4JSTA

Structure of clostridium thermocellum polynucleotide kinase bound to utp
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
171
structure length
171
Chain Sequence
b'SMKLTIPELSLVVLIGSSGSGKSTFAKKHFKPTEVISSDFCRGLMSDDENDQTVTGAAFDVLHYIVSKRLQLGKLTVVDATNVQESARKPLIEIAKDYHCFPVAVVFNLPEKVCQERNKNRTDRQVEEYVIRKHTQQMKKSIKGLQREGFRYVYILNSPEEVEEVVFERQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metallophosphoesterase
publication title Structural and biochemical analysis of the phosphate donor specificity of the polynucleotide kinase component of the bacterial pnkphen1 RNA repair system.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Transferase
total genus 64
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 2.7.1.78: Polynucleotide 5'-hydroxyl-kinase.
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jstA00
5EZ5A 2ZJAA 2F7SA 5C1BA 4XD7D 1XEXB 3IGFA 3KKPA 1E2LA 1DAIA 2EFHB 1BIFA 1US8A 2A5DA 2H7VA 5GVRA 1U9IC 4IJMA 2GBLA 5FTKA 3U4QA 5TARA 5ANRB 2G77B 2J0SA 2ERXA 5F9FA 1QHSA 4S35A 4KV9A 1DO0A 4C0SA 2BM0A 5IT5A 4XTCS 1WBBA 1XCMA 1RE0A 1LFDB 2NOAA 3IO5A 1MRSA 1FZQA 4DLYA 2HJGA 2NG1A 4LJ6A 5E7JA 4EFNA 2VLIA 2OBNA 5L3QA 3FMPB 3THOA 1G64A 3IO3A 1E1RD 1GDDA 3UXMA 2WOJA 3FHTA 2OESA 2QZ4A 1YHNA 2G6BA 5JSZB 2OM2A 221PA 4X8MA 1NLZA 3TRFA 1OFUX 1VYTA 2Z43A 4DIEA 3W90A 1CRPA 1WDTA 1FOEB 1N6NA 2GDJA 1XMJA 4JL6A 1N6RA 3I5YA 1ZNWA 3AVXA 4XVQA 2CL7X 5BN4A 4OK5A 4V0ME 1Z07A 2WBLC 4OQMA 3REFA 3QKUA 1Z6GA 3CNOA 4HB0A 3VR4A 1KDRA 4C2UA 1CBUA 3LDAA 1XPOA 5B64A 2E1RA 2XGJA 1FPMA 3VR6A 2PT7A 3QKSA 4TZ0A 3CM0A 2IEZA 3KTAB 3ZS9A 1KI2A 4KITB 1PV4A 3U6BA 4EAQA 3QBTA 4UNNA 4K8OA 2ZVQX 4PX9A 2ZEJA 4DZZA 1XP8A 3WP1B 2RCNA 1J99A 4B6EA 3RWOA 1G8GA 3EIHA 3TR0A 1LS6A 1TPZA 3LW8A 4MGZR 4AKGA 1OLOA 2ZVPX 1KGDA 3AUXA 5KYKA 3QSYA 1K6MA 5JWRA 3SQWA 4MH0R 2VP9A 3ONWA 2AWOA 4URXR 4DCTA 1OH7A 1D5CA 3QPUA 2VF7A 4C30A 2J7KA 4R7ZA 1GP2A 3ADBA 5FI0B 2QBYA 1UDXA 4TN1A 4Z1MD 4P4SB 1CF4A 4RD4A 5EE0A 4NYJR 3U7FB 1J70A 1NKSA 1M7BA 3RAPR 5EE5B 1Z6TA 4Q9HA 4LK2A 4A92A 5SZHB 4X8HA 3TBKA 1E9SA 2ZI6A 3QEJA 3W6OA 1VTKA 2IUUA 4DHEA 1Y3AA 4I1VA 4ZCMA 3A4NA 3UATA 4R71A 3KJGA 1XCGB 2AHOA 2QPTA 1AIPA 1TQ2A 3U7EB 4BFXA 4B73A 2JIZD 4FCVA 5FPHA 4HAWA 2HCJB 1AM4D 3LLUA 3H86A 3TUIC 2QT1A 2W6IA 1R0WA 2ZUBA 2RGNC 1IHUA 4BFWA 4KBFA 4Q9LA 1JBKA 4JLMA 3SOPA 3B9PA 5G3YA 1GSIA 4RVCA 4ABYA 1S96A 2FOLA 2VQSA 3FWYA 1T3LA 2IYZA 2QN6A 4JLKA 2QSYA 3BERA 3UIEA 3U7GA 4M9XA 2W6ID 4KJZA 4BLRA 2TMKA 1YZKA 2JLXA 4D4KA 3QXXA 2RMKA 5KSOA 3J81k 4XWOA 1P2VA 4B32A 2XNDA 4DLWA 3C16C 4M1TA 4TTQA 1DARA 1SKYB 3SE0A 4WVFA 4DLUA 4ERNA 1OFTA 4BFSA 4JVNA 3VQTA 2Z5FA 1KKLA 2H5EA 3X1ZA 4L9SA 2BM1A 3NH9A 5FBVB 3PEUA 5M04A 2ZJZA 4WZAE 1KSGA 2XNDD 3QE0A 2XX3A 4NE2A 1G5RA 1H8ED 2IF0A 1VCNA 4B75A 3Q9LA 1HA3A 2ZJ8A 2RGDA 1QHGA 2IL1A 1W0KD 5SZJA 2BBSA 4HZUB 4LHYA 2QAJA 4GT1A 1IXSB 3TSWA 3LV8A 5EJEA 4WAUA 3KXIA 1G9XA 1F6BA 1H65A 3H0KA 3QKRA 5A4JA 5GJBA 3W9YA 1R2QA 2IYWA 2WWGA 5FOWA 3SFZA 2FMXA 3KFVA 1DADA 1Q3HA 2FPLA 2F9LA 1S9HA 3MD0A 1NBMD 3A1VA 3U6KA 4H1VA 3K09A 4MYCA 2O8EB 5CDFA 3T1OA 3B13B 3SYLA 5HPYB 4DUGA 3KB1A 4MYUA 3RC8A 3ETLA 2DR3A 2C9OA 2P6NA 3CKLA 3ICEA 3CRMA 5JEDA 3CWZA 5LDDC 4HLDA 4IOKA 1P9NA 3A6PC 1T9HA 3MMPA 3NH6A 4CW7A 3Q72A 2NO7A 1GFIA 3OHMA 4CT4B 2EFDB 2ZI9A 1NI3A 4YMSA 3EA5A 1KTVA 4OI1A 5B2ZA 3RS3A 3CWQA 4IDHA 3SFVA 5AUOB 3WYFA 2F1JA 4DLVA 3E5HA 1KO5A 2IYLD 3GLIE 2ZS7A 2DFTA 3B1XA 2R62A 1YJ5A 4JLDA 1E69A 4Q21A 5H68A 3MGCA 5FR1A 2CLDX 1Q1EA 2JLVA 3NTUA 3UWOA 5DO9A 3K0CC 3K9NA 1AQUA 1GAJA 5EE3A 1SXJA 1SVIA 3Q7QA 5EUMA 4C2TA 2AXNA 3L0IB 4TSFA 5F9HA 2H8KA 2PEYA 2YOHA 2P65A 4RFVA 1OV4A 5JI3E 1EX7A 4LPKA 4RFSB 2IF2A 4E22A 1N0UA 1Z08A 3CUEF 5C4GB 2RHDA 1SXJD 2GXQA 4GNKA 2ZI7A 4MA4A 2VTKA 2AD1A 3QOFA 4BLOA 5IF9A 4MKFA 4JJKA 4MGIR 4PQRA 2CK3D 1HTWA 4C0HA 4Y0AA 2UZ3A 2WHXA 3ZQJA 4PPQA 2QRZA 3OIYA 1G20E 4JIMA 3W6NA 4URUR 1TUIA 2JJ2A 3TH5A 2PCLA 4A6XA 3IIKA 4O2LA 1TF2A 1FNNA 5JEEA 4QGHA 5SZIA 2HV8A 2OXRA 4FMDF 821PA 4PPFA 3BFXA 5FBWB 3JVUA 5FPYA 2AK3A 2GJSA 3X1DA 1L7VC 1FUKA 5FPTA 1RYHA 4PPNA 4LDJA 2R6AA 2JATA 1OXTA 1XB2A 2J3EA 3EPLA 3R7WA 3THXA 4TLDA 2HYIC 2DWQA 1NMZA 4W5HA 3LXRA 4B3CA 4DSNA 5FOVA 5CLLA 2NZ8A 1HT1E 2NZJA 3TVDA 2OUKA 1RJ9A 2I3BA 2ZI4A 2RHMA 2Z83A 2ZRPA 4FW9A 4A82A 1N5KA 4HUQA 3AQ4A 3PUZA 2QAGC 4P0TA 3KQHA 1ZNYA 3ZIAA 4EIWA 3CX6A 3FDIA 2NQ2C 1YR7A 1JR3A 1XTIA 4G5SA 1EFHA 4ARZA 4AK9A 3QY0A 4DB4A 1ZMXA 2WPDA 3KJHA 1CP2A 4P33A 2IHBA 2CCKA 2GZDA 2ZETA 3LY5A 3T1QA 1WCV1 2OEPA 2BMJA 3ZIAD 2GF9A 3PUVA 3DM5A 2C98A 4I1UA 4BRUA 4NYIQ 2NO1A 4KI0A 1JR3D 3SJZA 2R6FA 2ZI5A 3EXAA 1FMJA 5KO2A 2IYQA 1MO3A 2WPDD 2WVJA 2G88A 3EZ6A 4NCJA 2A78A 2K5UA 1UKZA 3F0TA 2BCJQ 4NBSA 5GJVC 4D80A 4EPTA 1BOFA 3QNUA 2A30A 2F3TA 1Q1QA 3PV0A 1DG1G 1RW4A 2ZUDA 1DAMA 4Z51A 2XTMA 4KVGA 1HY3A 3BJIC 4PO9A 3REGA 2WJGA 1R0XA 2OHFA 5KDLA 4RCZA 4JSTA 3RRNA 5JFGA 5J4VA 4UNSA 3W34A 1KK3A 1NKTA 3ZVLA 2CDNA 4NCKA 2YINC 1MO4A 1A7JA 3X2SA 2AX4A 4M8NE 4PHHA 4BASA 4NCIA 2QT0A 3U44A 3B78A 1GOTA 2MMCA 4MRSA 1OSNA 2BBWA 1Q57A 5HTKA 2ZRKA 1EFRA 1KI6A 1U9IA 2OLJA 3BWDD 3KB2A 5EP4A 3X1XA 5FTLA 1OFIA 4CEIA 3EASA 4QRHA 6Q21A 4CF7A 1TU4A 5H8WA 1VHLA 4JZKA 4P31A 3RABA 4TZ6A 1IY0A 2C99A 1L2TA 1KAOA 1ONBA 3GEHA 2GJ8A 2AL7A 1G19A 1KI3A 1RRPA 4OQLA 3I61A 1EFRD 1E79A 4DCUA 4A8JC 4A0HA 3ADKA 1PZNA 5J4LA 3QPWA 1CEEA 1KI8A 2N42A 2EW1A 4LBWA 5KNBA 5CYPA 2RGCA 4U00A 2EFGA 1Z22A 4WXPA 5HE8A 5ELXA 2CL6X 3GJ5A 4IOLA 3K53A 5KSPA 4D4JA 4ZV4A 5JLJA 2OSBA 4UXHA 5AJYA 1P4SA 1QBKC 2GAAA 2ZUCA 4OJQA 4ITRC 2O0HA 3K0SA 3QUSA 1E2GA 4H9GA 3IPXA 4Q4AB 2BJWA 2ZU6A 1FQJA 3QXSA 3VHXA 2VIIA 5TMPA 1JXOA 2E9SA 4M1YA 2HT6A 3CBQA 4QBIA 3U7HB 2BC9A 1G5PA 3CONA 4TMXA 4V0MA 2BMDA 4MGYR 4QBHA 4CDGA 1Q3TA 4D6PA 1P9WA 4EJSB 2AD5A 1VHTA 4G1UC 4DCSA 1KY3A 4QHSA 1XFAA 5J5CA 1NIJA 1SVSA 5AWFC 2ZRBA 4JBWA 1G291 1F2UA 2DHRA 1KJZA 1A5TA 1MV5A 2V4ZA 1QHXA 1RRGA 1NP6A 5JS7A 4PC1A 2XZLA 4KLNA 1R0ZA 3BGWA 4LHWA 4B6FA 4JLJA 1YR8A 2WJVA 3U60B 1WA5A 2ZJ2A 3L0OA 1R7RA 3G5UA 1NBME 1N6KA 1OXUA 1ZIOA 4PQYA 1TADA 4YMWA 1DOAA 2VO1A 4WZBE 4W5JA 1ZUIA 3V9PA 2O8DB 3CZQA 4EPXA 1QF9A 5JECA 2JLUA 1D9ZA 4ESHA 3SQXA 1PJRA 2GCPA 5TV2A 2JDIA 1MRNA 3NG1A 3ZZ0A 4DB2A 1DBSA 2FFBA 4QGFA 1SKYE 2OT3B 4D0LB 2W2TA 3X1WA 4LBVA 3I8XA 4ZCIA 1Z6XA 3FFAA 1DO2A 4QJ3A 2NPFA 1KI7A 2JDID 4KO8A 3JZAA 2ODNA 1CJKC 1Q20A 2RGNA 4L4UA 4D25A 1AS2A 3BB4A 4PO1A 3RS0A 2JASA 4PAQA 2Z4RA 5EXTA 5FH9A 2OAQ1 4UXIA 2GEDA 5JWHA 1IOZA 3K8YA 1DAEA 2QROA 4MDFA 1DAHA 2YHSA 1R8SA 2YVUA 2O8BA 4XH9B 5D3MB 4AKEA 5TXGA 3MCAA 4UNQA 3KQNA 5DI3A 3AVVA 3OFNA 1Z28A 3D31A 2X77A 4R98A 2XEXA 2ZRLA 1XD2B 1Q1ZA 1XNJA 2FSHA 4B74A 2NO9A 4G5RA 1ZIPA 4OHZA 3OE7D 4LGMA 4JLNA 4R9UC 5F98A 4U02A 2WZQA 5FUWA 2V9PA 3BAFA 4CEJB 1C1YA 2OCPA 3KZ1E 2GEVA 4NDZA 4BECA 3VX3A 4L8GA 2FU5C 4ZKDA 4DBLC 5DIFA 1WE2A 2IYYA 1U8AA 1II9A 4JT2A 3FTQA 2XNSA 5HCNA 1VG1A 4GOJA 2IT1A 2ZJBA 3TNFA 4PAMA 3NHAA 2HF9A 2XAUA 3UG6A 1N5LA 3KXKA 3TMKA 2GJ9A 1II8B 1S2MA 2OCYC 4Q4HB 3OIUA 4URVR 1X8LA 2C03A 1OH5A 1W4BA 2BOVA 4LHVA 4Z8YA 3HR8A 4E09A 2RGBA 2AFHE 4Q19A 1MABA 5LD2B 3O8DA 4Q9JA 3BD9A 5KDOA 1JEEA 1S4QA 3NDBB 3PFIA 5HR5A 2Q9BA 3SJCA 3VR1A 4AG6A 1XZPA 1Z6AA 3LVRE 1MO6A 4QNRA 1ZVQA 1RZ3A 2B8WA 2ERYA 4G5OA 2A9KA 4PHGA 4YXWA 1A82A 1TQ4A 2XOKD 4BEJA 4I4LA 3T15A 3PQCA 4L5BA 4TMTA 2BVNA 2ZRHA 1VCMA 1MKYA 2W0MA 4M1KA 1U90A 4FWTA 4UJ5A 2GF0A 3L82B 1AZSC 1QG4A 1S8FA 1DPFA 4JSYA 3U3JA 2OCAA 4EFLA 2ZM5A 2IS2A 3PR1A 5G41A 1XU4A 5BXQC 1OXVA 3O8CA 4NMMA 1HT2E 1E98A 2N46A 4TLBA 1TQ6A 1COWA 1MOZA 1VG9B 4Q9KA 3SYKA 3RC3A 2JA1A 1U2RA 2V1XA 2KWIA 1NNEA 2J0QA 4MUBA 2GZAA 4KHZA 2Z0MA 4JVLA 4JL5A 4LC1A 3KKNA 5FPSA 5JRZA 1KZ7B 1EFTA 1NJFA 1TU3A 3AGPA 4LJYA 1WB9A 1COWD 4QC2A 3IIJA 2A5FA 2WIAA 4O25A 2EYUA 2J46A 3KQKA 4HAVA 1MR3F 2ZRJA 2DYKA 3NBZC 4B3BA 4AKIA 1DTSA 4W7SA 4V02A 2IS1A 4ILEA 5JI2E 1XXHB 2G1JA 2GZHA 3AVOA 5JJIA 1LF0A 4C0JA 1N3BA 1U98A 2EVWX 4OL0A 3BXZA 4FCWA 3NEJA 1Z0DA 1ZUNB 2NTYC 3ND9A 3QG5A 3UMFA 3PEYA 1G1MA 1OHHD 2ZANA 4Q66C 4QFMA 1I4TD 3LW7A 3N2IA 1US8B 3KDSE 3LFUA 3U4QB 3VR3A 2NPIA 3SDZA 5C46F 1BS1A 4RZ3A 3WYGA 4Q1BA 5IK2D 5HZKA 4DSUA 1YR6A 3C4JA 5FFMA 1JECA 1UKEA 1X6VA 4LJ7A 2IX3A 2XTZA 4N0DA 1U8YA 2WWWA 1BYUA 3NXSA 5L3QB 1R5BA 1F48A 1E1RA 1R10A 1E9DA 3K70D 1G7CA 4YQFA 3WMGA 2R44A 4OHXA 2R65A 4DDTA 4YMUA 1IAQA 1AJEA 5A0FA 2YYZA 3S1AA 2WJHA 3HPRA 2CCGA 1EX6A 1UJ2A 2FFAA 3PEVA 4QHTA 3TR5A 3NEYA 4EKDA 3FMOB 1G7SA 2ZPTX 2QAGA 3LLMA 3OESA 3FKQA 1IY2A 2GCNA 4RCYA 4TTPA 1DAFA 3GJ8A 5JCPA 4M2LA 4OQNA 4AYXA 4B35A 4OHVA 2O8CA 1E0KA 1XPUA 1XMVA 4TMWA 3SC3A 3QI2A 3ZVNA 2CL0X 5EUQB 1HV8A 4Q7JB 1EWQA 1YE8A 3QKSB 4LYHA 1UPTA 1L4YA 1D9XA 1KSFX 1SGWA 2ZE6A 2J0UA 1K5DA 1U0LA 1CJVC 4MKHA 3WNDA 1YZGA 3I62A 4MRRA 2FGJA 4QL3A 2JLQA 2AN9A 3FYHA 2ASEA 5EP3A 3RSOA 4P3YA 1IXRC 2ONJA 1D2EA 3Q7PA 4F91B 1KNQA 5EP1A 2NO6A 1CLUA 1HQYE 1UFQA 2VHTA 2LCFA 2FGKA 4RJLA 2ANCA 3MAAC 4NYIR 1P72A 3M1IA 1D8TA 3U5ZB 2IYRA 3EC1A 1XPRA 4Q4JA 2ODBA 1CU1A 2GHIA 1TNDA 3CRVA 3OEED 4OBEA 3CR7A 2QBYB 3G82C 1T0JB 2GXSA 3I1FA 5AJVB 4Z1MA 3MUFA 5C2JB 1VYVA 1P3JA 2IW3A 3ADDA 4X8LA 2H92A 4BFVA 3GJ7A 3TQCA 5FR2A 2ZSAA 2WJYA 3HU2A 1IM2A 1R5OA 1CR1A 2J9RA 4H1UA 1Q12A 3ZLJA 5E3HA 3A4LA 3M0EA 3CB4A 1IN7A 4TQUS 3R20A 1BKDR 4ON9A 3CO5A 3TE6A 4PHFA 2JIZA 2KBFA 2FPKA 4CT5A 1OYWA 5JJKA 1DELA 2Q21A 4U5XA 3ZZTA 4ESVA 2WKPA 4GDFA 2ZRCA 5E95A 3T61A 4JYCA 5DH9A 4BZQA 3QG1A 3A1SA 1C4OA 3AGQA 3E70C 4TTRA 4A8JA 4PZLA 3A1WA 1XEFA 3T1VA 4CEHA 2QNRA 5JHHB 1JPNA 4DLTA 1XX6A 2ZJ5A 3A8TA 4M1MA 4HAYA 1GWNA 5FOUA 3SS8A 1ZM9A 4KVAA 3SI7A 2UKDA 4A2QA 3DZDA 3LXXA 3WP0A 1KO7A 4LV8B 4ZDJA 2RGAA 4ASUA 1FX0A 2IXFA 3BFVA 4LCBA 1HUQA 2XJ4A 3R8CA 3WMEA 4DXAA 1JAIA 3HYRA 4BGDA 5LB2A 4C7OA 4HB4A 1NMXA 2FE4A 3P1JA 5CB6A 4MUAA 1FTSA 5BN5A 4PAOA 5EXSA 1MT0A 1M1YE 3O8BA 4XWKA 3R9IA 1E9BA 2A3RA 4ASUD 4ACAA 2F3RA 3AP1A 3NBYC 5CIQA 1GNRA 3E1SA 1R8QA 1QHIA 2QU8A 3GLHE 1H8EA 3LBIA 2GNOA 3I8SA 4QNMA 2AKYA 5GJWC 2J7PA 2P5TB 2PMDA 1KMQA 3K9HA 4Q7MB 4YDSA 1ZNXA 4F92B 1RRCA 4OI2A 4G5GA 1YRAA 4JLOA 2ODWA 3PUYA 4BLTA 1CKEA 1OPXA 1W0KA 2PEZA 3R9XA 3C15C 3W8NA 3SZRA 1KMHA 4KSCA 4N3NA 4RZ2A 3ZD6A 4A2PA 1CR0A 2OBLA 3QKRB 4Q1CA 5KOYA 2D2FA 2J7PD 1I4DD 1E32A 3AUYA 1FTNA 3QF4A 2PLRA 4EDHA 1JB1A 2EQBA 2VSXA 1ZUHA 3RRYA 4NONA 3B6EA 1NBMA 1E4YA 2OFXA 1QHHA 5BN3A 1F2TA 1W1WA 3WXMA 1YZLA 1GL7A 4D82A 1XRJA 4AKHA 1KK2A 3GEIA 3RNLA 4Y0VA 2X8AA 1G4AE 3MG9A 3SNHA 2YC4C 2NGRA 4TYPA 3H84A 1XTRA 2D74A 3FPAA 4BPBA 3ZH9B 2BHRA 1ZAKA 3IILA 3NBFA 4GI7A 4UNRA 2A7QA 3HJNA 4M9SA 3OIWA 4IXNA 3VX4A 4GRAA 3K0AA 1E2KA 1TF7A 2WJIA 3GMTA 2ZRGA 1RIFA 4DC9A 2GKSA 2VHCA 4DDUA 3AF4A 3KQUA 4F4CA 3VNVA 3SBDA 4RZXA 1KO8A 3SHWA 3W8RA 2UVQA 3DL0A 4V0NA 1W5TA 2QMUA 521PA 3ZDQA 2HT1A 1HURA 3WBKA 3VAAA 3MWKA 1SHZA 4UJ3A 3GJ0A 5K8UA 1SXJB 4IDOA 4PZZA 1VMAA 1X3SA 3ICQB 2ZSBA 4AURA 2JLZA 4IDQA 4EPYA 3LNCA 3SBEA 4LY6A 4NH0A 2JCSA 1AS0A 4V03A 3B85A 1ZBDA 2ZSDA 2BKUA 3GLGE 1UKVY 4CRWB 2F6RA 5B58C 2GWHA 2ZR9A 1E2DA 1UEJA 2VF8A 4KU4A 4ZKEA 3FOZA 4NYMR 2IEYA 3RLFA 1X8KA 2CK3A 2F1HA 1P9RA 3LD9A 1OE0A 2VL7A 1DG3A 3WMFA 4EQ6A 1G8YA 3C5CA 2JLYA 3ZD7A 4MQBA 1Z2CA 2JLRA 3IEUA 4BQSA 3QF7A 4WXRA 1W7AA 1IQPA 2FSIA 4B3DA 1II0A 4ZIRA 1W36C 4FMCF 4EUNA 3AP2A 2VYFA 4F7WA 1T6NA 2YWHA 3K0EA 1OIVA 2KSQA 2QUZA 2ZU0C 3NC0C 1GRQA 1O87A 4AI6A 2ANBA 1E0JA 5DLQC 3FHOA 4RD1A 1TAGA 4YONB 1QHNA 2QTVB 3R7WB 3THXB 1N25A 2XB4A 3FMFA 1AK2A 3K70C 3AKDA 4HDOB 2CVHA 3RVBA 3Q5EA 1JEDA 1XJ0A 1RJ9B 2OG2A 3IHLA 3RS5A 3AKEA 4BFZA 1X1SA 1X86B 2WAYA 1UADA 4HB2A 1HH4A 4HUQB 4BE7B 1EG7A 2CLSA 3L2OB 2C2HA 1ZCBA 2R8RA 2WM9B 1W46A 1UF9A 4Q00A 2ZJYA 4Q7LA 3RS4A 4ARZB 1R6BX 1EWRA 4YC7A 2GILA 3SJBA 2J45A 3IUYA 5TDHA 2G0NA 1QDEA 2G3YA 1JQJC 3LVQE 3BFKA 4I1OA 4XSHA 2QMEA 4LHXA 3RANA 1OB2A 3LX8A 4X8OA 1NIPA 5CJ2A 4FINA 2VP5A 2F1IA 4LJAA 1JAHA 3ASYA 1LB1B 4TT3A 3Q3JB 2ZSEA 2P6RA 3TSZA 3V00A 2VHQA 2PZGA 1I2MA 1CS4C 2Q3MA 2V7QD 3CRW1 2PCJA 2REXB 4DT1A 4B34A 2HLDD 4D4LA 2Z6VA 5B57C 1VDZA 4TT3D 2EFEB 1DVRA 1P6XA 2VA8A 4KFUA 3GFTA 5J4KA 4E5UA 3GLFA 4FCTA 4EPWA 2DFLA 3AB3A 2QQ0A 1TL7C 3B5JA 4NHOA 5DGXA 2O8FA 1XBTA 3N5CA 3B9QA 3QENA 5CJPA 1Z3IX 3LO5A 3LRPA 4A0GA 3BRWD 5LB4A 1VCOA 3U44B 3BE4A 1Z0AA 2B21A 1GRNA 1KI6B 2CHQA 2ZRFA 3L43A 1DAGA 2QMHA 4CEIB 1Z83A 1Y63A 3O47A 2ZXUA 1E4VA 5CITA 2CE7A 4O0MA 1S9DA 3D3QA 1M7GA 4F4JA 2WWXA 2ZRNA 1SVKA 1NL3A 3Q85A 721PA 3BORA 3P20A 2GA8A 3QIAA 2WJJA 2QI9C 4Q02A 4IVRA 4DLZA 4HDQB 2IXEA 2VHUA 4AYWA 3TSOA 4F4IA 4ZO4A 1YU9A 4PC3A 1D6JA 2H17A 2IS4A 2OV2A 2RKOA 2FJUA 1J2JA 2QQEA 4IRUB 4HAZA 1XTJA 3QBVA 3CH4B 3QXCA 1NN1A 1X8JA 3RDPA 2KI5A 3GFOA 3UG7A 2FSGA 2DPXA 2DFKB 2JAQA 3EZ7A 3FMIA 5K8TA 2NO0A 3VU9A 4IVPA 3OZXA 2WICA 4Q5IA 5E7MA 4XTRA 5EZ6B 1SKQA 2RGEA 3VR5A 3CNNA 4FIDA 1RFLA 3DPUA 4XVRA 1VIYA 4Q01A 2F43A 4IKEA 3IBGA 4N0EA 2ZQ5A 4TLAA 4B3FX 1P5ZB 3TJZA 4GSYA 3KUDA 5KNCA 4OHYA 4POAA 2WWYA 2GCOA 1OF1A 3AF3A 4V0LA 5C4MA 4AY2A 5J4HA 3PXGA 2IC5A 3HU3A 4K81B 1KK1A 1TTTA 1NVVQ 4Q1EA 3CX7A 1E2MA 1F2UB 3VR2A 3MWYW 4JL8A 1GILA 4OHWA 1GNQA 4Q18A 3A36A 2ZRIA 2P2LA 2PT5A 2VBCA 5KNDA 3EIQA 3DMNA 2IA5A 1E1QA 1M34E 5JMTA 2ZJOA 1A2BA 1NF3A 1U99A 4W5WA 2QE7A 1GL9B 1FNMA 3FVQA 3IQXA 5JWOA 2CNWD 3VNUA 4GOXA 3GP8A 2BMEA 2XB2A 2WV9A 4HI0E 4KBGA 2OCBA 1N6HA 1DEKA 2HJVA 3CRQA 2H18A 3QQ5A 3VFDA 4C0LA 1GUAA 3FKSD 3UK6A 1E1QD 3DHWC 2ATVA 4P4TA 2AFIE 2QE7D 1KSJA 2FH5B 3HP1A 2Z4SA 1LTQA 1ZM4A 4LYJA 2Q9AA 2VP2A 3LH5A 5L3RA 2BEKA 4LYFA 5DSZA 4A36A 4BFYA 5DISB 4D2IA 3A1TA 5SZKB 1VG0B 1KZGB 3EPHA 1D2MA 3PUWA 3I4LA 3MRSA 3AKCA 1OXXK 4JKIA 5E4FA 3AM1A 4G3XA 1P2UA 5FUXA 5BYJA 4AIIA 2GESA 5KPDA 3TLXA 1ZC4A 4TMKA 3EZ2A 1E2JA 4JLPA 4IEIA 4CVNA 4LJ5A 1NG1A 1VIAA 2KBEA 4EPRA 1A2KC 2QRNA 3K0FA 3P4YA 4A15A 2NMVA 2O8BB 2XXAA 2QPOA 2GRJA 1Z0JA 1Z0KA 4DJTA 3GD7A 2ECKA 5DI3B 5AUQA 2YC2C 3I5XA 3PITA 1QHYA 1ODFA 4HDCA 3CNLA 4KFRA 2JJ8A 3EA0A 2OILA 4KXFB 1XJQA 4IEEA 1P7CA 3IIMA 2I4IA 5G3ZA 1FMLA 2ZE7A 4ZI3A 3ND8A 3B8HA 4LZZA 2CHVA 5DYGA 2LKCA 2WWFA 3BB3A 4GMDA 121PA 5CIWA 2QTFA 4NYMQ 3OE7A 4Q1DA 1T0HB 2D62A 1VKJA 4R2IA 5CDFE 2C9YA 4P4UA 5HCIA 5EQTA 1YZUA 2EWWA 4M9ZA 1G21E 1N5JA 1S1CA 1Z2AA 4NZYA 3PCRB 2IYXA 3OIVA 5L3SA 2WMOB 4OYHA 4B3GA 4GPTA 3GEEA 5CK5A 3GLHA 3ZJYA 5JRJA 1Z5ZA 5KHOC 2OE2A 1AKYA 2P67A 5FI1B 2WWIA 1E0SA 2QORA 4I81A 3GJ3A 1E2EA 1G4UR 3D7MA 2YKGA 2OLKA 4NPHA 5F3WB 1NJGA 1VECA 1T8TA 3GCGA 4M9QA 4BZPA 2ZITA 2NIPA 3BIFA 3T5DA 1NLYA 4IFBA 3EWSA 3TGPA 4TL6A 2WMNB 4OK3A 5UKDA 4MKGA 1VCIA 1GZSA 1MABB 3BBPA 1L4UA 1QZXA 3DOEA 1N6LA 3NKVA 2FNAA 4IOMA 4YDHB 3OEHD 2ZRAA 3CPHA 1NRJB 2KJQA 2A5JA 4HLQB 3JVVA 2BMFA 1QG2A 1P2SA 1OB5A 1T3SA 2B7CA 2D06A 3NBXX 1ZW6A 4HEJA 4QG7A 1AS3A 1E9AA 1SHKA 4TLEA 4GL2A 4ZDKA 1W0JA 3F3YA 5CYOA 1FP7A 1SZPA 3UWKA 3TIFA 1E3MA 3CPJB 3ECCA 2VSOA 2XOKA 4TL8A 3KX2A 4QJ4A 2QY9A 4LC0A 4MGKR 1UBFA 2CJWA 4Z8XA 3O8RA 4LJ9A 3LA6A 2HYDA 3C14C 4QXAA 4FD2A 3RS7A 1W0JD 2WAXA 4K46A 1XZQA 4LJ4A 3I32A 2G0TA 4LV5B 2GK7A 2JGNA 4QGAA 1XTKA 3MWLA 2DWPA 3HPQA 5KTYA 4TL7A 1V5WA 2PX0A 5GADl 2G83A 2PZFA 2YWGA 1JI0A 2ZYWX 1WQ1R 3OF5A 2Q3FA 4PXAA 3RHFA 3FB4A 1EFUA 3JZMA 2ZE5A 3TUJC 3GLIA 4PANA 1YKSA 1IONA 2BV3A 2D2EA 2X1VA 2ZAMA 3ZQ6A 2WWHA 3GLGA 1CJMA 5D3QA 4QHYA 4I99A 3GFPA 4QOSA 3U2QA 3OAAD 2WSSA 3QXJA 4TMZA 2GTPA 2YOGA 1AGRA 1HE8B 3VHLB 5DN6D 3B60A 4OI0A 4B33A 4DIDA 2WSMA 3DKPA 5CK4A 4FMBB 5AUNB 1IN8A 4JVSB 5E7IA 1M8PA 4WIAA 3THWA 4AWXA 3AP3A 5IHPA 3KKQA 1OHHA 3THYA 3G0HA 1G8PA 2WSSD 3LQRA 4HB3A 2VP6A 4HUTA 3P32A 2J5XA 3SEAA 1UBEA 4NCHA 3H2YA 1F5NA 4O3MA 4XOIA 4LX0A 5EXXA 5IK2A 3DMDA 3QJYA 1N6OA 1JQLB 1PLKA 3B1WA 5JS8A 1SVMA 5GJCA 4GBMA 2V6JA 1G16A 3CF6R 1KDOA 1A4RA 2AKAB 1W36D 2JJ1D 1FP6A 1Q0UA 1I2DA 3EPJA 1W47A 2RAPA 4GOKA 2W0SA 3EZ9A 2HEIA 4Q4LA 3LX5A 1OIXA 1SQ5A 2QGZA 2C78A 4PTLA 4ZI2A 3BS4A 3S1AB 3TUZC 3KKOA 5FUYA 1E2NA 4EFMA 1YVDA 2IWRA 2D7DA 2FPMA 2W58A 1LF5A 1YRBA 5KPJA 5P21A 2QAGB 1CIPA 1I4LD 4DWJA 4DRZA 3CLVA 1OT3A 1AN0A 3AKYA 5G40A 3PVSA 4A0FA 2O8CB 3EZFA 2PL3A 1HYQA 1SULA 1P62B 3AF1A 2IUTA 2IUSA 3C41J 3K9LA 1F60A 2R6DA 4A1FA 1UAAA 1U0JA 2FZ4A 4HLCA 4M1SA 3SN6A 3TVTA 3WNCA 4LRWA 2ORVA 5KU1A 4WA7A 5L3VA 1NN5A 4LUCA 1DS6A 4V0OA 1KNXA 2J0UB 4FXPA 1ZD1A 2CHGA 5CLQA 1J7KA 2C8VA 1FQKA 4OJKA 4JMPA 1XEXA 4C0KA 5G53C 2ZYVX 3QVUA 1G6OA 2FDCA 4JT4A 2ZAOA 2W83A 4LPSA 4Q4JB 4TQAA 4B3XA 2QTHA 2I1QA 4O2RA 1KJWA 3OEEA 4B2IA 4DCNA 3MWJA 2QL6A 1CULC 3TAUA 3U3OA 4TQ9A 4QM6A 1B0UA 1GM5A 1OYYA 2Q3HA 2B8TA 1QVAA 3DDCA 4TYYA 3BH0A 3WBJA 2W6JA 2VEDA 5JZVA 2ZR0A 4D81A 2P3SA 1OXSC 1R4AA 4GFDA 3EPKA 4WZ6A 1P60A 2OBMA 1W2HA 3A58B 4GP7A 3CH5A 1UM8A 2R2AA 5JSZA 3KJIA 2YV5A 2QP4A 3DO6A 4DVGA 4TYWA 2F9MA 4M22A 4Q1AA 1GNPA 1KKMA 2Q9CA 2GVZC 1KY2A 5EP2A 4LI0A 1P2TA 2W6JD 4RSGA 4Q47A 2IHYA 4C3ZA 2LWIA 2F55A 4A8JB 1E9EA 3HYTA 5FBQB 1W4AA 3E2IA 3PG5A 2X19A 4CEHB 5BWMA 1KIMA 2ONKA 4Q9IA 1S3SA 1P75A 2WTUA 3HR7A 1KOFA 1OIWA 2O52A 3ZS8A 1LS1A 4EJSC 5H1YA 4W9MC 3GJ6A 3EWAA 5HKKA 1A1VA 3RRZA 4QKQA 3KTAA 2D7CA 1Q22A 1ZCAA 2QP9X 3L0SA 1GITA 1OKKA 4ZCLA 4CIDA 1FX0B 2J0VA 3UMRA 1M7HA 3WRYC 4NCNA 1ZYUA 1U94A 2ZR7A 4C7OB 3X1YA 3EIEA 1G3QA 1BYIA 3NHBA 5DI9A 4B2LA 1Q21A 5HKKD 3DKVA 3GJ4A 3VKWA 3T1TA 1WMSA 2CEAA 1OKKD 2FX3A 2VH5R 4NU0A 3A37A 1E2PA 3TW8B 2IS6A 3L0PA 2EU8A 2GETA 4M4SA 1RKBA 1KJYA 4BZXA 3QKTA 4P4SA 3WYAA 2ZRMA 4LOAA 4M53A 3C7KA 5AK0A 4NKRA 1E2QA 1W5SA 2FN4A 4OKSA 1KMHB 4DLXA 4R2HA 3KUCA 4XIGS 1GKUB 1CXZA 4JKYA 2PJRA 3C8UA 2H1LA 1N2CE 2A5GA 3QF4B 4HZIA 1UEIA 1NVVR 2V8OA 4LJ8A 1U8ZA 1W48A 3CX8A 5AR1A 2N1BA 3ZVMA 3RWMB 1S1MA 4OK6A 1QHHB 1G7TA 1F2TB 2FF7A 2HDNB 2O0JA 5FOSA 4MRPA 1WRBA 2QENA 4PFSA 3DZ8A 1R5NA 2YWEA 2P6UA 1E2HA 1W49A 5FTNA 4MKIA 2MSDB 1LVGA 1KDTA 3U3RA 2IK8A 4RD3A 1ZM3A 1GL6A 2BJVA 2D3WA 1T8UA 5FL7A 4D26A 3WY9A 5HE9A 1VYUA 3I72A 1K8RA 3K0AB 1CR2A 1Q44A 1EESA 4URWR 3AVWA 1TQDA 4RZUA 4OI4A 1QRAA 1ZC3A 2RGGA 1GIAA 1ETUA 1G7RA 3NWJA 2J41A 4M0LA 4US1R 2ATXA 1ESMA 5FL7D 4BEBA 1PUJA 3GPLA 2C95A 4KAXA 4NP6A 3KKMA 2KB0A 3VKGA 4MYTA 2XITA 4BWYA 1KHTA 3EARA 2MSCB 4DKXA 4DEXA 4B71A 1G3RA 1Z29A 2W00A 4IHQA 3TQFA 4IVQA 4HZUA 4MITA 4BLQA 4Q03A 2FEMA 1ESNA 1MO5A 2GXAA 3MJHA 5J4YA 2G9NA 2ZYTX 4HSEA 2C77A 4RKFA 2CCJA 2ORIA 3I92A 4UXJA 3SYNA 4M21A 2JEOA 4FI3C 1G5TA 4JVMA 4JLVA 4B2PA 3UMSA 2QA5A 4EQ6B 5LD2C 4JBYA 3B1ZA 4LYAA 4URYR 3CIOA 4V0KA 1JNYA 1Z63A 2DBYA 1XJCA 3TKLA 2O8EA 1E2IA 4PZYA 2KE5A 4IFEA 4ZIRB 4FWIB 2V54A 4DUGD 1YZNA 2C96A 1W2GA 4BLSA 3F5FA 1RVDA 2VHJA 2BCGY 3TAHA 2EYQA 1M74A 5AJZA 5BQ5A 1YQTA 3CW2A 1IJEA 5TVKA 3CRRA 4HLUC 1ZINA 5K8IA 3AVTA 3B1VA 4NTZA 4US0R 3H4MA 1KK0A 1G41A 3CR8A 4D4MA 3EAQA 4YLGA 4LBZA 4MRNA 3ZYCA 3VKHA 1TX4B 2E87A 3T5GA 3UKDA 2DWOA 3L8YA 3PENA 2H57A 1IY1A 2XSZA 3IBYA 1GKIA 1OFHA 5A5GA 2A2ZA 2P5SA 3RYTC 4DDVA 1HE1C 2OXCA 4QBFA 4OQFA 1KYIA 4JJZA 3RSLA 2YWFA 4HYYA 4D0NA 1P73A 1NN0A 2BWJA 2R6GA 1G17A 2VRWA 4TSFD 3AVUA 2V1UA 1ZD9A 2ZIAA 1RYFA 4PQFA 4FN5A 1LNZA 2F1RA 2V55B 2XSZD 1AQYA 2ODEA 2P0EA 4B43A 3AVPA 1NSTA 3QPVA 1KO4A 2ZRDA 4RFSA 5TB5A 4MRVA 2AWNA 3ZGXA 1X1RA 3KXLA 2QM7A 1XXHE 4JLAA 4RKEA 1E9RA 2EFCB 4JS0A 4QGGA 3H1TA 1AA9A 3CF2A 4M1OA 3IPYA 4QJ5A 1WF3A 1XDBA 4A6PA 4Q1FA 1FL9A 1PUIA 2JJ2D 3NC1C 1E94E 2V7QA 3CF0A 4F38A 4DT1B 1Z06A 2YZ2A 2JLSA 1Z8FA 4E07A 5DE3A 4PR0A 2PX3A 2GBLC 4NL4H 2HLDA 3NDPA 1RC8A 4IDNA 2RH5A 2HUPA 421PA 5IRCD 3T34A 2L0XA 2IYTA 3AV0B 3B7GA 4KCGA 3GLFB 4C0AC 2QSZA 1LW7A 4KSBA 4PHTA 3RS2A 1E9CA 1UBCA 2IYSA 2O8FB 2REOA 4AD8A 1IXZA 1JPJA 4LWZA 1CJUC 1FUUA 4G5QA 4F93B 3IDQA 4RD0A 4KFTA 1XMIA 2DCUA 1KO1A 5AJXA 1G3IA 5DHAA 2GK6A 1BH2A 2ORWA 4KYIB 5TY0A 5CM8B 4YMTA 5BW8A 3A4MA 2B6HA 3RRMA 2GAOA 1RPZA 3BC1A 3WNBA 2Y8EA 3LWNA 4D0GA 3P4XA 4QBGB 1C9KA 4UQOA 4TWZA 2UZIR 4BFUA 3W5JA 3AF0A 3W5IA 1CJTC 3EG5A 2AR7A 2FEOA 2QPAA 1H8HA 3K9GA 1JJVA 4JBXA 3CZPA 4GMXA 2CE2X 4P32A 1NVUQ 3NVAA 4A4DA 4PC6A 1XF9A 2WKRA 3IKJA 3VU9B 1UKYA 5FPKA 5KDDA 1XD9A 2BEJA 2QGNA 4N1AA 4KYUA 4WBSA 2HF8A 1XCPA 2BKEA 1H8HD 3CPEA 1NG9A 1T5IA 1GKYA 4NYJQ 3KJEA 1U0HC 2RGXA 4XVUA 2Q0HA 4C4PA 2QM8A 4U7DA 1JXMA 3VTKA 1XMSA 3W3ZB 4G01B 2YOFA 2F43B 5JJLA 1KI9A 1XTSA 2O0KA 4FMCB 4TLCA 1FFHA 2FG5A 1IJFA 2PLFA 5BYKA 1LY1A 1N5IA 2OFOA 2GCOB 1OW3B 2FFQA 1KAGA 2BBOA 5FOXA 3A1UA 4WW0A 2J1LA 1NSFA 2ZSFA 4Z54A 3WHLA 2IXGA 4UNPA 3AEZA 1S3GA 2A5YB 2Q6TA 4FMDB 1ZM2A 1XWIA 1RRFA 3EC2A 2RB4A 2VPPA 3B82A 3ZZUA 1WP9A 2FA9A 4PPGA 4RD6A 2HXYA 1TF5A 4BRWA 3MJRA 2FV8A 2CNWA 4BLPA 4GP6A 3D6TB 5DNYB 4PC2A 2OAP1 1G18A 1G8HA 4M1WA 1CRQA 4RY2A 1GG2A 2GEUA 2O5VA 3IHWA 1PLLA 5C18A 2FWRA 2CMKA 2D4HA 3FKSA 2XZOA 1E79D 2PZEA 1EGAA 1YZQA 3EX7C 4JYBA 3WRXC 2C04A 2FSFA 1HQCA 2QP3A 1J8MF 1EFCA 2QEQA 1OH8A 4J0QA 4IDPA 5H70A 3PEWA 4YMVA 1TEVA 3M4YA 2PJZA 5JCZA 3DM9B 1NY5A 4URZR 1NMYA 2ZI3A 4HATA 4Q4AA 5DYIA 3V4RA 1YR9A 2GJKA 4L16A 3UPUA 2WIBA 2BDTA 5FL3A 1XEWX 1KDPA 1E99A 3SJAA 2DFNA 4ZPXA 1NY6A 4PSKA 1PVOA 3DVLA 4B47A 1ZM7A 5J40A 4QM7A 3Q8XB 4AYTA 1B23P 4A0RA 3K0FB 4MYHA 3HWSA 5FTJA 2X2FA 4EJSA 1NLFA 2XXAB 3L8ZA 4KLZA 4CZ2A 1L8QA 2G1KA 4CGZA 1VPLA 3AH8A 1N0WA 2OZEA 4WOPA 1TMKA 3BH7A 2GJAA 5F2EA 4DDWA 1ZP6A 4GZMA 5B30A 3W3AA 3SHFA 5K8LA 2QMOA 1T4GA 3U3KA 1HEIA 2BBTA 2J87A 5LBIA 1G3UA 4MDEA 1G3MA 1ZU5A 2OO7A 3WHKA 2R9VA 3KFXA 3LQQA 3UANA 1IBRA 1V43A 2REBA 1J90A 1QVRA 3BOSA 5L3SB 1U81A 2AK2A 3BH6A 4Q48A 3ADCA 3NIBA 1KI1A 3AVYA 3MSXA 3GLHB 5AUPB 3BK7A 1E2FA 1EK0A 1JALA 3K09C 4B48A 2PBRA 4A9AA 4LSGA 2PMKA 4KFSA 1P61B 2O8DA 1XD8A 4BUJA 1IN4A 3LAWA 2ZS9A 3U61B 3HU1A 1K5GA 4PC7A 5LPNA 1T91A 1W44A 2IBMA 2X2EA 4DSOA 2EWVA 4IW3B 1EXMA 1UDWA 4PO8A 1AKEA 2IWHA 2BIFA 5CM9C 4TMVA 1O3YA 4IOJA 3OEHA 1T3HA 8OHMA 3BB1A 4XWAA 4C0QC 1GVNB 3R9WA 1D2NA 4G0NA 2W2XA 1NVWQ 5FTMA 3PIRA 3VMFA 1E0AA 2DB3A 1KI4A 2IYUA 3GQBA 2GVDC 4DCVA 1SVLA 3IQWA 1CR4A 2LKDA 2B7BA 1R0YA 1WXQA 1E6CA 1SXJE 4RD2A 1Q1BA 5D3MA 1AZTA 1SXJC 4S2EA 4PSVA 2B92A 3W6PA 4B44A 4XSGA 2CJWB 1TUEA 1MH1A 3ZVRA 1LV7A 3OFND 1SVWA 3PJRA 1DE0A 1ZNZA 2W2VA 5GVSA 1CTQA 5L8VA 4PSAA 2CVFA 1XD2A 4GZLA 1Z0IA 4DLSA 4II7A 5KSYA 1BO6A 3FFBA 3QXHA 4DSTA 1ANKA 2ZREA 3K1JA 1ZJ6A 4CEJA 2H16A 2ZYUX 2C5LA 4A2WA 1WBDA 2HCBA 2YJTD 4I1SA 5EXPA 2CXXA 1NN3A 3GLIB 2ZROA 3AF2A 1FW6A 4JLBA 1YZTA 3Q5DA 1VG8A 1NVXQ 2ZS8A 4ACBA 1W4CA 2R6CA 2VP4A 2WOOA 1F3OA 2XTNA 1S0UA 3HDTA 3GLGB 3F8TA 1UBGA 1N0VC 3AVQA 3OAAA 1XTQA 4KODA 4DEYA 5KSZA 621PA 5KUTA 1II8A 3P26A 2C9CA 2J59A 4Q4HA 5EE1A 5IDVA 4ZDIA 5DN6A 1N6IA 1J8YF 2CLCX 2FZLA 2WKQA 3FGNA 1OJLA 4L15A 4TYNA 3I73A 2VP0A 1JJ7A 1TEXA 4LBYA 1ZRHA 5CB8A 3THWB 2AXPA 1Z6YA 3THYB 1XEWY 3DEFA 1BMFA 3GJXC 3IEVA 2XZPA 2MSEB 1Z47A 4AG5A 3DOFA 1IN6A 2IYVA 2FFHA 1W36B 2I1VB 1M2OB 2V6IA 2MMGA 3D8BA 4ZDWA 3M6AA 4C9BA 3SR0A 3TW4A 4L9WA 4YXWD 3ASZA 1ZD8A 3V4FA 3QEOA 1BMFD 2OFWA 1JR3E 2HXSA 1E9FA 4Q7KA 4DLRA 4E03A 5JHGB 4HLUA 2JJ1A 3N2EA 1G6HA 3N70A 5FBRB 5DHFA 3K0CA 1IN5A 4IXMA 3K70B 1T5LA 3P27A 4BFTA 3MFYA 3TK1A 4LV6A 1AGPA 3FHCB 3SU8A 4XJXA 2JLWA 3T06B 4UKDA 2CBZA 3T35A 4US2R 1GRRA 4B76A 3B1YA 4LHZA 4CYMA 3PUXA 3B2EA 2V3CC 3MLEA 3FE2A 4TYQA 2DY1A 5FUVA 2ZTSA 1ELOA 1DAKA 3I3SR 3GLFE 1PLJA 5JBQA 3T12A 1M6NA 2QG6A 3KL4A 4HAUA 1ZU4A 1GTVA 2YNMA 4OQXA 5HZHA 4C0BA 4HAXA 5FBLB 3KQLA 1KSHA 4TL9A 4XD7A 2XJ9A 1OH6A 2GXUA 2VSFA 4EPVA 1E96A 3R8FA 4AC9A 3EW9A 3LBNA 1Z0FA 5EE9A 1W4RA 2ZE8A 1SVOA 2PH1A 3QVVA 1XXHA 3LBHA 5AJWA 5FOTA 1JR6A 1G8FA 3C5HA 2SHKA 5J47A 3U3MA 1N6PA
chains in the Genus database with same CATH superfamily
2C5HA 2GHQA 2X4DA 2XLBA 1EYZA 3AZPA 1L7DA 4J1NA 1BQ4A 1FBNA 1PE0A 1DJNA 4NENA 5K3AA 5C1BA 3H0EA 3W2TA 1RYEA 1IWPB 3QFRA 1BIFA 2A5DA 4NZZA 2CZCA 2WM3A 4IJMA 1NM5A 2GBLA 5GVRA 5LDHA 3TW8A 5TARA 3TSAA 4BQQA 1U3DA 3UMVA 1QHSA 1RLMA 3KP1A 3LBFA 3WGKA 3EULA 4C0SA 1U3GA 5E1DA 2BM0A 3KR9A 4UTNA 2CT8A 1GYPA 3HVUA 4XTCS 1O54A 2QX6A 5D8DA 1E2BA 1R9NA 2F1KA 2Z3WA 2JARA 1UPBA 4EFNA 5T5QA 3BSSA 4H7HA 5L3QA 3FMPB 4BS9A 3THOA 4B8YA 4M9CA 2O50A 3P0FA 4ZQIA 1I6WA 1HLGA 1EX1A 5ICFA 2RK3A 2WOJA 3T41A 3UXMA 3FHTA 2Y0BA 3UKJA 1PS0A 3BTSA 3A6EA 4YQEA 4NLLA 1VE3A 1Y37A 4K0RA 1V2HE 2QRKA 1J8FA 3FDZB 3MTJA 3PLAE 1YHNA 2G6BA 4IV5A 1E6LA 4IDBA 1QE0A 1VGRA 3K3PA 4X8MA 4DMCA 5HUJA 5LOVA 1ZR4A 2OCGA 3FTEA 4DDHA 4F60A 1PD1A 1Y1KE 4ZHQA 4Z4EA 2ZW9A 5KAPA 3GZJA 2A9OA 3KWLA 5BWBA 3HNPA 3IC5A 3PTLA 4JNKA 1DKRA 3T5BA 3TCXB 1XMJA 1N6RA 1HXHA 3BM5A 3CLUD 2EL9A 2OC9A 4F2PA 4OK5A 5COAA 2ZP1A 3QKUA 1EX9A 1PJBA 1KDRA 2AZTA 3KLNA 4C2UA 1CBUA 3H2HA 2VRCD 3LDAA 4NZ9A 4UBJA 3ZY2A 2J3LA 3PU6A 4S1OA 1FPMA 3VR6A 3QKSA 1H3EA 3CM0A 3KTAB 1Y4AE 2I1WA 1KI2A 2X1LA 2X15A 4ND7A 3O9ZA 5JCOC 3U6BA 2N3ZA 1WHTB 4EAQA 4UNNA 3MWFA 5K0ZA 1URPA 4H17A 2ZFUA 2ZEJA 3VNSA 3QVJA 4CIDA 4G89A 1WULS 4DZZA 1GCUA 3I04A 1CY0A 4B6EA 1QZTA 1G8GA 4AKGA 1LS6A 3MGAA 2A9RA 3W9SA 3MJCA 1VIVA 3ACCA 1O9BA 3VR6D 4IH1A 5JVDF 1OT5A 1V25A 5HM6A 3WB0A 3SQWA 1J5EB 3MHTA 3WAKA 2HA5A 4DQDA 1Y42X 1XA4A 1EWVA 1Y9AA 2V7EA 2W6NA 1OUMA 2AMVA 1A71A 3E48A 3K35A 1NW8A 3KWMA 5A7GA 4TPKA 3T9AA 4X62B 2VF7A 4HNSA 5I7AA 4IX9A 2VDRB 1ZOOA 3JQAA 3FLMA 1I8TA 4GMFA 3DMFA 1ST3A 5HS6A 1PWYE 5KYWB 4Z1MD 2DHQA 3NASA 1SC4A 3U7FB 3QX7A 4N12A 1Y8RA 1Z6TA 3U5TA 4LK2A 3GEGA 3NB0A 4X8HA 5SICE 2ZI6A 3DTVD 1VTKA 3RSSA 2I66A 1V5GA 1Y3AA 2VCYA 3HYCA 3LVFO 3JQAD 2D5LA 1SBZA 3NT5A 4GPZA 2AE2A 1GZ5A 2V7PA 2JFBA 4OG2A 5DHSA 1Q1AA 2BMWA 3KJGA 4NHEA 4J9VA 5ALYA 2AHOA 2OFPA 3HABA 3TQSA 3U7EB 1LPSA 4EJ6A 4D9KA 2JIZD 2H9YA 4O4IA 5FPHA 4DQXA 3TG8A 2EBFX 3JTEA 1AM4D 4RV9A 3W2EA 1N2SA 5D2CA 2ZUUA 1L7PA 3Q7SA 1N9ZA 1FDOA 1A8PA 1NUAA 2ZUBA 3I9V1 2GPJA 4HS9A 3EDMA 3I0ZA 3MRVA 4MUFA 3S7ZA 1QK4A 1DC6A 2G4LA 3NQ41 2JGDB 4EJ2A 3H3XA 3FWYA 4JR1A 2QN6A 5LQNA 1KP3A 2V4MA 2X9NA 4JLKA 2Q1XA 2QSYA 3AR3A 3ELBA 4M9XA 3PYLA 2R1VB 3RAGA 1U8UA 3TSCA 5K6TA 2ACEA 4JUCA 5F9MA 3ZEIA 4YT5A 3G8DA 2R4UA 4D4KA 7GPBA 4KTVE 4YDRA 4QDOA 4ER0A 5LKAA 1G8JA 5CT8A 5JTTA 4XWOA 1I2CA 1ECFA 2PZ8A 4B32A 2H85A 3ZHTA 1R5JA 4F8YA 4LF8B 4NWIA 2X7JA 3G5AA 3SE0A 1W85A 1FFEA 3F4KA 1F8GA 1OFTA 1PI3A 2HPAA 5H9VA 3K9BA 4DVJA 4CM4B 1H9CA 3JQ9A 4NR0A 2BM1A 1BCSB 4MYSA 1HPLA 1ABBA 5FBVB 3VYTB 3PEUA 5K3SA 4HQOA 1TVCA 3OETA 3ZI7A 2WJAA 2ZJZA 4BQRA 3V46A 3KQYA 1MB3A 4NE2A 4Y1RA 3C3BA 1VCNA 3FMVA 3Q9LA 2ZSKA 3LDFA 4WINA 2ZJ8A 3IKLA 4EGCB 1NRWA 3DMYA 3QLEA 4EJ0A 2RGDA 5F2KA 1BAPA 1U2GC 5SZJA 1XV5A 2BBSA 5CGZA 2GEFA 2QAJA 4GBJA 4GT1A 4S0XA 1IXSB 3DDUA 3IRUA 3B3FA 2OGTA 3KXIA 4MVJM 1E2UA 1B41A 4DMKA 5GJBA 3N6XA 3KXDA 3WL5A 3DFKA 4ZVNA 2VT6A 4LDRA 4KXVA 1ZFNA 3G5TA 3OP4A 3MUOA 4R1TA 4PQEA 1P3Y1 4CIWA 3IT0A 1W93A 1YRHA 2FXIA 4JY7A 4R83A 3RIXA 3JQRA 1ZJWA 3GNTA 5FLXA 4DCTA 2PX2A 3U6KA 5JZ9A 1PFGA 4R1OA 1QRTA 1O96B 2GN9A 3K09A 4D45A 2GN2A 4I5DA 2O8EB 3IEIA 3FZYA 4I9UA 1ENPA 2XY4A 2ZWIA 5IYZF 3T1OA 5JSKA 5HPYB 4DUGA 2EJCA 4F4UA 2EEPA 2BHLA 4MYUA 1P1RA 2C9OA 2P6NA 5A7HA 1GPYA 1HOTA 1QIGA 3KZVA 4NXMB 4GECA 1NYTA 3KTOA 5LDDC 2VJCA 3AC0A 4IOKA 3WO1A 4EECA 2NUBA 1LTKA 1Z2NX 1DXYA 1X1QA 3A6PC 1XLVA 2X8JA 5A4FS 3Q72A 4MI3A 1O0CA 3TXXA 1BJRE 3JCZA 3LYUA 3PDHA 4YMSA 4CMEA 2XMQA 2IELA 5ISMA 5LJIA 4EG7A 2XNJA 2G4VA 3BHJA 3CRZA 3SFVA 3WYFA 2F1JA 1A4IA 3NXKA 4G1CA 1PNTA 4OU4A 4ENRA 1D6SA 4O08A 3B1XA 1RQRA 1IEVA 1YJ5A 5AI8A 5H68A 1T8WA 4DKJA 1C30B 3K05A 4NU6A 5JVDA 3G0BA 2CLDX 1Q1EA 2Q5HA 3C24A 3EQ2A 3BK2A 4O02B 4U3JA 4AMBA 5B4TA 3AR9A 2XQVA 1AQUA 1KDVA 5JDCA 1PT9A 3Q7QA 4KVFA 5T4HA 3BMQA 4TSFA 4GI5A 3MUNA 6GPBA 3WLJA 4M55A 4JJIA 2PEYA 1EDEA 2TS1A 1RAEA 4OVKA 5GM2A 3CVYA 1DGQA 3K73O 1EX7A 4LPKA 3RCBA 2IF2A 4AUEA 3SZOA 3CUEF 4M7WA 1JJAA 2VTEA 5AXAA 2GXQA 4G9GA 3ZGOA 5B7GA 1ISIA 2BZ1A 2H06A 4RIEA 1TA9A 3HJAA 2AD1A 4HDNB 4BLOA 4ES6A 3X3HA 4C0HA 2RJNA 4Y0AA 2UZ3A 4CL3A 4CDRA 1CT9A 4XGQA 5I7WA 2JFZA 1LLFA 2D2XA 1JTFA 3W6NA 2D5IA 2OCKA 5DGTA 1CZUA 1P2BA 2GJ4A 2JJ2A 3I9V6 3IXMA 2PCLA 1Q16A 3IOMA 4A6XA 4EITA 3IOBA 1TF2A 4GVPA 4O2LA 1XOIA 2OORC 3X1JA 4G0ZA 4Z53A 1FNNA 2RHLA 3W7VA 3OCJA 4EHBA 5SZIA 1R0BA 2HV8A 3EOAI 3SQOA 4C6TA 821PA 3DT8A 1NJ5A 4CHTA 5IJ0B 3DAOA 1W34A 4MW7A 2FZ5A 5FD8A 2YR0A 3QWFA 5KYGA 3TTXA 2OB2A 2R6AA 4G85A 4QLAA 3T3HA 3FDFA 4WERA 1YWGO 1FCJA 4A23A 3BF8A 1JMKC 3R7WA 4BMPB 4OIFA 4JQOA 1KVQA 2HYIC 3FI9A 1IHYA 4RTSA 1USUA 1YUNA 1RYDA 4WDRA 5CYFA 4W5HA 5KQGA 4WFQA 5A71A 5FOVA 3ILSA 1HT1E 2FW9A 5JSYA 4I4IA 1JH8A 1SOAA 2O8NA 1WO8A 1NURA 1PR4A 2XA2A 3EUAA 2OGZA 3WLQA 1HEUA 1PJLA 2I4LA 5ALHA 3SYTA 4BZWA 3GFQA 3CXRA 3EOBI 4G9EA 1ZSYA 2UZAA 1BW9A 4KK3A 4A2CA 4TKVB 5TR9A 3ZCQA 4MVWA 1Y1PA 4MP6A 4GE3A 4EHIA 1TM2A 2FAXA 3AQ4A 4UZFA 3KQWA 1EKXA 1ZNYA 4IMJB 2ZBPA 3CX6A 1HYBA 3ZXXA 4EIWA 4OLHA 4EKNB 2P69A 2WSBA 4MV9A 3NHMA 4MB0A 3IVAA 4X6XA 3QHPA 4G1MB 4H0NA 1USWA 4DR5B 3C43A 1DMRA 1QQ7A 2W4QA 1CP2A 2IP4A 4DUYB 2GZDA 4PGMA 3GI1A 3LY5A 4MGHA 4UTOA 4YUAA 5CYGA 1WCV1 2ZVJA 3ROZA 5JBIA 2CSXA 2HH9A 2OEPA 4LEIA 3IKTA 5JDIC 3MHPA 3ST7A 2GF9A 1KJQA 5KYNA 4BRUA 1J8VA 2VTDA 3OLQA 4NYIQ 3SE7A 2UYQA 4K87A 3SJZA 3ZU5A 4GWLA 2JFYA 1P0CA 2R6FA 2ZI5A 1FMJA 4GXTA 4QUGA 4KR9A 4KZPA 2FW1A 4FSHA 5AVVA 2Y1XA 3E7XA 3O92A 2A78A 1NMEA 1UKZA 2K5UA 4EPTA 3OIFA 1GXSB 4U4AA 5LN1A 4RIFA 2ZTUA 3RYFA 4B3HA 2HRDA 2F3TA 5I4CA 4C76A 1RW4A 2NUAA 3LT1A 4Z51A 1AZLA 3FRJA 1OWOA 5ULLA 1XMQB 1U63A 5ALOA 5DHUA 4V2IA 5JQGB 1R0XA 3OC0A 4AP6A 2OHFA 3RRNA 3G0GA 4N18A 3H4IA 4OXRA 4D8VA 5J4VA 3KSBC 1Z73A 4UNSA 1U7WA 4F9GA 1QPZA 3ZDBA 1FSGA 3Q3CA 4UVIA 2GRUA 4RS3A 1EVYA 3NGLA 4E2ZA 2XUPA 3H17A 2V97A 2MSNA 4FHGA 4P86A 4JODA 1MO4A 4E21A 4UM9B 2AX4A 4M8NE 1DNPA 4WMLA 4RMHA 4NCIA 3PI6A 4KQ1A 3B78A 3TL6A 2BBWA 3X1XA 2ZRKA 4H3KB 4DXDA 1U9IA 2OLJA 2C4TA 1VL6A 4V1CA 4KRYA 4CEIA 4LZLA 4UUPA 2C2KA 4OAOA 2WD7A 2YYYA 1VHLA 2O07A 3E7PA 2HPHA 3FAKA 4TZ6A 3I4FA 1CUGA 2C99A 2IZZA 2FRVA 3M34A 4YT8A 1JG6A 3KKEA 4B7XA 1VHWA 1PF7E 1RRPA 3STHA 1AB6A 3OPYA 1K4MA 2BFFA 4LNUB 4CKCA 3PR3A 3QPWA 2P40A 1RNLA 1VBMA 1KI8A 3GA0A 3PGLA 1CEEA 1B2RA 4PCLA 3BWCA 5C1PA 4NBNA 1GU0A 3OM0A 4U00A 4FDUA 2A94A 3V8QA 1SBHA 1RPNA 1UK8A 1FRZA 2RARA 1H1LA 1O6GA 3LHIA 4QDUA 5IKXA 5A04A 1XLTC 2O0HA 3K0SA 4JWTA 5LNK1 1MVLA 2O1WA 3I30X 1JYSA 3KPYA 4WFKA 5I45A 2O19A 3MYRA 3VO1A 3G9XA 3CEJA 2C7RA 4I9GA 3NYQA 3S81A 4MIOA 1IIRA 2VIIA 4F56A 4BIMA 1BQ3A 4DNXA 4M1YA 1EFKA 3COYA 3IE2A 4IZIA 4QBIA 1DQPA 3ONFA 1G5PA 2W6MA 2BN4A 2B9VA 4V0MA 5AKKA 2ZIXA 5CVJA 5L40A 1NT4A 4CDGA 4DCCA 1Q3TA 1Z6ZA 3DPIA 4D6PA 4O4JF 3T3GA 3V80A 4G1UC 1GAXA 4DCSA 4I1YA 1XFAA 3GRCA 3F6RA 5J5CA 1A7UA 1T0PA 4E15A 3DOOA 1YBFA 4P36A 2ZRBA 4R68A 5EFOA 1G291 2WJ6A 2ZBVA 1KJZA 1A5TA 1MV5A 1N2BA 1C1DB 1MJGA 1QHXA 1NP6A 4J1SA 2XZLA 1R0ZA 3A6LA 1RE1A 3QWIA 4B6FA 2VK1A 4HFNA 4DA7A 4JASB 2R85A 4Z3OA 3U60B 5AW4A 2I7TA 3T38A 4Q16A 1WA5A 2EATA 1PEDA 1U31A 1KL7A 3I2HA 4KN5A 4H3SA 4BIIA 4HVTA 5AKYA 1QGAA 1JFFA 4RF2A 5H3HA 1N3LA 2IGBA 2IQIA 1TA4A 3OM1A 4PQYA 4DNFA 4QOFA 1N4AA 2C2BA 2EKZA 1Z8DA 5A62A 4NBKA 2H1CA 2Q41A 2XQIA 3NP7A 4LOHA 1QF9A 4YCBA 2JLUA 2WQ7A 2X23A 3SQXA 3I4CA 2PNFA 4ZAWA 1MRNA 4JC8A 1DC7A 4WPGA 3OLZA 1V1MA 4KMSA 3TLAA 3CISA 3U80A 5FP0A 3OIGA 3R23A 2C2ZA 2B1QA 4LXYA 4PLCA 4B5LA 4COKA 3ANNA 4ZCIA 2F8MA 1DO2A 5ENVA 2GEKA 2NQ8A 2NUPB 3AXSA 2IV3A 2VYVD 2NPFA 1N77A 4HN2A 1FYVA 3G23A 1J9GA 2J4DA 3V55A 3NBKA 3QYPA 3A26A 3SLGA 3NM4A 4GMKA 4KPUA 1KAEA 2JASA 1CZLA 1V6CA 1N8TA 2BSXA 2V7WA 3GQBB 2GEDA 4OGLA 4K2HA 5FH9A 7MHTA 1FK8A 2SBTA 1IOZA 3H2JA 3GHYA 1V37A 1XMXA 3UCEA 3CVUA 2X5KO 1KBOA 2YVUA 4NBVA 5FWYA 2IDMA 3GPDG 1NI4B 4AKEA 2A1UA 1U8FO 1E5LA 3MCAA 4L5IA 2NU8A 4NCAA 4OQ4A 2B94A 3AVVA 2PMWB 1QTIA 1GJRA 2PRYA 5CM2Z 1RCTE 2HZ7A 2CL5A 4M86A 5E2AA 5A02A 1JS1X 2XEXA 1O6ZA 1XD2B 2IPMA 2YV2A 2UU9B 1Q1ZA 1IAVA 2FSHA 1KYVA 5E6RA 4B74A 5FOQA 1NNI1 5L7TA 1CR6A 4TWIA 4MIKA 1GCOA 3OE7D 3N8KA 5EFZA 4ZT5A 3A9CA 4FFNA 2J4FA 3WLMA 5F98A 2FFJA 2XB9A 3HEBA 2AN3A 1RWPA 1EE2A 1DZ3A 4TUYB 1C1YA 2C4MA 2OCPA 2PMFA 2ZSIA 3EIWA 3MMXA 3OSUA 4NDZA 5DDIP 3CTMA 3RUPA 2UUPA 2FU5C 4WZAA 1CS0B 1V39A 2X76A 4NCXA 4ZKDA 3QEBZ 2I4NA 3E03A 4HVAA 1DTEA 1IUNA 2C4UA 3DE3X 4C7KA 1HQKA 4JT2A 4S1NA 4WXEA 1GPKA 4BU1A 4GOJA 2PVSA 1HYEA 2ZJBA 3NM6B 3TNFA 3VPDA 3W06A 1QUEA 4S1TA 5DEIA 3S7TA 1F5SA 1H0HA 2HF9A 4JR0A 4EW3A 3UG6A 4IDGA 2BF7A 1X1CA 1N5LA 3DW1X 4C20A 3DYVA 2GJ9A 3MWEB 4FKMA 1T9AA 1ISFA 2R11A 3ZWQA 1X8LA 4QYIA 2HEGA 3CPSA 5LNK6 3F7MA 4QDJA 3C1AA 3B3JA 1MABA 4ZFNA 1CP3A 4LXXA 5KDOA 3BD9A 3KELA 3SKXA 2BP7B 3P45A 4PZ9A 2IH5A 4HNQA 2OPHA 1MGOA 2XB6A 5EPEA 3AJ9A 3FBTA 2DUJA 2HOQA 3PFIA 4FR2A 4OKNA 4EA9A 2Q9BA 1ZA2A 4FDMA 3W78A 3N0WA 3T3PB 5IN4A 2Q5IA 3NDIA 3NJ4A 5J2TB 4XWTA 1QJCA 4EJMA 1JWBB 4YRBA 2A9KA 4PZEA 4V0SA 1QWSA 1PR6A 2O6LA 1A82A 4O5OA 1R50A 4I4LA 4BEJA 1T8YA 2G82A 1A27A 3PQCA 2ZRHA 4I5FA 4YV7A 3CVOA 4BFCA 5KC8A 1NJ2A 1EB9A 1RWQA 1U90A 2OZKA 2VUUA 3R3SA 3LE8A 3T7SA 2IOFA 3NJRA 4DJ5X 3DDSA 1WZCA 4AJ2A 1BXZA 2YJ5A 2ZM5A 4ZI7B 1I7DA 4A5SA 5C8YF 5HF6A 3T3NA 5CNMA 4ZVVA 3ZJTA 2B98A 5G41A 1OXVA 2ZUVA 1HT2E 2N46A 3OJFA 2EZ4A 3A6FA 5K2MA 4ALLA 1TQ6A 4MV4A 1MOZA 1DHTA 4NVRA 4E7OA 4DFDA 2P3QA 3SYKA 3RC3A 1Y8ZA 3VH3A 4YB8A 1ZCJA 4H6WA 3CVWA 3P9RA 2Z0MA 2YZ7A 1TJ5A 4LC1A 3X1MA 3ZE6A 5LVAA 4I2NA 2JCYA 3A1FA 8ADHA 5IJ9B 2IITA 1WB9A 1TU3A 2PS1A 4OXYA 4REQA 3UGJA 1TVMA 3UM9A 3DLAA 1JEYA 5AIBA 1ECLA 1SU7A 3OE5A 5E2IA 4LF5B 1SK8A 1DRJA 2J46A 5M34A 3COSA 4FUQA 5K8JB 2WDPA 3VR6H 3JSAA 1MR3F 2R1TA 2DYKA 4HAVA 1X1AA 1VE7A 1SCBA 1XKTA 2BHTA 1A9XA 2FQQA 2NV0A 2ZUSA 4PU0A 3UN1A 2IS1A 4IUDS 3JRXA 1XLWA 1XXHB 2XE6A 1OZAA 2WHRA 3IULA 1LF0A 4Q3KA 4KXUA 4PBTA 4AZ0B 2XUJA 1OASA 1KY4A 4RY9A 1XN4A 1V8FA 2H65A 5ECYA 3UJCA 3HB4X 3GRAA 4LWPA 4AN0A 1ZUNB 1YO6A 1G20A 4KDEA 4LXIA 4KQHA 2W8ZA 5K7SA 1MC1A 1H2AS 2ZANA 3BRCA 2X9LA 2XDQA 5IWCA 3CSSA 3KDSE 4ZQHA 4L8YA 5IF3A 3U4QB 4ZRMA 1JA1A 1JIIA 3KJNA 3FGOA 5F12A 3VR3A 2IXAA 3X0DA 4X20A 2RHTA 4RZ3A 3GDOA 3WBBA 5HZKA 4DSUA 4U2FA 4BQIA 3I39X 2ACKA 1UKEA 1X6VA 3LL4A 2ZIUB 1J1UA 1LXCA 3F74A 3IQEA 3UW3A 2XTZA 4CMJA 1PIWA 4E11A 1POXA 5C5IA 1L1QA 1F48A 5E4JA 2AJDA 3IBFA 4YQFA 3II6X 1NKVA 5AW7A 3C6XA 3ZNQA 1F1BA 1FBTA 4OHMA 4PLHA 4NQRA 2CUNA 1AJEA 1TYZA 1Q50A 4PG7A 4OYRA 2IOFK 2RJOA 4L9RA 1DIHA 1UMBA 1MRZA 4UM5A 4ENSA 4JBGA 3LKDA 1G7SA 4M7OA 1F9EA 1W6UA 2AVDA 3OESA 4KPEC 1GO2A 5F1OA 4NABA 4QELA 4ZD6A 1A7AA 2Q2WA 3EDYA 3SZLA 4PGHA 1DAFA 4TTPA 3ZWOA 4JX9A 3H16A 4PSDA 2O8CA 2I7VA 2C5EA 1T9ZA 1XMVA 4K6OA 4JBIA 5BN4B 3ZTYA 3WLNA 2ZIZA 3P9PA 4RELA 2DXIA 2FHPA 3S28A 4XOUA 3QY9A 3C6KA 3SQLA 4HDMA 1D9XA 3F6EX 1KSFX 4OQQA 4ZVSA 4BNUA 1IZZA 2J0UA 1K5DA 2CBGA 1CJVC 2WKWA 3ML1A 4MKHA 2R7LA 1UT8A 2Z2XA 1NNSA 3SS9X 2P4EA 1Z17A 8GPBA 5KX5F 4HWPA 2ZYGA 1QP8A 3R3ZA 2Y0DA 4P3YA 3VI3B 4WKBA 3W04A 2WYOA 1D2EA 4MAFA 4CIVA 5EP1A 4NARA 2BD0A 2VHTA 4C07A 3PZBA 3PGXA 2F55A 1UJ4A 4NYIR 3M1IA 4TLMB 3VYWA 2IYRA 1RI3A 3CKMA 3EC1A 3F96A 5KOJB 1CU1A 1SO8A 3M9WA 1BXRA 2E6KA 4TV8B 1U28C 5GQSA 2PMEA 3HJFA 4CKEB 3CRVA 3OEED 3V1UA 1QK3A 5FBQB 3CNBA 4M3NA 2ZLBA 3DC7A 3ICPA 4GW3A 3MCWA 5AJVB 1VSTA 1VLHA 3PXBA 1P3JA 2GRAA 1CZHA 1NDQA 2VXCA 4DILA 3ZLUA 1JDNA 1V7PC 3MWDA 2ZSAA 2ZYDA 3SX2A 4D3XA 1IM2A 2OV1A 3H4VA 2JGRA 2OHGA 3ISJA 3GROA 2IE8A 3KDAA 4BKOA 1IN7A 1UIMA 1T8RA 3B3GA 2JF0A 5CT6A 5K6AA 1FSPA 3TE6A 2V7XA 2TECE 4JEMA 4PHFA 1U9ZA 2FPKA 5D1HA 3WOHA 3KYCA 9GPBA 5FA5A 3EZYA 1DELA 5JJKA 2Q6IA 3T7KA 2X0RA 4MUKA 3UH0A 5LZ9A 3NTLA 2WKPA 1L7EA 4Q05A 1TMYA 1VPTA 4JYCA 1CG6A 2GN1A 1I1QB 2H1VA 4Y6QA 1Z35A 1JIKA 2H6EA 3SY8A 4BZQA 3TFWA 4BVAA 3I1YA 3NRCA 5BPFA 3A1WA 4FVTA 4ZAFA 1ACLA 3I5MA 4N4AA 5KVAA 2G1PA 1LJLA 4CR7A 3RFFA 1JPNA 2C58A 2I54A 2ZJ5A 5CH3A 5EYPA 4X1OA 3VOAA 2ZT6A 3OZDA 4HAYA 2F4VB 3SS8A 4KVAA 2VYCA 4KLRA 4X91A 4A2QA 1U2DA 3GLUA 4EUSA 1Y9DA 4AJOA 2RGAA 1KEUA 1RVV1 2I71A 4KZKA 4ASUA 5KYUB 2QVXX 4AQYB 2XJ4A 2ES4A 3R8CA 5BMOA 3DE4X 4DXAA 5HRCA 1E1YA 2GPWA 3HYRA 3CT6A 2BFCB 4RADA 1U9YA 2GLXA 3GFSA 5CB6A 5LP6B 1MT0A 3AONB 5HQ3B 1M1YE 3INRA 3O8BA 2I2BA 1GYQA 1HTBA 4X45A 4ASUD 1VKRA 3AP1A 3NBYC 5D6NA 5CB4F 1GNRA 1WG8A 3ESYA 5LP1A 3R5XA 4N5NA 4S12A 1R8QA 4M0UA 1QHIA 3L7CA 4IR7A 4Y2JA 1H8EA 2OBFA 1JSRA 4OXNA 1H2FA 3C6MA 4Q7MB 1KMQA 2BFCA 4RIHA 1S2IA 4BO5A 3T99A 1EZ1A 1P3DA 2ZBFA 1OLXA 5E3JA 4QICA 1AQNA 1CKEA 1OPXA 1W0KA 4S1WA 3U4GA 3S2GA 4RSHA 3SZRA 3CZ5A 1KMHA 3TZQA 4A26A 1QKJA 1DQZA 2I80A 3QKRB 4Q1CA 3V7YA 3ASUA 4EHKA 3RASA 5JCJD 1H0KA 5DWDA 4RUKA 3QF4A 2EBWA 4EDHA 5H5JA 1ZN8A 3COJA 4MR9B 3FFWA 4GZ3A 2JGIA 4P5DA 1JB1A 1E6UA 1GZVA 2EQBA 1GLGA 4J94A 3T9EA 5AM3A 4B3SB 4DWVA 1NBMA 2X9QA 1CIJA 3HBAA 1ZD5A 3AWDA 1KIAA 4G09A 3EVCA 5BN3A 3WXMA 4Q3CA 4EYEA 1YZLA 1GL7A 2O2ZA 4WZBA 4MLZA 1CRLA 3QMVA 1KQGA 2AKEA 3AUTA 2X8AA 5HEKA 1G4AE 5CG2A 3ZHVA 3RJ5A 3MK31 3L1VA 1VLQA 2IIPA 2G80A 3H84A 3U9LA 2LIVA 4ZC8A 4G2NA 5JS2A 2P9FA 2W6QA 4G81A 1JHXA 3BIJA 3KETA 4UNRA 3Q6MA 2JCGA 2I6XA 2A7QA 1X1DA 3INGA 3BL5A 1B6SA 3OE1A 3R1IA 4HTAA 1KGSA 3VA7A 1XTBA 4BBJA 2FETA 1KIFA 2QDKA 2JGEA 1TF7A 1GNLA 1RIFA 3IBTA 4TKLA 5DBIA 4MV0A 4IILA 3UHFA 3EWNA 4IIDA 1KZHA 1JA0A 4P3PA 3RFUA 3SBDA 4RZXA 4QSHA 5A5DA 3W8RA 2UVQA 3WI7A 4V0NA 2LD4A 1C9JA 1L5VA 2QMUA 3DF7A 1MLDA 3N8HA 1IWBB 3QUAA 5F76A 4YJ2F 3Q7TA 3MWKA 4GBED 1NU8A 3ICQB 1ZXLA 4C1NA 4ZOBA 3PVZA 4EPYA 2PUEA 1LWOA 4NJOA 3SBEA 1AS0A 3E3OA 4L8VA 4FC6A 2Z98A 4MCHA 2DR0A 1KE1A 3FOEC 4HEA1 3O75A 5GOZA 1QU2A 4H4CA 1Q92A 3CLKA 1AC5A 4HWOA 4EHFA 3A3KA 2BGJA 1C9YA 2QHXA 4KE7A 3GH1A 2PIAA 1V5IA 1S89A 1SRRA 2QJTA 3U0BA 1Y9EA 2M32A 4DTIA 1Q6YA 2IEYA 3S0JA 1KOGA 3KR1A 8AT1A 1X8KA 2CK3A 1MUUA 1P9RA 1YHYA 2JH3A 3G0DA 3LD9A 4OU5A 4D8XA 3FDJA 4CCYA 4Z3KA 3ZKWB 3JD1A 1JFRA 2O4CA 4M60A 2GARA 5CHYA 3C5CA 3EA4A 3G8YA 4MUYA 2JLYA 5KAMA 1XIVA 3ABQB 3QU4A 1Z2CA 3ORRA 3IEUA 4V3BA 5G4KA 3VZDA 3LGXA 3U19A 3L0CA 4WXRA 5TGTA 5IANA 4GBGA 4MEBA 2B61A 1II0A 3K8ZA 4E13A 4EA8A 2PXAA 1X0VA 3LLCA 4LHEA 3G9TA 5CLIA 2CJXA 3A6DA 3IHKA 2WLSA 2IHUA 1E8MA 4MP8A 3RPEA 2YWHA 4I4TB 3I52A 1LI4A 1GRQA 5H83A 2ANBA 2AS0A 1JHPA 2FSUA 4FHFA 4FFRA 3L41A 1CZRA 1X0XA 3ZW8A 1U7DA 5EZYF 1GFWA 3T1HB 3GGDA 2QTVB 1HMPA 1QIIA 5U4XA 3D8RA 2AFHA 2Y77A 3FMFA 1ZN9A 1BFKA 1JEQB 1WHSB 5FEUA 5JMPA 1AK2A 5ITWA 2C4NA 1DIOB 1DBVO 1P8AA 1K06A 1T43A 2J3QA 3HUUA 3ITDA 4G5XA 3TB4A 4EW1A 5KOHA 2HA6A 4MR7A 1RJ9B 4U8GA 3IHLA 3IXLA 3AKEA 3RS5A 1X1SA 3KKZA 1O57A 3GW8A 2WAYA 2LV8A 1HH4A 3N8DA 2HA2A 1NFFA 5ED0A 2VZEA 2JJYA 3P0JA 2C2HA 1ZCBA 1L4NA 4WXHA 4HEHA 1W46A 2XUFA 4HPJB 4P08A 1KARA 2HMYB 1I6KA 3KLBA 2AI2A 3TM5A 1R6BX 2VJPA 4RHUA 1X39A 3ZGNA 4QZVA 1G59A 3JYOA 3IUYA 4AM8A 5I01A 1K0UA 2H7CA 1V9CA 1SUFA 4CTNA 1QDEA 2G3YA 2PTGA 1LI5A 3NHJA 1TB4A 4GGPA 2XXJA 4MQLA 2YIVX 1V5FA 2QMEA 3M5DA 3WK9A 4KO1S 3S70A 2HIMA 2WUGA 1DXHA 2ZXFA 3RANA 3EOZA 1CLEA 4L95C 3AILA 3HJBA 4FFMA 4BNXA 1ZAYA 3WGTA 1SOUA 3OX2A 1ZH2A 1LDMA 4LJAA 1BEZA 1NP3A 4U6NA 2KX7A 1XCBA 2EJVA 3ANXA 3H13A 4IJ5A 4K9RA 4UATA 4WNIA 3TPFA 1RTTA 3R3YA 3V00A 1W76A 2PZGA 4A16A 3LY8A 3CRW1 1LD3A 4NOKA 2PCJA 4PRLA 4DT1A 1JIUA 4F45A 5JAPA 4N65A 2UZ1A 5JANA 4LG1A 4XJTA 2A33A 2B8JA 2PL1A 2Z6VA 3K0BA 3BRQA 1DEAA 2VA8A 4INPA 5JAOA 2ON6A 2EL7A 5DGDA 4KFUA 1ZY2A 4XI9A 4OV6B 3WR5A 1R1DA 5LLDA 1A9TA 2AOTB 2EIHA 3K2IA 4ND6A 2C4KA 2XMZA 2FR8C 3BD8A 3B5JA 2G9RA 2QQ0A 2CXQA 4UUOA 5IT4A 2O8FA 4GE0A 4Y2VA 5CT9A 1BG6A 2FP4A 2IHVA 3B9QA 3LO5A 3LRPA 4XYMA 3TLKA 1ZL0A 1LWNA 5LB4A 3RBAA 5BURA 4TRJA 5LIPA 5H81A 4NJMA 4RORA 1HSZA 1GRNA 1R0RE 2A67A 3D0QA 5CFZA 1KI6B 1BOOA 2CHQA 5EJ7A 2P8SA 4XRRA 2QVYX 1UBNA 4KQCA 4D5EA 1Z83A 2PUWA 1UZNA 2ZXUA 5EWLA 2J6BA 1WVMA 1XAIA 5CITA 4KO2S 1ECJA 3VZPA 1VJ5A 1Q74A 1EVEA 1MIHA 3DCYA 1U9CA 1EINA 5AI0A 3WJ2A 1SVKA 4M9UA 1NL3A 2JLBA 1MDFA 2H0QA 3Q85A 3WWPA 4YJ2A 1T0IA 3HLTA 2GA8A 3AIKA 2V58A 1WUTA 5CGQB 4ZVLA 2Q6OA 5CFNA 2OCLA 3OT5A 4HEA6 3ZHZA 3LFHA 1PR0A 2W70A 4XB2A 1A2QA 4FJ2A 3C1TA 5E4YA 4YT4A 4KIUA 3G5MA 2YVAA 1BFUA 4CM8A 2IS4A 1IHPA 4K5QA 4KLAA 2V8BA 1XZDA 4HNRA 5IC6A 2BISA 4CQNA 3N74A 4N40A 5JMOA 3L46A 2WVGA 3LUHA 4MLPA 3DZIA 3QU9A 2OYCA 2YS7A 1RM4A 3E5MA 1F4PA 3QBVA 3GVIA 3HGMA 1X8JA 1AHHA 1VL1A 2FVXA 3EZ7A 2HK9A 2JAQA 2PV7A 4TROA 4B17A 1YHZA 1C8VB 1EPUA 3TNJA 4IVPA 2PX4A 3IUSA 5LXTF 5AW2A 2WTMA 3AFIA 3GP3A 2P9HA 4Q5IA 1CY7A 5F3RA 5AFSA 1VCHA 1A95A 3PDWA 2OR3A 5EZ6B 3O8OA 5KWJA 1R37A 2WIKA 4OGGA 3E9NA 3RAEC 3C5VA 1ODTC 1UP4A 3C8ZA 4FIDA 1PZXA 2BF4A 1LPNA 3BF7A 5MGBA 5KYYB 1LC3A 3MSCA 1XHLA 4HMPA 4MQ5A 4B3FX 2FE1A 2YASA 3M2TA 1P5ZB 2Z08A 1ZEMA 3AR4A 3DEAA 3KUDA 4O2AA 4QSMA 5KTSA 3DUFA 3O82A 3PRKE 4POAA 2W71A 1OF1A 4P6VF 1GDHA 3R5SA 2COUA 4NAVA 5IT9A 5TJ9A 3PXGA 1NGSA 2IC5A 2R8OA 5DLYA 4AMYA 5MFPA 2YS6A 5INTA 3IR5A 5EZYA 2ZPAA 3VR2A 3KDPA 4HJRA 1M2JA 4JL8A 3V2HA 2CGEA 3PB3A 2VATA 2XB8A 5DCYA 4DADA 1CX9B 2FEKA 1LSSA 3DD1A 4Y2SA 1O5TA 1U2SA 2VBCA 4FB4A 4BNFA 3KSUA 5KNDA 4P8RA 2D5CA 4L5YA 3FRHA 1C3EA 2QE7A 1RKVA 4HQ0A 3RHTA 2Q27A 2Z58A 3FVQA 2X0FA 4YPVA 5EEGA 1T8PA 2BMEA 2YDYA 3E9DA 5EIBC 3VR2D 2XB2A 2WFLB 5IVIA 1L1FA 1NDUA 4U9HS 2D8AA 1RD4A 3CRQA 2ZJ6A 3D5QA 4QODA 2QQGA 2BI7A 4RF4A 1U80A 2Z9DA 1XT6A 1C3VA 3JWPA 3T7CA 3R5TA 4AJPA 3KWFA 2X58A 2QE7D 5G2OA 4MO9A 5KVQA 2FH5B 3PGJA 2GX6A 1K7FB 1Z2DA 2CLHB 2I6SA 1WZNA 2JBWA 4LZPA 2B7LA 3VVBA 1BHO1 1RLUA 1ZM4A 4QO8A 3ZV7A 2XGSA 2AW3A 3LDGA 4U6QA 2YICA 1L4BA 4LYFA 2JRCA 3ZW7A 4F6RB 1O58A 3TI9A 4KXQA 4D2IA 3AESB 3BJEA 3ESBA 2LR0A 2PG3A 2R7MA 2AG0A 5MN4A 5KVSA 3F5MA 3IUQA 5D3KA 5LZ4A 3EPHA 2ZJFA 4Q7EA 1PHRA 2PGLA 2I6QA 4JLSA 1XNQB 2BKXA 3R3HA 1E7YA 2NXNA 1OXXK 2VOJA 2ZTMA 4WKPA 5E4FA 5BYJA 4UHKA 3ZXSA 4F06A 4D6YA 4HF7A 1KMMA 4OB6A 2JIPA 1B42A 2JC3A 1UJCA 2YFQA 3EZ2A 3ZWYA 2P1ZA 4FGSA 5DT2A