 1U4SA 3LZ6A 5A5EA 1C1DB 1T1SA 2NTNA 1NYTA 4F3YA 2QRJA 4IMRA 2YUTA 4MDHA 4ZQBA 5ER9A 1HZJA 2HU2A 1NVMB 3BMCA 4G81A 4TWRA 4ZA2A 3PHGA 1PR3A 5TSDA 3ZV5A 1MP0A 3IQDB 4A73A 1K0UA 3SC4A 4CV2A 4GVXA 4XA8A 4EDFA 4UEJA 1YQGA 1NTOA 4CR7A 3DXFA 2DLDA 3ZV3A 2DTDA 3WQSB 3DR3A 3TL2A 3EW7A 4YXFA 2Q45A 1N92A 3DMTA 1EEHA 1CERA 4ZU3A 4CLHA 2LDXA 3HNPA 2GRAA 1OFGA 4U7WA 7ADHA 4DQUA 3GT0A 5DBIA 3WFJA 1ZMTA 2FR1A 4QFCA 1NBOA 4UAGA 3W8EA 4E5YA 1HYHA 1PJBA 1IUKA 4NNJA 2GN9A 1H2HA 2WD8A 2DKNA 1HSZA 4PLWA 3RJ5A 4YAGA 4W99A 1HWYA 1PJ3A 4NBTA 3OIFA 1HKUA 3TRIA 3JQ7A 3ZH2A 3OM9A 3I9OA 1LA2A 1GUYA 5BNTA 1XGKA 1EUCA 4XX0A 2ZCUA 2PD6A 4ZICA 3ANLA 5HBRA 3R3JA 5C3MA 3I3OA 3OA2A 1BG6A 3WGQA 1R4NB 3WICA 2XOXA 2E49A 2GASA 3KO8A 2Y66A 4E5KA 3KZVA 4M86A 4CM6A 1BXGB 4DA9A 4BO8A 3F47A 4TQGA 1RKXA 4L4XA 2B83A 5DCUA 1NAIA 1CQIA 1DDOA 2Q4EA 3N7UA 2ZKLA 1AE1A 1B7GO 2F00A 3AOGA 3OQ6A 3RD5A 2P2SA 1QMGA 4R1UA 3KYBA 2VWGA 3F3SA 1GDHA 3UVEA 1Y8QA 3Q2KA 4Q3AA 3ZWBA 4BO3A 5A4DA 4R3NA 1HDRA 1PQUA 2R6JA 1N8KA 3SC6A 2CY0A 1GYRA 4QUKA 4CL8A 4CL3A 1T25A 2O3QA 1HL3A 5KJCA 4BO9A 2O3SA 1E3IA 2H5LA 4J0EA 4RO0A 4YRBA 5IJZA 3ROPA 2JKVA 1U3TA 3JQ9A 4XCVA 3I9JA 2VN8A 4BHTA 4IZHA 3CTMA 4GLOA 4YRDA 3RUHA 4KDFA 1O8CA 4CUZA 5JSFA 2JFFA 4WLUA 1UP6A 4INAA 4TRRA 3JD1A 1LSJA 3PTZA 1GCUA 5B4TA 1DPGA 5JNLA 1YJQA 1GZ3A 3I4FA 2B35A 2QW8A 4GX5A 3WYCA 3D64A 5GZ1A 2GUGA 2Y1OA 3K6JA 1YDWA 1XEAA 3WQQA 4BGVA 2PK3A 3D4OA 1U9JA 3ENKA 1Q7CA 2D1YA 4OOEA 4OXYA 4RPHA 1SPXA 2UUOA 2PGJA 3JQ7B 1MA0A 1I32A 4HNHA 4RDIA 3FBGA 4IQGA 3S2EA 4F6LA 5TS3A 2FR0A 1F06A 4BS9A 2VUTA 4IPTA 5DZSA 3WGIA 4OJNA 1XLTA 2OFPA 3C85A 2NU9A 1ISGA 2P9CA 2UDPA 3ASVA 1FDUA 1SNYA 3FTNA 1MLDA 2VWPA 2Y93A 3D5QA 2OORA 4R1TA 3GGOA 1PU2A 2BFOA 2WYUA 1KVUA 1BXGA 4M49A 3X2FA 2ZJ1A 4XJTA 5L45A 3OJOA 4R54A 1HTBA 4RF2A 5T5QA 2EP7A 4PN3A 5JY6A 3DEYX 1VJ0A 5KOIA 5JAQA 1UXIA 1YL7A 3IMFA 4GGPA 3VTZA 5L4SA 2DTXA 1LTHR 1P3DA 4WEQA 5TT0A 2EWMA 3M6IA 5HWSA 2DAPA 4PLTA 4LCJA 1Q2XA 4W4TA 1YS4A 3PIIA 3IL2A 3ZHXA 2DQ4A 3HUDA 4BNKA 4OAQA 3FCOA 1DIHA 4ROSA 5ES3A 4CUKA 1PJ2A 4Z9XA 4YT8A 3LLVA 1KY4A 3RFXA 1WVGA 3ENNA 2C20A 2FPPA 2P68A 3BMQB 4XB2A 2D0IA 4Y67A 4YJDA 1YONA 1GUFA 2GN4A 4XYEA 1E3WA 3RKUA 4BNGA 1IB6A 4PG5A 4RJTA 3ZHZA 1Q1NA 4FGSA 5DT9A 3RROA 1GV1A 2I66A 2R00A 3L4BA 2CNBA 3B1KA 1LDYA 2HSDA 2FR8A 4GWKA 2HKIA 3RFTA 3VDQA 5JS6A 1JAYA 4NI5A 3WNQA 1A4IA 3ASUA 4HFMA 1ZXLA 2AEMA 4G5HA 3EC7A 4YBZA 2V6GA 2YV3A 2ZIZA 3C3XA 1IE3A 3MEQA 4IS2A 2X0RA 2ZTMA 1Q0HA 4PLCA 4QO8A 4ZGWA 3AUUA 3IC5A 1W4ZA 3H9QA 5AQ1A 5DDIP 2IZ0A 2AG8A 4H3VA 3ONEA 5L3ZA 5DP1A 4CQMD 2Y99A 2B4RO 4RDHA 1VSVA 3ZWAA 4CV3A 1SMKA 1DC5A 2YQ4A 5JAIA 4U5QA 4WEOA 5CDGA 3ORFA 4HNGA 3P19A 4ZQEA 3ZNPA 8LDHA 3AM5A 1BXKA 4S3MA 5JAMA 2BI8A 3T7EA 3O26A 3OEYA 4YTEA 3CSDA 1HE5A 4D0RA 1M6WA 3JQ6A 1PGQA 1UP4A 2X9NA 3JYNA 2FZWA 4YT5A 4UVEA 2I3AA 1NVTA 1KEVA 3JQBC 1MC5A 1YGYA 5DF1A 3QWIA 4NBRA 1EDOA 3FNEA 4BNZA 3U62A 4XYLA 2VZ9A 1R4MA 4ZRMA 4BKQA 1LLQA 1M75A 4ALMA 4FPXA 4PZDA 4MVJI 4B4OA 2C5EA 3DOCA 3PDJA 5THKA 1V35A 4QEDA 3PLRA 3HFGA 1DC4A 3O03A 1GQQA 3ONFA 1HE4A 4H7PA 3OBBA 4PLZA 3WLFA 1MG0A 3KBOA 2Q2VA 4FOSA 1GADO 2I65A 3W6ZA 2EHDA 3KYCA 3JTMA 4YCAA 4WOKA 1WDKA 2ZB8A 1K6JA 2HQ1A 4FDAA 4FS3A 4FCCA 4LRTB 4HV4A 1YB5A 1G0NA 2EEZA 1CDOA 1S7CA 4WLEA 4K9DA 3I9NA 4NFHA 2ZQZA 4RGBA 4FJ0A 4DPMA 3QHAA 4Z3DA 1I8TA 3UHAA 1ZK0A 4FB5A 2CUKA 5TJHA 5C5IA 3S55A 4M1QA 2NVUA 4TSKA 1H6CA 2NADA 3DBHB 5IDYA 1NX6A 5BSGA 5JMPA 4F46A 5AXBA 4J16A 1NPDA 1Y1PA 3UAGA 1QLJA 2YY7A 1UP7A 1KVRA 1N1GA 5L9AA 1DEHA 4IDAA 1EVIA 1OBFO 4YJGA 3DC2A 3GGPA 3OA0A 4NJOA 4DYVA 3N58A 1GCOA 2VUUA 3QA9A 3A4VA 5DNAA 4EUEA 2V6BA 1Y7TA 5EQFA 5A02A 3RBXA 1DHTA 3DQPA 3PEFA 2E4AA 2C7GA 1PGPA 3DHYA 3V5NA 5I7VA 3VDRA 1N2SA 3E5RA 5A3JA 1E0DA 3CPSA 3DZIA 3LK7A 4J43A 4FIZA 4JJIA 5G0WA 3C1AA 1BDMA 2J8ZA 4Y8VA 2VZ8A 3PXXA 3PI7A 4F6CA 4BGIA 3HSKA 3C1OA 3FTPA 4CR8A 4U0KA 4IXWA 3BMNB 4UUOA 1X15A 2RBEA 3H5NA 4WE3A 1U3VA 2EW8A 3ZNQA 4CQLB 1QV6A 1VL0A 3DAPA 3KYDB 4K6FA 5TNXA 5JDIA 1BTOA 1DSSG 3I52A 1AUPA 3WFIA 4M55A 3TZ6A 4L0QA 4Y9DA 1NFQA 1HE2A 2Y1FA 4C4OA 3T7CA 1HDYA 3M2PA 1D1SA 4W6ZA 1HLDA 5ITVA 4G2NA 4YEDA 1QG6A 3OJ0A 1ENOA 3CUKA 2AHRA 3BYZA 3MTGA 4TRNA 1BVUA 2VYND 4E4YA 1P77A 1Y81A 3E9QA 5ICMA 3K9QO 3ZN2A 3V1UA 2IRWA 3DONA 1VPDA 3GPDG 4AL4A 1SB9A 2Q1TA 3D0OA 3Q6IA 4KOAA 1I30A 4LK3A 4NJMA 4BKUA 3H9GA 1DRVA 3EVTA 2RH4A 1T2DA 3MZ0A 2Q46A 1B3RA 1I5RA 2FY8A 4CLXA 4BMNA 4CM9D 1ZUD1 1U7HA 3DO5A 1U3WA 3JYOA 4EJ6A 2OOSA 1ZK4A 3V1YA 2X0NA 4JK3A 4W7HA 4ZJUA 2P4QA 5EL0A 1WWKA 4XB1A 5HA5A 2W8ZA 4E32A 3JD3A 1EQ2A 3H65A 1MFPA 3GEGA 4DREA 4MP8A 4CLDA 4BO0A 2XXJA 1Z6ZA 3F4BA 3S1LA 4ILKA 5KJ1A 2O4CA 1EDZA 3KEOA 3LF2A 4WKGA 4E5MA 4UVDA 2D8AA 1FDVA 3G49A 5B12A 3HE3A 1SO8A 3AUTA 3NGLA 4UEOA 4BNWA 4A26A 1C0PA 1TA4A 3FI9A 4HKTA 4MO2A 1U5AA 3GVPA 3JQGA 2YV1A 4MVJF 5TF4A 1CJCA 4W7IA 3GRKA 4NJMB 5U1PA 1F12A 1E92A 1XKQA 1YXMA 4WLVA 5BT9A 4AG3A 3KOUA 1BGVA 3ROKA 4DGSA 3WJAA 1Q7BA 4H16A 3ZWYA 2PD4A 2WE8A 3H2ZA 3V1TC 1BRMA 1YBVA 4MVJE 4B7XA 1EBFA 1E3EA 3CXRA 1OAAA 1KS9A 2E6UX 5MGBA 2CMDA 3KLPX 3VOSA 1QYWA 2QG4A 1DXYA 3P7MA 3EY4A 3GA0A 1BMDA 1R4NA 4CLOB 4XYMA 1LNQA 1DB3A 3I6QA 4GX2A 4KQWA 3PHLA 3OQ1A 3AY7A 3GG2A 4RVFA 2BGLA 3K5PA 4JGBA 3FHLA 1GU7A 4BOYA 2DPGA 4I5FA 3AY6A 4LISA 3EVNA 4L75A 1XU7A 2BH9A 3GDFA 1XQ1A 4I08A 2CSUA 2PY6A 4OQYA 4L8VA 3E9MA 1BWSA 1ZJYA 2Z1MA 1LDNA 1GY8A 1HRDA 4CMIA 2OO5A 3D7LA 1LBEA 1E6UA 2W4QA 1E1LA 1DAPA 2BGKA 3WR5A 5JY1A 2EW2A 3TWOA 2BELA 2Q1SA 4EEXA 4OM8A 5F1PA 3AUSA 4UVHA 5JO9A 2P4HX 3UCEA 1YO6A 3HHPA 4YAJA 3JQAB 4J9VA 5BQFA 2HMSA 3VPHA 1IZ9A 3U09A 3WBFA 4EJ0A 2DTEA 3FNGA 4XQ9A 1B15A 1EK5A 2VRCD 2GLXA 4OYRA 4QO7A 3E82A 4OHUA 2PGDA 4MKXA 2Z5LA 4YA6A 1U8FO 4MJLA 4RCVA 4E12A 3LLSA 3E6AA 5IZCC 2CF6A 2WD7B 3GLQA 5T8KC 1O5IA 3PJEA 1RM0A 2PV7A 2XAAA 1N9GA 3OECA 5H81A 1XCBA 3KSDO 4JP3A 2AEFA 4MPDA 4RF3A 4XQEA 2BRUA 4NBWA 2A94A 3NRCA 4X54A 4GGOA 2C7VA 4PLFA 2NU8A 1I10A 1PWZA 1GD1O 3R6DA 4RPLA 2Q50A 3Q2IA 4LVCA 3H3FA 3JQFA 3ZWWA 1H6AA 1Z7EA 4DQVA 6LDHA 4BO5A 3H9UA 1DO8A 1Y5MA 1U8XX 3TZHA 4LGVA 5JC1A 2O3RA 4YAIA 1PGJA 2QHXA 1A71A 1Y9AA 2VZ0A 4BKRA 3VH3A 5COBA 3OP4A 4B3JA 3ZV6A 4MP6A 4M54A 4E13A 3GEMA 5KJFA 3ITDA 3L07A 1K6XA 1Q0LA 1N7HA 2HUNA 2RAFA 1E77A 5IF3A 1IULA 3FD8A 1HT0A 2H9IA 4N5LA 4ND2A 4WCFB 2D5AA 4Z3KA 2E82A 2JD1A 2XF8A 1YRLA 3RJ9A 3GAZA 1DJQA 5T8KA 5A03A 4JNKA 4MIYA 3EYWA 3V2GA 5K6AC 1C0KA 4IJWA 2Y0EA 1ZCJA 1G1AA 5GZ6A 4LVUA 2PH5A 3DFUA 3F5QA 4MVJD 4OMUA 2I99A 3DBRB 4B4VA 3PQEA 1EFKA 3C1TA 3JQAA 1JTVA 4R51A 4WECA 4CM8A 5HS6A 2YHIB 4W9NA 2ZTLA 3OQBA 4O1MA 3RC2A 5KVQA 3O8QB 3GK3A 1PJLA 1VI2A 4ALJA 5CDYA 2ZTVA 4E2WA 1NWCA 3R0IA 1G0OA 4FN4A 4AVYA 1DFGA 1WMAA 1R12A 3QW2A 2WJPA 2OP0A 3P2OA 1WAMA 2ZTUA 3QWAA 2EG9A 4FFPA 3GDGA 2BD0A 2G17A 2AG5A 3D5TA 1V6AA 4L4RA 5ADHA 4HFNA 3MWDB 1LXCA 1EZ4A 3L9XA 4E31A 4XIYA 3RCBA 5COAA 3WWZA 1RM3A 4IIUA 3BHIA 1E3JA 3DBLB 1D8AA 3TNLA 3GUYA 1FF9A 4ND1A 2VYVA 3HN2A 4JLWA 4EITA 2ET6A 3INGA 3GF4A 3GR6A 3ROMA 4O0LA 4KQXA 4CLRA 4DLAA 3RASA 4ZRNA 3PQFA 4OXNA 5HTOA 1U5CA 3CE6A 4FGWA 3G17A 4TVOA 4RL6A 3B70A 4FQ8A 3S8MA 1GPJA 2HDHA 3GZNB 4J9UE 4PRKA 4BVAA 5TT1A 4J1QA 4NMHA 4AJOA 3Q11A 4A10A 3PHIA 2X1HA 5TX7A 1K6IA 1HYEA 1B0AA 2EKQA 1ZJZA 2GZ1A 2UVDA 4D44A 3RBZA 3WBBA 4J2HA 3V2HA 3AW9A 1QV7A 3GPIA 1IHYA 3INTA 4BNYA 2GZ2A 2PGLA 1R0LA 1LQUA 3C7CB 1ZSNA 2O7QA 1HDCA 3ZU2A 4BNMA 4DLLA 4RQUA 4Q9NA 1YDEA 4NIMA 3VH2A 4IJUA 3PJFA 4C7JA 5HRUA 1L7EA 1TT7A 3DBHA 2X4GA 3RUFA 5CG2A 2PWZA 1CWUA 4GX0A 4J6FA 4PVCA 2X5OA 3DZHA 1YWGO 3FSRA 2G76A 1EQUA 1LDBA 1LDMA 3AI1A 4GSLA 1UDCA 1PTJA 3ZCXA 5BSHA 5JBIA 3OEWA 2A4KA 4MIOA 4I5EA 1Y9EA 3NV9A 5JE8A 1UXJA 2QRKA 1ZK2A 3DOOA 4IY1A 4J7UA 1LEHA 2IDZA 2O2YA 3V8BA 1K89A 1A27A 2HRZA 1XWFA 2YDYA 8ADHA 2P91A 3H6KA 3NX4A 2DT5A 2GCGA 2TMGA 2YFHA 3KM0A 1DFHA 4AJEA 5I9MA 4NQZA 2DU8A 3Q1LA 4DWVA 1AHIA 1CIVA 1C1DA 3GDOA 5AXAA 2CD9A 1GUZA 3BTVA 1RJWA 1EVJA 4FFRA 3D4PA 4JCOA 3O8QA 2H63A 3O9ZA 1KVSA 4JJFA 2O3UA 3VZQA 1ULUA 4E5PA 2JCXA 4B7UA 1LDEA 4GVLA 1PWXA 4R41A 1NPTO 1Y8RB 1X0VA 3ZU5A 4XDZA 1DFIA 1V3VA 1ENPA 2HO5A 5TJ9A 1X1EA 1KVQA 3KLMX 5TLSA 2VT3A 5AXCA 3L77A 4K26A 1NHGA 4TRMA 3RSHA 5IDXA 3BZUA 3OJFA 4AJLA 3IUPA 1H6BA 4PLHA 5BNIA 1YKFA 1XSEA 4P4LA 1JKFA 1R0KA 2PKQP 3DAGA 1P0FA 3FNFA 1KC1A 4E0BA 3H7AA 3HDYA 4ND4A 1I3NA 3BTUA 1PL8A 1UXKA 3AFNA 1ZEJA 2NV6A 1Z45A 2IZZA 4YYZA 4WCFC 1IZ0A 1CQJA 3JD2A 2VOJA 1JU9A 3JYLA 4QXMA 4CMHA 1PZEA 5EPOA 1AN9A 2I6TA 1HDZA 1DC6A 4PVDA 5J23A 4D7AA 2NQ8A 3FNHA 5CFZA 2B4TO 4CV1A 5CDSA 1WDMA 4OXKA 1C1XB 4YQZA 5H82A 2GPTA 2A9FA 5A9RA 1MC4A 2OZPA 4CM3A 2CVQA 5KCZA 5U9CA 3GNQA 1QSGA 5KVCA 3KB6A 4BKOA 3Q9NA 2NM0A 3DBVO 3WTBA 4EI2A 1QORA 1ZXBA 2G0TA 1C3VA 1ISMA 2R2GA 4LMRA 1YB4A 5KJ6A 4JP2A 2EERA 2X6TA 1WMBA 3WYEA 3DTYA 1ZW1A 3JD4A 2C59A 4D42A 2D3TA 4BNNA 1TT5B 2FMUA 3HJAA 4UUPA 3K2BA 1WZIA 3EHEA 2EP5A 3L6EA 4NR0A 4R4JA 1XR3A 3JYQA 4OIMA 5IXSA 1LQTA 5ITWA 4R3WA 2IODA 4GH5A 4BQPA 2W2KA 5COQA 2EXXA 3PWZA 4WJZA 2DBVO 3HDHA 2HK9A 3MOGA 1H94A 1LC3A 3GFBA 2P9EA 3KSZO 3D3EA 4CM4B 1QYCA 3LC2O 4RVHA 2WE7A 3WGHA 1MXHA 2OXIA 3RVDA 1E5LA 3TPCA 2Q1WA 1M66A 3WOHA 2NWQA 4R69A 1HDGO 3E03A 4JJGA 3N74A 3IJPA 4A2CA 3E18A 3BA1A 3QVOA 4FFOA 4J4BA 2W90A 4MKZA 2Y05A 1B8UA 1P1JA 3M1AA 3I5MA 3IP1A 1EMDA 1TB4A 4RORA 2RCYA 3RUCA 2YJZA 2C2YA 4XKJA 1VL6A 3BMCB 1DIBA 2UV8A 3HZZA 4Q3EA 4DBZA 1LSUA 1ONPA 3F9IA 3RC7A 3JSAA 1A72A 4Z6KA 3VAZA 1E7QA 3SXPA 3E1KA 3B1JA 1EUZA 1SBYA 4LSMA 1PSDA 4ZN6A 1A7AA 3RC1A 1B16A 1PJTA 1LLDA 3H5AA 1T2CA 3T4XA 1ID1A 3L4BC 1H6DA 2J5KA 4DC0A 4DQXA 1U4OA 3WGOA 3QJ5A 1GEEA 3PK0A 1EE9A 2HCTA 2HMWA 3BMQA 1G6KA 2WSBA 4II2A 3ZWCA 1H9AA 5DULA 5I8WA 1PZFA 4EEZA 1JLLA 1SCUA 2WDZA 4ONEA 4JIGA 1Z73A 4EYEA 3F1KA 1HF3A 1ZEMA 4IDFA 1EUDA 1TVEA 1BW9B 4DPLA 2WYWA 3NJ8A 7MDHA 2BFAA 2OBYA 3WGGA 3UKOA 3ON5A 2BLLA 4WUVA 1F8GA 1FK8A 4MIEA 1IY8A 1VM6A 2HLPA 2YQ5A 5G0VA 2VRCA 2X23A 5G0TA 2X8LA 2ZYGA 4BO1A 1ZFNA 2SCUA 1YH3A 3B20A 5ICSA 1I3KA 1A7KA 2BF7A 1LSSA 1IYZA 1OZAA 3PYLA 3CH6A 2J5RA 5K6AA 3SEFA 2Q49A 1KC3A 4Z9FA 5JCXA 4J1TA 2H1SA 3WMWA 1E1NA 1XHLA 4AJNA 4CUJA 1UH5A 3WGZA 1GR0A 4RVDA 2W98A 4NDNE 3RQSA 1J6UA 2EIHA 2FSSA 5KIAA 4I9HA 4L73A 4LW8A 4B8WA 3GMSA 3U4IA 5JMWA 5KTKA 4NBUA 4BNJA 2NVBA 2DBRA 4OKIA 1F14A 1U1IA 3WXBA 4YJFB 3WGYA 2Q99A 2V6MA 4D79A 3WQRA 1H0KA 1JQBA 3I9MA 3JD0A 3Q0EA 3WTCA 4Q3NA 3LQFA 2OMEA 4XQCA 1M6HA 3NUGA 4NZ9A 4B3IA 2GYYA 3RU9A 4EUHA 3DOJA 1E7MA 1I2ZA 3DFZA 2CDAA 1X0XA 4J1SA 4UVIA 3DMYA 4J49A 4RVGA 2DBQA 1RPNA 3DAFA 1T4DA 2O48X 5G0SA 1QYDA 5BR7A 4QECA 2GN8A 3MJCA 4M89A 3RUAA 5LCXA 5ENVA 1DRWA 3QRWA 4CJXA 3I9LA 2X86A 1XELA 2OGUA 3TOXA 1I36A 3A06A 1UZLA 4HY3A 5T6BA 4CMAA 5L95A 4XGIA 1ADBA 4LMPA 1HETA 3KEQA 3JQAD 3QLJA 1V0JA 4NK4A 5DOZA 2I9PA 3S2GA 5DN9A 4CMBA 2VT2A 4II3A 3WIEA 3GRPA 4DTIA 3K8ZA 5LDGA 1MGOA 4BO7A 5ILGA 2DM6A 2JAPA 2VOEA 3C8MA 5GY7A 1ZH8A 5T57A 4OKNA 3RWBA 1UAGA 2W2LA 3EMKA 3NTRA 4YJGB 3EGOA 4JXKA 5KKAA 1ADGA 2AQHA 4N54A 4YDRA 3AM3A 3PDUA 1QYVA 1D7OA 3L4SO 4IXTA 4WK6A 2CVOA 3FF4A 2PFGA 3GZ4A 1DIRA 4B79A 2LDBA 1FJHA 2PZMA 4CMEA 1MXFA 4MP3A 5IFLA 3P5SA 2RH8A 2WWRA 3FBTA 1OOEA 3NYWA 5TRTA 1CRWG 1FXSA 3UXYA 4PG4A 2O4UX 2DC1A 1P31A 4D46A 4O59O 3NGXA 3M1LA 1KYQA 4CM4A 3VTFA 3PQDA
chains in the Genus database with same CATH superfamily
3LWBA 1EP2B 1A9OA 2WVGA 3CZMA 1J8FA 3MJTA 4TGLA 3SXUB 1T5DX 2R87A 3KOMA 3IAHA 5AXDA 1X7GA 3S68A 5THQA 1C2YA 1L2TA 4NZYA 2O57A 3PA6A 1A9ZA 4MRNA 5BNTA 2HWUA 4IM7A 2PZKA 2WFAA 3L6RA 3JATB 4GYKA 1E2NA 2F43A 4RADA 3UOGA 3WHIA 2YXLA 3G2QA 4PLGA 3O8BA 1S2LA 1W4BA 4Q1VA 2EGHA 4C21A 3IDSA 2W83A 3H1PA 4G07A 2BEUA 2PVCA 2WIAA 4URFA 3GJZA 3IEIA 1P3JA 3WLEA 4DUGD 4M7OA 1R0RE 2ZUUA 4D8VA 3SR0A 3R9WA 4WXYB 2GPSA 4UU7A 3MUOA 2O3JA 3LV8A 3M2TA 3TTSA 1RJDA 1VBMA 1YOVB 2OAP1 3E5MA 3NATA 3QKIA 4GKVA 1XEFA 4IZ6A 4HDNB 1E79A 3VFDA 1CC1S 4PZCA 3PUXA 4CMGA 3FFAA 2XV1A 4XOUA 3LPLA 1BNCA 2J4DA 3NU1A 1Q0SA 2QPAA 3SVZA 1D3AA 3GJ5A 3U3MA 5ALNA 2PM8A 4JSTA 3DZBA 1AKUA 3FWYA 5L3SB 1BX0A 1YCGA 3RU2A 2AOUB 5C35A 2WQZA 2ZYUX 1FRFS 2QN6A 1E7WA 4R0VA 2FWIA 3PEEA 3R0JA 2YL2A 2IVFA 5EMLA 2AA3A 3RVMA 3ZCPA 2XB2A 1WA5A 4QGHA 3LUDA 4LHVA 3CT4A 3IDFA 4NEHB 1FOEB 1UOPA 1WEHA 4M87A 1GPDG 1QLWA 1DBRA 1G9XA 4NYMR 2D54A 5KNDH 3VDMA 4BV9A 2BV3A 4FM9A 1J5EB 2MSEB 3KETA 2J59A 3AZOA 4CWAA 4ARAA 3GEEA 5H4HA 5B1SA 3KDSE 4CRWB 2VTBA 1JEYB 1BW9A 2R8ZA 2YWRA 1RAHA 4DZTA 2RH5A 1D09A 5A9SA 3GVCA 3AVQA 3R74A 1E2JA 3UGQA 1DX4A 4L50A 1CDZA 3GVIA 3SNHA 5M2QA 1YHZA 3RFUA 2OV4A 4ETMA 4D9CA 1EWRA 2PMWB 4LBWA 2GF9A 3NLLA 3A9TA 4HH3C 1F0YA 2XMQA 2IHNA 4DIMA 2WFZA 2XI4A 2X6QA 3DMNA 3WG9A 1E69A 4WBNF 4J03A 4X41A 5GM2A 6Q21A 5KTSA 4WFIA 2GN6A 2RD2A 3VOBA 2ONCA 1XTIA 2PMDA 3L8YA 1W46A 3PFKA 5ALSA 3SBOA 4HAXA 3WV4A 4BDTA 5KTYA 5LQCA 3PC6A 5M34A 1EU1A 1IH8A 3A7DA 3OM8A 2GK6A 4RTLA 3B3GA 5ITZA 3LYHA 2REOA 1KWGA 3ZWNA 4LZAA 3KVOA 5KQSA 1N8TA 1GPAA 3WAGA 4YRAA 5TV2A 3QE3A 2GKGA 1CD5A 2RHWA 1QIJA 2ZIXA 2IW1A 3U5TA 1N2JA 3I1JA 4UM9B 3THYB 3LQQA 3RGGA 2LVBA 1C7QA 4MVJH 5C8ZA 1T1RA 1U0TA 3EZ9A 1OAOA 3A6DA 3GUZA 1EA5A 3W1WA 4DA0A 1VLQA 1HEUA 1OZFA 4QM6A 1M33A 3WNVA 1AX9A 4JMLA 5CXQA 3QMWA 3O8OA 4DNXA 2Q3MA 4KV7A 1K66A 1SA0A 1XAGA 2YV2A 2FPIA 1EG7A 5IK2A 4KITB 3GO4A 5L7WA 3VR2D 3MS7A 3AM1A 3PRJA 4Z0PA 2QZJA 2RIRA 3VRHA 4D3ZA 4PRYA 5EMHA 4EUKA 5AI0A 4TUYB 3WZ2A 1Z35A 1GZHB 1G8YA 3GD7A 2Z1NA 3CR3C 4ENRA 4EFKA 1APBA 5IEBA 2JZNA 3UJPA 2CFTA 3UUWA 4I55F 1QRTA 2D2IA 1NJGA 2XRZA 4DG8A 1PKEA 1T0UA 3D1JA 2VZEA 4HB3A 3ICPA 4ECEA 3EX7C 2AWNA 1ML3A 4YAEA 3G2IA 3IOCA 4DQKA 2PGOA 2ABWA 4MXDA 1NX9A 1VSQA 3EVEA 5JYBA 4RD4A 1P9RA 3MG9A 1GDDA 3MTDA 5I9LA 3A6ZA 5EZ5A 1E9CA 3WL3A 1GO2A 1YZHA 3U3ZA 2XH8A 4YASA 4OLJA 4ESEA 1MQAA 3G8YA 3L4EA 2KE5A 4ADSG 3CINA 1BKSB 3CH5A 3K8QA 2O1WA 3HQ4O 1XO1A 2MU1A 3U4HA 1JDVA 3MBKA 3MJ4A 1HE1C 4UNNA 2DBZA 4NRDA 1UBRS 2AOTB 4I55A 5TR9A 1TVMA 3E3LA 1TRKA 4DV1B 4ROTA 4A27A 2HPVA 3GLHB 1P80A 4N9WA 4Y6LA 3LT0A 2DPHA 3OMWA 1YB7A 1LS6A 2ID7A 3LH5A 3LUKA 3FSGD 4JASB 3O0TA 2QXTA 1H1LA 3UKDA 2VDVE 1JEYA 3NR2A 1USVA 1WDLA 1K88A 2WEKA 3LUBA 3VNRA 1BMQA 4L95C 5CT5A 3HM2A 2OESA 4MLDA 4BMOB 4HDSB 4FFDA 3HVKA 4KWHA 1G21E 4P5DA 1T0PA 5KTOA 3DJYA 4MVYA 2ES4A 4AY3A 3ZW8A 5IK2D 2AE2A 1AS2A 4DHEA 1G64A 1JJ7A 1QRRA 2JF0A 1N2CB 2FKNA 3TOCA 5LUAA 2IGTA 3TJRA 3H9JA 1PQWA 3DF7A 3TLXA 2F48A 4HNTA 2G5CA 4AJ4A 4EYGA 1GGFA 3MSXA 3QJYA 1FTSA 2P6OA 3R7SA 2IFTA 1RBMA 2RBKA 4G6ZA 2WT8A 2WF7A 1NN0A 1RYBA 5EZQA 3IT3A 2AG0A 2ID8A 3HUTA 1D2MA 2AMJA 1L4UA 3G79A 3IO5A 4V0NA 1U2ZA 3GELA 4O1HA 5PNTA 4ETIA 4PN7A 5KPDA 2H57A 3L8ZA 1I0ZA 1SVOA 3C3KA 2Q2OA 5CYFA 5LR6A 1QAQA 3VU0A 2QR3A 5EVCA 2C7RA 4NX2A 3CN7A 2XUKA 3H2GA 3OFSA 5K0TA 4JXZA 4MS4B 4OYYA 3F2VA 4GWGA 4AUKA 3S8EA 1XMOB 1R8QA 4D3SA 3R24A 5C8VA 4BNTA 1JG2A 1P2TA 3ESZA 2FW6A 2VK8A 3RH0A 1QDEA 1M0SA 3E9ZA 3VR2A 4YT2A 2Z4SA 3A3PA 2AZ4A 3FUXA 2A84A 1TIPA 4HXYA 2X0JA 3AF1A 2XE6A 3EUWA 3U81A 4F2GA 3GLIB 4UUQA 1B93A 1DC3A 2B36A 2PUDA 1ECJA 1UPFA 4LZZA 3S29A 1Y4SA 2K7ZA 3FI0A 3IUJA 2HWKA 3LSYA 3Q3VA 4L8GA 2OK7A 4F45A 1Y3BE 4LJ6A 3H18A 3PQ7A 2J9FB 3O4GA 3UMYA 4BMZA 2HHHB 2GAOA 1ZKMA 5B53A 3O3NB 5BURA 5JD6A 1FQJA 3GV0A 2OQRA 4IOJA 4RH3A 2FG5A 3AIKA 5MDHA 4RQTA 3A37A 2YWFA 9MHTA 3INYA 3J7TA 4AYXA 1UJMA 3LBHA 2QTVA 3RT7A 1E98A 1M8JA 2VXOA 3CNEA 2OP1A 1VG1A 3H16A 3NGMA 1I7SB 1UJ4A 4GW3A 1BKDR 2C8LA 2MYNA 1DP4A 2OV6A 3HP7A 4CE6A 4PFJA 2FK7A 3AGPA 4PGGA 4AIRA 4YV2A 1MC1A 4S2EA 2O19A 3ICOA 2PMCA 3AJ9A 4RIHA 2VTBB 3GCDA 2AYYA 4QE3A 1ZGJA 3CLVA 1MORA 2QOEA 2D59A 2SHKA 4IMIB 4Z3OA 1T4CB 1E64A 4AO6A 4EL0A 3CO5A 4J4TA 4YLYA 1SQ5A 2CBZA 3VVMA 1MEJA 3PBKA 4XSHA 2IXTA 2QT9A 4PX9A 2JHFA 4EBFA 4PM4A 1J4AA 1L7XA 2ZRFA 2C57A 3ZQ4A 4IUYA 4L15A 1ZJ4A 4UREA 2FUNB 2ETVA 4R7ZA 1PYDA 5DI3A 3RU7A 4LRWA 3A6FA 4EB6B 2CLKB 3S44A 4B4UA 4XI9A 2C92A 2HDNB 1HDEA 3TEMA 3NKLA 4UNQA 4A8PA 4H7HA 1KE2A 1X6VA 2QTTA 4A0FA 1DQRA 3UW1A 4KWCA 4X8HA 2EKPA 3ETGA 3L1IA 1Z83A 1MABB 1R66A 1XRNA 1JDUA 1GPMA 2ZI4A 3GGJA 3IPRA 2WAAA 1L5GB 2P5SA 3UT0A 4KMOA 4H6PA 4WNIA 1CZRA 4P4SA 7ABPA 4JYCA 5DKFA 1T10A 2P6RA 3WIOA 1Q3KA 3TLZA 2WSLA 2YN0A 4KV9A 4L28A 2BE9A 5CYOA 3RHFA 3SHQA 3I04A 5E9QA 2VJQA 4PAWA 1RZVA 3EZYA 1U02A 1NYQA 1T13A 3TMYA 1FFCA 5CVVA 2J67A 1QH1A 2NLOA 3LT4A 3OT5A 5DX1A 3KWJA 1NASA 3OIDA 3U4MA 3NHKA 3I5AA 1ZA2A 4BMXA 3D6FA 1E3MA 4EG7A 2ZPAA 1XQWA 3I01A 4PPFA 1HQCA 5LP6A 4G5SA 3OIYA 3OESA 1J70A 4JC8A 5IH7A 2FNAA 4DG9A 2GAFA 3GEHA 1AKVA 4MWGA 1USKA 2AMLA 1JVSA 3E23A 4YJHA 3WKAA 3I39X 2G1UA 2VCHA 3AVTA 3EZFA 2BZGA 2IY7A 4OO3A 1JSZA 1GG2A 3INRA 1L8QA 2VHXA 3BHMA 4AWAA 1G2OA 2GHIA 3OWHA 3KJNA 4OI1A 2JFUA 4Y2YA 3VVLA 2J9XB 2SICE 2ZSFA 1CHNA 4GMXA 1KZHA 3VA7A 2X77A 4QJ3A 3ZJ5A 1X7ZB 1UM9B 5IX8A 1Z5WA 1KO8A 1N3LA 1YMUA 2AW5A 3F3MA 1QR6A 3DWIA 4R81A 4MDEA 2PWAA 5LZ5A 1P1IA 3EXFB 4ZEVA 1K7YA 1KVTA 1TF2A 1JKIA 3ELUA 5HG0A 2JCYA 4AZ0A 3BWVA 3I6ZA 1Q7EA 1ZO8A 1VGVA 1YL6A 1T2AA 3O9VA 5TMDA 4JI6B 7REQA 5IAAA 4IRUB 4DUYB 4L5BA 5ALVA 2W6JA 4Q7MB 3VYRB 1ID8A 2I67A 5K8CA 2TMYA 1G8PA 1XAIA 2Y0DA 4M9CA 1X7YA 4K9QA 5JMTA 1OB5A 3LHSA 3R0ZA 4EA6A 2IYOA 2QN2A 3CX6A 3IFSA 2C5GA 2GVNA 2XGMA 1I24A 3QPAA 4LV5B 3TN7A 1LJUA 1MAHA 1T8WA 4KX5A 5AYVA 2V3CC 1C9KA 1XYGA 1W2GA 4YJHB 5TQJA 2A5DA 3KHUA 5LXTF 1IPFA 2CN1A 3VR4H 4EF5A 3PGXA 1PL0A 2ENWA 4PZ0A 2C29D 2GN1A 4FXPA 2PZLA 2Q41A 4X1KB 5DP2A 4YFYA 3QHPA 2XBLA 2WY2D 1EG2A 2WUDA 3PI6A 3RIHA 5AKZA 2WTMA 1O95D 5HF6A 5EPUA 4WXHA 4FBGA 5HBGA 1VJTA 4M1MA 1WEKA 3M34A 3ZU4A 1ZMBA 1JWBB 4MPTA 2EP8A 3D54D 3G2MA 5AVVA 2OQIA 2BDTA 1YBMA 3TSYA 3C7AA 2B8NA 1E5QA 2JAXA 2C3YA 3ZNNA 1UJCA 2VNSA 3FPCA 5ED0A 3DPIA 4MS1A 4DW8A 1X9GA 3ZX5A 1A50B 4YUYA 3BRWD 5E8JA 2B5WA 1Y3DE 3EGIA 5EQTA 2ZPUA 3ZZUA 3TUIC 1A0OA 3RK1A 2A57A 3OKFA 4IDHA 4FMDF 5BWOA 2QLLA 4E3ZA 5H9VA 5TDHA 5KDDA 2PL1A 4RXMA 2Q3JA 4AJHA 4N47A 3WAKA 1ZZGA 4K0RA 3DEJA 1JVBA 2E48A 4RHFA 5LQUA 5B3LA 1SXJC 3DL2A 3VPBA 4L9SA 5J4LA 1KI2A 4BO6A 4AXXA 3TLEA 1JPJA 1WPQA 3LDAA 1R6XA 4JLSA 5JS2A 4M88A 2UYHA 4BXOA 4QRIA 1X7HA 2FE1A 2P75A 3JWIA 1SBZA 4FR5A 3CCBA 4XFKA 4H59A 2NO1A 5HM8A 3SQDA 1H9BA 2A59A 3KB8A 2AMVA 5AKXA 2O8FA 4M9UA 3L0ZA 4H9GA 2YHUA 4IDEA 4PC7A 2OG1A 5I9TA 2WU8A 1E9FA 3N2LA 5DM0A 5I8ZA 3CVUA 1QHIA 4TYNA 1WETA 3SYLA 1QFSA 2Y0PA 4BYMA 1OU4A 4MW1A 4R8LA 2PNJA 4BRUA 2OA0A 2FMTA 1M6EX 1LNZA 1V3QE 3PC4A 1NXOA 4N3CA 1SPBS 1ZBQA 4YP0A 1SK8A 5KYVA 4G0VA 1MOQA 1F8YA 5K3OA 3QOFA 4BIIA 2XGGA 1NXQA 1UWVA 4HS9A 3P9QA 5FBZA 5LNK1 2IHYA 5B30A 5BPHA 3OLXA 1YAJA 2YWGA 1JR4A 3FOAA 3KS9A 4HI0E 4M0LA 3FWKA 5EJ2A 4W9RA 1AHPA 3IAAA 3TAUA 4JYAB 1F20A 2N75A 3HDVA 1EFPA 1Z7BA 2H3EA 2V7UA 1OLOA 5HUQA 5F4ZA 4BO4A 4Z51A 3CZ5A 3QU9A 3IV9A 4HRVA 1Z18A 1ZM4A 3AR6A 3O6VA 3RSSA 1V11A 1U7PA 3WLSA 3O94A 3USZA 4KN6A 1THTA 3JWEA 1O97D 4D1YA 4EVSA 1E9BA 5A0TA 2ZE6A 2ZWIA 5CPBA 1IQ0A 3VZSA 1Y9JA 4I5DA 4YALA 3EGWA 4JKIA 1A5TA 3KYIB 4HB0A 4PIVA 3MUEA 5GONF 3HXMA 4X7BA 1BDHA 1R6VA 1PR1A 1F6WA 1JLLB 3UENA 4Q3BA 4ZEMA 1H5NA 1G5TA 1XC7A 2FOIA 3L7BA 1DAEA 3BBPA 1VE1A 4P33A 4WZZA 2NU6A 5CFQA 3CKYA 3QWBA 3SR4A 1XDDA 3BWXA 3RIGA 2QTBA 3RTEA 1B73A 3GMDA 4H27A 2AMYA 4CCWA 4ER3A 3W5HA 1E2EA 5DWVA 5JD5A 2XB9A 3ZQUA 3HI6A 3TFWA 5AKGA 4ZTUB 1S3IA 1VJ1A 1W44A 1AC5A 1UMDB 4RHTA 4DA8A 1WOYA 4XGNA 2RGNA 4G25A 3TR0A 5LKAA 3TD2A 1Q7GA 3SBDA 1OLSB 4XYBA 4IEEA 3GFGA 1LBQA 5GONA 4YCBA 3M5CA 4P9NA 4ALLA 1MDBA 1YE8A 5CVTA 4V3CA 1E79D 4EJSC 2E55A 4F6RB 4XB6B 3IBGA 1CVIA 2W2LD 2PVSA 4Q1BA 3TZKA 4RZIA 4RVUA 2ALJA 3ZIDA 3IVRA 1QCDA 1UMKA 3ND6A 1RKUA 3LRTA 4WCFA 3EIOA 4K3UA 1IONA 3DPSA 4FQ7A 1XZAA 3DZFA 4RPKA 4MW0A 2I34A 1IEVA 2YFKA 2WJZB 2EVWX 2I91A 4O29A 3OTHA 4ZOBA 3U3XA 3L93A 1M2VB 3ESBA 3I2JA 1L4NA 3R4CA 4RABA 3S81A 5G2OA 1MDFA 3NXSA 1Q19A 4EA9A 2LR0A 1AS3A 3G8AA 3ROZA 3UQYS 2LPMA 4PSUA 1LZKA 2NU6B 4WAUA 2BEJA 1AO3A 1GJRA 3FDXA 2VH2A 2GD1O 4O4HF 1ESCA 4K88A 1BD3A 2IHKA 3DWGA 1VHWA 2GF2A 3AHFA 1NWHA 4MZDA 4ZVLA 1SUIA 3RK4A 1BQEA 3HO8A 2OAEA 3URKA 3SP1A 1H8ED 3KXLA 4BKPA 3ZHUA 1RI5A 2WFLA 2AI2A 4JQYA 4YUWA 2EDAA 2O0KA 5FH9A 1XZMA 2GPYA 5K7SA 3AEQB 3F9RA 4PC3A 4E2XA 1XVAA 5G0UA 3AU8A 4UBKA 4J94A 2ZFUA 3NC0C 2VI5A 1RAAA 4RF5A 3CLKA 4E09A 4O33A 2PKYX 4Q18A 4LPSA 3CX8A 1K27A 3T5GA 1MO5A 1O7JA 1AUXA 1P7PA 4U7DA 3TCNA 1L8AA 1DV2A 3TNYA 4GC5A 4PYMA 3MCTA 3NWEA 2MJLA 4KOEC 2JRCA 2CXHA 2QLBA 2VTEA 3IERA 4EJ2A 4IJ6A 4KUHA 2VHYA 3ROGA 1ZGAA 3FYUB 3NYRA 3B6ZA 4JJZA 3GLUA 2YV4A 2PR7A 4PFQA 2C1ZA 1DAIA 3HYNA 2Q21A 3UMRA 2KW5A 4BLRA 4CDRA 4H4EA 3NKFA 3U3DA 3WKEA 1M1XB 1Q1AA 2XYPA 1EGVB 3C6MA 3QF4A 2CMHA 2WUVA 2C94A 2K87A 4QDZA 1P1KA 4DJTA 1L4KA 4MUJA 1K8ZB 2PE5A 1RC8A 1D4OA 4BVLA 4ZYYA 1JR3E 3VSAA 4LF6B 1TCCA 5EJ5A 2D2VA 2CVZA 2FGKA 2G4VA 7GPBA 3CE9A 1ZLYA 4BV3A 1H2XA 1NT4A 3PGLA 4RKQA 1Z47A 4DAOA 4DMCA 4HC4A 2YJ6A 4Z4HA 3RAFC 1J0EA 4MUHA 4S1WA 4KPUB 3WHPA 2O0JA 3F67A 3HC7A 7MHTA 1E6EA 4NHOA 3K0SA 2QBYB 3CH4B 1YRQA 4DB2A 5K6TA 3FMPB 4K28A 3BAZA 2VDOB 4EDHA 3VYTB 1V25A 1C4WA 3P9KA 3EMBA 3FNRA 2BL4A 4RIEA 3FHCB 3JQ8B 1F0KA 1GVHA 1NUQA 3O1HB 5B3AA 1XTUA 4LRYA 1P3Y1 1W2HA 1GQYA 1OI7A 4YRQA 5ITSA 3KOXA 3UTCA 2QRMA 1JR2A 4A2PA 3GRFA 1RI4A 2FP4A 2I54A 3H4VA 4ID9A 5TPZD 3UAVA 2WZBA 1KDYA 3THXB 4TQUS 4C0WA 3AVPA 4EL5A 4J0QA 5KYUB 2ID9A 4GLLA 1K3TA 9ATCA 3FN4A 4CTKA 4RHXA 1IPHA 4CU5A 3YASA 2XGSA 3EG5A 3F7TA 3WMGA 2DHEA 3H5LA 2IEDA 2QVGA 2WU0A 5AMXA 2ZU6A 5LJIA 1CUHA 4Z4QA 3CBQA 4ZVSA 2FPUA 3X1KA 3PQ3A 4B74A 1N2XA 2BTEA 2CLEB 4ZQGA 4C2TA 3V55A 3ANNA 1AGNA 2JD2A 3B1FA 2QZPA 4NFYA 1NVDA 2E7ZA 2QRPA 1BGWA 1HYGA 3DXXA 3UG7A 4EKGA 1UK6A 2PCLA 3EVBA 5IC6A 3X0DA 3MXOA 1C9EA 4FCWA 1ZGCA 4FKZA 1BAPA 2JHGA 4IHJB 3RIXA 3SC2B 4IAOA 4YO7A 2G3YA 4QOSA 3SN6A 3SXUA 1TCUA 3PSHA 3S2ZA 1JZSA 3IXQA 4X65B 4POOA 5G1NA 4IGKA 5C9ZA 1DHRA 1LV7A 3PUZA 2OBMA 3E05A 4OJKA 4RHEA 3UT6A 2NZ2A 4HWKA 5EGNA 3BE8A 1G6HA 5ARDA 3WWEA 3VUEA 3J81k 3T61A 3LRXA 2J4FA 2BM1A 4W8HA 4CFSA 4JXXA 2QQ5A 5LB2A 3WWOA 1W30A 4HYTA 2PZJA 3R3XA 5KTPA 2BMAA 1J2JA 1Y6QA 1MX3A 4FP9A 3B1XA 4HPXB 1TUGA 2UVQA 1RTKA 4ZARA 3SVLA 4OSEA 1CYDA 4PZYA 4UQOA 4ZXPA 2UZ0A 1S9DA 4NABA 2BP7B 1FJXA 2ZJ0A 1OX4B 4DA4A 1S96A 1FUYB 1WKBA 2FOXA 2Z3ZA 1UOQA 3NONA 1FBNA 3PE6A 4V0SA 3W5IA 1P72A 1P2VA 2QE7A 4H3HB 1JFTA 5LBTA 5KYYA 3MS4A 3QUSA 4BRWA 5DBFA 3WAJA 3P9RA 3AIOA 2W7TA 1W52X 3CH7A 3OHMA 5FL3A 5AW0A 3QYPA 3EE6A 3S4YA 5GZ3A 3ILHA 4LJYA 4NEGA 4R1LA 5JDCC 1CY0A 1I33A 2WM3A 2V7QD 2YXBA 2ZQ5A 3KCNA 4LKRA 2SECE 4B35A 1KH1A 4BMYA 1R0XA 4CT4B 4KR7A 4NZNA 2EEPA 1MPXA 2GZSA 5L3QB 4DMRA 2PUAA 5K05A 1C1HA 1RWWA 5A4MS 3R6GA 2VK2A 4R9RA 3QTTA 1BJTA 2WVJA 5IDQA 3VJRA 1TM1E 1RM5A 4FB4A 1B8PA 4DLBA 5KNCA 5AVUA 3O0DA 4GSKA 4IDGA 4BB0A 1M6YA 3HYTA 3W6NA 3NDIA 2GZMA 3QQ5A 4HP8A 4HRXA 4FOPA 2H6EA 3OOYA 5LZ2A 2POQX 2Y0BA 3NTXA 3AUXA 2GZAA 2XE4A 2UXCB 1NVXQ 2ECQA 3AI3A 1WOMA 4FEEA 4EMSA 1KETA 5CA1B 2FCAA 2HZ7A 4CT0A 1XXHE 1CQPA 1DE0A 1R9JA 2KYRA 5FNVA 5EI5A 2FK8A 3SYTA 2BR5A 4IKPA 5IASA 1JIQA 2AUMA 4KDRA 5I51A 2BVNA 2QMEA 3WIDA 5K2OA 1J2YA 4YJFA 1E96A 1KJIA 3RYHB 4BBZA 3L43A 2ZXUA 3OCUA 2V8OA 2QP4A 4UTZA 5A04A 2PH3A 1LC0A 4OHWA 5E3HA 1TW3A 5F3DA 2WWHA 1V4VA 4LG1A 4QTTB 4KVZA 1TZKA 2B5VA 3TZQA 3PUIA 1C8BA 3NOOA 5DYTA 3JALB 3ZCRA 3H2BA 1KPHA 1TTQB 2I03A 4KODA 1NM5C 2Y0CA 4BV2A 4EWLA 1CJVC 3H83A 2HNBA 1GZVA 2X2OA 3KKQA 3DCNA 4PCAA 1EJ2A 2BMDA 3RC9A 3KYDA 1ONBA 3CIFA 3H2SA 4UM7A 1PDWA 1XIVA 5FWDA 2XE7A 4DVJA 3P9XA 3BXXA 3MJSA 1WSAA 5T3UA 2XDAA 4ZDWA 4B4WA 1RXWA 1ORDA 3OQIA 4YGYA 3VHXB 3VHRA 3VTKA 2JCVA 1L1QA 3ITKA 4G5GA 4MUBA 4UE6A 4Q12A 3U48A 5KYYB 1R10A 2JGLA 3IOEA 4MUMA 4PCLA 1CFZA 4R2KA 2CE7A 2HA0A 2O52A 3ER6A 3O83A 3PZRA 2QX7A 3HR7A 1TCAA 4HYQA 5G4KB 3B3JA 4C1NA 4PYLA 1PJZA 1UZMA 1FQKA 5CFRA 1QNFA 2CFIA 1AA9A 2Q5IA 3PPXA 4AU1A 1T2EA 3T99A 3LXUX 2Q5OA 3RC8A 1T6BY 1KEPA 2CNOA 4P38A 2G5GX 1XZJA 4NYJQ 4PC2A 3VAAA 1OH5A 1YRAA 3SS9X 3EC1A 5JI3E 3NUZA 2Q1UA 2BGIA 4XARA 4J7XA 4F4DA 2VSFA 3GMTA 5LFAA 5IJWA 4RJKA 5FTNA 2ZITA 3KRTA 1DRUA 4CL0A 4WCDA 3KL4A 2DPYA 4IIBA 1FW6A 1VIDA 1SHJA 1D2CA 3FSJX 3U61B 1IQPA 2CCGA 4LJSA 4L74A 3DHEA 2B2CA 1U9YA 4D8TA 4YMUA 1YMQA 3QEBZ 2X8JB 3HUUA 2W6PA 4GMDA 4JUCA 4ZT6A 1MIHA 5DISB 2NZWA 4IIJB 4CIDA 3SZLA 4Y9TA 3TGLA 2C8KA 3FVVA 4IUCS 3MELA 3L7IA 4YJ2F 5AVKA 1HDXA 4B76A 4CM9A 4PG6A 2GWHA 3A4IA 4K6CA 3ADPA 4RWEA 3OO1A 3VH4A 5IZ4A 1OE0A 1O94D 1OFIA 2HLDA 3DDCA 2BY4A 1IQRA 1YC5A 1KP2A 4MSUA 4N8EA 2NXWA 2VAWA 2Z5VA 1SBNE 2NYVA 3QFTA 1GQ2A 2XLCA 3ZV4A 6NULA 3DVLA 1R5OA 3A4LA 3U39A 3H84A 2XSZD 4QVKA 2HJHA 4Q6BA 3CLSD 5ARCA 1X2EA 5JRJA 1R1DA 1KK2A 1S9HA 3GQVA 3AZQA 3MYYA 2NZJA 5A5FA 3TL3A 4FGUA 3KLBA 3LC7O 4HTFB 4WOPA 5CNIA 1EZ1A 2JDIA 1NVBA 3M6WA 5EIBC 1Z33A 3LPMA 1WCXA 2BRUC 3NIWA 2ZB4A 3R6WA 3AXTA 2I76A 2WUEA 5LLDA 1SCBA 2VSXA 4Y2SA 5EESA 2QSUA 5IYZF 1XG5A 3FZYA 1K63A 4TTAA 3UTDA 4BO2A 3OP1A 3BFKA 1GSIA 1OV4A 3II6X 4XUDA 2RGEA 2NUTB 4CG3A 3WGJA 1T26A 4BQQA 1WZEA 2ICAA 4Z4CA 3KT3A 4JLAA 3EPJA 1QGYA 2UUAB 1RT9A 3JS5A 2VYVD 3HB9A 3O92A 2YS6A 4OSPA 1W5FA 4KTTE 1RAIA 5AIBA 1KMQA 3ZNOA 4U7PB 4XGRA 3IBFA 2A92A 1H4QA 4E1VA 2Q27A 3PNQA 1KKLA 1NXPA 3BWCA 1XA0A 1LZLA 1WLYA 1XQ6A 1BROA 3R7FA 4EELA 1X74A 3QV2A 3ZCVA 3B7WA 4UM5A 4COKA 4HWOA 3FPEA 2AKEA 1UFOA 1U3UA 2BFPA 2BF4A 1IOLA 1D4FA 5IUJC 1B1CA 1CR1A 1OA0A 1TAQA 3GT4A 4TT8A 4Q7QA 5AW1A 2P30A 2VYCA 4JROA 5SYAA 2PU7A 3V4OA 3LA8A 5JFOA 3VVCA 1O94A 1QWOA 2YCBA 4JL5A 1HE3A 2ZROA 3A1VA 4P4GA 5DOVA 5FJIA 4GYWA 1FTGA 2HYIC 4DT1B 1KYIA 4A03A 3PF8A 3CLUC 4Z4IA 1Y8QB 5HMLA 3ESXA 3SXJA 1AKTA 1USWA 2ZVPX 3EXG2 3QV1A 4HNQA 5DIFA 4XVRA 3LDHA 1QKKA 2XA1A 3E9CA 5TF0A 4UFPA 3H04A 1DO2A 1YZGA 3WZLA 3QM1A 3QPBA 3Q6MA 1I3MA 1KDOA 4WKNA 1OZGA 3G5MA 4I8XA 1WBJB 3ENVA 4L07A 4UMEA 1UKVY 3TQOA 3OPVA 1W0CA 1HYQA 4GL4A 5SZIA 3W4JA 3FOZA 3MT8A 1ISFA 1NHWA 3CKKA 4YIKA 2DLCX 1NVVR 4FK8A 4KFUA 2VT6A 1C1DB 1T1SA 3UWSA 5HIKA 3RADC 5BQ5A 2UYOA 3BIFA 3BPSA 3Q7RA 1K0FA 1J56A 1NYTA 4IDNA 4TN5A 5AJUA 5TVGA 3SM3A 1P2FA 2YUTA 4MTLA 1RYFA 4EFDA 3CJQA 3HY3A 4XX0B 2HU2A 1E20A 1ZONA 3D8UA 3E1GA 3K0HA 3PHGA 4UAVA 3HFRA 4YP5A 3LFUA 4JENA 4ZEWA 3IQDB 4A73A 1W5TA 2XITA 3IAXA 4RCZA 5A5GA 1D2HA 2JLYA 1M2OB 2ODEA 3GFOA 4XA8A 2QM8A 1G20E 3EGCA 1WR8A 4GP6A 3E3NA 4BUZA 4ZK2A 3GLFA 1WBBA 3UMBA 1THGA 1ZH0A 1YZYA 4CNBA 3KB2A 1JALA 4JQSA 4REQA 1QGED 3DR3A 3TL2A 5DNCA 3IMKA 3SF8B 1CQIB 1E9SA 2Q45A 3VC2A 2AFHB 1EEHA 3HNPA 3RYHA 4FR0A 1A77A 3KJZA 4BAGA 5FR1A 3UK1A 4GD3Q 4ZAWA 3ZXXA 4BX3A 4DIUA 2FR1A 3BAFA 5FBRB 4K6OA 1M2HA 4DADA 3MLAA 1GN8A 5KS2A 1K4KA 1MQ8B 3KOZA 3OEED 4XTCS 1FSGA 1IQUA 3EIQA 5C3UA 1PJBA 1IUKA 1H4VB 2BT4A 2QG6A 4LNHA 2OZVA 4NNJA 1O0CA 2R0QC 4AX8A 4R8RA 3RJ5A 2QTCA 1IN1A 4XLZA 4W99A 3I6MA 1GNTA 4FT4A 2H52A 3PNPA 1XYYA 2QVBA 3CZPA 5SICE 3TXYA 4MAAA 4BAUA 1HKUA 1E0AA 3JQ7A 1IJKA 3ZH2A 1LA2A 4V1CI 5JZMA 5CCBA 4TL6A 4YFVA 2ZCUA 3IV6A 4YMLA 2BDUA 2JFYA 1CVRA 2GXAA 3L3BA 2WIFA 1QOZA 4FDLA 4HBZA 4OHMA 3HJUA 1ZH6A 1XZNA 5IULC 2XQIA 3D7RA 4D25A 3PS9A 3D8HA 4QASA 2E49A 2GASA 4R2XA 2Y66A 4M86A 1YR8A 4CTNA 4CM6A 5H80A 3CNOA 4BO8A 4DA9A 1L5HB 5EG5A 3RNLA 2WSYB 1BXRB 2OY0A 5BN3A 1RZRD 1FFWA 5EZ6B 2WJHA 5LMNB 2V4ZA 4Q48A 1VYTA 4PS1A 2JW5A 2C0QA 3N7UA 4L5IA 4XLLA 3MINB 5KNBD 3G0HA 1QH0A 3L18A 1X86B 2BFWA 1BU5A 3N5KA 2F8TA 3AOGA 2X14A 5A4FS 2AXNA 1WZCA 1ESNA 5CNKA 2B20A 3OQ6A 1C9YA 4PNZA 9GPBA 4R1UA 2VWGA 4O2BB 1P6XA 4EMUA 2P1DA 3KELA 4ARZA 4MRRA 3P9ZA 4AN0A 2GXSA 3HK2A 3MXTA 1AQUA 1DJPA 1K8YB 2FQXA 2I62A 3M5WA 4A0GA 2BISA 2IPMA 2CY0A 2H2GA 3CLTD 4QUKA 5DHUA 3SC6A 4CL8A 4D2IA 4QBGB 4DIKA 2RGRA 1EWKA 5BOSA 2H5LA 3EFHA 1QX4A 4EX7A 3MQFA 1JEOA 5IJZA 1K68A 2JKVA 1U3TA 2FLWA 4XCVA 5F77A 4FZVA 3UYLA 5AM2A 4RANA 4DNOA 3CTMA 4PCUA 1MN6A 2FJPA 1DTSA 1Q83A 2JRLA 4IF4A 5CBPB 3K0AB 3RUHA 4JLUA 1S2OA 4L0CA 4BCBA 2C1XA 4IH9A 4PZPA 3TSOA 2IWRA 5I4IA 1BHJA 3ECCA 3H05A 1O6CA 3JD1A 4MMYB 5D7BA 3PTZA 1B6RA 1GCUA 4RKWA 4ZYZA 1YJQA 3DUWA 5JNLA 2VSOA 5I7OA 2B35A 2QW8A 5F12A 3WYCA 2F64A 1PP4A 2JVIA 4F85A 4YDHB 2B82A 4N01A 3OFVA 4O5AA 3FF1A 1YDWA 1UKEA 2GPNA 4D97A 3WQQA 4BGVA 1UADA 2PK3A 3D4OA 3G7UA 1NOJA 1Q7CA 2D1YA 3PCTA 3VTAA 4DNFA 4KNWA 4B6OA 1MA0A 1I32A 2VP9A 4H35A 3FBGA 4IQGA 5ERYA 2P67A 2QTGA 5TS3A 1YACA 2FR0A 4GFDA 1F06A 3RF7A 4B7AA 3NOXA 5EY5B 3PFGA 4D4HA 4ZAYA 3ROEA 4MITA 4BVFA 2ZSBA 1XLTA 3BJZA 3C85A 2NU9A 2KBFA 3ASVA 5I4CA 1MB9A 3F96A 2YUIA 3FTNA 4MLPA 2VWPA 2Y93A 1D7AA 2D3WA 1PF7E 4LJLA 5IKOA 1ZNYA 1SU7A 3TBKA 4BE4A 2VSYA 2ZSJA 3JQRA 1BXGA 4BFTA 4BC0A 3SFTA 5KQRA 4P36A 1YZLA 1MOZA 3G0GA 4A8JB 1S02A 4KX3A 1FTYA 4LZOA 4ML3A 1RVDA 4D6YA 2C9BA 4XJTA 5DM4A 1XJWA 5L45A 4J1TC 1UPXA 1BJKA 4D80A 5T5QA 3T3PB 3IQHX 3TZEA 4E5DA 5JY6A 3DFMA 3OHPA 4GGPA 1E0KA 1PJAA 1U1EA 1IOWA 4KK4A 3B82A 4LXHA 1P3DA 1QK3A 3GXBA 3DDOA 2H4JA 5J58A 2DAPA 3TKYA 4PLTA 1G8SA 1BWQA 4ZO4A 5IRCD 2PAAA 1BXRA 2BHNA 3N75A 3FPBA 4N5IX 4CIAA 3IL2A 2ZSEA 4MLZA 2REQA 2VF5X 4WADA 3CXUA 1R6TA 1PUJA 4HJXA 4YN3A 3DTVD 3ZHXA 4BNKA 2OFWA 3GRCA 4YP6A 2XHEA 1SVUA 2OTCA 4QXAA 4OQLA 4YT8A 3FFXA 3LLVA 1KY4A 4ZI7A 1VJDA 4YAFA 3T15A 2FPPA 3OQNA 2VP2A 2D0IA 4L8WB 1GZUA 4PINA 1GUFA 2GN4A 1G21A 2YINC 3ZHRA 1IB6A 4PG5A 2CHEA 1SH7A 2OFFA 3TAXA 2P9ZA 1EESA 1BRTA 4KQEA 4WESA 5LP6B 1E0JA 5JANA 3VX3A 3QJGA 2RGDA 4OXRA 2A1UA 3SIRA 1FRNA 3N2EA 4AMZA 3B1KA 1LDYA 2AX3A 3FOWA 2Y76A 3NTUA 1ZVQA 1SOAA 2HKIA 2V1XA 2XQJA 5JS6A 2Q8NA 4I6GA 1L4FA 1T3HA 3WBJA 3ZGZA 1TAUA 3KHKA 1CY6A 3ILXA 3MHPA 4G5HA 2AXPA 2WWIA 3K4HA 4FCTA 1XJ0A 4OCZA 3DE2X 1NN1A 1IE3A 1QKJA 4PX2A 3HJHA 4MK4A 4PLCA 4QO8A 1YQQA 3BKXA 1NBMD 3AUUA 4BX9A 4UZFA 3H9QA 4Y1RA 3X1XA 1RRMA 2IZ0A 1KK3A 2H1WA 2YICA 2I2BA 3AX6A 3DVSX 1GTL1 2Y99A 4II7A 2J5XA 1VSVA 4RDHA 5DP1A 3UPDA 1ULZA 2PFSA 4U5QA 4RSGA 5CDGA 3ORFA 4O4IF 4DV6B 1QIIA 1QO0D 3R5FA 3ZNPA 3AM5A 3TZBA 3HA3A 1CY2A 3GJSA 4U7GA 3LP8A 3OZIA 5EJ8A 2KB0A 5DGTA 1DJOA 3N2NA 1SHZA 4P35A 3ZXIA 2P9YA 2Z08A 1JFVA 2A5JA 4F9TA 2WM9B 4JL6A 3QFRA 4PO3X 5CFPA 1M6WA 4CQNA 1PGQA 1UP4A 4Y2UA 4D99A 5K6RA 4J07A 2GESA 2A7XA 2BGGA 1S8AA 1QV9A 2SKDA 2JFBA 3IPYA 1QFXA 3BN3A 3DDSA 3KQVA 2ZIGA 4BY9E 1QQ7A 3QWIA 4NBRA 2OAGA 2V5UA 4BNZA 5EZYA 4O4IA 1CUVA 1UMDA 5IFKA 3T4PA 3ZCUA 1SCDA 4EAQA 1E5TA 1LLQA 1M75A 1EM8A 2IUYA 3WK4A 1BN7A 4ALMA 3N05A 3K4PA 4PZDA 3AG5A 5CT9A 4JS0A 3DLIA 3I0NA 3PNOA 5EYPA 4B4OA 3N0VA 1VZ2A 2CW5A 2J7KA 3BL8A 3NS7A 3J81A 5I9SA 3FKSD 2PHZA 3HFGA 1DC4A 3S7ZA 1MNAA 5LU8A 2DEUA 3BXPA 5CB6A 3RQIA 3KBOA 2CT8A 3A1UA 1BE6A 2I65A 1KAHA 1UBCA 3RS7A 3KYCA 1KTVA 1K3UB 3C6KA 4UBMA 4BCDA 2IBTA 2O8BA 3I2KA 3D6VA 4NJEA 2OHIA 1GFZA 4PYOA 1YB5A 4C0SA 4P2GA 4IILA 1IBKB 5HX7A 1G0NA 1Y7HA 1RWQA 1CDOA 1S7CA 3PPYA 4GUDA 5DBOA 3TECE 4MDFA 1JLSA 3NQ41 3AEKB 4FNMA 3T54A 4GZ3A 1ZD5A 1KAEA 4CEIB 1L7MA 1XRLA 2NV0A 5CX4A 1JQDA 1YZKA 4ZWNA 1RZ3A 5IS2A 1KWKA 2DUNA 2BLNA 5C5IA 4AF8A 3ILYA 4PC6A 1DGQA 2NADA 3BRWA 3O3MB 1CS0B 4ZT3A