3TOZA

2.2 angstrom crystal structure of shikimate 5-dehydrogenase from listeria monocytogenes in complex with nad.
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
291
structure length
291
Chain Sequence
MTNKITERITGHTELIGLIATPIRHSLSPTMHNEAFAKLGLDYVYLAFEVGDKELKDVVQGFRAMNLRGWNVSMPNKTNIHKYLDKLSPAAELVGAVNTVVNDDGVLTGHITDGTGYMRALKEAGHDIIGKKMTICGAGGAATAICIQAALDGVKEISIFNRKDDFYANAEKTVEKINSKTDCKAQLFDIEDHEQLRKEIAESVIFTNATGVGMKPFEGETLLPSADMLRPELIVSDVVYKPTKTRLLEIAEEQGCQTLNGLGMMLWQGAKAFEIWTHKEMPVDYIKEILF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Shikimate dehydrogenase
publication title 2.2 Angstrom Crystal Structure of Shikimate 5-dehydrogenase from Listeria monocytogenes in Complex with NAD.
rcsb
source organism Listeria monocytogenes
total genus 104
structure length 291
sequence length 291
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.25: Shikimate dehydrogenase.
pdb deposition date 2011-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08501 Shikimate_dh_N Shikimate dehydrogenase substrate binding domain
A PF18317 SDH_C Shikimate 5'-dehydrogenase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3tozA02
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 3tozA01
3T4XA 1ML3A 5CEEA 1YBMA 2HMSA 2B35A 4GSLA 1XHLA 1LSOA 1YL6A 3G17A 4P4LA 4QX6A 2HSDA 1OC4A 2WSBA 5EERA 4XDYA 1SB9A 3TF5A 4WK6A 2ZCVA 1R6DA 1ZW1A 5TIIA 2WD7A 3PQFA 4CR7A 2PWZA 4IMPA 5ITWA 4Y8VA 4YA6A 3VAZA 3BA1A 3DAGA 1H6BA 3BIOA 3A14A 5G0VA 4JBHA 2IZ0A 2NWQA 4XWYA 2P9CA 2O2SA 4CM9D 3ZNOA 1B26A 3E9QA 3EGOA 3OM9A 5K9ZA 1CQJA 3L6OO 4BNMA 2NM0A 5B4VA 4OO3A 2I9PA 4GGPA 2D3TA 3RI3A 2EIHA 2C0CA 4DA9A 3DAFA 4WLUA 4J4HA 3DHNA 4XR9A 4OJNA 3ZNNA 4Z3KA 3PFWO 3OJEA 4MP6A 2D2IA 5F1PA 5TT0A 4L73A 2C7VA 4NZ9A 5I8WA 5IDXA 1FMCA 1KETA 4CMHA 3KYCA 4PZEA 1YVEI 3TL2A 2QX7A 5A03A 2DTEA 2BH9A 5G0TA 1U4SA 1R0KA 1C1DB 1E7QA 3G49A 5KOIA 2YFHA 2VHYA 1IE3A 4G65A 2Y68A 3DFUA 3ROMA 3NT2A 2W2LA 4MVJA 4XB1A 3E8XA 4JROA 2P4QA 1HRDA 1XIVA 4I8XA 4XYBA 3NTQA 4CV1A 3OMLA 6ADHA 2YW9A 3CKYA 3D4NA 1A72A 3H9EO 1LRJA 1W73A 2Q2VA 1LDEA 1NPYA 1C0KA 3NX4A 4QXMA 1BVRA 4PG6A 3QP9A 4PVCA 1T4DA 3U62A 1KEWA 3ZV4A 1ENOA 1VL0A 3I52A 3WBBA 3U4IA 3C8MA 2DPHA 3SJ7A 3U4DA 4TVOA 4IQ0A 1O89A 4QT0A 3NV9A 5TLSA 1IYZA 1DPGA 1PGJA 4D45A 4DPKA 5T5QA 2JHFA 4N54A 4RORA 3Q9UA 4A26A 2PY6A 2GN9A 3LT4A 4YVFA 1SEPA 3E5MA 1HLDA 3MCVA 4BO2A 4FGWA 4TRJA 1BXKA 1MV8A 3AY7A 4IXWA 5IN5A 2DAPA 3H8VA 2AMFA 1DEHA 1MC5A 1E1NA 4C4OA 4WJZA 4FIZA 3TNLA 4YAIA 1WZIA 1E77A 4UVGA 3ZU3A 3X2EA 1AN9A 2ZB3A 1I3LA 1ZVMA 1EBFA 1PJSA 1NVTA 3QY9A 2H6EA 4KTTE 4BMSA 2BFAA 2FMUA 3BMOB 2ZKLA 3I9KA 1IZ0A 4UUPA 5CDSA 2DBRA 1ZKMA 5KWEA 3S2IA 4EDFA 2BHLA 1MXHA 3DZHA 1BXZA 4RF5A 2NVBA 2YQ5A 2Q99A 2X4GA 1OAAA 3HDHA 2FZWA 4CMKA 1KC1A 5ES3A 3PLRA 4XCVA 3RJ5A 1B8UA 4TMFA 1P74A 5TRTA 3JQBC 3RUEA 3WGTA 4M8SA 5JMPA 1P33A 4XRRA 1TLTA 3OJOA 1UH5A 1KVTA 3LC2O 5CPBA 5DP2A 3ITDA 2AA3A 1YWGO 4TZTA 2H1SA 3GZNA 1NX6A 4IY1A 1F14A 1U2GA 2IRWA 1F12A 3WLEA 5JW6A 1GCOA 3GDOA 1O6ZA 2VHVA 1LLUA 3HFSA 5DOVA 4OH1A 4KTVE 3SC4A 1FDSA 2O4CA 4E12A 1F8GA 4L76A 3K73O 3BTOA 4WNCA 2GASA 4CMIB 1A7AA 4S3MA 1PZFA 3TZKA 2Q3EA 4F46A 4CMAA 4CV0A 1ZJZA 2VOEA 4UVEA 1FDTA 2BI7A 2D4AA 3H3JA 4BGVA 4DLBA 3NT5A 1Q0LA 2POQX 3NEPX 4DBZA 2FZEA 2QHXA 5IZ4A 1T2FA 3RC1A 3AM3A 1B16A 4GX1A 1PJLA 5MDHA 1SOWA 2A92A 1Z6ZA 2PH3A 1K5HA 2OP1A 1NHGA 3IJPA 3L9XA 1PZHA 4R01A 1MC4A 1VM6A 3I6IA 4OMUA 2WYUA 3CXRA 4XKJA 1T2AA 3SLKA 1I32A 4GL4A 2G82A 3I83A 1KVUA 2FR1A 1VPDA 2P68A 3GC6A 4BKRA 4BVAA 4J9VA 5C7IO 4IIVA 5A05A 1CYDA 1NFRA 2RAFA 3Q9NA 3WQRA 3WXBA 1UDCA 3PFFA 4Z0HO 1YL7A 4R1SA 1EVZA 1GYQA 3GPIA 4DC1A 1WP4A 1PTJA 3DBLB 2FWMX 4FBGA 4EITA 1ZXBA 3VHRA 1E6WA 5FYDA 5EIOA 3JQGB 4YEDA 4MP3A 3RIHA 4YPOA 3F47A 3DOJA 4BUCA 4TRNA 1H93A 3Q2KA 4OXYA 5TF4A 1A4IA 1VSVA 5THKA 1MUUA 4AJOA 1RM5A 2BFPA 3ZHZA 4CM5A 1N8KA 2Y1DA 4U5QA 5BNFA 4FOSA 4ONEA 1YGYA 4YWJA 2ZB7A 3GR6A 3OJ0A 3VTZA 2PV7A 4NU6A 1CJCA 4EEZA 1WW8A 1I36A 1Q0QA 2D1YA 3WGQA 2JL1A 4IM7A 4RO0A 1HETA 1I2BA 4UEJA 3CMMA 2OP0A 4CM9A 4F45A 5CDYA 3PYMA 4FPXA 3WR5A 3ZU4A 3ZZNA 1H6CA 4YAGA 4RVHA 4RLSA 4K26A 5TT1A 1ONPA 5L51A 3KETA 4OOEA 4HADA 3DWFA 3M6IA 4BNLA 2Y05A 2Q50A 3GEMA 3L0DA 4IZIA 2AQ8A 3JQEA 1E3LA 4FD3A 1Y5MA 1ADCA 5JO9A 5A9SB 4PCVA 2NQ8A 2GZ3A 3AUAA 5LDGA 1Z75A 1ISGA 2DPGA 1BDMA 4B8WA 3JYPA 4K28A 2Q1UA 3VPSA 4B3HA 1GFSA 4LMRA 5AOVA 4FJ2A 2J5KA 3JTMA 1ADFA 2X7HA 1B14A 1E7MA 1E3IA 2O2YA 4A03A 1WVGA 3BTUA 3CTMA 3KLPX 2ZTLA 2ET6A 3DC2A 4NJMA 3QWBA 2F00A 4MOWA 1DXYA 2E6UX 3BYZA 3ORFA 3D3WA 4A0SA 3ZH2A 3FWNA 3AW9A 3BMOA 2ZK7A 1HYHA 1MXFA 4CLDA 4EJMA 1LDBA 2NADA 2PZJA 3ENKA 4GX5A 4LCEA 5I9NA 1GV0A 3ZHYA 2CVQA 3MEQA 1HDGO 4B7CA 8ADHA 3ANNA 3DZGA 1DFIA 1X7GA 3E03A 4YB8A 2IODA 4J16A 4XGIA 5TS3A 1K6JA 4WASA 3K96A 2O3RA 3JYLA 3QQPA 1E3WB 1PJ3A 3JQFA 4WNIA 4U7WA 3V5NA 1V3UA 5CG2A 4BB5A 3HWRA 1UAYA 4P4NA 2EKQA 4CMEA 2AEMA 1EEHA 1F06A 2ZYAA 3JQ9A 1OI7A 3WFJA 1NVMB 3LU1A 2C82A 1Z7BA 3ST7A 1ZZEA 3QWAA 4LVCA 4W9NC 4C7KA 1DAOA 4MINA 5JYDA 1XWFA 1GCUA 5A3VA 4J1QA 4KOAA 5F3RA 5L53A 2DKNA 4HY3A 1W0CA 1XGKA 3H5AA 1LTHR 2HU2A 3E82A 9LDBA 3LT0A 1DRUA 3HUDA 4GQAA 3EW7A 3OEWA 4A7PA 4E5MA 4CMIA 3PWKA 3KXDA 1E1KA 3GG2A 3PVZA 4WEOA 2DBQA 1GZ3A 3KSDO 4CLRB 3AU9A 3VH4A 1DIAA 4GLLA 5JCJA 1OOEA 3DZIA 1B7GO 1GPDG 3NT4A 5CEFA 1FDWA 1H5QA 3ADPA 4FGSA 1WPQA 2QIOA 1WDKA 4R9SA 4Z9FA 2TMDA 4D0RA 4E30A 4BNYA 1GUZA 1U7HA 2JCVA 1QYDA 1ZJYA 2WMDA 3RUHA 3S8MA 4CV2A 4BO1A 3VPHA 1R12A 1LI4A 3RUCA 1U3UA 4DQVA 1GADO 2VRCA 3WYEA 1PJ2A 5JCXA 2WDZA 1Z73A 3DBLA 1X1TA 5L7YA 4WCFC 1ULSA 4I08A 4XJTA 2WYVA 3FR8A 2JAHA 1EFKA 1S6YA 4GKBA 3OF2A 2PGJA 4BV9A 3PPIA 5ENDA 1EMDA 4YRAA 4GKVA 4M49A 1HZJA 4YACA 1SCUA 3ITKA 1K0UA 4HNHA 3WGYA 2Q1TA 2GPTA 4BMNA 2GR9A 5DOZA 2B4RO 4LGVA 1A7KA 4PG7A 5C7OO 5A4DA 3A9WA 5TGDA 4B4OA 3U5TA 3NDIA 1IHXA 3FWZA 4RVSA 1ENPA 4DUPA 4WLNA 1YOVB 3L9WA 5K6AA 4NBVA 2BKAA 1NWCA 4B8ZA 1FDVA 4CL8A 1YRLA 5F5LA 1SC6A 2O23A 1W4ZA 3FNGA 3RAJA 3GVPA 4YRBA 5DCYA 1C1XB 2AG8A 3UAGA 3HB5X 4MP8A 5DBGA 2WEKA 3V1YA 3ONEA 3H3FA 5CDTA 1AHIA 2NVWA 1VKOA 4BO9A 3F5QA 3Q2IA 4RV9A 3TJRA 5IZCC 3HJAA 4OHUA 4YJFB 4EJ6A 2I99A 1YL5A 4AJLA 2NQTA 2VUUA 3QVSA 4RPGA 4LW8A 1PQUA 2AW5A 4ESOA 2IYOA 3GQVA 2QQ5A 3WGGA 3K30A 1GUFA 1EQ2A 2PD6A 2VNSA 5JO0A 3FSRA 2YHIB 3ONFA 2CUKA 4ZHSA 3TZCA 4N7RA 3V2UA 1P44A 5EQFA 1N92A 3WQQA 3RFXA 1Y8QB 1Z82A 3O9ZA 1MGOA 1X1EA 3ROQA 4GSKA 1J6UA 3ROKA 3QWFA 1W6UA 1E6UA 2YV2A 1BMDA 2DVMA 2VYVD 3H2ZA 3TFQA 4QECA 3V2HA 2J3KA 4G5HA 3JYNA 3BTVA 2V6GA 4Q3AA 3VZRA 3ZNPA 5EL0A 3I5MA 3GH3A 1UP7A 1PL7A 3H7AA 4MVJM 4UUMA 2GCGA 3GFBA 1DC5A 4QO8A 5IDQA 5KJCA 4R3WA 2BGMA 1GEGA 2PGLA 5JAMA 1E3WA 2Y0DA 4A73A 1BDBA 4NFYA 2Y99A 5JBIA 5KVVA 1LBEA 3WWZA 5TQVA 2DC1A 4CUZA 4R41A 5A3JA 1HLPA 3N58A 4J43A 3KYDA 2CF5A 2CZCA 3AM4A 1SBYA 1I3KA 4YDRA 5THQA 2BGLA 2FPGA 1SPXA 2CDAA 4WOJA 2XPCA 4J3FA 4IZHA 4K6FA 1H0KA 2AEJA 1R0SA 5I7FA 2JFHA 1YBAA 2YFQA 4D42A 5ER9A 1A9YA 3FNEA 4IBOA 4MVJE 2QRJA 3MZ0A 3AFNA 3Q11A 3VTFA 2QZZA 5DCWA 1SMKA 1DC6A 4ZU3A 3GMSA 3R0IA 4ALMA 3HDJA 3EZLA 1PSDA 4E2ZA 4FCCA 1VJ0A 4G81A 2E37A 4BNXA 2VQ3A 4L9RA 3RU9A 4RCVA 1NQOA 1C0IA 1U8FO 2HK7A 4WLFA 1NTOA 3DZJA 3ZWMA 1NM5A 1R16A 2HK9A 2Z1MA 3LQFA 1GUYA 5B37A 3GN1A 2GD1O 2JJYA 5KTKA 4I1IA 1ADGA 1J4AA 3IJRA 4PLTA 4B7UA 4CLRA 1HT0A 2VZ0A 1NQAO 2XXJA 1N1EA 3BHIA 3TQHA 2IXBA 1R66A 2QYTA 5KVSA 4NHEA 3VH2A 1E5LA 5H82A 2O48X 4E0BA 1Q7BA 4L0QA 2O50A 1VI2A 3GT0A 1V3TA 2DU8A 3VC7A 3GAFA 1GR0A 4CM1A 3OQ6A 4W4TA 2DTXA 2OORA 3AJRA 4IJWA 2UV8A 5I7EA 1A71A 5L7TA 5AXDA 2X5OA 1X0VA 2J5RA 4TKMA 3LSYA 2V7PA 3TN7A 3O03A 3H9QA 1PL6A 3D1LA 1BXGA 1PGQA 1OFGA 3E9MA 3DDNA 2J5QA 3FR7A 1HXHA 2GF2A 4KDFA 3ZW9A 4PGFA 4UAGA 3L07A 4CMJA 3DZBA 2JCYA 5T57A 1PR9A 2PR2A 1N7GA 5BNTA 4BNNA 3BHJA 4AJJA 4J91A 3E48A 1D7OA 2X5KO 2XAAA 2PGDA 3NJ8A 4BQPA 2CVOA 1QXSA 1DRVA 3IOYA 3OJLA 2X0NA 2VZ9A 1HDCA 4DPLA 2Y1CA 3RUAA 4Z0PA 5KVQA 4CM8B 2EKLA 4A27A 2VWQA 4H3VA 1HE5A 4YT4A 3JQ7B 4WLEA 1AE1A 1PZGA 1YOVA 3EHEA 1YDWA 3HE3A 3VH3A 3BMNB 4ZQFA 1I5RA 3M2TA 4C7JA 4JNKA 5TNXA 4AICA 1LLCA 2B83A 4M1QA 4HNGA 4DYVA 5JNLA 1C1XA 1KERA 1O5IA 3GGOA 3GVXA 4U0KA 3VPGA 4ZQHA 5JDIA 1G0NA 3WBFA 4MPDA 1HL3A 2JAPA 3IUPA 1P1FA 5FF9A 2NVUB 3WSWA 2GSDA 1NFQA 3X2FA 2ZTMA 4NMHA 1YKFA 4YJFA 3M1LA 1U3VA 3MWDB 5B12A 4ZQGA 4OKIA 4PZDA 1HE3A 3PHLA 3AOGA 4INAA 5B1YA 3M1AA 3WGOA 1L7EA 1QKIA 3RC2A 3ZN2A 1N9GB 1AXGA 2FSSA 1HKUA 1ZK0A 2YHIA 1PEDA 1CDOA 3ANLA 1SOVA 2W90A 4BKUA 1VL6A 1QLHA 3HN7A 1Y1PA 3VDQA 1VRWA 1YB5A 4J1SA 1C0LA 1WDLA 1KYQA 5IDYA 4R54A 1Y8QA 1MFZA 3IUSA 3I9LA 3FF4A 4CUKA 1M2WA 4Y6SA 3WGHA 4ALJA 1B8VA 2FHSA 5HBRA 3VKUA 3WNVA 1Z45A 4OSOA 3K92A 2GRAA 1E3SA 1JWBB 1U1IA 4FDAA 4DYDA 2JFGA 3WIEA 4F3YA 3GN2A 3D64A 5JY1A 1U5AA 5C3MA 4WOKA 1AUPA 1MB4A 1JU9A 2C5AA 3I9MA 4E5YA 4EUFA 1P1IA 1ONNA 4J4TA 5IDWA 4EZBA 1J5PA 1U4OA 4JP2A 4LK3A 5HS4A 4D3DA 2C07A 2HUNA 2X86A 1PQWA 4DPMA 3DONA 2JCXA 4YXFA 4EYEA 4DL9A 3O8QB 4HFNA 2EEZA 1P1JA 3S1LA 3GZ4A 2XOXA 3FPLA 4RJTA 4PLVA 1ZSVA 1U3WA 2HMWA 2Q49A 4Q3CA 1NVGA 2X5JO 1LC0A 4ZVVA 2PKQO 1FDUA 4IXTA 3BXXA 3QHAA 1B15A 2VTEA 2B4QA 3HN2A 2X6TA 5FI3A 1YO6A 2DQ4A 2I67A 1EQUA 2PZMA 3F3SA 3HADA 3ZWBA 4O63O 1GL3A 3F1KA 4WE3A 1KC3A 3KHUA 1A4UA 2PFGA 2VYVA 4FFNA 1LDGA 4HKTA 1R4NB 2NU9A 4B3IA 3GFGA 4XZ3A 1LQUA 3S55A 1T2EA 9LDTA 4RF2A 3UVEA 4W7IA 5JLAA 4GI2A 4CR6A 1P1KA 1NAIA 3W4JA 4ITUA 2EF1A 1NR1A 2ZQZA 4XR4A 3H4VA 3B1JA 2UAGA 3DHEA 2X58A 1GQQA 1PGPA 4AJEA 2J3HA 1LNQA 3AFMA 2FN7A 5GY7A 4R9RA 1LA2A 1Y9AA 4LVUA 4Y67A 5DCUA 2OMEA 1LU9A 4Z6KA 2VNAA 4M89A 4S1VA 5JDCA 3HDYA 4I9NA 1RPNA 4BNFA 1YXMA 4CLXA 4QFCA 5DNAA 1V6AA 5JXWA 2ZQYA 2YDYA 1E7SA 1TXGA 4PG5A 2DBZA 3LC1O 2OGUA 1DLIA 4EW6A 2X22A 1XEAA 2FR8A 1RYEA 4E2WA 3KVOA 4TKLA 4CQMB 4NH4A 3TDKA 4FFMA 1D1SA 3D5QA 5FWNA 2G17A 5DBFA 1U28A 2PA3A 4FC7A 4J9UE 4MO2A 3WNQA 1LUAA 3CZMA 4MKRA 1H6AA 2NACA 3AUTA 1IL0A 2BF7A 4IINA 3ZWOA 1BVUA 4WEQA 5L4LA 4MVJG 5HTOA 3D0OA 3O4RA 4U6QA 3KLMX 3RUFA 1PX0A 3T7EA 4BKPA 3ABIA 4OQYA 5AVOA 2DUWA 4BQRA 4HP8A 5CDUA 3PK0A 4B7XA 3GA0A 1NHWA 4IDCA 3MWEB 4XB2A 3MJSA 4ZN6A 2NLOA 1ZK4A 3QIVA 4TRRA 1Y6JA 4QSMA 1PJQA 1WDMA 5IG2A 4CMCA 1DOHA 3DMTA 1BHSA 1PWZA 4IDAA 5T8KC 3QJ5A 3UFXA 3UCFA 1ZIDA 2JD1A 2BD0A 5ITVA 4JJGA 3SJUA 3NRCA 5KJ6A 4UVDA 3CINA 4E2YA 3PJFA 4B4UA 5I9MA 4CM8A 4E21A 1LSJA 2YYYA 4ZICA 4RVFA 3JQ7A 4II2A 5AYVA 3JSAA 1M67A 3RWBA 3W6ZA 4ZJUA 4JK3A 4RZHA 1AXEA 4KWHA 1GD1O 3MJTA 4P4GA 5EINA 1I24A 3P2OA 5HRUA 3QRWA 4CLEA 1ZH8A 1NQ5A 3GNSA 3KZVA 4R1UA 5BSFA 3IP1A 5ICSA 4ZD6A 2RIRA 3Q1LA 1T24A 3K9QO 4CQLB 2IZ1A 4EGFA 4E13A 1F0YA 2NVUA 2YHUA 2UDPA 3FBGA 4D43A 3CUKA 1YB1A 1UXKA 3DHYA 5HS6A 1ISIA 2XXBA 1D4FA 3GDFA 3DBVO 3ASVA 1RM3A 1JKFA 3HG7A 4FW8A 4QQRA 3RKRA 4L75A 2GO1A 3UICA 1M6WA 2GN6A 2DFDA 1IY8A 3KEQA 1QG6A 3NYWA 3DZFA 1N9GA 1EBUA 1UP6A 1E7YA 1LSSA 4D46A 4A5OA 5L9AA 1D1TA 3RFTA 2YDXA 2C59A 2GZ2A 3ETDA 4IPTA 2X9NA 1A27A 4Y98A 3ULKA 3GDGA 1N5DA 2QRKA 3GOHA 1DSSG 3UW3A 5CP8A 3A4VA 4UUNA 5KJFA 4IDDA 1GYRA 3MJEA 1I10A 1XU9A 4HUJA 4IJKA 3L6EA 3B6ZA 3LLVA 1KEUA 2A9FA 2IE0A 4OKNA 5T6BA 1UUFA 3UGKA 2NNLD 4PLYA 1UXHA 2FOIA 2OBYA 2Y1FA 5ER6A 2JKVA 2GZ1A 4XYMA 3H9JA 4RGBA 2NTJA 3C1OA 3LZ6A 4R1NA 3RQSA 3KYBA 4XQ9A 2F1KA 3L4SO 3O8QA 4HWKA 3WICA 3K2BA 2E49A 2X9GA 4BO8A 1F8FA 1I2CA 2Y1GA 3RFVA 3EYWA 1YQGA 2YV1A 1C1DA 3GEDA 3IIEA 2EGHA 3JQFC 5C7LO 3UXYA 3ZWYA 3SVTA 1Z74A 3JQ9C 4XDZA 5CEJA 4UVHA 2BGKA 2QG4A 4RPLA 3UKOA 4LISA 3WG9A 4PG8A 3Q0EA 1R4NA 3NDJA 3FI9A 5ENVA 5TC4A 1EE9A 2BI8A 4YJGB 5BSEA 1M6HA 2OZPA 5KKAA 4ND3A 1XQ1A 3V8BA 4YTEA 4M86A 1DIHA 4R1TA 1JN0A 3P2YA 3GEGA 4J2OA 4DMMA 1XELA 4M87A 4DLLA 3E5RA 2A4KA 1PS0A 3VDRA 4Z9XA 1LJ8A 3BZUA 1O9BA 4RZIA 4WGGA 2PNFA 4DXHA 3KSUA 3PZRA 1DIRA 2BFOA 2HRBA 3JD1A 2HJSA 5COAA 5A9TA 1PWXA 2O3JA 1P31A 5I9LA 3IKVA 1X7HA 4RQTA 1G0OA 1M76A 3F6YA 3D4PA 5DP1A 1CWUA 1GQYA 4NI5A 3I3OA 3VZQA 4BO4A 3VVBA 3AY6A 4CJXA 1SAYA 3PI7A 2AQIA 4IGFA 1WWKA 4YQYA 2B5VA 1D8AA 3UN1A 3G1UA 4CQMA 3FHLA 1X15A 1GY8A 3C3XA 3NTRA 3EY4A 1DC3A 2H63A 5C37A 5JC1A 3JQ8B 4ND5A 3CIFA 3PDUA 1KBZA 2H5LA 4AJIA 4E33A 4Z0TA 2AEFA 1VLLA 2D5AA 2HMUA 3T4EA 1PZEA 4TROA 3DTTA 2DFVA 4BOYA 1I8TA 5BQFA 3IDSA 3WQSB 4TVBA 4D7AA 3ZV5A 3OHSX 4P38A 1XKQA 4JJFA 4WCFB 1Y8RB 3JQCA 3JQAD 1XLTA 2JD0A 4ID9A 4MVJF 1LC3A 5ILOA 3CE6A 4BIIA 1DJQA 1LDYA 4E5PA 2PD3A 1EDOA 2EERA 2HKIA 3OFSA 4MDHA 3ROPA 3WMWA 2CD9A 3PWSA 4EEXA 3GRKA 2OOSA 2IZZA 4NR0A 3SBOA 1R4MB 2PK3A 4IDFA 5L95A 2V65A 1NXQA 1EVJA 2O7QA 1SEVA 1X0XA 1C3VA 2CDBA 5K6AC 1QYCA 4UEOA 3IC5A 5CFZA 2XF8A 2VCYA 3U49A 1ZUD1 4N5MA 4I5FA 4KZPA 4CM3A 1DBVO 3UCEA 4JXKA 3NJ4A 5L45A 1ZK1A 1NFFA 3CSDA 3INGA 4OL9A 3SEFA 4YR9A 3AUSA 1ZNQO 2B4TO 1B8PA 1N7HA 2W4QA 3GLQA 1HEUA 1LDMA 4R16A 1X7DA 1T4BA 4I9HA 4IIUA 2VT3A 3EZYA 3JQAB 1K89A 1E1LA 3AU8A 3ZGYA 2B0JA 2G76A 4BNJA 3C7DB 2Q1WA 2I3GA 3K8ZA 1OZAA 4GMGA 5COQA 5JYEA 4PLHA 1UP4A 1WZEA 4PLCA 2UVDA 3GUCA 1TT5B 4HFRA 3H9UA 2B5WA 3RBZA 4JLWA 1CEQA 3PIDA 4UREA 3TOXA 3CEAA 2FY8A 1XSEA 4KUEA 1XA0A 2AXQA 4JIGA 4RDIA 2HAEA 5EESA 5G4LA 1BWSA 2RHCA 1K3TA 1HWYA 3I9JA 1T2CA 3BMQB 2PTGA 4DTIA 2YZ7A 3FTPA 1UJMA 3JQGA 5G4KB 3WWYA 4BS9A 3STHA 1LEHA 2Z95A 4FFLA 3PEFA 5CDGA 2QYSA 3D4OA 3LC7O 2LDXA 1DFHA 3U09A 1B2LA 1KIFA 1R15A 2UUOA 5T64A 1B3BA 3K31A 3EC7A 3VKVA 3I23A 2FR0A 1P0CA 1UZNA 3U0BA 5LDHA 1B3RA 4BNGA 4YQZA 3MJ4A 1XDWA 5G0UA 5B4UA 3TSCA 2HCTA 2HMVA 4MIEA 1S7CA 4NQZA 5GZ6A 4XYLA 2JD2A 2NTVA 2TMGA 4ND2A 5HA5A 4IUYA 5ADHA 1J0XO 2DM6A 1JAYA 3B1KA 4JX8A 2EXXA 4DIFA 3C1TA 2EW8A 4W9NA 4A10A 1LSUA 4JQCA 4IQ8A 3NAQA 1DRWA 3GHYA 5LC1A 1PJCA 1HSOA 1N1GA 1HSZA 3PHJA 3C1AA 2G1UA 4J7XA 3OIGA 5A9SA 1FJHA 3PWZA 2AE2A 5H83A 2AHRA 2VWGA 4GX0A 1VL8A 1P9LA 4MJLA 4AJ4A 5AXAA 1NP3A 2DUUA 4Y6RA 4HX5A 5G0WA 2W2KB 2O3QA 2I6TA 3TZQA 4E4YA 3NKLA 4BNUA 1EUZA 1NBOA 4XGKA 2OXIA 4KUHA 1PQPA 3FNHA 3P19A 4NBTA 4EJ0A 2PZKA 4HFMA 1KEVA 1ZEJA 2A35A 2PKQP 2Y93A 4AJKA 1I30A 4OXNA 3INTA 1KS9A 3AI2A 3JQ8A 1ENZA 4H16A 2RBEA 3RVDA 3FD8A 1KVQA 2PZLA 3FTNA 1VC2A 4YAEA 5A1TA 2EJWA 3ZHBA 3IQDB 3LVFO 4YBZA 5IJZA 4XGNA 2GLXA 2YQ4A 3FPCA 4YAKA 2HDHA 2J8ZA 3Q6IA 3LLSA 4MVJD 2ZYGA 4Q3DA 5DZSA 3RCBA 3TL3A 4IS3A 1E7WA 2C54A 4WCFA 1Y8RA 2A94A 1HE2A 2P9GA 4GWKA 4CODB 4E5KA 4J2HA 5TSDA 4BO3A 4EUEA 3I9OA 3ZWAA 3WGIA 1IUKA 1R4MA 2X9VA 5BT9A 4ND4A 1F17A 3HHPA 3TZ6A 4PLWA 3LDHA 4PG4A 4DLAA 1LXCA 1P3DA 4DIBA 2CFCA 5IXYA 3HQ4O 4L8VA 4BB6A 1Q7GA 5GZ1A 3R6DA 4I9UA 2VUSA 4DQUA 4CV3A 2FPPA 3EAGA 3WX0A 1GQ2A 2HJRA 4L4XA 2D8AA 3DOOA 3GVIA 5JDIC 1DHTA 3PDJA 3COSA 2FP4A 2OUIA 5BSHA 3MOIA 1I33A 2EKPA 2VT2A 5L4SA 2V6MA 2WTBA 1NPTO 4O6VA 3JQAA 5IF3A 3GK3A 3SC6A 2J6IA 3WJAA 2YY7A 1KY5A 1NASA 1G1AA 4BKOA 1XR3A 2R00A 4WKGA 3V1TC 3GRPA 1U9JA 1MFPA 4J4BA 1TT5A 3OQBA 3OA2A 5JFOA 1YJQA 1ZSNA 3VH1A 4Q39A 4DWVA 5F1KA 1DAPA 1CIVA 3GVHA 1L1FA 2H9IA 3RC9A 3OIDA 4BL5A 3CMCO 1I2ZA 2P9EA 3WB9A 3BMQA 1I3NA 4BNKA 1AGNA 3RUDA 4OOFA 2DLDA 3L4BA 2DBVO 4GAEA 3IKTA 1YE3A 1ZEMA 3ZV3A 1J49A 1EK6A 4RQUA 4O59O 2DTDA 1YJ8A 1PGOA 3FCOA 1QR6A 2QZ9A 2WE8A 2ZCUA 2I5PO 3ENNA 2HRZA 4BGUA 1XYGA 2R6JA 4CM6A 5IAAA 2SCUA 3HFGA 4DQXA 5G0SA 3ZCXA 3BTSA 4OIMA 4HFJA 1MLDA 1YONA 4FC6A 3SX2A 1YQXA 3G3EA 4BV8A 4PN3A 3VPXA 1PJTA 3R3JA 2Y1OA 4Z3DA 1RM0A 4CL3A 1ISHA 3DO5A 3VVCA 4XA8A 1UZMA 1AHHA 5KIAA 2X0JA 4J7UA 2YUTA 4QFDA 1HYEA 1O0SA 4CLOB 1RYDA 2HK8A 1JWAB 1ONOA 2OFPA 4R5MA 3JCZA 2Q4BA 3F5SA 5JMWA 1ZCJA 1LRLA 3I1JA 4FFRA 3EMKA 4DGSA 1YDEA 3WYBA 5DDIP 3AOEA 3OIFA 3GVCA 5L40A 1JDJA 1GTMA 3EUWA 3VOSA 4LRSB 4OYRA 5A5FA 4EBFA 4XYGA 1X14A 4BMVA 3F4BA 1HDZA 3DFZA 4E31A 2PKRA 3G1TA 3I6QA 3QWHA 1Y9EA 3CPSA 1ZSYA 2PLAA 1WMBA 4WECA 3S2FA 2B36A 1E1MA 5CG1A 3U3XA 4QTZA 4RVUA 2EJVA 1NAHA 3PP8A 4IJVA 2HMTA 5JDCC 2C5EA 2Q4EA 2RCYA 3GNQA 5JY6A 3PGJA 1P77A 2CDCA 1V0JA 2FSVA 3C7CB 2EP5A 1HF3A 2WE7A 4JJIA 5DBIA 3NGXA 1C0PA 2GN8A 3A28A 5IXSA 3DL2A 1Y7TA 1RWBA 3OECA 4E2XA 3GG9A 5EMHA 2ZJ1A 3D3EA 3KTDA 3OBBA 1ENYA 1O8CA 4MKZA 1TVEA 4YAJA 1QV6A 3RASA 5JSFA 4GPD1 4NBRA 4YRDA 5JAIA 4OAQA 1GPJA 4RL6A 1EFLA 3TFOA 4HBGA 1CETA 3KSZO 4AJHA 1BGVA 4II3A 1FXSA 2HLPA 2ZYDA 1LDNA 4I5DA 1DC4A 3OA0A 4BNWA 1JA9A 4HV4A 1H2HA 1M75A 3DMTC 3W6UA 4AL4A 4CM7A 5FFFA 1UDBA 4J1NA 4BKQA 4E6PA 1G6KA 2AE1A 4BO5A 5L7WA 4JBIA 3HNPA 2BFMA 2E48A 4P22A 5A9RA 4HXYA 1K6IA 4OQZA 3LF1A 3FBTA 4B4VA 3OETA 4JP3A 2C29D 2RH4A 4ALKA 4TSKA 3OP4A 1XCBA 5DN9A 2AQHA 3TRIA 3EK2A 4CM4B 1GU7A 4R69A 2WWRA 3W8EA 3DBHB 1JLLA 1BTOA 3H2SA 3LT2A 4WUVA 4NDNE 3ZWCA 3ETGA 3CZRA 5KNLA 1I01A 4FSHA 2D59A 3ASUA 5ILGA 1PR3A 3EDMA 4XEHA 5DULA 3HB4X 2BMAA 4I5GA 5G2OA 3ICCA 4O0LA 3KRTA 1H9AA 1YQDA 3WS7A 3DBRB 4RVDA 4L74A 3PTZA 2I3AA 4X54A 4BO7A 4LMPA 4JN6B 2EV9A 1YH3A 4I5EA 2C2XA 3JQDA 3WMXA 4DREA 5B4TA 5KJEA 1UXGA 1V8BA 3W1VA 1H6DA 4OM8A 3HZZA 1O95A 3KEOA 4W7HA 1JW9B 4OXKA 3LF2A 1EVYA 1U8XX 1ID1A 3WYCA 3UHAA 3C24A 4Y9DA 5IFLA 1C14A 3E1KA 1ZBQA 3RROA 3I4CA 3UOGA 3W4IA 4R51A 1ARZA 3S2GA 5A02A 4NIMA 3H6KA 2R2GA 4NJMB 2VN8A 1GZ4A 3VPFA 3HSKA 1D3AA 3QW2A 3D3WB 2Q45A 3MTJA 2Z1NA 2EW2A 3AY3A 4J90A 1HDXA 2OL4A 2OO5A 2VWHA 5HM8A 3QLJA 3JD0A 1M66A 2Q2WA 4PRKA 5I7SA 4BNZA 3DB2A 3BMNA 3E18A 1UXJA 2X8LA 3ZWXA 4BO6A 3PJEA 1T26A 3U9LA 1QORA 1A5ZA 5MGBA 3DTYA 3SXPA 2Y1EA 3ZWNA 4KQWA 4YJHB 5JCJD 3H65A 3EVNA 5EQDA 4CLOA 4RPKA 3DOCA 2IEDA 2NU7A 4PLPA 1PJBA 4RLHA 3F4LA 3KBOA 2VHXA 4XD2A 3ETEA 3WFIA 3W4KA 3B1FA 1LLDA 1EK5A 1BRMA 3PJDA 2JFFA 3KO8A 4W82A 4GBJA 4BNIA 2WYWA 3ZWWA 4MVJP 3N74A 3WTCA 5GZ3A 3CH6A 3DQPA 3K2EA 1MX3A 2Q1SA 1BSVA 2GDZA 2VRCD 3AWDA 2NTNA 3F9IA 4ND1A 1QYWA 4TRMA 5CHEA 2FPIA 1K2WA 3JYOA 4DMLA 2X23A 2J3JA 4XJSA 1ISJA 2BLLA 2RH8A 4PRLA 4U8GA 3TPCA 4RF3A 3TZHA 2VWPA 3K5PA 5LCXA 2VYND 4IQGA 1H2BA 1XQ6A 3QE3A 4PZCA 1HYGA 4F6LA 3IP3A 1DJNA 1T2DA 4JCOA 2W98A 4FQ8A 3I4FA 3ZI0A 4JBGA 5TX7A 7MDHA 2P4HX 3PHGA 5U9CA 2VRBA 2V6BA 3G0OA 4NFSA 1DFGA 4GLOA 4G2NA 1GDHA 2PD4A 1SB8A 4B4WA 3GMDA 4QEDA 1VKNA 2Y0CA 1P45A 3GY0A 4D0SA 2EP7A 4MVJH 4Y6PA 3ZNQA 4O5OA 4B3JA 1U2DA 4YT5A 2G0TA 3QSGA 5EN4A 3B70A 1I0ZA 3B20A 2VUTA 4CMEC 4UEKA 2VHWA 5T8KA 3INRA 3JQBA 3FNFA 4P8RA 4TQGA 3S2EA 3KUXA 1CF2O 3O38A 2Q46A 2QW8A 4FJ1A 1CERA 4K1LA 4IS2A 3W8DA 2P91A 3AK4A 4ZA2A 3R3SA 3TWOA 4NK5A 2VTDA 5KCZA 1JAXA 2BELA 1E7RA 2CSUA 4R4JA 5ICMA 4M54A 4NU5A 4FFOA 4CM4A 3H9GA 2EG9A 5A5EA 3DBHA 2X0RA 4YCAA 4YJDA 3H5RA 2ZB4A 1PGNA 2D5CA 1NYTA 3NGLA 1QRRA 3GPDG 1PL8A 5U1PA 3DBRA 1NNUA 1K6XA 4N18A 2WD8A 1DDOA 2O3SA 1L7DA 4FFPA 5AXCA 5I8ZA 3IL2A 4W99A 3KB6A 3DZKA 3PHIA 3WDSA 5A04A 1EZ4A 4B79A 1YBVA 1IULA 1UXIA 3BMCB 4WLVA 1KY4A 4ROSA 2UYYA 4IDEA 4XQCA 3ZWPA 3H5NA 1XU7A 3ONDA 4PLFA 3PZBA 3U4HA 1KOLA 4R68A 1A9ZA 1CQIA 2UUPA 2GUGA 4WPGA 1U5CA 5JC8A 3P5SA 2O7SA 3GHHA 4D41A 2CNBA 2FRDA 1ZMTA 1ZO8A 2QRLA 1GAEO 1ZFNA 1Q0HA 4ALNA 1E3EA 4PFJA 1FF9A 4TZKA 2Y0EA 1NWHA 4XIYA 2HO5A 2GGSA 1PIWA 4A2CA 4KMSA 2WJPA 1YS4A 4IDBA 1VE9A 4GVLA 4CR8A 3ZHXA 2HQ1A 1ISMA 3SLGA 5AXBA 2O3TA 1TB4A 3AUUA 5FEUA 3KM0A 1BW9B 5H81A 4H7PA 1ZK3A 1VJTA 3PYXA 3UF0A 4LCJA 4U0JA 4GMFA 4OGWA 4DBVO 4MKXA 4YJHA 4J49A 4CQLA 2NU6A 4ALIA 3KYDB 4XQGA 3TOZA 3V2GA 3QVTA 2DT5A 3ANMA 1EUDA 4CPDA 2X0IA 5U4QA 2I76A 3L6DA 1DHRA 1JQBA 4FN4A 3OSUA 5F1OA 3BHMA 3JYQA 3VZPA 3LYLA 1IB6A 1JVBA 4J0EA 4DIOA 3U4CA 4AJ1A 2VHZA 2IEBA 1V9LA 2LDBA 2V6FA 4GGOA 4D3SA 4J1TA 1ADBA 1B0AA 3OH8A 4BNHA 1OBFO 4M55A 2O4UX 3JQ6A 1MG0A 4AG3A 1WNTA 1P1HA 2IDZA 4GH5A 5EJ2A 3RU7A 5AQ1A 1P0FA 4PIVA 3GGGA 2X1HA 6LDHA 4ZQBA 3PIIA 4NK4A 4BNVA 4E32A 2OBNA 4QUKA 1OC2A 4AJPA 4XIJA 1Z7EA 3F46A 2ZATA 2IXAA 5L4NA 4NBWA 3WIDA 1V3VA 3L77A 4TWRA 2EHDA 5COBA 1RJWA 2P2SA 3G79A 1JTVA 3PRJA 4DRYA 1TT7A 4UUOA 1GV1A 4RPHA 3QVWA 4MIYA 5GMOA 3NUGA 1DO8A 3R1IA 4NNJA 3LT1A 1UAGA 4MIOA 4NFHA 3DAPA 1MG5A 3ZWVA 3ZU5A 3WGZA 1HDOA 4J0FA 5JAQA 4L4RA 1BXGB 2W8ZA 4CLHA 2P5YA 4N5LA 1KVRA 4DVJA 1H9BA 1P1RA 3NDRA 1IPFA 1T1SA 4CUJA 3PYLA 4CQMD 1NPDA 1YB4A 3D7LA 3WJ7A 4R5HA 2IYPA 4WCDA 3ZDFA 3LK7A 1HDRA 1WXDA 1SO8A 1T1RA 3ON5A 5JE8A 3MOGA 4J7CA 1WLYA 1PJ4A 1E6EA 2VYNA 4YJGA 5TJHA 4LRTB 3OEYA 4URFA 3WLFA 4PLZA 1HE4A 4FB5A 3M2PA 4FS3A 1EVIA 4EUHA 4MVJI 5I7VA 1QYXA 2ILTA 3F1LA 1Y81A 3IMFA 4AJNA 2CF6A 7ADHA 1E92A 1QMGA 1UZLA 3RBXA 2NSDA 5J23A 4CMGA 4R3NA 2YV3A 3A06A 3OQ1A 1DB3A 3K6JA 2ZJ0A 3GUYA 5EPOA 5IN4A 1HZZA 3PHHA 3A1NA 4NJOA 1PS8A 2I66A 5FI5A 3UH1A 1OMOA 3ZV6A 3ADOA 3C85A 3T7CA 3WTBA 1LX6A 2Q2QA 1QLJA 1VJ1A 2CY0A 3JV7A 1KEPA 4Q9NA 3BMCA 2C7GA 2GN4A 2Z5LA 8LDHA 3D5TA 1ULUA 4ZQEA 4QO7A 3GAZA 1LQTA 1TI7A 2R00C 3NTOA 4F6CA 4RVGA 3FRJA 3GGPA 3ZW8A 2B37A 4KUGA 2P5UA 3JD4A 4RDHA 2D0IA 4NBUA 2WD7B 3AI3A 2I65A 1GEEA 3MJCA 4EI2A 1E5QA 1PS9A 2W2LD 4XYEA 4BNTA 1TEHA 1TA4A 2J3IA 1RM4A 2NUAA 5DT9A 4Z9YA 3RBVA 2JHGA 3L4BC 3QV1A 2ZTVA 3RKUA 1H94A 4K9DA 5TJ9A 1U7TA 1Y5RA 1HDYA 2NV6A 1ZXLA 5C5IA 1QSGA 1R37A 4FR5A 2CVZA 3RD5A 1XG5A 2O3UA 3N7UA 1ZK2A 4PLGA 4BO0A 1BW9A 2Y66A 3PQEA 1BG6A 4PVDA 4ALLA 3O26A 2AG5A 1EE2A 1UDAA 5BNIA 1MP0A 4D79A 4D3FA 2ZB8A 1MA0A 3RSHA 1JKJA 3IS3A 4YYZA 1IZ9A 2VOJA 3I9NA 3KYCB 1JVSA 5L3ZA 3PLNA 3PGXA 4IDGA 4UVIA 2EWMA 3C7AA 5JAZA 1RKXA 1WAMA 4Q3EA 1LLQA 4IGEA 3E9NA 4L4SA 4GX2A 4YT8A 2CMDA 1DIGA 2WM3A 3V1UA 4LN1A 3WOHA 3WSVA 1E0DA 3QWIA 1QP8A 2PH5A 2GYYA 4KQXA 2RHRA 3KV3O 3PQDA 5DF1A 4UULA 4GWGA 2E4AA 3FN4A 3IAHA 4RPJA 3AOEC 3VZSA 5IZCA 1DLJA 3W8FA 2AQKA 3PXXA 1SNYA 1T25A 3GNTA 1Q7CA 2Y67A 4AVYA 5CAEA 1JKIA 1X13A 2EGGA 5KKCA 5KVCA 1UR5A 5A06A 1GZ6A 3E6AA 2E82A 3RUIA 1E3JA 2OHXA 3DEYX 4ILKA 3KOUA 3MTGA 1V35A 4W6ZA 1PU2A 1ZMOA 3BAZA 4JGBA 4LSWA 1QV7A 4N5NA 1Q2XA 2C2YA 1DIBA 3JD2A 4CMBA 1O94A 2ZIZA 4RF4A 1IOLA 3GF4A 5G4KA 3UCXA 1GYPA 5HWSA 3AM5A 3P7MA 5BR7A 2VZ8A 4WLOA 1SZJG 1W8DA 3RJ9A 4E3ZA 3QVXA 4IJUA 4XQEA 5CPFA 1R0LA 3HDQA 2GERA 5JS6A 4BGIA 3EVTA 3UUWA 3PJGA 4Q3NA 4D44A 4FJ0A 3DXFA 1EUCA 3ZU2A 1I3MA 4XRGA 1VSUA 4NPCA 1IHYA 4U6SA 1FK8A 1NQTA 1WMAA 4FOOA 2NU8A 4BHTA 5T67A 1Q1NA 2G5CA 3OJFA 5BSGA 4Q3BA 5F21A 1LRKA 3Q3CA 3RC7A 1HTBA 2GNAA 4AFNA 4NG5A 4IMRA 3OICA 1U3TA 4XX0A 1IPEA 1CRWG 2ZTUA 3JD3A 2BRUA 4KDEA 4O1MA 3GZNB 2YJZA 4KWIA 3DR3A 4ZGWA 3DMYA 1ISFA 4YT2A 4K6CA 4E5NA 3QVOA 2B69A 4H15A 3ICPA 4KP7A 1ORRA 4ZRMA 1EDZA 3MJVA 1N2SA 1QYVA 2W2KA 2C20A 4LSMA 5F5NA 4BGEA 4ZRNA 5KJ1A 1KVSA 3AI1A 4GVXA 4AJ2A 4DC0A 5K0ZA 4J6FA 1NR7A 3QA9A 4OSPA 5JPIA
chains in the Genus database with same CATH superfamily
2GOYA 2ZYVX 4CDRA 1ECJA 4Y3UA 5CT5A 3EBLA 2FPXA 3LDUA 4HWPA 3CSUA 2V7WA 4O1HA 1RYYA 1IUPA 4RDCA 4GSLA 1RSZA 3EVFA 4JI7B 2EQAA 2I22A 2PMDA 4DDTA 3L1VA 3GROA 1TF2A 3CX6A 1OC4A 1BXRA 1GKYA 3VYRB 2WSBA 5EERA 4RYLA 1ZD3A 1J2TA 5DI3B 1T9CA 1ZW1A 3LCJA 1AB5A 3EFEA 3CNOA 1SVWA 3PQFA 4XLTA 5ITWA 1WETA 3OM0A 1H8EA 4OQLA 4YA6A 5E6RA 1SCNE 5F64A 3FTFA 3UMCA 2B82A 2PUTA 2GFIA 2Q8NA 1EXNA 4QGHA 2O5RA 4H7FA 2Q5IA 4BBAA 2IZ0A 2NWQA 1TIPA 2PTHA 4OFBA 4Y0VA 4XWYA 2HTFA 5GGXA 5I6DA 1CZNA 1T9KA 2C4TA 3CPEA 4YRTA 5K0NA 1OW3B 2EATA 4ZMRA 1RXIA 3LUDA 3R7LA 1SD2A 4WBNF 1T0BA 1J23A 1LS6A 1X8XA 2J67A 4I50B 1BOOA 3EVBA 2VFAA 3N8DA 3HWX1 4F86A 1HNWB 2XLBA 3OT1A 2OBLA 3NBYC 4PHGA 2O2HA 1OPRA 5LP6C 3PNSA 3W9BA 2K5UA 3O82A 5IJWA 5DBOA 3DHNA 4XR9A 2CXOA 3LAWA 4JWKA 3ZNNA 3PFWO 3OJEA 1PR0A 3CN7A 3IOEA 3DA8A 2D2IA 4RM2A 4WMLA 1RWXA 5TT0A 5K20A 2H4HA 4TS4A 4Y1GA 2C7VA 3I61A 1KETA 1O8BA 2QRUA 4PZEA 5F1YA 3GPLA 3K0FA 1FA9A 3JVVA 1J8DA 3PHCA 1Z28A 2R6HA 4L5YA 3GA5A 5G0TA 1U4SA 1ZN9A 3DT8A 1R0KA 1C7JA 2RKOA 3WA6A 1QRUA 3G49A 2XCLA 2OYRA 2YFHA 4KR9A 2KPOA 2Z9DA 3LX6A 3D1VA 1H2AS 5LMUB 2C8KA 3RS3A 3EFOA 1H1TA 4MQ5A 4FYVA 2WF7A 4MVJA 4DR6B 4JROA 3A6ZA 2P4QA 1V71A 1YJAA 4KVAA 4GI7A 4W7SA 2IW3A 1BD4A 3NTQA 1C4KA 3DJYA 3PGA1 2D7CA 1CULC 3I5XA 1NW4A 1YQQA 2QI9F 1A72A 5L3QA 1W73A 2Q2VA 3ADKA 4PANA 4PC3A 3ANTA 5BXQC 3QVLA 3OAAA 3QP9A 1VCOA 1XJQA 3QXSA 1T4DA 4B3GA 3ZV4A 1M6EX 2CE7A 1PN3A 4BFTA 1LK5A 1E2HA 2JFXA 4QYIB 4EGAA 2R1VB 4Q9AA 2DPHA 2YJ5A 3U4QA 3SJ7A 3BWDD 2B92A 1O89A 5IK2A 3IIKA 5CK5A 1I1NA 3BS4A 3FPKA 4JR0A 3JASA 3GP8A 2VAXA 4MA4A 1EJ2A 3TGLA 3GWZA 2PY6A 2GN9A 3WDLA 4YVFA 2NN3C 4P5PA 5BW6B 3E5MA 4EY8A 4LF5B 3O8NA 4QUHA 3KVNA 1T5DX 1MC1A 1MV8A 1Q6YA 2I1WA 3AY7A 3HCDA 1ZGCA 2DAPA 3H8VA 1MR3F 2VUHB 4WOPA 2AJBA 3UAVA 1E1NA 2LV8A 3N2IA 4IFTA 4HXGA 4WJZA 4W1RA 5E7JA 5K3CA 4BLQA 2VLBA 1W35A 3N76A 2Z57A 3T3MB 3WJ1A 4P34A 5HYVA 3JPWA 1XWWA 3DUFA 4PC2A 4ER6A 2FI1A 2ZT8A 3A9VA 3SYMA 1I3LA 3QUBA 3UWDA 4HWSA 1PJSA 2Q3DA 3QG5A 3Q5EA 1NVTA 1OX4A 3ZQUA 4F6RA 1RVV1 1WEKA 4BMSA 2BFAA 2FMUA 4GEGA 4IF6A 4NMWA 1DTWB 3GLHA 4D3ZA 3UJ8A 2DBRA 1ZKMA 3C39A 2BHLA 3IX7A 1M1NA 1BCRB 3DZHA 4IKEA 3SHQA 1T8UA 3DH0A 5E6SA 4CF7A 4OHZA 2YINC 2DH5A 3FM9A 2HA7A 3L82B 1T9BA 3O47A 1ZH2A 4EHNA 2X4GA 3RIGA 2GEJA 4MXDA 3BWVA 4UHKA 3I04A 3QPCA 3HZRA 1H4VB 3RS9A 4DDVA 3ADBA 1N36B 4AJEA 2Q9CA 3WGTA 1XNHA 2XZDA 5HCIA 4I3GA 3RUEA 1GGVA 3JQBC 3SYLA 4M8SA 3PT9A 2XD9A 1DRKA 2I1QA 1SCQA 4MLCA 1B0UA 2B2CA 1TLTA 4EP1A 1TJPB 4CT4B 2DZDA 1F48A 3A26A 3FVRA 5IH7A 4PTLA 3EOZA 1KVTA 1V4NA 3LC2O 5CPBA 5ALEA 4M37A 4D02A 4XVUA 4J6EA 5A6SB 2O8CB 5P8WA 1X1CA 1XQXA 3PC2A 4NABA 1YWGO 4NYJR 1QM5A 4KXUA 2QN9A 3DP7A 4RVNA 4TMYA 1H3EA 1U2GA 1FYEA 5CM8B 2IRWA 4FGZA 2KYRA 4L0CA 4OBBA 8ATCA 5JW6A 3MGBA 3HFSA 3I32A 5DOVA 2FA9A 2XW6A 3AETB 1P81A 4KTVE 1SCKA 1Y1QA 4QOGA 3DDHA 4K05A 4MKFA 1DINA 1MABB 3M6XA 4UFOA 5F78A 3I42A 5EYPA 1E4OA 1A7AA 3IT3A 1FLNA 4OXRA 4S3MA 1TVKA 2KHZA 5K3EA 1AKVA 1YJBA 4UVEA 3LVQE 3DDSA 4FP9A 1OFUX 4QSHA 3N05A 3H3JA 5G02A 3L18A 5I7AA 2OYCA 4RHCA 2QXUA 2QHXA 1N8TA 1FP2A 1T2FA 3OURA 4R2WA 1T2VA 1I4DD 3L84A 2ZRMA 3L8YA 3DMPA 1S8OA 5ADUS 5K4GA 121PA 4M53A 1L7RA 1OXSC 2PA0A 3GA7A 3K1AB 4FOPA 5AI5A 5IKMA 2VYCA 3GYBA 3OWOA 2PU7A 2XGGA 4L7VA 2Z2KA 4RMIA 1V95A 1VM6A 4WKPA 5F2EA 5B57C 4K9OA 5HGXA 4EB8A 3F6EX 1C8LA 1T2AA 1CR1A 4EQ6A 3KQUA 2G82A 5LD2B 4B3DA 1SG9A 1TL7C 3I83A 3GC6A 4NU0A 1VPDA 4M9UA 3UHFA 3DOEA 1APBA 3KL2A 4J9VA 1IOVA 3D0KA 3WXBA 2JLWA 3Q9NA 4LAFA 3HXMA 3VSAA 3GPIA 4DC1A 2RGAA 3B36A 1WSAA 1LVGA 1N6PA 2QNIA 3GPCA 4KB5A 4WKOA 3RR2A 3AH8A 5HHTA 4LYYA 5FYDA 2CB9A 3JQGB 1M0SA 5F3WB 3T1TA 2CCJA 2ERYA 1I3OA 2P9FA 4GKAA 5IBQA 2RE8A 5BORA 3EZ2A 3F47A 3DOJA 3JR3A 4Q00A 3BSSA 4ITVA 4TRNA 2FQYA 1H93A 4JFRA 5JLJA 1SC4A 1X94A 3HKBA 1VSVA 4P08A 3OM1A 4FOTA 2IYQA 1RM5A 4LOLA 3ZHZA 2HBQA 1N8KA 4U5QA 1M54A 1E66A 1YGYA 1FTNA 3OJ0A 3U39A 4CIDA 2PV7A 3E7PA 4NU6A 4QGSA 3PQ5A 2NTYC 2YJ3A 3DV2A 5GONB 1OUMA 2PAAA 3GL9A 4C0LA 1SZDA 3WRWA 2QU7A 1Z8DA 4S1PA 3EZXA 2X41A 2VKTA 1AKUA 4QPJC 4CTNA 4UEJA 1QIKA 1HETA 3A7DA 2ORYA 1D2HA 2QENA 4AWXA 4CM9A 3IR6A 2IPNA 3MGCA 3ZU4A 3A9SA 2QDKA 3BFVA 3IBCA 4RVHA 3UTDA 4K26A 1FUKA 2AFIA 3RJTA 2EJTA 5AI8A 2WSSD 1N9ZA 3KETA 3OZBA 3HSYA 5IM4F 3EOAI 3TB6A 3TLJA 1BE1A 1QQ6A 2PSHA 1XZCA 5TV2A 1H1LB 2IUUA 3QF7A 4IZIA 2BUBA 1E3LA 4WFQA 4IV8A 4C4YA 1Q7TA 1X1RA 2F43B 1RC0A 4FD3A 3STWA 3IMGA 4DG5A 3HSSA 3VC1A 1FY2A 2YW2A 4KIWA 1K06A 1UBGA 1BIFA 1VPTA 4FEEA 1VHTA 4PYNA 4B80A 5AM3A 2DPGA 4B8WA 4K86A 3JYPA 4K28A 4UMFA 5HM6A 1ESDA 4KFCA 2VP4A 4B3HA 2ADMA 1FBTA 3E8SA 3MAAC 1SVOA 2R79A 1JHXA 2J5KA 3WLAA 1PK8A 2I7TA 4NEQA 2X7HA 1E7MA 3EMBA 3E53A 3ESYA 1WVGA 4FLFA 2Y0BA 2G5TA 4MHOA 3IILA 4JHLA 2AR0A 5ALZA 1N77A 3PNBA 4LVNA 4P4SB 2ET6A 3DC2A 4I4NA 4B5KA 1NBEA 3G2QA 2MYPA 5BW5A 1KQ3A 3BYZA 4MB0A 3D3WA 5C4GB 2JCSA 1TVCA 2YWFA 4PZPA 4URVR 5HIJA 1K66A 1KAGA 2PWPA 1JB9A 1P0PA 4BQNA 1NU8A 1TRHA 2JBAB 4TKUA 3ZHYA 2WJVA 3V1KA 4AECA 2FSUA 2GA8A 3DJFA 4KXVA 3NWBA 3SZ3A 2B94A 3NALA 2CXTA 2HBRA 2A9JA 4P3YA 3ETHA 3V46A 3K0CA 1B6SA 2WZBA 4BV2A 1SKYB 2OV4A 4CKCB 2I2DA 4GW3A 2IODA 3KWFA 3LFHA 2PVSA 5C31A 1WZUA 2ESRA 4AZSA 4UZEA 1ZI9A 2J41A 4WNIA 1C7RA 3GLIB 1XXHA 2JW5A 1JJ7A 1WXXA 4U7WA 4I99A 4WFIA 2IY7A 3HWRA 3MRSA 1Z4KA 1EEHA 1F06A 4EHHA 5DNCA 5FH9A 1NVMB 1XA3A 1ZNZA 4OJKA 3K8YA 3LU1A 1GL9B 5LZ7A 5A5VA 5LYJF 3QEMA 4R2LA 3K5HA 1X9GA 3G0CA 2WMNB 5KX5A 1G8JA 1DADA 2QE7A 4LJ4A 2QGFA 2TECE 1U11A 4W9NC 4NENB 1DAOA 5FOXA 1AH2A 3FZNA 1DX9A 3P2EA 1DKMA 1NRIA 1TMGE 1NX9A 1VHWA 1WXGA 1HQKA 2RBKA 2W6MA 2E4ZA 1KRHA 3B1XA 3H5AA 3R20A 1N6RA 5B58T 4CEHA 3DZDA 5DASA 3R6TA 5DLYA 2HU2A 2J07A 2PGAA 4HB4A 3AM1A 1FUUA 2VDKB 1RBMA 1DRUA 3K1JA 2P5TB 4PSKA 5EXPA 1Q1ZA 4GQAA 1G21E 4Q7EA 1UT5A 5J4HA 3EW7A 3OEWA 4HWTA 2DSNA 2C9BA 3I01A 4H4EA 4NZZA 3PR3A 3RRBA 2X6RA 4KI0A 4O2BF 3ELUA 3BE4A 2HJGA 2I6XA 1QE3A 2HREA 3GG2A 2W2QA 4P3NA 4U7TB 2H5JA 2DBQA 4H0NA 2OTCA 4NAHA 4TXLA 1N0HA 4CLRB 3AU9A 5FKJA 2SKEA 5BV8A 4RV4A 4KEAA 4V2UA 5F5XA 5KNDD 4I81A 1S8NA 1IBLB 3LXRA 2RHDA 1JEYA 1XNJA 2CHFA 1B7GO 3DZIA 3RK0A 1GPDG 1BN7A 1G5FA 3A0UA 3CKLA 1DX6A 4PBRA 3KJFA 5D1HA 4ZGBA 1QHXA 1SD5A 2OGSA 5EIAA 1SVUA 4Q4HA 4FGSA 1TOAA 4QZVA 2QPTA 1SY7A 2P3SA 4Z9FA 1MJFA 1QR2A 2TMDA 5KSPA 5EHXA 2I3BA 4BEJA 1I7SB 1O08A 4M21A 1GUZA 1L4HA 1U6KA 1U7HA 3EXIB 2JCVA 4Y1EA 1QYDA 1ZJYA 1QHSA 2K4MA 3RUHA 3BREA 1R2QA 3S8MA 4BO1A 1PCXA 4PBSA 5E4YA 3VPHA 2Y6UA 1A9RA 3VNQA 1CRQA 1R12A 1P0IA 3OEHA 4YREA 3RUCA 1XNGA 3O3CA 3OOJA 1N6NA 2FEWB 4YMTA 2P6MA 3PX7A 3LBFA 3EGIA 4JLDA 5CVEA 2VRCA 4QE3A 5CVTA 5EJ5A 1Z73A 2GPYA 2Y9MB 5ALLA 2X0EA 4WCFC 1TCBA 3TNYA 4RS3A 2PXHA 4YFYA 5TQ2B 1U9IA 3FR8A 3ACCA 1VPLA 3T1YB 1WKCA 3C7TA 3I73A 1RI5A 1V48A 4WDRA 5IW8A 4KRFA 3HR7A 4YACA 3IEIA 4RD4A 1SCUA 3RU3A 1K0UA 1I4WA 5KWSA 1YKGA 5I7OA 4BMNA 3I9V1 2GR9A 4R8RA 3GRFA 2WYHA 2GBFA 2BE7A 1ULTA 4PG7A 3TTYA 2IU4A 4QRDA 1C7ZA 1RWMA 5AESA 2GCPA 2F1HA 4M7WA 5A4DA 5JH7B 3OTIA 1NSFA 4RVSA 1IHXA 1E2NA 1L4NA 3FWZA 4X1OA 4DUPA 3O8OB 5EJFA 1FRQA 1U8TA 3L9WA 3MD9A 4NP6A 5EWJB 1XE3A 2BMFA 2FZLA 4HEA6 4Y0NA 5BXYA 1NWCA 4JYZA 4CHGA 4BFUA 5SZIA 4JSYA 4ZZIA 1SVLA 3SBEA 1USUA 2WJHA 3RAJA 3SS7X 4YRBA 1C1XB 5CLIA 2AG8A 3FLAA 2XIQA 4YWHA 3LUBA 2V7QD 5FUQA 2V98A 2DERA 1NLUA 2NT4A 5FOUA 3UAGA 4FNOA 4UW9A 3OZXA 5IF9A 2H1HA 4BCDA 2WUFA 3IVXA 3ONEA 1UWCA 1XD8A 1AHIA 3F7MA 4RTPA 3Q2IA 3CUTA 1MH1A 3TJRA 4UZFA 1VLVA 5LP1A 4GPIB 5AVKA 1NXSA 2UYOA 5E4FA 4HNQA 3UZUA 1YL5A 3VJMA 5FBVB 3NTXA 4DBLC 2VUUA 3IODA 2WKRA 1QMPA 5KO2A 2AW5A 4X3CA 3RT1A 3QPVA 1V16A 3GQVA 3K4PA 1B43A 1IXKA 1V47A 3GLKA 3K30A 1GUFA 3M4ZA 4HB3A 1WVIA 1H2YA 2XMDA 2YHIB 3ZGLA 1C5KA 4EMBA 4M1YA 1JKXA 3RODA 3EIXA 3B89A 5JCOA 3TZCA 1JI0A 3V2UA 3FGNA 3FRHA 4Q3KA 5FHQA 5BO5A 2HV8A 4KYTA 2GF0A 5D1NA 3RFXA 4PM4A 1WB4A 3WLTA 1O94C 2A84A 2KI5A 4OP1A 1I7DA 1JXOA 3R2JA 1S1MA 3O9ZA 4YJKA 1MGOA 2OZVA 2V45A 5SY6A 1NBMA 5CH8A 2PSSA 3C70A 1EUYA 1E6UA 2D2EA 1BMDA 4GS5A 3ESCA 3H2ZA 1MDBA 2EZ4A 4QECA 3UPDA 2H4FA 4G5HA 2ZUVA 2P7HA 3F8TA 5AVVA 3A4YA 1VG9B 4AN4A 3NHRA 3LBNA 1UP7A 2G04A 1FS5A 5TDHA 1UANA 2FW1A 1CY1A 1Y7LA 1I1OA 1NA5A 2GCGA 2JIPA 3GFBA 3WDMA 1XB2A 4C0BA 1QFMA 2R97A 4A73A 1DUIA 4XVCA 5ETJA 2PRKA 4NFYA 2ECFA 5JBIA 2EARA 4AIRA 1P9RA 3WWZA 1UM9A 3SDSA 1JPVA 4OHYA 1CQZA 4ZU1X 3QELA 1HLPA 2BP7A 2XADA 3N58A 4LQ4A 3AM4A 1P2GA 4CG1A 1I3KA 4EKYA 2WIKA 3LT5A 2CDAA 2ZRPA 2XPCA 4RZ2A 4WOJA 1G4HA 4IZHA 5EPUA 5IYZF 1A88A 3WK9A 2OQ2A 1H0KA 3X43A 3UMRA 3M9LA 2A1UB 2QMHA 2DXIA 1HV8A 4K6OA 2MSLA 2CK3A 3EIOA 4MVJE 1PDOA 1RE1A 4B6OA 4LXTA 3JWEA 4Q1BA 2HSGA 1OHHD 3UMBA 4LV8B 4ZU3A 4F2WA 5C9ZA 1CZLA 3HDJA 1AQIA 1PSDA 1V8ZA 4E2ZA 5BNZA 1X92A 4J1QA 1VJ0A 3K5WA 4KV7A 2V4ZA 4LBZA 5CCDA 2WWWA 1NQXA 2VQ3A 2QD5A 5HIIA 4KPFC 5F73A 3ZHSA 1QJCA 1V2HE 1E18A 2P2ZA 2HK7A 2Q3MA 4WLFA 3ZWMA 2HK9A 2IHJA 4CDGA 1UMCB 3TPFA 1J2EA 5I4BA 2JIBA 1ZA1A 1GITA 5F2OA 1ADGA 1J4AA 2F9MA 2RHBA 3I09A 1YS2X 5D51S 2ZZNA 2JHAA 4PLTA 4G1UC 1RFGE 4WA7A 2XDAA 1HT0A 1Z16A 4LE2A 4LOHA 1ODLA 2AV6A 2XXJA 4HH0A 5AMXA 3KHTA 3TW8B 2A59A 2H2DA 1A96A 4DG9A 1WSWA 1OGYA 3PFIA 3HC7A 3V1NA 5IFKA 2QYTA 3DLPX 3KG2A 3A3NA 1TZ2A 3E4CA 3GJ6A 4P32A 4V0MA 1T8SA 2Y2VA 5H82A 3UHOA 2PX2A 2G5PA 3SHOA 3L0OA 3A1DA 2G25A 1RRMA 2N1MA 3LYHA 1XL1A 2O0JA 3MUEA 4EHAA 1Q7BA 1WW3A 3BJIC 4L0QA 2O50A 4Y9RA 4WN9A 5B7PA 5FDFA 1OIVA 2ZT6A 4KE8A 4WKNA 3LRTA 3WB2A 5C5DA 3GAFA 2XZOA 2JPDA 3VNUA 2H11A 2QTFA 3FPSA 3LRPA 1HBJA 4EHBA 4MARA 1BAPA 2CL7X 5FRDA 2UV8A 3QKRB 4RGYA 1IHUA 1WUKS 4AZVA 3MGKA 2NPOA 2XCRB 2P30A 5FL7A 5IARA 2VNHA 2X5OA 2KX7A 4FQ7A 3TN7A 1E9VA 4EHIA 4ENWA 3GLHE 3CB4A 3HLTA 3OE4A 4ZI5A 4U2CA 1NR5A 2BWJA 1PL6A 1XTJA 1W87A 4GRIA 3P9CA 1X1BA 3E9MA 3PQ6A 4ZYZA 1XKXA 2JANA 1VSQA 3HXLA 3ACDA 1F0KA 2AMVA 4UAGA 2JLAA 4M8IA 3AR6A 3DZBA 3PQCA 3O1LA 5T57A 4CMJA 5BWNA 1N7GA 3P94A 4TWBA 4IIJA 1WMSA 4YAWA 1R6BX 1ESCA 5H3LA 3UY4A 5B3LA 4ZO4A 3EXHB 3E48A 4OMDA 1ORIA 2ACWA 4ZODA 4CEIA 3IQWA 2PGDA 4BQPA 3CA8A 5CRIA 2V55B 3MC1A 1XPJA 3L6RA 2VZ9A 2PU5A 4NZPA 4QJ4A 1W0KD 2YNMC 4PWYA 5F7OA 2P2DA 5KVQA 1H2FA 2YZNA 3DFIA 3RTGA 2VWQA 4H3VA 1HE5A 4YT4A 5A4KA 4WLEA 1PZGA 3VPCA 3WI7A 4BFXA 3BD9A 2MR5A 3EHEA 5K6RA 3HE3A 4XJXA 3PQ2A 1HI9A 1UINA 1I5RA 2QY9A 2COEA 2RSLA 2YJGA 3G6WA 4H3KB 2V54A 4TLAA 1A9PA 4EX6A 1ORVA 3V8RA 3E7XA 5CITA 1XZLA 1XZMA 1OXBB 2FNAA 2LWIA 2FWIA 4PC1A 4DYVA 3FHJA 4ZYUA 5JNLA 1KERA 3L6UA 4U0KA 1KK1A 3VPGA 2VJPA 1ZCAA 2OHHA 1TZKA 3ZY3A 2BKXA 4MPDA 1QQBA 1YU6A 2I03A 3P9NA 4OQFA 5FF9A 2GSDA 3VR3A 1NFQA 3EDQA 4QXPA 2D1RA 3X2FA 1GAQA 3TVDA 5GADl 4NMHA 4UTZA 1KWKA 5FUMA 3EPKA 5GGYA 4YJFA 1L7AA 3VYVA 4ZHQB 1TZCA 3MWDB 5FT9A 4ZQGA 5AKGA 4DR2B 3UMMA 1WG8A 1AB6A 3CQ9A 4TUYA 3K9WA 4CG0A 3WV5A 4OHCA 1T5LA 3PHLA 1NVAA 3WLQA 4HPJB 3WMEA 5B1YA 3M1AA 3WGOA 3ICWA 4IJMA 1ZD1A 3UMFA 1G18A 1AXGA 1O57A 1Y80A 1MIOB 5BRNA 1RLMA 1HH4A 2W90A 2ZWMA 1UQRA 1Y1PA 3HN7A 3LNTA 3R75A 2QORA 4N5DA 4UOZA 5JXJA 1C0LA 1WDLA 5JADA 4HDMB 1O2DA 4KL8S 2FG6C 1MFZA 3I9LA 3FF4A 4CUKA 3VKWA 2R751 5HBRA 5IKPA 1KAMA 4OXQA 4Y1RB 2VKQA 1XQYA 5EP2A 4W5QA 4MW1A 1OI2A 5EEGA 4OSOA 1GP2A 1THMA 1NW5A 1OZGA 2I2CA 3COZA 2GRAA 4HQ0A 3G8BA 1C4XA 4X64B 4FDAA 2CFTA 3WIEA 4AF7A 5JY1A 1V1MA 3N2YA 1EWKA 1U5AA 1PSZA 3AHCA 1AUPA 4G09A 1HRKA 1MB4A 1JU9A 1TQ8A 3BSWA 1W0JD 3GV0A 4MRMB 4HS4A 1ONNA 5KI6A 2P6PA 1G19A 1QQ7A 1BQ3A 1V6CA 1Z25A 4IIYA 3O83A 2HUNA 1PQWA 3EXFB 1AGRA 3EGDB 4G3XA 4FFVA 4PNPA 4CF3A 4EJSC 3UJCA 2D00A 4HDKA 2B0CA 4N48A 4AZTA 2G40A 1XAHA 4CGZA 1M2VB 3P4UA 2XOXA 2DQKA 1TCVA 4PLVA 2HMWA 5T4EA 3WBJA 2Q49A 3KLNA 2BGWA 3I39X 1NVGA 3R0QA 4Q3CA 1P80A 2V4UA 1UQUA 1LC0A 5HE8A 2EU8A 5MFZA 5JJIA 4N8DA 4CIXA 2PRSA 5AQEA 1FDUA 1YFLA 3BXXA 1FP4B 3QHAA 1O5OA 2VTEA 5FI3A 1YO6A 4BYGA 1XCLA 3NC0C 4Q7KA 3ZWBA 2VP5A 2NSLA 3A36A 2PMEA 4EMSA 1GL3A 3F1KA 4L8LA 1E2FA 1KC3A 4FFNA 1NJFA 4UC0A 4GRAA 1R4NB 2NU9A 2PN1A 1LKZA 1LQUA 2WTMA 1LNSA 1V1JA 4ADSG 4RQAA 1U1GA 1QF7A 4GI2A 1P1KA 3AF1A 5HF6A 3WRYA 3CWQA 1FX0A 4ITUA 4KWEA 1NR1A 2ZQZA 4RFSB 2IV2X 4K9QA 2GB4A 1D2GA 5LYYA 1UBUS 4ARSA 3TO5A 3DLTA 2A5GA 1PGPA 3X1XA 2X1MA 4H4CA 2J3HA 4XTCS 4MKHA 3AFMA 4AY5A 3AUJB 1O54A 2FN7A 1NW7A 3R0XA 2G4CA 2OHFA 1LA2A 2YMPA 3NOVA 5D85A 1R9GA 4ZCQA 5EP4A 1X7ZB 4OK3A 3SEAA 1X9HA 1AU9A 3H0CA 1MOQA 1WZ2A 5EOVA 4OQXA 3TRHA 2ZITA 4J0IA 1Z2AA 4BNFA 1BH2A 2ZEJA 4CLXA 2Q4TA 4M88A 3TSAA 1T9GR 2YDYA 1G8PA 3SQOA 5E2IA 2PRIA 3W2TA 3LC1O 1QGOA 1DLIA 1UBFA 2OGUA 2CLOB 3CZPA 4KBFA 4TKLA 5B55A 4NH4A 1B0PA 2ZRKA 4FFMA 3D5QA 1Z4MA 5FWNA 3AEXA 2CL6X 5DBFA 1U28A 3O8OA 4MO2A 1KZHA 3HWSA 1KI7A 4O1IA 1UBSB 2NQ2C 2VNJA 5IS2A 4IP0A 4RXMA 1I2MA 3TZBA 4MMXB 2BF7A 2BEVA 3ZWOA 3W6NA 4HNSA 1PK7A 4RE6A 5FUYA 1J0DA 3BIFA 3O4RA 4U6QA 3KLMX 5AKEA 1R8XA 2IY8A 1PX0A 1NXPA 3RUFA 1J1UA 5AVOA 3SM3A 1L7NA 4BQRA 2GD6A 4HP8A 2Q3LA 3KPJA 4Q82A 4ZN6A 4N76A 2VXCA 3MWEB 4XB2A 3TCNA 2WKQA 2NLOA 2AC7A 3QIVA 1SK9A 3Q85A 5F3RA 1NG9A 1Y33E 1N2EA 3CR3C 3QKSA 1IEWA 2AJCA 1XRMA 2P9ZA 1PWZA 3DMTA 2EGUA 5CTAA 3W2EA 3WL5A 1XXHE 3HL4A 2ZRAA 3UCFA 2HV9A 4BJ3A 4LBVA 3LX4A 5ALTA 3QLUA 4QJ5A 2OB2A 3RSOA 2AFHE 3NRCA 3SJUA 1VPEA 1W5FA 1KXJA 3CINA 4UVDA 3SNHA 3PJFA 4KYUA 3ZKAA 2FLKA 3WWDA 4E2YA 4E21A 1LSJA 3IUEA 4QDUA 1HDEA 2DFNA 3ANSA 4WL0A 3JSAA 1RAEA 3V4SA 4ZJUA 1ID8A 1QIDA 1ORHA 1Z4IA 2HSJA 4AXXA 2X1VA 4FDTA 1X42A 3A3OA 3P2OA 4LTMA 2K87A 3KZVA 2FJUA 2JVJA 5AM2A 3ZHVA 3IP1A 2WICA 2CUZA 2EX1A 8MHTA 5JJKA 1P9OA 2RIRA 4G07A 2XYPA 3K9QO 4LIPD 3R76A 2O5CA 4RETA 5EJ4A 2UDPA 3VPDA 4U7DA 1DNPA 4I4CA 4TKVB 1Y89A 3QIAA 1C7QA 2P1DA 4ZARA 2OPHA 3IEMA 1HY3A 1RZ3A 1D4FA 3GDFA 4QBTA 3HG7A 4ZZ3A 4D92A 3AMVA 3RW9A 2O2IA 1PE0A 2WINI 4O33A 5CD9A 3K05A 4XQ0A 3D7RA 3FNRA 2ZRQA 3PEVA 4S1TA 2I8AA 4HRXA 4ZOEA 1EBUA 2PG3A 1E7YA 4XSVA 2NYVA 4D46A 3SEZA 4FI3C 2R7MA 2JA1A 3A1TA 2YDXA 2VF8A 2WIFA 2GT1A 3QEOA 2C59A 3H9CA 4JLBA 4ZPXA 5I8PA 2X5XA 4QODA 4IPTA 3K9HA 1EWRA 2FJPA 4YUXA 3ELYA 5JFGA 3ULKA 2XTZA 3GDGA 1TFRA 1C8VB 1DSSG 2C7QA 2Q29A 1OT5A 2VDJA 1LK0A 2PL9A 4IDDA 3TLXA 2PE5A 4TXJA 4D9FA 3N8IA 2GN0A 4IYJA 1XU9A 3BIJA 2H0QA 4D2IA 3ZLUA 3EBPA 2HK6A 2WG0A 4NOMA 4ZANA 4UHBA 5T6BA 5K0EA 1Z2PX 2NOAA 5DHAA 1W5BA 3O91A 2I91A 2D5BA 2FPOA 5GJWC 2F3QA 2P3QA 1Y8CA 4N8SA 1G59A 1QHNA 3EASA 2R9VA 4KXWA 1FPMA 3H9JA 4RJIA 2NTJA 4NY1A 3KJIA 1CZKA 3BC1A 3O8QA 4HWKA 3ZX5A 4BO8A 2D8MA 5E2BA 2HY7A 3KFXA 3F96A 5KNCD 1YQGA 2JGFA 3D0RA 3GJSA 4LY0A 1WDWB 4HX2A 1C1DA 3GEDA 3NTVA 5IPFA 2X13A 2W8BB 4F4UA 3ZZ1A 2Z5VA 5D84A 2HMAA 3OQIA 3UXYA 3ZWYA 4MV7A 4MUAA 4CKXA 4A3SA 2Q4DA 1AKEA 5EJ9A 1WEHA 3M49A 3O3OB 3JQ9C 4WOBA 5EP3A 4MYRA 3RSFA 2R6AA 1G64A 1RBQA 2BGKA 3OU7A 4Y2GA 5J5CA 5BYJA 3UKOA 3H17A 4ZT5A 2A0XA 3VR0A 2ISCA 4PG8A 2WFMA 2GXSA 1EHYA 3RUPA 4OU4A 4PIPA 3NDJA 3RJZA 5ENVA 3IEPA 5CB4A 2HT6A 4KQFA 1SR8A 2QLMA 2JJQA 2ONCA 3HJBA 3M6MD 3DUWA 4R05A 5BSEA 1X3SA 4OX9Y 1FMLA 3GUUA 4N5HX 3QUSA 1G20B 4UAVA 4JEHA 1Z6AA 1NC1A 4R1TA 4U63A 4YTEA 1PR6A 2V74B 2ZI3A 1JHZA 3B1ZA 3C6BA 3GDWA 5D3MB 5LKRA 2BYTA 3K9LA 2B7CA 5IULC 4EARA 4ZYYA 3E5RA 2IEIA 3J81k 1T9GS 4XDGA 6REQA 5HXAA 3EAQA 3H0KA 1LJ8A 3AL0C 4WGGA 3VSCA 2PNFA 1DQZA 1U31A 5CVUA 3JD1A 5COAA 2ADOA 5ECGC 3ZOKA 1FYWA 1QE5A 4FEGA 2C4NA 2Q27A 1P31A 4ZEOA 5I9LA 2DETA 1QH8A 1X7HA 2PUJA 4RQTA 2ZIXB 3RS8A 3G6KA 3HVJA 3IURA 2QAGC 2XMBA 3CEPB 4C05A 1LS1A 2X1LA 3URMA 1BMFA 3A32A 1Z62A 5AI6A 1C41A 1Z17A 1VI5A 3FTQA 4I1UA 1XCPA 2CE2X 1IG3A 3AY6A 3TINA 1SAYA 3PI7A 3VVBA 5KDDA 1QTRA 2QX9A 1WWKA 3S1AB 2YJ4A 2AF4C 4CQMA 2GKSA 2VC2B 2GPWA 3G2MA 1GCAA 3R23A 5C4IA 1GY8A 2NYRA 2WNHA 3BE8A 4PAWA 4I7EA 3LKVA 5C5CA 3P9ZA 4DCVA 3ZE9A 1DC3A 1KEZA 1NBME 2VJLA 5C37A 5JC1A 3BJEA 3QXGA 1E0JA 3A25A 4H6XA 4ND5A 2JLRA 1KBZA 1FNSA 4E33A 2D5AA 5LSAA 2HMUA 2VBGA 3T4EA 4MWDA 5FULA 3B52X 3RVOA 1MMFB 3D43A 3U48A 4UM9B 2XUKA 1R3UA 3H3XA 4J75A 4LNAA 1I8TA 3L0SA 5KQGA 1BN6A 3FYSA 1D6SA 3O94A 4DJEC 4IH1A 1VKJA 3CKMA 1UWLA 3O1HB 4BN4A 1LTKA 5L6LB 4ARIA 1I94B 4JJFA 4XX1A 3EWAA 5J1TB 4N7BA 3JQAD 2ZPTX 1VIMA 4ID9A 1PZMA 4MDEA 4KOEC 3ADDA 2ACKA 4ATNA 1DJQA 4NYJQ 1YT5A 5HKBA 4E5PA 1FFBA 1XRRA 3OZVA 1Z3IX 1ZAYA 3OFSA 1NDHA 2IU6A 4E94A 2OOSA 2C2BA 2H59A 5K99A 1OJLA 3CRRA 1R4MB 1WBBA 2JS7A 3LPNA 4S35A 5D5HA 4DLWA 3VZDA 2XCSB 1C3VA 3PNKA 2JC3A 2I6QA 3ICVA 4E1BA 5CLJA 5K6AC 5F7ZA 1H05A 2XB8A 3T35A 2P4SA 4GR5A 1IAVA 5BN5B 2R8OA 1MEOA 4KAAA 1L5LA 3AEUB 2EOAA 3U49A 1UQTA 8OHMA 3CUUA 2IKSA 2CHUA 1DBVO 2XNCA 4JXKA 3UCEA 5JXGA 1GLVA 1E2JA 1Z5WA 4GRDA 2H57A 3V7YA 1E2QA 1QIHA 2G0NA 3HI6A 1I5OA 2Q2NA 4C04A 3D5EA 3W3AA 5C52B 5ALKA 4DIKA 1TU0A 2BUAA 3GLQA 4ZEMA 4DDWA 1R0YA 3DLHA 1X7DA 2BHSA 2WKWA 4X71A 2VT3A 4MAFA 1Q0SA 1ECLA 2VTKA 3FCAA 4IIEA 4LYFA 4B4KA 1E2KA 3AU8A 3NKVA 1FYVA 5BOSB 1TM2A 1Y3CE 1E63A 1XYVA 2NZWA 4B34A 1JAZA 3EQ6A 1U2QA 3B3GA 1OZAA 2O1EA 5COQA 3EXEA 4TXMA 3BXOA 1WZEA 3QLEA 2Y76A 2O0LA 1MX1A 4FYXA 4PLCA 4BVEA 1XCJA 3EDOA 4HEQA 3CEJA 4M0MA 1ZL2A 4OGLA 3RYIB 4JJEA 4DMCA 3FDZB 1OVMA 3CH4B 3GI1A 4BUJA 3TOXA 1PEAA 3KSMA 3U17A 5KNBA 3BT7A 2LCFA 1UAAA 4RDIA 5LQCA 3SXUA 2RHCA 1SBCA 1KYIA 1HWYA 3VYSB 3QBEA 3I9JA 3W34A 2O8BB 4KLZA 2G5GX 1G8YA 1JQJC 3FTPA 3OFNA 4Y9SA 3QV2A 4XD7D 4KH1A 2OO7A 3DO6A 1Z22A 3WO0A 4JI1B 4EBBA 4UNRA 4FFLA 1SHTX 2YXDA 4UTRA 1HK7A 5CDGA 3N39C 4CEJA 3R9WA 2EEPA 4MS3A 5EJ8A 3G2NA 4KH0A 1FZQA 5ADWA 3TG8A 4Q1EA 1DFHA 3LX8A 2OLJA 4C0XA 2OCGA 1TIBA 3BWXA 1XMVA 4C87A 2BMDA 3II6X 3CVVA 3OCUA 3AVOA 2AL7A 2PKXA 5KAPA 1VHDA 4ZVQA 5G3ZA 2QLLA 1WBDA 2FR0A 4H17A 2WF6A 1XTPA 4F1JA 4URZR 1RPJA 1QGUB 4QOSA 1KOFA 5BYBA 3MRTA 2DKFA 1XDWA 3DOIA 4AZ0A 1P62B 2KWIA 5G0UA 2ZUBA 1EHIA 3IE2A 4DV0B 1ZD9A 3LPMA 4JT2A 2HCTA 5FTWA 2VSFA 2IU3A 1Q20A 3CZ5A 1A9SA 3F9RA 4HZGA 4WA8A 4XYLA 3DAOA 4BVJA 1ORWA 5KYXB 2NU8B 4ND2A 4L7QA 4LXUA 5EFZA 5HA5A 3SKYA 1VQ1A 2DM6A 3UQZA 3PD1A 4GQIA 2YVKA 3AIOA 4F6RB 3GLGA 2ST1A 3REFA 4DIFA 3SIXA 4PR0A 4W8GA 2EW8A 5LIRA 2F62A 1PDVA 3QXCA 4II7A 4JQCA 2C8VA 1KXZA 5ERYA 4B17A 1XZAA 4Q15A 3VR5D 1EFVA 1K1EA 2FMHA 1JYFA 4M9QA 1PV2A 2BFBB 4POAA 4UTNA 1AO0A 5HP4A 1F2TA 1JFTA 4L78A 4J7XA 2CHQA 1WQ1R 3Q0IA 3EIEA 4HJRA 5C1BA 4ARZB 1D6JA 4DJAA 5HSGA 3LGXA 4UMDA 4X66B 1PQ4A 2AHRA 3CONA 5D3ZA 2ZUEA 2ZWAA 3F49S 3LZCA 4GUDA 3JWHA 1WCIA 3WYDA 1Y6FA 4P86A 1ULAA 4B32A 5KPJA 5G0WA 4G85A 4OA5A 1CD5A 2HJHA 2TYSB 3PG5A 4RD2A 2I6TA 3ESXA 3ETNA 1P9WA 3O21A 2IWRA 1QIGA 4N3GA 4A16A 1M2FA 2ODWA 1D1QA 2PGOA 4BWVA 5IX8A 4E7OA 4XGKA 3HK2A 3KEFA 1W1UA 4WBNA 4D96A 2B4AA 2XCIA 4HZUA 4M60A 5EHNA 5TVGA 4BRZA 1LBIA 4C20A 1RWNA 2AOWA 4XUEA 4KQEA 1ZEJA 3EG5A 4AQ7A 2YMMA 1FRNA 1I30A 4F71A 1KS9A 4GZMA 4P53A 3HVRA 4OJTA 3UWSA 2J9XB 3RVDA 4EHFA 1WXEA 2OFXA 1OCEA 4BAUA 1IVSA 2PZLA 4YAEA 5A1TA 4BCCA 5ALIA 4LC9A 1KRXA 4YBZA 2OSVA 2QDXA 3B78A 5JAHA 2GLXA 3B38A 3DPIA 4J0DA 2JJ1A 5E6RB 2HDHA 3QNUA 3Q6IA 3H13A 1JS1X 2JLVA 2ZYGA 5DZSA 1WR8A 3CWZA 2GN2A 2EP8A 3LQRA 4IEFB 4NX2A 3TL3A 3ZPXA 2UU9B 5KWVA 4FE7A 1Y8RA 2A94A 4QGBA 4N41A 2JGRA 5EY5B 2IGBA 5BVHA 5LZ4A 3HJRA 1XJ5A 1KFEB 4MWGA 2H48A 4Z53A 3AKYA 4E11A 2YX1A 1X86B 3IAAA 5ALGA 4AW9A 1IB0A 2JKZA 3HBFA 4B81A 4E5KA 1A5TA 2CXHA 5TSDA 4BO3A 4EUEA 5DSXA 2BFWA 1AMOA 3G23A 2XQFA 2JGLA 4H0CA 3IERA 3ECSA 5TQJA 2O06A 1YA8A 3ZEIA 1E61A 1H0RA 4B09A 3TZ6A 3LDHA 1HFWA 4WW0A 4DLAA 4DY6A 1Y7HA 3OCVA 4QQ8A 3HM2A 3W5CA 2XR1A 5FPTA 5AVJA 5AVYA 3HQ4O 3TJMA 4BB6A 1E3QA 5EE1A 3EG9B 1JTEA 2JATA 3K16A 1XZBA 4O3MA 3ORHA 2EAUA 4JXJA 2BBOA 1T9HA 4M1Z