4JSTA

Structure of clostridium thermocellum polynucleotide kinase bound to utp
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
171
structure length
171
Chain Sequence
SMKLTIPELSLVVLIGSSGSGKSTFAKKHFKPTEVISSDFCRGLMSDDENDQTVTGAAFDVLHYIVSKRLQLGKLTVVDATNVQESARKPLIEIAKDYHCFPVAVVFNLPEKVCQERNKNRTDRQVEEYVIRKHTQQMKKSIKGLQREGFRYVYILNSPEEVEEVVFERQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Metallophosphoesterase
publication title Structural and biochemical analysis of the phosphate donor specificity of the polynucleotide kinase component of the bacterial pnkphen1 RNA repair system.
pubmed doi rcsb
source organism Clostridium thermocellum
total genus 64
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 2.7.1.78: Polynucleotide 5'-hydroxyl-kinase.
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jstA00
3KTAB 1CEEA 2VBCA 4G5OA 3T1QA 1N3BA 4ZCIA 2A5GA 1JR6A 4YMUA 5DN6A 3UG6A 2IYTA 3CF0A 3QKRB 1N6RA 2BCGY 2FSIA 3HU1A 2O8DA 3KKNA 1HV8A 1JEDA 1HY3A 2R44A 2H5EA 2REBA 1XXHE 3K9GA 4R9UC 3VU9B 4LHWA 1UKEA 3UWKA 3PUVA 2CL0X 4HUQB 3U3KA 5FPYA 3LLMA 4IFBA 1MABB 2G9NA 1TQ2A 2GBLC 2CHVA 3OIWA 5EE0A 2ZE8A 5CLLA 1IN6A 4RZUA 1OH6A 5F2EA 3C4JA 4D82A 6Q21A 3LD9A 4TMZA 4DSUA 2PT5A 5B64A 2OLKA 3L8YA 1G19A 3QKSA 4O0MA 4PTLA 1W4RA 2QAGB 4YXWA 3VAAA 1Z6XA 3D8BA 4ASUA 4D0NA 3FKQA 4IOLA 5D3MA 2O8CA 5JZVA 3CH5A 2J5XA 2OBMA 3PQCA 2IW3A 4PC2A 2W0MA 1JNYA 4DC9A 2CMKA 1JB1A 2ZQ5A 2VHJA 2QTHA 2RGXA 4DWJA 1IY2A 2C98A 1NLFA 1OV4A 3B13B 3GCGA 1W48A 5C1BA 4OKSA 3EARA 1AS2A 4FCTA 5FOTA 4XJXA 1OHHA 2VP9A 2RGNC 2EYQA 5JS7A 2CDNA 3OIUA 2GEVA 2J1LA 1S2MA 4GOKA 3LX8A 5J4YA 1ZD8A 2CLCX 4KITB 2ZETA 3AGPA 1N6IA 3GLGB 1NN5A 1NG9A 5LB2A 2R6FA 3GLIB 4TYQA 3R7WB 1RW4A 4IOJA 3X2SA 1DELA 4C0AC 1GNQA 3D7MA 3U6KA 3A1UA 1Z83A 3AVQA 1YRAA 4LJ4A 3E70C 3VFDA 2FFAA 1QHNA 1UJ2A 4MYHA 1WDTA 1LTQA 4YMSA 3LWNA 2P6NA 2ZRKA 2OAP1 3TAHA 3EPJA 4QHSA 3CO5A 1KZ7B 2ZI4A 3VR1A 1TNDA 1E2FA 5EXSA 1E2GA 2DWQA 1Q3HA 1DADA 1XEXA 3EW9A 4HZIA 4M21A 5JWRA 2ZI9A 1YU9A 2YWGA 2H1LA 3MUFA 2QGZA 2WPDD 3FMPB 3NXSA 3RRYA 2EFEB 4IXNA 3TE6A 4PR0A 5CK4A 3KQUA 3NTUA 4KBGA 1SVIA 1IOZA 1EK0A 3EA0A 1E1RA 1XBTA 4AYXA 1S8FA 2VP6A 3FDIA 4M9SA 2ZI7A 3TUIC 4AG5A 2I1VB 4DBLC 4W5WA 5AJWA 2HCJB 5KPDA 1MO4A 3DEFA 1T9HA 1FQJA 4IW3B 4EUNA 2OBLA 4F4CA 1KY3A 1T0HB 1Q57A 2FDCA 3PUZA 3FKSD 2FE4A 4XVRA 1NIJA 5DISB 2V8OA 2HCBA 2F43A 3DM9B 1A2BA 1X1RA 1E6CA 1G1MA 2AX4A 3SFVA 3OAAD 4Q7MB 1W4AA 1ANKA 4D26A 4NDZA 1N0WA 2WICA 4TZ6A 1W36C 4EFMA 1NRJB 1NY5A 1F5NA 2VQSA 3F8TA 2HV8A 2OFXA 2C9YA 2V4ZA 2ZRHA 2B6HA 2B7BA 1KI7A 1Q44A 2J0VA 1ZRHA 1UEJA 2FG5A 3KJGA 4XD7A 1E9CA 1FUUA 1DE0A 3N70A 4LPSA 2VP0A 5FPKA 4FWIB 2Z4SA 3MJHA 5D3QA 3ZDQA 1CKEA 1IN8A 4ZKDA 4Q4AB 3VR4A 3WP0A 5KTYA 1Z29A 2J0SA 4TLEA 2Q21A 1G17A 4Q4JA 3GJ8A 4V0ME 4B3BA 1OFUX 3CUEF 4Q1AA 1N5KA 1VCNA 4JKIA 1EFTA 4X8OA 5DE3A 1XCMA 1PZNA 4K46A 1RRCA 1XDBA 3SU8A 5LD2C 4PZLA 1E4VA 2GWHA 4QFMA 4U00A 1XF9A 5FBQB 4ACBA 3QXSA 4A2WA 4DVGA 4ZDIA 1YZQA 1OPXA 1ZCAA 4IFEA 2J41A 2BBWA 2G0TA 3BS4A 3RC8A 5CYOA 5GVSA 4HDQB 3AVWA 2IF2A 2ZU0C 4ZDJA 3P32A 2PJRA 1QHGA 4GL2A 1NSTA 5C18A 5KO2A 1ZC3A 2FF7A 1SVOA 3L8ZA 2CEAA 2WWIA 4ILEA 1U8ZA 1JJVA 2KE5A 2YC2C 5JLJA 1JJ7A 1TTTA 4L5BA 2XZOA 4C7OA 2C03A 3THWA 3DDCA 4P0TA 3CLVA 3ADCA 2DFKB 1TUEA 1QHIA 5LBIA 3TW8B 2W6JD 1KNQA 4BFTA 2WBLC 4UXJA 4CEHA 3DOFA 4MGYR 2DWOA 1ONBA 1G9XA 1MKYA 3WRYC 1Z63A 4UXHA 1I4LD 2XNDD 2ZS8A 3BC1A 5G3ZA 4DLXA 1WQ1R 4OHXA 1E9BA 1KI8A 1D8TA 3T12A 2FSGA 4RCYA 3ZGXA 4BRWA 2FZLA 4EJSC 4EQ6B 5DHFA 1II8B 4R2HA 1TQ4A 1H8HD 2IHYA 2QPAA 3RS4A 2W2TA 3ZZUA 4YMVA 5CIQA 2KWIA 2QAJA 3BFVA 4DCVA 1LS6A 3RVBA 3IQXA 5HCIA 5KUTA 5CB8A 5L3VA 1OIWA 2CNWD 2NO9A 3LY5A 3X1DA 1SKYB 4TSFA 1L2TA 1LV7A 1UKVY 2DY1A 3V4FA 2VLIA 3SEAA 5K8UA 4LJ8A 3CZPA 3BD9A 3IKJA 4D0GA 2HYDA 2ZRPA 3WRXC 5JI2E 3U6BA 2KJQA 1OH8A 1JAHA 1GILA 3LLUA 4UNRA 5H8WA 4IDQA 4D81A 4HATA 4B3CA 4ZIRA 1CU1A 1WRBA 3QIAA 3REFA 1VIYA 3CIOA 1QHHA 1R5OA 1N6PA 1A1VA 5FL7D 4UJ3A 2WWYA 5IDVA 3CRMA 1R8SA 5AJYA 2DWPA 2QG6A 3K9HA 3J81k 2XTNA 3IEUA 2HUPA 2ZSAA 4ZV4A 1NP6A 1IBRA 1TADA 1ZJ6A 5DI9A 4CT5A 2QBYA 1KJZA 4LJ9A 4POAA 1ZD9A 4OJQA 5BYJA 1QHXA 2C8VA 2OV2A 2RHMA 5J5CA 3T1OA 2FWRA 4F91B 5JHHB 1XXHB 4AY2A 4P4SB 4O25A 1KDRA 4C30A 3GPLA 4DLYA 2GNOA 4JT2A 1OXXK 2WJYA 3DM5A 4JBYA 4QGFA 2A3RA 2FEMA 3QXJA 2ONJA 1S4QA 1HQYE 4HAYA 3B1XA 3K70C 4GNKA 2ZXUA 3PEYA 1G291 3ZD6A 2RGCA 1GKIA 3EASA 1XU4A 2GKSA 3IIJA 1NVUQ 1TEVA 3WYAA 2IK8A 2IYYA 3THYB 3I3SR 3THXA 4GI7A 1BIFA 4ZCMA 5E95A 4BRUA 1SXJA 2H18A 4RSGA 2VA8A 3NBYC 2IYLD 3OZXA 3SJBA 1EFHA 4HI0E 5TARA 4EPVA 3CR7A 5KNDA 1P72A 2WSSD 4RD6A 4FWTA 1NBME 1GITA 1HURA 4DLTA 3WP1B 4QNRA 2A2ZA 1G7RA 3UXMA 3VHXA 4DEXA 2BJVA 4I1VA 3EWSA 3KQHA 4M53A 4EIWA 5UKDA 1YR6A 4KCGA 4NYJQ 4QBFA 2AHOA 1Z06A 4D6PA 1GUAA 2RB4A 3G82C 2P5TB 2MSCB 1XPOA 4G5QA 4IHQA 2ZM5A 4AI6A 4RKEA 1MO3A 2GCOA 1ZU5A 621PA 1N6LA 3EPKA 1VTKA 3L0IB 4XOIA 3C5CA 4B43A 3ICEA 3KQNA 2WJJA 1QHSA 1R10A 3THOA 2XX3A 5JEEA 1WXQA 2YKGA 1DAEA 3BAFA 4FCWA 2FPMA 5EP2A 2B7CA 2C5LA 5H1YA 3P4YA 2ZS7A 2RGDA 1CJMA 4PO1A 4QBHA 4HSEA 1OH5A 1G3QA 1O3YA 2ODWA 1J70A 2H57A 1KZGB 2VP4A 5A4JA 2F9LA 2AD5A 1S3GA 1R0XA 1H8ED 1U9IA 1Z0IA 1HA3A 1E4YA 1JI0A 3AUXA 3BH7A 3EZ6A 4KVGA 2DCUA 3B1YA 1D2EA 1FQKA 2A9KA 4PC7A 4UXIA 1VIAA 5B2ZA 2PBRA 3CWZA 3IQWA 5DH9A 1IN5A 2X2EA 3BFKA 5DYIA 3RYTC 3VR6A 2Q9CA 1VHTA 1RRPA 1XNJA 4L16A 1X3SA 2ODEA 3KKOA 2A5FA 3K0FA 5EXPA 3PXGA 1KI6B 1N2CE 2VHTA 1ZIOA 3ASZA 5EXXA 4BZQA 1CBUA 2ZE5A 4UNQA 3OFNA 4Q7LA 3PR1A 3KFXA 1FL9A 4DUGA 1NMYA 2V9PA 3GLHE 4Q1DA 4Q01A 5G41A 1NN0A 4IJMA 5M04A 3QPVA 4JMPA 2R2AA 1GG2A 2PX3A 5E4FA 2IS4A 3CONA 4DT1A 1OIVA 2GXAA 3UMRA 1G6OA 1SGWA 221PA 2E1RA 2QN6A 2XJ9A 4NPHA 3RNLA 4XWOA 4ON9A 1M6NA 3B78A 4M1MA 1NMZA 2CE2X 3WY9A 1CXZA 2C95A 2GK7A 2RGEA 5KNBA 1TU3A 3QBTA 4A6XA 3H2YA 2EFDB 3RRNA 5AUOB 5DNYB 4AKIA 3B82A 3B60A 3QF7A 2G6BA 2H16A 1AA9A 2RHDA 3I32A 1QZXA 3AKEA 4DSOA 2CL7X 1GRQA 3HPQA 5BQ5A 4ZKEA 4LY6A 1E99A 2V55B 4I99A 5GJBA 1BMFA 1MOZA 3SN6A 4FMDB 3UIEA 4PQFA 4JBWA 1E3MA 3MWKA 1XMIA 3X1WA 3QXHA 2PL3A 2A7QA 2FU5C 1E1QA 1KKMA 1LFDB 1XMJA 3QE0A 3WMEA 1D5CA 3WXMA 4V0KA 4P3YA 3GFTA 4P4UA 3KUCA 4Q02A 2X8AA 1CS4C 1XD2B 3KFVA 4JT4A 4NZYA 4TT3D 2QM7A 2BMEA 1JQLB 2F1RA 1KY2A 5FFMA 3EPLA 3ZQ6A 3FB4A 5BN5A 3L0PA 2BMJA 3L0SA 1X6VA 1OXSC 1Z5ZA 4OI0A 1KDTA 4HB0A 3ZVMA 2XSZD 5FUWA 2RGBA 4LBVA 4NCJA 2WTUA 3TRFA 2BMDA 2CJWA 1KKLA 2W58A 1JR3A 1CJKC 1VPLA 4NCKA 4WZ6A 3I8SA 2DB3A 2HDNB 4KFRA 1CRPA 1SVKA 1G20E 1FPMA 1EGAA 1ZM3A 4IDPA 1G7TA 2QQEA 4QBGB 2JCSA 3VQTA 5A5GA 4A9AA 1HUQA 4BUJA 2V6IA 2PMKA 3NDPA 1DTSA 4B34A 3RABA 2VPPA 3U44A 1U81A 4AYWA 3P26A 3TUJC 4C4PA 1X1SA 2OO7A 5FTMA 3W9YA 1XEWX 1EFCA 1DAGA 2KB0A 4KYUA 4RFSB 4M9XA 1E96A 1W2GA 2W2XA 2WAYA 3GEHA 4N3NA 3AM1A 1GP2A 5HR5A 1CJUC 1TX4B 2WWFA 1K8RA 4B44A 3B2EA 3WMGA 4B3GA 1IQPA 2D74A 3TH5A 4JLAA 5HZKA 4V03A 3KL4A 4UQOA 4Q4HA 2J7PD 2JEOA 2P6RA 1PLJA 3Q8XB 3P27A 1Z3IX 3FHCB 5FH9A 2A78A 2HF8A 3N2IA 2FZ4A 3UG7A 2IUSA 2GZAA 1SVMA 1F2UA 5AR1A 2ZRMA 1Q3TA 2O8BB 1FP7A 1DPFA 1SQ5A 3CF2A 4P31A 4JLKA 4EPXA 1E9RA 5EE9A 1OXTA 3H86A 1HTWA 4BZXA 2PCLA 1TMKA 1Y63A 1DG1G 4LHVA 2MMGA 4KVAA 4W7SA 2GAAA 2IEZA 2D4HA 4ARZB 2D06A 4JLJA 1RRFA 2ZR9A 3NEJA 2VEDA 4DLVA 4HDCA 1Q12A 3PITA 4RJLA 5FBLB 5GJVC 3RS2A 4V0LA 1DS6A 3H1TA 1AQUA 2ZSBA 2UZ3A 1G8PA 4BFVA 4CIDA 1B0UA 3JZMA 2NPIA 5JECA 1FNMA 2VF8A 2YWHA 1T0JB 2WIBA 4CEIB 3LBNA 1NKSA 2D7CA 1W0JD 3NG1A 4C0SA 1JXMA 1E69A 1IY0A 4QJ4A 3SBEA 2R9VA 2ZUDA 1WA5A 2J0UB 1R7RA 4BLQA 5JCPA 4B32A 1M7HA 2JLRA 4MUBA 4TLBA 1FMJA 2WJGA 1US8A 1QBKC 3EZ9A 4TWZA 2F3RA 4OK6A 1OFTA 821PA 1AGPA 1O87A 1SKQA 5AK0A 4MDEA 4RD4A 2XB4A 2CHGA 4ZCLA 2GETA 1E0JA 3IPYA 1R2QA 1P9NA 3DO6A 4M0LA 3NHAA 3IBYA 2IX3A 1DOAA 1Z47A 1E2PA 1CJVC 5FPHA 4B3DA 2WPDA 2OESA 4LSGA 4NTZA 5H68A 1COWD 1Z6GA 2N1BA 3HU3A 2QGNA 4HDOB 4C2TA 3SHWA 1P9RA 2YOFA 1HQCA 3EG5A 3TAUA 2FSFA 5FR1A 4C0QC 4AKHA 4US2R 3JVVA 2OCBA 1XRJA 3TIFA 5KDLA 3T61A 4BFZA 3RC3A 1IN4A 3RRMA 1XEFA 1RIFA 2Q9BA 3CW2A 3FKSA 5CB6A 4HLCA 4LJYA 2XZPA 2ZRGA 3W6OA 1ZC4A 3Q72A 2AWNA 2WKRA 4U7DA 4JVLA 3AVYA 4Q19A 1SXJC 2PT7A 4MRSA 4TLDA 1HE8B 2ZU6A 1YR7A 5BWMA 3OAAA 1XJ0A 2ZRNA 3OIYA 1W36D 2QMHA 1F2TA 2OAQ1 2XNSA 1H65A 4CT4B 4CRWB 2BMFA 3TMKA 5K8IA 3M4YA 2R62A 4GMXA 3NIBA 4BQSA 1M34E 1KMHA 1AIPA 3C5HA 3H4MA 4TN1A 2R8RA 4H9GA 2ANCA 2VHCA 3PEVA 4F93B 4LUCA 1XCGB 4MKHA 1BKDR 1G8GA 1P2SA 1T8TA 2AFIE 4JLBA 4RZ3A 2ODBA 2O8FA 3Q9LA 1CRQA 1KSJA 5G3YA 3IO5A 5JRJA 1KI1A 1IXZA 1G3UA 2BCJQ 2IYSA 4B33A 5L3QA 2GZHA 3CH4B 2C9CA 3CRVA 2RGGA 5E3HA 2I1QA 1OSNA 5CK5A 3KJEA 5DI3B 3GLHB 4URXR 1M7BA 1XMSA 3PUYA 5KOYA 3R20A 1NLZA 1W2HA 1P60A 3O8DA 1ZYUA 2Z5FA 3K0AA 3LQQA 1AQYA 1U9IC 4LZZA 4TL8A 3KX2A 2BWJA 2J45A 1YZGA 5A0FA 4TLAA 1P75A 2Z6VA 5JRZA 3LV8A 5G53C 4B2PA 1RFLA 4PO8A 2Q3MA 4DRZA 1GWNA 1MO6A 3AF1A 3BFXA 3V4RA 1F60A 1AZTA 1ZIPA 4IDHA 3BH0A 3OEED 2W6JA 1MO5A 1Q20A 1AGRA 4Z51A 3KXLA 4IDOA 4G5SA 1KOFA 3FPAA 1I4DD 5KYKA 1F3OA 2JLUA 2XNDA 4BASA 4LJAA 3CPHA 5FTLA 1NVVR 1U0HC 3IPXA 2ZRIA 2RAPA 3TW4A 1KK3A 3PUXA 4O2RA 1CR1A 1W36B 4QGHA 3AUYA 1DBSA 1H8HA 4QGAA 4NONA 2QMEA 2JDID 4NL4H 1OB5A 5FOUA 5K8TA 1LW7A 3PIRA 4HAVA 1KSFX 1N5IA 4LCBA 1MRNA 4TL6A 2G88A 1KHTA 3KUDA 2ZSFA 3PVSA 2JLQA 4EPRA 2ATVA 1ELOA 4BE7B 1MT0A 1OB2A 4CGZA 4NP6A 1FZQA 4UNNA 2AKYA 4URVR 4DIEA 1SHZA 4NYIQ 1T8UA 1BH2A 4N1AA 2ZRAA 1GRRA 2JJ1D 3W6PA 4B6FA 2ZYWX 4ESVA 1GSIA 3LX5A 1J2JA 1W46A 4YDSA 3K8YA 2ZVPX 3Q5DA 2J59A 4Z1MA 5LD2B 4F38A 3DKVA 3I8XA 4U02A 5EP4A 1WB9A 3AB3A 1Q1QA 4BFUA 5FL7A 4M2LA 2P65A 1G64A 4Q48A 5F9FA 3PV0A 4ZDKA 2G1KA 5FUYA 2X1VA 2FNAA 4EDHA 1YKSA 1GKYA 5FBWB 4A6PA 3GJXC 2XB2A 5EE1A 1J8YF 3QNUA 2RKOA 2WJHA 4C9BA 5KSOA 1G18A 4Z8XA 2J0QA 3SE0A 3A1WA 2J46A 5JSZA 2XOKD 3QG1A 3SQWA 5FOWA 1A4RA 1R5NA 2WKPA 5DIFA 2J87A 3EC2A 4MITA 4X8MA 1CTQA 2V7QD 3B7GA 2JATA 2NO6A 2E87A 4QNMA 5KPJA 4CEJA 3LW7A 2ZI3A 1Z6TA 4MGZR 2O8EB 1YHNA 4WXRA 4NCHA 3MJRA 1BYUA 5SZHB 3AVTA 3CNOA 2VYFA 1NNEA 4B2IA 3I1FA 2CLSA 2O0HA 4RD2A 3F5FA 1LF5A 3TR5A 3FVQA 4S2EA 3N2EA 5FR2A 1W0KA 5DN6D 4EJSB 1Z0JA 5LPNA 2F6RA 3JZAA 3LAWA 1XX6A 1OE0A 3BBPA 3OESA 3QF4B 4JLMA 5FTKA 2QZ4A 2B21A 1SVSA 4GP6A 5JHGB 4NYMR 2VH5R 2C77A 2WSSA 3B6EA 1M8PA 1P73A 2RMKA 4PQRA 5FUXA 4WBSA 2ZR0A 4IOMA 2IS6A 2AK3A 2AKAB 2WMOB 1TPZA 2O0JA 4Q1BA 3SYLA 1E9SA 1NVXQ 2WHXA 4MKFA 4WW0A 3D6TB 2ECKA 3AVVA 4FMDF 4B3XA 5BXQC 4JSTA 2P3SA 2R6GA 4KU4A 4A4DA 1VG1A 3Q85A 1IY1A 2YOGA 3PG5A 3EZFA 4RVCA 2CL6X 3SOPA 5E7MA 2AL7A 2LCFA 2VIIA 4BFXA 2IWHA 2JJ2D 4DIDA 2QMOA 4C3ZA 4ASUD 2WOJA 3V00A 1EFRD 2FOLA 3EAQA 1VYTA 3CX8A 2PLFA 2W0SA 1BOFA 1H8EA 4A0GA 3MRSA 3K0EA 1Z28A 3DZDA 1RJ9A 1FX0B 4IVQA 1N25A 5IK2A 4HB3A 3S1AA 4JIMA 1KJWA 3IIKA 3NC0C 3AP3A 3CNLA 4IEEA 4M1SA 4Q9JA 3K70B 3LRPA 4IRUB 2LKDA 5AJVB 3GLFA 5FTJA 4D4KA 4OI2A 2Q9AA 5L3RA 3ZS9A 2MSDB 3CRRA 5CDFA 4GOXA 1VHLA 3U3JA 2G3YA 3TSOA 4ZI2A 2GEUA 3T1TA 1GNPA 1XJQA 4DDWA 2B8WA 2DHRA 3OEHD 4ITRC 1EG7A 1ZCBA 2FH5B 2NZ8A 2W2VA 5B30A 5CITA 1LS1A 2NG1A 3B5JA 1S1CA 2GCNA 4AYTA 4D4MA 2CVHA 4PHTA 3H84A 2Q3FA 1OKKD 1ODFA 2O8DB 2IHBA 1WMSA 5C4MA 1S3SA 3Q5EA 1KO7A 3U3OA 1QG4A 4A8JA 2KI5A 3EC1A 4QBIA 3FMOB 4Q9HA 4NE2A 1D6JA 4DHEA 2IYXA 1ZNYA 5AUNB 2A30A 2IBMA 1QVRA 3HPRA 4LHXA 1I4TD 4TQUS 2YOHA 4N0DA 3I72A 5E7JA 4PPNA 1HH4A 1RC8A 4JKYA 4PSKA 3GQBA 2AK2A 3LNCA 4KJZA 2FPLA 1WF3A 1XP8A 4QHYA 4JLOA 4PPQA 2EFGA 4LBYA 2CK3D 1SXJE 4JJKA 4PHGA 3QKSB 5IT5A 3QKTA 2YNMA 3IBGA 5LDDC 4B3FX 3ZS8A 3B9QA 5D3MB 2O8CB 2W00A 1N6KA 2CHQA 4M1TA 3CWQA 4LDJA 4PAQA 4PSAA 3K0SA 1FW6A 1GDDA 3WNCA 4M9ZA 2BOVA 5HKKD 4RD3A 3QBVA 3QI2A 4E5UA 1HE1C 1UBCA 3Q3JB 4WA7A 2BJWA 1AS3A 4W5HA 3CB4A 1P61B 4TT3A 4Q47A 1IJFA 2XXAA 5EXTA 1ESNA 4JL5A 4JL6A 4I1SA 2JLVA 2JLYA 4U5XA 1F48A 3UKDA 1W7AA 4MH0R 3AVUA 2XSZA 1OW3B 4J0QA 1TF2A 2ORWA 3MFYA 1C4OA 3KZ1E 5GJCA 4OQFA 4B76A 3U4QA 2H92A 5FOVA 4KFUA 2GJ9A 4CF7A 5C46F 1GNRA 2QP4A 5CJ2A 4TMXA 2QTFA 1UM8A 3RRZA 3VKGA 2HJVA 2EU8A 1YVDA 2PCJA 1UFQA 2IWRA 1XPUA 3X1XA 1YZTA 4LC1A 1EWQA 1HEIA 1YE8A 2REXB 2QMUA 4AKGA 4HZUA 4MRVA 2YWEA 1UBGA 2GTPA 4GDFA 4JLDA 4A92A 2N46A 4TZ0A 1S0UA 4GZLA 3TUZC 3EXAA 4KFSA 1XEXB 2P2LA 2B92A 2X2FA 1FFHA 4P4TA 5LB4A 2RCNA 1AK2A 2WWXA 521PA 3O47A 4OBEA 3R9IA 5L3SA 4XTRA 3CX7A 2YWFA 3X1ZA 4MQBA 4JVNA 4ZO4A 3VKHA 1DAMA 1E9AA 1ZNZA 3P1JA 2C99A 3FGNA 3TSWA 1GTVA 4PFSA 3MMPA 1T5IA 1W1WA 1UEIA 2J7PA 3KB2A 1GVNB 3DPUA 2WKQA 4Y0AA 5SZJA 3KQKA 3PEWA 3PENA 5KNCA 2QP9X 4KAXA 1GRNA 5DLQC 3M1IA 2BVNA 5IF9A 1SVWA 3CNNA 4CDGA 2D2EA 2XITA 4NCNA 1G8HA 3T1VA 5TY0A 3VTKA 3O8RA 3U7GA 2ZJYA 1UDWA 4ZDWA 2ZPTX 3IILA 1OT3A 1U99A 2ZSDA 2F43B 1T91A 4IDNA 2F55A 1VYUA 3KTAA 2OEPA 1Z0KA 5FUVA 4QM6A 1KDPA 3BK7A 2C9OA 4GSYA 2WV9A 3QKRA 3TQFA 1NIPA 2ZRJA 2QI9C 3QOFA 5HTKA 2QEQA 3DKPA 3W5JA 4HAWA 3KKMA 2V54A 1Z2AA 3W6NA 4OQNA 5EZ5A 4DLWA 5JS8A 4FXPA 3VU9A 2KSQA 721PA 4WZAE 2QE7D 3MWYW 2IUTA 4HUQA 2IXEA 2NTYC 2ZITA 4K8OA 3ZVRA 2GDJA 1W0JA 1ZUNB 1MABA 3WBKA 2GVZC 3GEIA 3AKYA 4DEYA 3C15C 3B9PA 3NVAA 2GXSA 2ORIA 4Q4JB 1CP2A 2WAXA 1KMQA 3MCAA 4B74A 2V3CC 3DVLA 4OHYA 1F6BA 3SJCA 1R5BA 3BB4A 4GBMA 8OHMA 4ACAA 1Z0AA 3QKUA 4YLGA 2ZANA 3C7KA 1S9HA 4GFDA 1PUIA 2QAGA 2ZYUX 4O2LA 3SI7A 2W6ID 4KO8A 3JVUA 3U61B 1T4GA 2NO1A 5L8VA 2PMDA 2JLZA 4Q00A 4UNPA 1JPJA 4F92B 2DFLA 4PHHA 1AS0A 3L82B 2IYUA 1TQ6A 1X8LA 1JALA 2EWVA 2HEIA 1COWA 1U2RA 1DARA 3IHWA 5JFGA 3DZ8A 4X8LA 1GKUB 2AXPA 4TTPA 3ZIAD 3D3QA 3UATA 1KI9A 1GL9B 2AR7A 4MRNA 1Z0FA 2QL6A 1JR3E 2ZTSA 3SR0A 3I5YA 1VCOA 4C7OB 2MMCA 3PCRB 2DPXA 3THWB 1E0SA 1P7CA 3BWDD 4BPBA 2H7VA 2W83A 4JLVA 4MGIR 3GLGA 1G4AE 1WP9A 2ZEJA 2ZI6A 2VP5A 1BYIA 3R7WA 3GLIA 4CEHB 1OF1A 1XTRA 4D2IA 4Z54A 2WSMA 4OI1A 5IHPA 2HXSA 3KJIA 4RZ2A 2CBZA 1NJFA 5J4LA 3ADBA 1RKBA 3ND8A 2IS1A 1EESA 3SBDA 4BEJA 2ZJBA 4FMCF 2ZROA 1EX6A 2AFHE 1RE0A 1KO8A 4EAQA 1RVDA 1VECA 2PH1A 4FN5A 2ORVA 4LHYA 1E0KA 1II0A 2AXNA 1TU4A 4M4SA 2DYKA 1WCV1 3DOEA 4WAUA 4BFYA 3ETLA 3WHLA 3QY0A 3WBJA 3LBIA 4TMTA 3HR8A 4OHZA 4LK2A 1G16A 3HJNA 4Q7KA 3R8CA 2J9RA 3U60B 2IYVA 4JLNA 1OIXA 3W3AA 2OBNA 1NBMD 3BJIC 5FOSA 3SJZA 3A1SA 2IEYA 3AV0B 2GVDC 4OK3A 2CLDX 3NEYA 1GL7A 1TUIA 4NU0A 4P32A 3CKLA 3GFOA 3MSXA 4Q1EA 5J40A 2ZIAA 3A4LA 3GEEA 4EPTA 1OXVA 1CIPA 5EE3A 3VR2A 4NH0A 2ATXA 3AVXA 4ZIRB 2IUUA 1P2UA 4QM7A 2ZRDA 1QHHB 1S9DA 4PPGA 2IYRA 1M1YE 4RFVA 3IEVA 1E2JA 4C0KA 3OE7D 4TYPA 1PVOA 5JJKA 3O8CA 3FMIA 5HCNA 2QBYB 4NMMA 2FEOA 3TSZA 3QPUA 4MKIA 2IYQA 1G3RA 4B73A 3SNHA 4KODA 1ESMA 3PUWA 2BBSA 4JYBA 1G41A 3MD0A 3BOSA 1E2DA 5TMPA 2BEKA 3GJ4A 2G0NA 4B47A 4QKQA 4TQ9A 3E2IA 1M7GA 2KBFA 3OEEA 3AGQA 3EZ7A 4ERNA 4JSYA 2F1IA 3NC1C 1AJEA 1T6NA 4PXAA 1IJEA 1E98A 3OF5A 1NKTA 3THXB 2H17A 4Q4AA 3U5ZB 3AF3A 3IIMA 3L2OB 1SXJB 3VX4A 1KSGA 4IVPA 3P20A 3U7EB 3CR8A 1XJCA 5GVRA 2QU8A 4OK5A 2GK6A 4LWZA 5TXGA 1KIMA 2QUZA 4DDUA 3QSYA 1C1YA 4V0NA 3SHFA 2JDIA 1CF4A 3M0EA 1GFIA 5IRCD 3QVVA 2BV3A 4OL0A 1NG1A 3MWJA 2GEDA 2CCJA 4GPTA 4TMVA 3H0KA 1CR4A 1NF3A 3OIVA 4A8JC 5F3WB 1MR3F 3EWAA 3K53A 3LXXA 3RSLA 4BLPA 3LDAA 2ZRBA 1JECA 2ZRFA 3HYTA 2GCOB 2BIFA 4G01B 4KYIB 2OXCA 2G83A 4IOKA 3L0OA 2OSBA 3MAAC 3F3YA 4KFTA 2BKEA 2SHKA 2ZS9A 1ZM4A 2JJ1A 2BHRA 1U8AA 4Q9LA 3D31A 2NO7A 1K5GA 2QPTA 1BMFD 4R2IA 2ZE6A 4GZMA 3I4LA 4QL3A 4TL9A 1ZW6A 1R0WA 4P33A 4LV8B 2L0XA 4A0HA 4EPWA 4OQXA 1DO2A 1NMXA 5AUQA 4R7ZA 4EFNA 3B8HA 1RRGA 2BM1A 4HEJA 1P6XA 1U0JA 3FE2A 3ONWA 1AZSC 1OJLA 2QQ0A 3ZJYA 3PFIA 2GJ8A 1NSFA 5B58C 1T5LA 1DG3A 1E2MA 4IVRA 5EE5B 1Z6AA 3MG9A 2ZJOA 2ZUCA 3O8BA 3TJZA 4PZZA 2BKUA 2G77B 4QJ3A 1UKZA 3LBHA 2VSXA 3T5DA 4CW7A 1N6OA 5DGXA 4EQ6A 2XEXA 1II8A 2ZYVX 4L8GA 2ANBA 1LY1A 2XOKA 3B1WA 3BIFA 4I81A 4N0EA 4GP7A 4MKGA 3U2QA 3EA5A 1DAKA 3K0FB 2OM2A 3SDZA 2V7QA 4A2QA 1EX7A 1QRAA 1I2DA 121PA 3N5CA 4NYJR 1FOEB 2XTMA 3AF0A 2GJSA 3FHOA 2F3TA 1BS1A 4DJTA 1R4AA 5KSZA 5EUMA 3NH6A 2VTKA 421PA 3C8UA 3CF6R 3ND9A 1RYHA 2IYZA 2ZAMA 4KSBA 1M2OB 4K81B 4LGMA 2D7DA 1KDOA 3LO5A 4HB2A 5F98A 4LHZA 4XVQA 1A5TA 1YQTA 1J90A 3K9NA 4X8HA 4A1FA 3ASYA 2OT3B 3QEOA 4Q1FA 3BRWD 3FYHA 1E2LA 1JEEA 4DT1B 2ZJ5A 3IGFA 2IT1A 4HLUA 2ZJ2A 2HLDD 1V5WA 3NBZC 1KO1A 3W8NA 2OFWA 3I92A 4MA4A 4Q9IA 2Z4RA 5E7IA 2GF9A 5EP3A 2FPKA 3TNFA 3EZ2A 1XXHA 2WJVA 1P9WA 2HT6A 4P4SA 4TYNA 2QROA 4M8NE 2HF9A 1AN0A 3LVRE 1CJTC 4BECA 5DO9A 4DZZA 4AD8A 2OCPA 2EWWA 2QA5A 4WOPA 2JJ2A 5AJZA 4A0RA 3UMSA 4M1WA 1EFRA 1ZUIA 1E79D 3CBQA 2R6AA 3A1VA 1E2HA 3LXRA 3WNDA 1U8YA 4YONB 4KBFA 3WYGA 3WYFA 3THYA 2NGRA 4OJKA 2NIPA 1IXSB 1G5TA 4M1YA 5CJPA 2EFHB 1UF9A 2DFNA 2F9MA 2CCKA 3BGWA 1Z0DA 1E9FA 5DHAA 5AUPB 3K0CA 2OG2A 2PZEA 5KSYA 4FMCB 4UNSA 1TL7C 4DCNA 4TMWA 4FMBB 1NLYA 2GXQA 2WZQA 4OI4A 3TLXA 2CNWA 2C04A 1LVGA 5AWFC 4KSCA 4HAUA 4CZ2A 2CJWB 3HDTA 3OEHA 2CCGA 2ZVQX 4I1UA 1IXRC 1PJRA 5JEDA 4GOJA 4MYUA 3QJYA 4OHVA 5JJLA 1VKJA 2YVUA 1ZM9A 1XTIA 4RKFA 3ZVNA 3I62A 4DCUA 4E09A 2P5SA 5FL3A 2REOA 1OKKA 1U94A 4GT1A 3U44B 2WJIA 1E32A 2PEYA 3HYRA 4XWAA 4EKDA 3M6AA 3K09A 4ZPXA 2UKDA 2QAGC 3A58B 3IDQA 3Q7PA 2V6JA 1XCPA 1CR0A 1PUJA 4XVUA 2IF0A 4KLZA 1NN3A 1SHKA 1XZQA 3R8FA 1XFAA 2JIZD 3NDBB 1NI3A 4PAMA 2PLRA 4LRWA 1IN7A 2NO0A 3U3RA 4AK9A 1OYWA 3AEZA 4IXMA 5JBQA 3C14C 3RS0A 4V02A 4D4JA 2VP2A 4M1OA 4DLZA 1DAFA 2QP3A 3VNUA 3IHLA 2HT1A 3FHTA 4FINA 3QUSA 1ZM7A 4GRAA 4Q4HB 3RHFA 5J4HA 4TYYA 1AM4D 4AURA 1NVWQ 4A82A 3K70D 1KI6A 1OH7A 1F2UB 4Q5IA 2FX3A 1XTQA 3B1VA 1ZM2A 4LYAA 2CK3A 2ZRCA 3A4NA 4JBXA 1D9XA 5CYPA 2WOOA 1AKEA 3BE4A 2F7SA 4Q4LA 2I3BA 4PSVA 4DCSA 4HAZA 4KHZA 3W90A 1FP6A 1FTSA 4B71A 3P4XA 1K6MA 2V1XA 3QXXA 4LV5B 5HKKA 2EVWX 5TB5A 1Q1BA 3WNBA 4QXAA 2ERXA 4HUTA 4H1UA 4F7WA 1NN1A 4V0OA 4UKDA 5HPYB 4LPKA 2YJTD 2R65A 1Q1EA 2X19A 4LJ6A 1JAIA 5AJXA 1YZLA 3AH8A 3T15A 2EQBA 3GJ0A 2OILA 4TMKA 2CE7A 1X86B 4BFSA 1W4BA 4JS0A 2PJZA 1ZD1A 4LC0A 1ETUA 5KSPA 4PZYA 3AKDA 2A5YB 1V43A 4LBZA 2FFQA 4AIIA 4FI3C 4E22A 5KDDA 3GJ6A 1RYFA 1KAGA 2X77A 1US8B 1S96A 1TF5A 4NKRA 4US1R 4OHWA 1QVAA 1VCIA 1D2NA 1JXOA 4BLTA 5ANRB 2V1UA 3QXCA 4YXWD 4LJ7A 4Q1CA 4LYHA 4IEIA 3QG5A 2OCYC 5BW8A 4V0MA 1VMAA 3G0HA 4DLRA 2QM8A 2QT1A 2N42A 3KQLA 4ESHA 1OFHA 2QRZA 2VSOA 4BFWA 1ZMXA 4KLNA 1J99A 2RGAA 1E2NA 1MV5A 1SULA 3GLFE 2YZ2A 1XD2A 2A5DA 2KBEA 3TK1A 1TQDA 2HYIC 1DAHA 5CDFE 2ZRLA 4TL7A 3FMFA 2QT0A 3TKLA 3KB1A 1OHHD 4ABYA 2LKCA 3CX6A 3EPHA 2WWHA 3A36A 3SYNA 2R6CA 4QHTA 4M9QA 1N5LA 4MYCA 1TEXA 1CLUA 2ZJAA 3Q7QA 4JLPA 4BLOA 4QJ5A 1VG9B 4LYJA 3MLEA 3CM0A 4BGDA 1P5ZB 4WVFA 3T5GA 2QSZA 3GMTA 4Q21A 4BLRA 1Q1ZA 3DL0A 4LBWA 3AVOA 4CYMA 2XGJA 3W8RA 1KI4A 4TLCA 2WIAA 4QG7A 4MGKR 1GIAA 1U0LA 1BO6A 4XSGA 4C2UA 5H70A 1F2TB 4W9MC 1VDZA 1W5TA 2YINC 3QQ5A 4JJZA 5K8LA 2OFOA 5JCZA 2FMXA 1N5JA 4NCIA 4XSHA 1HT2E 2OZEA 4Q03A 5SZKB 1Z2CA 2ODNA 4RFSA 3RWOA 5J4VA 4I4LA 4YC7A 4NBSA 3U7FB 4D25A 1P4SA 2WVJA 3BORA 3ICQB 1KMHB 3QVUA 3F0TA 2QE7A 1NY6A 4MYTA 3GFPA 4OQMA 4JZKA 2NPFA 1KI3A 2NMVA 4GMDA 3ADKA 1MRSA 1N6HA 2IXFA 2JLXA 2O8FB 1T3SA 1E1RD 4HYYA 2IYWA 5FTNA 1X8JA 1G4UR 3ZH9B 1FNNA 4HLDA 2ZI5A 2XZLA 3L43A 4PC3A 3ECCA 4BZPA 5L3QB 1XTSA 4LOAA 2NQ2C 4Z1MD 4C0JA 2TMKA 2O52A 2WWWA 1VG0B 4D0LB 4L4UA 2O8BA 4LJ5A 1A7JA 2ERYA 2W6IA 2P6UA 1YZKA 3SS8A 1T3HA 2GHIA 3MGCA 4PC1A 1J8MF 3HU2A 3W3ZB 3K0AB 4L9SA 3ZQJA 1W49A 3AVPA 1XD9A 2C78A 5FBVB 2QTVB 3QENA 2IS2A 2GF0A 3FFAA 4TTRA 4ARZA 1RPZA 1DO0A 5HZHA 2K5UA 4LX0A 3WMFA 3ZIAA 1ZVQA 1Q22A 1P2TA 3C41J 1LNZA 5FI0B 2BDTA 2FA9A 2QRNA 2QNRA 1KTVA 5JWOA 2ZUBA 4XD7D 1HYQA 2VRWA 2GA8A 2HJGA 2GRJA 5SZIA 4CEIA 2ZSEA 1XB2A 4G5RA 2J0UA 5FPTA 1Z07A 1KGDA 5P21A 1EXMA 1W0KD 2OHFA 4HB4A 1L8QA 5TDHA 4Q18A 3RWMB 4DSTA 2D3WA 4HLQB 4QRHA 2QY9A 2EW1A 2PEZA 1Z08A 3A6PC 3E5HA 4RZXA 3CZQA 1YR8A 3FTQA 1A82A 2Z0MA 5GADl 1ZINA 4FW9A 4HLUC 1G8YA 1A2KC 2NOAA 4I1OA 1KJYA 4LI0A 4TTQA 1YZNA 1T3LA 2ZAOA 4DSNA 2AN9A 1NBMA 2ZYTX 3GJ5A 4HAXA 3GP8A 4II7A 2GBLA 3B1ZA 3CRW1 2P0EA 3TBKA 2J3EA 4DDVA 4YDHB 2VF7A 3HP1A 4PX9A 1IHUA 1I2MA 5BN4A 3RS7A 4NHOA 2GILA 2ZE7A 5ELXA 3R9WA 2HXYA 4FD2A 4PQYA 3BB3A 5F9HA 4PPFA 1VYVA 1G3MA 2GJKA 4W5JA 2WMNB 5EZ6B 3AKCA 4KXFB 1P3JA 2Y8EA 3MWLA 3UANA 3FFBA 3ZZTA 1YRBA 3OHMA 1E2IA 2FGKA 1UADA 3OE7A 3SC3A 2XTZA 2JGNA 2ONKA 3C16C 3NBFA 1G21E 2FN4A 5IK2D 1PLLA 3V9PA 3NKVA 1YR9A 2F1HA 4A36A 3NWJA 5JSZB 1GAJA 3PEUA 4RD0A 1R0ZA 3DHWC 2FJUA 4A2PA 2ZJZA 2RGNA 3K0CC 3VKWA 3LH5A 3TQCA 1II9A 1E2EA 1TAGA 5C4GB 4DXAA 1R8QA 4WZBE 2NZJA 3RANA 4MUAA 4PHFA 4CEJB 5CM9C 4D4LA 4TSFD 3GD7A 3REGA 1G5RA 1J7KA 3RDPA 1XWIA 1GM5A 4E03A 2F1JA 1EWRA 4B48A 1XEWY 4KV9A 4NYIR 2OE2A 1NVVQ 4AC9A 4FIDA 4M22A 4A15A 1DEKA 1FMLA 1G6HA 2VL7A 1N6NA 3RLFA 2VO1A 3RAPR 1GZSA 3BH6A 4JYCA 4OQLA 2LWIA 2IA5A 1U90A 1PLKA 3LQRA 4F4IA 4TYWA 5DI3A 4L9WA 3K09C 1QF9A 3GLHA 4Q7JB 4G1UC 1Q0UA 2I4IA 2YYZA 4MDFA 1QHYA 2WM9B 2XJ4A 3VMFA 4E07A 2DFTA 4DB2A 1G3IA 3GJ7A 1OXUA 2OCAA 4ZI3A 1VCMA 4WIAA 3FWYA 3AF4A 5CLQA 5EP1A 5JWHA 4RD1A 1D2MA 3DMDA 3GLGE 2IXGA 3KXIA 3I73A 4KI0A 4PC6A 3GLIE 1KK0A 1G7CA 1KO4A 3KXKA 2PZGA 3LA6A 3NH9A 2JLSA 1CULC 3TR0A 3LVQE 1CR2A 1E94E 4B75A 4S35A 3UWOA 4DLSA 3R9XA 1ZAKA 3FOZA 4JVMA 4LYFA 4XTCS 3EIHA 1QDEA 1ZBDA 5FBRB 1Q21A 1E2KA 2EYUA 5J47A 2FSHA 3T06B 3DMNA 3ZVLA 3ZZ0A 3ZLJA 2C96A 1SXJD 1Z8FA 1JBKA 2GZDA 2IC5A 4Y0VA 3T34A 1RJ9B 1N0UA 1SZPA 1UBFA 3LFUA 4PAOA 1KSHA 2P67A 3S1AB 4YMWA 5JI3E 3U7HB 1IM2A 1UKYA 3AF2A 1C9KA 2VSFA 1Z6YA 4L15A 3NBXX 4OYHA 3W5IA 4G3XA 2FFBA 4MRRA 2Q6TA 3GLFB 2IL1A 2YV5A 1P62B 2Q0HA 1W47A 3KJHA 2CVFA 4B2LA 4PO9A 4BEBA 1E0AA 1QG2A 2JASA 1L4YA 1K5DA 2GJAA 3QPWA 2MSEB 3AQ4A 4TQAA 5EUQB 4AWXA 4DB4A 1X8KA 1ZUHA 3TGPA 1WBDA 2BM0A 3BERA 4URZR 1YJ5A 3AP1A 3T35A 1FUKA 2QENA 1GOTA 4PANA 1NJGA 2GAOA 4NYMQ 3RS5A 5BYKA 4CVNA 1GL6A 4H1VA 1OYYA 2Z43A 3AP2A 5KU1A 2OLJA 2JLWA 1WBBA 1U98A 2HLDA 4URYR 3RS3A 3B85A 3NHBA 4D80A 3KKQA 2BBTA 3TVDA 4A8JB 3UK6A 4JL8A 5CM8B 2VHUA 5CIWA 5HE9A 2BEJA 2CXXA 1UPTA 1FTNA 1UDXA 2QORA 3EIEA 1G7SA 2RH5A 2C2HA 1DVRA 4G0NA 4RCZA 3VX3A 5JJIA 2QSYA 3EX7C 3IUYA 2PX0A 4B35A 4YQFA 2YHSA 2GXUA 1IONA 4G5GA 4R71A 3SJAA 4DKXA 1B23P 1KK1A 1E2QA 1LB1B 2OUKA 5KDOA 3BB1A 3CPJB 4LV6A 2QPOA 4XWKA 4QC2A 3OFND 2O8EA 4Q9KA 2FV8A 4C0HA 4WXPA 1E79A 2D62A 1RZ3A 2ZJ8A 1XD8A 1XZPA 3SFZA 1KI2A 2G1JA 4DUGD 2UVQA 3VR5A 3A1TA 5FOXA 5DYGA 3W34A 5GJWC 3UPUA 3SQXA 1S1MA 5B57C 1R0YA 1R6BX 2O0KA 3KKPA 4EJSA 3ADDA 3VR3A 1KYIA 3K1JA 1E9EA 2GCPA 3HWSA 2FGJA 3QF4A 1M74A 3A37A 2OXRA 3A4MA 4YMTA 1MH1A 2XXAB 2YC4C 1DAIA 3RSOA 4DCTA 2AD1A 1TF7A 2EFCB 2JJ8A 1KAOA 1EFUA 2J7KA 2BBOA 5TV2A 4RY2A 4F4JA 5J4KA 5KHOC 2DR3A 1VG8A 1ZU4A 5BN3A 1ZNXA 3SYKA 3U4QB 2Z83A 4URUR 2O5VA 2Q3HA 4JVSB 1W5SA 1PV4A 3IO3A 4QOSA 3QEJA 5G40A 5TVKA 4EPYA 2JAQA 1Y3AA 2XAUA 1XPRA 3CPEA 2FFHA 1WE2A 1P2VA 5FPSA 1UAAA 4BLSA 2AWOA 1N0VC 2ZREA 4O3MA 3PJRA 4Z8YA 1G8FA 1LF0A 3I5XA 4HZUB 4UJ5A 1OFIA 2DBYA 2VHQA 1SVLA 2R6DA 4A0FA 4R98A 2H8KA 4C0LA 3I61A 1W44A 4URWR 3G5UA 5EQTA 4FCVA 1Z22A 2ASEA 3HR7A 1AKYA 3SZRA 3VHLB 3WHKA 1E1QD 4BWYA 2D2FA 1YZUA 2JIZA 5L3SB 5FI1B 4AKEA 1UBEA 1L4UA 1E9DA 4QGGA 5JMTA 2GESA 3VNVA 1FX0A 4DLUA 5DSZA 2UZIR 2ZR7A 3KDSE 3X1YA 4AG6A 1SKYE 4C0BA 2PZFA 3BXZA 4DDTA 3ZD7A 4US0R 4EFLA 3TVTA 1IAQA 1D9ZA 1KNXA 1L7VC 3E1SA 4Q66C 5C2JB 1XMVA 2A5JA 1OLOA 2E9SA 3ZYCA 1HT1E 1KK2A 2BC9A 1XTKA 1G5PA 1JQJC 4IKEA 2WWGA 3U3MA 1W4CA 1NL3A 3UMFA 1KO5A 4XH9B 4B6EA 2B8TA 4M1KA 4XIGS 3GJ3A 1JPNA 1JR3D 1XTJA 3EIQA 3K9LA 3LW8A 1ZP6A 1ZNWA 5HE8A 5EJEA 2JA1A 3A8TA 4MRPA 3CRQA
chains in the Genus database with same CATH superfamily
5J5VA 4LYYA 1ZISA 3FCYA 2VBCA 2P75A 3L49A 4G5OA 3USCS 3DONA 4C4TA 3O8QB 3TM4A 1CQJB 3BXOA 4EVRA 4H1WA 1P8AA 5KVVA 3D59A 4XASA 2O2JA 3LXMA 2BCGY 3IV6A 4KVZA 5BUZA 5HKOA 2CXPA 1NI4A 2H11A 2QV7A 3MBOA 4PYOA 5ERXA 2QQGA 3DBLA 2H5EA 3EQ8A 1R0LA 2YHUA 4QSMA 5G4KA 1E5VA 5I9BA 2P4QA 5EIWA 1G0OA 1P0IA 3K9FC 3I8OA 5JV5A 2CWWA 1XQXA 4G26A 4U9UA 3TMAA 2GBFA 3UZUA 3UWKA 3FPGA 4MA0A 1SUIA 3RW9A 3JZDA 4GE3A 1EWYA 1ZICA 4YP0A 3QFTA 1M2JA 3W1EA 1B73A 4F4UA 4IFBA 4YAOA 2OUIA 1TQ2A 1TTPB 2GBLC 5AXCA 2CHVA 4FLMA 4HXFB 1TMYA 4MW1A 4JX9A 3F73A 4Q24A 4WZBB 2UYYA 5LDGA 2XDWA 2VUIB 3IDFA 3R7BA 5EE0A 4DJJA 4RZUA 1OH6A 2MWMA 4P86A 1JHDA 5F2EA 2ZJ6A 4D82A 4DSUA 5GGYA 2JEZA 4RKYA 3VO2A 1Y9ZA 3SXUA 1K75A 2GZMA 2HJSA 3UGJA 3FKQA 1NOIA 3QIVA 1KH1A 1EP9A 1QTRA 1VMIA 2QZPA 4GG1A 1A2OA 3JD0A 2OBMA 3RJMA 3TXYA 3NHRA 4M37A 3A6LA 4BQEA 3UUGA 4DC9A 3HBFA 4G8JA 3MAJA 2LV8A 1JB1A 4GU5A 4GE0A 3TZBA 4M3NA 3ZD8A 2AKEA 1IY2A 3KJQA 5C1BA 1HNNA 2KPOA 4XJXA 5BSGA 1OHHA 3GAZA 2VP9A 3GGDA 1PP4A 4CR7A 4HDRA 5JS7A 1HFJA 3GRRA 1M1NA 1Z4QA 4P3OA 4BJ5A 2UU9B 2VJKA 5BMVA 4G23A 1BWQA 1FC0A 1ZD8A 2CLCX 3CNBA 4UM9B 3DKKA 2ZETA 2RGUA 3M6MD 3OETA 4HMQA 3GLGB 1B1AA 4UHDA 5LB2A 2R6FA 1QU2A 4TYQA 2CXSA 1CUWA 4QT0A 4CV2A 4DLKA 1DELA 4MW5A 4C0AC 2JFYA 3GCDA 3D5EA 3T99A 2PX8A 4BVAA 1UMDA 3PS9A 1I13A 1VP9A 3A1UA 1N2IA 4KQ2A 5AK5A 5I3ZA 1R0SA 4WE3A 1PUXA 3AVQA 1YRAA 2VAXA 4BWFB 4YCNA 4OUDA 5FWYA 2DBRA 1QHNA 1X2EA 3M4NA 1PKEA 1KMMA 4J0GA 4XYMA 2IBTA 1XA0A 2AOTA 4S1VA 2ZI4A 3DMFA 4ROTA 5E38A 2RB5A 2BEVB 3Q9SA 3VR1A 1TNDA 4RTRA 3DOIA 3N2KB 1J5PA 1A88A 2P27A 1Q3HA 4R1LA 3WV5A 1DADA 4YMIA 4M21A 3D4PA 2ZI9A 4WXYB 1O95A 1FDOA 1YU9A 2OXFA 3QHPA 4NS4A 1T2VA 4IHJA 3UHOA 1BGXT 1UDAA 3A6JA 3D3JA 3GC6A 3HGQA 1O97D 1WNTA 3MUFA 4CXMA 4TTIA 3G8CA 1ZHOA 2NSHA 3ED1A 3NXSA 2DQ4A 2HQOA 2LRHA 3JWHA 3L18A 4IXNA 5LDHA 3OM0A 3BBLA 3TE6A 5G1OA 2FRDA 3PC8C 3KQUA 3ZV7A 2YBEA 4KBGA 2GJ4A 1EK0A 3EA0A 3M70A 3WWZA 4ITVA 4IMIB 3IAS1 5IN5A 2PFGA 1UAYA 2CWDA 3L8HA 4RDIA 5HZMA 3H04A 1N1EA 1Y9AA 2N9UA 2I1VB 2VHYA 3DDSA 3WL7A 3GOHA 5F52A 3A1CA 3NMUF 3DEFA 5EPOA 1T35A 3SMVA 1PZFA 2EP5A 3JRNA 3OWHA 4F4CA 3FKSD 1E6LA 3TL6A 3DMTA 1UXHA 5IJ9B 2WAMA 3IA2A 5FLKA 1NIJA 5B2EA 2GFHA 3I30X 3ELWA 4XGRA 1QK3A 4ZVOA 4C7XA 1DLIA 1F9AA 1R1DA 1UCFA 3HDQA 1HWYA 4MYSA 2K4MA 3VJLA 4Q7MB 4KR6A 4LAFA 4K9MA 3JYOA 1KH3A 4Q37A 3SSMA 1XF1A 5IS2A 3F8TA 4M8KA 1XZIA 1APBA 2QRPA 2IPNA 2C9YA 4AIRA 1PSZA 2ZRHA 3ZNOA 3EIXA 4GXNA 2J0VA 1FLVA 4R01A 3KJGA 4D3SA 1L5HB 5BV2P 4MJ3A 2WKSA 1OVMA 2HW8A 1FUUA 1DE0A 2Z6UA 2BH9A 4PZPA 3CF4G 1QK4A 1XNHA 5FPKA 5JPCA 3CMCO 3JQFC 4OYRA 2Z4SA 3UCXA 3MJHA 1ZUNA 5D3QA 1PFGA 3ZDQA 1IN8A 1X80B 1YULA 3NGMA 4YP1A 2WIFA 4ZKDA 1WHTA 4Q4AB 5KTYA 5EIEA 1G9TA 3EG9B 1J0EA 1MA0A 4TLEA 4EG6A 3EEQA 3KYBA 4XJVA 4Q4JA 4V0ME 3DHEA 4E32A 2OXEA 3GO4A 1W5EA 2R11A 4II3A 2DE0X 1QQBA 5B7GA 2RHGB 2JANA 1H94A 1RQLA 1THTA 4ID3A 4X8OA 1EXWA 2G9QA 3EULA 5FO1A 4PV7A 1ZN7A 5EMNA 2OO5A 3F4LA 1XN1A 1XF9A 2PUHA 5AK4A 3NUZA 5G1NA 3E84A 5FNVB 1SBHA 4DVGA 2B61A 4A16A 4ZDIA 4PSUA 2BFCA 2PXXA 3DCJA 3NVMB 2HEGA 5CYOA 3TE7A 5FWNA 4HDQB 3NYRA 5CLGA 2ZU0C 3P32A 1QHGA 2ACVA 1WLYA 4O63O 1XAHA 1NSTA 5AQ1A 3RB8A 5KO2A 2HMSA 2RARA 1NULA 2QUKA 3LS2A 1O08A 2YS6A 3LWZA 1U8ZA 3IE0A 2BGJA 5FLXA 4E51A 1DX6A 1DRJA 1N7IA 2PQMA 3IQEA 1DWUA 4FHEA 3FYSA 4MPTA 2FG6C 1BGWA 4RMNA 1CIVA 2C03A 5EFOA 4DV4B 1M8FA 3WAGA 5ENZA 1FNCA 3THWA 1J24A 1YZYA 4GLOA 4D96A 4I4TA 5AM4A 1CR6A 5FP0A 3NHZA 3RC1A 1ILWA 4BP3A 1LQTA 1ZGHA 3NIDB 4LJLA 1KNQA 3TW8B 3ZWBA 4DMRA 2WBLC 3A6DA 4UXJA 1P80A 4YJFA 4MGYR 1E2UA 4E88A 1EP2B 1MKYA 2NUAA 3SZ3A 4YREA 3Q40A 4V1CI 1YWGO 1CUUA 2IY9A 2OD9A 2BCEA 3DL7A 1I4LD 4KAFA 4O2AB 3W5CA 5G3ZA 2PBZA 5C1PA 4LWOA 3KYJB 1ZSVA 3ESDA 4OHXA 1KI8A 2W2OA 2I3AA 4M0CA 4RCYA 3ZGXA 4ER6A 4LOIA 2B9EA 4UDYX 1HZZC 4HAIA 2HFKA 5DHFA 2FCAA 1VI2A 1C81A 1II8B 1J5EB 3TSYA 2QPAA 4YMVA 3T7RA 4MYRA 3IDOA 4XSVA 3VU3A 3BJEA 3NRBA 2BL4A 4PLCA 4YAJA 2R8XA 2EGHA 2Y9MB 3ETGA 4QBKA 5HCIA 3ZQUA 5BNTA 5CB8A 5I48A 5L3VA 5JTUA 5HRUA 1GPYA 2O6HA 5D6OA 4ML3A 2GI4A 4DAEA 3G68A 1XU9A 2DBZA 3ROPA 3TLAA 3ENQA 4G5YA 2PXCA 1FXWF 2VWPA 2QF7A 2X9GA 1G42A 1XRRA 2B5WA 2OGTA 4DIMA 5G1PA 4BP8A 1DQPA 1IBCA 4KIWA 4NRDA 3NRCA 3IKJA 4KN8A 4O4IF 5LLSA 3I37X 3WRXC 5JCXA 2KJQA 2EKZA 2QNIA 1TYEB 3G0HA 4RTJA 1H0SA 2P2NA 1JAHA 4UNRA 3WGIA 1CEXA 4KXXA 2YIVX 4B3CA 4ZIRA 5JS2A 3WWPA 4FGKA 1DIHA 2AN3A 2YR0A 5LA6A 1WRBA 3QIAA 2AE2A 3HO6A 4EKNB 3RAFC 4TPKA 1VIYA 2FR8C 5DTRA 1E77A 2DBQA 3VKUA 4PQEA 3HS3A 4UJ3A 5IDVA 3CRMA 1LI5A 2DWPA 2QG6A 3K9HA 2XTNA 1FVOA 1S8OA 3I6IA 4QYIA 2QSUA 2Q29A 3WL8A 1NP6A 1ZJ6A 3MB5A 4JMLA 4LJ9A 5LP1A 3OTGA 4OJQA 1P5RA 2C8VA 4FKZA 4R31A 4BMDA 5JHHB 3OOEA 5KOJB 5DKFA 1W73A 3AUUA 4O25A 4JT2A 2OZPA 2IXDA 2CHFA 2JZOA 3KELA 4P4NA 1TEHA 4QGFA 5IJWA 1XJWA 3RBAA 3QXJA 4TUYB 1FYDA 4HAYA 3B1XA 4X97A 2PV0A 2ZXUA 1TO1E 1WAMA 2ZVJA 3C5EA 3ONDA 2ZYSA 2ZQYA 2NX2A 3PWTA 4K9DA 1S5PA 4ZANA 2H4JA 2JFVA 1GKIA 1T29A 1XU4A 3C6BA 4IIYA 3H7AA 5H7XA 1YGPA 1MPTA 1NVUQ 1TEVA 2R97A 3Q7TA 4H59A 4TS1A 2IK8A 4KDRA 1U9CA 2NNLD 3I9NA 2QYSA 4JFAA 3LC7O 1SNYA 3RK1A 4GP9A 4D9EA 1BDJA 4QYSA 4NI5A 2JH8A 5FA8A 2IQ5A 4ZCMA 1C3OA 1SXJA 2D2XA 1PVOA 1O4WA 2VA8A 3L7AA 3SJBA 1X7YB 3EVTA 2G28A 3OLCX 3FXAA 5TARA 2VHEA 1EDOA 3AONB 5F35A 5BOSA 5DBHX 1P72A 2Z3VA 1I30A 3WGZA 2M1ZA 4FWTA 4OIFA 2RFLA 1Z5WA 5LQCA 2AEEA 5LNK1 3SOZA 4IZHA 4M7OA 1UPAA 3UXMA 4WOJA 3F8WA 3VHXA 2BJVA 4I1VA 4M53A 4EIWA 2JF0A 3BWBA 5T67A 2J0SA 1TVCA 4EWLA 1GUAA 2GEFA 2RB4A 3FZNA 2P5TB 3ZWNA 5LN1A 5LQSA 1XLWA 1D1TA 4MUJA 3SLGA 2GCOA 621PA 3BCRA 5DP1A 4O1IA 1QANA 1VTKA 1ZH2A 3L0IB 3LU1A 3C5CA 2HMTA 4FC6A 4LKOA 1T6ZA 1OZ0A 1OX4B 1KQPA 2A3NA 4PVCA 4B43A 3BYZA 3NDIA 2WJJA 1WXQA 5KC9A 2B37A 2YKGA 4FCWA 1GKKA 2FPMA 3PIIA 4XEUA 3NTVA 2ZT5A 2B7CA 4XQ9A 1PX2A 4A8TA 5LKAA 3QNWA 2ZIFA 4J2OA 4BVFA 2ZS7A 1JHQA 4MMZB 1E5QA 4PO1A 1CJMA 1MJGM 4LF7B 2QTBA 1NVDA 3KJFA 3MWFA 3PQ4A 4WFJA 1N2SA 2ID4A 5TJHA 4UFOA 1ZMBA 3UW1A 4BJ3A 5KBYA 3FZQA 4QECA 3I1IA 4FNMA 2JBWA 4C1NA 5A4JA 2F9LA 3BHNA 4B3TB 2II6A 3BZBA 1R0XA 1U9IA 4IDCA 1Z0IA 3BH7A 2O7VA 4HVCA 4Q3BA 1IHOA 4QJIA 3KE8A 2PBRA 4HGNA 1KMIY 1FFAA 3QNMA 2AE1A 4OB6A 1KRWA 1PK9A 2BFFA 4WNAB 1KE1A 1WUHS 4CFYA 2ET6A 4FGZA 2NNWB 3VR6A 2Q9CA 4EW6A 4ZN6A 1Q92A 2VJNA 1VBNA 1KI6B 5K2OA 5EXXA 1VXRA 1ZIOA 2PL9A 3ASZA 4G07A 3AHDA 1FBTA 4C6TB 4EUFA 1XP5A 4B85A 2VTEA 1RAFA 2O2ZA 3OQJA 4HNQA 3UAVA 2TMGA 5SY9A 3WLQA 1OXMA 4J94A 4OLBA 2DFVA 1ZI8A 4UOQA 3MWGA 3M2PA 1VI5A 3EPPA 5CT9A 2PL5A 4QOIA 1Z8DA 3V42A 2WW8A 3NYWA 2G9RA 1AUVA 3COPA 3GLHE 4WUTA 3SIXA 2KX7A 2DKFA 2XE8A 5J2UA 3G2KA 2CF5A 2XVMA 3ETEA 3O31A 3L0YA 3DFZA 4BYMA 4IJMA 4DYHA 3EXHA 2Q5OA 1Y5RA 4JMPA 2R2AA 3ZLBA 4QQKA 2PX3A 5E4FA 2ACKA 4CKEB 1WUJS 2NU7B 3FJOA 4CM3A 4DT1A 1A5SB 1RZRA 1SCIA 5IDXA 2GXAA 1V7CA 1SGWA 221PA 2E1RA 4FDUA 4KX3A 2XJ9A 4XWOA 2PZJA 2IIQA 3F9IA 1XHLA 1O2DA 3F6PA 3L40A 4ON9A 4M1MA 4RKRA 4ZVSA 4ENWA 1O95C 2ZSIA 1X74A 2EWMA 4HDAA 1BROA 3BKWA 2O2DA 3M6XA 3FTDA 3R0QA 4QRDA 4TRMA 3WY9A 2C95A 2XV1A 1LPSA 3V1KA 5HK9A 3I2FA 4MO2A 10MHA 5IWAB 3OQBA 4XLZA 5IAOA 3TZCA 1Z7YA 4F4HA 4F91B 2WA1A 2FRDC 2ZTMA 5FL3A 3QF7A 3GEBA 2PN1A 4LMRA 3EFBA 4BO6A 2A35A 1P1RA 1QZXA 5EESA 1CSEE 3ROTA 3PDUA 1GRQA 1P4GA 3PHGA 4WLEA 3DP7A 4UQPA 1E99A 2V55B 4GOLD 1G0NA 1MOZA 5DHQA 3UIEA 4UTRA 3DF7A 5I9SA 4PQFA 4HDKA 1E3MA 2YXBA 1GPUA 4P0QB 3AUTA 4Z49A 4DUYB 3FSRA 3DGFC 1M6HA 4RZSA 4YRFA 2A0YA 3DMTC 1XMJA 5KCMA 3S1SA 3SDSA 2BGKA 4P3YA 3S5UA 2Q7OE 2PUFA 4M54A 2J3HA 3M34A 1XZLA 3BSWA 4QELA 4QDTA 3GJRA 2X8AA 1KARA 5BO5A 3QEMB 1YDWA 1K6EA 4JT4A 5E4TA 1FY2A 2WUFA 4ZCSA 1TVMA 2XHZA 2F1RA 3DZKA 4S24A 3HVKA 3H87A 1EJ6A 4EA6A 4O1MA 5BN5A 2Y9PB 5AVXA 5FLEX 1E7RA 2VJMB 1X6VA 3NHMA 2VPIA 1Z5ZA 4OI0A 1IH8A 3M89A 3O94A 3ZVMA 4WCVA 3HCRA 5DRTA 5BYAA 1J8QA 4B6JA 2Q1WA 3DMGA 1A9SA 1EM8A 1SM4A 2OCXA 3ND5A 3MINA 1XFDA 4K6HA 2GKGA 3M81A 4PQGA 4E5MA 1XYGA 5DW3A 4MQUA 4DLAA 1JR3A 1CJKC 4A92A 2JGRA 4FEAA 1RAIA 2ZAYA 4DIBA 2PG3A 1DIGA 1TZBA 1YB4A 3AFNA 4E1BA 2V45A 4TWAA 4M8IA 1ENYA 3FX2A 4XA8A 5AIAA 4EY3A 2ZWMA 1FPMA 1ZM3A 4R1PA 2CXOA 2JCSA 4ZQIA 1HUQA 2B2CA 1A8QA 3NDPA 1DTSA 4FYMA 1A8PA 2H8GA 4YWJA 3RABA 3WYCA 5JJCA 3I4CA 3RYIB 3U44A 1NBEA 1L3CA 2GNPA 2GN1A 1QFXA 2Z1DA 4C4PA 4CQJA 1R27A 2OO7A 1FDWA 2F3UA 5FTMA 3W9YA 5FOQA 1BJKA 2OO5C 3L6UA 4FYXA 2KB0A 4KYUA 4PRZA 4M9XA 5E0KB 1JEYB 1MJGA 3H8VA 1QZZA 3I64A 4QULA 5G4LA 5AH0A 3GEHA 2WAYA 2VOEA 3FNHA 3IYLW 2WWFA 1K8RA 4GEGA 5F76A 2AOUB 3TH5A 3OVMA 4G9EA 1CETA 5LSAA 3TCNA 5JQGB 1JEQA 2P9YA 4CM6A 2JEOA 3O9ZA 3VYRB 3Q8XB 1L4HA 2ECFA 3P27A 4ZK2A 2OVFA 3WQBA 2ZATA 2IUSA 2B5OA 5I9NA 1M2KA 4DUPA 2ZRMA 1Q3TA 3KT6A 1MQAA 4KB5A 3DVSX 3LX4A 2DPLA 3BMCB 4FOSA 3H42B 4P31A 3U3ZA 1NPYA 1YZ3A 3ZK7A 4C5CA 2BM8A 2GHRA 3H86A 5CB4A 1F7UA 5CTAA 2MSWA 1U4NA 3ZZNA 1BFDA 1JFFB 1JPVA 3HWX1 2ZBRA 3MJEA 2MMGA 3OPYB 3C8ZA 4O5AA 5C7OO 3DEKA 5LQDA 1PT6A 1YTLA 5SICE 1C14A 1T6XA 2P1RA 4JLJA 1U1EA 2RI1A 2ZR9A 4XOUA 5DULA 2HNAA 4HEA1 4URFA 4HDCA 3TTSA 5AHRA 4F8EA 3PITA 2PH7A 3DAHA 1DS6A 3H1TA 2DF8A 2XH8A 4C4XA 4DWOA 3C3CA 5EJGA 1WPGA 3EZGA 3RVNA 1G8PA 3ACBA 4CLHA 1SC3A 4R9SA 4PLFA 4MDFA 4C7BA 1FNMA 2FETA 2VF8A 2WIBA 1QIIA 3GMIA 4MDYA 2B1IA 4DMGA 2MHCA 3UUEA 2AEJA 3CRNA 4FCCA 1JXMA 1HFWA 5I7VA 2ST1A 3UFXA 4IIJF 5JCPA 2J3MA 3C24A 4HF7A 1R7RA 1ZKDA 4EH1A 4ADSG 4MB6A 3B6MA 1US8A 2Y27A 2CEKA 4L50A 3NYIA 3S0JA 1OFTA 3BHIA 3I12A 4L6CA 5ISMA 2M6KA 3EGEA 3RYHA 2TMDA 4YJHA 3DZGA 5JE8A 3Q98A 4KDCA 3HJBA 2QUHA 4NQRA 5F5NA 2H07A 3DO6A 1FW8A 4B3HA 1TVKB 2AVNA 2F59A 1DOAA 5K5EA 1I33A 4PCVA 4AZ0B 2CMHA 5FPHA 4B3DA 2A1UB 2WINI 4MP3A 4HDOB 2YOFA 4BYGA 2B78A 2ZAGA 4JZYA 5FR1A 3WO0A 4C0QC 5L9AA 4IKOA 2OQVA 4YDRA 4IYJA 5BN4B 3WV4A 1XRJA 4ZO9A 3AWDA 3TIFA 3E0XA 3WBBA 1JEAA 1PFVA 1IN4A 1SUPA 2N47A 1NHGA 5MN4A 2DLNA 1Z4IA 3A28A 1K7EB 3FOAA 4HRAA 3OLVA 1GCIA 3PF8A 3PGVA 4QX6A 1E6KA 4HLCA 2ZRGA 2ERCA 4OHFA 3W6OA 3A1DA 2AWNA 4OP3A 3EN0A 2WKRA 1PEYA 3D3WB 4Q19A 4D99A 1SXJC 4RDXA 2PT7A 4G4SP 4RL6A 5BWMA 1X7WB 2ZU6A 1HK7A 1KXJA 1W36D 1UPCA 3C87A 2YMPA 4CU2A 6AT1A 5JY1A 4HN9A 3COWA 1F2TA 1NXSA 1T9AA 2I62A 4F1KA 4MUXA 4CRWB 2FCRA 3ETJA 4U3JA 3M4YA 2PUTA 2YUIA 5FBKA 4BQSA 1KJQA 2ONYA 2AUMA 4XCVA 3VO1A 4QDJA 2WJPA 4ENQA 2I4NA 4JIGA 4TN1A 1M1XB 4XQ0A 2R8RA 4NV0A 2AIRA 2E5LB 4L22A 2I6QA 2WHEA 2ANCA 4HDNB 4KO1S 3L4JA 1JLLB 4HFMA 1T8TA 1P2SA 3I2HA 4JLBA 2Q7DA 3TLGB 2ODBA 2O8FA 3GAAA 3OOHA 5FULA 2UUBB 5JRJA 3O1JC 3PCXA 2MU1A 2BCJQ 2CGEA 4YMLA 1PZHA 3CPSA 4QPZA 4YHHB 2AX3A 5ESRA 4BQOA 3OC0A 3FCXA 3V33A 2FDXA 1T4BA 4HL6A 4H4CA 4AO8A 5K8JB 4M8SA 1DRVA 1ODIA 5DI3B 4BQIA 1HTTA 4CL0A 5TGTA 1M2WA 4MQ4A 3PUYA 2M2IA 3R20A 4YO7A 1JLSA 3L4BA 3O8DA 1KYXA 3P19A 1RHRA 3DV2A 3UJBA 4BNZA 3LQQA 1U9IC 2F64A 3A7DA 1TRHA 5TMBA 4C43A 5JC8A 3IDZA 3IPAA 3AW9A 2QTVA 4QGBA 5T3UA 2V7EA 5AKZA 1YF3A 2XWJI 1KEVA 4M7RA 1WTAA 5AW6A 1XU7A 3KT8A 1I6LA 4J3JA 4EY7A 1LPBB 5BVGB 4P7FA 4BUCA 5ADVA 4BX2A 5JD5A 1GWNA 4D9JA 1MW9X 1DKRA 3CV3A 4I6JA 3NBQA 5AOVA 3AEUB 2W6JA 3QK7A 3E7WA 2Z2YA 1Q20A 1AGRA 1ZGBA 5DGIA 2C3YA 3QELB 3QYPA 3SX0A 1JSLA 4JK3A 1JG2A 1YFKA 2OCLA 2N0SA 3UM9A 3TZEA 1KOFA 3SSNA 4HWSA 2OZLA 1UBUS 5KYKA 4TSRA 4AN0A 2QRUA 2VJDA 4BASA 2Z3WA 2O2HA 1JWAB 1GSHA 3CPHA 4QYXA 1KVUA 3IPXA 2ZRIA 2O3SA 1EE2A 2RAPA 1OWPA 3QE3A 4ENRA 3DOHA 9LDBA 1KK3A 2VKTA 1BVRA 3A10A 1LTHR 2ZDGA 2W22A 3EXHC 2YV3A 4O2RA 5DT2A 5BQFA 2JJMA 3FW1A 1KH2A 5DV9A 2QMEA 3VTZA 1EIWA 5JNSA 3DAGA 5AKEA 1HI9A 2XVYA 1OB5A 2R8OA 3D02A 3FGOA 1LW7A 1A1SA 3PIRA 4FHDA 4WKCA 2VNJA 4YAWA 2WTUA 5HF6A 2IXTA 1MRNA 1MIOB 4X45A 4MI9A 1IJKA 1KHTA 1JLRA 2G88A 2ZSFA 3OPNA 3PVSA 2ATVA 2YWXA 2C2GA 3P0RA 4MVJP 1IUPA 4BE7B 1U7WA 2PBLA 1H1DA 5BUCA 3O7MA 3KBBA 1FZQA 2Z04A 1N9GB 4G0MA 1LEHA 4URVR 3HA3A 4NYIQ 4WCFC 1EWQA 4X90A 1VC2A 2BFEB 3LUHA 4CDRA 2ZYWX 5IKPA 4ESVA 4R9RA 1WULS 3B5EA 2B69A 3QPBA 3LX5A 4BB0A 2BKVA 3PVCA 3UB2A 1YRYE 1EK5A 1Y7LA 3K8YA 3PDIB 1GVHA 3Q5DA 2I2AA 3AJEA 4RZIA 5DBIA 1USGA 1XDDA 4Z1MA 3UEOA 3EBOA 4J1TA 4F38A 5I01A 2C00A 3EUEA 2BAGA 3IRUA 5A04A 1IB6A 4BFUA 1WB9A 3M6IA 5FL7A 2Y1LA 4Q48A 1G64A 2OECA 4D97A 2D59A 4R0NA 4ZDKA 5F9FA 2W43A 2H0QA 1VL8A 2NZYA 5ALOA 3S28A 2ZUFA 1USUA 1U1FA 1YKSA 3PKIA 5HJ7A 3GJXC 1KERA 3GJYA 2EKQA 3IR5A 5GWXA 1I5EA 5FFNA 1KOLA 4G0ZA 4A91A 2P2DA 5DN9A 5EE1A 4F9GA 1J8YF 1XK6A 2ZXFA 2RKOA 2WJHA 4AN4A 1AU9A 5KSOA 4Z8XA 1D4FA 1NXWA 1SHTX 3O4GA 4C7MA 2XOKD 4QFBA 1GTRA 3QG1A 3MA0A 3K4HA 2Q0QA 3SQWA 1P6UA 4DV5B 1AK1A 2WKPA 3IBTA 1LFAA 2FWAA 2JLBA 1K5PA 2I8LA 1XDSA 1U0RA 3CVOA 2V7QD 2XT0A 3EC2A 3OZAA 4YN3A 4CIAA 1ZSNA 4XRRA 4AL4A 4QNMA 3FDXA 1ECCA 1ODCA 2COKA 4D4HA 4QOHA 1Z6TA 5BQXA 2DT5A 3ZLUA 3H16A 4WXRA 3OZRA 4FONA 4NCHA 2O8EB 3UAWA 4EHJA 2WYWA 3QVGA 1V1MA 2VYFA 4B2IA 3I1FA 1YS7A 3WICA 3IR7A 1P2DA 3UUFA 3UMJA 1ILEA 1Y4ZA 3FVQA 3DKRA 1Y8RA 3IP5A 1X3LA 3QKIA 4TROA 1SELA 4I55B 2F6RA 1DKOA 3JZAA 3B89A 1XX6A 3L9WA 3QF4B 4CHGA 2VJOA 3QRWA 3WSVA 7AT1A 3I28A 4NYMR 2VH5R 2C77A 1XHEA 5D7NA 4G2NA 4DSAA 3GT0A 2R1TB 4UAVA 5TC4A 3BA1A 3KHTA 4HGPA 5BQ3A 2H51A 3OQNA 4KR9A 3H11A 4C06A 4XCQA 5I3CA 1HYBA 2I4RA 2IS6A 1KEUA 3IHKA 3MBIA 4JQZA 3WDSA 5LU9A 3E35A 2Y1GA 4EW1A 5LZ2A 1C9NA 1TPZA 2O0JA 2YWBA 4Q1BA 1I7DA 4KV7A 3J81A 4GUDA 3R5JA 1I94B 1LRLA 1JHVA 2ECKA 4B3XA 2CHEA 3GFFA 2NTVA 3I2GA 4KU4A 3WB2A 3VR6H 1ZJZA 4D5GA 4GVLA 4BQPA 1U7PA 1RWPA 1YRWA 4KIFA 5DP2A 2JHFA 4AO6A 4R69A 2C57A 2V7GA 2LCFA 3G2MA 1L4NA 4LK3A 4MPPA 4MB0A 4NR0A 1N36B 4Y6LA 1O5OA 1SUEA 3L93A 4RIGA 3LPLA 5JG7A 4MTLA 2DPMA 3TD9A 4C3ZA 1NE7A 1MAHA 2WOJA 3V00A 1AXEA 1NR5A 2VWGA 2AMYA 2DUNA 1I2BA 2I71A 3S2UA 4CKBB 3CNEA 5JARA 4LA4A 5ALIA 1JHXA 1QS0B 3BF7A 3HEMA 3SBOA 5I4KA 4J1SA 2OZVA 3KOZA 3MRSA 2Y0DA 4UREA 3DZDA 4MV8A 1RJ9A 3ZHBA 3KYDB 3EXFA 4ZARA 3PGKA 3UAXA 4QAJA 2F1KA 3H19A 1ZQ1A 4MS3B 3VVCA 3IIKA 3NC0C 3AP3A 1J8FA 3JY6A 4NLLA 4F21A 5A03A 1DCTA 3ZGOA 3OEWA 5DXAA 2LKDA 1V4BA 1FJ2A 2V0NA 4IVNA 3H6GA 4HGRA 3T9CA 1NZFA 4OI2A 4D4KA 3GLFA 5FPSA 2MSDB 2RHOA 2D13A 3C8HA 3N8HA 4YACA 5MHTA 4N6GA 3S8MA 3T1TA 3OZVA 5FBZA 1C0IA 3IERA 4ITRC 5EC8A 1YASA 1O6BA 4FFMA 1NLMA 4G2TA 3TI9A 2JCYA 3TLYA 2O6LA 4EGSA 5C80A 3HP4A 3N2GA 4Q6BA 1M1UA 3DO8A 5CITA 2VH1A 3TIGA 1PNOA 4QASA 1ZXLA 3OOJA 3BWMA 1CUBA 3IUQA 1FXWA 2GCNA 1LJLA 4U1RA 5LZ5A 4D4MA 2Q3FA 3M4JA 4WH0A 2JBAB 4DG8A 2Q99A 4ESEA 4MHTA 2IHBA 1R5JA 1MC8A 4UULA 2FY8A 4UTNA 5I4IA 5KTTA 5A71A 3PUJA 5C4MA 1S3SA 3Q5EA 4M0PA 4DS3A 3UBTA 1ZGJA 3TRKA 4TTTS 3DTVD 3FMOB 5K3FB 5C9ZA 4NE2A 1D6JA 5F23A 1GAEO 1H2EA 2VDLB 4CM4B 1ACJA 1TK3A 1QVRA 2XYHA 3EAGA 3HPRA 3TFOA 3QY9A 5A5EA 3FUXA 4RJJA 4KJXA 3LIPA 2BI7A 1M34B 1QCCA 3I72A 1EVQA 1HH4A 4PPNA 5E7JA 5ERGB 1PEDA 1WB6A 2J6IA 2J85A 2Y3IA 4HBZA 4PSKA 4JR0A 3FDZB 1WQ4A 3G7NA 1WF3A 2XMPA 4L4XA 2AEFA 4EG4A 3FZYA 1UANA 3FDFA 4LGYA 1FYFA 1SXJE 2YRWA 4OTZA 2ZP1A 3H18A 3PDHA 3F49S 3PXDA 1VE9A 4B3FX 1L5FA 2A9FA 4MIOA 5D3MB 3NHJA 4KQ1A 1GZUA 4U2EA 3ABSB 2V7BA 4QM6A 4PSAA 1QAQA 1FW6A 1GDDA 3ORFA 4Y2JA 4M9ZA 4CM9D 5HKKD 4FDVA 4HX9A 1T3GA 4E5UA 1HE1C 4KR2A 2GHTA 2BJWA 3HBLA 3IRVA 4N48A 1IVNA 1AS3A 1L5SA 2EGUA 5JSYA 1P61B 5KU7A 2A92A 1RM5A 2CLLB 4TT3A 5GZ1A 1HSZA 3CLUD 1CQPA 4L5IA 3TL3A 2IIPA 4JB8A 4YRIA 3O74A 2IEDA 3T7JA 3T1YB 1H85A 4YH1A 4MLZA 2PH5A 3AC0A 2OYCA 2JLVA 4JJ7A 3GMDA 1G66A 4U5XA 3AVUA 4LZWA 2ZDHA 3L1VA 1J23A 1N7HA 2D0IA 3OKFA 1HRKA 4J0EA 3L7JA 4WACA 2JGFA 1U2PA 5KNCH 2H92A 1P39A 2LP4Y 2XKAA 1PGJA 2WJ4A 1YVUA 4K0KB 3UFBA 5KHLB 2RAVA 4QTTB 3FOBA 5J1TB 3PJEA 1XELA 3URKA 3FLMA 3C3PA 3MIIA 4GI2A 2PCJA 2Z08A 4NDNE 4DJDC 2IKSA 2VDRB 2IWRA 1XPUA 4LC1A 4EYKA 1U2GA 1YE8A 2O2YA 1MJHA 5KTSA 2BTOA 3H99A 2H1SA 3JPWA 2UZ1B 3KUXA 3EHDA 1CNMA 1NXXA 3LGXA 2O0MA 2WEKA 5E9WA 1N92A 4NY1A 3FAZA 5JXWA 2X2FA 4GICA 1I7QB 1D6MA 3ZI4A 5LXTF 2PWZA 1FBNA 2NU8B 1J8DA 3LT0A 3L4BC 2YWFA 4EATA 4ME6A 1VPWA 4MW4A 5DK6A 4JP2A 4MQBA 2ORYA 2AJCA 4TKVA 1TLFA 3LZ6A 3FGNA 1SOVA 1ZRMA 4GC5A 1GTVA 4K9PA 4Z0TA 2Q6KA 1FFWA 3MMPA 1SKBA 1YC5A 4EHKA 3KVNA 2VUUA 2BHSA 1MNAA 1XA3A 2X1HA 2Q1YA 3DPUA 3AUKA 3A4TA 5SZJA 1QZUA 3UVEA 2IPMA 2QP9X 1B0ZA 4KAXA 3K4PA 5DLQC 3L4SO 1CDEA 1F1JA 1M6YA 2BVNA 1IATA 3FROA 3IKMB 4L9AA 4EHNA 5BNIA 3ZV6A 2WIKA 3L01A 3AB8A 3JQGB 2MINA 3K31A 1UJCA 3UMVA 4N12A 3COYA 2GPWA 3JAMA 3M4ZA 3SKVA 1EJ0A 1UDWA 1V41E 3K2EA 3TJMA 1GD1O 4P3PA 4DCOA 3FYTA 4JUIA 3F9CA 3ZJVA 1T91A 1F9EA 3GZ4A 2F55A 3JAWB 4ITUA 4NOJA 1YQEA 2PSJA 1VGRA 3QTBA 5FUVA 1KDPA 2BGUA 3BK7A 4L2IA 4DM4A 4KN6A 2O2SA 4AP5A 1WKCA 4GSYA 2WV9A 5K1ZA 1Y37A 3TQFA 2FEXA 1GSOA 1CUGA 2CV0A 3GPCA 3TFWA 1KY5A 5HTKA 2G4VA 1QX3A 1H3FA 4HAWA 3IBCA 3KKMA 3AR9A 2V54A 5B1HA 1Z2AA 3W6NA 4OQNA 1JQEA 2VT2A 1SOAA 2F2TA 4XYBA 4FBGA 1MB0A 1Z4OA 3HMKA 4QVIA 4OQPA 8ADHA 3KUKA 3ONFA 3PNSA 1OBFO 1S2DA 2G9VA 3B51X 3R7LA 4BP9A 4FS3A 3WBKA 2OBFA 3GEIA 2VDMB 3DYVA 3FPLA 3UHPA 4IHAA 3KZXA 1RWOA 4P4LA 1X1AA 4BNYA 3UK1A 4ZOQI 1ZGZA 4BNVA 3FD8A 1HL3A 1SG0A 3GROA 2BJHA 1KMQA 3KWLA 3OI7A 4B74A 3RUFA 4L7VA 3WNVA 4N40A 3BB4A 4POOA 2ZT7A 8OHMA 5KREA 3V8QA 4ACAA 2XECA 1Z0AA 2XMDA 3QKUA 1LXCA 1S9HA 3D4BA 1PUIA 4GFDA 1LA2A 2ES4A 4J1TC 2WPNA 4O2LA 3ZWXA 2W6ID 3DLCA 2IIVA 3F97A 3OC6A 4KO8A 3U61B 3OIGA 1QP8A 4I1IA 4BNKA 3KOOA 2PMDA 1F8XA 5L53A 5HQJA 4FSHA 3F2IA 4PHHA 4TKZA 1E92A 3URMA 2VS1A 3DEIA 4D0RA 4R6XA 3IIIA 1N57A 1JALA 4PFJA 4TRJA 3NTXA 3IHWA 3DZ8A 4X8LA 1GKUB 1X7ZB 3SX4A 3ETCA 4YEDA 2AXPA 2HMUA 5CH8A 2CLKB 2M98A 3UATA 4H4DA 4MRNA 2QL6A 1X1CA 1JR3E 5CLHA 5DNAA 1Q7EA 1KPIA 2MMCA 3PCRB 1YNSA 1PJAA 1C8KA 1TFUA 3QFRA 1LLQA 5H5JA 4CG1A 3FLEA 5JCZA 3GA0A 2W83A 3C3AA 1ZVKA 1XAGA 1WP9A 3GLIA 2FQ1A 2FWMX 1BYIA 3R7WA 2E55A 1XTZA 3CJQA 4UHJA 4KGZA 2W93A 3KJIA 2VPXA 1QZTA 4RZ2A 5F77A 3ADBA 2VF5X 5L45A 1BG6A 3H2SA 4BEJA 1E3WB 2ZJBA 1CE8A 1QFJA 3HYNA 4FMCF 1GT6A 4GPAA 2Z56A 5FKJA 2QSJA 3MUEA 2X76A 3QZUA 3RVKA 1RVDA 4CU5A 4PZCA 4LHYA 1E0KA 1MB2A 2AXNA 4X63A 3UT5A 3P2KA 4F0JA 1TU4A 3F1LA 2DYKA 3DOEA 1U2QA 4MXDA 4O4HA 1P4HA 1BGVA <