4JSTA

Structure of clostridium thermocellum polynucleotide kinase bound to utp
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
171
structure length
171
Chain Sequence
SMKLTIPELSLVVLIGSSGSGKSTFAKKHFKPTEVISSDFCRGLMSDDENDQTVTGAAFDVLHYIVSKRLQLGKLTVVDATNVQESARKPLIEIAKDYHCFPVAVVFNLPEKVCQERNKNRTDRQVEEYVIRKHTQQMKKSIKGLQREGFRYVYILNSPEEVEEVVFERQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metallophosphoesterase
publication title Structural and biochemical analysis of the phosphate donor specificity of the polynucleotide kinase component of the bacterial pnkphen1 RNA repair system.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Transferase
total genus 64
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 2.7.1.78: Polynucleotide 5'-hydroxyl-kinase.
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jstA00
3SJAA 1G7TA 1RYHA 5L3SA 2VP2A 3QI2A 3C4JA 3MSXA 3I92A 3ZD7A 3HP1A 3AV0B 3GLGE 3SQWA 1EG7A 1SKQA 4M1MA 1Q22A 4WBSA 2VYFA 4F38A 4XH9B 1P2UA 2IC5A 1B0UA 2RH5A 5DGXA 1D5CA 1D9XA 1EFRD 4GZLA 3KB2A 1AGPA 3CNNA 4NCIA 1SKYB 2NG1A 2HT1A 2BMEA 2QPAA 5JJLA 1E9BA 4UKDA 1PJRA 2IYVA 1Z5ZA 5KNDA 1IY1A 1GNPA 5HKKA 1XTRA 2GWHA 4OJQA 3SZRA 4MDEA 1OIVA 5TY0A 2ZETA 3K0FB 5DI3B 1CULC 4B33A 1ELOA 1YJ5A 5FBWB 3LD9A 1NSTA 1GRNA 2ZPTX 1XXHA 3OF5A 3B1ZA 4NYMQ 1HV8A 1MH1A 2ZUDA 5DSZA 3QOFA 4B3DA 3ZZTA 1NRJB 3CIOA 4E03A 5JRZA 4DLZA 3W90A 4MYTA 4IJMA 5FL7D 2KBFA 2QM8A 2IS6A 1R4AA 1SQ5A 2J0UB 3ZQJA 2GF0A 1T3SA 2VSOA 2WVJA 3QE0A 4MKIA 4EPVA 2R9VA 4GP7A 5AUNB 3CRVA 2CCGA 3UXMA 4LWZA 4BQSA 2WMNB 4G5RA 1FUUA 4P33A 4WW0A 4KCGA 1D2NA 4ZIRB 1AKEA 3SJZA 3S1AA 2G83A 2G1KA 1UKEA 4TMKA 4BFVA 3LBNA 2ZM5A 5TMPA 1SGWA 5JWOA 3B82A 3KTAB 2XZPA 4BLSA 1W4CA 1AZSC 1NBMA 4RD6A 1COWA 4TLDA 1OFTA 1U90A 3VR3A 3QF4A 2OLJA 3T1TA 2LWIA 2JDIA 4MGIR 1Z29A 4AG5A 4Q1DA 2F1IA 3QUSA 4HDCA 1MABA 1Z28A 3TIFA 2V6JA 4HZIA 5GJBA 3SYNA 3TQCA 5BXQC 1MO6A 4XIGS 1HTWA 2ZR0A 4PC6A 4XSHA 3PXGA 5KHOC 5EE3A 3GLFA 4DC9A 4GSYA 2AD1A 3PUZA 4I1SA 4ZPXA 4KFRA 3ZZUA 1Z22A 1F48A 4W9MC 1J7KA 4Q00A 4CEHA 5TXGA 1E9EA 4LDJA 1VYTA 1U2RA 2GEUA 5D3QA 5P21A 3W6NA 4JBWA 2R6DA 1P4SA 4N0EA 1M6NA 5E7JA 3L0OA 3L0SA 5J4VA 3BFXA 2WWIA 3V4FA 4EIWA 2IA5A 1U8ZA 3W8RA 3AM1A 3OE7A 1W49A 1G1MA 2ATVA 2BMJA 3K9NA 1CIPA 3K53A 3VKGA 5HPYB 4HYYA 2J3EA 2ZJ2A 2FFBA 4L5BA 3RC3A 5FTMA 4JBYA 2DBYA 2D74A 3QEOA 4LPKA 1G3MA 3EC2A 3D7MA 4YQFA 5FPHA 4YMTA 4BFTA 4D2IA 3H84A 3IEVA 4AKGA 4RFSA 4LHZA 2GJKA 3CF0A 2P5SA 4P31A 1OXSC 3WXMA 4C9BA 4EQ6A 3VKHA 2ZU6A 5JBQA 3B78A 2XZOA 1Z0IA 1C4OA 2Z43A 5L3QB 3SJCA 2Q3MA 4X8LA 5EZ5A 3GP8A 3CKLA 3CX7A 2ZRPA 5LBIA 2JLVA 1PLKA 1JR3A 2BBWA 4Z51A 5FI0B 5KDDA 2R8RA 3EPLA 4KLNA 3EA0A 2G1JA 3TJZA 3VKWA 1N2CE 2C9OA 5LB4A 4IFBA 2GAAA 5EXXA 1NP6A 4OL0A 1YU9A 1IQPA 2QP9X 2WWYA 1KGDA 3U2QA 3I5XA 1Z83A 4B3CA 4LJ6A 3NTUA 5EP2A 1YR6A 3DM9B 3RRMA 1GL7A 121PA 2JASA 2QP3A 3K70D 4Y0AA 1GDDA 1OKKD 3ZVNA 1DADA 3KDSE 4DSNA 1C1YA 2JJ1A 1US8A 1S96A 2EWVA 2R65A 4EAQA 4URXR 4ZKDA 1K5GA 3BH6A 4NYIQ 1U98A 5B2ZA 3UMFA 4Q9KA 2DFTA 4KBFA 2XOKA 4DZZA 2FNAA 3T5DA 1XTSA 2H57A 1XD2B 4RD2A 3NC1C 3THWA 2JLYA 1E0AA 1CP2A 4GL2A 3FVQA 1LB1B 2ERYA 2YINC 2ZUBA 4M1TA 1KO1A 5D3MA 4HB2A 2ZJ8A 4CRWB 2Z83A 4DT1A 5JECA 1FMLA 2LCFA 4RZXA 2GNOA 2JA1A 1XEWY 2WJGA 3EG5A 2BVNA 2ZI3A 4L4UA 2CCJA 4LHXA 3NBFA 2TMKA 3R7WB 1XCMA 2ZSFA 4FXPA 4OI2A 2YOHA 1NMZA 1AQYA 1CRPA 1JECA 1TMKA 4D81A 1EWQA 1LFDB 1M2OB 4LYFA 2IEYA 1GOTA 2XEXA 1WE2A 3KX2A 4TZ0A 1YHNA 2C03A 3LA6A 3LH5A 3LV8A 4PAOA 2A2ZA 3CPHA 4MA4A 3B1YA 2F3TA 2ZRHA 1GVNB 4DLVA 1EESA 1P7CA 5GJVC 1S4QA 3BIFA 1LS1A 2F55A 4TL6A 2GZDA 2VSFA 3D31A 2EWWA 4NYJQ 5BN4A 4PXAA 2ZYUX 1BYUA 2WSMA 3AF0A 4LV6A 4EPTA 6Q21A 2D4HA 2WIAA 4GOKA 5KSOA 1OH7A 2OAQ1 2GTPA 4XVQA 5E4FA 2HCBA 1A2KC 3P4YA 1IONA 4EJSA 1PZNA 2HV8A 3PV0A 3JZMA 4Q4JA 4TYQA 3CZPA 2QGNA 1RYFA 2W00A 4O0MA 1UJ2A 5CDFE 5LB2A 1KOFA 2VO1A 4GNKA 4MQBA 2H7VA 4Q1BA 3DL0A 4HATA 2GXAA 4I1UA 3U3KA 3WMGA 1W0KA 5C2JB 5DYIA 4HLUC 1N5IA 1S2MA 1PUIA 4JJZA 3K70B 2REOA 1M34E 3GPLA 2FJUA 1UFQA 1SHZA 3PVSA 4PPFA 2O8FA 2PJZA 3IHWA 1XZQA 1G8PA 2F1RA 3KKNA 3HYTA 4LJYA 1NMXA 2IYTA 4M21A 4BRUA 2HYIC 5F9HA 4I81A 4PC7A 2Q0HA 3BRWD 3EARA 3KJGA 2PBRA 1G9XA 3UANA 3BB4A 4Q21A 3TSZA 4XWKA 3SQXA 1WA5A 3MMPA 3PITA 3E2IA 3PCRB 4LUCA 621PA 4KFSA 3GJ3A 2BM0A 3GLHA 1Z6AA 4R2IA 1NY5A 4NZYA 4A2PA 3W6OA 2HUPA 2VF7A 1NVXQ 2GJAA 1AIPA 3W34A 4M9QA 3SR0A 3PG5A 3SJBA 4KVGA 1NL3A 1ETUA 1U94A 2A9KA 1UBFA 4PANA 4QRHA 1XD8A 2C9CA 2FA9A 3FMPB 5F2EA 2ZE5A 4BEBA 1AN0A 1N0WA 1F2TA 2Q21A 1EFUA 5LD2C 2FPMA 3NXSA 4B74A 4B47A 3AVPA 2V3CC 5DO9A 4HUQA 2BV3A 4HB4A 4B43A 2W6IA 1EFCA 4DLRA 2OEPA 1RFLA 1XEFA 2HLDD 1HT1E 1JQJC 2FPKA 2ZSAA 1Z0KA 4LHYA 3ZYCA 1ZM7A 2UKDA 1ZU4A 1Z6YA 3K9LA 2IW3A 1YZKA 1Z0DA 3CW2A 5FOTA 1TNDA 1PUJA 4G5SA 2DR3A 4D4JA 4AI6A 5G3YA 3HYRA 1HA3A 3WHLA 4NDZA 4XWOA 4D4KA 3IIMA 1CR1A 4H9GA 1J2JA 1W0JD 3GLIA 4C0BA 1H8HA 2I3BA 4ASUD 5DN6D 5GJCA 1P61B 3W9YA 1SULA 3HU3A 4PQRA 5EUMA 1T4GA 4QL3A 2HDNB 5B57C 1CS4C 3KUDA 4JLNA 1UKYA 3BD9A 1OXUA 1XCGB 2F1HA 3RLFA 1V43A 3T34A 3WMEA 4DEXA 2OSBA 4G5GA 2UZ3A 1GRQA 1VG0B 3GEEA 3AF4A 2QZ4A 4IW3B 3CNLA 4JVSB 4LRWA 5FBLB 3BFKA 4JLAA 4K8OA 1OXTA 2IYYA 3C14C 2WKQA 3OIVA 4OHYA 1BO6A 5EUQB 5BYJA 4C0AC 2REXB 5LPNA 2E1RA 1U99A 3JZAA 2XZLA 1E4VA 1N25A 2K5UA 1QHSA 2BM1A 4G3XA 1BOFA 1NJFA 4R98A 1X8KA 3K0CA 1TEXA 2LKDA 1XDBA 1GTVA 1QVAA 4M9XA 3ICQB 4XWAA 4RD1A 3OHMA 2O8BB 3OAAD 2AL7A 2ZE7A 1S9HA 4Q48A 4V03A 4HAZA 3RSLA 1KAGA 3LBHA 1J8YF 2PT5A 3ZH9B 2V1UA 2VF8A 4MKHA 2YC2C 1X8LA 4Q9LA 3ZS9A 4ABYA 2W6JA 1A5TA 1XTIA 1DBSA 1KI2A 3AP3A 1LF0A 4XVRA 2HJVA 3NEYA 2O0KA 1LV7A 1N6HA 2XNDA 4UJ5A 1WBBA 3ICEA 4Z1MD 1FQKA 1CJMA 1E79A 2OM2A 3QG5A 2WZQA 3IUYA 2HXYA 2PX0A 1G3QA 3QBTA 1G3UA 5CM8B 5JZVA 4AK9A 4B32A 1AGRA 3THXB 3ASZA 2OE2A 4PQFA 3I1FA 3QSYA 1DAFA 1OYWA 4B6FA 3WYFA 4AG6A 3GQBA 1WDTA 1T9HA 2A7QA 1K8RA 3WP1B 3L2OB 2W83A 4TL9A 3PUYA 4UNQA 4XD7A 1MV5A 1X3SA 2JJ8A 1OFHA 4RY2A 4C3ZA 3CH5A 1UKZA 2L0XA 5FPSA 3IQWA 2P6RA 4PPQA 1JNYA 2ZJYA 1E1RA 1R0WA 5H8WA 3LO5A 1VCNA 4C0JA 1SXJE 4QJ4A 4MYHA 1RRFA 3U3JA 1TPZA 3JVUA 5CYOA 1JXMA 2VRWA 4CEIA 3A1SA 1LTQA 2QP4A 2D7DA 5CITA 5FOSA 1Q1QA 4LBVA 5FOUA 3PR1A 1MRSA 2DPXA 5L3VA 1IAQA 3Q7PA 2GJSA 5FH9A 1JJVA 5AUPB 3U4QA 1T0HB 4FWIB 4LBYA 2ONJA 2JIZA 2IT1A 2VL7A 4TTQA 3QKSB 4GMXA 4M1SA 2BOVA 4NTZA 3KJHA 4Q9HA 3AVTA 2A5JA 3CRQA 1KKMA 4F93B 4ZDKA 1P2TA 2ZRFA 3FDIA 2H8KA 2WKPA 3UG6A 1E2PA 2J0SA 3LQRA 4CF7A 3C5HA 1I4TD 3HR7A 3DZDA 4IOMA 4AYTA 4C0HA 3IO5A 3MWJA 2IXGA 4LHWA 4I99A 3NBZC 4LGMA 4PAMA 4Q4HB 3MRSA 1KY2A 5FR1A 4ACAA 2CNWD 3WRYC 2PZEA 2RAPA 2CK3A 4IEEA 4TYNA 2Q9CA 3QVUA 4LX0A 5C18A 4BEJA 3OIUA 3ADDA 2AX4A 1CJVC 4OQXA 4GFDA 4YMUA 2BIFA 2OBMA 1JPJA 4YMSA 4AIIA 4B73A 1W4BA 4O2LA 1A4RA 4KV9A 1VCOA 1FX0B 2J7PA 2ZITA 2GESA 5BN5A 5KSPA 2OHFA 5FBVB 4GOJA 4CZ2A 1AS0A 3W5JA 3OFNA 1RVDA 3LX8A 3QEJA 1YRBA 1HE8B 1RIFA 1VECA 4H1VA 4PC3A 2W0SA 2VLIA 3B6EA 2J7KA 1VIYA 3FGNA 1K5DA 2FOLA 1OF1A 5CM9C 3AVXA 3V9PA 1Z47A 4F91B 1ZVQA 3K0EA 1NG9A 2A78A 2IF0A 1T8UA 2G0TA 2QE7D 1U0JA 3GEHA 2CJWB 3SE0A 3REGA 1JR6A 3R9XA 2XJ9A 3IILA 1G21E 3AF3A 4JLOA 4AC9A 1NF3A 1OIWA 1SXJB 4NYIR 3OEED 5FFMA 1RW4A 2PLRA 2J46A 3L8YA 3U44A 1GITA 3VU9B 5G53C 5JMTA 1TUIA 2EFGA 1E9CA 1XB2A 3NWJA 5C4GB 1R5BA 3FHCB 4JVNA 1NVVR 3ADBA 1M7HA 4CDGA 1GWNA 4RZ2A 1YZUA 4BZQA 4MRRA 1G7CA 2ZI6A 2P3SA 1QBKC 3PEVA 3TK1A 1SHKA 1CRQA 1UF9A 2ZIAA 2IUUA 2GEDA 2FSIA 1G64A 1IN6A 3A6PC 2FZ4A 1H8EA 1G6OA 3VAAA 1FP7A 4HB3A 4HZUB 3GJXC 2OLKA 5FTNA 3FFAA 2W2TA 1GNQA 2WMOB 3L0IB 2ORIA 1BS1A 2P65A 1D8TA 1OXXK 3Q5DA 1E94E 5SZHB 1NKSA 3I61A 4DUGA 3HPRA 5BYKA 2JLUA 4B2IA 3K0FA 3HPQA 5DI3A 4A2QA 2NOAA 2GEVA 4NHOA 1YKSA 2PCJA 3I5YA 1DAKA 1L7VC 3QKRA 4EJSC 5ANRB 2XXAA 1P5ZB 2GAOA 3VFDA 3R8CA 2IYLD 2O8EA 1QHXA 2F6RA 3U6KA 1S0UA 1BMFD 3R9IA 1U8AA 1ODFA 1YZLA 1TQ6A 4NYJR 2J0UA 1E9RA 1E2NA 4ARZB 5JEDA 3PEWA 4PPGA 1S9DA 1WRBA 4R7ZA 3T1OA 5M04A 3FKSA 2ZRBA 1F5NA 5L8VA 2ZS7A 2Z4RA 4TT3A 4EKDA 3N2EA 1X1SA 2ZRDA 1E96A 1QRAA 1X1RA 1XTKA 3W5IA 1I2DA 4WVFA 3L0PA 1HT2E 4HAYA 1KSFX 2KJQA 4C7OB 3CRRA 4JKIA 2WAXA 4TSFD 3AUYA 3EIEA 2ZXUA 4GOXA 4OK5A 1OHHA 2WPDA 3KTAA 3AKCA 1KDOA 4IHQA 1J90A 1QVRA 4PPNA 1R0YA 2C2HA 4FMCB 3VR6A 4BUJA 2EW1A 2VTKA 3GCGA 1G6HA 2V8OA 1L2TA 4BASA 3KB1A 4PO1A 1DO2A 2ZEJA 3TSWA 2QAJA 3B8HA 2QRNA 1OH6A 2YNMA 2Z4SA 4DKXA 2JLZA 5F3WB 1NIJA 3U7GA 1NN3A 4CIDA 1VMAA 2R6FA 1A1VA 1TL7C 5TVKA 1FTNA 2PEZA 4I4LA 3FMOB 3TE6A 3B5JA 4BPBA 3SNHA 1U9IC 3P32A 2QORA 1WMSA 1G16A 2RCNA 1PVOA 1C9KA 2WWGA 1XPUA 4TYWA 4LJ5A 2X2EA 4MGYR 5TB5A 4KVAA 4IXNA 1EFRA 4M2LA 1XXHE 2HJGA 3TUZC 2XTMA 4A36A 2ZYVX 2QPOA 4X8OA 5AJYA 3UWOA 3BORA 4LBWA 1II8A 4JLVA 4UNSA 3L8ZA 4P32A 4PHTA 1QHHB 1OSNA 3CF2A 2ZYTX 4TQAA 1Q3TA 1KAOA 1N6LA 2OAP1 1E98A 1GM5A 1XNJA 4DDWA 3BB3A 4FI3C 1E6CA 1S1CA 2QAGC 3EIHA 5DHAA 3SOPA 5FL7A 4D0NA 4IDPA 3VHXA 5DI9A 1WF3A 3TAHA 2X8AA 5GVSA 5K8IA 2OBLA 1E0JA 4LJAA 1P72A 2C95A 2CEAA 5L3QA 1DAMA 4MRNA 2IX3A 2KE5A 1VCIA 4A1FA 1XEXB 1NBME 1KTVA 3QXHA 3MJHA 2P5TB 1OFIA 3ZIAD 1NN0A 1W46A 3FMFA 4OQFA 2N42A 1COWD 3GJ6A 5CB8A 2ZRMA 2VHJA 221PA 2OCPA 2KI5A 3EWSA 4NMMA 1HQYE 1MO5A 3U6BA 1CTQA 1IOZA 2HF9A 3ADKA 8OHMA 4ILEA 2J87A 3GLFE 1KMHB 1EFTA 4ZCLA 3RHFA 1HURA 3K0CC 3RABA 2BKUA 2GF9A 4Z8XA 1T0JB 1AM4D 1DEKA 2QTVB 2C8VA 5EE0A 2OZEA 3A8TA 2EQBA 4U7DA 4UJ3A 4E07A 4O3MA 1NN5A 3A1TA 5KSYA 1QG4A 4BZPA 4FCWA 3U3RA 3GLGB 1GKYA 1CJKC 4B71A 4QHYA 3TSOA 4DLXA 1KJZA 2E9SA 2Q3HA 1U0HC 4DLYA 1GRRA 5GVRA 5JWHA 3G0HA 1L4UA 5CYPA 4HAUA 1E2JA 2GXUA 5C4MA 5FI1B 4A9AA 2QMUA 4HLQB 4B35A 2B8TA 5K8UA 2NGRA 3OEHA 1N6NA 1JI0A 1YZGA 2R44A 1XD2A 1HY3A 3HWSA 4QBGB 2IYZA 4LJ8A 1ZNWA 3AF2A 3AVYA 2F43B 2DHRA 3ZDQA 1E2MA 4DLUA 3CR8A 3P26A 1N6RA 2ANCA 3QKUA 1RE0A 3EPHA 4U02A 1KKLA 4JLKA 1W2HA 3GMTA 1XJCA 2P6NA 2DFLA 1R5NA 1N6IA 4BFWA 4WOPA 4URVR 5JJIA 2O8DB 2UZIR 4QGGA 2C5LA 4DIDA 3R7WA 4N1AA 4F4JA 3MFYA 1CU1A 2IS2A 4JMPA 4WXPA 3MAAC 3IEUA 1KK2A 3FHOA 4TTRA 3QF7A 1WBDA 2IHBA 4DDVA 2OUKA 5KYKA 3HU1A 1JEDA 5CIWA 1JR3E 2FPLA 1DAGA 4P4UA 1X8JA 3CUEF 2Q9BA 4LJ7A 2YYZA 1KO8A 2XTZA 4WXRA 3QG1A 4LYJA 3S1AB 3BC1A 2NO6A 2IHYA 2J45A 4BLOA 3V4RA 2FU5C 4LI0A 5AJXA 1T5LA 3BK7A 3B2EA 4FD2A 4RKEA 2P6UA 2QA5A 2ZJBA 4NKRA 3IO3A 4FW9A 2H17A 2Q6TA 2QENA 4XOIA 2KB0A 1P9WA 2NPFA 2JLQA 4F7WA 4C2UA 5AUQA 5IT5A 2J0QA 2ZSEA 2ZSDA 1T3HA 2R6GA 2GVDC 4WA7A 1MABB 4D26A 4DSTA 2GETA 1JAHA 2AD5A 4OI1A 2ZVPX 4A15A 2C78A 2VIIA 1MKYA 5FPTA 3THOA 3LBIA 3I32A 3EIQA 4PZZA 3DVLA 4KYIB 4POAA 3QIAA 1F2UA 2OFXA 1UEIA 4HDQB 1OKKA 1WP9A 2A5FA 4QBHA 1FOEB 3DPUA 1F6BA 5IRCD 3B9QA 3LLUA 3V00A 1JPNA 4JIMA 1NVVQ 2NO0A 5F9FA 4JVLA 1RJ9B 3BH0A 4JS0A 2WHXA 4FWTA 4Q7LA 2IWHA 5EXTA 3QPUA 5IK2D 4HAVA 2A5GA 2QY9A 1KI6B 4KAXA 1DG1G 4TQ9A 4DXAA 3KKQA 4M4SA 2OXCA 3ND8A 3KQHA 4XTRA 1XJQA 1ZW6A 2AR7A 2HT6A 2ZS9A 4JT2A 4EFNA 2O0JA 2JJ2A 1JEEA 2FG5A 3VNUA 1R6BX 2FFHA 3NKVA 2JLWA 3A1WA 1QHIA 3FE2A 3AF1A 3I3SR 3RRYA 5HR5A 4RFSB 1NIPA 2GXQA 4EQ6B 3MD0A 1FMJA 2JGNA 1QZXA 2X2FA 2EFHB 4QJ5A 1ZCBA 2R62A 4JLPA 1MO3A 3A1UA 5FOWA 4IRUB 3CWQA 2PLFA 3X2SA 3RDPA 1DAEA 2NMVA 1ZD1A 2QSYA 1TEVA 3D8BA 1M1YE 4JLBA 4DEYA 2CHVA 1W5TA 1Q57A 2QSZA 3DOFA 1FZQA 1W36B 2C98A 1NVWQ 4DCTA 4L15A 4M22A 4A2WA 2NQ2C 1AKYA 1X86B 3UPUA 2FX3A 3CWZA 3U61B 1UBEA 4CYMA 3SHFA 2QTFA 2ODNA 3GJ8A 4LPSA 2SHKA 3PQCA 3AB3A 2JCSA 2ZROA 2YOFA 5TARA 1ZBDA 4PHFA 3T1VA 1R8SA 4YXWD 2VP0A 4OHVA 4PC1A 3EWAA 3KJIA 4TTPA 4EPXA 1TUEA 1R2QA 3U7EB 1TAGA 2ZRLA 1Z63A 1G8HA 2CL7X 3N5CA 2PT7A 2F1JA 1G7RA 1G20E 1NLFA 1TU4A 1U0LA 5FPYA 1JQLB 1Y3AA 4EUNA 4UQOA 1TF7A 4DLWA 4QGAA 3GLHE 4QFMA 1G18A 5AJWA 2W58A 3LFUA 3TVTA 4DJTA 4JYBA 1G19A 2D62A 2WJJA 3THWB 3CPEA 4US0R 5JCPA 3K09C 4G0NA 2QG6A 5CB6A 4LOAA 5D3MB 1K6MA 4RZUA 2NPIA 5EE1A 3ZJYA 1RPZA 2QEQA 5A4JA 4A4DA 4TLAA 4CW7A 1AK2A 4LSGA 3MCAA 1U9IA 4URZR 1E99A 2O8BA 1E2QA 2GXSA 3TUJC 4EDHA 3K9GA 4G5QA 5HCIA 1JB1A 3QXJA 1IXSB 1VCMA 2GJ8A 3T5GA 5J4HA 3OESA 1DE0A 4ZKEA 2D3WA 2ZJAA 4FMDB 3AKYA 4Q19A 5BQ5A 2B92A 3RNLA 5KNBA 2I1VB 4D25A 4Z54A 2G77B 3ZVMA 1EXMA 3RS0A 2ZI4A 3RS2A 2XX3A 3RSOA 2CCKA 4PO9A 3AKEA 2W6ID 3C8UA 4OJKA 2WWFA 2YKGA 3TR0A 5IF9A 2W0MA 1CR0A 3JVVA 4L9SA 4Q9IA 1X6VA 3GD7A 1E2GA 3CX8A 1P62B 1J70A 4LJ9A 3K8YA 1U8YA 1ONBA 2BBOA 5J4YA 4NCHA 3WNBA 4IDHA 1R5OA 1T8TA 2IBMA 3EX7C 1ZINA 3Q85A 3THXA 3GLIE 1DTSA 3GJ5A 3LXXA 3MWLA 3W6PA 4B44A 2QAGA 2ZRJA 2H92A 2ECKA 3U7FB 3GFTA 2LKCA 3ZD6A 2KSQA 4Q47A 4GI7A 4BLPA 4OQMA 5JWRA 2IF2A 1S3SA 2P67A 3ND9A 1W0JA 5CIQA 1NMYA 4GPTA 4ASUA 4KHZA 5DN6A 3EAQA 4B75A 4D82A 3CRMA 1KK3A 3MWYW 4MKGA 3T1QA 2ZRNA 3IPXA 4LC1A 4D4MA 5J47A 4X8MA 4MYCA 3BB1A 2IYSA 4V0MA 1S8FA 1Z2AA 3I4LA 3PEYA 4BGDA 5FTLA 4V0ME 5AR1A 3NG1A 2VH5R 4A0GA 2RGGA 2GK7A 4YLGA 2Q9AA 4EFMA 1HUQA 3VX4A 4LZZA 1QDEA 2QU8A 2ATXA 1ZUIA 2ZR9A 4G5OA 2GILA 2QT1A 4A92A 1EX7A 1JJ7A 1YR8A 4QKQA 1KMQA 4R9UC 1KI3A 1CJTC 3Q8XB 3DMNA 2PEYA 3FFBA 3QKSA 1O87A 3C15C 2FH5B 2X77A 1E1QD 1R8QA 1E2DA 2D7CA 2GRJA 2AXPA 4Q66C 4QG7A 3WNCA 1H65A 2V9PA 5K8LA 4CT5A 3B9PA 4DDTA 3ASYA 2V7QD 4FMCF 1TQDA 2ZRCA 2VP5A 2RKOA 4X8HA 4YC7A 1J8MF 4IFEA 4M1WA 2QMOA 3PUXA 2BJWA 3NBYC 5JFGA 3UIEA 3OAAA 4Q1CA 2V1XA 1OPXA 1F2TB 2BCJQ 1KIMA 3E1SA 4Q1AA 4OBEA 1IBRA 1L4YA 1DARA 3CR7A 4K81B 3TAUA 2ZTSA 2WV9A 1T6NA 1ZM4A 3ZQ6A 1ZM2A 2F3RA 2GHIA 2HEIA 3CF6R 4PSVA 3RANA 1FX0A 2A3RA 4MH0R 4KI0A 2O8CA 4DCNA 2QNRA 2ODEA 1FUKA 1P73A 5UKDA 5GADl 3VNVA 4KYUA 3GLIB 3RWOA 3O8RA 3FPAA 4M53A 3NHAA 3K1JA 1XZPA 1NSFA 1SXJD 1GP2A 1ZUHA 2BHRA 2ZJ5A 3G82C 3KXKA 3P1JA 3RS5A 4MRVA 2MSDB 2EFDB 2W2VA 3T06B 3CPJB 1MOZA 2CLCX 2NZ8A 5JSZA 2Z5FA 3QXSA 4LCBA 3TVDA 5JEEA 2CJWA 2F9LA 1W44A 2BEKA 4R2HA 2H5EA 2PZGA 1VKJA 4BFSA 2DCUA 3WRXC 5EJEA 1ESNA 4QGHA 1KI7A 4U00A 4RD3A 4J0QA 1LF5A 3NH9A 4V0OA 2BWJA 5TV2A 4C0SA 3KXLA 3RRNA 3UK6A 4NCJA 4IDQA 4Q01A 3VU9A 1TTTA 1KI9A 4OK3A 3TR5A 1NN1A 4MITA 1CJUC 1E9DA 2VP9A 1CR4A 3C7KA 1G291 4FN5A 1CR2A 4A0HA 4AYXA 1SVSA 2CBZA 2FFAA 4DSUA 3BXZA 2XSZA 3OIYA 5J4LA 5FUWA 2QI9C 4LK2A 5DIFA 3THYA 2WJHA 1ZM9A 1N5LA 2IYWA 4O2RA 3CH4B 1OXVA 1P6XA 1P75A 4F92B 5AWFC 1IXZA 2CNWA 2Z0MA 1GKUB 3KKPA 1PLJA 2MSCB 4M1YA 5FL3A 3O8CA 1ZD8A 4LV8B 1Z0AA 2J7PD 1UBGA 3DMDA 1RRCA 3F0TA 5JS8A 4A8JB 3RYTC 1N0UA 4KFTA 3EZ7A 4L16A 2WOOA 2ZQ5A 2WTUA 1E4YA 2GCOA 1FL9A 1UBCA 3AEZA 4JT4A 1KK1A 1IM2A 4OHZA 2QBYB 3M4YA 3TKLA 4P4TA 4HUTA 2I1QA 3H0KA 2WSSD 1Z0FA 5JHHB 1OH8A 4C2TA 4ZV4A 3K70C 4H1UA 4A82A 4DCVA 4PR0A 3B85A 1XCPA 4DCUA 5EP3A 4KXFB 3C16C 4I1VA 3WNDA 3F3YA 1CLUA 4HEJA 1MO4A 5J4KA 2QM7A 1ZRHA 4C7OA 3KFVA 4CEIB 3C41J 4RD0A 1SVIA 2VHTA 3LXRA 3K0AB 3CONA 2QE7A 1N5KA 2IUTA 2NZJA 3FTQA 4RCZA 1VG8A 4US2R 3LVQE 4P0TA 5G41A 1HEIA 2CHGA 5KDLA 3T35A 1G8GA 4P3YA 3U4QB 1N5JA 3BE4A 3DKVA 1ZC4A 4TMZA 5FR2A 2IXFA 3LLMA 3OEEA 4TMWA 3SS8A 1DO0A 1ZIPA 3NVAA 2OBNA 2HCJB 1LVGA 3ZVRA 1A82A 3UMRA 4Q18A 4ZI3A 2V54A 3BBPA 5BW8A 4B6EA 1SKYE 4GRAA 5KO2A 3RVBA 5JLJA 5C46F 5DE3A 1CKEA 1KZGB 5AUOB 4JZKA 3VQTA 3KQKA 1G4AE 721PA 3I62A 2FDCA 3WBJA 4FCVA 2FEOA 2WICA 1Q44A 3K09A 1CBUA 4CT4B 3NIBA 1Z07A 4D80A 1B23P 2PMDA 3X1YA 1E32A 2RGDA 1QHHA 3PIRA 4RCYA 3ZLJA 3F5FA 2IK8A 3PENA 4AWXA 4OHWA 3KQLA 4DDUA 1OT3A 2RB4A 5CJ2A 4Q4LA 1AS2A 4KU4A 3FMIA 1QG2A 1KI4A 1DOAA 2WJYA 1IY0A 4KSBA 3G5UA 1Q12A 4NE2A 1UADA 5H68A 3DM5A 3FKSD 1KDPA 3TRFA 1BMFA 4TT3D 1TU3A 4ZIRA 5IHPA 2IS4A 4OHXA 2W2XA 1D9ZA 2CVHA 1E3MA 1R0XA 3FYHA 1DS6A 4LC0A 5CLQA 5L3RA 3LQQA 1Z0JA 4Q1EA 3X1WA 4Q7KA 4ESHA 2PX3A 2O0HA 3DOEA 1P2SA 4CEJB 3GJ4A 1XEXA 3QXXA 1I4LD 1LS6A 3T12A 1S3GA 2ODWA 3DZ8A 2ZRIA 4GT1A 2OFOA 4NU0A 2ZVQX 4TSFA 4JLJA 4AYWA 1OJLA 1U81A 2ZAOA 2GK6A 3AGPA 4ESVA 2OCAA 5SZIA 3WYAA 1NNEA 3EASA 1Y63A 4UXHA 1EFHA 2A5YB 2C77A 2XNSA 1XBTA 4ZI2A 1Z2CA 5LDDC 2CLDX 4LBZA 4V02A 4LYHA 3H86A 2BMFA 2R2AA 1V5WA 3QNUA 3FOZA 4BLQA 2WKRA 2QTHA 5CK4A 3IIKA 5HKKD 1Z08A 3EZ2A 3GLGA 3BJIC 1CXZA 3Q7QA 1KYIA 3T15A 1A2BA 1OB2A 4DB4A 1O3YA 3AP2A 4M1OA 4QNRA 3B13B 2XB2A 3I73A 1XPRA 3CLVA 1XMJA 4UXJA 4JSTA 3BAFA 4NL4H 4Q7JB 4Q4AB 4TQUS 1KSGA 2B21A 3K9HA 2CXXA 4QBIA 5HTKA 1J99A 4Q9JA 2F43A 3SYKA 2AK2A 1VYVA 2WOJA 4BWYA 4OYHA 1SVMA 3MWKA 2VA8A 2VSXA 3N2IA 4KFUA 4AD8A 4CVNA 3K0SA 2DYKA 3QKRB 3BGWA 2XXAB 2DWQA 3KL4A 1OLOA 1Z3IX 3UWKA 5G3ZA 4JL8A 2O8DA 3KKMA 2O8EB 1FP6A 3Q9LA 4B2LA 4TLBA 1OV4A 5E7IA 1ZU5A 1GFIA 2OG2A 1YR7A 5LD2B 2ZUCA 4WZAE 4JLDA 3M6AA 2FV8A 1WXQA 1II0A 1MT0A 1NBMD 2GJ9A 2XITA 3IDQA 3VX3A 5HCNA 3EC1A 2JDID 4NCKA 5E95A 4P4SB 1GAJA 5J5CA 1XWIA 4II7A 4OI0A 1ZMXA 3HU2A 3NH6A 1VPLA 4FMDF 2CVFA 1CEEA 1OE0A 2DWOA 1A7JA 4WZBE 5FBRB 1GL6A 1M7GA 3ZIAA 2RGNA 2QUZA 2BMDA 2YHSA 2CE2X 4QJ3A 5A0FA 4BFXA 1YZNA 2FSGA 2ZAMA 4HDOB 5L3SB 1KI1A 2IYUA 2ZU0C 5F98A 2ZANA 2RGAA 3UG7A 4E5UA 2AWOA 1ZCAA 2ZJZA 2PH1A 2GZAA 2BKEA 4IVPA 1F3OA 5E7MA 4IDOA 4PSKA 3MJRA 2PJRA 2N46A 2OCBA 3RC8A 4D0LB 4IXMA 4BZXA 2X1VA 4ZO4A 2H1LA 1XRJA 3SC3A 1KO5A 1YRAA 3OE7D 2A5DA 2G0NA 5KDOA 1KNXA 3OEHD 1ZIOA 1N6KA 3O8BA 1P3JA 3QQ5A 2VBCA 4URUR 3QXCA 2ORWA 4PZLA 1RJ9A 3DDCA 4B3BA 3SBDA 1XXHB 4OQNA 3HDTA 4C30A 2FMXA 2RGBA 3A1VA 1FW6A 3R8FA 1VYUA 4KLZA 1II8B 1SZPA 1SVKA 3IKJA 3PFIA 1KI6A 4BE7B 4GDFA 4A8JC 5EZ6B 4TMXA 1W2GA 4DLSA 1ZM3A 5KOYA 1I2MA 1N6OA 2IYXA 2JLRA 4ZDWA 4PFSA 3FB4A 5DH9A 5JS7A 2NO7A 3U7HB 2YOGA 1WB9A 3TBKA 1JR3D 1Q1EA 4GZMA 4ACBA 2RHMA 4XVUA 1EGAA 4QHTA 2YC4C 3GEIA 2ORVA 2ZI9A 5H1YA 1KO7A 1XD9A 2VP6A 5CLLA 2ZS8A 3H2YA 5FTJA 1GSIA 2FWRA 1W36D 4BLRA 4FINA 4QGFA 3WMFA 4B3XA 1BKDR 1G3IA 1IJFA 2V4ZA 1N6PA 1SXJC 3QF4B 4KITB 3UATA 1T5IA 3CX6A 4KBGA 4M8NE 2NTYC 1DVRA 3KUCA 2ZR7A 3CB4A 4Q1FA 1XX6A 4QHSA 3O8DA 3LAWA 5JI3E 4EPWA 2O5VA 1OW3B 5K8TA 3VR4A 4HLCA 4JL5A 2JJ1D 3GLFB 1VHTA 4KJZA 1GZSA 2BC9A 2QMEA 2QRZA 2IYRA 1KSJA 3OZXA 5EXPA 2ZE6A 3CO5A 2JATA 5KNCA 2XOKD 3HJNA 3CM0A 3VMFA 1P2VA 4C0QC 2XGJA 1HQCA 4PSAA 4AKIA 5KPDA 4CEHB 1UDXA 1DELA 3FKQA 1BYIA 1RZ3A 4V0KA 4TZ6A 1SVOA 2I4IA 1XTJA 2YJTD 1YZQA 3X1XA 4FIDA 2WJVA 4XJXA 1RKBA 3QVVA 1TQ4A 3DHWC 4WZ6A 4NP6A 1G41A 2RMKA 2YWFA 2VP4A 3W3AA 4S2EA 3J81k 3AVUA 1D6JA 1KHTA 3IBGA 1GL9B 1UDWA 5KUTA 5FPKA 4OKSA 3U3OA 3A58B 1NVUQ 4A6PA 2VQSA 3IHLA 4DLTA 1AJEA 1TQ2A 3W3ZB 2QMHA 2D06A 4OI4A 1RC8A 3I8SA 4YONB 4ZCMA 1TF2A 2JJ2D 4UNPA 5IK2A 1XMIA 3B1VA 4PZYA 3VR5A 1AZTA 1MR3F 1KJWA 5FBQB 2ASEA 5JHGB 4RJLA 5JCZA 2OILA 1IN4A 2XB4A 3SEAA 2G9NA 1EWRA 1XP8A 2BEJA 5EXSA 2YWEA 1IN5A 4YMVA 3D6TB 1NLYA 2JEOA 4XSGA 2J5XA 3PJRA 1GG2A 2KWIA 3WY9A 2JAQA 3LX5A 2Q3FA 3CBQA 2AKYA 2IYQA 4YDSA 3VR2A 2H18A 4C0LA 2R6CA 2PMKA 1TADA 2WWHA 2GBLC 3GJ7A 1OH5A 3NEJA 2PCLA 4TMTA 1E69A 2FFQA 2WJIA 2ZJOA 3RS4A 3IIJA 2G88A 4QXAA 4IEIA 2Z6VA 5AJZA 5TDHA 3RRZA 3TW4A 4JLMA 4G01B 4MKFA 1NLZA 1W0KD 2KBEA 2WWWA 4IOJA 4OK6A 5EP4A 1BH2A 4PC2A 4DHEA 4NBSA 2D2FA 2ZE8A 2ZYWX 4MDFA 4W5HA 4HSEA 1IN8A 1KI8A 1VG9B 4E22A 1AS3A 4KSCA 5CDFA 1US8B 1P9RA 2GVZC 3AVOA 5A5GA 2JLSA 1NKTA 5BWMA 5DISB 3LRPA 1N3BA 3AP1A 4BFYA 1F2UB 5EE9A 1TF5A 1G5PA 4NPHA 4YXWA 4AURA 4BLTA 1DPFA 3TNFA 2R6AA 1ZNYA 3AH8A 4I1OA 4DIEA 1W4RA 2REBA 3L43A 2RGXA 4QNMA 4A0FA 1W1WA 4G1UC 5C1BA 3LVRE 3D3QA 4Q02A 1LW7A 5CK5A 2QROA 4DT1B 1ANKA 4HAXA 3SYLA 4IOKA 4AY2A 2X19A 1DG3A 1JBKA 1WCV1 3C5CA 1E2KA 2ZSBA 2N1BA 2C9YA 3MGCA 2WBLC 2XTNA 3MLEA 4MRSA 2DB3A 3KZ1E 1YZTA 5KSZA 2HF8A 4F4IA 1Q20A 3E70C 3IBYA 1GUAA 5EP1A 3WHKA 3SDZA 1Q21A 1G8FA 2PL3A 1OFUX 2NO1A 2J41A 1DAHA 1F60A 1GILA 1P60A 2EFEB 3LDAA 4EPYA 3NC0C 3U60B 3KXIA 1ZNXA 2VPPA 4M9ZA 3AUXA 1E0KA 1E9SA 3H1TA 2ZRGA 3SFZA 3U5ZB 4QM6A 2IWRA 4GBMA 5IDVA 2Y8EA 4IDNA 3BFVA 3CRW1 3W8NA 1KSHA 4MRPA 5B64A 1ZUNB 3A4MA 3SI7A 3LWNA 4B2PA 2YV5A 1E9FA 1FPMA 1YR9A 4C4PA 2EYUA 3A37A 5EE5B 2HLDA 2MMGA 4XTCS 4IVRA 2CL6X 4V0LA 3B7GA 4ITRC 4DB2A 3AKDA 1H8HD 4LYAA 1NG1A 4YMWA 2CE7A 2EYQA 2AFIE 4PTLA 2EVWX 1GIAA 4IOLA 1M74A 4Q4JB 4V0NA 1N0VC 1VTKA 1YQTA 2ANBA 2D2EA 2ZI7A 3DO6A 3LW8A 4Q5IA 4TLEA 3TQFA 5GJWC 4UNNA 3F8TA 4NH0A 3EA5A 2AN9A 4DWJA 1Q1ZA 3A4LA 1BIFA 2XJ4A 1JALA 2OV2A 4TL8A 5J40A 3EPKA 4URWR 4LJ4A 2BBSA 2J1LA 1PLLA 3EZ6A 2HXSA 5B58C 1W4AA 2FN4A 4D6PA 4TLCA 3KQNA 2O8FB 3CZQA 2FEMA 1E2LA 4QBFA 4HLDA 4WAUA 4BFUA 3LNCA 4JJKA 4WIAA 1I4DD 2HYDA 5HZHA 1M8PA 3BERA 1KDRA 3DEFA 2B8WA 1AQUA 2QQEA 2QQ0A 2OXRA 2FGKA 2J59A 5AJVB 3AVVA 3A4NA 1UPTA 2OFWA 1XTQA 3BWDD 3GLHB 1G7SA 2YVUA 2C99A 2FSFA 3NDPA 3ZZ0A 2ZREA 2QGZA 3KFXA 4HI0E 3R9WA 2V6IA 3R20A 1HYQA 3ZGXA 2J0VA 3UKDA 4D0GA 1E0SA 2B7BA 1G4UR 3TH5A 5BN3A 2QN6A 4Z8YA 3PUVA 2QT0A 1KDTA 4NCNA 4ON9A 2F7SA 3B60A 4OQLA 5FUXA 1G8YA 2W6JD 1VDZA 3BOSA 4Q4HA 3U3MA 1E1QA 821PA 1W5SA 2XNDD 3NHBA 3FHTA 2FZLA 4B3FX 1JXOA 4NYMR 1E79D 3Q3JB 3A36A 4Y0VA 2FE4A 2V7QA 3KKOA 3MUFA 1NI3A 1OB5A 1UM8A 1XEWX 4GMDA 4HUQB 3ETLA 3WYGA 3EZ9A 2A30A 4URYR 2P2LA 1NJGA 5FUYA 4CGZA 1KJYA 4DSOA 2OCYC 4Z1MA 1FFHA 3QBVA 1G17A 2CL0X 2WWXA 4M1KA 1SVLA 1CF4A 2DFKB 3B1WA 3ZS8A 3BH7A 1E2FA 2RGNC 4TN1A 2DFNA 1G3RA 2CDNA 4XD7D 1E2IA 3I8XA 1ZJ6A 4TWZA 4A8JA 1UAAA 4TYPA 2GA8A 5KU1A 2GZHA 1OIXA 5ELXA 4L8GA 3KJEA 1E1RD 4JSYA 3B1XA 3WP0A 2VHCA 4TYYA 3ECCA 2QBYA 2ONKA 2QAGB 2XAUA 2FF7A 5FOVA 2UVQA 3TLXA 4E09A 1ZYUA 1E2HA 1HE1C 4F4CA 3QPVA 4MYUA 4EJSB 1WQ1R 1XMSA 4DCSA 2JLXA 1G5RA 4HB0A 1XPOA 4BFZA 3M0EA 2AHOA 1EK0A 2G6BA 1SXJA 1P9NA 3QJYA 1S1MA 2BCGY 2FSHA 2ZRAA 1HH4A 2JIZD 421PA 3ADCA 2GDJA 1VIAA 1MRNA 4B76A 3TMKA 1RRPA 2J9RA 2YWGA 4RD4A 1ZD9A 2NIPA 2WAYA 3AVQA 3K0AA 1QHGA 2B6HA 2WIBA 2GKSA 3RWMB 3QKTA 2RGEA 4JKYA 1LNZA 1GNRA 4US1R 4IKEA 1KZ7B 3TUIC 1NY6A 4ZDIA 1GKIA 4PHGA 5JJKA 3IQXA 2BDTA 1VHLA 1Q0UA 5AK0A 4JL6A 1IN7A 1XU4A 2OO7A 2CHQA 3UMSA 3GFPA 2CK3D 1RRGA 1XFAA 4LY6A 1L8QA 3PUWA 4HZUA 2XSZD 4B34A 2DWPA 1AA9A 1XF9A 2IUSA 4TMVA 1QF9A 2RHDA 5EQTA 4N0DA 4Q03A 4A0RA 1OYYA 3MG9A 4N3NA 3O47A 1EX6A 4MGZR 1QHYA 1VG1A 5DYGA 5H70A 2B7CA 2CLSA 5CJPA 2V55B 1FNMA 1R7RA 4YDHB 3RAPR 2AWNA 4L9WA 4A6XA 3VR1A 2AFHE 3OFND 1IXRC 1Z6GA 2OESA 2G3YA 2VEDA 1FTSA 1KK0A 4PQYA 3IPYA 1UKVY 4JVMA 4M9SA 1D2MA 1W36C 4AKEA 4MGKR 4RVCA 3WBKA 521PA 3SFVA 1M7BA 3VHLB 3EZFA 4ARZA 4MUBA 1DAIA 1D2EA 4QC2A 3AVWA 2O8CB 1ZAKA 5DNYB 1G5TA 2QPTA 3SN6A 4QOSA 5HE8A 3NDBB 5FOXA 3EPJA 4MUAA 1IJEA 2RGCA 3CNOA 2GCNA 3X1DA 3KQUA 5DHFA 1XMVA 3I72A 4LHVA 1UEJA 3SBEA 4EPRA 4NONA 3EXAA 4PX9A 1W7AA 3L82B 5FUVA 2IXEA 2GBLA 2WSSA 4FCTA 4LV5B 3TW8B 4O25A 2IS1A 2ZI5A 3QPWA 4KODA 3AGQA 4ERNA 1KO4A 5JSZB 3GFOA 4K46A 3Q5EA 4CEJA 4DVGA 1SVWA 4PO8A 1ZP6A 4W5JA 2CMKA 2IL1A 5E3HA 3GJ0A 3P27A 1FNNA 4RZ3A 4RKFA 2O52A 1IY2A 1XJ0A 4S35A 2QL6A 4R71A 3N70A 1FQJA 4PAQA 2C96A 3DKPA 5B30A 4UNRA 3REFA 3PEUA 3SU8A 4D4LA 1Z06A 3ZVLA 1R10A 2WM9B 5FTKA 1H8ED 4TL7A 1ZC3A 3P4XA 5DLQC 1YVDA 1W47A 2E87A 2MMCA 4IVQA 1Z6XA 2AXNA 1E9AA 4EFLA 5KTYA 5HE9A 4DRZA 4HLUA 3QENA 5SZKB 2F9MA 4B3GA 5HZKA 4DUGD 2GCPA 3BS4A 3M1IA 2EFCB 3Q72A 4M0LA 4FMBB 2IEZA 1ESMA 3OIWA 2MSEB 2VHUA 4U5XA 3IGFA 1W48A 4BECA 1QHNA 4RFVA 3EW9A 1TX4B 2VHQA 3THYB 4HAWA 3QY0A 2FGJA 1KY3A 4Q4AA 1R0ZA 3E5HA 2YWHA 4Q7MB 4BRWA 2BJVA 4UXIA 1Q3HA 2OT3B 2PZFA 4RSGA 1Z8FA 3ONWA 2EU8A 3LY5A 4W7SA 2BBTA 2ERXA 4ZCIA 2ODBA 3P20A 1PV4A 2DY1A 4PHHA 2GCOB 4GP6A 4ZDJA 4JYCA 5JI2E 1JAIA 5JRJA 1E2EA 5SZJA 1II9A 4W5WA 1Q1BA 2AK3A 1Z6TA 5G40A 3X1ZA 3TGPA 4B48A 2H16A 1T3LA 2P0EA 1LY1A 2AKAB 3RS3A 3AQ4A 1OHHD 3FWYA 2WPDD 3LW7A 4AKHA 4QM7A 5KPJA 2NO9A 2YZ2A 1T91A 3T61A 4C0KA 4P4SA 4DBLC 3NBXX 3SHWA 2C04A 1YE8A 2ZRKA 3H4MA 3HR8A 3U44B 1IHUA 1ZNZA 1KMHA 3VTKA 4JBXA 1KNQA 4KO8A 3RS7A
chains in the Genus database with same CATH superfamily
2WT4A 1B3RA 1CHNA 1D5WA 1WSBA 5BW5A 1I5RA 1X1QA 3QI2A 3A7EA 4CIWA 1B0ZA 1OAOA 1NVAA 1QJCA 2QW1A 3JQPA 3NOVA 3RUHA 5EHQA 1PTJA 1XLWA 2C58A 3AV0B 3SQWA 1XRMA 5E4YA 1V4VA 2DFPA 2I3AA 2OWDA 1FFWA 3OEYA 4S0XA 4WBSA 1CUIA 3NIDB 1IY9A 4PG6A 1P2UA 3KLPX 1B0UA 4XH9B 1GV0A 1MF7A 5LMZA 1YS1X 2CXNA 4MR8B 2VHYA 1U0TA 3CNNA 3W5SA 2X0IA 3OH8A 2BMEA 1ULSA 2QD4A 4KYVA 4HNVA 5CH5A 2IYVA 1PWHA 4DJAA 3JQDA 1Z5ZA 3IODA 3TN7A 5B7NA 4XGKA 4E5NA 3BUSA 3DYBA 3FUCA 1Z5PA 2F1OA 4B6QA 2V58A 5DI3B 1CULC 5EHIA 1ORTA 1SOVA 4BB9A 4C3UA 1YJ5A 2Y71A 2PJUA 2SKDA 1GY8A 3DW3X 4Q05A 1DB3A 2PGXA 1JVNA 1V5EA 3B1ZA 4NYMQ 5CA0B 4LF8B 4B4KA 3K9CA 1B74A 3ZPXA 2CJYA 3GQVA 4PYQA 6CHYA 5DEOA 1WNFA 1JHAA 1NRJB 5LXTA 2JFGA 2ZWIA 4DLZA 3Q88A 2XRFA 2LW7A 3UUEA 4BCBA 3IP1A 3Q8KA 2IS6A 1R4AA 3ZQJA 1PSZA 2GF0A 3P0FA 1QQBA 1T3SA 2VSOA 3GT3A 1MLDA 1GYRA 3U3ZA 4QUIA 1C7ZA 4EPVA 5BNZA 2QK4A 3K0BA 2C2BA 3BQMB 5LP6C 4XIJA 3CZAA 3HEBA 4CL8A 4P58A 5TGZA 3NEAA 4BQSA 3N2KA 4ZOAA 1JKFA 4CM5A 2A35A 1FUUA 4ETWA 1W87A 3TBFA 1KU6A 4B3TB 3ZE1B 4IKPA 4X7RA 2HFKA 3DAYA 2PDAA 1AKEA 3CEMA 3OPYA 3R3ZA 5DVZA 4D9NA 4EHDA 2G83A 2GLXA 3JPWA 3M6UA 2UXDB 4BFVA 1FMFA 2E89A 3JQCA 2YXLA 1IN1A 2SNIE 4IQ4A 2IXAA 5B7QA 3ETNA 2HLPA 1JA1A 3I45A 1UOOA 3PLRA 5FLKA 5DTQA 2GO7A 1U1DA 1W4CA 1AZSC 2XZPA 4Z3DA 1COWA 4X62B 4GYYA 1U5CA 2E0IA 4MGIR 3FWZA 4UTZA 4HC4A 3KJXA 3TNDA 4E3ZA 5BV7A 3LBAA 5FO0A 1EK2A 5JAPA 4UCFA 2V6JA 3QV1A 3S7ZA 3TIFA 5LWHA 4J0KA 4S1NA 4BTVA 1I3CA 2WNSA 2FRDA 3M70A 2FPSA 1PI3A 2ZR0A 4PC6A 3U4GA 4AP5A 4R3NA 4CM9A 1M1NB 1QLWA 3GCXA 1YRWA 4ZANA 3PUZA 3AI3A 2Z2KA 1C1XA 5DPMA 4QATA 2JAUA 3RUDA 2WTMA 2YMQA 3HU5A 4K9MA 1F48A 1HLGA 3H6HA 1I3MA 1FLDA 2QRJA 4OLJA 2LNDA 3VI4B 1YCGA 4QDJA 3DV0A 4XPZA 3EC7A 1E9EA 1TUGA 2QUIA 3DXZA 3LC2O 4TRJA 4O5AA 2EDAA 6YASA 1JKJA 2ISQA 5ADVA 4Q82A 5P21A 3DZHA 2ZBQA 1RQGA 1P4SA 4N0EA 1M6NA 2CXTA 2GEFA 3AU9A 2VPTA 3L0SA 4GPBA 1PL7A 2ZT6A 5E7JA 4ZU6X 1CZKA 3PHCA 3STHA 3V4FA 5J4VA 4EIWA 3LO8A 4IIVA 1U6JA 1JGTA 2NV6A 3QUCA 1JVBA 3W8RA 3AM1A 1PWEA 1X14A 3D43A 3D6MA 1W49A 2G63A 3HNRA 4G4SO 2ATVA 3NHZA 5IVKA 5FEMA 2OO3A 1DIGA 1Y7LA 3A04A 4L27A 2VJMB 2VUHB 4TS1A 2PUGA 7REQB 2GCEA 4FDUA 4K9LA 2IEAA 5K3CA 2DBYA 3MJ4A 1JP7A 3GOQA 3KL2A 4C7MA 3LPDA 2DBVO 1IHDA 4LPKA 4MWDA 4PTYA 4QJBA 3ZWVA 3QLJA 1T8RA 3D7MA 3H2ZA 3RYIB 3JALA 5DTJA 1TQ8A 3N3AC 4DMRA 3EWNA 4OQ4A 5H82A 1U2GA 3PNBA 4OY3A 4NJMB 4WN3A 1MGOA 4OA8A 3VKHA 3DEHA 5TJHA 1Y33E 1N7GA 3B78A 3OLCX 4OJTA 3DCJA 2BHTA 2A33A 3RD5A 3UF0A 4K9DA 4ZN6A 2J9XB 4WZAB 4Z4FA 1Z62A 1T35A 3QVXA 3U7JA 4BWGA 4DLAA 4KNYA 5FADA 1E64A 1KZ4A 5B53A 2JLVA 1TJYA 2DH5A 2HSZA 2I4OA 3K96A 1FNSA 4KLNA 3ZCRA 4XEHA 1N2CE 5LB4A 4QU0A 5EXXA 3W1EA 1NP6A 4G37A 1KJ9A 1YU9A 5KYUA 2AN3A 2GAIA 4RJTA 2PUWA 2HC9A 2HMVA 1DBWA 3C39A 3AHGA 3HWX1 4YP1A 1Z83A 2HTFA 2TMGA 2AEJA 1XALA 2RJOA 4LJ6A 4NABA 4AU1A 4B3CA 2QYSA 4MI1A 1F4PA 3UAVA 5H9VA 2OGZA 2RHJA 1FLAA 1DWOA 3RRMA 1GL7A 121PA 2JFWA 4EGFA 2QP3A 3ZDAA 4Y0AA 5K9ZA 5KYXB 5AW5A 3ZVNA 1QP0A 1QX4A 3CYFA 3VMMA 3HXLA 4M54A 1C1YA 1UJMA 3RBXA 1X7HA 2JJ1A 2CWDA 3R2JA 2C57A 1F2DA 1ZA1A 2FUEA 1HKUA 3CZ4A 4IIXA 3BH6A 4EAQA 4Q6BA 1Y82A 3EF3A 1O58A 4Q34A 3UMYA 1U98A 3E9YA 3ZCPA 3OZSA 3UMFA 2QVZX 4X92A 3C1OA 3JD4A 4P53A 4DCJA 2XIQA 4H31A 1W94A 2H57A 3IJEB 2DKFA 4IXDA 4EX6A 4KUGA 5AVYA 3S1SA 3WB2A 4KR3A 4N3AA 4HWKA 3PFNA 4CV1A 1RABA 4JI6B 4GL2A 4AJEA 1H4TA 3ODGA 5FDFA 2QLTA 1LB1B 2IHKA 3NBMA 3WA7A 1KO1A 1QIIA 1I9CA 1JEYA 4BO7A 5DM0A 1ZSNA 4DE5A 4HB2A 4INJA 2H4YA 2RCYA 2ZJ8A 3AOEC 3GC6A 4JLWA 2H52A 4TZKA 1FFAA 4RZXA 5B3AA 4EKEA 2GNOA 1Z7YA 4IZIA 3DFUA 1YB6A 1NI4B 3H0CA 2CCJA 3BPSA 1P39A 3SDBA 3HN7A 5EWLA 1G0OA 1AF4A 1K3UB 2ERCA 2YOHA 3DDHA 5DNDA 1L7DA 1JECA 1YOVA 2XRZA 3L4SO 2CXRA 2HRRA 3IUEA 3K31A 4BNUA 3TTWA 1EWQA 3AFHA 1P74A 1MFPA 2IEYA 3DT9A 4LQDA 3ZK9A 3BDVA 3EOAI 2ODTX 2Y1EA 5EJ8A 4WOKA 3DLAA 4ZAYA 4TZ0A 1I2BA 2C03A 1GZ6A 3E3NA 4JT9A 1BU8A 3G17A 4PAOA 1EESA 4FKBA 3VU0A 2ZRHA 1PFUA 1ZOOA 5AJHA 1B8NA 1P7CA 4AJJA 1BWSA 1S4QA 1NV9A 4P2GA 3K0HA 3L46A 3BXGA 2GZDA 1SNYA 2VSFA 2ZYHA 3PI7A 5BN4A 4PXAA 2Q4RA 2ZYUX 4OCZA 3AJRA 2AC2A 2COKA 3DNPA 5KSOA 1OH7A 5E4FA 2HWWA 3QPBA 5FNVA 3A05A 2HCBA 1IONA 1ORVA 1PZNA 4WNCA 5YASA 4EJSA 3IAFA 4QICA 3CZPA 2QGNA 4RKWA 2W00A 4TVKA 3TZHA 1UJ2A 2AA3A 4YJ3B 4MV5A 5BNIA 4GQBA 3ORFA 5K0GA 1AV6A 1CY4A 1KOFA 1AUOA 2VO1A 3OFKA 3ECAA 2GXAA 3OE4A 2ET6A 4I1UA 3H4VA 3TEJA 1GLGA 2IEBA 2Q5LA 3ASUA 3QMPA 4ZVPA 3S4YA 4D74A 4ARCA 1N5IA 1KVUA 3EZLA 5ALKA 4NAHA 2JCXA 2REOA 4OFBA 2K7ZA 4MUHA 4RADA 2FJUA 3AINA 3S2IA 5T67A 4G0QA 3PVSA 2O8FA 4LRSB 1JS1X 1UEXC 1VE7A 3IHWA 4JUCA 3K8ZA 1Q6YA 3WYDA 5CAEB 2IYTA 3W2HA 4I81A 4KXYA 3RT7A 3EARA 3H11B 1ZRSA 3OHSX 5DJ5A 4RY9A 2I6UA 4Q21A 5TC4A 3W5UA 4XWKA 3SQXA 5LIPA 3FI9A 2EAUA 3E2IA 1G20A 1SUDA 4KFSA 5HJ7A 2ZXEA 4P5PA 2CMHA 5F5XA 5ALJA 2EHJA 1Z6AA 3N8NA 5KKCA 2Z6AA 1NY5A 2I66A 3P9NA 4WVLA 3W2EA 1Q1NA 3LUJA 2NXNA 5BSTA 3W34A 2M9MA 2CV0A 3FVRA 1JE1A 3RCBA 3WIOA 4KVGA 3BXFA 1U94A 2A9KA 4MW5A 1QAQA 2QVXX 3IIIA 4MB6A 5KNBD 2FA9A 5A2QA 3BWMA 1HYGA 1SC1A 3EZXA 3HN6A 2X76A 2ZE5A 4P08A 5JU6A 1LJ8A 1OX6A 1YQDA 1N0WA 1ZN2A 2Q21A 3AR6A 1IHPA 5AFSA 5LBTA 3NXSA 3AMVA 4YDRA 2VSNA 3RFXA 1CZRA 1UM9B 4D5EA 3A2KA 5KHLB 5IXJA 1GGVA 1GL3A 1GPLA 1O4WA 1QH0A 2HBZA 1SBQA 2JFZA 2VDVE 2Y9PB 1ESDA 1SHTX 4ZA2A 4O2AF 1ISFA 4HRXA 4E70A 4ZJZA 3RT1A 4ZYWA 3S2GA 1TE2A 1TYZA 4HB4A 4IQFA 5A9TA 1EFCA 4B43A 2I29A 4E3WA 1RFLA 4A16A 1WF6A 1XEFA 2H7CA 4RMGA 2FPKA 3MS7A 1Z0KA 4DN6A 1TA9A 1VGRA 2IPAB 1CCWA 2ZIVB 1N0HA 3K9LA 3STVA 3BSFA 1YZKA 1M2EA 4Z53A 1Y8CA 3OMWA 3J81A 4F5YA 3GRUA 2GH1A 3CE6A 1N3LA 3NHFA 2Q7OE 2IPXA 3HUEA 2CJPA 5LP6A 1CR1A 2P6PA 3QWBA 4M9UA 3BZWA 1A76A 4RETA 3PKJA 3MA0A 4ASUD 4BNFA 3K15A 3P45A 2H3HA 4JNKA 1EA5A 2YS7A 2DZDA 2YNMC 2I71A 4KE7A 3WYBA 3EGEA 1URPA 1NR7A 3RUAA 2HDNB 4KMSA 1N1MA 5B57C 1C1HA 3PQ3A 4RXMA 2R6R1 4W5TA 3BD9A 1UPAA 1GPDG 3OBIA 3MIIA 1BS2A 1EUDB 2EZTA 3KYJB 4YN3A 1Z68A 1DC4A 3V3KA 3IXMA 2Z2IA 3WLAA 1GXSA 1VG0B 1RWMA 3GEEA 1I3KA 4FZJA 4JAVC 4O3FA 3RG8A 2HU8A 3F90A 4IIFA 1OXTA 1W73A 3H19A 3C14C 1F0KA 2I1WA 1JT9A 5TQ2A 1FFSA 4IJKA 4NAUA 1XTUA 5ECGC 2FP4B 3HG7A 3S44A 3U62A 3F5DA 4B7AA 3GLTA 2Z04A 3W7BA 4REOA 4WEQA 1IYZA 3JZAA 2XZLA 2ZR8A 1N25A 4EHKA 1BOFA 2V7VA 3T5CA 1XDWA 1JQ3A 2V5AA 1JLKA 2LKDA 4XB6B 2VTEA 1XDBA 2B3TA 3KUKA 2Q4EA 3ICQB 2W7TA 3O2NA 4ZZ0A 4Y6GB 3MMZA 1S9HA 2FWPA 2PIAA 3IXLA 4Q48A 5DOVA 4HAZA 3LUGA 1YV9A 2VF2A 3RSLA 3SZMA 3IQHX 5EKSA 1T15A 1EP3B 5JCJA 3DYIA 5EIEA 1VPEA 2C2WA 3ZH9B 5IXYA 3FOWA 2VF8A 5CLIA 4CLDA 3LFTA 1X8LA 4RKQA 1Y1SA 5ED0A 4MZDA 5BNTA 3VOTA 2HMYB 2W6JA 1XTIA 1A5TA 3EGIA 4COOA 1K97A 1VJDA 4UPDA 3O1JC 5EUBA 2GASA 1UXIA 3H0EA 2XNDA 5CX4A 3W3AH 4EQZA 1WBBA 3RSHA 4Y6SA 2ECOA 2OM2A 3CVVA 1ZOPA 2O2GA 4CKEA 1LUAA 4CQMA 1NURA 3NASA 1NOJA 2PKRA 2WF6A 3PQ8A 1OLSB 2NACA 5JZVA 4LF4B 4UVHA 4EI2A 4BWFB 1AGRA 5SY4A 3ASZA 4BP1A 1K7SN 2CNDA 1DAFA 4B6FA 1M6YA 4AG6A 5CVDA 4Y6OA 1KYZA 2PX4A 2AFIB 2Y4OA 4U7FA 1JG3A 4XUDA 5DXFA 3SCZA 4QEZA 3RGGA 3P9PA 3HY4A 1I9GA 1C1DA 4I14A 3O94A 4UNQA 1XKXA 2ZIZA 3O8QA 2JJ8A 1X3SA 4RIHA 5HGJA 4BBJA 5LYJA 4CMEA 5LUAA 5REQB 3UY4A 1R5JA 5G4KB 2Y99A 1WZCA 2P6RA 1OOEA 2OV3A 4PPQA 2V6BA 4YJ2F 3VYTB 1H0HA 4OATA 1BXGA 3SHQA 1A27A 2DF8A 3C3BA 4G1CA 5L95A 1R0WA 1VCNA 1M6WA 3B3JA 5B7PA 4WV3A 1JLLB 2RG7A 3FF1A 4D9KA 1XRRA 3GCDA 4V0QA 2AJ8A 2VQFB 4P0PB 1MEJA 4MVJD 5CYOA 2B1JA 1F6WA 3RFUA 4BQFA 4CEIA 3UC5A 2OYCA 1J2YA 4D42A 1LTQA 2HWKA 3RC1A 5K4HA 1PL6A 3UBMA 2D7DA 5FOSA 2I55A 4RULA 4IRXA 5FOUA 3EMDA 1RTKA 3W2GA 2XBMA 3Q7PA 2YCLA 2GJSA 4M86A 1ZL0A 2BP7A 1MZPA 2WKWA 1XZFA 2ONJA 1OROA 1X1AA 4TTQA 5EZYF 3QKSB 2FB9A 1A7UA 3JTEA 1A4IA 2BOVA 4NTZA 2YQ5A 3RK4A 4ENQA 1BDIA 1PIWA 3CRQA 3C3XA 4W8OA 2VNJA 1TVKB 3E82A 2QL9A 3TQTA 2H8KA 2J0SA 4ZYVA 3LQRA 1XNRB 3HR4A 4EUHA 3UWSA 4MJ7A 4WNIA 2PTGA 4IOMA 4X84A 4ZOLF 4AYTA 4C0HA 3IO5A 4LHWA 2IXGA 4P80A 4ZEWA 5K51A 5C81A 3WQRA 2EG9A 5JD6A 4PAMA 2JFUA 4LGMA 2ACKA 2PTHA 2FI1A 5EMHA 3VHQA 2PZEA 2X86A 2CK3A 3MCUA 3WV4A 4IEEA 3NXKA 4CM4B 1UJ4A 1ZGGA 3GYGA 4BO3A 4IMPA 3GIWA 3QVUA 3U4IA 5C18A 2Q1UA 1WPXA 4BEJA 4RS4A 4A5SA 2DTEA 1CJVC 1SZCA 1TVEA 1GTJ1 2OBMA 2OSVA 4UQPA 4XVCA 2AHRA 4DA7A 3MM4A 4O2LA 3I30X 1QFXA 3DSRA 1JSZA 1FCJA 3OJ0A 1AS0A 4N7RA 1FJXA 2C83A 3OFNA 4CTJA 4JIGA 4CKWA 1A77A 1TGVA 2HJSA 4LNUB 1XLTC 2QXYA 4O1MA 1BCSB 1RMYA 4CTOA 1G2IA 3B6EA 4FQ8A 2I6QA 2PG3A 1RKUA 2RI0A 2PGJA 3PCXA 2UYOA 5CTJA 1W581 4UDYX 2O2HA 3K0EA 1ST2A 2UXBB 1MVOA 1RQPA 3GFSA 3PFCA 2QM0A 2BFDB 2N75A 3KQWA 4XARA 2C5EA 4HDAA 2G0TA 3WZMA 2CJWB 3ZH2A 4BZWA 3EB9A 2FPGA 1T0BA 4UUQA 1JR6A 3R9XA 1GTMA 4AMUA 1VKZA 4P7BA 5KTKA 4AC9A 3UFBA 3C6BA 2CLFB 2HRBA 2ZUWA 1UQRA 3K35A 2OCXA 4L07A 4U3JA 5K2MA 1Z4PX 5IS2A 3OEED 2ES4A 4KQ6A 3RG2A 3QX3A 1J1UA 2FE1A 2P69A 2PLRA 2REQB 3VKFA 5BPFA 5KX5F 1JQBA 2IH4A 4D9EA 4QOEA 3VU9B 4JJIA 1I8TA 4C89A 3NHJA 1TUIA 4U2GA 4KXVA 3X0DA 4B6RA 1NVVR 2JHGA 1V1MB 3SQMA 2XECA 1WPRA 5CG2A 3ZI7A 1ID8A 1BD4A 1GWNA 3G1TA 3ZWKA 1P7VA 1XCOA 1YZUA 2ILTA 3NORA 3HABA 3UHFA 1GTZA 1G7CA 3W6UA 2P3SA 1QBKC 1Y6RA 2FR1A 4NV1A 3PEVA 5K99A 3TK1A 1SHKA 1UF9A 2IUUA 4EL5A 1P2BA 1NRWA 1MENA 2GEDA 2BKVA 3AC0A 1ACMA 2WI8A 4B3IA 3FBWA 1QH1B 1KR5A 1LU9A 3WLPA 3E84A 1Z2DA 2NLOA 3VC3A 1PU2A 1J2EA 4H7EA 2R2GA 4RTOA 2HRZA 1E94E 1QYVA 1XMQB 2JLUA 4F6CA 4DR3B 4MGEA 3WTCA 4BNGA 2ZIUB 4FEYA 2WWRA 3ABSB 3E23A 5K09A 3KPVA 2FYTA 3T9AA 3DBIA 1EGVB 2PCJA 1L7PA 4YR7A 3I5YA 1I4OA 5IDQA 2BFOA 4BMCA 5U4QA 3QKRA 4E14A 1OC4A 2OBYA 1JHVA 1VMIA 4QUGA 3VFDA 1GRCA 1YASA 3R8CA 4UTRA 2IYLD 3UJHA 3AEKA 1QQAA 1KQNA 1BMFD 2B61A 3IUPA 1EBFA 3QYFA 1P5RA 1K92A 1ODFA 1M5TA 4GRIA 4MR7B 4K6CA 1C7EA 5ARCA 4EFDA 5IABA 5LQAA 1E9RA 1K2VN 5CG1A 2VJQA 2HQSA 2NSDA 4PPGA 3IP3A 1XZHA 3GXBA 1CYDA 3HVUA 2P3OA 4WUTA 2ZRBA 3U37A 1MV8A 4TT3A 1GQQA 4EG7A 2ZJ6A 1C9YA 4XX0B 1QRAA 1X1RA 4LGVA 3ABQB 1FTGA 4JASB 3T9DA 3W5IA 3V1LA 2ZWVA 1QK5A 3M4XA 1HT2E 3SK0A 1KSFX 1YCFA 4OD0A 5JASA 1JH8A 1KHHA 1KPIA 4X1KB 3KQPA 3NBKA 1ZS9A 4N82A 2WAXA 2XAAA 4P1ZA 4GO1A 5EZYA 3EIEA 4B4DA 4GOXA 1OQAA 2Y0BA 2ZXUA 1WKCA 1AOXA 1PJQA 4OK5A 5CXSA 3AKCA 1KDOA 3F46A 3RC7A 2H1IA 3OZIA 1J2RA 1YJBA 4OXRA 2OD2A 2EW1A 4YUWA 3O4RA 1BSVA 1X92A 2GM5A 4BASA 2CUZA 1L9XA 3E22B 2DTDA 3K8QA 2YNMA 5JQGB 3OPNA 1O7JA 1LBIA 2QY6A 1YCDA 3QJGA 3AB8A 3QMMA 4XA8A 5FA6A 5BQFA 2R6FA 5MN6A 5FFNA 2SECE 1L5GB 2FQYA 5ESXA 5IJXA 1FTNA 5ICFA 3B52X 1AX9A 4HQNA 2BZ0A 1C9NA 2VDNB 3SNHA 5A06A 3WWZA 1U9IC 1P17A 1ABBA 3JQ8B 4KFCA 4UC0A 1CNMA 1G16A 2DQ4A 2RCNA 2X5NA 1B3BA 1TK2A 2WWGA 1AKMA 1O9BA 2XB6A 3EXHC 2X2EA 2FZKA 4R5MA 4KE9A 4Z86A 3OLVA 4PLZA 1N5RA 3A9VA 4KVAA 3LCMA 1KEWA 3CIFA 1R6DA 5TQVA 1N4AA 4AS2A 4RV4A 1XXHE 1ZL2A 1THMA 3H87A 4ENVA 2G82A 2MYNA 2QPOA 4XDGA 3K71B 1EK6A 3KT0A 4LBWA 3EBLA 2WSYB 4H59A 4P38A 2QE6A 3VJMA 3DEJA 4OBXA 4JLVA 4OU4A 3DT8A 3L8ZA 4JK3A 4P32A 3WLTA 5BR7A 4GR4A 4YR9A 2O5RA 3D7RA 3MMNA 5IAAA 5IVPA 4Z7JA 5G1PA 4M89A 2HR1A 1K5PA 4UBIA 4YBZA 3GWGA 3HZRA 2O54A 2WF7A 4Q7QA 1A04A 4J90A 2XYRA 1HNWB 1BGXT 1PFWA 3FYUB 4FI3C 3ZY4A 2WB2A 4GGMX 2JBHA 1JLRA 2COEA 2IUFA 2C9ZA 2XXBA 4YVFA 5HK9A 3M8KA 1ZBQA 1ONPA 2XUPA 2YW9A 1GEEA 3KOWA 1L4NA 3DXXA 3VHXA 1CC1S 1JSCA 3A4VA 4TV9F 2D7JA 1OBFO 1L5MA 2GR9A 3D6JA 4JQCA 3FUUA 2ZJFA 5DN9A 3TAHA 2XVXA 4A0QA 5K8IA 1GQ2A 1P72A 1ZK2A 1PSWA 4EKNB 5L3QA 2PH7A 1DC3A 2KE5A 1VCIA 2IX3A 1QQTA 3K1AB 2AMYA 3HA5A 4JUDX 1W46A 1OXBB 1NVBA 2HMWA 2N42A 3GJYA 1IU9A 1COWD 3MXTA 1WETA 3EEQA 3EF1A 3FCYA 1R4ZA 4IIUA 3EQ2A 1MB2A 4TROA 1RQ2A 4E33A 5CB8A 2OXEA 4UQLA 1RQXA 2R1VB 3EWSA 3PZBA 4A27A 2D8AA 2FZ5A 3HBAA 1HQYE 1MO5A 1AB5A 3O84A 3INYA 4F9EA 4ZCTA 1EGMB 3ADKA 4WXEA 3ZCTA 4TVSA 4ILEA 5BSWA 2J87A 4NBTA 4Q15A 4WZBA 4RL6A 3GLFE 2IGTA 1HURA 3K3PA 3ONNA 4CG0A 2FDRA 3DE0X 3NW9A 1T0JB 1AM4D 4KWHA 4U2KA 4CDMA 1I7QB 1H9CA 2O7SA 1OZ0A 1HE4A 1ZZGA 2Q4OA 1DRWA 1J06A 3OE5A 1RP1A 2BHNA 1C8VB 3WGTA 4B3RB 1BFKA 2O4UX 2IE0A 1V9CA 3N8GA 3LT1A 2W43A 5E4TA 1O6BA 1U7UA 3R5SA 3ZNOA 3GLGB 1V4NA 3H18A 3ENNA 3VYSB 5GONA 3ZWCA 1LZLA 2IIPA 4AWAA 3Q7IA 3LOPA 4EEKA 1XQVA 5I7WA 1HF3A 5GVRA 1L4UA 3HA2A 1PYOA 5BUZA 4OAPA 3IR6A 2O7NA 3D6NB 4A9AA 2IBTA 2YDYA 3SC6A 1VJ0A 2B8TA 1SPXA 1MD9A 2H0AA 2QIPA 3AFOA 3OZUA 4MJXA 5AM1A 5M3BA 1V47A 5SICE 3EAFA 3VPGA 1YZGA 2GEKA 1XD2A 4MWTA 4JWKA 3ZKWB 1PGPA 4YPOA 1F4LA 2ATIA 4G65A 4LJ8A 1X1BA 1IZ8A 2Z56A 2DHRA 3UYKA 1EK1A 1E2MA 2Z1MA 4KQ1A 1BVYF 1MJFA 2ANCA 3QKUA 4AUEA 1M75A 2E4WA 4U02A 3EPHA 4H60A 3GMTA 2P6NA 5ER9A 8LDHA 1X9GA 1PL0A 5LYJB 5TQJA 4BFWA 1QV7A 4QLAA 5D86A 5CR9A 1A5SB 4URVR 4S05A 5JJIA 4J6EA 2O3UA 4DIDA 2D1RA 4MQ5A 3KDPA 2OHJA 2XPCA 4UFNA 1BXKA 2OQIA 1NHWA 2WP0A 2FUG1 3DQZA 2MDTA 2WUFA 2JKZA 3L8CA 3FHOA 3GLRA 2IHBA 3GNSA 1L5RA 2V8BA 4KACA 2A1UA 2OUKA 1ODJA 5AM4A 4LEIA 1DIOB 2ACEA 4JP1A 4B7XA 4KNWA 3UJ8A 1H1DA 4AUMA 4CKBA 4YRPA 1X8JA 3R6DA 4NX2A 1EM8B 2E48A 1KO8A 4L7VA 2ZT8A 3MB8A 1V41E 4WXRA 4CNBA 4LYJA 4JOCA 3BC1A 2NO6A 2IHYA 5EIXA 3GT4A 1T6YA 4BLOA 4LAFA 3IBFA 1T5LA 2HA2A 2P1RA 2FUCA 4H16A 4XRRA 4BNWA 1QCZA 3E9QA 4MKZA 4AZ3A 2P6UA 3PLAE 4NKRA 2FHSA 4FW9A 5TF0A 1XLTA 2H17A 3IVMA 5CA1F 2PBZA 3EDRA 4PR3A 5ECWA 4YI3A 3OSZA 5AUQA 2GZSA 3NT2A 4ATNA 4KQHA 2P77A 3QEAZ 4PHCA 1GU0A 2WM3A 1CY2A 2GVDC 5IEJA 1ZQ9A 1UJNA 4JMLA 1CJBA 4ZYUA 2XVMA 4GW3A 3QX7A 4LYGA 4NU6A 4OI1A 3OZWA 5FPTA 1UT6A 3LBIA 3W4JA 3EIQA 3G89A 3EGXA 1VPTA 1SK9A 3DC7A 1COZA 1WP9A 3PX2A 3ZGNA 4F4DA 4QBHA 2B69A 1JFSA 1OX5A 2FQWA 1QC5A 2IYFA 5B4TA 3L1VA 1M8KA 1JHYA 1BH6A 2A92A 3L8FA 4RPIA 4CQLB 4EUFA 3SZGA 2JJMA 3MIZA 2WHXA 4R81A 4PGAA 3QFFA 4Q7LA 4GXQA 4O4JF 1EEXB 2XD4A 4W7HA 1QPBA 1UK8A 1V5FA 2G9VA 2IWHA 3O9MA 4UCQA 5EXTA 2GHTA 4ZODA 4HAVA 1F0NA 2A5GA 2QY9A 2VJDA 4HRVA 3VR5D 1YJ8A 1DG1G 1I7NA 4CLXA 4YB8A 3I83A 4M4SA 1U0OC 3UA4A 4XTRA 5C8YB 2HT6A 2IPNA 4HQ0A 4LMBA 4MMZB 1MCZA 2O0JA 5HIIA 1JEEA 4DMHA 4UAVA 1R6BX 4F04A 3GT7A 3O8OB 3NKVA 4LY9A 4RK1A 3WB0A 4YLYA 2JLWA 4ZTUB 3K9FC 3QE2A 4HEQA 3FE2A 4J3NA 1Y7IA 2QDXA 3AF1A 4JFAA 5JXGA 4M7OA 1WV1A 1RIIA 1B14A 2GXQA 2Y1XA 3MD0A 4YQEA 1LH0A 1QZXA 1JAZA 2X2FA 3BZBA 5H3CA 4B0PA 2QMQA 5LN1A 2E37A 5KNDH 1ZUNA 3HZZA 1UJ5A 4HBGA 4QJ5A 3I1JA 1W8DA 4QUJA 1ZCBA 4WT7A 3WGUA 2Q6KA 2R62A 2DLCX 1EFVB 1DKMA 4R1OA 2HQOA 4B8WA 3E0XA 4M46A 3A1UA 4KPYA 1ONSA 3CWQA 4IRUB 5JO0A 3MHTA 4B3SB 4AJKA 3N6VA 2WJ6A 2GRAA 3VZPA 1A5BB 2R00C 5KHAA 3KOYA 1FRQA 4Y18A 2IU0A 5CDYA 4KEAA 1K0FA 1M1YE 3KZCA 4IO1A 4NMWA 5TPWA 1BKYA 2HCTA 1Q57A 2C42A 1W36B 1KXZA 1F0YA 5FCDA 1NVWQ 3I9NA 4DCTA 3LY7A 4L15A 4FBLA 1KOGA 4A2WA 2E55A 2NQ2C 4DV5B 3U61B 3CWZA 3HB5X 2YUIA 3AF6A 2LDXA 1UBEA 5LLSA 4CYMA 3C8ZA 2ODNA 3GJ8A 4R1PA 2SHKA 3PQCA 2NU9B 3AKZA 3AB3A 2PZAA 5FA8A 4HH0A 5EIOA 5ULLA 3QVKA 3O1HB 2ZW9A 1MP0A 2C5SA 1R8SA 2A86A 5JXHA 3RVDA 3ROXA 3UEOA 4OP3A 2R8OA 2HQBA 3U7EB 2UYGA 2ZRLA 1G8HA 3T5TA 5EWJA 4LQLA 1JQLB 4EUNA 1I7LA 4X7PA 4RHEA 4DLWA 3DMGA 1MIOA 2BZ1A 3FSJX 3I6IA 1YB4A 2W58A 3TVTA 4PSDA 2DQSA 2J4CA 1KMMA 4D8WA 1G19A 3I23A 1BRMA 3M9WA 4CV2A 3C5WP 5JCPA 3ED5A 4GKVA 1V95A 2IEDA 2Y3IA 2QD5A 5TSDA 3W5DA 1WX1A 4CMIB 1RZRD 3H1FA 3AG6A 4ZAFA 3VJKA 3ZJYA 3HBJA 4QOFA 3GAMA 2HW8A 3X3HA 4NLLA 5IVHA 1AB6A 5COBA 2LIPA 2RHLA 1BOOA 2O3QA 1RM3A 3I01M 5EIBC 1KEZA 4RACA 4JI8B 1U9IA 1E99A 1SOMA 2XQIA 1E2QA 5FUMA 4MK4A 1TK9A 2O8BA 3BHMA 3JD0A 1YB1A 2XRYA 4QXOA 3BXPA 4UUAA 2GJ8A 3BFPA 3EXHA 1IG0A 2BEWB 3NJ4A 3OESA 4IH9A 5IZCC 5LU9A 2ZJAA 1YL6A 3P2MA 4HYEA 2R7AA 4Q19A 1K86A 4H15A 4D25A 3PU6A 4MVYA 3VPDA 3OSUA 5EPEA 5ADWA 1OA1A 4JI3B 1V71A 2XX3A 2CCKA 4PO9A 4R9RA 3RSOA 1N2IA 1U8XX 4CCYB 3AKEA 1PRYA 3NOQA 1JTVA 4IH1A 2WWFA 3MNFA 4C03A 2YKGA 1BDJA 1KZ9A 3LA8A 4L6AA 2W93A 3PGVA 1E2GA 4YAGA 1J70A 1OASA 1TM5E 1ONBA 1UL1X 4G23A 3WNBA 4IDHA 1R5OA 3TMYA 2IBMA 2XBUA 4I55B 1KWKA 3N28A 3THXA 2B37A 4H7PA 1P7ZA 5GY7A 3V1KA 5L45A 1U8FO 2XUQA 2PUEA 2CT8A 4ROSA 3LXXA 3MWLA 4B44A 2ZRJA 3ZE7A 2BFBA 2H92A 2QKYA 4KREA 2ECKA 2Z6UA 4DABA 3ZHSA 3ZD6A 3GJQA 3LQ1A 1PJ8A 5FLYA 4Q47A 5KTMA 4OIMA 1SUIA 4S1WA 2DPMA 5FKJA 1HT3A 3I9OA 3KUUA 2IF2A 4H3HB 4K9RA 2P67A 3PPVA 4BVGA 1W0JA 2VRCA 3UUFA 1TAUA 1Q0RA 3JYOA 4KHZA 1V16B 4I5GA 4PYRA 2Q5QA 4PY2A 4YCCA 1QGED 4O4JA 4X63A 2Y66A 3TLBA 3T1QA 4MHSA 1NVTA 1ZN8A 1H6DA 2ZRNA 3IPXA 3R7LA 3SXJA 1I94B 4YASA 3Q7RA 2WFAA 1UBUS 4AP6A 2C88A 5L6LB 3DTVB 4V0MA 3V8QA 2BI8A 3I4LA 4GE3A 5FTLA 3JARB 4V0ME 4A0GA 5AW6A 5KQLA 3LQYA 2I7TA 2C20A 2RGUA 1D09A 4YLGA 3RLIA 2Q2WA 2O06A 1XXLA 3VX4A 4EG1A 1ZUIA 3P96A 1BMDA 2GILA 2QT1A 4JC0A 1OY1A 4QKQA 3L7YA 5AI6A 3UT6A 1TM3E 2BCEA 5C8XA 4AJIA 5TMEA 1H1LB 4UTXA 2G5GX 3HKEA 2PEYA 3FFBA 1M72A 3WXMA 2D7CA 3B7WA 4OXNA 3WNCA 2NZVG 4D3DA 4YRJA 2V9PA 4EVRA 1AH2A 2JW5A 2UVPB 3T41A 4DDTA 2QIOA 4IWNA 1M5RA 3OJLA 1VP3A 2WVHA 3PE4A 3TTSA 2I78A 2FCAA 4YC7A 5DX8A 4M1WA 1KIAA 4QELA 4HTFA 3PUXA 1NF2A 1NW7A 3H75A 3S7TA 5JFGA 5T4EA 2J6CA 3G1WA 4PLGA 3T7RA 2BCJQ 3ITKA 4KJXA 2H4FA 4DXHA 1YE3A 3CR7A 3KZKA 4MRMA 2Q5OA 1IXYA 2ZTSA 3WZLA 2WV9A 1WXGA 1YGYA 3RV3A 1T6NA 3ZQ6A 4H6WA 3E27A 4G1MB 2P1DA 1YT5A 1UMDB 3LQKA 4GS5A 3CF6R 3KKLA 1QYXA 3ZX4A 1FX0A 4YAWA 1GKKA 1IWPB 4NJOA 4BMYA 2OXIA 3BMXA 1PZFA 3EMBA 3PQ7A 4KI0A 1WMAA 4TMFA 5HSGA 3NFRA 1QRSA 4QFBA 4MB2A 1QGUA 1Z36A 3PFBA 4IV0A 3QEMA 2QYTA 3OLXA 4KYUA 4M53A 4N4AA 2YXNA 1YQQA 2Q7XA 4CMKA 5BWNA 3G82C 4KXNA 1GP2A 2ON6A 1E6LA 1QZ3A 3RS5A 1Q1GA 4CBVA 4MRVA 2MSDB 2W2VA 3W06A 3F47A 3T06B 3DMYA 3H7IA 1MOZA 3D2BA 4XPIA 2NZ8A 3IJ5A 3QXSA 3Q10A 4HNAA 3WRVA 3F5MA 1WTCA 4XIIA 4DIOA 3STYA 2F9LA 1CQWA 2BEKA 2Z3WA 5CUQA 1LDGA 2H5EA 1S8OA 2HPZA 3G49A 3ZHXA 1C4XA 1VKJA 2HSDA 1RHMA 4P93A 4ZD6A 4BFSA 5LLTA 2JAWA 1RXSA 3B6MA 3WRXC 2PX5A 1V7QA 4U00A 4X20A 4RD3A 1XZDA 5I7SA 5IYZB 4Q3BA 1Z5NA 1W1IA 3NH9A 5J63A 2EJCA 4V0OA 5JD3A 2Q5JA 1HDCA 4KC0A 4M0CA 1TJ4A 4C0SA 5A9RA 3B20A 2BW0A 3OTOB 3UK6A 1JFLA 1TGYA 4Q01A 5BN3B 3TR5A 5J3JA 4MITA 5HILA 3SXUB 1MVLA 5BMVB 4GEGA 1CR4A 3IR5A 4KQEA 5TNXA 3C7KA 4QDUA 2Y1FA 1Z7BA 4A0HA 3KAQA 1GCUA 2CBZA 3C8DA