4JSTA

Structure of clostridium thermocellum polynucleotide kinase bound to utp
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
171
structure length
171
Chain Sequence
SMKLTIPELSLVVLIGSSGSGKSTFAKKHFKPTEVISSDFCRGLMSDDENDQTVTGAAFDVLHYIVSKRLQLGKLTVVDATNVQESARKPLIEIAKDYHCFPVAVVFNLPEKVCQERNKNRTDRQVEEYVIRKHTQQMKKSIKGLQREGFRYVYILNSPEEVEEVVFERQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical analysis of the phosphate donor specificity of the polynucleotide kinase component of the bacterial pnkphen1 RNA repair system.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Transferase
molecule keywords Metallophosphoesterase
total genus 64
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 2.7.1.78: Polynucleotide 5'-hydroxyl-kinase.
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jstA00
2ATVA 4KSCA 2OAQ1 4PSAA 1XD8A 2E87A 1OXSC 5EP1A 1WBBA 4LHWA 3LA6A 1ZVQA 1W2GA 2OFOA 3EZ9A 4ZKEA 1UBCA 5J40A 2GJ9A 8OHMA 2D2EA 4B2PA 1FUUA 2X8AA 2P6UA 2CNWD 3H2YA 2ZI7A 4JVSB 3ADCA 1W36D 1KK0A 4E03A 4IJMA 1KTVA 5LBIA 3SFZA 4FCVA 4M9XA 3WMFA 2HJVA 2HCJB 1BH2A 4WZBE 3K9HA 1U8AA 2JLYA 3W6PA 2VL7A 4F92B 4OHVA 3GFOA 4DCUA 3KTAA 3AUYA 2PBRA 1XTQA 2ZVQX 1K6MA 1K8RA 1XEFA 1ZW6A 2WWHA 4LOAA 3UMSA 5FPKA 1KK3A 3DMDA 1ZNYA 2ZRCA 4B71A 3QOFA 1A5TA 2WPDD 4LRWA 2G1JA 1PUJA 2IBMA 1UBEA 1CS4C 2ZJ5A 4LYJA 4B33A 3U3KA 2JJ2D 1G64A 3MCAA 4DLUA 2PZFA 1JJ7A 4URUR 4ZPXA 3FOZA 1MV5A 2FA9A 3U7EB 4GL2A 5F2EA 5TARA 2TMKA 2ZVPX 4LWZA 2O0HA 4RCZA 5E7IA 1D6JA 3T1VA 2XB2A 4C7OA 2GXUA 1E79D 5HKKD 3C4JA 3B1VA 5E3HA 3DZ8A 4FMDB 2FN4A 1RJ9A 3TUIC 5FTJA 2W58A 3FFAA 2HLDA 4FD2A 4RY2A 1JPNA 2PT5A 3MWJA 4QGFA 3THOA 3HR7A 1UBFA 4LBYA 1MABA 5JSZA 2KE5A 3VAAA 2JLRA 2X1VA 4WZ6A 3LD9A 2YOGA 3U3OA 1MRNA 3C5HA 1C4OA 1JR3E 1CRQA 2GK6A 2RGXA 5E7JA 1SXJD 1GOTA 2ZJYA 2WVJA 3DKVA 2HF8A 3TIFA 4XWOA 4KVAA 3V4FA 3HYRA 2QTHA 3CRW1 2RGDA 4P31A 1SHZA 4Q02A 1CJKC 4YLGA 1BS1A 1F3OA 3QXSA 4A6PA 4XSGA 2YOHA 1R0XA 2PLRA 2BVNA 3AF3A 2UZ3A 4PTLA 3KFXA 2VF7A 3GJ8A 3CX8A 1NN1A 4A8JA 1ZM3A 2ZXUA 4KLZA 3LH5A 2XTMA 4JLBA 3MD0A 2GILA 3AVYA 4IEIA 4ZDIA 3K70C 4XWAA 1NVXQ 3UATA 4IDPA 2ZJOA 3EXAA 3KXKA 3KL4A 1EK0A 1AGRA 2VSXA 2ZU0C 4QKQA 1IJEA 3LO5A 4FW9A 2FSFA 4TL8A 2GVDC 5JWRA 5FL3A 5M04A 2J5XA 4JKIA 2WWWA 2UKDA 4RZ2A 1C9KA 1PLJA 2F9MA 3QG5A 4I99A 5AR1A 4Q03A 3U7HB 2GRJA 3VR1A 2VEDA 4A0FA 5GVSA 5JJIA 1CR1A 2K5UA 3BFXA 3MUFA 1L7VC 5IF9A 1YR8A 1FP6A 2V9PA 3HR8A 3RC8A 4O3MA 2OE2A 2XNDA 3L0SA 4LC1A 2WKPA 3SJAA 1E2LA 2ZPTX 1KMHB 3GCGA 4PC3A 2YVUA 2ZM5A 5EXPA 2XTNA 2EFCB 2XSZD 5EE0A 5BYKA 5DIFA 1OIWA 2A78A 2YNMA 4F4IA 2ASEA 1UAAA 4B48A 1KO1A 5CM9C 2GESA 2DFLA 2XITA 3OAAD 3J81k 5G53C 4GP6A 4W5WA 3QKSB 2WJJA 1W4BA 3U44B 1Z0IA 4PFSA 2H92A 4EQ6A 4JBWA 1JNYA 4MYTA 4RKFA 5FI0B 721PA 3SN6A 4TLDA 5HE8A 5G41A 1JR3A 4QJ3A 3VMFA 1GIAA 3GLFA 4HZUA 4TTRA 5JHGB 4TYPA 3FMFA 1T3HA 4C0QC 2NO1A 3WBKA 5JFGA 1Q3HA 521PA 3EWSA 2ORVA 4B3DA 4EPRA 1QRAA 4OQFA 4PO9A 1NG9A 1Z0JA 2ERXA 1HQYE 1QG2A 1BIFA 2WAXA 1KKMA 4GRAA 5DYGA 4TLBA 2PX0A 3CNOA 3K09A 3SFVA 2AWNA 1NN0A 3B82A 4HB2A 5CITA 4ARZB 1E2JA 2C03A 2EFHB 1ZUHA 3VX4A 4NKRA 2HJGA 1W5TA 2WWYA 3ZIAD 3RANA 4R2IA 4IW3B 3TVTA 4JLKA 1N2CE 3NBYC 2CLSA 3TR5A 4MRRA 4N0DA 2R65A 4KFUA 2ZJ2A 1XNJA 3AGPA 4LJ8A 4AG6A 4U00A 2JLVA 2WBLC 1ZD9A 3RSOA 3EZ2A 1CBUA 4MGKR 4GOXA 3LLMA 2XJ4A 3U61B 1IN4A 2HDNB 1Z2CA 4A6XA 1WRBA 4AYXA 4ZDJA 2IW3A 1UKEA 2O8DB 4XVRA 3BK7A 4GFDA 1X1SA 4M1KA 1KO7A 1ZNWA 2OXRA 4JZKA 4B2LA 3REGA 4KAXA 3ZZ0A 1XEWX 4GZLA 2IHBA 2O8EA 3F8TA 3RS4A 1P62B 2EFDB 2W2VA 1A4RA 2RCNA 2VP2A 1XD2B 4DJTA 4QGHA 2CL6X 2R6DA 4URYR 4EFMA 3UMFA 3U4QA 4KU4A 1E0AA 1YVDA 2O8BA 2ZE7A 4ZKDA 1S9DA 5JHHB 4GSYA 3ZLJA 1Q0UA 2XX3A 4Q47A 5FTKA 3VFDA 2ZRJA 3AF0A 4QC2A 3RRNA 4QGGA 5FOTA 4WAUA 1OKKD 5HE9A 3T5DA 2JDID 4NCIA 5E7MA 2A5JA 3NKVA 1BYIA 4JKYA 3Q7QA 3ZVRA 1J2JA 2QQ0A 3PEVA 4PAMA 1E9RA 3DPUA 1KMQA 4FMBB 3K0CC 1E1RD 1NVVQ 1J8MF 1SHKA 3QKRA 3NDPA 4BFYA 5KOYA 5FOXA 2J9RA 3HDTA 5FBLB 4A15A 3IO5A 4QL3A 4PHTA 2BHRA 1WF3A 1JR6A 2BMFA 1U94A 4TMXA 3RS3A 3VR6A 3FGNA 4B74A 3C5CA 4L9WA 4HEJA 3LX5A 1Q21A 1O3YA 4D25A 4P33A 1Z6GA 1ANKA 2XOKD 4PX9A 4CVNA 1NBMA 1IN6A 1US8B 2Z5FA 3TJZA 1M34E 5A4JA 4PPFA 2BEKA 1FQJA 2WWFA 3FMPB 4HUQA 2JAQA 5EE5B 3FMOB 3GLIE 2CCJA 3QE0A 4HLQB 2AKYA 4Q01A 4QNMA 4RSGA 1RPZA 1NLFA 2ZJ8A 1NVVR 3KQLA 3AKCA 3QEOA 4R2HA 2QRNA 4A2PA 3P20A 1TNDA 4IDQA 3EASA 3AVVA 3GLHA 1NF3A 2QU8A 3A4NA 5HCIA 4UJ5A 1U9IC 1M7BA 2GDJA 5J47A 2AL7A 1M7HA 4DIEA 5UKDA 2QMHA 5EZ5A 1G4AE 1GAJA 2V7QA 3CZPA 2QPAA 1ETUA 3DL0A 5LDDC 1ZD1A 2JASA 3WY9A 2IEYA 4GOKA 1DAIA 5EP3A 3CW2A 1S9HA 4KV9A 1GITA 1A2KC 4DLZA 2JLSA 5BW8A 1ZBDA 2OO7A 4RZ3A 4IDNA 4ZV4A 5FH9A 4A2WA 4TQUS 2QAGC 4Q4LA 1Z63A 1P72A 4PC7A 3PUXA 4BZQA 3C15C 2BM1A 5KNBA 5KSOA 2FH5B 1UADA 5BQ5A 1ZUNB 2ZRAA 4BFSA 4BPBA 1MH1A 2P5SA 2RKOA 3GJ5A 1UEIA 3WMEA 2H8KA 3WMGA 3NBZC 4OQMA 3LVRE 4KYUA 4AG5A 1GFIA 1HQCA 2VPPA 1E0JA 1IONA 1JQJC 4NYJQ 1Z28A 3JZAA 4U7DA 3ADKA 1QHHB 1CJVC 1QHNA 1TADA 2WSSD 4C4PA 1QHYA 3L82B 1OV4A 1W4AA 3T15A 5JEDA 2ONKA 4Z1MA 1ZC4A 2XGJA 2B21A 3QBTA 4R71A 1BOFA 1OIXA 2O8CA 4A4DA 2O8CB 2REXB 1JR3D 1Q57A 1R7RA 4CF7A 4IVQA 2EYUA 4DIDA 3GQBA 4V0KA 1DG3A 4Q1CA 5C18A 4C0BA 4LDJA 2GCPA 4Y0VA 4BFUA 2ZRGA 1OKKA 4Y0AA 3H4MA 1A7JA 1T3SA 5JI3E 2FJUA 2R2AA 3B85A 2FFQA 1KJWA 5SZIA 1T6NA 2BCJQ 2J45A 1KKLA 3PUWA 3LRPA 4D26A 2ZYWX 3GEIA 4ZI2A 2CBZA 1EX7A 2ZI9A 4RKEA 2WOJA 5CM8B 5KHOC 1LW7A 2ODEA 4Q00A 4AKGA 3BC1A 3FFBA 3GFPA 2IYZA 3RYTC 3LQRA 3U6KA 1C1YA 4DSNA 4KI0A 1R4AA 1RYFA 3E70C 3T35A 2ZS8A 5LD2B 3BORA 3OE7D 4TYWA 3I92A 5FOVA 4NCKA 1CJTC 1DO0A 4IDOA 1KK1A 1QDEA 2AR7A 2CL7X 1GSIA 3CM0A 4V0NA 4A9AA 1CKEA 1HEIA 3M1IA 4BLRA 1XXHA 2OEPA 2WSMA 1M1YE 2WIAA 4DT1A 1GL7A 4RZUA 4AI6A 3P27A 4H9GA 3EPLA 2ZJZA 1G3MA 3F3YA 1DAHA 2F1RA 2Z4RA 3QF4B 1OFHA 2BIFA 4TMWA 1OH6A 2CK3A 1CJUC 2ORIA 3GLHB 3PEUA 4TMZA 1W36C 2Y8EA 1ZIPA 4LJ9A 3ZJYA 1E9BA 2ATXA 1GZSA 4HDOB 1R0YA 1G8HA 4OBEA 1ZM2A 1D5CA 4JBYA 1D2NA 3ICQB 2G1KA 3NHBA 2C5LA 3TQFA 3RS5A 4A0GA 2GHIA 1G6OA 2CXXA 2DFNA 5HCNA 1E98A 4JLMA 3IQWA 1D8TA 4GNKA 2LWIA 5E95A 3ZS8A 1G7CA 4TTPA 4O25A 1PVOA 1Y3AA 3W3ZB 1KMHA 3GPLA 4KFSA 3DVLA 3B1ZA 1UFQA 3OEED 1X8KA 3K0FB 3W5IA 5FR2A 4YMWA 4Q66C 4HAUA 3KZ1E 5CIQA 5CJPA 1P4SA 4GPTA 3TAUA 4BLSA 4TWZA 3FMIA 1H65A 3EZFA 4P4SB 3GMTA 2GCOA 4RD1A 2HUPA 2ZRPA 3MSXA 1N0WA 1G3QA 2B7BA 3EA0A 3THWA 4QHYA 4RFSB 4AKEA 2QMEA 4OJKA 3MJHA 3Q5EA 4FCWA 2PCLA 3GJ6A 1N6KA 3R7WA 3SYKA 2IYQA 1LY1A 4I1VA 4D4LA 1G7SA 5C2JB 3WP0A 4DCVA 2ZRKA 2C78A 2FEMA 3L8ZA 4QBHA 1EWQA 3EC2A 2F9LA 1N5JA 1OFUX 2DB3A 4O2LA 3RDPA 3RRZA 2FEOA 3GD7A 3PUYA 3UANA 3UXMA 3FYHA 3THWB 2G9NA 3RS2A 2HV8A 3I5YA 3LXXA 3CX7A 3KQHA 3TUJC 2LCFA 1P2TA 5KNDA 1I4LD 1NIPA 4LBZA 2BMEA 1QVRA 2OV2A 1XEXA 2FSIA 1IBRA 4JLNA 5J4YA 1TF5A 1UKVY 3A1TA 1VG8A 4IOJA 4PHFA 3TH5A 3U7FB 4JT4A 1AM4D 1BMFD 3QJYA 5CK5A 2NMVA 4JLPA 3R20A 1NSFA 2IYRA 4A1FA 1JBKA 4N1AA 3VNUA 4AKHA 3K0FA 3CWZA 3KJGA 1G7RA 4LSGA 1XBTA 1P7CA 5K8LA 3UG7A 1ZJ6A 2ZEJA 2AD5A 5KU1A 2A5DA 3HU3A 1XZQA 3M4YA 1U0LA 4QRHA 1MOZA 4V0MA 1P75A 2CNWA 2XZPA 4DZZA 1QZXA 1GRRA 1EGAA 1YU9A 3HU1A 2EWVA 2G0TA 3LV8A 1E1QA 1XB2A 1NMZA 1YE8A 2IXGA 4Q1BA 2I1QA 2DCUA 2KI5A 2J0QA 5DHAA 1EFCA 2RHDA 4HAYA 5FFMA 1Z3IX 3C14C 3HJNA 3QPVA 4DLVA 4D4KA 1E2QA 2BMJA 4NDZA 1E0KA 3L0OA 4GT1A 2P3SA 5KPJA 3ICEA 4HUQB 2VP0A 3RSLA 3B5JA 3DOFA 1YR9A 1R0WA 4JVMA 3AVTA 4WZAE 2EWWA 2Z83A 4NCNA 4XSHA 2VP4A 4V02A 3UKDA 4JLDA 2QE7A 4D0NA 4D2IA 1IJFA 2Z43A 3AVQA 2ANCA 1X1RA 1N5KA 1TEXA 1XEXB 3BH0A 4XJXA 2WJHA 4NP6A 1E94E 3UPUA 1MABB 3RHFA 1D9ZA 4QG7A 1ZM9A 4B32A 4UXIA 3K53A 4XOIA 4JL8A 1KSHA 1Z6TA 3N70A 5DN6A 1G8PA 1YRBA 2WJVA 2W00A 1RRFA 4JYCA 3SC3A 3SJCA 4C3ZA 2N46A 5B64A 2DWPA 5EXSA 1HY3A 2DPXA 4TYYA 5FPHA 1OXTA 4HLDA 4UNSA 3CBQA 2IYXA 1UEJA 3A36A 5JZVA 5EE3A 4EPYA 1ZNXA 2GZAA 4KHZA 2UZIR 1HA3A 4H1UA 4BFZA 3SJBA 4L5BA 2ZRLA 1SKYB 1N6IA 2CHQA 3KJIA 4NMMA 4QHTA 2GEDA 2MSEB 4JJKA 4LJ6A 5AJZA 2IA5A 3X1DA 4WXRA 2YWHA 3DM5A 1YZTA 4BLPA 3QUSA 4MQBA 2QN6A 3AP1A 2A5YB 2R9VA 4M1MA 4IRUB 5AUNB 2GA8A 3RNLA 1NJGA 2MSCB 4FIDA 4TZ0A 4LHXA 1NI3A 2ONJA 4TQ9A 1OB2A 1LS6A 2KWIA 4Q18A 1DADA 5J4LA 2VTKA 4OI2A 4V0ME 1ZM4A 2ZI5A 1I2DA 4QM7A 4PSVA 2XZOA 3CWQA 3VHXA 2X77A 2IWHA 2VQSA 2QPTA 1UKYA 3ASYA 4HAVA 3KKOA 2NZJA 4G5GA 2F3RA 1W1WA 5FUYA 3VQTA 4EKDA 3BJIC 3FDIA 4NH0A 5BWMA 4LV8B 4ON9A 3IHWA 2J0UA 821PA 2WICA 1YZUA 2AK3A 3NEJA 1F6BA 1G8FA 1ESMA 2A2ZA 4PAQA 2ZS9A 4LI0A 4XVQA 5TB5A 4JLJA 1D2MA 2JGNA 2FF7A 5KDOA 3ADBA 1DAFA 1DELA 3OIWA 4Q7KA 3GLGA 2W2XA 1YR6A 4OI0A 3WYGA 2PCJA 2G88A 2EYQA 3HPQA 4ZCIA 5CB6A 5JCPA 4M9ZA 1OSNA 4M4SA 1Z2AA 3QQ5A 2QQEA 2FPKA 4CYMA 2QZ4A 2H18A 2QBYA 4A8JB 5TDHA 5FI1B 2QROA 1G8YA 3TUZC 1G5RA 5EQTA 1YQTA 1Z06A 1OH8A 1CULC 3HWSA 2Q21A 3OAAA 1HUQA 1KO8A 4UNNA 3ZYCA 3RAPR 3MWYW 1OYYA 3TSZA 1FFHA 1JAHA 2ZTSA 3BOSA 4DEXA 1W48A 4Q21A 1Z0AA 4RVCA 3B8HA 2QGZA 3IQXA 4AURA 3H1TA 5C1BA 1F60A 3OF5A 5BN5A 1DVRA 2GVZC 2KBFA 3TLXA 5TV2A 2QP9X 4IFEA 4ILEA 4AWXA 1Q1QA 4CW7A 2Q9AA 2REBA 1I4DD 1RYHA 1DPFA 2IEZA 2GXAA 4KO8A 3PUVA 3QPWA 3QNUA 5D3QA 1L4UA 2CLDX 3TR0A 3VKHA 4RD0A 1YJ5A 3HU2A 1CRPA 4JL6A 1N25A 4AC9A 4FMDF 1T5IA 2ANBA 5FOUA 2J87A 2V55B 1N0VC 1ZC3A 2C95A 2FNAA 2J7KA 1T9HA 2J0VA 1KI8A 1WDTA 3DDCA 1N0UA 3DHWC 4X8MA 4EFLA 1PV4A 2ECKA 4QNRA 2OBLA 1J90A 3B7GA 2NQ2C 3PXGA 4MKHA 5KTYA 2FPMA 1ZP6A 2YV5A 5SZKB 4RFSA 3ZVLA 2JEOA 4G01B 3H86A 1OF1A 4MDEA 3FVQA 4Q7MB 4L9SA 5H8WA 4M22A 2DFTA 1ZD8A 4Q5IA 2KSQA 3CZQA 2D74A 4MUAA 2DY1A 4Q4HA 5ELXA 1WCV1 1CTQA 4I1OA 3UMRA 2JLQA 5IHPA 3T1TA 1TX4B 1VCNA 1RIFA 3X1ZA 4CEJB 4CEJA 1KO5A 2WSSA 4JIMA 2P6NA 1T4GA 4HLUC 4D6PA 5AUOB 1GM5A 2WV9A 4NYMQ 2Q6TA 2V4ZA 1GG2A 5GJCA 4BZPA 1SVSA 2H1LA 4F4CA 4Q9HA 1E9EA 3QKRB 1ESNA 4EDHA 4B3GA 3LVQE 3ZD6A 1H8HA 2XSZA 3CNNA 4EQ6B 5DI3A 4NPHA 4Z8YA 5LB2A 3QI2A 4YMSA 4BGDA 2BJWA 2QUZA 2Z4SA 1ONBA 4WW0A 1AJEA 4XD7A 1GKYA 5HKKA 3THXA 2O8DA 2O0JA 3TKLA 1XMVA 4M1OA 2LKDA 2GF9A 1MKYA 2P2LA 4YMUA 1E1RA 4DLSA 5JJKA 1TUIA 1JALA 2VBCA 3FTQA 4M9QA 2QI9C 2DR3A 3AP2A 1MRSA 4OQLA 1IN8A 3FKSD 4JSYA 1R8QA 2L0XA 3B2EA 4DLYA 2D06A 1Z0DA 4RFVA 4D80A 3BH6A 2WKRA 2OCBA 3T12A 2KJQA 4Q4HB 2ZIAA 2AX4A 2F43B 3CR7A 3T1QA 2GTPA 3A6PC 3CX6A 1AN0A 5HZHA 3FKQA 2OHFA 2ZRMA 4NTZA 1KNQA 2VF8A 4G3XA 3GEHA 4LCBA 3TGPA 1ZCAA 3PEWA 4TLCA 2J1LA 1L8QA 4EJSA 3CKLA 3JVUA 4GP7A 4YQFA 4LC0A 5KSZA 4KJZA 3K70B 3AM1A 1QHXA 3EAQA 5JI2E 2IT1A 5L3QA 2C04A 4CDGA 1RRGA 1E4VA 2QAGA 4DUGD 3PEYA 2QBYB 1SVLA 4P4TA 5FUXA 3ZS9A 5FUVA 1KDOA 3I73A 3DZDA 4POAA 1N5LA 1SVKA 2D4HA 4LBWA 1I4TD 1Q22A 4LV5B 3KX2A 2FX3A 4FXPA 5KNCA 3OZXA 1VMAA 5EXTA 3RWMB 2FE4A 3CRRA 3S1AB 3IBYA 1Y63A 3GJXC 4N0EA 3GLFE 1XJQA 3NIBA 2W0MA 2ZYUX 1QBKC 5F98A 1U2RA 2IXEA 4MRSA 1EX6A 1LFDB 1GRNA 4EPTA 4H1VA 1FMJA 2KBEA 3ZVNA 1TQDA 2BBWA 1AZSC 1H8ED 1KHTA 2ZR0A 4DHEA 2I1VB 4L8GA 3CIOA 5FTMA 4CIDA 4MRVA 1IHUA 4DC9A 4CEHB 2YOFA 1XPRA 1SVWA 2RHMA 3LY5A 2JLZA 2ZUDA 1CU1A 4CEIB 2QMUA 1WBDA 1E4YA 1LF5A 4II7A 4WBSA 3Q9LA 4D82A 4MITA 4PO8A 1E2DA 1XCMA 1G20E 5FTNA 1FX0A 3RLFA 1XCPA 1OXVA 1Q1EA 1YZLA 2V6IA 1YRAA 2CE2X 3WP1B 1SGWA 3OIUA 1VYVA 4GMXA 4AK9A 1ZCBA 5FOSA 1FOEB 3BWDD 2C8VA 5GADl 2GJSA 1A1VA 2XOKA 1M6NA 2BWJA 2J0UB 1FNMA 1LV7A 1S2MA 2P0EA 1Q44A 3MMPA 4HYYA 3EIQA 4Q4AA 3TVDA 1OXXK 1E2GA 1GWNA 4EAQA 4DWJA 4CGZA 2ZR7A 5LB4A 3W34A 1A82A 2H17A 2QSZA 3TRFA 5DYIA 3U3RA 3M0EA 3H0KA 1IXRC 3U3MA 1AS2A 1TUEA 3SOPA 1G3RA 2J41A 4J0QA 5AUPB 3FHTA 3SNHA 3OE7A 2XNSA 3MFYA 2XJ9A 1XEWY 1CR4A 2F43A 1AZTA 2W83A 3K70D 1F2UA 1U9IA 1HT2E 3CRVA 4EPVA 3RVBA 2IS2A 1KZGB 2V54A 3U6BA 3K0CA 1IN7A 4B3XA 1AIPA 2VHJA 2ZSBA 4MKIA 1KSJA 2OCAA 2R44A 1KI2A 3B1WA 1OPXA 3BFVA 4TL7A 5AUQA 1KGDA 4TLAA 2FOLA 3CLVA 3OEEA 1GILA 5AJVB 3SQWA 3OFNA 3TW8B 2V3CC 1AS3A 4OQNA 4TSFA 2WM9B 1W47A 5J4VA 2EVWX 4NONA 2YYZA 2XB4A 1F2UB 3QVUA 4Q48A 3THXB 3AUXA 3C16C 1NVUQ 5HZKA 5LD2C 1NG1A 1WA5A 2HEIA 2ZE6A 3PVSA 2VA8A 5TVKA 4A82A 4B47A 5DHFA 1S3GA 2B8WA 4ZCLA 3LW7A 1XMJA 2WMNB 3BIFA 4D0GA 4LPKA 2CVFA 3B9PA 4G5OA 2OXCA 2D7DA 2F1JA 5C4MA 3I4LA 4C0AC 3V9PA 1EFHA 3HP1A 3QEJA 2AN9A 4TMVA 2GK7A 3RRMA 4BRWA 2MSDB 5AJWA 3KKMA 3Q5DA 5AJYA 3WNDA 1S0UA 5L3VA 1UF9A 5A0FA 4JSTA 5JJLA 1E9DA 2FSGA 1SXJB 2J7PA 1GP2A 1S96A 4LUCA 2GF0A 4D4JA 1T8TA 5K8TA 1XPOA 4R98A 3P4XA 1N6LA 4ASUD 2C2HA 2OUKA 2PX3A 3K9NA 2H5EA 4YDHB 1JECA 4OQXA 2YC2C 3X1XA 2WJYA 3C7KA 4LJ4A 3D8BA 3IHLA 4LPSA 5CDFA 1VCIA 2GEUA 2I4IA 1RE0A 4PHHA 5KSPA 4PC6A 1WMSA 1NY6A 3UG6A 4PR0A 3G5UA 1A2BA 3I5XA 4QM6A 4B75A 2OBMA 3KB2A 4KCGA 3I72A 2IXFA 3GLIB 4YDSA 2VLIA 4CT4B 1SZPA 1ZM7A 5FOWA 2IYUA 1GVNB 3BE4A 3NC0C 3GJ4A 4F7WA 4JVNA 2AKAB 3U5ZB 2IUSA 3AF4A 1N6HA 3K0SA 1FZQA 1W49A 2DBYA 4PPNA 1KDRA 3AKEA 2ZAMA 1EFRD 1KNXA 5CK4A 4EPXA 1G18A 2YWEA 1E9AA 2QRZA 5B57C 3TSOA 3IPYA 2HCBA 3P32A 1G9XA 1D9XA 4NL4H 3TMKA 4DCSA 2Q9BA 1TU3A 2VRWA 4G5SA 1UJ2A 4ZDWA 3R9WA 1II8A 1G3UA 3Q85A 2VHQA 1XFAA 2Q9CA 3VU9B 2YJTD 4US0R 3V00A 1MO6A 2VYFA 4BLTA 4CEHA 1K5GA 4C7OB 1XU4A 2VP5A 4ZI3A 2N42A 3BD9A 3P4YA 1JEEA 5BN4A 4C9BA 4G5RA 2WKQA 4KLNA 2ZJAA 4W7SA 1W4CA 2HXSA 1E2EA 4A36A 3KQUA 5J4KA 1AK2A 3CPJB 3EZ7A 1YR7A 1TTTA 1ZAKA 3GLGB 3ZH9B 1SQ5A 1OJLA 5KPDA 2J3EA 3KB1A 1ZMXA 2OCYC 4TT3D 3K8YA 2C96A 2CLCX 3EIHA 4YXWA 4URVR 1VCMA 1Z0FA 1PLKA 4HDQB 1EXMA 3S1AA 1E96A 5FPSA 1QHIA 1G8GA 3W3AA 2PLFA 1DBSA 2EQBA 3I61A 3IGFA 2E9SA 2X2FA 4DDUA 1XX6A 3IEVA 1JJVA 1S4QA 4ZDKA 1RJ9B 4Q4JB 1Q12A 1E2MA 2ZRDA 3JVVA 1YZKA 1WB9A 2FGKA 1N6OA 1P61B 1E9CA 1NBMD 5DISB 3OEHD 4DCNA 5FR1A 2A3RA 3NH6A 1CP2A 1IXZA 1ZUIA 3QF4A 3ZIAA 3VU9A 1G3IA 2EFEB 4EJSB 5CB8A 4AD8A 1DARA 2B6HA 2IS1A 4KBGA 5TY0A 4ERNA 2V1XA 4MYHA 1O87A 3MWKA 4DSUA 1XTJA 1ZU5A 4W5HA 3KKNA 5IK2A 2RGCA 1SVMA 4P3YA 1U8YA 2EU8A 4PC2A 1R8SA 2GCNA 2R8RA 2ZJBA 3NTUA 2RGNA 3A1WA 2HT1A 1R5BA 2NGRA 4HAWA 2B92A 4PPGA 3R8CA 2BM0A 3ASZA 3W90A 5JMTA 2FDCA 4FWIB 5KUTA 1LNZA 2ZU6A 1DEKA 1Z07A 4UNRA 2J0SA 2IYWA 4K8OA 4BWYA 1TQ6A 2Q3MA 2XAUA 3C41J 4LHVA 3NBXX 4LYHA 1FQKA 1GL6A 4R9UC 3ZD7A 2IYVA 3A4LA 1W0KA 4LYFA 1KK2A 4V0LA 2IF0A 5SZHB 1E2NA 1G5PA 3A58B 4FMCB 3SHFA 4YMTA 3THYA 5L8VA 2H7VA 621PA 1K5DA 2JIZA 1E79A 4HDCA 4DBLC 2FPLA 3KFVA 1LS1A 2QENA 4URZR 3UWKA 3UIEA 4R7ZA 1NMXA 1CR2A 1I2MA 1X8LA 2BJVA 3W6OA 3CUEF 1FNNA 3PIRA 1XWIA 4TT3A 1G19A 1SVIA 1XXHB 3PFIA 3TNFA 1XMIA 1TQ2A 2RAPA 1SXJA 4ITRC 2O5VA 1KI6B 2G6BA 5J4HA 3TE6A 4CEIA 1KY3A 1P9WA 1VG1A 1U81A 4HB4A 2GZDA 4ASUA 2IYYA 1XDBA 1S8FA 1HV8A 1NMYA 3A1UA 2V8OA 2JDIA 4JS0A 4NYJR 3E2IA 2IL1A 1Z29A 3AF1A 2F1HA 5JWHA 5K8UA 1TEVA 4MH0R 4OK3A 1NKSA 5F3WB 5EP4A 2FMXA 4PXAA 2YKGA 3ZQ6A 2QM7A 2VP9A 3U60B 2UVQA 3DM9B 4Q19A 3BS4A 3MGCA 3SS8A 2AXPA 2W6JA 3AV0B 4B76A 1SXJC 1II9A 4P0TA 3IPXA 1G4UR 4IOLA 3VX3A 4URXR 4Z1MD 3JZMA 2NIPA 2WMOB 4M0LA 4C2UA 2XXAA 2ZSAA 4BECA 3NG1A 2CVHA 2FV8A 3WHKA 4LX0A 4O0MA 2ZRBA 4RD3A 4XIGS 4B3FX 2ZUCA 4QJ4A 1P73A 4HB3A 5IT5A 3EARA 5KDLA 4ESHA 4Q9IA 4IHQA 5EXXA 3FHCB 3Q8XB 1JEDA 4OL0A 4C30A 1NLYA 2AHOA 3B13B 5L3QB 4KBFA 3L8YA 3DMNA 3IBGA 3AGQA 3BB3A 2O8FA 1AA9A 4DKXA 2BEJA 3LDAA 2C77A 4BEJA 5KSYA 421PA 1KO4A 1W5SA 5FL7A 1UM8A 4LZZA 4LY6A 1KJZA 1CF4A 4B2IA 5G40A 3SE0A 4BFXA 3L0PA 1COWD 1G291 2VHUA 3H84A 1LVGA 2DWOA 4Q9KA 2Q0HA 1BYUA 1N6PA 1VG9B 1P9NA 3U4QB 4QBFA 1YZQA 3MAAC 3A4MA 2OFWA 4XWKA 5LPNA 2QAJA 2H16A 1U90A 2ODBA 1AS0A 4OI4A 2ZE5A 3FKSA 1GNPA 2BC9A 2NTYC 4TL9A 3GLIA 3GFTA 4RJLA 2JLXA 2NZ8A 2ZSDA 2CL0X 3AVPA 5FUWA 4KVGA 3UK6A 4ZCMA 3FE2A 3QXXA 1DTSA 1N5IA 1E1QD 4TTQA 3G0HA 1E3MA 4PZYA 2RGEA 1KI3A 2ZRFA 3AVOA 2O52A 1GNQA 3SYNA 1G1MA 3NHAA 4BE7B 1OHHA 4E07A 4L15A 3SZRA 1SULA 2GJAA 4G0NA 3QSYA 2OCPA 1Q20A 1UBGA 1JAIA 4S35A 4KODA 4UXHA 1G17A 5CLQA 4ABYA 5DNYB 2D2FA 221PA 4QBGB 3EPKA 1T91A 2CJWA 3RS0A 4TLEA 4F4JA 1W4RA 1KI4A 1RFLA 1RKBA 3FHOA 2CEAA 5J5CA 4BFVA 5JBQA 1UDXA 2XXAB 2JCSA 1Q1ZA 2J7PD 3FPAA 5SZJA 1E99A 3QF7A 1R5NA 4DEYA 1XXHE 4XTRA 2ZRNA 2B7CA 2MMCA 2WWIA 3KUDA 3PQCA 4FI3C 1U98A 6Q21A 2WHXA 4AYWA 3T5GA 2PMKA 2PMDA 1OH5A 2PZGA 4NYIQ 4YMVA 2JA1A 2IX3A 3L43A 1G41A 3SI7A 3ZVMA 1VHLA 1EESA 3W9YA 2P6RA 4JVLA 1XJCA 2DYKA 4PAOA 4M2LA 1T0HB 3L2OB 1DAGA 1QVAA 3FWYA 1CEEA 3TW4A 4IFBA 3LQQA 2AXNA 1U0HC 4ZO4A 3QKUA 3V4RA 4BLOA 5IK2D 4TSFD 2VSOA 4PANA 1FX0B 3ZGXA 2FGJA 4C0LA 2KB0A 1CXZA 2ODNA 4A8JC 1XP8A 4UJ3A 4PZZA 1Z6AA 3I3SR 1FUKA 3NC1C 4NZYA 3EG5A 3REFA 4IVRA 1SKYE 3K0AB 1PZNA 1Z22A 3KJHA 2NPFA 2ZYTX 3QVVA 5D3MA 4DLXA 2RH5A 3TBKA 3VR2A 4DDWA 2JLUA 3IIMA 3WBJA 2IYLD 3QENA 2C9CA 1VHTA 1DAEA 3DKPA 3KJEA 4QXAA 3PR1A 3ETLA 1LB1B 3A1VA 3DOEA 4N3NA 4XH9B 3P26A 5FBWB 1NJFA 4Q9JA 3CNLA 4Q1AA 3K0AA 1Q3TA 4B3BA 1T5LA 4NBSA 2G77B 3O8RA 4W5JA 4TN1A 3OFND 1LF0A 4HZIA 1FP7A 2QT1A 4V03A 2OSBA 1IQPA 4B44A 1XZPA 1Z6YA 2YINC 4Q9LA 3GLHE 3WRXC 4C0HA 1IY0A 1OYWA 4PO1A 4FCTA 3TK1A 2FZ4A 2ODWA 1JQLB 1R0ZA 3TSWA 1F48A 5BXQC 3AF2A 3W6NA 2GCOB 2ZUBA 4IEEA 5HPYB 1EWRA 1H8EA 2WOOA 3CF6R 3IUYA 5G3ZA 2NO7A 1NVWQ 3NWJA 2R6AA 3I1FA 1W0JD 1JB1A 3A8TA 3AKYA 3FB4A 3QG1A 3CRQA 3KDSE 1W46A 1P2SA 1AQUA 4DUGA 3Q72A 1PUIA 4OK5A 2IYSA 1KI1A 1E2HA 2O8EB 1QHSA 1KZ7B 4OKSA 2WIBA 1U99A 4B6EA 1TL7C 4URWR 2ZANA 2QL6A 1RRPA 2OAP1 4KFTA 4PZLA 2GZHA 4ACAA 4CRWB 4WIAA 1CJMA 1ZNZA 1KJYA 4MKGA 4KXFB 4Q1DA 3EC1A 4PSKA 2QP3A 1HURA 3PJRA 2ZRHA 2ZS7A 2AFHE 1Z8FA 1X86B 2IUTA 1ODFA 2IC5A 1VPLA 4TZ6A 4UQOA 4DT1B 1DE0A 2OT3B 1KDPA 1KYIA 2VHTA 3BBPA 3EA5A 4Q1FA 3AEZA 2HT6A 3IO3A 3IKJA 3QXHA 2GETA 3D6TB 2QE7D 4NU0A 1Z08A 2YWGA 1E2IA 4LK2A 4MA4A 1IXSB 1XTIA 5CYPA 5GVRA 5EUMA 4IOMA 4AY2A 4U5XA 5EE9A 3SYLA 2QMOA 3NH9A 5CYOA 1NKTA 2R6FA 1S3SA 4AYTA 2OESA 3IDQA 2HYDA 1M74A 2IK8A 5JEEA 2A9KA 3LBIA 3LWNA 2BKUA 4GZMA 1US8A 1KAOA 4XVUA 3SQXA 4LJ7A 4PPQA 4IOKA 1VTKA 3D3QA 5ANRB 5EJEA 2W0SA 2BBSA 4Z54A 1EFRA 1GNRA 4NCJA 4ZIRA 3B78A 2LKCA 2HF9A 121PA 4C0KA 2VSFA 1KSFX 2NO0A 3ND9A 3LW8A 4UNQA 2V6JA 5GJBA 1W44A 1RVDA 3VTKA 3A37A 3MG9A 1ZIOA 4JMPA 4GOJA 2GJKA 2OLKA 2JJ2A 2ZETA 3PG5A 5CIWA 5DSZA 1GTVA 4JJZA 4MGZR 3ZZUA 3T06B 2QEQA 4BFWA 1W0JA 2J46A 3OIVA 2SHKA 1XRJA 5JRJA 1Q1BA 1OXUA 3OEHA 2O8FB 5E4FA 5H1YA 4E5UA 1IN5A 4UKDA 4PQFA 1QF9A 1TF7A 1S1CA 1VYTA 2GWHA 3B60A 1XTKA 2ZQ5A 3KXLA 3W8RA 1UDWA 3IIJA 1NL3A 4QOSA 1F5NA 4Z51A 2R6GA 4A92A 1V43A 2A5FA 1QG4A 1P60A 4MUBA 3AVXA 3W5JA 2H57A 2BCGY 4K81B 4LHYA 4M1TA 2GKSA 5C4GB 4S2EA 2W2TA 3UWOA 1XCGB 2C9YA 3U7GA 3B9QA 1JXOA 2WPDA 2CHGA 4I4LA 3CONA 1M8PA 1TMKA 1UKZA 1X8JA 1G7TA 4BASA 3IEUA 2IHYA 5FBRB 1KY2A 3VR4A 2CK3D 2G83A 1NN3A 4NCHA 3RS7A 3WRYC 4BQSA 4E22A 1OB5A 4HATA 2N1BA 4G1UC 4TQAA 1E9SA 2VH5R 5L3SB 3K9LA 5KYKA 1HT1E 5GJVC 3W8NA 1DAMA 1UPTA 1ELOA 1ZU4A 5TMPA 5B2ZA 3IILA 4TYQA 1YZGA 2HLDD 3K9GA 4LYAA 1KI6A 2ZAOA 1II8B 1M2OB 1E9FA 3PENA 1SVOA 2P65A 3AB3A 1WXQA 4P4SA 3WYAA 5JECA 2YHSA 1GDDA 1KOFA 2WJIA 3K09C 3SJZA 3VKWA 5C46F 5D3MB 4F91B 1BO6A 3CB4A 3E1SA 4US1R 4ACBA 2EFGA 4NYMR 2XNDD 4PQYA 2F1IA 3PCRB 2CE7A 4DLRA 3QKSA 4M9SA 1L4YA 2R62A 2DFKB 4FMCF 1EFTA 4E09A 1E69A 4YC7A 4TMKA 2RGAA 4NYIR 1VKJA 5CJ2A 3LBHA 1T3LA 3QY0A 4EUNA 4X8LA 2PEYA 4O2RA 4M1SA 4UNPA 2FFBA 1X3SA 1XMSA 4IKEA 4FN5A 2AK2A 1XTSA 4DLTA 2A7QA 2XEXA 4I81A 4DVGA 3L0IB 1Z0KA 2AFIE 3X1YA 1RZ3A 3PV0A 1HYQA 3MJRA 4Q1EA 4C0JA 4HZUB 2OG2A 1DS6A 1WP9A 2YC4C 2ZR9A 1OLOA 4GMDA 5DH9A 1NN5A 2F7SA 2QT0A 1NSTA 3VR3A 3C8UA 4EFNA 1SKQA 1XPUA 4RD6A 1YZNA 1LTQA 4PQRA 3ND8A 3ONWA 1NIJA 1BMFA 4EIWA 5K8IA 1Z83A 2HYIC 3HPRA 2F3TA 1RC8A 2JLWA 2ERYA 3KKQA 4Q7LA 3K1JA 4FINA 2PJRA 3BRWD 1NBME 4M1WA 1PJRA 4HI0E 3QKTA 5GJWC 4M21A 3QBVA 1W0KD 2QNRA 2X2EA 5B58C 1NP6A 2FFAA 1CR0A 1OFIA 4OJQA 3VHLB 1OH7A 4ESVA 2CDNA 4GBMA 4I1SA 2C98A 1X6VA 1KDTA 3O8DA 4W9MC 2CCKA 3AH8A 3Q3JB 1E2PA 4B6FA 1T8UA 1Z5ZA 3BFKA 3U3JA 4Q4AB 5F9FA 1DOAA 2F6RA 1JPJA 1FTSA 1M7GA 2ZRIA 4HAXA 4MRNA 4OHZA 4OI1A 3KQKA 2EW1A 2D7CA 5JS8A 4MGIR 3SHWA 2GEVA 3WHLA 4KSBA 4MKFA 1VYUA 2ZYVX 5AJXA 2Q3FA 2P5TB 1ZINA 1VG0B 4JLAA 2FZLA 2FFHA 3O47A 1U8ZA 3QXJA 1L2TA 1KAGA 3BXZA 2FSHA 3D31A 4G5QA 3RWOA 3E5HA 4WVFA 1NY5A 5FL7D 1KIMA 4JYBA 1TF2A 4HLCA 5JRZA 1B23P 2WWXA 3NXSA 4F38A 3PUZA 1BKDR 1EFUA 1Z6XA 4DLWA 4XD7D 4AIIA 4A0RA 2JIZD 4Q4JA 1HE1C 4US2R 2GAAA 1IY2A 2QY9A 4DCTA 4LBVA 3RRYA 2VO1A 1MR3F 3LXRA 3RABA 4DDTA 4QBIA 2CCGA 3K0EA 1WE2A 3QIAA 2QG6A 3SDZA 5DI9A 2WTUA 2ZSFA 4DSOA 2DHRA 5H68A 2QPOA 3WNBA 3IIKA 4CZ2A 1E0SA 3OESA 2JATA 3OIYA 3KTAB 3PITA 2VP6A 5G3YA 1NLZA 3B1YA 2IS4A 1W7AA 5JCZA 4OHXA 3M6AA 2XTZA 3NEYA 5A5GA 4C0SA 3N5CA 1FTNA 2BBTA 3B1XA 2A5GA 2ZREA 3ZZTA 4GI7A 4M53A 5BN3A 2V7QD 3BB1A 2PL3A 4IDHA 3GEEA 4Z8XA 2R6CA 3NBFA 4BZXA 1CLUA 2GXSA 3GLGE 1II0A 1HH4A 2ORWA 2C99A 2VHCA 1GUAA 3ECCA 2OLJA 3TQCA 3VNVA 4PC1A 3EPJA 5EE1A 1W36B 1TQ4A 1XD9A 3SEAA 1KI7A 4JLOA 4QFMA 3WYFA 1P3JA 3O8BA 3A1SA 3CPHA 2V1UA 4X8HA 2G3YA 2RGNC 4RCYA 3AP3A 3D7MA 2GBLA 1N6NA 2PEZA 3CO5A 4RD4A 1KSGA 4LGMA 1E2FA 1DG1G 2J59A 4RZXA 4JL5A 2E1RA 2ZI4A 2BBOA 1MO3A 2NO9A 2NG1A 3T61A 2PZEA 3LLUA 4PHGA 4D4MA 4WOPA 5CDFE 1N6RA 1TPZA 4D0LB 3EZ6A 1Z47A 3MRSA 1F2TB 4ZIRB 2W6IA 4TMTA 3BH7A 3BAFA 3WXMA 3LFUA 1AKEA 3I32A 4Q7JB 1ZRHA 2IYTA 3GJ3A 4HSEA 4BEBA 2RGBA 2NPIA 5IRCD 1QHHA 3SR0A 2OZEA 1OE0A 4OHWA 1EG7A 5P21A 2IUUA 5DN6D 1FL9A 2QSYA 2GAOA 2JJ1D 2AD1A 4C2TA 4DDVA 1GKUB 2BKEA 4A2QA 4LJ5A 3SU8A 1F2TA 4IXMA 5EUQB 2ZI6A 3CH5A 3N2IA 3Q7PA 3KUCA 4YXWD 3OHMA 2WZQA 3GJ7A 4BUJA 4TYNA 4NHOA 1IM2A 1PLLA 2QTFA 3I8SA 4AKIA 3AVUA 1VDZA 1IOZA 5DGXA 4P4UA 4OHYA 2NOAA 2FG5A 2ZROA 2CJWB 3EW9A 1G6HA 4LV6A 4JLVA 4RD2A 4HB0A 2I3BA 1MO4A 5KO2A 2A30A 4EJSC 1XTRA 2OBNA 2RMKA 3EWAA 3DEFA 5FPYA 1IY1A 4DB2A 1VIYA 5TXGA 1DO2A 1HTWA 4JBXA 1CIPA 1E2KA 1GL9B 2OFXA 2QAGB 4B43A 2YWFA 2CMKA 3U2QA 2Q3HA 4FWTA 4L4UA 5DE3A 2C9OA 3CR8A 5FPTA 1P9RA 3QXCA 2PT7A 3F0TA 4U02A 5HTKA 1G5TA 4B34A 3SBDA 4B73A 2NO6A 3CPEA 1OHHD 1XF9A 2ZITA 1COWA 4K46A 4EPWA 3BB4A 2F55A 5IDVA 3CF0A 1DAKA 4XTCS 3EX7C 3VKGA 4I1UA 4DXAA 3U44A 2XZLA 2FU5C 3X1WA 1GKIA 5EZ6B 1SXJE 2GNOA 1FMLA 4GDFA 1RRCA 3WNCA 4MYUA 1NNEA 2OM2A 2RB4A 4LHZA 4M1YA 2G0NA 1XD2A 2IF2A 2QM8A 5B30A 4X8OA 1KI9A 1ZYUA 2BOVA 2QORA 4ARZA 1B0UA 5FBVB 1J99A 2JJ8A 2QA5A 3AQ4A 2WJGA 1AQYA 3MLEA 3EIEA 3NVAA 4LJYA 1R10A 2BV3A 4OK6A 3P1JA 3ADDA 1AKYA 4DB4A 1D2EA 5FTLA 4HLUA 2JJ1A 4B3CA 5L3SA 2B8TA 3KQNA 1E32A 1XJ0A 1OT3A 1P6XA 3R7WB 1J70A 2QTVB 2WWGA 3LAWA 5BYJA 3T1OA 2VIIA 4DSTA 1G21E 5KDDA 1GRQA 5AWFC 2WAYA 2W6JD 3BERA 2W6ID 3CF2A 1JXMA 1QHGA 1E6CA 1VECA 1FW6A 3R9XA 2AWOA 2GJ8A 3CH4B 2ZSEA 3AKDA 1TU4A 2REOA 3ZDQA 2P67A 1H8HD 2IWRA 5AK0A 1MO5A 3GJ0A 3G82C 3AVWA 2CHVA 2GXQA 1U0JA 2Z6VA 3I8XA 1R6BX 2BMDA 5DLQC 2D62A 2Z0MA 4TL6A 1YHNA 3VR5A 1P2UA 2FWRA 2PJZA 2QP4A 5L3RA 3MWLA 4QJ5A 3SBEA 1NRJB 2D3WA 4M8NE 4KFRA 2IS6A 2MMGA 4WA7A 5H70A 4OYHA 4MGYR 4CT5A 5EP2A 4F93B 5JWOA 1OW3B 1TAGA 5FBQB 4BFTA 3I62A 3EPHA 1OFTA 3R9IA 4HUTA 1OIVA 4NE2A 5JLJA 3R8FA 1VCOA 1R2QA 4YONB 2O0KA 1N3BA 1P5ZB 3LX8A 2OILA 1WQ1R 4IVPA 4BRUA 1JI0A 4MDFA 3QPUA 3KKPA 4UXJA 1V5WA 1MT0A 3BGWA 3CRMA 4LJAA 2HXYA 1FPMA 4QGAA 3X2SA 1HE8B 4A0HA 3GP8A 3DO6A 4HAZA 4KYIB 2YZ2A 3RC3A 2BDTA 1R5OA 1RW4A 3TAHA 3KXIA 4QHSA 3THYB 4WXPA 5DI3B 3N2EA 4L16A 3T34A 5F9HA 1AGPA 2X19A 5JS7A 2QGNA 3NDBB 2GBLC 1W2HA 3LNCA 4MYCA 1IAQA 3B6EA 4BLQA 4IXNA 2O8BB 4B35A 3F5FA 4P32A 1T0JB 5CLLA 4KITB 3HYTA 1YKSA 3LBNA 2PH1A 4JT2A 1G16A 2ZE8A 4D81A 1VIAA 3O8CA 3GLFB 2RGGA 2ZI3A 4MRPA 1J8YF 3ZQJA 4DRZA 5JSZB 1P2VA 2DWQA 5HR5A 4V0OA 1S1MA 1J7KA 5DO9A
chains in the Genus database with same CATH superfamily
2Y76A 4EYKA 1GPH1 2IOFA 3M7IA 2GGSA 3Q3CA 1GA1A 1WBBA 2P4SA 4P3KA 4OUDA 5BSTA 4F21A 2QE6A 3L9WA 4PLGA 5LJIA 3ZH2A 2GX6A 2X6QA 4DVJA 3E61A 1W75A 1FLVA 5CAEB 2GJ9A 4ZT5A 4O4LB 8OHMA 4B2PA 2VZ0A 3EEYA 3Q3GE 2IPNA 2P6UA 3D02A 3H2YA 3RCBA 3U81A 2ZI7A 2C1EA 1BCSA 4JVSB 5A5FA 2JGFA 1KK0A 2PL1A 5EN4A 3VDQA 2PGLA 2OCIA 3FTNA 1KTVA 1ESEA 5AIAA 1YDEA 4IMPA 3SFZA 4FCVA 3A4VA 4R0NA 1CUGA 4HNAB 2HJVA 3ZV5A 4XYEA 1H69A 4NMXB 1DZIA 1ZJ5A 2JLYA 3RT1A 4QXMA 3M5WA 2BUAA 1T2UA 1E5VA 1YQQA 1SMKA 4N7JA 3IDOA 3TW6A 1B0AA 3GFOA 3OOEA 4INOA 4NFHA 3TZ6A 5CA1B 5H81A 1JG3A 1XTQA 4BLWA 4QUGA 4ZO7A 1XEFA 2DHCA 2WWHA 3RLIA 5KNDH 3MYYA 3H83A 3ZCXA 3CSSA 3LCRA 4U1RA 4WY2A 1JTEA 3AJAA 3TZLA 3N2GB 2PJUA 1O9HA 6PFKA 4M7PA 2KQUA 4GYYA 5CNIA 1PUJA 3I04M 4ZU1X 4EYGA 3SSNA 1CS4C 1ZK3A 2BR5A 3F96A 5IF3A 2RI0A 4C88A 4FZ5A 4G24A 2PLWA 4URUR 4ZPXA 3U7EB 5TARA 2TMKA 3T1VA 2DJIA 2H48A 4BQEA 5DB4A 3MTEA 3K2BA 5ENVA 1ZUD1 3JS5A 4HQRA 4B6SA 1JQBA 4IIBA 3HE3A 5E3HA 3ER9A 5G1OA 3DVRX 4KW7A 3DFMA 1DKNA 2W58A 3EVCA 5SZJA 4BATA 4RVSA 1I7LA 4FD2A 4BV8A 1JPNA 2IKQA 1Q0HA 4ZI7B 4LBYA 1UBFA 1KEZA 2IZOA 3K8QA 3TEFA 3TLCA 2XTAA 2PXHA 4Q4CA 3X0DA 1JU4A 2IHJA 4N9QA 4U8HA 3IDFA 3UMYA 1KQFA 3QLTA 3JY6A 2DWCA 1JIXA 3QWIA 3TL6A 1SXJD 1QH9A 2ZJYA 4HQ6A 2JHGA 3ENWA 4RESA 2J31A 3TIFA 4RJJA 3ZCRA 3GRRA 2NVUB 1LC3A 1BW9A 1GLVA 3LKVA 4JXZA 3L7DA 2RGDA 1HLGA 3N1UA 2ORED 4I4TF 4IFTA 3UW1A 1SHZA 4Q02A 1SIBE 1Z38A 4C6TA 5KC8A 2GYWA 1K2VN 2PS1A 3NKLA 3EA4A 4KQ1A 2FFJA 5I9IA 1R0XA 3M34A 4DPLA 2ZBVA 5KVVA 1SC6A 2BVNA 3GNSA 4RIEA 4Y6PA 1V8FA 1AQIA 2PKEA 2PRKA 5CURA 3LZCA 1J0AA 2E4YA 5KS2A 5IYZA 2UZ3A 4WWHA 4B6GA 1HDYA 3O8QA 1SBYA 1UP7A 1Y0BA 1N1DA 2PO7A 2VF7A 4J3NA 4RSHA 1ZM3A 2NN3C 3A6KA 2Y6VA 2ZXUA 4UBKA 4ZMBA 1WU8A 5IDYA 1SIUA 1PTJC 5CT6A 3MD0A 4PYJA 4RMHA 5H4GA 1RWXA 1V9SA 3ORYA 5IM4F 5EPOA 3HA2A 3S44A 1C9MA 3K70C 3E3AA 1NVXQ 2WC1A 4AY4A 3BKWA 3KXKA 1FRQA 1I80A 3TWOA 2FSFA 4BX0A 3VI4B 1UFVA 5FL3A 3T4UA 2J5XA 3DXXA 3SVTA 1PQ4A 2H11A 2VUUA 5AR1A 1J4AA 1M6HA 2NT4A 3U7HB 2RSLA 3O2QB 1R6AA 4N8DA 5D3ZA 4D8UA 5GVSA 3F2IA 2OZLA 1Q83A 5CG2A 5AQEA 3BFXA 1L7VC 3DC2A 1DCMA 3H99A 4FSDA 2DKOA 4QTXA 3RC8A 2VSNA 4GVPA 2PVCA 1Q92A 4QXQA 4XXHA 5KYTA 2QN8A 2DSTA 4TKMA 2QLMA 2Q07A 3RI3A 1MJGA 4WK6A 2ZM5A 5EXPA 4HJXA 3M82A 4ZHQF 1HQKA 2FW7A 4LAFA 4ER6A 3LYAA 1GQOA 4C6TB 4IMJB 5I7HA 5HOQA 4BWFB 2FCAA 1VRCA 4ZI5A 4JI4B 2CYBA 2XF8A 4RZHA 5CM9C 1A76A 2GESA 3IXMA 3OAAD 3E2PA 3J81k 4W5WA 1JJAA 3HB4X 3VR5H 3K73O 1W4BA 2QKYA 3PXXA 5EZYA 4WTOA 4EQ6A 2ZUEA 1QMGA 5ILGA 2NSLA 3BGVA 4OB8A 4RKFA 2A88A 4K40A 2PNFA 3K31A 3V34A 1M83A 4DKJA 2GD2A 1P5JA 1WOMA 3A28A 3OZIA 2Z1NA 1QM5A 2QNBA 1KZ9A 2WM8A 1LQTA 1RPAA 4DN6A 3GN2A 1JG1A 3BSWA 5E6UB 2QMZA 4X24A 4CDMA 3FMFA 4IYRA 4YLEA 4C1NA 3RAJA 1Q3HA 1Y3CE 2OP0A 521PA 4LJSA 1ACLA 1NBHA 4HBGA 5DT9A 4DG8A 4OLAA 4ZV9A 1HFKA 4E5MA 5F3DA 1EG2A 4PO9A 1EXNA 2GAIA 4YROA 3ZCTA 1NG9A 2ZIFA 2WAXA 2PX5A 3ZOZA 4H08A 3OZBA 3I76A 4W1PA 2ZAIA 2HFJA 1J2UA 2R1ZA 2R8YA 3FGZA 5IXSA 3D4BA 3MCTA 1O6FA 1VL1A 1ZUHA 3ER6A 2PXXA 4DNPA 1CD5A 1NM5A 1QJCA 4NKRA 5AK3A 2HJGA 4LZWA 4Q3EA 1FU8A 1PQYA 2CYCA 4R2IA 1T34A 1N2CE 1V71A 1UZAA 1CE8B 4DPMA 3C98A 3I6MA 3F67A 3NX4A 1N5DA 1PP4A 4UM8B 4B4KA 1WMEA 4X7RA 5I7SA 4QQRA 4AG6A 4GUDA 1DWQA 2WBLC 3RSOA 3EWIA 4YHHB 2YBDA 1A7AA 2E4AA 2GO7A 2J4CA 3EZ2A 3SK0A 4MGKR 4YAUA 3V8MA 4G84A 4ZZ2A 5BR8B 3AFNA 4DTIA 1R6UA 1Y7HA 1KYWA 1Z2CA 4A6XA 4KQKA 4ZDJA 2ZBQA 3BKXA 4BCDA 1Q2XA 5CB0A 3BK7A 4GFDA 3KQTA 1FP4B 2IUFA 2WJWA 3QFSA 2JI4A 1HT0A 1GYRA 2JFBA 4TT8A 4YP9A 2BMWA 3TD6A 2JIQA 2AFIB 2J3IA 3VH3A 2OR3A 3W8DA 5I5GA 4B2LA 3TF5A 5BQOA 4R8RA 3OTQA 4O2BB 1JH8A 2C42A 3F8SA 1Z45A 3RSHA 1P1CA 2O8EA 4CWAA 2A0YA 1Q7TA 2RHHA 1EIWA 4ARSA 1QZ3A 4P2BA 4R2WA 1DC8A 4DADA 1L1RA 3LBAA 3O4GA 1ZOLA 2SBTA 2W2VA 1ONOA 3OKPA 1Z0UA 3QBDA 4EJMA 4F3YA 4KXYA 4MHTA 2RCNA 2GBPA 2WG1A 2GN6A 3ESCA 5A9TA 4RTPA 1NW4A 3AEUA 2DEUA 2A67A 4REMA 4CTOA 2R6DA 4P3NA 1NRXA 1USIA 4IQFA 4URYR 5DYYA 3DLBA 2VAXA 1LWNA 3DYBA 4DY6A 1Y1KE 2E48A 1I5RA 3MTGA 1RU3A 4N01A 1IOVA 1QG6A 5EUCA 6LDHA 1PL8A 2W90A 5M29A 2L2QA 3INNA 2C92A 4GSYA 1Q0RA 1FP1D 1MQAA 3NHWA 4LYDA 4OXYA 4Q15A 2ZRJA 4QC2A 4XGIA 2QTTA 1RWVA 3RRNA 4ZWNA 2OD9A 3IQEA 4YRBA 3S99A 5ALJA 4F46A 1OKKD 4ARVA 4BV2A 2QZSA 2JVIA 5AOVA 2ALJA 4TMFA 3UYLA 1BYIA 3N2ZB 3JQBA 2WAMA 3ZVRA 1J2JA 1TVCA 3C1OA 3E8XA 1C7IA 2FQ1A 1JG6A 2B9VA 3IJEB 3R0JA 3TG2A 1SVNA 3BJRA 2VJDA 5TQJA 2YL2A 3Q8KA 5JASA 1J1IA 3NDPA 4BFYA 4QAJA 3AR9A 1V6CA 3HDTA 4YP5A 4L6IA 4TKUA 2VTDA 5CDHA 4E5YA 1G60A 4LFAB 4PHTA 3NFYA 4IXDA 5KTPA 4C4OA 1JR6A 2BMFA 4F5ZA 2WTMA 4TMXA 2O2DA 3RTEA 3VR6A 1Q2UA 2FQWA 4RO0A 3A6JA 5D84A 4HRYA 3C5CA 1EHCA 5JMOA 1P6UA 2XRZA 3SKVA 3LYLA 3R76A 1RQGA 2PRYA 3OHPA 1C1DB 3SE7A 5T3YA 2OQVA 16PKA 1H2HA 4L0CA 4ZOCA 4JWKA 4D25A 2F00A 1GPBA 4HEHA 3GPDG 3GZNB 3JQQA 1IN6A 3HYSA 1HWYA 4YRPA 3T54A 3TJZA 4RWZA 4PPFA 4KMSA 5J5AA 4EW6A 3OU7A 2BEKA 4HUQA 3KPJA 4HPXB 1BN7A 3RFFA 4HLQB 2AKYA 3EEOA 4QNMA 1BEEA 2Z4TA 3QV1A 4R54A 4UMFA 1HRKA 4XIJA 4AF7A 2ZJ8A 3DNFA 3KQLA 3C1UA 1IE3A 3EHDA 5BRNA 3AKCA 3L93A 1NOIA 4HXEB 4D44A 1SCUA 4A2PA 3P20A 4IDQA 2IGBA 3RIHA 2QU8A 5BV7A 3A4NA 3UK7A 5IYZB 2QTWB 3T9CA 4EENA 1U3DA 2NZ2A 3D1JA 1QIIA 2COKA 2YVAA 3QVTA 3RIGA 1J24A 1RMYA 4ZOEA 2CN1A 2QMHA 5ED4A 1E5LA 1GAJA 2V7QA 5LDDC 1ARZA 1ETUA 2QJTA 3MN1A 1PX2A 3LI2A 4GOKA 5ALQA 3WWPA 4KV9A 1T0PA 1K8QA 4QOJA 2EJCA 2I3ZA 4ZV4A 1W8IA 1AX9A 4A2WA 2QXUA 3BPSA 5IDWA 3HGQA 5IAGA 4QYIB 4Q4LA 1Z63A 2FMUA 2GAJA 2PO5A 5K3AA 4FILA 4BZQA 4PIMA 2G76A 3PNMA 2BM1A 5KSOA 1VXRA 4Q3KA 4A8HA 1MH1A 2YZNA 3WMEA 2Z1MA 2R8PA 4BO2A 2H8KA 1ZVKA 1SUBA 1EFPB 4S1VA 1E6KA 2XNHA 2WHYA 4KYUA 4AG5A 4DIUA 4CQNA 4IQ4A 1JQJC 3D6NB 4FZJA 1RC1A 1NR7A 3ADKA 4WLFA 1QHHB 3KZMA 3Q6MA 4RJKA 2BFCB 1IZZA 2AMYA 2GFIA 1CWUA 1TADA 2CSUA 2Q8NA 4BMOB 3SY8A 2QQFA 3ABOB 5JYEA 3AFOA 1V5GA 2WPNA 3G0DA 3DP9A 3PP8A 1VOTA 3TZQA 5JEDA 4UCFA 2NACA 2YWBA 3GA0A 3QBTA 4I08A 1BOFA 1ZN7A 2O8CA 2ZJ1A 4A4DA 4YJGA 1PNVA 1NU8A 1GZ4A 4BO1A 3WGQA 1KFKB 2Q27A 3P19A 5BV2P 1OYOA 5IAOA 1DG3A 5C18A 2HSJA 4FKMA 4P34A 4PXSA 3H11B 4FYHA 1XGKA 4Y0VA 4XIYA 5F5LA 5TT0A 3W5AA 3PX7A 1GDTA 3EVEA 2BFCA 4FBMA 3UWMA 5H02A 3ZHOA 1A7JA 1O94D 3FWPA 3NAQA 3TINA 1NW6A 3R6WA 1FFBA 3TZEA 3B85A 4ZVRA 3PQ5A 1LBQA 3NBMA 3PQ4A 5JVDA 1L8XA 4HQKA 5LP6F 1T6NA 2BCJQ 2FK8A 5IP5A 1ODIA 2VPWA 4YRDA 5BO5A 2J45A 3S2GA 3UPDA 4CMCA 4E6EA 3NT2A 5ECYA 3GEIA 1CX9B 4XRRA 3VKVA 1TYAE 4KN6A 4H7PA 4RKEA 5CM8B 2WOJA 4DBVO 5I4KA 1LW7A 1WJGA 2ODEA 2G06A 3TQTA 5LFAA 1RQPA 1ZMOA 3PNQA 3QITA 3ZHQA 3RK4A 2Q4OA 2PL9A 3R7DA 4Y98A 4DSNA 4ECAA 4ZZ3A 2FQYA 3OEWA 1GPJA 1VL5A 5M3BA 5DYNA 1VLHA 3QTBA 1PFGA 5A1TA 3A6HA 2UYHA 4JYAB 4AJOA 3CZ9A 3T7KA 5FTWA 5FOVA 5CB4B 4Y6RA 1CJTC 2D0PB 2G67A 4IDOA 4TKZA 5DLDA 3RYIA 5LZ5A 1JWLA 3K3PA 2HLPA 2ZKIA 2CL7X 5ECGC 4AWBA 4BFCA 3EDMA 5I45A 4A9AA 4ROSA 1CKEA 2QV0A 2WSMA 4P5PA 1GL7A 1KVSA 1SEVA 4WGFA 2PRJA 2CXTA 4WACA 3AI2A 1B6TA 4IF4A 2ZJZA 4PY2A 5FUBA 4CCYA 1WSWA 3EPLA 2F1RA 4JXXA 1OFHA 2BIFA 4TMWA 1A98A 1AK9A 1ENOA 2IPXA 3AUJB 1ZIPA 4QE3A 2ATXA 1GZSA 1IHOA 2IFTA 2X4IA 1D5CA 2QRVA 1D2NA 4GVLA 4KR3A 3E7FA 4XDZA 3U3ZA 3M2TA 2QYOA 1Y6FA 2X0KA 1L4NA 2TMDA 3HYLA 4JLMA 1J22A 5E0KB 2CKDA 3IQWA 1OBFO 2CDAA 4GBGA 4K9PA 3IE2A 2XXJA 2IOQA 2LWIA 3A06A 1G7CA 3ITKA 3KSZO 4GNKA 4LJLA 3UC5A 1PVOA 3GPLA 2YY5A 1JHDA 3HJBA 5ADVA 4BZWA 5LJLA 3DVLA 1UFQA 1FSGA 3OEED 2CYAA 3OLWA 3L40A 3UCFA 3AL0C 3KALA 3TTUA 2XGOA 3M4JA 1RLUA 2ZSHA 4YMWA 4HFRA 1L7DA 2PFKA 1H2XA 4UMVA 3RTBA 3OT4A 3UGKA 2NTJA 2Q7XA 3KR0A 1EK1A 1P4SA 5CJPA 3OMLA 4BLSA 1G6Q1 2NYVA 1X15A 3ENKA 1XZHA 1JIQA 1H65A 3QELB 2H1VA 4P4SB 3WLFA 2PPVA 4BP1A 4CM9D 2HUPA 5BR4A 5DNCA 2QAIA 4FYWA 1MAVA 3TRIA 1IXYA 1T1RA 1KRWA 1K7FB 3RYIB 4AKEA 2OKCA 2JFPA 2OCKA 2XD9A 3JV7A 2M1XA 5ALNA 2PCLA 1E58A 2O14A 2ZPAA 3R7WA 4H0NA 3E3LA 4I1VA 1BX0A 1OGYA 4ETIA 4NENB 1QHEA 5LBUA 1EKXA 2WM2A 1VGRA 4QBHA 4B6PA 4A23A 2UZ1B 3SQNA 1XZBA 1ZIDA 3IAEA 5K3BA 5IN5A 1N5JA 1IG3A 1CCWA 4FLMA 5DM4A 3RRZA 1DZ3A 1MNQA 3HJCA 4UHDA 4UTPA 1N0HA 4RPKA 3UXMA 1TZJA 3SQOA 4N7BA 3AUKA 2QL7A 4ALMA 2YWXA 1G4HA 3CX7A 2OORA 3QWHA 4BL5A 3RBAA 3RVRA 1P2TA 1YKGA 1I4LD 2Q50A 3TTVA 4DJEC 4LBZA 4NBUA 2BMEA 2OV2A 2DFDA 2FSIA 4JLNA 4JI3B 1AXEA 1TF5A 2J6BA 3C70A 1MNAA 1MHPA 4JODA 4U7FA 4JT4A 2QIOA 4PGFA 2NMVA 2XKKA 4A1FA 3T94A 1FUYB 3LPDA 1I4EB 2LXNA 5CU7A 1E1YA 1EE9A 2PZKA 3KT0A 4OMFG 1G7RA 3W8EA 2BGWA 4C0JA 1ZJ6A 5KVCA 3DZCA 2DUUA 4WFJA 1KYYA 1XZQA 3GRFA 1U0LA 4QRHA 1RZRD 1RM3A 3W05A 4S3MA 1QZXA 1EMDA 4A7PA 5DLEA 4AFNA 1TIBA 1YU9A 3BM5A 5C7YA 2EWVA 3LV8A 3OX2A 2I66A 3THSA 4NE7A 2PWBA 1QIHA 1XB2A 1YE8A 4X1IB 2I1QA 2DCUA 3C6XA 2J0QA 5DHAA 5K6AA 3OQ1A 4HAYA 2VAMA 3R3YA 3C14C 3ZDYB 3CLSC 3IV9A 4D4KA 1E2QA 1KGSA 1JEAA 4UCQA 2QSJA 2PV7A 1M2VB 4HVAA 3I6IA 3QUQA 4BLUA 2QL9A 3H19A 4R3NA 5JC8A 1H4QA 4L8LA 5DU2A 2W70A 5E9JA 4X64B 2Z83A 1FPQA 3ZDFA 1D1TA 1FTWA 3GDGA 2HWKA 3M33A 4NCNA 5CYFA 3ESQA 4OYRA 3N87A 2QYSA 2VOEA 1LDYA 1E1KA 4G0YA 4GPZA 4JUFA 4D0NA 2Z43A 3RJ9A 4KQJA 1X1RA 3BDIA 4FYJA 3HBJA 1M1YB 3BH0A 3UPUA 4RVDA 4K1LA 2CNKA 3GC6A 1ISIA 4MWCA 1D9ZA 2P4QA 4X3CA 3ANLA 4JBNA 3RHFA 3VA7A 1QYRA 2P2NA 3JRXA 5EWMB 4D9GA 4W5NA 2YXDA 1XMXA 1Z6TA 1KJ9A 4UHBA 1G8PA 1M66A 1T3ZA 3M6VA 1DIBA 1UFRA 1M1NB 1EM6A 3K5PA 3SJCA 1FDSA 4EYEA 1TCVA 2N46A 4G8BA 2QN9A 3LZDA 3E48A 1YBAA 3PQFA 1SOUA 5AKGA 4Y9DA 3JTEA 1HY3A 3IUNA 5KCMA 1NOJA 3SIPA 3RVSA 1TM5E 3R3VA 4YACA 4TTVA 1OXTA 4HLDA 2XECA 1VJGA 3CBQA 3GA5A 2B94A 4FNOA 4LTNA 1BMQA 3KELA 5LUAA 3K6KA 4HDMA 4U5QA 4DAEA 4XX0B 3ZU6A 3AJ8A 2WD9A 4D9KA 1GYPA 1HA3A 1EE2A 1Z0SA 2O57A 5ERXA 3K16A 3ZC3A 4B6JA 4RJTA 4BFZA 3SR3A 2F3SA 4IVNA 3UAZA 2ZRLA 2CHQA 1N6IA 1RLJA 4LJ6A 4YALA 5CVJA 2O8VA 3X1DA 4WXRA 3DTVB 5ALIA 4MQBA 3TOSA 2Z1DA 3AESA 4I9NA 3CUVA 4WOKA 3UOWA 1OXBB 4IRUB 3TKAA 4TZ0A 3C7DB 3K1ZA 2H1RA 4LHXA 1TEHA 3WRXA 4HNVA 1UBKS 3UTCA 1NQ5A 3QKIA 3R0VA 1LS6A 4GECA 4U2DA 1UIRA 4OLJA 4B87A 5HM6A 3WB9A 4OI2A 4V0ME 1ZM4A 1JIJA 4I6GA 2ZI5A 1I2DA 2PSHA 2ZSKA 4LFCB 1NF9A 4BP9A 4XLZA 4MKRA 2X77A 2IWHA 1O9GA 4BVEA 5KC9A 3F98A 3QHPA 1KDVA 3RUCA 1W1WA 5B36A 5I9SA 1XKTA 3FDIA 2WHQA 5K45A 4ON9A 2WICA 4D92A 4JROA 5TC4A 1WKBA 3R7SA 1C0KA 2ETXA 2JRCA 3H42B 3EVTA 4LI0A 4JLJA 5TB5A 4KX5A 3ADBA 5IT0A 2A84A 4S1OA 4L78A 5CNJA 2FPGA 1DELA 4YAWA 1YJCA 2EZ8A 3G0CA 4CR6A 4OI0A 3OZRA 1DJMA 2I71A 4LXGA 3BEDA 1OSNA 4WK4B 1I3CA 1WW2A 2FPKA 4RETA 4YPFA 1EVQA 4CCSA 4EBFA 2H18A 4A8JB 1J07A 1PO7A 1NNI1 2QROA 2R25B 4FR5A 4RH0A 5D6OA 1YQTA 1Z06A 2YHBA 1HT3A 2B34A 3BMOA 1IZ8A 3HWSA 4HBZA 4WFKA 4MZXA 4PR3A 1KO8A 3HN7A 4UHKA 3RVDA 3RAPR 1E5XA 2DC1A 4W1QA 3GNLA 5KYYB 4LYEA 1QBGA 1XZEA 3K32A 1C3LA 1EJBA 4ZO4A 4DEXA 2JGEA 1WUYA 3L0CA 2NVWA 1SK9A 1MF7A 4JJ4A 4RVCA 5HILA 5DW0A 2B0CA 3D2CA 3IQXA 4LDQA 4P7JA 4E1VA 3HTXA 4PCAA 2Z04A 1AVTA 3OCZA 5BN5A 1DVRA 4JI5B 4ILEA 1Q1QA 2JKVA 4G1VA 4CW7A 3ZUPA 3T3MB 5BWCA 3SC4A 3OLYA 3QYAA 2Q4BA 2GXAA 1ODJA 2EL7A 2JL1A 1P81A 5EEHA 1U5AA 2X1MA 3D3JA 4W7HA 3LLSA 3NETA 4WBNB 4EHKA 3HU2A 1XRPA 2A1UA 4WQMA 2P9EA 2VPIA 4JL6A 1C30A 1N25A 3CH6A 3FJ1A 4FMDF 4MQFB 4AICA 2ZT6A 4ZO9A 3UMGA 1MPTA 1T1SA 4P84A 2G80A 1N0VC 2C95A 2F62A 1NVFA 3H1BA 1KI8A 5HUJA 3BWYA 3DHWC 3QU5A 2Y1KA 3HNOA 1XVTA 2HV9A 2Q6KA 3BA6A 2OBLA 4QXPA 1OLUA 1RTTA 3HKDB 2DSNA 1EXDA 4F71A 4YRSA 1UKAA 5AOCA 5HKOA 4XWTA 4BX8A 3FPJA 4UTNA 1PT6A 2YV5A 4BO8A 5SZKB 4J9UE 4RFSA 4F8EA 2HPVA 3PUIA 4X6LA 1P0FA 1TU0A 4I4TB 1VKRA 3FVQA 4RGVA 3CZQA 4GOND 3Q7IA 1XYYA 1DKMA 2DY1A 4XW2A 1CTQA 3W6ZA 1NQVA 1CZHA 2FWMX 1SQ6A 2JLQA 2XMPA 3EY9A 4JUBA 3RUPA 5AI9A 2R6JA 3UMRA 4XQCA 5BR7A 5IZCA 4CEJB 2FAXA 4NBRA 3AR7A 1JSCA 4F4UA 4FOSA 1N5RA 1T4GA 1HZZC 5CT5A 5AUOB 3T1YB 3COJA 3OECA 4NYMQ 2MYUA 2Q6TA 2V4ZA 4KXVA 3WG9A 1F0PA 4GMHA 3UV7A 4ENWA 3AU9A 4Q7QA 2H1LA 3L7KA 1D4FA 4F4CA 5J1TB 4QELA 4K1XA 4Q9HA 3QKRB 3B6JA 1X1BA 3ZD6A 4B3GA 5TNXA 3WLPA 2NYUA 5BN1A 2YFQA 4M46A 4TRRA 3MPOA 4OVKA 4BGDA 2Z4SA 2QRPA 1FMTA 3A1DA 4XD7A 3I52A 2ZOSA 3SIWA 1AJEA 1GKYA 3CQ9A 5IS2A 1ENPA 3BL5A 1V41E 3PHGA 3TJMA 1P44A 4WESA 2O0JA 4YCJA 3WMRA 3OJCA 2DPYA 2G1UA 2YHAA 2XCIA 3REQB 4CN8A 2GF9A 2CWDA 1L1FA 4E5NA 1M2GA 4CCYB 1KJNA 4OGLA 2C5GA 1E1RA 1TUIA 4UD6A 2QI9C 4MI9A 1NWCA 1R0SA 4E15A 5FWYB 4OQLA 3GF4A 3FKSD 3EF3A 2I87A 1JLLA 4JSYA 1C7RA 1JHZA 2QD2A 3E5RA 4BYMA 4XWGA 3IH5A 2PQ6A 2QL5A 1E8DA 2KJQA 4UZSA 3T12A 4Q4HB 1AURA 2ZIAA 3CR7A 4DM7A 4REOA 1U3VA 4FOTA 1AU9A 3CX6A 4ZT7A 1ZPDA 1GCUA 1GG5A 5HZHA 3FKQA 1ILWA 2BGRA 3QMVA 4OLHA 4KE9A 5JSYA 4LCBA 1OBHA 3TGPA 5HKBA 4EHHA 1F9AA 3V4PB 1BMDA 2FVYA 3D0OA 2H1WA 2NXJA 3G13A 2BFFB 4WZZA 1WU7A 4JJIA 2XUZA 1O6BA 1QHXA 1OLSA 3EAQA 3C3YA 2I4MA 3H13A 1A9OA 1QVVA 4BMSA 5JI2E 2FW8A 4C4AA 1TECE 2C04A 2PGIA 5K3FB 1E4VA 5ESWA 3VPGA 5CEJA 4P4TA 5FUXA 3ZS9A 4KGXA 5I9LA 1Y1PA 1YQGA 1R9MA 2XDWA 3GX1A 4ND2A 5A3SA 2VF5X 1SVKA 1DWUA 3PX3A 5DRTA 2WJ6A 1CIJA 1GAXA 3DW1X 2GFHA 3MRVA 3LDHA 3EQ9A 3HWRA 4FXPA 2YUTA 2ZB2A 4XM0A 2HI0A 4I3HA 2HO4A 5EMMA 3JQ8A 3PIIA 5KNCA 1KWKA 1XCLA 1NBWB 4MULA 4L7VA 3OOSA 3ESYA 1J42A 3NDJA 4OTZA 3OPYB 3T8YA 4Y6LA 1RAEA 4TUYA 1JR2A 4BNMA 5AM2A 6ABPA 3ZPXA 4R6XA 2XGSA 2GTIA 1X9GA 2XUIA 5KU7A 1MB4A 3UWDA 1AGYA 2R8XA 2WUDA 2K2QB 4IDCA 3NIBA 1N3YA 2B25A 4V1CB 1CQJA 2W0MA 2ZYUX 3LUCA 3TTSA 5JOQA 1BGVA 3AXSA 1U2RA 4LA4A 5C52B 4R16A 5F98A 4HVLA 3TOVA 1OAAA 4EPTA 2A33A 3QFTA 5JJKA 1K98A 1FMJA 4PN3A 2KBEA 3AY7A 4ZQBA 1YJAA 2ZR0A 5HRUA 4G65A 3FCUB 1JFFA 2WA2A 4L8GA 5IC4A 2P9YA 1U1IA 2IY8A 3QX8A 3H5VA 4F1WA 3V4SA 4OKIA 1HDGO 4R6WA 1ZK0A 1YB6A 4FS3A 1M0TA 1I7PA 3KVYA 3LGAA 1YRLA 2K6GA 4M8LA 4YGYA 1R18A 3RROA 1WVGA 3FCSB 4QJBA 1CQJB 5HQJA 2JLZA 1QZTA 2GPAA 1WBDA 3RVMA 4MJXA 1SBTA 1E4YA 4II7A 3Q9LA 4PS1A 1PZGA 4MITA 3BRSA 4PO8A 1MT3A 1ORTA 4NS1A 2VATA 1GRVA 1OXVA 1ZH6A 2XUFA 4FDLA 3QLVC 4EKEA 4KHPB 5B6PA 3WP1B 1RLMA 4LOIA 2FW1A 3G9XA 4CIWA 3PC6A 1IPEA 3BWDD 5GADl 1NSYA 2VT6A 1YQEA 4Q3NA 2XOKA 2AJTA 1FS4A 3VTAA 2J0UB 1S5PA 2P0EA 5I7UA 3FX2A 5REQA 3TVDA 5SYNA 3IPAA 4EVRA 3EY4A 3QU9A 4YDQA 2BGGA 1ZNQO 1UBRS 2FEWB 3WZLA 4U7JA 3WI7A 4EAQA 4DWJA 1MA3A 1TUBB 5AK5A 2H17A 3W34A 1FJXA 1DBWA 3TZBA 3TRFA 1V35A 4D3DA 5DYIA 4C4YA 3HB9A 4U6SA 5JQWA 1TD1A 1EX9A 3WYEA 1Z73A 2C3PA 3O7MA 3ZXYA 3HBNA 2J41A 2XCLA 5AUPB 2APJA 4UU1A 4UVDA 5I7VA 5FAKA 3Q3IA 4ISBA 2IODA 3KXPA 3MFYA 4JA0A 1XEWY 3C6MA 4E31A 3VOAA 2F43A 4JI0B 4S2UA 1GNTA 4OXNA 5LWHA 1GPMA 2G08A 1A9PA 1U9IA 3CRVA 3DLTA 3ETEA 3A3OA 4DDWA 2ZT5A 5CH8A 3GGDA 4IGIA 1TVMA 2HK6A 2X0IA 3DBRA 3K0CA 1V4BA 3L6OO 4B3XA 5AW6A 1C0LA 2ZSBA 1IM8A 1KSJA 3A6DA 2R44A 3AKZA 3KPYA 4PQGA 4UDYX 2RFLA 2IZ1A 4XYGA 8MHTA 2FOLA 3CLVA 3SSOA 3IKVA 2YRWA 4PYNA 3GGSA 5EQFA 4RL6A 2V3CC 3K2QA 2QVXX 4TSFA 1TAQA 2XQVA 3D3NA 2L17A 3KE8A 4G1CA 2FUG6 3G0GA 3H04A 1K8YB 2PUAA 2ACKA 5CB4A 4NONA 2EG5A 4M7OA 3FRHA 3QVUA 5KYVA 1WWKA 1QYVA 3THXB 1ZCFA 5IUJC 1NVUQ 4DGSA 3DMPA 4PNHA 1WA5A 5TVKA 2VA8A 4XDHA 2IIQA 4B47A 2X23A 5BOSA 1LPMA 3T5PA 1Y7LA 3G5AA 3P9QA 4FYKA 3BIFA 2QVBA 4UASA 4F96A 5IFLA 3DDWA 1DRVA 3B6IA 5TPZA 2HJ9A 5A4DA 4X5OA 5FULA 3ZNPA 1QF7A 3DXZA 3QEJA 3S7TA 2QRUA 3TRHA 2H4JA 4IIXA 5FRDA 4C21A 2MSDB 5THQA 5AVZA 1NYLA 2AR9A 4ZRNA 2JGMA 3MBIA 5BSHA 5L3VA 1IWOA 4O6VA 1W52X 2FSGA 5A03A 1GQFA 1GP2A 1GG8A 2J7PA 2Q5IA 2VNJA 4KPGA 5IBPA 5K8TA 4R98A 1ADBA 2VDOB 4OB7A 3WBBA 1NVAA 5LU8A 3IEXA 1N6LA 1Z9BA 3KLNA 4RXUA 5LOVF 2EZ9A 4YJGB 5EIHA 2DP4E 2OUKA 1YDWA 5T4FA 4TS3A 5MGNA 2H2HA 5E4JA 1YCGA 3GN1A 3CZ4A 4LJ4A 5KTRA 3QP9A 1AV6A 1XHLA 4LPSA 4AF8A 2X13A 5CDFA 1OWMA 3OLCX 3ENVA 2I4IA 4IDDA 3L7JA 4ZCPA 4XB1A 5TPWA 2OYCA 3C8MA 4PC6A 3DQZA 4CQMA 4XCVA 4LDAA 2O59A 4NZ9A 4EB8A 3I5XA 3G5UA 1N8SA 4C06A 3FCOA 4MB0A 5A5DA 3I72A 3HLKA 1HYBA 1PR3A 4AX4A 2PX8A 1QO7A 5KTTA 2W48A 3PJGA 4RVGA 3QK7A 4EWLA 2EV9A 2VLIA 2NU8B 1QUEA 1NYRA 1YD7A 2ZBPA 4ICIA 5E1BA 2YJ4A 4YUAA 3LUFA 3FI0A 3I23A 1O94C 1AZWA 1O5IA 1VE1A 4IJ6A 4I4CA 1CY4A 2HRCA 3B2NA 3PJEA 3ROQA 1QOZA 5AKKA 2Y1OA 3W2GA 4B43A 3ELUA 1FZQA 4DANA 1P7ZA 1ADYA 4W5RA 4PPNA 4TN5A 3A6ZA 2Q0XA 3K20A 1EFRD 1KNXA 2L19A 2HWXA 2XRYA 3TLBA 1QLHA 2Q3EA 1JSLA 2XW6A 3E05A 3TMKA 4NU5A 1K7YA 1GYQA 1KY4A 1THTA 1C4XA 4NL4H 5DX1A 2Q9BA 3FW1A 3R7NA 3SXUB 5I47A 1TU3A 3F73A 4MO9A 1UJ2A 1XK7A 3PDIB 3R9WA 3Q85A 4KQCA 5INTA 1OA0A 2Q9CA 3TLGA 3TYXA 4NEQA 2JAUA 4US0R 1NXTA 1U2GA 4ZT6A 5EMHA 2ZBGA 4GYWA 4FUTA 1XU4A 4ANFA 5ICEA 2JJMA 3BD9A 5IJZA 2GBIA 4GX1A 4WK0B 5KJ1A 2ID4A 4BY9E 2YASA 1JEEA 3JWEA 5FYDA 3UXYA 5BN4A 4C9BA 5HSGA 4MDHA 4G5RA 2VJMA 4W7SA 1Y8RA 2G9RA 5JNUA 2AC7A 1E2EA 1GT91 3EBOA 3K4PA 5J4KA 4I2VA 5ALKA 5LN1A 3SXUA 2ZWIA 3KT3A 3T7JA 3KNZA 3GLGB 2RH8A 3C3MA 1XZFA 2H63A 4XR9A 4ZOAA 5EHZA 1KARA 2O3RA 3UFXA 5KMGA 1KORA 3QU2A 2C96A 1VE9A 1GQRA 5CPFA 2XBLA 3DE3X 3EIHA 5B5SA 1E7SA 1V2HE 3L8EA 4HDQB 4R83A 2CXPA 4EO9A 3DTTA 5IULC 1QHIA 1GG9A 2CNLA 4FYVA 4QWWA 3DMGA 1DBSA 2ZXFA 2YVKA 1UT5A 2X2FA 4DDUA 3PXCX 4F2WA 3H8WA 2N75A 3GAMA 5DIZA 4FX2A 3IQZA 4ZDKA 5HUQA 4HDNB 4Q4JB 1CZKA 4B3DA 3VSBA 4XOUA 4Z4CA 3DWIA 3ILXA 4TWBA 3IBFA 2ACVA 4FSHA 3KZOA 4WT7A 3IP3A 4BHTA 4HDRB 1QGOA 4GP9A 5IANA 1FP2A 3DR5A 5ALTA 2HO5A 4K9QA 4HC4A 3R9KA 4JKOA 2X9QA 1Y3HA 3VYSB 3NH6A 1DEAA 1ZUIA 2IIBA 3HJRA 3DDHA 4GVXA 4J6FA 3CSDA 2OFPA 2C59A 4AD8A 1HMPA 2B6HA 3ZDRA 3CC8A 2X4DA 4UULA 1IH8A 5BSFA 1O87A 5FDFA 3MGAA 4DSUA 3WLIA 1GUBA 5IK2A 4W5HA 2FWBA 4KLAA 3IUEA 2YXPX 3BVPA 4D0RA 3NATA 3DFUA 1WPQA 4PC2A 1R8SA 1E7WA 1ZD3A 3VVLA 2HREA 1R5BA 3A1EA 2NGRA 2PRSA 2B92A 3HVKA 3MGKA 3LQ2A 4GX2A 3PEEA 2UVPB 1ZSYA 4OBXA 4X71A 1IMJA 3AINA 3WK4A 4DJJA 1JKXA 2Q7DA 3KZCA 4LW8A 1LNZA 2ZU6A 1Z07A 1I36A 1BE1A 1ST3A 2IYWA 2W6ZA 1FYDA 3AETB 4WASA 4BWYA 3PL1A 5DXFA 3CEPB 2R84A 1FQKA 3EN0A 2PZJA 2VPYA 4R9UC 1U4SA 3V48A 3ZD7A 1RVV1 1HYHA 4B8YA 2B5VA 2D2IA 4CTKA 4INZA 3VPXA 3W8FA 2E5FA 4V0LA 2WKSA 2IF0A 3QHAA 3DNMA 5T3UA 3OM1A 4NG4A 2H4YA 5IW8A 5KSWB 3ZXXA 2FR0A 1E79A 2HM7A 4KLRA 2EGUA 2FPLA 1IL0A 2DULA 3ZNQA 4BAGA 4LKOA 3RFTA 5LZ2A 1P1JA