1AB6A

Structure of chey mutant f14n, v86t
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
125
structure length
125
Chain Sequence
ELKFLVVDDNSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMTTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chemotaxis
molecule keywords CHEMOTAXIS PROTEIN CHEY
publication title Structure analysis of two CheY mutants: importance of the hydrogen-bond contribution to protein stability.
pubmed rcsb
source organism Escherichia coli
total genus 44
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ab6A00
1E2BA 4G0PA 4DQDA 1F51E 1S8NA 1QQBA 5T3YA 2RJNA 3FDFA 4FE7A 4Z0NA 3HK2A 3JVIA 9ABPA 3G85A 3Q9SA 4MRMA 2M1ZA 1JYFA 3BREA 3CHYA 2FMKA 1YVUA 2JVJA 3Q41A 1D5WA 4H3KB 4IMIB 1EHCA 4Z4EA 4DN6A 1U04A 3DGEC 3GA5A 4Z4GA 4HNRA 2PL9A 3SAJA 4WUTA 2A9OA 3OM1A 4EYQA 3HXMA 2JB9A 3ILYA 2JK1A 2FMHA 3OLWA 5BRJA 4YO7A 2PUDA 4HYEA 3LUAA 5CNMA 1BA2A 2JBAA 2FMFA 4KQCA 4IRXA 3H75A 4PZ0A 1D1PA 5TQ0B 2PUEA 5IEJA 2WY2D 1XWWA 1DCFA 4Q7EA 5IULC 1RXEA 5KC8A 4S04A 4RU1A 3TMYA 2E4WA 2CHFA 2MYPA 4D74A 2FLWA 3CFYA 1DJMA 1J56A 2E4YA 5JS1A 2FLKA 4KRFA 1NXSA 3JS5A 3C3KA 5IEBA 3M9WA 2HPHA 5FBHA 3VNAA 4ZMRA 4GNRA 3C97A 2MSKA 2NUBA 2IOYA 4KZKA 2JRLA 4F12A 1FSPA 4Z4IA 2F8TA 2IKSA 1ZVVA 2A9RA 4RSMA 4EYKA 1QP4A 4LE2A 3T38A 2FN8A 1GLGA 3GWGA 1LBHA 5HM6A 3C6QA 1BDJA 1DBPA 4FE4A 1F4VA 3MMNA 3CLKA 5C5EA 3GL9A 1YMUA 3F6CA 4RXTA 4Q6WA 4EYOA 1USKA 4D6XA 3KJXA 1L5YA 2IPNA 4IILA 5TQ2A 3D02A 3SG0A 5JNSA 2OENG 2A9PA 3H5VA 4RK6A 1U0SY 4LE0A 3TD9A 4G0QA 2FW0A 4G0OA 5IUKC 2E4VA 4NQRA 4YGXB 3KKEA 1RZRD 1QO0A 4G0YA 2VYCA 4XASA 3TO5A 5BQ3A 1MVOA 3HDVA 4NICA 4ML3A 3A0RB 4S05A 2R4QA 1NXVA 2MSWA 4LDZA 4Z4CA 4F11A 2VUHB 5CNKA 3O2JA 1YS6A 3LKVA 1ZGGA 2PKXA 3CTPA 4MR9A 3SM9A 1HEYA 2PMCA 2FKAA 5KQLA 5C5CA 1PNTA 3HZHA 4RK0A 5KQGA 2PUFA 1NY5A 3MM4A 3O21A 3CZCA 4LZLA 5GOTA 3RVOA 1JHZA 3GYBA 4QPJC 4D6YA 2FSPA 1JX6A 1R8JA 4MQEB 5IUNC 3OO1A 4ZJPA 6ABPA 2HJ9A 2YHAA 2O20A 4H60A 3QLVC 4O1IA 3QELB 3TB6A 1U2PA 1C4WA 3RH0A 2PLNA 1RPJA 5F64A 1GCGA 2FQXA 4G0XA 2ZAYA 5EWJA 3MIZA 4YR7A 4WZZA 3QLUA 1JFSA 3HS3A 4MYRA 5EWLB 2TMYA 1YK0A 3IPAA 1Z13A 5GQSA 1DC7A 4Q6BA 2R48A 5KWSA 5FBKA 3QLTA 4P98A 2QU7A 5IX8A 1ZGZA 3CZ5A 3H5OA 4Z4FA 4RKQA 4HNSA 1AB5A 4KK3A 2QW1A 4M88A 2CD7A 3D8UA 1QMPA 4YLEA 4PEVA 4UHJA 5TE9A 1DCKA 2GX6A 3UUGA 1ZY2A 2X7XA 2XDYA 3A0UA 4JASB 1MIHA 3IDOA 4MLDA 3IPCA 1VKRA 3T6KA 4B09A 1JL3A 3EGCA 4JB0A 2LP4Y 1QP7A 3O75A 3RVSA 2PL1A 4YCSA 1QPZA 3O1JC 1APBA 1RZRA 5TPWB 3LUCA 2FEWB 5JS2A 1Z26A 4XAQA 5KQPA 1EWVA 1ABFA 1GUDA 4TMYA 1SRRA 5CNIA 1A2OA 5DTEA 4Z4HA 4XXHA 1YS7A 4MS3A 4KMRA 4N47A 2WWVD 4RS3A 3UK0A 3CRNA 1Y1LA 3LOPA 4OATA 1Z25A 3H6GA 1ZH4A 2MSLA 4MR7A 1VLZA 4KREA 4RV5A 3BILA 3ROTA 4RDCA 2NT3A 3SQNA 3HM9A 3ILHA 3QEKA 2PUCA 5JNTA 2L19A 3JPWA 3KHTA 4KVFA 4MQFB 1AB6A 1MB0A 3Q7RA 1DP4A 1LJLA 3EULA 1D2AA 5TPZD 1Z17A 4LRQA 5B3JA 3NNSA 2HQRA 3GT7A 5FWXB 3JPYA 1PHRA 3A3KA 3W9SA 1DC8A 1TM2A 1W9HA 2R25B 3H1GA 3QEMA 2FN9A 1YK1A 3K4HA 5D2CA 3RVMA 1H9CA 3CU5A 1CHNA 1KGSA 2B4AA 4EGSA 4LE1A 4G0ZA 2A9QA 1ISSA 3UKJA 1DBQA 2AYZA 3NNDA 2ID9A 1NXPA 1QNLA 3NBMA 4WXEA 1QKKA 1CEYA 3GV0A 4MS1B 1PNRA 4ZPJA 4JA2A 4TN5A 1SXGA 1XHFA 3OMXA 4RKRA 4LDAA 1A04A 1M2FA 3HUTA 1U8TA 1DRKA 3CG4A 5HQJA 1Z2EA 3KYJB 3LKBA 3G1WA 4N0QA 1I3CA 1ISRA 3HSYA 3FFTA 3M6MD 3N0RA 3KG2A 3Q7SA 1MB3A 2QZJA 2QSJA 2RGYA 4L4UA 3RVPA 3R0JA 1VRVA 3RVNA 1URPA 5HKOA 3GRCA 2FXIA 3DBIA 4ETIA 5IC5A 3OMWA 2PAFA 3H5TA 1Z12A 4G97A 4Z9BA 4N76A 2WB4A 4OTZA 2AYXA 4JP1A 3CKMA 4O1HA 4OLBA 2H3HA 1TLFA 2MYTA 1ZDMA 2GBPA 5FWYB 4MGEA 4N0PA 1OXBB 3T95A 5ED4A 3RVJA 5TPWA 3CS3A 3F7NA 1TJYA 3OLVA 4RXMA 4IF4A 4MRMB 2FVYA 5PNTA 1M5TA 5TPZA 4O5AA 2LPMA 3KLNA 4RK1A 4WT7A 4EVQA 2W42A 4RY0A 3LUHA 5T7BA 1ZAYA 1P6UA 3LTEA 3LUGA 1EFAA 3N53A 2PUGA 1UDRA 3Q7TA 1DRJA 2J48A 5DLEA 1DG9A 1W25A 3EAFA 3L6UA 4RK4A 3H1EA 1CYEA 4MLCA 1PEAA 3LUDA 2FEKA 1OXKB 2RJOA 2JBAB 3OO0A 5JNUA 4KFCA 3KYIB 2LUOA 3S99A 2Q5CA 2WMYA 5TQ0A 4MQFA 4TLMB 3QLUC 1PEYA 2HQBA 1M2EA 4UHKA 2H0AA 3IP7A 1VPWA 4RWEA 5BRAA 3CNBA 2I6FA 2QVCA 4TLLB 4EVSA 5BR1A 3H5WA 2RDMA 2ID7A 4Y9TA 3O1HB 4XFKA 3DGFC 3H6HA 3O1IC 4EYGA 3GBPA 3JTEA 4RY9A 4YRZA 2PUBA 5CNJA 2IPLA 1JBEA 3MYYA 4G0MA 4LX8A 2E4XA 4KPYA 3A10A 1DCMA 3LFTA 5TQJA 1BDHA 3HJFA 1JDPA 3OLZA 2DRIA 4DADA 3OLYA 2WJWA 2B1JA 3E3MA 3FFXA 4ETNA 5DKFA 3RVQA 4MAAA 3GBVA 5DGCA 1USIA 3O74A 2NZVG 3JY6A 2E4ZA 1A0OA 3ROFA 6CHYA 3IP5A 3NHZA 5IUJC 4NCBA 1T34A 2JVIA 3FFWA 1Z16A 3CG0A 3EQZA 3BRQA 4IMJB 4RK5A 5E3JA 3EJWA 3KTOA 1U2QA 3HVRA 2V0NA 1TMYA 2GWRA 3OM0A 4Z9AA 3EQ2A 1SXHA 1JF8A 3BRSA 4GPAA 4WWHA 4JOQA 2L18A 5KI6A 4NCAA 4KNYA 3EODA 4KQ9A 5I4CA 4YP9A 1YIOA 5B3JC 4W5OA 3DLBA 1DBWA 2MYUA 4F8JA 3MQ4A 1K68A 1E6LA 1JH9A 3KCNA 2M98A 4NV3A 2L2QA 1Z15A 4MR9B 4QYMA 1NTRA 4WXMA 4XARA 4YWHA 1L5ZA 2LBPA 1BAPA 1GUBA 2HQOA 2P4UA 4KV7A 2NT4A 2KYRA 2YHBA 4EVRA 4MR8B 4IGAA 3HDGA 2QVGA 1QO0D 4MQEA 3MF4A 4FB4A 1WETA 5EWMB 2IDMA 2LIVA 4YS6A 2IPMA 1FFSA 1Z18A 3QELA 2OQRA 3QK7A 2FQYA 3EDCA 5EWJB 2HSGA 4G86A 3I45A 3OQMA 2IYNA 1MAVA 2CHEA 3NNNA 5EWLA 5ABPA 3E61A 1ABEA 3QX8A 4W5RA 1M5UA 4MS4B 3K9CA 4F06A 4E7OA 3KSMA 1RNLA 1SXIA 4OBBA 5HSGA 2NZUG 1C0EA 5JNVA 4QICA 2BGGA 2JCGA 2VUIB 1TVMA 1QP0A 2CWDA 3I42A 3C3WA 1YMVA 3JVDA 3KLOA 2QV0A 4OLAA 1EWKA 2L17A 1PUXA 3I5AA 3OQNA 3VNBA 3N0XA 3RVRA 1ZN2A 1IIBA 2QR3A 3N6VA 4PYRA 1XHEA 1BVHA 2PJUA 5DCLA 1NATA 2PUAA 2MYNA 1BDIA 2JVKA 7ABPA 1ZH2A 4H3HB 1D1QA 4ETMA 1ZITA 4MS3B 3N8IA 3OLXA 1RXIA 1LBIA 3DZDA 3TX6A 3H1FA 3I09A 4MR7B 4N03A 3MA0A 5JNWA 1EAYA 8ABPA 1JYEA 4RZSA 3O2SB 4MPTA 5IBQA 1P6QA 3L49A 4W5TA 1FQWA 3QX9A 3SNKA 3URMA 1GCAA 1LJUA 3H5LA 1NXXA 3Q15C 1JFVA 3RVLA 3RVKA 5KC9A 3HO1A 4W5NA 1JFTA 3LUKA 4PICA 1KMIY 1FFWA 4JAVC 3M9XA 3T8YA 4XLTA 4F3TA 2FQWA 3OQOA 3H5IA 5FWXA 3O2QB 1KRWA 4HNQA 1DZ3A 3F73A 2FEPA 1NXWA 2F8SA 3FGZA 4JB2A 3LUJA 3BBLA 3QEMB 1K66A 1Z2DA 2IPAB 3P9YA 2VK2A 5JNRA 2E4UA 3HV2A 4RXUA 1USGA 1SD5A 4P1ZA 4CBVA 1JWLA 1FFGA 4MR8A 5KQMA 1KRXA 3N75A 1ZESA 3HCWA 5EWMA 2P9HA 2QXYA 1B00A 3C3MA 3HEBA 2GI4A 4MS1A 1JLKA 2R47A 2GKGA 1QQAA 3QLVA 1P2FA 1ZHHA 4ZMSA 1E6MA 3DLHA 1EWTA 3HUUA 4OG2A 3B2NA 4RY8A 3SY8A 4W5QA 4MS4A 5CHYA 4N41A 2ZWMA 3N0WA 3LUFA 3RQIA 1P8AA 3LMKA 4Z99A 1YTUA 1D4ZA 2PE5A 1E6KA 4ZYLA 1NXOA 2WJAA 4PE5B 3F6PA 1NXTA 3NHMA 4KK4A 2FMIA 4RK7A 5TQ2B 4E7PA 1JDNA 2FTKE 3FMVA 4YV7A 3IP6A 2N9UA 2WRZA 3IP9A 4QYWA 4EUKA 3KS9A 5FWYA 4L85A 1LK0A 4EY3A
chains in the Genus database with same CATH superfamily
1C9EA 4IJVA 5EMKA 4E31A 1JNYA 1ZFNA 3T5AA 1Q0PA 3BFVA 1S8NA 1QQBA 2ZAOA 4NFSA 2I4LA 4O4HA 2RHCA 4GVLA 3UWDA 4AMZA 2D5BA 4QHSA 4WX2B 2JFPA 1P18A 3KD3A 1U04A 3ZDYB 4IOMA 2XT0A 1LS1A 3WFJA 2ZP1A 2D4HA 1V4NA 3BJMA 3UNXA 2GBLC 4HQLA 4UEKA 4WJZA 5ADWA 4PZAA 5TB5A 3RUAA 4IGKA 4CCAA 1PN3A 5ALWA 1ACLA 1UZNA 4F5WA 3EBOA 3GJTA 2VDWA 3ICPA 1ZN7A 2OFWA 4YRFA 3W4IA 2QSYA 1N8TA 2GCEA 1FU7A 2B82A 2E18A 3EFEA 1L4YA 4GLOA 4IRXA 4OP2A 5KNDH 1PNOA 2VJOA 4CLRA 1O6ZA 2PZMA 3TM5A 4EKGA 3VH2A 4XI9A 4BQEA 4MZXA 4MPJA 1KMQA 1RXEA 5DSXA 2PZLA 4IOJA 4Q21A 4UE6A 3QBJA 1K1EA 4HV4A 1Z7WA 1JAYA 2ZSAA 4GHWA 2VNJA 4J7AA 4LOAA 4C7XA 2XWPA 3GHHA 3JRXA 4UTOA 5KHAA 4GLJA 2OEPA 4Q00A 5G3ZA 4DBVO 5C8XA 2C4VA 3SR3A 5IDXA 1J4AA 2VDKB 5JZVA 4MUBA 1NFQA 1GKLA 1RRKA 2YXLA 5DWQA 3C2QA 2VYQA 2YH2A 3BQNB 4XJXA 1BYIA 3TLCA 3H11B 3ROZA 3GLQA 3DCNA 5MFZA 3EPJA 1Q0SA 4EI2A 4GI7A 4XEHA 2I3GA 2X0JA 3NT5A 2ISQA 3EIQA 4L5BA 1TJPB 4OFBA 4WA8A 5AJYA 1DIOB 2GRAA 1QZZA 3C3BA 2GHTA 4HSGA 2WUFA 1NOKA 3UCXA 1EFRD 4YMHA 5TEVA 4EB3A 1NNUA 2QRPA 4CODB 3LA6A 1DXQA 4DOMA 1YCHA 1HC7A 4BP9A 2VCEA 1E3TA 4FW9A 4N3GA 5JTUA 2PO5A 3CX3A 4M36A 4MUGA 1U3VA 4RO0A 3UK6A 5CDFA 3A32A 4EYOA 2ZJ4A 2HK6A 1K6MA 2JAQA 3DS8A 5FA8A 3PF8A 4DIUA 2UZ1B 4JSYA 2YOFA 1DPFA 4K3UA 4MB2A 3OVMA 3ESQA 3AEUA 2RHGB 4AYTA 3UG6A 1L7BA 1CY2A 5K3DA 4QJIA 1W4LA 1KZHA 2NU9A 1CDZA 2E4VA 4NQRA 3FG9A 1W1WA 4QNNA 4QULA 1DGQA 3TFQA 1FYEA 1N33B 4NEQA 1UUFA 2WP8J 1NMEA 1R4NB 3I53A 4RVUA 5TJHA 2VJAA 4XH9B 5ADUS 5BN3B 4ZA2A 2NO5A 5EHNA 3W2FA 4F2HA 2C9BA 3M5CA 3ZHTA 5AH0A 1U7XA 2VUHB 1AU9A 5LKAA 4IICA 3MMZA 3CNQS 3ZI4A 3DV2A 4IZIA 3OFKA 4ZZ0A 2G1PA 5AOAA 4RENA 1HEYA 2DR2A 4EJSA 2H11A 4JLSA 5HDBB 5F7ZA 3HKEA 5JV5A 5CM2Z 4B7ZA 1E4VA 1LEHA 2EJWA 4HQRA 1X0VA 3L40A 3T4PA 2W4MA 3Q5GA 4D6YA 3JAKB 5AVYA 4Q0MA 1B8VA 2PX2A 1G8PA 4PPYA 3Q3IA 2YWHA 3GOHA 3D6NB 3KQVA 4HCJA 3UOGA 1B6GA 2BH2A 3PGA1 1QE5A 2V98A 3BYZA 3PKIA 1KYWA 1YZ3A 4XQ9A 5EIBC 3CUTA 3I5MA 5BY2A 1FNBA 3PC3A 1RM3A 1JAHA 2QHXA 1OZAA 3ETCA 3USES 3H4MA 2A5FA 4ITRC 3WWEA 4ZK2A 3KYCA 5TF4A 1AKWA 2VN8A 2WJZB 2R48A 3RFVA 3T3DA 3QFSA 1X14A 1F6DA 4Q1DA 1IL0A 3EXIA 4AI6A 2OPHA 3TTUA 1R0ZA 1S0UA 4LHZA 4MV3A 4DLLA 1IWBB 4I55B 1DKPA 2DR3A 2WAXA 3DFZA 5F33A 1V48A 3KQPA 1X7DA 2VJDA 4DSUA 4ZVKA 1XZ8A 4WOKA 3UUGA 1YV9A 3A0UA 5ICGA 3VJLA 3B82A 2ZSKA 4HQ6A 3T6KA 4B09A 1PZEA 3I83A 3W9UA 4AD8A 1CJUC 3VZSA 2NO9A 4AO8A 4RV4A 1QFMA 3ZNPA 2HMUA 3FOFC 1XDWA 2ZDHA 2ZIUB 5HILA 1ZEJA 1YQDA 3UPUA 2J0QA 1U4NA 3WFIA 4TWZA 4Q4JB 4XAQA 3RKUA 2F64A 3L4EA 4I5DA 3RIMA 2NZ8A 4BN5A 2I4TA 1TM7E 1GZHB 2PX0A 1X7YB 4R2XA 2IZ6A 3HB4X 4KR9A 3G7SA 4XXHA 4U7HA 4C05A 1U11A 4QBKA 3B6MA 3U16A 1FJHA 3IR6A 4QU8A 3S6JA 3ZNNA 3CRNA 5E1OA 2ECOA 4OATA 2HSEA 1FQJA 3RSFA 1CK4A 1E3EA 1W30A 4ENVA 4EL0A 4C78A 1WHSB 2NT3A 4KPGA 3ZGLA 1XQWA 3E6AA 4WV3A 3STUA 4DKJA 1QOQB 1E2FA 3AU9A 4DCGA 1AB6A 3AIMA 2A8YA 3BWDD 3KJEA 4PYQA 3VH3A 4WA7A 4MV7A 1DWOA 1QAMA 2O2XA 1P3JA 1XQ6A 2BHSA 3PX2A 3RYHA 2PZBA 2EF0A 1TMKA 1ICIA 1V7QA 1OH8A 5AESA 5BV1A 3NHBA 1RWMA 3BXFA 2G36A 1JHDA 3MUFA 3EK2A 4DMHA 5LNK6 2W6JA 1Z45A 5J59A 1OQAA 1AK1A 2PYDA 1BCRB 2DPGA 2VPWA 1UJNA 3DEYX 2F43B 5KKNB 3SQLA 2JFXA 3DDHA 3PG5A 5E4TA 3CU5A 4B3HA 1M6VA 1VPDA 3OX1A 3G49A 1MN6A 3DWEX 2G8LA 1F9EA 3KJQA 4F9TA 1FTWA 3HUEA 5A4KA 2JW5A 1NXPA 5ALYA 1QGAA 2R6R1 3A1UA 3PP8A 3H8WA 4MS1B 3GLFA 3MEQA 1YC5A 1YRLA 2XCLA 4INZA 1P1FA 5ESRA 1DOZA 5E0KB 1PW5A 3E3LA 4RVDA 3IOCA 1E61A 1E9BA 3ZGXA 4TM7A 1TYZA 4RZQA 4FYWA 3K0AB 1R0WA 3H0EA 3L8HA 3IXLA 3NUGA 1DL5A 1K9VF 2OHIA 1RWKA 2HCBA 1QYCA 2WE7A 2FOIA 3FFTA 3H2BA 4OM8A 3VR2D 4DR1B 1QS0A 2OZLA 4FEEA 4BP8A 5TMPA 4B3RB 2IXBA 5TV2A 4U02A 1OILA 2ZR7A 1CUGA 1JSXA 1VRVA 3P9QA 3K0FA 4LXYA 3IODA 4P36A 4BNIA 1PVVA 1ZK0A 1DWPA 2V3WA 1WS6A 4R1MA 4YMGA 5IN4A 1KBZA 1Z12A 3WMEA 1AKVA 2DE0X 2AYXA 1DTWA 2RIPA 4CCYA 2RJ3A 3PVSA 3JAMA 1E4YA 1I0ZA 1P9OA 2WMNB 1Y7LA 1QAOA 2QT1A 2YHIB 4Q39A 1ZDMA 2BI4A 3TJRA 3VFDA 3CLSC 4C2BA 5BPFA 1U7TA 3R5JA 1DNPA 5TPWA 4GS5A 2ATVA 5CYGA 4AKTA 5A4MS 3FIUA 1K97A 4RXMA 1KETA 5PNTA 3ZHUA 4E5VA 1D5CA 2J0UA 3CZ9A 4WT7A 4KPUA 4O63O 2FP3A 3E8MA 4ZREA 4J1TA 2IUUA 3RUIA 4OFZA 3TLGB 3MT7A 1E79D 1OFUX 1I1NA 1IH8A 1NBWB 2HPAA 4WOJA 2BZGA 4J49A 3QFFA 3TQRA 2O1EA 1KY4A 3EAFA 5DH9A 2N3ZA 2IXEA 5CB4B 4H4DA 1SQGA 1NVDA 1SUAA 3UENA 4RH3A 4Y3UA 1DRVA 4BE7B 1SVOA 2J4DA 2WT9A 3CNNA 1NWHA 3OCJA 1R6AA 4KQ6A 2B37A 1JV2B 3FPKA 1KBOA 1SB8A 1KJZA 4TLMB 3I23A 3JARA 1XVLA 2VT6A 4MKFA 4PANA 2E5WA 4Y9RA 5FFNA 2EL9A 3L6OO 2XNDA 3OPQA 3L8YA 1PT6A 4H6VA 3CNBA 1O5TA 2HOQA 3AV0B 1RTTA 2C94A 3VZDA 2GRJA 1YS1X 1KDVA 7MDHA 1XNHA 3SKXA 3R44A 2Z6QA 5E4YA 5LQJA 3R0IA 4KI0A 2F1RA 2VTDA 5KYVA 2FGKA 5A9RA 4LPKA 3PS9A 3BFJA 3B78A 2JCXA 4EYGA 3NHYA 3PENA 5DX1A 3CGWA 4INJA 1Q84A 3U7QB 2HF2A 2NOAA 3L1IA 3R7DA 2BGRA 1E5TA 1T3LA 1VHWA 3BD6A 3LYUA 1J99A 5KVQA 1LB1B 4EY6A 3L18A 1P7VA 1PE0A 2A5LA 1WXIA 2ORVA 1Z34A 3DLPX 3OLZA 2BMDA 3PXDA 4J1SA 4OX9B 4PZLA 4YY3B 3P96A 3NQ41 4OHMA 4WL0A 4PTYA 5IHPA 3JY6A 4TN1A 5C4IA 3MWEA 3W2TA 3FLBA 5BN4B 4TX1A 4TV9F 5B53A 5EVCA 1ZXLA 5KNLA 2C77A 2UZ1A 4DNOA 2Q62A 1Q77A 3JYNA 4RK5A 5KJCA 1FZTA 3NDBB 4LZWA 2V0NA 1KORA 3C8MA 2DPMA 2P78A 1Y6QA 4ALMA 1C3JA 4CF6A 3EZ9A 1EDEA 1IK6A 2XUQA 3HCOA 3AVTA 2C4HA 4M38A 3O8QB 2VSXA 4WWHA 4AU1A 4OSEA 2L18A 3EOAI 3GEPA 1JI3A 2EKDA 2Z2YA 3RJ9A 2ZTHA 4DEYA 2R8ZA 3Q3VA 4DCTA 2J5KA 4E12A 4EB0A 3H05A 2L0XA 5JCJD 2Z9CA 4PG7A 3DT8A 2IXFA 1T3GA 3JZMA 1PR6A 4LK2A 2IVZA 2J09A 2BDUA 2L2QA 4UNQA 1E2NA 1VJCA 1NN1A 3T7DA 1Y98A 1M10A 5IJ9B 2WM3A 5LD2B 3RSCA 3AO0B 4C2UA 4JT2A 1KJQA 2FFRA 1PJ4A 2AJDA 2I54A 3G68A 1SQ5A 2LKDA 3BHMA 3UWMA 3BZWA 3G23A 2WVJA 3JAKA 1Z7GA 1T25A 1X80B 4LY3A 4IGAA 1G8AA 4LJLA 2W90A 4HYTA 4C3UA 3MHTA 3ENKA 1AKUA 1K92A 1MORA 1U7ZA 3FAKA 2BHTA 5EL0A 3ROKA 4C14A 5J4HA 2WQ7A 4A6EA 4N82A 2FPGB 4UUOA 3PCXA 3QKWA 1NPYA 3I45A 4IQFA 1QU3A 4ZDIA 5CIQA 2OHVA 3GDWA 4NV0A 4K7JA 2DLDA 3P9SA 1P0CA 2ZIXB 4A26A 1PK9A 3GPBA 3PFNA 4YALA 3UWSA 4XM0A 1IN6A 4MS4B 3UJHA 4F5ZA 3D2AA 3BHIA 1W47A 5BXYA 3EAQA 1AQUA 4CWAA 4BGDA 1MIOB 3K5HA 3AJAA 2YL2A 1XXLA 4I55A 4WEOA 4FQ7A 4LF7B 5HS4A 1R18A 2GCPA 5K5EA 1XYYA 3CLUD 1VBKA 1NTOA 3U2QA 4BUCA 1AS0A 2C2YA 4RJLA 2XVZA 1G4HA 3HL4A 3ELDA 1XPJA 4Y0AA 3STHA 3UGTA 3K0SA 3QMPA 2ZDQA 3FRHA 4C0KA 5AM5A 4O4JB 3VNBA 3Q0IA 2DQSA 4FBGA 4ZD6A 4MV6A 4N9QA 5KVCA 1JG2A 1RXYA 4LI0A 4BC0A 3B9BA 5M3BA 3WE7A 1KPIA 4J6FA 4Q4JA 3CUEF 4MWOA 4UPVA 5FAXA 5U9CA 3M1AA 1H2BA 5DNDA 1E2UA 1QQ7A 2OHFA 4J4HA 4P3PA 3L6CA 3LAWA 3A6ZA 1U9IC 5KJEA 2R4UA 2UAGA 4JBNA 3AVYA 1Q1QA 2CW5A 1OBOA 1ONNA 1ZNQO 3R74A 5FEUA 4N03A 3I6YA 1ZS9A 4BMZA 5AM1A 1ZHFA 1GADO 4POAA 1N6LA 1WHSA 1E0JA 2J6HA 2ZT6A 1IAQA 1NOJA 2PX8A 2QLTA 3F0TA 3LCVB 3N6XA 5ALSA 4R1UA 3URMA 4KACA 4EDHA 4XYEA 4ZQHA 2IH2A 3IIEA 5IM4F 2PXAA 4LOJA 4MW0A 1HFEL 1ZIPA 1SXJC 2D2IA 2DG2A 2XZDA 3C39A 2ZKIA 3PGMA 4S35A 2OY0A 2X2PA 4BUZA 1CWUA 5KWIA 4PSKA 1XMSA 3TUZC 3O2QB 4DUYB 1VECA 1NYRA 1JH9A 3FGZA 2G9UA 2L42A 2BZSA 1RXSA 1BCRA 5AM3A 1KSFX 3T61A 3GJ6A 3HLTA 1BKDR 1AV7A 4CBVA 3BMQA 3ECCA 5NLLA 5I7WA 3S2IA 4NBLA 1FUYB 1CUJA 1KFBB 1F3LA 1T8WA 3Q3GE 1XQVA 1VGQA 1JKXA 4QAJA 3HCNA 1WABA 2V6JA 1XRLA 2B98A 3LK6A 2LZ0A 4MS1A 1GTL1 5JOQA 3LWZA 4DMLA 2DBRA 1W0JD 2N46A 2CLEB 5JPIA 4K26A 4ZMSA 2QYSA 2A5JA 2JIMA 5CA0F 3DLHA 2HBZA 1D4OA 4DLXA 2I6GA 2ASVA 2HDHA 2HUNA 3K0AA 4AMVA 4BIMA 4QT4A 4FPXA 2NSJA 4HRXA 4R81A 1VG8A 5EEGA 3NHPA 6ADHA 3W5AA 1H65A 2CJXA 3KJZA 4D25A 2FZGA 3KPUA 4Q9LA 3ORQA 4KXVA 3QLJA 4I3FA 5SICE 1ISMA 1ZK4A 4XPZA 1EVJA 2WJAA 3FWYA 1IY0A 4JQYA 1O8CA 5KBYA 4DR7B 1JDTA 2JH8A 3LXXA 3PFFA 3V3KA 3K1JA 4XCVA 3IUEA 4HBZA 3T3MB 3UWOA 3R5XA 2TMKA 2MCFA 2WIFA 3BH6A 1E3QA 2JFOA 2YHIA 4PY2A 3DBRA 5A9TA 3B8HA 2WTNA 3HSSA 3WKBA 5JDCC 3WYNA 2ZUSA 4FHGA 4S0ZA 3L01A 5GM2A 3WTCA 4BZZA 1XNQB 1Y9ZA 3ZJYA 1Y6GA 2OO7A 4MW7A 3M6VA 2Z8YA 3D31A 4Z0NA 3WOHA 5FWDA 2C78A 1JYFA 2E6UX 3HZOA 2YY5A 5EKXA 3SKYA 2JVJA 2H8GA 2YKGA 1WW8A 2EKPA 1OPXA 4F6LA 1AMUA 3W78A 3TLGA 4E32A 1VG1A 2KW5A 1Y3CE 1OB5A 2WINI 2A9OA 1UZUA 3D8HA 4DCSA 2XGGA 1R88A 1YB5A 1P73A 4RZHA 4ZIRB 3JZAA 3WL5A 5I3CA 1HUQA 3LBIA 5CCDA 3PQ8A 3V4FA 4FFVA 3U7JA 5EMLA 3WI7A 2VSFA 1U2GC 1GL9B 1ZWKA 2ODEA 1E0AA 2HNKA 4P3OA 5H8WA 3H75A 4RF4A 2NSYA 1C0PA 3PNKA 3UIEA 1LQTA 2PPLA 3RARA 2A0KA 1JS1X 4QYIB 1LNZA 4UULA 2PZFA 4XDZA 1WXWA 1J09A 3VV2A 3UJ3X 2PCJA 2CHFA 4HLUA 3JWHA 4LF9B 4RYLA 1NUPA 1XTSA 3PR2B 4FMPA 1WHTA 3TTYA 1B2RA 5E6RB 2ZI6A 1X1BA 4ND7A 4QSMA 2A0WA 2FCRA 4FKMA 2HPHA 3A9TA 5JMWA 2P1DA 1QSGA 1SVWA 1KKUA 3V4LA 3K0EA 4CIDA 2UU9B 2JH3A 1GQFA 4UQOA 5I8ZA 5TX7A 3U7QA 1I36A 2EL7A 2QQFA 3T9AA 1Z5OA 1FSPA 5KWEA 1D09A 4OM7A 1XD9A 2JJ1A 2DKFA 4AQ7A 2DH5A 2O0KA 4CV3A 2VHUA 4LJ6A 4FGSA 3TOSA 1GJRA 1W59A 1P62B 5DBIA 5KQRA 2YJNA 5HM6A 4BGUA 2ZSHA 1AHNA 2ONZA 3BH0A 4CHTA 2ZRGA 3SHQA 2A0XA 4PO8A 2NYUA 4NECA 3Q3EA 2NP7A 1YMUA 1Z56C 4H35A 3S55A 5BN4A 1P9WA 2QL7A 3B36A 2XWQA 2EX4A 4P83A 1PQ4A 4BFCA 4A03A 1USKA 3BK2A 4JYZA 1KXJA 1I5RA 3A14A 4JLNA 2V58A 4N12A 3M70A 1V71A 1CUAA 1UZMA 2CVHA 4MYDA 3NAZA 2P69A 1NRIA 4C6TB 1T0BA 5KYTA 2HMAA 5KZMB 3IAUA 1VKNA 4I3HA 1Y3DE 3O8QA 1Z0DA 4XASA 5IF3A 1JILA 5BQ3A 3TR0A 1A9YA 5BN3A 2KHZA 2AX3A 3KJGA 4EHFA 2WFAA 3VO2A 4UM9B 3KYDB 5DBFA 3TX2A 3T34A 3VNSA 4UBLA 2GEUA 3Q2OA 2QPOA 1DV2A 4XB6B 5AO9A 2D62A 3U81A 4CV0A 2JI4A 4PGFA 4ZVRA 2HKIA 2MSDB 1P75A 3LWDA 4E5SA 5IJ9A 3GLGE 2ODAA 3PR1A 5LUAA 2FCAA 3LO8A 4LN1A 3OZDA 1OTXA 1QH0A 7REQB 2RGUA 3ICQB 2NWQA 3U3KA 3QTBA 3G0DA 2O5CA 4NOJA 4QQRA 4HPWA 5CLLA 3HP1A 4LNUB 1X80A 2X4LA 4ONEA 2XUAA 4XWAA 2QR5A 2Y99A 3DF7A 5EI5A 1L7EA 4FEYA 5FL3A 4BKRA 4F60A 3WHIA 1KOJA 2P91A 3AWIA 4K40A 5FTKA 3N5CA 4P4LA 2C20A 1I2AA 2A6PA 3MJVA 1YZHA 4IHJB 2FPGA 1JDZA 1CKEA 4HWSA 5AUNB 2TMYA 2EQ5A 1FNMA 5FQNA 5DSZA 3T99A 3VR4H 1MV5A 2G76A 3SEAA 3EVNA 4C3ZA 2ZW9A 4UAUA 1YL5A 1EM6A 4ZZIA 2WKRA 5JU6A 2IODA 2QW1A 1ZCBA 1MIOA 1HFJA 5EUBA 1D4FA 2WFMA 3G0GA 3WY9A 4JFAA 4RW0A 4YLEA 3L8FA 2XYGA 4CR6A 1JWAB 1RZUA 4R9SA 2CVFA 1ODJA 3F6BX 1OTYA 2BTQB 1Y4SA 3WJAA 2OCXA 3EXHB 3MGBA 4E15A 4ZI5A 4EHIA 1NUAA 5CPFA 5I7HA 4G8BA 2A1TS 1JDBC 3IUPA 4UTXA 3ZY3A 3OJ0A 5FULA 1UPXA 2YWDA 3DLAA 4LPSA 2YYYA 5JFOA 3UJ7A 5IAOA 1XU9A 4YYEA 1NJ5A 2X8JB 4UJ5A 4WLNA 1K6JA 3T9FA 1UFOA 2JGKA 3UMMA 3E81A 3UK0A 3OUZA 3LT2A 1R3UA 1BWPA 5B1HA 1FTQA 1S01A 4RTOA 5EUCA 3SR4A 2V59A 3KZXA 1X2EA 4PZDA 5DNCA 5HYVA 4KBGA 1N1DA 4OHRA 2CV1A 1E0SA 2PLWA 3OQVA 3QEKA 5A71A 3ES9A 3ADPA 4GD3Q 4C5AA 3CW9A 4OBEA 2H00A 3OETA 3NIGB 4G5SA 1CV2A 2BFBA 4W6QA 5AP9A 1UQUA 2I1QA 5JJIA 4BV9A 3GT7A 4CQMB 2PSFA 4KXUA 1CR2A 1O58A 3S29A 4Q4LA 3VOSA 4PCAA 3HYLA 4C01A 3EWSA 2Z3VA 3ZE2B 2DULA 1B8PA 5BMOA 2Q8PA 5D2CA 2RI1A 4Q19A 4PR3A 3R5TA 3IUJA 3BDIA 3U7RA 4NV1A 1CQZA 3HYCA 4N7BA 2AMVA 3NNDA 4TV8B 1PJAA 4DWOA 3H42B 1PL7A 3PJFA 1XD2B 3NBMA 2R79A 1VBFA 3MAJA 2PY6A 3O94A 3AM3A 2KX7A 2WDPA 4XIYA 1G5IA 2B25A 5F3RA 4FYKA 4C1BA 5K7SA 3ZI7A 1FRZA 4QOHA 2YV1A 4QO8A 3FDXA 1C9YA 3PDWA 4LYAA 5K6RA 6REQA 3C1UA 2N47A 4CM4B 4M9UA 2QZPA 1TCUA 2ZSJA 1YJ8A 3MN1A 3CM0A 1DG3A 4JEMA 4JEHA 4F3YA 1Z33A 2QVBA 2RGYA 3VR5A 3B6JA 4X97A 2JDID 4F3KA 3QSYA 4ZALA 3G5UA 1MOQA 2NO7A 3UOAB 3VZRA 5ESDA 1Z4MA 2PAFA 4F86A 3C6MA 1CC1S 3FF4A 4IX1A 3OECA 3UAVA 5KYWB 3OQOA 3LTNC 4O1HA 3AEYA 2AG8A 2ECPA 3BXEA 2FAXA 3NC1C 1MX5A 1JEDA 2W70A 4LMRA 2MYTA 4MVJH 1M67A 3EPHA 2BM8A 1RPNA 3MWFA 3FR8A 4WASA 4JJ8A 4ERXA 3QF4A 3QYJA 3N8DA 5E95A 1HMPA 3TEFA 1ZJ5A 1CF4A 1Z6AA 5I8PA 1E7QA 5C52B 1YR3A 2WK1A 4MUIA 3HFGA 2DT5A 1Y3AA 4ZIRA 4YIHA 1FXWA 2E85A 3D4BA 3ED5A 3KPJA 3HU5A 1KAQA 3CA8A 3ZW7A 3ZWWA 6Q21A 1NQXA 4FSDA 2RJOA 4G5RA 3SYMA 4W5HA 3RBVA 5C32A 1EM8B 1ZZGA 3TCKA 4UMEA 1E59A 5K01A 5EQFA 2HPVA 1H2AS 3ORHA 3VPAA 1J7KA 2AVNA 4QYIA 4BO9A 1IZ0A 5JR3A 2VZEA 1VPWA 1ZA1A 3MMXA 4EPYA 2BGUA 4U7GA 4OIFA 5A6VA 5D6OA 1XTRA 1FSGA 4KVGA 4TLLB 5ELLA 2WM9B 2IH4A 1FMFA 4Y9TA 5E6RA 1RWNA 4PRYA 2FWJA 3VVLA 4XFKA 3H6HA 5JAMA 3FOZA 3EIXA 1XLVA 4CJXA 5K03A 4HB4A 3GBPA 3RRZA 4KR7A 1XZPA 3TG8A 1IDOA 4XB2A 2Z8ZA 3ABRB 4QPNA 4DPKA 1WLYA 521PA 2PUBA 3IOMA 3ZCQA 1QTIA 1RTKA 2ROQA 1REQB 3P26A 2QVZX 1EA7A 1Y5IA 4LJAA 1T8SA 4GRAA 1U7UA 1R50A 1PLJA 2V9CA 3DKVA 1C8KA 1FBNA 2XCOA 4N3NA 2WKPA 4BTEA 2REBA 4DADA 3E3MA 2ILVA 4GM4A 1UPTA 3A9WA 3GJXC 3K2IA 3PHHA 3V3TA 1ORVA 3WNBA 3C3PA 4K9SA 5A06A 2V8BA 1FX1A 1DAOA 4PFQA 3Q8LA 4E4YA 2OV8A 3QUTA 4MEAA 1JMYA 1T34A 4PVCA 3RAEC 3L0BA 4A8JC 1E8NA 3GEMA 5ERXA 4IS2A 5G0TA 4DHWA 4HT3B 3JQ9A 3P7MA 4CM6A 4ENSA 2IIVA 3BRQA 1KI2A 3KKKA 4BNLA 3EJWA 4YCLA 6GPBA 2JJ8A 5A03A 3ESZA 4D9BA 1FUIA 2B36A 2OP0A 2JIBA 1NN5A 1SBCA 4C6TA 2QMHA 3UHFA 4AXBA 1PVDA 3EW9A 3WZLA 4QGAA 4NCAA 3I6QA 1WCIB 2I2XB 4JLUA 2ENUA 5L4SA 3VOAA 1LBTA 4G5YA 5FI5A 3DTVA 3ICCA 3K9QO 3KYDA 3PB3A 4QDOA 4XRGA 3K7EA 1XPUA 5KQSA 2ZBVA 4H2DA 2Z5GA 1E2GA 1YS2X 3KCNA 5K3BA 3B7PA 2CMGA 1RLMA 2Z5VA 1ENPA 1ULUA 1H5NA 2QVLA 1JAIA 2PEZA 2YDYA 4GOND 4NBVA 4OK3A 4QYXA 1M1NB 4M9ZA 1JXAA 1J8YF 1U2DA 3D3WA 3DWGA 1Y8AA 1WQ1R 4QTXA 4RA9A 1OI2A 2FEXA 2HQOA 3IKTA 1JIUA 4KMOA 2GBLA 2P77A 4U9IS 1WXDA 2RGWA 5ALTA 4DYDA 2Q28A 3B1FA 4BNTA 2AN5A 4HJXA 4L08A 1TUIA 4L9SA 5AOVA 3TTTA 3QV2A 3AG5A 3C6XA 5JZMA 1IXSB 3SS8A 1QX3A 2O0JA 2ZZMA 2O2JA 5C8ZA 2NP6A 3MVEA 4EL5A 1COWD 5FAKA 1BG6A 4WFJA 3B89A 4FN5A 4Y2TA 5BV0A 1JHOA 1ISJA 2HMVA 4MUAA 3ZIAD 4YJKA 4CL8A 1NR1A 1JZQA 4YV0A 1M5UA 3DM9B 1X8XA 2F8LA 4DNQA 2HT1A 4JC0A 4RHYA 3KSMA 3P9ZA 1DT3A 5CDHA 1XKLA 4QQNA 4U6NA 1PQWA 4LHYA 4WBNB 3EFHA 4QEDA 5TMDA 1MJNA 1L8AA 5HSGA 3AZQA 1KSJA 5JIBA 1UFVA 4P4NA 3LPCA 3L7DA 1F20A 1O08A 2C61A 2O1XA 4OI2A 4PR0A 3T4XA 3UUFA 4AJ2A 3AL2A 1TVMA 1SG9A 3DVRX 1EJ0A 1HORA 3MJDA 5C8VA 4MVJI 1DDIA 5I7AA 2VYND 3QU2A 4TTSA 4OLAA 1GARA 3L8CA 3I4LA 3GZJA 1KTIA 1IHDA 1N2IA 3OQNA 3N0XA 1J23A 1YDWA 4BFWA 3MSXA 3EVEA 2FP4B 1VLHA 4MW1A 3OPNA 4PLTA 2P6UA 1GUZA 2ZWAA 5DBEX 4E4TA 1VI5A 5JWHA 3W5IA 4GLLA 2CHVA 2F8MA 2JVKA 2IHYA 3CE9A 3LECA 2X1VA 2X8JA 4FHZA 3DCYA 4WK4B 4JKOA 4QSHA 2XVXA 2OZPA 3TINA 4B7AA 3JZDA 4AZ3B 1WX1A 4BKMA 4PSVA 5JYBA 3OE7D 2WF9A 4H16A 4LIPD 2RHHA 1KYQA 1TTHA 2ZJOA 4URFA 5GJBA 3QKRB 3SX2A 1EAYA 5KSYA 4HDNB 3I9V1 5G0SA 3SZLA 2W93A 3PFCA 2PFKA 2Q41A 2RHDA 2XLBA 1SZPA 2AFIE 3HJHA 1I7PA 3F4BA 3FVVA 1ZNXA 3AVUA 4NXMB 1BWSA 1BVUA 2R1TB 2FJUA 1CUFA 1MF7A 4RFSA 3S81A 4HZGA 2ZJYA 1FVHA 2AKAB 4C4XA 5EKSA 2C1EA 2C9YA 1EVKA 3ED1A 4CQMA 2ACKA 1JIQA 5IKEA 4IBOA 3QU4A 3KC2A 3U62A 4RIIA 3E9RA 1E1LA 3QEMB 4YRBA 1H0KA 3KTDA 5HF8A 1EQUA 1W85B 1G8HA 1YO6A 2I4RA 1BOFA 1ZA2A 4PSDA 5HKKD 2VNKA 3SFTA 4CE6A 2VIIA 4DIFA 2I7DA 1RRMA 4TV8A 1C4XA 1G8YA 2Z09A 3HCWA 1XD2A 3PUWA 3WJ7A 1X94A 4KXQA 4R9UC 3MB8A 2Y1OA 4FLEA 2I3ZA 4YPOA 4MJ7A 3H7IA 3HP7A 1M8JA 2P35A 3W1EA 1J24A 3IQDB 1L5VA 1E6MA 2DHDA 2IIPA 4J9VA 5H02A 3C74A 1X7ZB 4F2DA 3C6YA 3WIBA 3A36A 4CM4A 1BFUA 2Q1TA 2ZWMA 1EFPB 3F49S 2D2FA 4A91A 1GL7A 4KAJA 2I71A 2QTVB 3NCHA 2X0KA 1IXKA 3UGKA 1RHKA 1IRIA 2IXGA 2XODA 5LQDA 1K9SA 4LFAB 3SOPA 2D4AA 2UDPA 3F6PA 2PK3A 1KJJA 2XUZA 2H4WA 5KYWA 4KQMA 3CCCA 2VBCA 1WKBA 3DMNA 4QUBA 2Q3MA 1JG6A 3GQBA 2FV8A 2V1XA 2GPSA 3MD0A 4MWEA 4GGPA 1G16A 3S1AB 3QE9Y 1IJKA 3AUJB 3O4RA 2B1RA 3S2ZA 4IZHA 3D7RA 5LQRA 5BW8A 2CFOA 1PQYA 2WJ4A 2FMKA 4IRUB 4TRMA 5DN9A 1M34B 3L4SO 4XCXA 1A82A 1U8XX 4NQZA 3BJIC 5KDOA 4RVHA 4UOQA 3FVQA 4FCTA 2HYDA 3A2NA 4QOJA 4KR3A 1PTJC 3BH7A 2H1CA 3K8ZA 3L84A 1K8YB 4WD3A 1UEIA 3VJRA 4OLFA 3EWAA 4MITA 4R1PA 4A1OA 1EM8A 2ZPUA 5BVHB 2VEDA 4M2LA 4JSRA 2PUEA 1XZKA 1GNRA 4QOGA 3KEFA 5IEJA 1JBKA 1QOPB 5J2TF 4LRYA 1ZYUA 5KC8A 2YZMA 4UCFA 3WRVA 1GL6A 1I2BA 1XTBA 5L40A 1AKMA 5F1YA 3ZK7A 2WWYA 4Y1EA 1SXJB 1XKQA 5H3CA 3KFLA 3FGNA 1YL7A 4MUJA 5JS1A 3RBAA 1E7YA 1JU3A 1QFSA 3KU4A 3WWOA 3R09A 4DCNA 3VGPA 2BISA 4A15A 4HNAA 1UBHS 2B4RO 2VDJA 2CJPA 1GYRA 1DBVO 3AEQA 2F4VB 1FFCA 1Z2AA 2JRLA 4DAEA 3FNQA 3NAMA 2BHNA 1REQA 3D8NA 1KYVA 2CV0A 4DM4A 3JVUA 3U61B 2QUJA 1SBZA 4EYKA 5EIAA 2GF2A 2I7VA 3PA8A 1QP4A 1U8FO 1W96A 4YJHB 3A4LA 4GC5A 2FW8A 3I2FA 2JIDA 2H5EA 2VJKA 2QX6A 2R85A 3WMGA 2VZ8A 4FE4A 1RQ7A 5ES4B 4A2QA 3TLYA 4GR5A 1F4VA 1S3GA 2JD0A 3UQYS 5KSWB 4ZVTA 3DQQA 3RIGA 2OGUA 1MC4A 3AIKA 3GIDA 4B7UA 4HDOB 1CVLA 2HU7A 2REQA 1BHSA 4GXRA 3ZWNA 3PNBA 2VUUA 3NEPX 2ZYUX 2XKJE 2HCFA 5AR1A 3C4QA 1JI0A 1G6KA 2OP1A 2GD6A 3OMLA 1OUMA 3FNBA 1YQUA 5EC8A 2H2FA 3AINA 3GT3A 4WECA 2AEEA 1U5AA 1KSHA 1NBMA 5EXTA 3OWOA 4ZAGA 1G66A 1TMOA 1QO0A 4O2BF 1EFVA 2VNHA 1Y3IA 4ZT7A 3ZWQA 3K32A 4QXQA 1AO0A 4FQ8A 4B74A 1G5HA 1WCIA 4I7EA 1HNXB 4BNZA 1WSDA 2IT1A 1S8FA 2R4QA 4S05A 1GSIA 3O47A 1X3LA 3DO8A 4HN9A 3RUHA 4CXMA 3CTPA 5B7QA 5J4KA 2EKBA 1N57A 2ZJ7A 3I9JA 3VR6A 3FNHA 3AR3A 3UXHA 1GT91 2BBTA 3GGCA 3GVIA 1DPGA 2ZPAA 3W5VA 3FMPB 2JG3A 2X9VA 1RYBA 3FZNA 4EG7A 4YRSA 2IS4A 2JA2A 1JHZA 2FN4A 4MYUA 3BE5A 5C7YA 2VUTA 5ELXA 1NV8A 3CLHA 1JX6A 2AQKA 3K0CC 5E9QA 3JQAD 3SYRA 5BYKA 2ODNA 3EGDB 3NTVA 2YHAA 3ZQUA 5IH7A 3DFIA 1W36D 4IH1A 3KFVA 3GF4A 4Z6KA 2PLNA 2I4MA 3JX9A 4CMKA 4D2IA 5F2KA 1ZGJA 1XRSB 3NBKA 2XOKD 3HJGA 4CQLA 4WK0B 5EQTA 3SSOA 3SBOA 4RFLA 1Z13A 2M2IA 1RMYA 3E9EA 4B3MB 3KL2A 1SUIA 4EB8A 1KK1A 5LZ5A 1U8AA 2CFCA 5DHUA 1W5FA 3V8NA 3BAZA 4G67A 3DAHA 3S2FA 4IV0A 1N8SA 4OKIA 3ZBPA 4V38A 4WBNA 4Z4FA 2A9FA 1TIKA 1A9PA 2GFIA 3ETEA 1KAEA 4LHSA 4NEHB 3ZTWA 4URXR 2NACA 3FTQA 1ZY2A 4DLZA 4JASB 1HH4A 4KLCA 1JZTA 1V9LA 1JL3A 4M21A 2WTEA 2HFJA 2XF2A 5L95A 4GKBA 1MUUA 1QPZA 3UK1A 1K6EA 4C7MA 1HQDA 2YNMD 4Y0VA 2QTBA 3PBKA 2K6GA 5JYCA 4LWQA 3UO8B 1I94B 3WGOA 2FW9A 3UHOA 4EJSC 2WG2A 3FHOA 4Z7NB 4ZOLB 4B3IA 1TPYA 3O1LA 5LCXA 2VHQA 2PUJA 2I76A 4YK7A 2YJ4A 3OICA 4HX9A 1AMNA 1N4AA 4U2BA 5D5QA 4KOEC 2GCGA 5FB3A 4R8VA 5JYEA 1I4EB 2SICE 3I3OA 1QORA 2ESRA 1GKYA 3GLHE 3RG8A 3WLSA 4AZ3A 5K6AC 3BL5A 4MLPA 4YP6A 2MSLA 1SOAA 3GCDA 3QKRA 4P5PA 4HDNA 1ZU4A 2X8BA 3AHCA 1I5EA 3ESYA 2EKLA 3OCWA 2PUCA 1Z2CA 1I7DA 2BFOA 3ZHSA 3VDRA 3UC9A 4Z9XA 5K0SA 2Y05A 1Q50A 4G24A 4JXJA 4MVJG 2ZIAA 4XWTA 4BBPA 1E18A 1EXVA 1YB4A 2RHWA 1M1XB 2R1TA 3FPAA 1P4AA 1AQIA 1EB8A 1P1KA 2C57A 2IUYA 3Q7RA 3H65A 5DM1A 4MJLA 5TPZD 4D45A 4TLBA 4UDOA 3K9LA 1W49A 4J2HA 1U3TA 2Y9MB 3B13B 3CUWA 3H2HA 1UPAA 4DMFA 1JQKA 2B8TA 1IUNA 2XZOA 2JCYA 2WYIA 5REQB 2TSYB 1TM2A 2JBWA 2O2DA 3CF0A 3QEMA 5EKTA 2MSCB 2GHRA 3R6TA 1W85A 5ICCA 2FX3A 4YP5A 3K4QA 1WM1A 1Z7BA 4BKOA 4ZT6A 2Z04A 3M4ZA 4QREA 2JLQA 3IKVA 1A5SB 4PIPA 5G3YA 4F97A 2FHPA 3DSRA 1Z5VA 1W52X 2I3BA 4BJ1A 3A9CA 3OZGA 4UARA 5DBHX 4TN5A 1OLSB 1SXGA 4FYMA 2BL4A 1C7RA 2OBLA 3QNMA 3WGNA 1JJAA 1X7ZA 3MFQA 4LXQA 2EWVA 5A4FS 1Y33E 1QF7A 3KE8A 2AMJA 4N0QA 2DPXA 1PNVA 2C31A 4JCOA 1EFPA 1BHO1 2BKUA 2XAAA 2PWYA 3G0IA 4ODIA 4BP3A 2QZJA 1NJ8A 4EKDA 3NXKA 2QTVA 2A14A 3AFHA 3OQ6A 4TQUS 3F8TA 4UREA 4LFBB 1HTBA 2VJNA 3GGPA 3DHVA 4RYDA 5DN6D 2WQ6A 5KNDA 3AR2A 5FLEX 3VU3A 2NXWA 2NAFA 1SA0B 1HE5A 2JLRA 4CI9A 4ZGBA 5F1KA 1AF7A 4EFDA 4AKGA 5HMLA 1BA3A 2H3HA 1JKIA 3MC1A 4B3JA 2AC4A 4JVMA 3BDVA 4DPMA 3K73O 1JNXX 3S1AA 2QKYA 4TKUA 2CLOB 1N1MA 1VYVA 1YFZA 2RGEA 5B1DA 2GVZC 1OU4A 3ROQA 2JFVA 3E4CA 3ZCRA 4I4TF 4IWXA 3VTAA 1JB1A 1JDBB 3IHWA 4RK1A 4DVGA 1HG0A 4JJ6A 1H8ED 1AA6A 1M34A 2WIAA 3NTLA 3UT0A 4R8KA 2GJ4A 1P6UA 1R0RE 1WUYA 3ACBA 1SG6A 1HNWB 1JQBA 1U9IA 2GEDA 1XTKA 4LQDA 2IHTA 4PPGA 2RKBA 4RF3A 1K3UB 5AKHA 1WXEA 5IVIA 3TGWA 2OVBA 3KNZA 1Q14A 4BVBA 2ST1A 2LCQA 5BVHA 3QX3A 3NUZA 2DWOA 2KBFA 3PQFA 2WMYA 3KUUA 2JLWA 1B1AA 3P4YA 2IS2A 3LS2A 5KPDA 1QBGA 2Z5LA 3KLPX 3L8DA 3ASZA 3DKRA 2GLXA 2NZWA 3H1BA 4U8HA 2WR8A 3HGQA 5IKOA 2B94A 2UXBB 1DC5A 2AXQA 3GCZA 4G01B 4I1YA 1F2TB 4B6PA 1SXJA 2XBUA 3GRAA 2ID7A 4HD8A 4JMPA 4KTVE 2EBWA 4I9UA 1K7FB 4QLOA 3FR7A 3RYIB 2O8EB 2YWGA 1SCIA 4U63A 2P4EA 3DGFC 4P33A 4ND8B 1PR0A 2VWQA 2QG4A 1DARA 1Z6ZA 3IO3A 1JR6A 1GG2A 3LM8A 3ND6A 5CNJA 2AXPA 4HB3A 3ZYCA 4AVYA 1MJHA 4KWEA 7GPBA 3FVRA 1C8BA 3V34A 3K70C 5KS2A 5FFFA 4N4AA 3BF7A 2WYWA 5K51A 3ZI0A 5IJWA 4ZP1A 3WICA 5H16A 4YJHA 1L7VC 1I1HA 4MUNA 3ORYA 3WB2A 4BLQA 2DY1A 5AKJA 5BMVF 4NPHA 4LVCA 1KK3A 3A2MA 4M89A 4D99A 1FVXA 1HDCA 1N2CB 1PR4A 1I3KA 2NZVG 3K6RA 3TI7A 2G5GX 3VJMA 3Q1LA 2ZSBA 4JIMA 4MW9A 4P93A 3ROFA 1P4JA 4LJYA 1T5LA 3B6ZA 2X1MA 3LQQA 4QUHA 3LJKA 1EK0A 4LRWA 1NVGA 5DLPA 2Q1SA 2B8WA 1LNQA 3MT8A 2GWHA 2P7IA 2DQ4A 1YVDA 1JG3A 4MSUA 2I5PO 3MERA 4IGEA 4W7HA 4D9HA 3HVRA 3QVVA 2NSHA 2W6PA 3VHLB 5TGZA 1G1AA 5AJZA 1BMDA 3M6IA 3ML1A 3BFKA 4L7VA 5CB0A 1C3LA 1KQOA 4GMHA 1WJGA 3KOWA 1CZRA 3F8WA 4NYIQ 3VOTA 4YMIA 3ZG6A 3M6FA 2VP5A 2O7VA 4YP9A 5B3JC 1ADFA 1E1NA 2C9CA 5JDCA 1KTVA 1XRQA 4PAMA 2YTZA 3JQRA 4JI3B 1W4BA 4EFNA 1ICEA 3ZIUA 3EEIA 1DJQA 4O2LA 4WKGA 1TU3A 4N5HX 1SBQA 4E08A 5I7OA 3PT9A 5FJJA 2F48A 1T4BA 4JCCA 3JD4A 3NV7A 1VZ2A 2GHQA 2P6PA 3F4LA 4OKSA 1JG7A 5E2IA 3ZXUB 4JOBA 3UYLA 1ODKA 1L5ZA 2LBPA 3W8DA 2I22A 5M04A 3K16A 4H18A 3RRYA 5C1PA 1XCJA 4DJTA 3MRTA 1XWIA 2NUTB 3TQOA 2ZEJA 2IYAA 4I66A 1H1TA 2ZT7A 3TWOA 4X64B 4A2WA 4D3FA 3EGDA 4HVCA 3K71B 2G0NA 3AOEC 4BLWA 4G09A 1U2GA 3K20A 3HO6A 4UPDA 1WPQA 3QK7A 3NFYA 2HSGA 3NG1A 2YHUA 4CNBA 4LGVA 4FONA 1DOHA 1JKJB 2FUCA 3KZKA 3A70A 4F04A 3W5BA 1I3LA 1U8CB 3LDHA 5G53C 2RGGA 4AYXA 1Q21A 5EE3A 3D1LA 3S1SA 4LRTB 2A30A 4HBGA 5EPOA 5ENDA 5C7IO 5EXPA 1GU7A 5AUPB 3PUHA 4CN8A 5AVXA 5EZQA 4PXYA 4YCMA 1VJ1A 2OVFA 1E9AA 2IEGA 1CQWA 4FC7A 3UAOA 3WSVA 2Q4EA 4TL9A 5AHRA 5D85A 2O3UA 2W6ID 1KI1A 2C4MA 3WJ1A 1BRMA 4MHSA 4PFSA 3TIVA 1Z0AA 4X95A 4H27A 2AXEA 2V6FA 3I3SR 3R40A 4HHEA 2OYCA 5BURA 4F5EA 1CY1A 2AOUB 1IBCA 3FKSD 3QQPA 4ZOLA 1VB5A 3TR5A 4D0LB 3JQ7A 1ZK3A 3KQHA 1BDIA 5CFLA 1F2UB 4BXOB 1L5MA 4LBYA 2XUPA 1II0A 3ITNA 1M6WA 3T7IA 1H1DA 2WWIA 3PX7A 1XVTA 5A4IS 1QO9A 2H65A 4KYIB 1UKAA 5JXHA 4DA0A 4M86A 3GRKA 4MLZA 3C5EA 2FE1A 3CRZA 3WK6A 1VLQA 4JENA 4ZQEA 4BVJA 1B41A 4NBUA 2AA3A 3K94A 5KX5A 2HUPA 4LDPA 3TXXA 2IS6A 3OU2A 4NAUA 1MP0A 2CLKB 3E05A 1RC1A 1ZIYA 1R6XA 1KC3A 1PJLA 4P3XA 2QTWB 5EAIA 3ZDAA 4W5NA 3OEHD 4AROA 3LUKA 5FKJA 3NRJA 4JAVC 1L1RA 2X1HA 4XZ3A 3BK7A 4ZICA 4U2KA 5MN6A 1S8AA 3EZNA 2FU5C 3R6LA 1EWRA 4FR0A 4X45A 3T94A 3N39C 4EQ6A 4FCVA 2J0SA 2ONYA 2FQ1A 5BPHA 1L4GA 1W94A 2CUTA 5REQA 4BYMA 3EGWA 4HDKB 1XX6A 3O90A 1QANA 4DUPA 3CT4A 3P9YA 4CUKA 2MWMA 2OYSA 2FZKA 3DZBA 3UK7A 4XLZA 3VUFA 4US2R 4D79A 2PJRA 4CMHA 3DDSA 3ISJA 4OMCA 2UYOA 4QA9A 3K1AB 4DBLE 1FFEA 1RKBA 2QXYA 3X1ZA 4H7HA 2V55B 3MWKA 4CKBB 5BW4A 1J1UA 2Q2VA 3Q87B 1QQAA 2BFPA 3BA6A 1OLSA 3LUPA 2LCFA 1DTEA 3OTHA 1DKOA 3RRBA 4DJDC 3THYB 1IAVA 3M5DA 4UVIA 1EBBA 1M7GA 4OG2A 3SVZA 4EFMA 3IQHX 3EJ6A 5CHYA 1P60A 1R9JA 1EGQA 1LPOA 4Z99A 5JADA 1JFLA 4BQQA 3R4CA 2MR5A 2J59A 1T24A 5ARBA 3L1VA 2R751 1U7PA 3FCOA 4FUTA 3IYLW 4RQBA 4Z1MA 4DRYA 4RTSA 4X3OA 1SUBA 1RYYA 4BZXA 1YJQA 1G4AE 1E0DA 3SGLA 1SA0A 3GR6A 3T1QA 1AUQA 1KEUA 4DG8A 3QE0A 3AUUA 4IV5A 5A7GA 3ILSA 3UHPA 4U0JA 1CUXA 3ET5A 3VSBA 5FOWA 5A04A 3HK2A 3OFNA 1G21B 1YJBA 2H0RA 2CNNA 2ZOSA 1J2JA 2FRDC 3EEFA 3M3DA 5IBPA 2X41A 1D5WA 3E0QA 4KH0A 2LXNA 1E3MA 3RFCA 1KEWA 3N3AC 3P9CA 1HFKA 3B12A 1OMOA 2XD9A 1T5IA 1EINA 1P5HA 4ERNA 3AU8A 4LJ7A 1CF2O 4IL5A 4PNEA 2NO1A 3UF0A 1NVTA 3LWNA 4UCXA 3OLWA 2ZAIA 4X84A 2EHJA 1OIVA 2QGZA 3DVLA 2R1VB 5EJ6A 3SEQA 1O4VA 3AM4A 1ZQ9A 1CF9A 1H6BA 2NTVA 2RGNC 4P86A 1IRXA 3G7NA 3SU8A 3V46A 4PYKA 4Y9SA 1VCNA 5IULC 1S5PA 4S04A 4QXMA 1GP2A 2E4WA 2Z43A 4C7KA 1OX4B 1OIWA 2GUWA 1DG1G 5ISMA 2C42A 4E2ZA 1T2NA 1F2TA 3ZHYA 1NJSA 1PZHA 1L7RA 1QCDA 1CQPA 3V2IA 4HUTA 2O8EA 3RYIA 5ALHA 1J8QA 2PYIA 4UCWA 5FLYA 4ZGWA 2A88A 2AXNA 2VPXA 1LX7A 2ZJ8A 1ORWA 2OUIA 3C97A 4A1FA 1NDHA 4BB0A 1N2JA 2HLHA 5ENVA 4B0PA 2JFYA 4MCIA 3UJAA 2G6BA 3U1TA 4CCSA 3EXEB 3NIFB 4AY4A 4GMGA 4ZEXA 4MGHA 2A9RA 1GZUA 1MQSA 1IE3A 3DE7X 1WA5A 2AQHA 1K5HA 2AD5A 2EBFX 4X1KB 3OZEA 1PSZA 3EZYA 1BKSB 2CXUA 4XGIA 1JJBA 1TC2A 2B78A 4FW8A 5D5PA 3C6QA 1BDJA 4J43A 4WNAB 5JAUA 3KUXA 1N2CA 3CJTA 2B4YA 3A9UA 4FYIA 4CM7A 1OFUA 2I87A 3IOEA 3UHAA 4DTIA 3EMBA 3UAWA 1XQYA 3DE2X 3X3HA 3DTYA 2PRSA 3T5TA 3VC1A 4BVFA 5HQTA 3DDCA 5KNCD 4IZOA 4NYIR 3ZBUA 3BXOA 3BCRA 1IJEA 3RW9A 1WCWA 1RU3A 3IVMA 2WWHA 1P33A 2H52A 1EI9A 4Y1RB 1NVKA 2Q7XA 4UU7A 4YWJA 2FW0A 4D98A 4EYSA 4WZAA 2CGEA 3Q85A 3D6AA 1RZRD 1L5SA 1FUEA 4G0YA 1G42A 2HA6A 1JHMA 4XQGA 4ZZ1A 4OHCA 2CZCA 2ZZNA 2FE4A 2JFQA 1IN7A 2J3DA 3NTXA 3Q0EA 2FZCA 3OI7A 4QBGB 3DKIA 3RTAA 4EF5A 3UB3A 1H0SA 1I3OA 1NVXQ 1SIUA 1ZW1A 1G9XA 2FETA 3CPSA 4HAVA 1UFRA 4GVPA 1AZWA 1PO7A 3NHAA 4IIVA 4UHBA 1N3YA 1ZRSA 2E55A 3A4NA 4WADA 4L5JA 3SM9A 3AKEA 2PMCA 3B60A 4UUQA 2G83A 4NWIA 3RU2A 3GC6A 3SSMA 4G81A 1KMMA 1UBGA 2IW3A 3G8CA 3MM4A 3QHPA 2R97A 4JYCA 4KC0A 5CAEB 3VYUB 1QG0A 4RABA 2NUTA 1OI3A 4JBXA 4KCGA 3EGXA 4DR5B 2KS6A 3VSEA 1G7RA 2BFFA 3OO1A 1YOVB 1D3AA 1L7NA 1IOVA 1I6KA 4H60A 3WLMA 3TDNA 2DBVO 4OFWA 5INTA 3DEHA 3CB4A 2XTZA 1WDWB 2PZAA 2HHAA 3O26A 3ZHRA 4AULA 2DFKB 2J0VA 4QFCA 2P5UA 1HETA 3HS3A 1CR1A 1EFRA 1RFGE 2X19A 4O5OA 4XA8A 5EEHA 5F77A 2ATCA 4ZAVA 3EF0A 4G0WA 2R9VA 4X6XA 1CY6A 4HQ0A 2D06A 4P98A 4D4JA 1C1DB 1NU8A 3QXJA 3AOGA 3DL0A 1QO7A 4PLPA 3WISA 3E9DA 1KY2A 2O1SA 4G4SO 4OQMA 2O59A 2ECKA 1I6LA 4FEGA 3IEIA 5IN5A 1X6VA 2D1YA 3KR0A 3TCXB 4OXQA 5TS3A 1N2BA 1E9RA 4MLDA 3MWLA 3QG1A 1AGPA 4TYYA 3PX3A 2LP4Y 4UW9A 3O75A 2DWPA 1EDOA 3F90A 4MQ6A 1BXGA 3V7UA 3CURA 3QFHA 1Q0RA 3K9NA 3UB2A 5CJPA 1POXA 1NNEA 5DNAA 5H5JA 4BYGA 1XPOA 1NQWA 3LVQE 1GQQA 2EEPA 3H0KA 3A9VA 1LW6E 1GUDA 1ADJA 1P7WA 2ADFA 2YY7A 3KKQA 4PCVA 4QUIA 4UNSA 4AZVA 1F2UA 1IG3A 1TCCA 4JX9A 2EFCB 3B85A 2C99A 4BLVA 3OCCA 5JPCA 1GG8A 1QGOA 4L5YA 1PHPA 5IAEA 4A8JA 2GNOA 5IJ0A 1KEKA 4TV9B 5JCZA 3T5PA 2EJUA 2WT8A 4BRUA 1P45A 5EIWA 3ROTA 3OQIA 3BMCB 1NY6A 3C24A 3FVWA 3HDJA 4KQHA 4TKZA 4TT8A 4XRRA 4B4KA 4EBBA 1PJZA 5C8YF 1HOXA 4V39A 5D3ZA 5KPJA 1YRBA 5IJAA 3DD1A 2G9RA 3SC6A 3WYFA 4ZQCB 4A0QA 1SZCA 1X15A 3BS4A 5CX4A 3H8JA 4KN6A 1B16A 1Z0UA 5E4FA 4ZCSA 5U4QA 3VR3D 4XUGB 3H1AA 4MCAA 3N58A 4OAQA 2GRUA 4TTIA 1JSZA 1DBIA 5L7YA 3RS4A 3AF4A 5KCZA 3OKAA 1W87A 4NCIA 4JU8A 2ATIA 3WAJA 2GFQA 1RAFA 1V3QE 3OQJA 5HQ3B 3A05A 5AJVB 4HDKA 4ESHA 3L7CA 5CM8B 4WESB 3DULA 3E1KA 3WZ2A 4JVOA 4R8LA 4MKXA 1DQPA 4FILA 1Y1PA 5CP8A 1BDMA 2GZHA 1CHNA 2M1XA 3M83A 1CY8A 5FBRB 3R76A 3PFKA 1ISSA 1CEXA 5DTJA 3UKJA 1ZPDA 3RC8A 4A5OA 3K1AA 4AP5A 3VO8A 4KL8S 4RD2A 1E7WA 1N9GA 3N2ZB 4CKBA 1PKEA 2YDXA 3B5IA 3GH1A 3T3OA 4LDJA 4TVSA 5IVDA 4HTAA 1OVMA 4MGYR 1TCAA 4CNQA 3THYA 5B4TA 1H4VB 2NU6B 3CZ4A 1UMKA 4LJRA 5CH8A 3A3NA 2XV1A 4OJKA 4QU5A 4AJJA 3ZE0B 4IDBA 3AJ8A 1CCWA 2VHZA 1ZUNA 3NTRA 2OPBA 3QMMA 1J0DA 3DMYA 5AM0A 3VZQA 5DNEA 1IVSA 2WPDD 2GBCA 2GM9A 3R0JA 5FUMA 2J6IA 5EJGA 3DC7A 3DBIA 3GRCA 3WGYA 3OZBA 3T7SA 4MV0A 3IKMB 1MZPA 1R37A 1NF9A 2O50A 5GINE 4MP6A 3RSQA 3CKMA 4M99A 1Y89A 1IQPA 2XCQA 4DSTA 1GFSA 4P0PB 2ID8A 4AUEA 1D1TA 3QXGA 5JS6A 1R6VA 3L92A 2WSYB 5A7HA 4HLCA 3HM2A 4MGIR 3TKYA 3NI2A 4DXDA 3AF6A 4MRMB 2WW8A 1YKFA 3NGXA 3WBJA 4XDGA 2OZEA 1BJKA 3R9WA 1WZCA 1Z06A 2EDCA 4JUIA 2C9MA 2Z95A 4V0RA 2EZUA 4HRYA 3R3JA 1ZLXA 5IARA 4KGZA 1WZNA 2OR3A 5K3SA 5ADVA 2PUGA 2Q9CA 2B6HA 1A2QA 2CLSA 1HEUA 4G0UA 3WLAA 3A3PA 3L6UA 3GB9A 3HCPA 3QNWA 4MIEA 4BQSA 3LLMA 1Z6TA 3ZV7A 4B5LA 1UJCA 2I8CA 2R1VA 5SYNA 1P91A 4OQDA 1Y9AA 3GVXA 2HJGA 3I6IA 3OO0A 2HIGA 2PD4A 1ULAA 3Q3HA 4M0DA 3TTXA 4Z49A 2PX6A 4HGOA 1ZUD1 1A4UA 2CEAA 3TIXB 4OI0A 5C18A 1UBCA 1VPVA 1IOLA 1RE0A 2BY4A 5BO5A 4ATNA 5K2OA 2GMWA 1NOIA 4Y6RA 1T10A 1TOAA 3R75A 4ACBA 1OX4A 5CX1B 2XCSB 2TS1A 4P5EA 1B26A 4YAGA 2ZYAA 2GT1A 1JVSA 3QEOA 4GPEA 4IJKA 8ATCA 1KMNA 2EF1A 3FYTA 3PXEA 4AJKA 3LT0A 3BSFA 3L6EA 4OQEA 1EAMA 3COZA 3WIEA 2JGFA 4OK5A 1VPTA 3PEFA 3GCXA 4QUGA 1UC4B 2A1UB 3ETHA 4PIVA 3ENVA 3UJNA 1AKQA 2C8JA 3JQFC 3EXEA 3Q4GA 3AV3A 3UUEA 1SVUA 3STWA 3WADA 5LLSA 1U1CA 5JXJA 1A4RA 1IATA 1DHRA 5FPHA 2XI4A 5A3SA 1E9FA 1G17A 3AKDA 3ELWA 4X1KA 4UTNA 3AP1A 4HL6A 3DVSX 1FYDA 2G17A 3QPVA 2D1QA 2W8BB 5BYAA 3DHNA 3A1EA 3GBVA 2WIDA 2CC2A 2BUAA 3G2IA 4IIYA 3INYA 3PICA 3RAFC 1BH6A 4BNDB 1QUFA 4DLAA 5DLYA 5IUJC 2Y6VA 5DWVA 4UHEA 2B2CA 4L0MA 1G55A 3PDJA 2QMQA 4BFYA 1E79A 3DO6A 2PGAA 1Q0ZA 5JH7A 2FRVA 4B3FX 3KTOA 1MO6A 2ACWA 2KLBA 1Q6YA 2P3QA 4G26A 3ZY4A 2IBMA 3QHQA 1XDGA 4Y1RA 4NL4H 5JSQA 1NU6A 2EFJA 1JFRA 1I32A 4NZNA 1ETUA 4PPFA 5K8VA 5CLQA 2NXEA 4H31A 4U7JA 2Z6UA 1D2EA 1KH2A 2VTBB 2QX7A 1IWOA 1SVMA 1JLHA 3RVBA 3K70B 2CZGA 4I1UA 4GEKA 4ZOEA 5I4CA 4U7DA 5HRUA 1Z6XA 4RELA 1HKUA 2CVOA 3LW8A 3AUYA 2X2EA 2UV8A 4ND1A 1NP6A 5B2EA 2AOWA 2FJ0A 2J3JA 1KSGA 3PEVA 1PJ3A 1L6RA 2HXYA 3R7SA 3D8RA 1WW3A 3JD2A 4D8WA 2XKKA 1BVYF 1NMYA 3U48A 1TW2A 1G3RA 4M76B 4XLLA 4J3NA 4N5NA 5HTKA 1P2SA 3L82B 5CAEA 1X13A 2NT4A 4WZBE 1V3TA 4EM6A 4PBSA 3ABQB 1HYHA 4TWJA 2YHBA 1PTJA 4JBIA 2P30A 3ZV3A 1YOVA 3GGGA 2IDMA 4IPTA 5DLQC 1FFSA 1TADA 4PCLA 4HQKA 1QYDA 4MA4A 1ENZA 1O89A 1WL8A 3ND8A 2PRJA 2PZJA 2Q0XA 1K7EB 4O2AF 3GN2A 1MH9A 4KIWA 2WHXA 3BHNA 2X8WA 2XRMA 4BKPA 3OSZA 3UBMA 1ZBDA 4U7TB 1C1DA 3FOAA 4E7OA 5BWBA 4BS9A 5C80A 4P2BA 4U2FA 2WWWA 5JAQA 2P11A 1Z8FA 2R87A 4RDHA 1E63A 1ST2A 3RBZA 4A16A 4QICA 3TEMA 3V1LA 1QZ3A 3ZJVA 5KUTA 3P20A 1AY0A 3DUFA 3JVDA 3RYCB 2V3CC 2OQ2A 3FDJA 2X14A 3GFOA 4GT1A 4WHMA 1J8VA 3QBVA 3MNFA 4PM4A 5H83A 5BW6B 3WL8A 2VBFA 1I2DA 2O8DB 1KL7A 1TEVA 4FTWA 4ME6A 3RC9A 1DC6A 4UTZA 3PNPA 1V2GA 4PFKA 4WCDA 1XZCA 4ER7A 3I6MA 5C46F 1ACMA 1SUEA 3IR7A 3O73A 3N6VA 4CFYA 1BWQA 4WDRA 4QJ3A 5JCJA 1ODTC 5DCLA 3GGSA 2VRNA 1PFGA 2P2CA 2N0SA 2PKQP 1ESNA 4JJ7A 1D1QA 3L02A 3FRIA 1GCUA 1XAGA 3TQFA 1HY3A 2H92A 4DMUB 3P9KA 4I6GA 4LBZA 3OT5A 1RXIA 3EBPA 1QBKC 2FUNB 4TV9A 1YTLA 4HWGA 4PF1A 4MR7B 2QN3A 2X9LA 2P3SA 5JNWA 3FUUA 3BMCA 1B0PA 3O2SB 4TTTS 3NWPA 1R27A 3ZCTA 4P0QB 2ZLBA 4XUDA 1JR3A 3MW8A 4TRRA 1JFVA 2NYAA 3DP9A 4FCCA 3RVLA 1SFRA 3VPDA 2EEZA 5CFOA 5KC9A 1IY9A 1EB9A 3SN6A 3HO1A 4X6YA 4HQNA 5C4MA 2V9ZA 4CKCA 5CXUA 2D0OB 3K8YA 4LECA 3BWEA 1QIIA 5HGXA 2XW6A 3ZHVA 4AJ9A 2R6CA 2YMPA 4OHVA 1ZINA 2H3EA 3DHYA 5NULA 3TL3A 4A27A 4D9GA 5HQ3A 2K7FA 1VYHA 5AW1A 5BUQA 4L8VA 3LO5A 3UN1A 4L8GA 4YRTA 5JNRA 3ZNOA 1SD5A 1S4MA 2PTHA 3TI9A 1FFGA 2XMZA 4CYMA 3C7KA 3QFRA 2Q0QA 4L07A 2ATXA 5CMLA 5G2OA 1T9HA 2X5KO 5EWMA 3GDHA 2UYCA 1UZLA 3IERA 1Y82A 2H4JA 4Q7LA 3S5UA 4OL0A 3K0CA 2GI4A 3PQ2A 1XCOA 5FPTA 3J81k 3UVEA 1KR5A 3EG9A 2WTUA 1GZDA 4AO7A 1G38A 2EBUA 1ZM9A 4HY3A 1JALA 3WWPA 4JLOA 4TS1A 1SY7A 5AOCA 3I73A 1K4MA 3G9ZA 3NGMA 4DE5A 1MFZA 2LGJA 3WGJA 3FB1A 4B32A 3M6XA 2VAVA 3H5AA 3O93A 2NLOA 3TUIC 2I2DA 1KPHA 1R00A 2VF8A 5EMNA 3EVDA 2WUGA 4MQ5A 4ED9A 2V6MA 1Z5NA 2WF5A 3HC7A 3WLOA 3IP6A 3V1MA 1YRAA 2ZIZA 3A1FA 1UBOS 2A35A 2Y4OA 3N3BC 4YBRA 4BO1A 2DPHA 4EY3A 2K5UA 3BXZA 5ENZA 3KQSA 2IYQA 2CMKA 2WJGA 2HTFA 4MWGA 4DZRA 4TXMA 1BCSB 4BAGA 1E2BA 2HY7A 1RBMA 1WB9A 3BB1A 1VDZA 1UBNA 2J3LA 3HVHA 4FE7A 4HGPA 4MRMA 1E3WA 2YN2A 4PAOA 4XIFA 3GG9A 4YV2A 5GJVC 1PR9A 2JEOA 3LWBA 1UFQA 2HHCA 3KSRA 1N5RA 4FGUA 4HGRA 4L5IA 4R2IA 3WGMA 2XCTB 2DSNA 4IXTA 4NJEB 3D1VA 3DYVA 4J16C 4DLTA 5AUQA 5DPMA 4CV1A 1O1YA 5DOVA 3PC8C 2GKSA 2RAFA 3EFBA 3RUPA 4YACA 2CN1A 2FMHA 4O4IF 3N7TA 2Y1WA 4YO7A 2IEZA 5K6AA 2EW8A 2CB0A 4M83A 1VCIA 2HRCA 1BXZA 4Y1GA 1YHYA 3HJUA 2ZU0C 4HZIA 4LQ4A 5BQ5A 3V8EA 1XNGA 2ZTVA 2OTCA 2XB9A 2DYKA 3DLTA 4JNCA 4Y2HA 3DBVO 1PT9A 4TWBA 5AT1A 5YASA 4C89A 4KQ1A 4QPPA 4EY7A 5CX1A 2XT9A 3EUAA 5IM4A 4DDHA 5LZ8A 2VNSA 1V41E 1W35A 4MTCA 2Q4BA 4TVBA 5CHEA 2AOTB 3OY2A 4YMSA 1TVEA 4KWHA 1UM9B 4G5GA 1WZIA 2GASA 3LFUA 1XZGA 4EW6A 4V1CI 2R6FA 4WBXC 2A1UA 5E6UB 3T1OA 2H1VA 5KIAA 3DL2A 3QI2A 4HPJB 4BVHA 4Q02A 3NOVA 4M0FA 3RS0A 5HJ5A 3CIFA 2DTEA 4GW3A 4YCDA 3GBSA 3H2YA 2OB2A 4UKDA 1KO1A 5EIFA 5F5XA 4N48A 2QY6A 3IBCA 2J7KA 3I39X 4N6OA 3GFQA 1KO7A 3IHKA 2XIQA 3GWGA 1VMDA 4AUMA 1R6BX 2BFCB 2XADA 4G65A 4DDKA 1W93A 1M8KA 5ALRA 2YOGA 1K5DA 2O7SA 1XRNA 5CA0A 1GHTA 5E8JA 5F7JA 1D7AA 2FFAA 5LFAA 2WNSA 4OV6B 4JLKA 2Y92A 3FN4A 4V02A 2QSZA 2IPNA 2Z8XA 3AHJA 4QRIA 2HXSA 5IWCA 1RLOA 4B0OA 4BNKA 4DIOA 4NARA 1BFKA 4RK6A 2QM7A 2ZM5A 2VWPA 5CFMA 1OAOC 3MLAA 4G0QA 3ROGA 1A9TA 2Q3LA 3LLUA 4QJ4A 4EHKA 1N6PA 4DC0A 3U7FB 3TOXA 2VTBA 3IKJA 3OZXA 1VL0A 2DGDA 2VP0A 2EJVA 1TTQB 3OBIA 4AIIA 3CVVA 3L7MA 4FT4A 3UKDA 3BN3A 1XWFA 2A5DA 4GQBA 3S2GA 2V7VA 4Q4AB 5EHIA 1CRWG 4WXPA 2PT7A 3OIFA 2PO7A 3KZVA 4GZLA 4NTZA 3LKVA 2PKXA 3S40A 4RMHA 4UQLA 3AX6A 4LNAA 4AZ0B 4QJ5A 4D92A 3JATB 3GLFE 1T5SA 5H68A 3ZGVA 4XPIB 2GZ2A 4RK0A 2F9FA 3NXSA 4BN0A 5KYXB 3DMHA 1EGMB 1NWCA 4BFSA 2V7XA 3T1NA 1R9GA 4DYHA 1XT6A 2PSEA 3ITDA 1RACA 4AX8A 3IEMA 3Q3CA 2HJ9A 5JMPA 1RM4A 4G37A 3WRWA 4MKRA 1YQ9A 1C4WA 3RH0A 1ZCZA 1P4RA 5SZIA 3RPEA 2AZ4A 1QJ4A 4PO1A 4XGKA 1WBJB 2B30A 2RIRA 5EE9A 4GOKA 5K0ZA 4YJFA 2J85A 4MYRA 1FYWA 2RK6A 3P2EA 3EXFB 4WACA 1H5UA 4ENQA 3RTGA 3S8MA 4CKXA 3E9NA 4L9AA 3S4YA 1LBEA 5KWSA 1CW2B 4WXYB 1EPUA 1U0RA 3SM3A 3H5OA 1MXFA 3LHIA 2WA2A 2XVMA 4COOA 2BGLA 1XIVA 4NDZA 4W4TA 2E4AA 2ODBA 3SLKA 4GKJB 4C0LA 2CD7A 1IHUA 4BMXA 3NX4A 1KF0A 3FW1A 2X7XA 5KTOA 2VDQB 5B5SA 4CQNA 4LHVA 4RJJA 1GY8A 1K0UA 3A6KA 4Q3BA 2B2XA 5AKYA 1ZD2P 2VSQA 2O8DA 1Y3HA 2JF0A 3JQPA 4MQLA 1NRWA 1VFNA 2FX2A 3AY6A 1Q44A 4W8OA 1GL3A 1MGOA 5EUQB 2AVDA 1EP1B 1JRLA 1N5MA 3BGDA 1ZOIA 3W7AA 2HM7A 1H8HD 2AH5A 3U40A 3CKYA 4YRNA 5B1YA 1USUA 5KQPA 3ZCXA 1E3JA 1NKSA 3TQHA 1QFZA 3H4VA 4C4AA 1EP2B 1JPJA 4RDXA 2O8CB 3PJDA 3PF9A 3N59A 3GXOA 4RHUA 2WG1A 5JAIA 1ZONA 4HOYA 2AK3A 2XSZA 16PKA 1QLHA 1W48A 4MR7A 2X5JO 3T5GA 1PS0A 5LC1A 2R84A 1NVWQ 4MA0A 4MP3A 4PTZA 4XW2A 2CLFB 2JIOA 3L7NA 1GNTA 4ZYXA 1AM4D 4D42A 3GRZA 3VMFA 4ZYWA 3HM9A 4KUEA 3D1JA 3HLYA 5CB6A 5CD1A 2BMEA 3KHTA 3CWZA 2P0EA 2V0CA 4FHEA 3K0KA 4Q82A 2X7JA 4IR7A 5GY7A 4L22A 1WPRA 2EQAA 3P0FA 4V0ME 2UUPA 4YHHB 3R8FA 2C7OA 2IOQA 1D2AA 1CRQA 4KNWA 4XJTA 5B64A 5B3JA 3QENA 2HADA 2J9FA 3NNSA 3OZAA 3R7AA 4TQAA 5T64A 4RE5A 1TZMA 4TRNA 2GR9A 3ICEA 4K9MA 1KI6B 1JEQB 1SUWA 2CNOA 1U3WA 1I0IA 2XWJI 2P9GA 3M5PA 4E5NA 2BGMA 5BR4A 2OHJA 1H9CA 2D3WA 1M1YB 2WLTA 3NUQA 5DCYA 5IDWA 4NDAA 4R3NA 1MB4A 5LYYA 3WIOA 1WEKA 1WG8A 4NYMR 1HX7A 2FDXA 1UIRA 3EXG1 1YHZA 4P92A 5FLKA 2B1GA 1MQ9A 3NHSA 1U7DA 1AXGA 2IRWA 1V7CA 4KQGA 2QNBA 3ILXA 1H2XA 3AOEA 2CEKA 1GNPA 2KSQA 2R00C 2B69A 3I52A 4LDAA 4CHGA 4HDCA 2X9QA 1JE0A 4U0KA 1DUIA 3CKKA 5DM2A 1XQ9A 5HQJA 2CUZA 1AHHA 3AUFA 1Z2EA 3FF1A 1LY1A 3KYJB 1H2ZA 3WP0A 1ISRA 4FR5A 2UZIR 4GI5A 5CCBA 4CM5A 3QVKA 2EZTA 1H4SA 3DV0B 2VDRB 5D5HA 2OBBA 2OFPA 4OHYA 2ZT8A 3PFBA 1URPA 1CHDA 2XIJA 1CUZA 2FSSA 3HO8A 3IULA 4FGLA 3UW3A 3BL8A 3DAGA 4KN5A 4Q47A 2HZBA 3VC7A 4BQIA 5K8CA 3KSAC 3MIIA 4NZOA 4WEQA 2W6NA 1LUAA 2ZXFA 2NN3C 4OY3A 4C6SA 2WI8A 2FI1A 3T95A 1N5LA 4WVFA 5DXAA 4BMNA 4F4DA 1EBUA 1AH2A 1S89A 3CS3A 3T06B 4MJXA 1BCSA 4CLXA 1TB4A 1M2NA 1GAQA 4KQXA 1G20B 5K8IA 4RKWA 1FA9A 3LCCA 2ZBFA 3F7MA 2WABA 4RMJA 1BOOA 4HUJA 4CF7A 5AK6A 1NNLA 2Y1EA 2V96A 5B3AA 2IHUA 3KVNA 3KOYA 3P27A