4JSTA

Structure of clostridium thermocellum polynucleotide kinase bound to utp
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
171
structure length
171
Chain Sequence
SMKLTIPELSLVVLIGSSGSGKSTFAKKHFKPTEVISSDFCRGLMSDDENDQTVTGAAFDVLHYIVSKRLQLGKLTVVDATNVQESARKPLIEIAKDYHCFPVAVVFNLPEKVCQERNKNRTDRQVEEYVIRKHTQQMKKSIKGLQREGFRYVYILNSPEEVEEVVFERQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical analysis of the phosphate donor specificity of the polynucleotide kinase component of the bacterial pnkphen1 RNA repair system.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Transferase
molecule keywords Metallophosphoesterase
total genus 64
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 2.7.1.78: Polynucleotide 5'-hydroxyl-kinase.
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jstA00
1QVRA 4WZBE 2REOA 4KFRA 2CK3D 4D0LB 1KI2A 2OFXA 1MKYA 4PZZA 4I1SA 1JR3D 4A4DA 4MQBA 4DLRA 3QUSA 3CR8A 2PCJA 4NONA 2QBYA 2XNDA 1XPRA 3X1YA 2HLDD 1XB2A 4IFBA 2ZRHA 1K5DA 4MYHA 2BV3A 1TU4A 1NF3A 5B57C 4HLCA 1N6HA 4XWOA 3KKMA 5KSOA 3B1WA 3BXZA 3QF7A 3CUEF 3FHOA 2P65A 4PPNA 2RGCA 1E2HA 1E9SA 1II0A 1XFAA 1P60A 5JHGB 1P9NA 5DGXA 5EE3A 4MITA 3THWB 1TEXA 3A4MA 2PEYA 4LWZA 1OYWA 2QE7D 4D4JA 4KU4A 4O2LA 3C16C 4GFDA 3TK1A 1T3SA 3W5JA 1FUKA 1XEWX 4B2LA 1D5CA 3V00A 4HSEA 4JLPA 3DVLA 2O8BA 2GESA 4DSOA 2BKUA 1FOEB 4TYYA 5KDLA 1HH4A 1UF9A 3U4QA 4U00A 4ACBA 4NCHA 1G7TA 1VG1A 2B7CA 2PX3A 2GZAA 2ZITA 3X1ZA 1T5LA 3B2EA 2CVFA 4M0LA 2O52A 3K9HA 4BLQA 1E4YA 2VL7A 4HYYA 1H8HA 1H65A 2XNDD 2OILA 4PHFA 3LFUA 2H8KA 3R7WA 1E0JA 1UBFA 1X1SA 4KYIB 1IN8A 3K0FB 2GCOA 4PC7A 4QBIA 1I2MA 1GITA 4DLYA 2P6UA 2KE5A 5C46F 2C96A 4M2LA 1COWA 1GRRA 3AVXA 3Q9LA 2XSZD 4M1YA 3K53A 4CT5A 5JI3E 3HJNA 5LPNA 1R8QA 3GLGB 1BMFA 2VEDA 2BCGY 1Y3AA 2HJGA 2OSBA 4OQNA 4A82A 1GL7A 1P2SA 2G6BA 2AWOA 3O47A 4B33A 1RFLA 3GLIA 1TU3A 2VP6A 5ELXA 2EWVA 2XXAA 1LY1A 2ZEJA 3U7FB 5KSPA 3AVYA 4MRVA 1GTVA 2ZRCA 2QMEA 4DBLC 4RSGA 3ZZUA 1E2FA 1KI9A 3K1JA 1T91A 4TTPA 2RGNC 2PT5A 1OT3A 3X1XA 1OHHD 1HUQA 2DBYA 2EWWA 3T34A 5BN3A 1CXZA 4LYFA 4Q9HA 1VG0B 1E98A 4MGIR 1WBDA 5HE8A 2ZS7A 2H7VA 3SJBA 2NMVA 4P32A 4IXMA 3QKUA 2AFHE 1Z0KA 4RKFA 1W1WA 1FUUA 2IUUA 4KFUA 3EG5A 3ASYA 2QT0A 2ZE6A 3NTUA 3PUVA 4QHSA 2JJ1D 2OBLA 3AKDA 1CRQA 1TAGA 2CDNA 4PC6A 4M9SA 5L3QB 4FCWA 1NVXQ 2FSHA 1VCOA 3ZYCA 3U6KA 4IDPA 1E2JA 2QN6A 3P20A 5AK0A 4C0JA 2WAYA 3SDZA 4GOJA 2MMCA 4TLAA 3K0CA 1XXHB 1G1MA 2YZ2A 4MRRA 3TQCA 4QKQA 1HEIA 1N25A 2YOHA 3H0KA 3ZIAA 3RS4A 2BCJQ 4UNQA 3M4YA 5JCPA 1CJVC 2PJRA 1TQDA 1MOZA 2J0QA 3UK6A 5K8UA 3I73A 4D0GA 3TR0A 5EE0A 1R6BX 4AYXA 5BWMA 4I1UA 1D9XA 2QAJA 4LHVA 3MJHA 3GLFA 4POAA 5B58C 2ZTSA 3J81k 4XSGA 2J7PD 2KWIA 4OBEA 2VP0A 1AGRA 3NH9A 5EZ5A 1G64A 1XD8A 1G7CA 2F43A 4QOSA 3CIOA 4GT1A 3CO5A 3EARA 4DHEA 1NLZA 1OKKA 1ZYUA 3ZGXA 2XZOA 4UJ3A 2V1XA 2ZM5A 2KJQA 3R9IA 4TMWA 2QQEA 3A1TA 1W0JD 4TYPA 4A8JA 4TSFD 4IOMA 3KQUA 5UKDA 4KODA 4Q1AA 1X8KA 1GIAA 2OESA 3DHWC 1OFIA 4A0GA 4DDVA 1N6IA 3ZZ0A 4BRUA 1IN7A 4ZO4A 1E9CA 5AUQA 2ZR9A 2A5FA 3IIKA 1GG2A 5JJIA 4NZYA 4Q47A 4KSCA 1EWQA 3K0CC 1RJ9A 3LBIA 3MMPA 4MKHA 3CPEA 2G77B 2CNWA 4DWJA 1Z0JA 4OI4A 4IW3B 4MDEA 1MH1A 5SZKB 2R8RA 1E4VA 1SVLA 1JAIA 3QG5A 3ZS9A 2GJ9A 2WHXA 5H68A 2WKPA 3AF1A 1UADA 5DIFA 1A7JA 1UBGA 4EQ6A 1KDTA 3NEJA 4A9AA 1QHYA 1HE1C 3I8SA 8OHMA 3LY5A 1OW3B 2QAGB 2QAGA 2ZR7A 4PHHA 5AJWA 5C2JB 1XPOA 1BYUA 1T8TA 2G83A 3LLUA 5JRJA 4CEJA 1KKMA 4GSYA 4C0LA 4ASUD 4LJAA 1T0JB 2JDIA 4FMDB 1BH2A 2G3YA 2PEZA 1ZUHA 4EPTA 2JEOA 4IHQA 4YMUA 1ZNWA 2QM8A 2F55A 1TNDA 2RGAA 1IY0A 4LHYA 3AKEA 5D3QA 3X1DA 4DUGA 2WJHA 4F91B 2AWNA 2OZEA 1R0YA 1L7VC 3BH7A 1VYVA 5FI0B 1KYIA 3FMOB 5AJZA 1AK2A 2ZROA 1FP6A 3PEUA 5TVKA 3K70C 4C2UA 2QRNA 3EPJA 3QBTA 3TW8B 4DEYA 2FMXA 1ZM9A 3VR2A 4QL3A 2OE2A 3WRYC 2O8EB 1R7RA 3FHTA 3QKSA 2CHGA 5CLQA 3TAUA 2WMNB 1NIJA 1JJVA 1W44A 1W5TA 4FINA 4HB0A 4W5HA 1HA3A 3UXMA 5JSZA 3IIJA 4B35A 4YMWA 2K5UA 2ZJYA 3BC1A 4XVUA 3H1TA 1NJGA 2ZUCA 3NKVA 2IXGA 1Q1QA 4BEBA 1R5BA 3VKGA 3IQWA 4P0TA 1MO3A 1R0ZA 4TMZA 3ADBA 1WXQA 4BWYA 3QY0A 2QAGC 2QORA 2WKRA 3K09C 2CCJA 4I99A 4LBYA 4LV5B 4UXHA 1HQCA 5JWHA 2Z4RA 2EFGA 1XP8A 1KDOA 2VP2A 3U7EB 2D2EA 2W00A 3ZQ6A 4DLSA 1LNZA 4S2EA 1U94A 3C5CA 5KNCA 1RJ9B 4X8LA 3AGPA 1UDWA 4LBVA 4Q00A 3Q5DA 3RRYA 3TUZC 2FPKA 3SYLA 2NPFA 4X8OA 1NNEA 4HEJA 4ZPXA 5KDOA 1ONBA 4G3XA 4RD3A 4CRWB 4RZXA 2BBWA 3FFAA 4EIWA 4DB2A 2ZI4A 3U61B 5EXPA 3NBZC 4BFWA 4BPBA 1NG1A 3A6PC 1JBKA 4R7ZA 2GILA 2A5JA 3W34A 4A6PA 1E2PA 2ZJOA 3EC1A 4LX0A 1NG9A 3QEOA 4DCTA 1MV5A 1DO2A 3K0EA 2ZE8A 2SHKA 2HEIA 4WZAE 4WZ6A 1GAJA 2P2LA 2HF8A 4O2RA 1OXUA 1Q12A 4C7OB 4CYMA 2DR3A 1JPNA 5JEEA 1II8B 1XNJA 2FN4A 2XTZA 2GK7A 2CNWD 3I1FA 4IOKA 1I4TD 2VHUA 4MYCA 3W90A 3GLFB 4US0R 1GVNB 1P7CA 2J9RA 4QGFA 1F2TB 1DAEA 4EAQA 4R2IA 2CHQA 1QHXA 4UJ5A 2JLRA 4JT4A 3VNUA 1NSFA 4OQMA 5KHOC 5SZJA 5KPJA 2DB3A 4NCJA 2V1UA 4KFSA 3LA6A 1DVRA 3O8DA 2WVJA 3OIYA 1AQYA 1W5SA 1RC8A 3LVRE 3RAPR 3N2IA 1U8YA 2WTUA 2FE4A 5A4JA 3EX7C 3B5JA 1TQ6A 3RSOA 2XJ4A 1IBRA 2ZRGA 5JJKA 3AF4A 2OLJA 2FGJA 4NYIR 1OHHA 3CZQA 1KY3A 1XMSA 3KJGA 3PUWA 4ZI3A 3EIEA 2QTHA 2FA9A 3QF4B 3SN6A 2G0NA 4XD7D 3OIWA 4IVQA 2IUTA 3LBHA 3T1VA 1E0KA 2XB4A 4RVCA 3RS7A 4B48A 3K0FA 5JECA 2D7DA 3KTAB 1E1RA 2DFLA 3GMTA 3EZFA 1RYHA 4L4UA 5GJWC 2H57A 1CIPA 1IXZA 2ZSFA 1N2CE 2C78A 4S35A 2LWIA 1DPFA 2ZSBA 3C5HA 4W9MC 3RS5A 2JA1A 2ZRMA 4A92A 4FD2A 5CK5A 4GDFA 3NXSA 4Q4AB 1SKYB 5BYJA 2GK6A 1S96A 3P32A 1S2MA 4Z54A 4CEIB 1EFHA 4JLOA 2F9MA 4HLQB 2WSMA 3E5HA 2RMKA 2NPIA 4TQUS 1DEKA 4R71A 1TTTA 2QPAA 4BZQA 4L9SA 4M1WA 4DSUA 4LK2A 1RRGA 1G6OA 1VKJA 2XJ9A 1MRSA 4G5QA 2FEMA 2ODBA 2GXAA 4Q03A 1DG1G 2AFIE 2FGKA 3KUCA 3P27A 1P2VA 2QY9A 3BE4A 1NP6A 1CBUA 1EX6A 5EXXA 3W8RA 5CDFE 2KI5A 2GXQA 2GEUA 3CPHA 5FOTA 4NE2A 3B13B 1DADA 5DI3B 2PZGA 2IYTA 2IA5A 3ICQB 2VF7A 3L0SA 1OE0A 5JHHB 4ARZA 4CEHB 1JXOA 5GADl 4Q4HB 4ZKDA 2FG5A 3CNNA 4OHXA 1W0JA 1D2NA 2P0EA 2V8OA 1B0UA 4GBMA 4BQSA 2OG2A 3CRRA 4FMCB 4ESVA 2O8BB 4BASA 3L8ZA 2IYYA 4PAMA 4QRHA 3SR0A 1T9HA 2G88A 4IDOA 1S1MA 1Z22A 4JL8A 4D4LA 5KTYA 3F5FA 2C9OA 2V6JA 3V4RA 2ZRJA 3OE7A 4C4PA 2D06A 1G8GA 3EWSA 3PFIA 4US1R 5EXTA 4PC3A 1EWRA 1Y63A 5JEDA 4TMXA 2TMKA 1FNMA 3NHAA 2W6IA 2CBZA 3TKLA 3K9NA 2XZLA 1M8PA 3Q7QA 3ZIAD 1FNNA 2JJ8A 1N6KA 3DKVA 5CIWA 5SZIA 3SJCA 5TV2A 5FUWA 4D2IA 4OQFA 4DLZA 1GILA 5FBWB 4IEIA 3EPHA 4GP7A 4OQXA 1KO1A 3B60A 1CR2A 1VHLA 4K46A 5H1YA 2EW1A 1KMQA 3KFVA 1FP7A 1VCNA 3WHKA 1AQUA 3GJ4A 2NQ2C 3UMFA 5FFMA 1G19A 2Z5FA 4ZDWA 4PPGA 4Q1BA 5JRZA 4JKYA 2O5VA 4RD0A 5EP4A 3FVQA 1G17A 2KB0A 3WHLA 3K0AB 2KBEA 3KQHA 4TL8A 3SBEA 2JCSA 5KSYA 5AJVB 821PA 4PO8A 4DLUA 1TADA 5BXQC 1J7KA 4V03A 1XBTA 2PBRA 5FH9A 2A9KA 1ESNA 1VYUA 5C4MA 5P21A 4P4SA 2CHVA 2IYWA 3L82B 3FKQA 3GLIE 3JZMA 2RH5A 3U2QA 4LCBA 4US2R 1WQ1R 2V9PA 4PZLA 2ORVA 3SE0A 1X3SA 2HJVA 1M34E 1DTSA 2A3RA 2W0SA 1S0UA 3PUXA 4PQYA 4B32A 4QJ4A 1JI0A 2VHJA 4B6EA 2CLCX 3A8TA 4DSTA 2YOGA 1YZLA 1Z28A 4B73A 4DCUA 1E2DA 1RRFA 1J70A 4LY6A 2QGZA 3RSLA 1COWD 2B6HA 3FKSD 1X6VA 1ZRHA 5HE9A 4NP6A 5F9HA 3O8BA 2F3RA 4YMSA 2JLWA 1J8YF 4GOKA 3F8TA 2NGRA 2R6FA 3DM5A 4Q9JA 3VNVA 5JBQA 2B8TA 4BEJA 1D2EA 3E1SA 3QXSA 3SI7A 1GNPA 1PLLA 2OV2A 1KSHA 1KI6A 3K8YA 3PIRA 4JKIA 2H92A 2V7QD 3B1XA 2J87A 1XMIA 1LB1B 3NH6A 4RD2A 4A0RA 1NY5A 3SU8A 1P6XA 1E99A 5HKKA 2D7CA 4P3YA 4I1VA 3Q85A 2ECKA 3PV0A 5JWOA 3WY9A 2IYUA 3AP3A 2PJZA 2WICA 2A2ZA 4A2WA 4D6PA 2ZRNA 3SBDA 4C0BA 4LC0A 2AK3A 3SS8A 2O8CA 3HU2A 2F43B 3KB2A 2DFNA 1CJKC 3W3AA 4LZZA 4P4UA 4CT4B 1YU9A 4DLTA 4Q4JB 3CNLA 1ZC3A 2BHRA 2CLSA 2GCNA 3OESA 4PSVA 1KSGA 4LOAA 1WB9A 2IF2A 3GLFE 3CKLA 4QNRA 3C4JA 3FE2A 4M9QA 4N0EA 4Q01A 3VX4A 1YVDA 2QA5A 1PLKA 1ZINA 1YRAA 1Z07A 4OKSA 4B34A 3GPLA 1XPUA 1BYIA 1E1QD 2QQ0A 4M1MA 5FUYA 4PSKA 5FBQB 4DVGA 1VECA 4JL5A 5JZVA 1GKIA 2ANCA 5DI9A 2F1IA 2PH1A 3RC8A 5L3SA 4U02A 3GLIB 2ZVQX 1CP2A 2VQSA 1YKSA 2ZQ5A 4ZDJA 2ZU6A 4YXWD 1DO0A 1W0KA 721PA 5L3QA 3KXIA 3FWYA 3I61A 1N5KA 5FL3A 2J7PA 2VHTA 2WJVA 3T1TA 3VR3A 2ONJA 1AKEA 1XZPA 3C8UA 3SJZA 4EJSC 1OJLA 2F7SA 3QF4A 5GVSA 3T06B 4QNMA 1G6HA 3K0SA 2FDCA 1IXSB 4JLVA 2PX0A 2GAOA 4XTCS 5EXSA 3Q5EA 3WMGA 4JS0A 3DOFA 3OFNA 1BOFA 3C7KA 5CYPA 3U4QB 2IYVA 5IHPA 3QVVA 1Z2AA 2P5SA 2ZI7A 1OH5A 4PC1A 2OHFA 4YDHB 1ANKA 1WDTA 1ESMA 2FF7A 2O8DA 1P75A 2GRJA 4TN1A 4PQFA 2J0UA 3IHLA 2R9VA 4V0ME 5EP2A 4LUCA 4NMMA 4ZDIA 1NMXA 1E9RA 4D0NA 2RCNA 1P5ZB 1W47A 4NYJR 3LXXA 4WXPA 2C98A 2EFDB 1SGWA 4ERNA 2LKCA 2OXRA 3F0TA 2FFHA 4C0AC 2I4IA 5SZHB 2AL7A 1YQTA 1Z83A 2QGNA 4ASUA 2DYKA 2AKYA 2JIZA 2QPTA 1VIAA 2VBCA 2HYDA 3TUIC 1P73A 1XCGB 2PMKA 3RS3A 3TJZA 2WKQA 3DZDA 2O8EA 1AS2A 4NYIQ 4OL0A 2A7QA 4HLUA 3BGWA 1DARA 2BOVA 1XWIA 5F9FA 3NIBA 4GZMA 4IOLA 2ZAMA 3KZ1E 3ZZTA 3RS2A 3HDTA 1UBCA 2JLSA 5FBRB 3TAHA 1OH8A 1OXSC 3A36A 3AQ4A 2ASEA 4GMDA 4LYHA 3THYB 1PV4A 5L3VA 2IS1A 5E95A 3THWA 4BFSA 4B44A 4WBSA 1KK2A 3THOA 2GZHA 3ZJYA 1KDPA 2BKEA 1CLUA 4Q9IA 4FN5A 4FW9A 4HZUA 1NBMD 4JVMA 4A0HA 2HF9A 4GNKA 2ZJAA 1Z6YA 2BMEA 4PR0A 5JWRA 3KQKA 3LQQA 3LAWA 3AVQA 3GFTA 4DCNA 3EXAA 2FEOA 4LBZA 3GEEA 3OZXA 4Y0AA 1W7AA 1EFRA 1OV4A 2UKDA 1C9KA 5TXGA 3LNCA 3RABA 1NRJB 4PAOA 1XMVA 3VFDA 3Q8XB 5DYGA 2GZDA 2YHSA 3NDBB 2Q9BA 1YE8A 4RD6A 3WXMA 1VG9B 3ZLJA 1Q20A 4FMBB 1XEXA 3QSYA 2QSYA 2GETA 4N3NA 3TBKA 4JBWA 2YWHA 5D3MB 3CLVA 4KLNA 4LBWA 4NTZA 3CH4B 5J40A 1XTKA 1K8RA 2FOLA 1I4DD 1AZTA 2WMOB 4OJKA 3ADKA 4Q4LA 2DFTA 4FMDF 2VH5R 5A0FA 5GJBA 4LHXA 2X8AA 2YVUA 5AJXA 3NEYA 1VMAA 4F4CA 4DCVA 4L15A 1RRPA 4CEJB 2V3CC 2E1RA 4MGYR 3AF3A 5B64A 4NYMQ 3WNBA 1YRBA 4QBFA 4B3XA 3GEHA 3I5XA 4F92B 1M6NA 4DRZA 2RGNA 1G8PA 2FJUA 3L0PA 5FR2A 5IRCD 4YMTA 4YONB 1QZXA 3LBNA 4QBHA 2QUZA 1KNXA 1FQJA 3T61A 3THXB 2GHIA 2QMOA 4HI0E 3THYA 3MG9A 4HAXA 2JLXA 2CL6X 3UG7A 1UEJA 2XZPA 2R6DA 1IAQA 4MKFA 5HCIA 4M9XA 2VLIA 4IVPA 4EPWA 4BE7B 3OAAD 2QP4A 2NO7A 4D26A 1P2UA 1G7SA 3I92A 5HZKA 4XOIA 2QMUA 2OAQ1 3FGNA 3B9QA 1NSTA 3ZVLA 3SHFA 1ZMXA 4URXR 2YKGA 1UKYA 2ZETA 4AG6A 2ZS8A 4KO8A 1D2MA 4KFTA 3TSZA 4LJ5A 4BLTA 3A1VA 4XJXA 4DT1B 2YWGA 3A4NA 5BN5A 1LF0A 2ZSEA 3ZVNA 3B78A 1IN4A 1E9EA 1YZUA 1IHUA 4OI1A 1EG7A 5IT5A 2MSCB 3LX8A 5DI3A 3RANA 2VSXA 5LD2C 1C1YA 1E9FA 2ZI3A 2YWFA 4UNRA 4TTQA 1CU1A 4URUR 1Z6AA 3QXXA 4TLDA 4UNSA 3SYKA 3Q3JB 4NBSA 1NLFA 5CDFA 3WYFA 3ZVMA 1IQPA 1V5WA 1ZD8A 2V6IA 4JVSB 3N70A 1LVGA 4V0OA 3LO5A 1N3BA 4M53A 2O8FA 1IN6A 2C5LA 4B76A 2G1JA 2IXFA 3BORA 4V0NA 3LH5A 3OAAA 3AVTA 4B3BA 1EESA 1OB5A 4Z8XA 1P3JA 3L43A 3KFXA 2XITA 3RWMB 1Q44A 1NL3A 3DKPA 1OIWA 3KXLA 1AA9A 2O8FB 1DAMA 4JSTA 2WWGA 1P9WA 4ON9A 3BWDD 4TMKA 1ODFA 2O0JA 4AK9A 3CRVA 1W49A 1KZ7B 1JXMA 1F2TA 1SVIA 3M6AA 4XTRA 2IS2A 1E2QA 2W6JD 1U2RA 4AI6A 2V7QA 1XZQA 3GLGE 2EFEB 5JCZA 4ABYA 2XTNA 1RVDA 5AR1A 1VCMA 5HKKD 2ZIAA 3H84A 1T3HA 3EWAA 4YDSA 2QZ4A 4M1SA 1H8EA 1Z3IX 2C77A 4TLEA 5CJPA 1N6OA 3SJAA 4TZ0A 1L4YA 1W2GA 4KSBA 4WA7A 1E0AA 2MSEB 2PZEA 4JLMA 4A15A 4KV9A 4WOPA 1XJQA 1FTNA 2BC9A 2WJYA 1IY2A 1T4GA 1XXHE 2VRWA 3W3ZB 1KZGB 3EZ9A 4LJ8A 4RFVA 4HATA 3C14C 1D6JA 2IEYA 2ZRPA 5LB2A 4NDZA 5FOUA 1OKKD 4QJ5A 5JS7A 3UIEA 3QXHA 3NC1C 1OFUX 1Z8FA 2ZSAA 5FUVA 4LI0A 5J4YA 2YNMA 4A0FA 1CTQA 2ZE5A 3QG1A 1MO4A 3FMPB 2ZJBA 5M04A 1FL9A 3IUYA 1YZQA 5DE3A 1CULC 1ZUNB 2GEVA 2X77A 3BK7A 2YJTD 4PPQA 1JJ7A 2V54A 1L2TA 1ZP6A 3TNFA 5FTJA 1G4AE 1ZM7A 1KK3A 3A58B 5EQTA 1KAOA 2OO7A 2ZUDA 3HU3A 2IYSA 3RDPA 1AKYA 2QM7A 4NCIA 1K5GA 4N1AA 2JASA 3U44B 3V4FA 3VR6A 2H18A 2IWHA 4CGZA 1QHSA 3WMFA 3H4MA 3SNHA 1E32A 1E94E 2ZRFA 5JSZB 4LJ6A 3W9YA 2J0SA 3NBXX 4IFEA 3AB3A 3T1OA 4A8JC 3LW8A 1L4UA 3T35A 4M1KA 1XTRA 2CE7A 1KK0A 2ZR0A 1KHTA 1T5IA 1ZNYA 3OIUA 3HPQA 5TB5A 1VHTA 1PZNA 1CRPA 2OEPA 2X19A 4UQOA 1J2JA 1G3UA 1R5NA 4HB2A 1R8SA 4MKGA 1SKQA 2JLVA 3EIHA 4MRNA 4M1OA 3JZAA 1KIMA 2DY1A 3AM1A 4RD4A 1P4SA 4CVNA 5KDDA 3AH8A 1O87A 1RW4A 4EPYA 5J47A 1AJEA 2CXXA 4BFTA 5BW8A 3BJIC 1W36B 4ZCLA 2JLQA 3FDIA 2LKDA 2Q3MA 5DNYB 2CK3A 3KJEA 4LJ7A 3I32A 3R9XA 2OAP1 1NLYA 4KJZA 1R10A 3GLHB 3WBKA 3MWLA 4OHVA 5H8WA 2C03A 2QP9X 2QEQA 4RZ2A 4IXNA 4Q48A 1NBMA 1QRAA 2BJWA 2FSIA 2GA8A 4W7SA 1WA5A 3UKDA 4FWIB 2HT6A 4NHOA 1JQJC 3KUDA 1HV8A 2GJ8A 3EA0A 4MA4A 1G7RA 2ZYWX 1CR0A 5CJ2A 1XEWY 4B3CA 2HLDA 4RJLA 3LDAA 1EFTA 2ZYTX 3B9PA 3H2YA 3A1UA 3L2OB 1KI1A 1OH6A 4J0QA 2C8VA 4QBGB 2OXCA 5FL7A 4WAUA 5FTMA 1XCMA 1E6CA 2IXEA 3PJRA 1IXRC 1Z47A 1KTVA 1P72A 4MUAA 2I3BA 5FUXA 3HR7A 4AWXA 4A1FA 2JDID 1YR7A 4JJZA 2O0KA 3IO5A 3ZD7A 4DLVA 2AKAB 4QFMA 5DHFA 4P33A 5TARA 1CF4A 3QKTA 2VO1A 3VR4A 4OHZA 4AYTA 1JB1A 1GP2A 1H8HD 4H1UA 2VTKA 1IOZA 3P1JA 5H70A 3QXJA 5HR5A 4MUBA 2DWQA 2FWRA 2WZQA 4ESHA 1E9DA 2MMGA 1EXMA 2ZJ5A 3AKCA 2YC2C 2C2HA 5JFGA 1XEFA 2GJKA 1W4CA 4UNPA 3MD0A 3U7GA 4XIGS 4C0KA 3CONA 1SZPA 2ZRLA 1OH7A 3OIVA 1MO5A 521PA 2IS4A 1AIPA 2WBLC 1SHZA 4RZ3A 4DB4A 2C04A 1IJEA 2HUPA 1A5TA 3GD7A 2QT1A 2W2VA 1II9A 1YR9A 1NMZA 1AS0A 1E1QA 2JLYA 3H86A 4AKGA 2IYXA 4Q18A 4RD1A 3E70C 3TRFA 2J59A 3I72A 1G21E 2E9SA 2HT1A 3KKNA 2AXNA 4HB4A 1SVSA 2NZ8A 3GJ6A 3IEUA 4A36A 1M74A 4TWZA 1Z06A 3DO6A 3DDCA 4BLPA 1W4BA 4HDCA 4Q1CA 4YXWA 2N46A 1RE0A 2XEXA 2I1QA 5BQ5A 1U98A 3GJ0A 4HUQA 3UWKA 4EPVA 3KXKA 2A78A 3IPXA 4TYNA 2ODEA 2UZ3A 1A2BA 2F3TA 4XSHA 2VSFA 1GRNA 2KSQA 1CKEA 2F1JA 3I4LA 1XD9A 3OEHD 3T5DA 2JLZA 2E87A 4OI2A 3KQNA 1YHNA 4BFVA 5EE9A 5A5GA 2ZYVX 2J0UB 1SVKA 2BM1A 4D4KA 3BBPA 1IONA 1MABB 4HLDA 4P31A 5E7MA 3PUZA 2HDNB 3TSOA 4B75A 1E2MA 1KDRA 2FU5C 1NN0A 2WWXA 1P61B 3TIFA 3VMFA 1B23P 2DFKB 3ND9A 1I2DA 4DKXA 1UJ2A 2VPPA 3FMFA 3W6PA 1OPXA 3VHXA 3PQCA 2WWYA 5E7JA 4NU0A 3NDPA 3TW4A 2IS6A 2GF9A 3L0IB 4BUJA 4JVLA 2OCAA 2XXAB 1MR3F 4EJSA 4ILEA 3PUYA 4YMVA 4MH0R 2J1LA 2ZI6A 1ELOA 2KBFA 4CDGA 1FQKA 3TGPA 2OM2A 3L0OA 2UZIR 3PEWA 2WSSD 2DPXA 4B2PA 3BIFA 2B92A 2P5TB 4KVAA 3EZ2A 2Q3FA 4WW0A 3CX7A 1CJUC 5E7IA 3D8BA 3O8CA 4HAVA 1S4QA 1TMKA 4TYWA 1OFHA 2AD1A 2XOKD 3EPKA 3VU9B 2D4HA 2FSFA 2RGBA 5J4KA 5AJYA 5IK2D 4E22A 5EE1A 2IYLD 2DWOA 4C2TA 4Q19A 3OF5A 4A2QA 3QKRA 1CS4C 1T3LA 5BN4A 4HDQB 1G5RA 4B3GA 3GJ7A 3IILA 3ZDQA 4Q1DA 1MO6A 3GJ8A 1P9RA 1Z0AA 2JIZD 3LD9A 2Q9AA 3N2EA 2HCJB 3MAAC 4IDHA 4PZYA 3SZRA 1ZUIA 3QNUA 1DELA 4EPRA 1AGPA 2XAUA 1U0LA 4IEEA 2X2EA 4DC9A 2YV5A 2NG1A 3VQTA 3BAFA 3LLMA 3THXA 5HCNA 1IY1A 1PVOA 2XTMA 1YR6A 2ONKA 4N0DA 3LQRA 4C7OA 5KNDA 2IL1A 2ERYA 5J4LA 2EU8A 4BLSA 2GCOB 3X2SA 4AYWA 3AKYA 3IPYA 2J46A 3R7WB 3R8FA 1QHIA 4JZKA 5FTLA 2NO9A 3DZ8A 3FYHA 1EFRD 5CLLA 1GL9B 5K8IA 1MT0A 4ZCMA 3PG5A 1HY3A 1LV7A 2CL7X 2W6JA 1WMSA 4H9GA 4OJQA 3GP8A 1KO7A 4FIDA 3S1AB 1N6LA 5EZ6B 2RAPA 2ZXUA 4Q02A 6Q21A 4PO9A 4TL7A 1GZSA 1YZTA 4FWTA 1JQLB 3CPJB 1RRCA 4XWAA 3WP0A 4D82A 1E9AA 4QHYA 4AURA 3MLEA 4Q7JB 4M4SA 5DLQC 2ATXA 3LX5A 3SEAA 3TLXA 4DDUA 3I5YA 1QF9A 5KO2A 3K0AA 4LPSA 4F4IA 4DEXA 1U90A 2BIFA 2Q3HA 4ZV4A 4LV8B 4URZR 5DYIA 1Q0UA 3FTQA 3LWNA 1PUJA 4KYUA 4Z1MA 2ZRIA 1GNQA 2WV9A 3GLHE 4TZ6A 3NG1A 2R2AA 4AKHA 3SYNA 5FTKA 4ITRC 1RZ3A 2R65A 4RFSB 4KXFB 2W2XA 3QPWA 4EDHA 4QC2A 3TMKA 5TY0A 3R8CA 1EGAA 3ND8A 2GF0A 5G3ZA 1YR8A 1RPZA 1E69A 2B21A 1DOAA 3WYGA 2H1LA 2F6RA 1DAGA 1UPTA 1N5LA 5IF9A 2VP9A 5K8TA 2HXSA 1UKEA 3FB4A 5EJEA 3T15A 2VIIA 4FCVA 3VR5A 4NL4H 1GDDA 1LFDB 1X8LA 1FPMA 1RIFA 2XOKA 4YLGA 5G41A 3S1AA 2EYUA 5HZHA 3TH5A 4RZUA 2CE2X 2DHRA 2YWEA 4A8JB 3LV8A 2B8WA 4ARZB 3NBFA 4M1TA 1NVUQ 4Z8YA 4BZPA 4PANA 4QG7A 4LYJA 1G4UR 5G40A 3VAAA 3PENA 2X2FA 2QENA 2EQBA 2ZS9A 2H17A 2CL0X 4LHWA 1KJYA 4D80A 3IDQA 4MKIA 4MRSA 5F3WB 1SXJB 2HXYA 2C95A 4LHZA 4C30A 1BIFA 2L0XA 2D2FA 1WF3A 2D74A 3V9PA 1G3QA 1R4AA 1GL6A 1ZM4A 2ZRBA 2Z43A 3CBQA 3GFOA 4QHTA 5FI1B 4Q9KA 3GCGA 1ZM2A 3GFPA 4OHYA 4AD8A 2BM0A 2O8DB 2GAAA 3CF6R 3N5CA 1ZNXA 2XNSA 1KMHB 3RRNA 1GWNA 4O0MA 4Q9LA 2IX3A 4CEIA 2AX4A 2JJ2D 3W8NA 4Q4AA 4NH0A 2ODNA 1ZM3A 4KITB 2PL3A 3OEED 5FBVB 3RHFA 1HTWA 4JLNA 2PCLA 3VU9A 4G5OA 3FMIA 2H5EA 3CF0A 3BFVA 3M1IA 4BECA 4PSAA 1UDXA 3TVDA 1OXTA 1VCIA 3HPRA 1N5JA 4ZDKA 1S9HA 1Z63A 4V0LA 1VIYA 1ZW6A 1XF9A 3AV0B 4HZIA 1D8TA 3SHWA 3BS4A 1NIPA 1PJRA 5IDVA 1VDZA 2F1RA 2RHMA 3D7MA 1XTIA 2N42A 3BD9A 4G5GA 2LCFA 1F3OA 1E0SA 4EPXA 3U7HB 1HT2E 1IJFA 4HAWA 3K09A 1OF1A 1G8HA 4G5RA 4EUNA 3U5ZB 1E2KA 3QKRB 3RRMA 3TVTA 2UVQA 3ECCA 4ZI2A 1ZIPA 1QHHA 4GI7A 2FPMA 1Q1BA 1BMFD 1US8A 4L9WA 2ZJZA 2P6RA 2RGXA 1TUIA 3EC2A 4OYHA 1TPZA 3EA5A 3MSXA 3SOPA 1GSIA 2WIAA 1ZCAA 2C9CA 2QNRA 4JBXA 1KSJA 1G20E 2GKSA 5CIQA 3T12A 4JIMA 2ERXA 2ZI9A 3L8YA 3W6NA 1R0XA 1KI4A 1IN5A 2J5XA 2CJWA 4OK3A 2J45A 4JT2A 1JECA 3CR7A 3KDSE 4I81A 4JLBA 1FMJA 4JJKA 1W0KD 2YOFA 2ZREA 3AEZA 2Y8EA 1NJFA 4EJSB 3K9LA 1KSFX 4IOJA 1TF2A 2OCPA 2QRZA 2ZSDA 5CB6A 1ETUA 5EUMA 4PFSA 3HWSA 4LV6A 4C9BA 1SXJC 3CX8A 4HAYA 2PT7A 3NC0C 1KJZA 3MFYA 3SQWA 2ORWA 1J90A 1XTQA 3MRSA 1M7GA 1OLOA 2RGGA 3EAQA 1O3YA 3QBVA 221PA 4DDWA 1MABA 4BGDA 4URYR 3VKHA 4JLAA 1X1RA 1OIVA 3DPUA 3KB1A 3U6BA 1KI8A 3KKOA 1FFHA 4HAUA 4RY2A 2WJGA 2IHBA 5L8VA 2IYRA 3OFND 1GFIA 2AD5A 3O8RA 1U99A 2JAQA 121PA 4PXAA 2BEKA 3K9GA 2EFHB 2GXSA 4DDTA 2WOOA 2J0VA 2FZLA 2OCBA 3IHWA 4DLXA 1Q1ZA 3ASZA 3P4XA 4LJ9A 3TUJC 2H16A 4TYQA 4OHWA 2QMHA 1AS3A 3UATA 4GOXA 2YINC 3FFBA 4K8OA 2XGJA 2NIPA 5L3RA 5G3YA 5J5CA 1LF5A 5KSZA 2QPOA 1GM5A 1KI6B 2ZRAA 3HYTA 4O3MA 4TT3D 1WE2A 2V55B 2ZE7A 5DISB 2A5YB 4G0NA 1GNRA 2OFOA 4LJYA 5CITA 4ZCIA 4H1VA 1W4RA 4KAXA 1GKUB 4PX9A 2PMDA 1EFCA 4QGHA 4B71A 1SXJA 2PLFA 5FL7D 3ZVRA 4QXAA 4RFSA 2W0MA 1F48A 2BBTA 1AN0A 4UXIA 4FI3C 4C0QC 4ACAA 5JJLA 1Z0FA 3HP1A 3U3RA 1BO6A 1G16A 1E79A 2JGNA 3CWQA 4KLZA 5CK4A 2WPDA 3MUFA 2QBYB 4Q1EA 1G41A 1CJTC 5AUPB 2F9LA 2JJ1A 2WWFA 1N6PA 1QG4A 3QKSB 4C0HA 1YZKA 2G1KA 3MGCA 4P4SB 3TQFA 4AKIA 4YQFA 4DSNA 1E2GA 4EFMA 3K70B 5CYOA 1FX0A 1Z6XA 3T5GA 4JL6A 2W2TA 4HDOB 3LVQE 1E3MA 1XEXB 3ZS8A 2IWRA 2QG6A 5LB4A 4AC9A 2WJIA 4LC1A 4NCNA 2RGDA 1SXJD 3A1WA 1E2LA 1KO4A 4LJ4A 3JVUA 4RCYA 4WVFA 3BOSA 5AUNB 3B82A 4HLUC 2ZI5A 1Q57A 3UMRA 1A82A 3CH5A 1ZCBA 2FFBA 2WPDD 3GLHA 1D9ZA 1NKTA 1G3MA 1KO8A 4HZUB 1J99A 2OBMA 4IJMA 4Q66C 4BLRA 4FCTA 4V02A 1R0WA 5C4GB 1N0UA 3BB4A 2GNOA 2WIBA 3EZ7A 3OEHA 4KVGA 2Z4SA 4PAQA 1QHGA 1OXVA 3VX3A 2GJSA 3BB3A 1Z0IA 4R98A 3U3JA 2EYQA 5HPYB 4LSGA 1W36C 2X1VA 1G5PA 3REGA 2QU8A 2BWJA 1DE0A 4LPKA 1NKSA 3FHCB 1JEDA 1NVVQ 1PUIA 5LBIA 4K81B 2QP3A 2ZJ8A 3ZD6A 4OK6A 1JAHA 1G18A 1LW7A 4RKEA 5FOVA 3KKQA 3ICEA 3JVVA 1XD2B 1UEIA 3TSWA 1HQYE 1NN5A 1Z5ZA 4NYMR 4F4JA 2D3WA 3C41J 2WSSA 3KTAA 3OEEA 4PHTA 4X8MA 4DIDA 4PHGA 3IBYA 4BLOA 3QIAA 1F5NA 1XJ0A 1ZU4A 2REBA 4V0MA 4PTLA 2ATVA 1AM4D 4URWR 4OQLA 2GTPA 4DLWA 4BFUA 1CEEA 2HYIC 3W6OA 1YJ5A 5CM9C 2VF8A 4PC2A 2HV8A 3WBJA 5DN6D 1X86B 3BERA 2Q0HA 3CNOA 3AF2A 4DUGD 1TUEA 2ZAOA 4LYAA 4IRUB 2NTYC 1DS6A 2ZYUX 2F1HA 1E79D 3OHMA 1NVVR 4KBGA 3ETLA 2ODWA 1W2HA 1W46A 2FFQA 4LRWA 4L16A 3W5IA 1S3SA 1XXHA 3RS0A 3BRWD 4B47A 3DM9B 1T0HB 2FV8A 1NI3A 2IC5A 2IYZA 1TQ2A 4DXAA 2QSZA 1R5OA 3LXRA 4TTRA 3QI2A 4LDJA 5CM8B 2VHQA 2XSZA 421PA 4B3FX 1TF5A 5KUTA 2NO0A 2J3EA 4GL2A 3UG6A 1XTSA 3PR1A 2N1BA 1LS1A 2IUSA 1YZNA 2GBLC 5EUQB 1JPJA 1XMJA 1W4AA 3AUYA 3I8XA 2ZPTX 4TT3A 1M7HA 1NMYA 1WCV1 1XCPA 3ZQJA 5CB8A 3AGQA 1M7BA 1U0HC 1KKLA 2IEZA 4UXJA 5DN6A 2FX3A 3U3MA 2AHOA 1Q3HA 1XRJA 1H8ED 1ZJ6A 1SKYE 3QQ5A 4MYUA 5KU1A 3IKJA 3DMDA 1Z6TA 3B1YA 2WM9B 4JBYA 4TQ9A 1G8YA 3PITA 4XD7A 4RCZA 1KGDA 3GJ3A 4MGKR 4CW7A 1W48A 2R44A 1SULA 4E03A 3DOEA 5F2EA 1NBME 4EFNA 3AVVA 1E1RD 1OXXK 3CRW1 5FR1A 1G9XA 3EIQA 3QEJA 4Q7KA 3KKPA 2FNAA 5EP3A 1W36D 4HB3A 3TR5A 1NN1A 1HURA 3GLGA 2IF0A 2WAXA 4G01B 1BS1A 2GWHA 4OK5A 1Q22A 4NPHA 4U5XA 4MDFA 3KX2A 1N0WA 5GJCA 4TMTA 4O25A 4Q4JA 4DIEA 5LD2B 2BMFA 3IIMA 1QVAA 3E2IA 2ZJ2A 5AUOB 3AVPA 3MCAA 4KI0A 1KY2A 2CVHA 3WRXC 2O8CB 1QDEA 3PXGA 3PVSA 3RLFA 2C99A 1QHNA 3IGFA 3VKWA 3SQXA 2AXPA 2ZANA 1TL7C 1JNYA 3CRMA 4DT1A 1KI7A 3GQBA 1N5IA 5K8LA 2BDTA 4L8GA 2W6ID 4KCGA 3PEYA 4DJTA 1G291 2XB2A 4Z1MD 1N6NA 1GOTA 1DG3A 1FTSA 3LRPA 3NVAA 4IKEA 2IK8A 1DAFA 1JR3A 4B6FA 1ZC4A 2OFWA 2REXB 1BKDR 5E3HA 4WIAA 4GMXA 4UNNA 3EPLA 2NO1A 4C0SA 5JS8A 5FPYA 4I1OA 4D81A 3CZPA 1A2KC 3UANA 1JR6A 5J4HA 2NZJA 1HYQA 2OCYC 1DBSA 2DCUA 4GP6A 2QI9C 2R6AA 3B7GA 3UMSA 3G0HA 4GRAA 3GJ5A 2NOAA 4JYBA 4ZKEA 2R6CA 1N0VC 1OFTA 1ZIOA 2G9NA 1L8QA 2FZ4A 4FMCF 1J8MF 1JEEA 1U0JA 2I1VB 3PEVA 3U3OA 4TLCA 4C3ZA 2OT3B 4Q5IA 3MWJA 3RRZA 1NY6A 3IO3A 3NWJA 2FH5B 2ZVPX 1A1VA 3RYTC 4QGAA 4EQ6B 4QM6A 1IM2A 3GJXC 2RHDA 2WJJA 4HUTA 5EE5B 1U8AA 4R9UC 4DCSA 1TEVA 5G53C 3B85A 1OYYA 3CM0A 5GJVC 5GVRA 3NBYC 5FTNA 1RKBA 3NHBA 4JVNA 2W58A 1E2EA 2J41A 4M22A 3MWKA 1YZGA 3A37A 1KO5A 3P4YA 1I4LD 3BB1A 5FOXA 4BFZA 2RGEA 4B3DA 3AVOA 1VPLA 1GKYA 3AF0A 1U9IA 3KJHA 3BH6A 1OIXA 5B2ZA 3D31A 3SFVA 4BRWA 1PLJA 5B30A 1UAAA 1V43A 2BMDA 3EASA 1N6RA 1JALA 2JJ2A 1HE8B 2ZUBA 1S1CA 2VYFA 1SVOA 4JLKA 3KJIA 3RNLA 1UKVY 2C9YA 3CB4A 4D4MA 5JLJA 3R9WA 1FZQA 4D25A 2GXUA 1EK0A 1SXJE 3IBGA 4KBFA 5FPKA 4CEHA 2A30A 5EP1A 3WYAA 4I4LA 5AWFC 5DHAA 5KYKA 4B2IA 3QJYA 4E09A 3U44A 3AP1A 3B1ZA 3ADDA 4E07A 4JLJA 5JI2E 5F98A 2A5DA 3I62A 4MRPA 3VR1A 1XX6A 2ZRKA 3I3SR 3CRQA 5FOWA 1SHKA 2WWIA 3DMNA 3MJRA 1Z6GA 1OB2A 1QBKC 3LW7A 5FBLB 1SVMA 1KK1A 5KPDA 4QM7A 1Z29A 1G8FA 1XJCA 3AVUA 2P67A 1E2IA 2IHYA 3M0EA 3RVBA 4L5BA 2PLRA 1Q3TA 1DAHA 3IEVA 3B6EA 4ZIRB 2GVZC 3B1VA 4E5UA 2PZFA 3ADCA 2P6NA 4TL9A 2CLDX 5KOYA 3X1WA 4CZ2A 2CCGA 3AVWA 2BEJA 4WXRA 2BJVA 2YYZA 3U60B 3KL4A 1AZSC 2MSDB 3IQXA 4GPTA 1MRNA 4F7WA 4Q4HA 2CCKA 4IDNA 2Q9CA 2WOJA 3P26A 1U8ZA 3A4LA 3BH0A 3T1QA 4GZLA 2GJAA 3RWOA 4IDQA 3WNDA 1DAKA 2CJWB 2VHCA 4KHZA 4Z51A 4PPFA 4TL6A 2QTVB 3D3QA 2VA8A 4Q7MB 5FPSA 2QL6A 2IW3A 2YC4C 4JMPA 5J4VA 3QENA 1M2OB 2ZU0C 2A5GA 3FOZA 4B74A 1OSNA 2J7KA 2HCBA 2FPLA 4W5WA 4R2HA 3R20A 3PCRB 4AG5A 1E9BA 1VTKA 3CX6A 4NYJQ 2BMJA 3ZH9B 1QHHB 5DSZA 4BFYA 5L3SB 3KQLA 1P2TA 2GEDA 2NO6A 2GCPA 4G5SA 5FOSA 4XVQA 3DEFA 4AKEA 5JMTA 1KOFA 3HR8A 4XH9B 3VHLB 1HT1E 1XU4A 1TQ4A 1RYFA 3UWOA 4EFLA 2EFCB 1S9DA 4CF7A 2QE7A 3Q7PA 4A2PA 4Y0VA 1ZNZA 3G82C 4TSFA 1CR4A 1E96A 3Q72A 2Q21A 4JLDA 1UBEA 1II8A 2JLUA 2FFAA 2GBLA 2GDJA 4II7A 1KI3A 3FPAA 5C18A 5FPHA 1X8JA 4EKDA 5E4FA 3BFKA 4YC7A 3WMEA 1FW6A 5C1BA 5ANRB 1UFQA 5DH9A 5DO9A 1US8B 3QPVA 1ZAKA 1TX4B 3DL0A 1A4RA 3SC3A 1SVWA 2ORIA 4PO1A 4B43A 3HU1A 4NCKA 3REFA 1LS6A 2Z0MA 1XDBA 2B7BA 4QGGA 4F38A 4X8HA 2AK2A 4JSYA 2ANBA 5IK2A 5TDHA 4LGMA 2RKOA 1KMHA 1U81A 4V0KA 1CR1A 2VP4A 2Z83A 3EW9A 3CW2A 3MWYW 1WBBA 621PA 1UKZA 1GUAA 3AUXA 2AN9A 4ZIRA 4BZXA 2IBMA 3EZ6A 3K70D 3FKSA 4M21A 3GEIA 4HAZA 2QROA 4XWKA 2P3SA 2CEAA 4MYTA 1R2QA 2DWPA 2EVWX 4M8NE 1ZD9A 2GVDC 5HTKA 4BFXA 1KAGA 4QJ3A 2AR7A 1QG2A 1E2NA 3F3YA 1VG8A 1EFUA 3HYRA 3SFZA 2IT1A 3UPUA 1F60A 1P62B 1KNQA 3QPUA 1TF7A 4M9ZA 4UKDA 4HUQB 4URVR 3BFXA 1G3RA 3A1SA 3U3KA 5BYKA 2R6GA 1XD2A 2V4ZA 2IYQA 1ZU5A 1T8UA 4A6XA 4TMVA 3D6TB 1T6NA 3CF2A 1S8FA 1WP9A 3VTKA 1XTJA 1K6MA 3QVUA 3CWZA 1ZD1A 4Q21A 3C15C 1DAIA 1WRBA 4XVRA 4CIDA 3B8HA 2BBSA 2Z6VA 1Z0DA 4Q7LA 3TE6A 2XX3A 4AIIA 2OBNA 3RC3A 1FX0B 3AP2A 2VP5A 1U9IC 4IVRA 2R62A 1VYTA 4TQAA 4Q1FA 3QXCA 4OI0A 1F2UB 2WWWA 1G5TA 4U7DA 3ONWA 2BVNA 2O0HA 2OLKA 1FMLA 1NVWQ 4PQRA 2D62A 4JYCA 5FPTA 3G5UA 4G1UC 4DZZA 4F93B 3WP1B 2OUKA 1Z2CA 1KJWA 1GRQA 1NN3A 2BBOA 3WNCA 4W5JA 1Q21A 1Q1EA 1UM8A 1ZVQA 2FSGA 1F2UA 1C4OA 5KNBA 2ZRDA 1Z08A 1LTQA 1CJMA 3QE0A 4NKRA 2CMKA 5D3MA 1SQ5A 3QOFA 4MGZR 1M1YE 1JR3E 5LDDC 1F6BA 1ZBDA 1G3IA 2G0TA 4P4TA 2VSOA 3OE7D 4TLBA 5TMPA 4AY2A 2WWHA 2W83A 2Q6TA 1EX7A 4FXPA 2JATA 2RB4A 1S3GA 2QTFA
chains in the Genus database with same CATH superfamily
3JVDA 1DB3A 2YXDA 4KFRA 2CK3D 2QXUA 5JSQA 1M33A 1XHLA 2O1EA 4JEHA 2P1DA 3FCXA 2EKZA 2F64A 2WYVA 3WSTA 5M2QA 4MQBA 3MLBA 1AG9A 2YV3A 4ZYWA 5JAPA 2XNDA 1XPRA 2P35A 4WZAA 1XB2A 2ISSD 4MYHA 5DEOA 2ZB2A 2IXDA 2Z1MA 3OFJA 5CCEA 3OMWA 1YI0A 4KH1A 4LMPA 2ODPA 4O4LF 3WS7A 2QYTA 3VBCA 3QF7A 2Q1WA 5K4GA 3ZWKA 2H9AA 2P65A 4MA0A 4BUCA 1E2HA 1XFAA 3JQFC 2FMIA 4J0EA 1OZAA 4YHHB 4C4RA 3FUUA 1JHAA 5DGXA 2WDPA 3A4MA 1Q6ZA 2PZBA 4D9JA 3C16C 4NMXB 5JARA 3T1HB 1T3SA 4CHTA 4QDJA 4UZFA 3W5JA 2HAEA 1U2SA 5AK4A 1FUKA 1NXPA 3HM2A 3LC0A 5AOCA 4HLNA 3JQRA 4HSEA 1DXQA 4JLPA 5A7GA 4FEEA 3FSEA 2BKUA 1SVUA 3I2JA 5CXXA 4X62B 2VTBB 3USZA 4QUBA 1QU3A 3WL3A 3O0TA 4EB6B 1QE5A 2I29A 4ZQIA 2AZXA 3EISA 4S0ZA 3TFWA 2BSQA 4BMCA 3F5QA 2PL9A 4IBOA 1V5GA 2M2IA 5LA6B 2IBTA 3B2EA 1DC3A 3K9HA 4GP9A 4HYYA 2VL7A 3FVWA 1OBHA 2XA2A 5AXBA 5JZOA 1JBQA 2XNDD 4CMHA 1Y4UA 4M8LA 4PHFA 1CFZA 1RDFA 3WQBA 2GCOA 2JFGA 2H29A 4KXMA 2P6UA 2C4KA 4W1RA 5BWOA 2Z3ZA 2HOQA 3IR5A 4NFLA 3KPVA 4U3JB 3UJAA 5AFSA 1P39A 2KE5A 3E05A 1P2FA 2VJKA 3E9YA 4MWOA 4OBXA 3K6RA 4DCPA 1COWA 1GRRA 2IELA 3CW8X 5G02A 3CY6A 2E85A 4AXXA 3A6GA 1TEHA 2P9BA 2XWBF 4P80A 1EU1A 4H1HA 1IXKA 3WGQA 4L73A 4ZEOA 4CT5A 1R27A 2QVBA 3IUMA 5JI3E 1Y3AA 4OQNA 2G1PA 1GL7A 1P2SA 4B33A 2Q3CA 4K6FA 3H11A 5C7OO 2VP6A 3VISA 3U16A 2OV1A 1AUQA 5DP2A 5EEHA 1JJIA 3O4FA 2O48X 2XV1A 4L51A 4Q3BA 4MI6A 5KSPA 4GKVA 1EHIA 5JMOA 1K7SN 4LJKA 1E2FA 2Y0EA 4TTPA 1T91A 1F1JA 3JARA 3ZZUA 3HVJA 4XRRA 3WNZA 1XA4A 3Q0IA 4WUVA 2OKGA 4B6QA 4LYFA 4Q9HA 3B1JA 2AOVA 3FOAA 2RIRA 1KYYA 2OVBA 5EIWA 3UGKA 3CCCA 2ZS7A 2OXIA 3RARA 3QITA 1D7AA 1RABA 4UPVA 4J0FA 5FLXA 2XXBA 2AFHE 1J5PA 3QKUA 2EG5A 5IH3A 4DPMA 1Z0KA 1HORA 1Q7CA 3KM0A 4RKFA 4DMLA 2DTXA 1FUUA 4OLBA 3ASYA 1W2WB 2HO5A 2Z3WA 2BYTA 2C5EA 2JJ1D 2FE1A 3RODA 2D2IA 3ZGVA 1ZCFA 4B3RB 5L3QB 2Q5JA 2W2MA 4FCWA 1NVXQ 4X94A 1HZZC 3LCCA 5CW1A 3OG9A 5IX8A 3ZHZA 3GRRA 3VVBA 3P9NA 2B9VA 4X6LA 1GFZA 2G5CA 2W93A 1R64A 1TU0A 2FDXA 1UT6A 4GOJA 4TLAA 3LTNC 1O7JA 2ZB8A 3IOEA 4WE3A 1G1MA 4MRRA 3UJ3X 4QKQA 4QASA 2YOHA 3ZIAA 1Z5PA 4QPJC 3GDOA 2NO4A 3QX7A 5F64A 2PSDA 4X44A 3AHHA 5SYNA 3RVSA 3WQRA 2PUVA 4C03A 1RRVA 2JHAA 2C92A 1S4MA 4UNQA 4CM4A 4PLYA 1CJVC 1DCTA 4G4GA 3V1KA 2O2JA 1ZD2P 4AJLA 4BKRA 1SOVA 5EMHA 4E1BA 1R0BA 4BO9A 1JQKA 1KEWA 1VPEA 2EBWA 2YVAA 3M9XA 4FONA 5EKUA 4AYXA 2QAJA 4YCNA 3U1TA 4CIBA 1IULA 3J81k 5DZSA 4WD3A 5EIXA 5K8JB 4BEVA 2AJDA 3AI2A 3FGOA 3I37X 3PSAA 5K9ZA 1K08A 3R3ZA 5BYBA 1F0KA 4K9DA 1L5FA 2VWGA 4XGRA 1JWBB 1G7CA 4IV5A 2F43A 3JRNA 5TJHA 2AJTA 3DZCA 3RF6A 1IHYA 2XZOA 3K9BA 4UJ3A 3HBJA 3ZX4A 1O0CA 4TMWA 5JQGF 1T1RA 4Z2YA 4Z3OA 4KIFA 1ZQ1A 4TYPA 1VHWA 5HF5A 5LBUA 4TSFD 3N2YA 1CQJA 1H2WA 3FPHA 3CSUA 3KCQA 2P9JA 5E4TA 3ZWXA 4KAAA 4ETWA 5B2EA 2NLOA 4BRUA 3DULA 3A6ZA 4MWTA 2Z2ZA 2IFTA 4HS9A 3Q2IA 2GKGA 3BWYA 1NJ8A 4IZIA 5HUJA 4NZYA 2LRHA 4Y2TA 2QX9A 4XIYA 3WMGA 1PR4A 3K0CC 3KOXA 1RKUA 1E6LA 1SBTA 2UZAA 3CPEA 3CUWA 3ANSA 1YFKA 3SHVA 5B7GA 2PBFA 5JH7F 4WVLA 4OI4A 4EHAA 1MH1A 3B36A 1LPPA 1SVLA 1T6BY 5KAMA 3EVNA 3R3UA 1WBJB 2QZ9A 3IVGA 2R86A 1WVGA 4HWOA 4R8KA 1A7JA 2R0QC 4D9KA 2FR8A 2BJHA 2X4GA 3UOWA 4LEIA 5CGZA 2VSNA 1GZ3A 2VSYA 3I9JA 4IGFA 1HG0A 1D8AA 2BKAA 3EQ8A 2YZMA 4G0OA 1UMCA 3LY5A 2R1ZA 3SXUB 1JQBA 2QAGB 5HRCA 5KVAA 2BMAA 2R00A 2G83A 1RWVA 4D9CA 3BBLA 4RLHA 4CEJA 1KKMA 1K98A 2QN1A 4ZEMA 1DSSG 1A4XA 1AX9A 2CWWA 4FMDB 4YTEA 1DRWA 2B78A 1WS6A 2J3LA 2PEZA 1YZHA 3H1FA 4YMUA 1ZNWA 2AFIA 3E8SA 3HS3A 1T2AA 1Y9ZA 1IY0A 2CN1A 3HVHA 2BGKA 4OMDA 5D3QA 2JFYA 5EWLB 2QTRA 5JDCC 3VZBA 4LKOA 1HDCA 4BVJA 4G0UA 2OZEA 4BNXA 1PYOA 1R0YA 2BEWA 2VT3A 3DMHA 1M0EA 3LFHA 1ZGHA 1Y6ZA 3A7DA 3FMOB 4FUTA 4GSLA 3NWOA 1AK2A 2PUTA 3GRCA 4MMXB 5CH5A 4QU9A 3PX2A 4TS1A 3G5LA 3JRXA 4A23A 5DGDA 3R3SA 5JRDS 2YBEA 4JJAA 1HF3A 4DEYA 4EEKA 3FVVA 1P44A 1XN4A 4MV4A 4NMWA 2ODAA 2P4EA 3FHTA 1Z2OX 5G4KA 3H2GA 5E7QA 5KKNB 4UEKA 2AQHA 4PF1A 3LC1O 4RM2A 2ALJA 3IIJA 4GRDA 3HUTA 3TLZA 2D1QA 1WMBA 1Y4AE 4WASA 5EZQA 4JUBA 2PNJA 2X9NA 5MN6A 1ZPDA 2ZUCA 2I6GA 3NKVA 1DZIA 4LTMA 4BEBA 3N53A 3O9ZA 3ZE6A 4GVLA 1BJRE 1BMTA 1P1HA 1Q77A 3LOPA 1KL7A 3AHJA 3TIVA 4MPJA 2XT0A 4UD2A 3A32A 4IDCA 4I99A 2QORA 2QDXA 4BWYA 4EPRA 3EMKA 4GX0A 1ZKDA 4J94A 4MRAA 4UXHA 5FLEX 2EFGA 1F0NA 1XP8A 1M0TA 3ABOB 3CO0S 4IDGA 1NJ5A 3IA2A 3T4EA 3LVBA 2GEKA 3ZR4B 2D2EA 4DLSA 3IMEA 1WVMA 1SPXA 1UBTS 4S2EA 4V38A 5DYYA 1RJ9B 4FHZA 4PYRA 4X8LA 5LQSA 4CR7A 1XAIA 4EO4A 1HEYA 2XMQA 4J76A 1ZI9A 3RRYA 3TUZC 2GN9A 4OUKX 1F06A 4TKVA 5A5FA 1NNEA 4HEJA 2IJGX 3BGIA 4RD3A 3GVHA 5FULA 4CRWB 3UVEA 3FFAA 2RH4A 1UWVA 3EBPA 4KMRA 5IF3A 5EL0A 3PYXA 3S70A 4B4WA 5KOHB 1KF0A 1ND6A 4QUDA 4LNAA 3R0ZA 1NYRA 4PPYA 4BE9A 3TRKA 4A6PA 2JFPA 1E2PA 2HGSA 2ID4A 1P1FA 2WIFA 2ZJOA 4MB0A 4GI1A 5CMLA 4ZT6A 1ESEA 2R66A 2VKTA 2ACEA 1NG9A 1XVVA 1QYCA 1LC0A 1MV5A 2A9QA 1I30A 1Y9AA 2QJOA 3K0EA 1IB0A 1XQ1A 2FFJA 2SKEA 4JLWA 3JQ8A 4U9HS 1T34A 4JIGA 5B58T 4O2RA 4ZVTA 4M6WB 4Q1VA 3WYDA 2PRKA 3VGJA 3OM8A 5JEEA 3I01M 4FNMA 2CNWD 1XLUA 2VHUA 4KX3A 3TEFA 1P4RA 4US0R 2J9RA 2QRQA 4KBYA 2VJAA 5IUKC 1SOAA 5AOAA 1P5RA 1DAEA 1EXWA 3HSYA 4A9AA 5LWQA 3H8JA 2BGGA 1KFEB 1M6VB 1TZKA 2W11A 2I5PO 4UJ5A 2C7GA 2JLRA 2SBTA 3QM1A 1NSFA 3AR4A 1Y3IA 5SZJA 1UQTA 1QGOA 2PR7A 1SNYA 2V1UA 1DVRA 3OIYA 5J3JA 3DEJA 4EUEA 4F8EA 3HXLA 1W5SA 4CNBA 4RH1A 1SCBA 3N2IA 5BURA 2FE4A 5L3ZA 4DV4B 2UUPA 1TQ6A 5ALHA 1SO8A 1GN8A 1VLQA 1KARA 2ZYDA 5A2QA 1T9CA 3EDYA 1KYXA 2P2CA 2ZSHA 1H05A 2OLJA 3TN7A 2QJRA 3L7LA 4KIUA 4QTUB 4CE6A 3KJGA 1QYRA 2QTHA 5JTTA 4XD7D 3R74A 4IVQA 2ZJ0A 2IUTA 1I0IA 1POXA 4ENUA 5HX7A 4OLFA 3M7IA 5DPMA 2VAWA 4IYRA 3KTAB 4BL5A 1L8OA 4RBNA 3NWBA 3EZFA 5IKEA 1OYOA 3CUYA 2H57A 4EGAA 3O4JA 5BNTA 3H5AA 1MAAA 3WYCA 4W9MC 1XVAA 2OCGA 5ICSA 1Y6JA 5ALMA 2V96A 3UJ8A 3PNLA 3VC2A 3OZ7A 3KU1A 4Q4AB 1NNI1 2GK6A 4FHGA 3P32A 4L72A 5LDHA 2UYYA 4YVFA 1HL3A 1FP4A 1LFAA 1O2DA 5FJJA 2PVPA 5KTTA 4CEIB 1EFHA 4D9IA 1JHMA 1ZH0A 3OZWA 1E6MA 2PUHA 3FRIA 4TQUS 5F2NA 1QOQB 1ZSVA 3K15A 3GX1A 4OTZA 4GBED 5IVDA 1DCFA 1RLTA 1X7XB 1L6RA 3U3XA 1GPNA 1XDGA 2ZGVA 3KB6A 1GGMA 3PUIA 4FYHA 4Q3LA 2P3QA 3LQ4A 4G5QA 1A9OA 2GD2A 4YRFA 5DNAA 4ZV7A 3JAMA 5HA5A 2GXAA 1T9GR 1RNLA 1U3GA 2J9FB 2XTAA 4FKBA 3WOHA 1L8AA 5DWDA 1DPGA 4P5DA 4B7CA 4G8CA 1EUQA 1U8FO 1YQWA 1NQ5A 4YUVA 5CDFE 4UMEA 1W87A 2KI5A 4RABA 1XELA 5IBCA 1DADA 3FWNA 1V4NA 3R0VA 3INRA 2G9ZA 2IYTA 1YS2X 2IA5A 5HG0A 1OU4A 2C54A 3DC2A 4E7PA 2OQVA 2VF7A 1D4FA 2ILTA 3L0SA 1KBOA 5JYEA 3NHMA 1OE0A 1CZRA 2W2LA 4ARZA 5JHHB 2CKMA 2X3YA 3JD2A 2BZ0A 2MINB 2RI0A 1JXOA 2RIPA 4FHEA 4GHWA 3DCYA 4G0VA 4B4DA 4AJKA 4E4RA 4HGNA 3RSZA 4BNUA 4GBMA 2P0EA 5TQVA 4F1WA 2OG2A 2VK4A 2JJMA 4QRDA 4EI8A 5KOJA 3MT9A 2HZBA 4V1CI 2CFRA 1RI5A 4IJWA 4EA6A 2QL5A 4KVZA 2IYYA 4R2JA 5IC4A 3NFRA 4HK4A 1Z22A 2X42A 2P75A 3PGLA 1U3VA 1KEZA 3V4RA 4BXOB 1U02A 2ZRJA 1YQXA 1X0VA 3A4IA 1E8MA 1WXFA 5JEDA 1Y63A 2Y1WA 4IIGA 3GBVA 4PBRA 4TMXA 3OZRA 4KVFA 4LXGA 2CBZA 3TKLA 1H1DA 1GJRA 2IUEA 1Q15A 1M8PA 5IDXA 3Q7QA 5CIWA 4LC9A 4NU5A 1SUBA 5FUWA 5TV2A 4OQFA 4C0WA 1GILA 2AEEA 4IEIA 4GW3A 1ECBA 3H8SA 1KO1A 1NV8A 4BNNA 1VHLA 1S89A 3NT2A 2ADMA 4K46A 5F12A 2XE7A 4LE1A 4O4HA 4MYRA 3H8WA 2Z9DA 4YRQA 4UUPA 1KMQA 5M3BA 4BMYA 4YT5A 3WHKA 1F8GA 5HRAA 1W85A 4P5PA 1H4VB 2XECA 3EF1A 1NM5C 4IEFB 5FFMA 3ZWQA 1UP7A 3MOIA 3QLVC 3S5JA 4GPEA 4HPJB 4Q1BA 2YJNA 4JKYA 4RD0A 2PX6A 3FVQA 5EP4A 1G17A 5A3QA 5J2UA 2G9VA 2QQFA 3OA2A 5IYZF 4UZEA 1NGSA 4UOQA 2QRUA 3AZQA 5DGHA 4FXOA 3O91A 2JFZA 4Y6PA 1FYDA 3Q3VA 5AJVB 4FYKA 821PA 2GPAA 1Q0SA 3GEGA 1XRNA 5A4KA 1TADA 2VDWA 5BXQC 1J0DA 1FXUA 1T2VA 2PBRA 3ZLTA 3ZY5A 5FLYA 2AJBA 3KOOA 4PW0A 2IVFA 3OUUA 3R5SA 3L82B 2XMBA 4GIBA 1TMGE 1EHYA 5ENZA 3GLIE 4GKBA 2VJOA 3PT5A 3JZMA 2RH5A 1HYHA 3ZYZA 2KMLA 2Q1TA 2DLCX 1WQ1R 3LHIA 2WD7B 1XAHA 3LYAA 3K1TA 2HJVA 3PR2B 3H75A 1S0UA 2VF2A 3PUXA 2YRXA 3PB3A 3CRZA 3LKZA 1JLRA 2VHJA 1CPYA 2ZTMA 3KT0A 1W94A 2CLCX 4B6EA 3TPCA 3ZJ5A 1W25A 4FFRA 4H17A 3KAPA 1I4EB 1GXSA 1NNSA 2FMUA 3NZEA 4AUEA 1YR3A 1JFRA 4UUNA 4OH7A 1CRLA 2I7TA 1RBQA 2QGZA 5CLJA 1COWD 4OSPA 3FKSD 1Z0ZA 4KL8S 4NP6A 4OPMA 2XZTA 3IVXA 2JLWA 1Y3DE 3DT9A 2PMEA 2LIPA 3EVDA 4E5NA 1YONA 5I4CA 3T5BA 2GHTA 3F3SA 3D5QA 3WK8A 1D2EA 2DQYA 3MVEA 3ROTA 1N2OA 3BIOA 2C4MA 1ADCA 1P7VA 2V7QD 2X9VA 3V8VA 4A0RA 5BT8A 1EFVA 3IJRA 2CVZA 3TOCA 1ZIDA 4AZ0B 1P6XA 4MI9A 4EG1A 1XA3A 4Z3KA 2D7CA 2GKOA 4X54A 1E3WB 2ZR8A 4I1VA 3PPYA 2R6HA 3HYCA 5ALEA 5F7JA 2WICA 4JXJA 1S3IA 2P9GA 3PDIB 1THTA 4C0BA 1TXGA 4N18A 4ZO7A 3N7TA 3TTYA 2NV6A 1U7XA 4PZ9A 4TWBA 2G4VA 1XRMA 3W3AA 4LZZA 3UB2A 4CT4B 5IJ9B 1YU9A 3OMLA 2HZ7A 3CNLA 3FAZA 2IEBA 1ZC3A 2AX3A 3FPEA 3KE9A 3RS8A 2GCNA 2O8VA 3BQNB 4PSVA 3RVMA 3DAHA 4EHKA 1DDGA 4UU0A 3NHKA 3A0RB 1Y37A 3CKLA 4FDLA 2YNMC 4N0EA 1YOVA 2QD3A 4LY9A 2RCYA 4Q01A 3VX4A 1YVDA 2X14A 1PEAA 3P0EA 1ZINA 1YRAA 4ZQBA 3TLAA 3G8AA 2PZMA 4OKSA 4OVKA 2X0IA 4B34A 3GPLA 2O1XA 1BYIA 2OZVA 1S2OA 4WKPA 4BVEA 4K8RB 1NTRA 4FEYA 2ZP1A 4DM4A 1PJZA 1PEYA 3AX6A 3B1KA 4HDSB 1BA3A 2HU5A 3O8OB 4QOJA 4ZYXA 5DI9A 2GD0A 4K9LA 5LXTA 2IOQA 2PH1A 3ZI4A 4LXHA 1QZTA 3ZCSA 1YUNA 3OBBA 1CZHA 4UCQA 4HDMB 2B5WA 1Z5OA 2ZQ5A 3NIWA 3OY2A 3OOYA 5BRNA 4D8VA 4ZDJA 721PA 2H1VA 3KXIA 2CBGA 3LQ1A 3VPHA 5FUQA 4DV2B 3QUQA 3CG4A 1N5KA 2CNKA 4EENA 3M6VA 5FL3A 2VHTA 1Z4JA 3HO8A 2OK8A 1RQPA 5CA0F 1XZPA 3TNYA 3FJOA 2CUTA 1OJLA 3HJCA 2VR1A 4IHKA 3QF4A 4J0HA 1BDBA 1L4MA 1JHPA 1YWGO 5GVSA 1AF7A 1NUHA 1XA0A 4J9UE 1CEYA 2E4AA 4IJ5A 4E21A 1EDOA 3IAM1 2P2GA 1P4HA 4H7KA 3ORSA 2FDCA 2QMYA 2PX0A 3Q7TA 3KQPA 2GEBA 5D1NA 2YIVX 5EXSA 2WY2D 5T4BA 4ZGWA 1SHJA 1I3KA 4IIXA 3F1LA 1KEEB 3LNTA 2GEJA 2HA5A 1O9HA 2A67A 3DEHA 3GR6A 3C7KA 3OFNA 4XKJA 4EJ2A 2IYVA 1ATZA 3D8SA 2CXQA 2GWRA 4PC1A 3UV6A 1Q7TA 2P1ZA 4HRXA 4YBZA 2O8DA 1Q5PA 1BVUA 1YI8A 4XQ0A 1P17A 3MYYA 1EM8A 2ORYA 3ZE0B 5BORA 5HP4A 3GV0A 1GYQA 1PTKA 4OP3A 5AJUA 2HWKA 3WOVA 2FMTA 2X0NA 2R9VA 5EP2A 3ETJA 1JKFA 3DDHA 4NMMA 1DV2A 3UH1A 4YCMA 4DV0B 5FWYB 1ZISA 4D0NA 3ANYB 1P5ZB 2V45A 4Y2HA 1VLJA 1GZDA 4RHUA 4ZTUB 2M6RA 1ZOPA 2EFDB 4RVGA 2O3TA 1RTTA 3BE6A 3A9VA 2FFHA 2Z98A 3F0TA 2EDCA 3F5SA 5T5QA 2O5EA 1I1HA 3PGXA 5A5DA 3E8MA 2Q46A 1ORVA 4LXTA 5C1DA 5CA1A 3CV3A 3IPCA 3SMQA 4UULA 2VBCA 4KQMA 4KQXA 2FP4B 3CVUA 3RIEA 1A9RA 2C1ZA 2G40A 2ILVA 1KJJA 1P73A 1XCGB 4CI9A 3RS3A 3TJZA 5KWSA 1VMEA 1C1HA 5T64A 1RWBA 3DZDA 3LRTA 1YACA 5FAXA 2IIBA 3UYKA 1P4JA 2PHZA 2Q4RA 4G63A 4CWAA 5CT6A 4I0WB 3BGWA 5DHTA 1DARA 3ZZMA 3RBZA 2I2AA 1EGQA 1YFJA 1VI2A 3D8UA 3LG2A 5A71A 3SGLA 1K8ZB 5JD6A 3ZZTA 2VXYA 1U31A 1P3DA 3HDTA 3ISVA 4X91A 3RYIB 5KOIA 2Z4TA 3L9XA 4GMDA 1PV4A 2IYOA 1QYXA 4WKGA 5E95A 4EELA 1YCHA 2O7SA 2H1OA 3MA0A 1NQUA 1Y8QA 3THOA 5E6UA 1IZ0A 1JBEA 1O8CA 1T9DA 3VC3A 5FORA 4LDPA 5CLGA 1XKTA 2IV3A 5ALSA 2BMEA 3N7UA 5JWRA 5KZMB 3LAWA 1NJ6A 2ZYSA 4GLFA 1EUCB 2VEOA 2FEOA 3FNBA 3PC2A 1J1IA 4Q12A 4LBZA 1OBFO 2H5IA 3OZXA 5D00A 1W7AA 1NXWA 1V3UA 3AM4A 1SUCA 2YZKA 2XHZA 2C3PA 4CG1A 3TZ6A 2E55A 3QH4A 1KVRA 5DRTA 4GBGA 4DUZB 2CZGA 1R4ZA 4AP5A 3WKBA 1DIOB 1E1MA 3HHPA 3LZ6A 4OHRA 1I01A 4J3JA 3WXMA 1ZHOA 3FTEA 4N7BA 3E5MA 4NS1A 2C59A 1JFVA 2Z95A 2FPIA 4P35A 3N58A 1XEXA 2RKBA 3RKSA 1M2JA 3DTYA 4B3HA 1XZEA 2WINI 4LZNA 2BEUB 4RQTA 3QK7A 2BEWB 3CLVA 3A31A 1XMXA 4NTZA 5ALTA 4ZXFA 3DE4X 3W0LB 2FR0A 2CUNA 4OJKA 5EFZA 3HO6A 3ADKA 2V5VA 2BFAA 1JR4A 4LQLA 3F96A 3BTSA 4RMGA 1QKJA 2H7YA 4LHXA 2ESRA 2YVUA 3CEPB 3TEMA 2A9FA 1VMAA 1TD1A 2AQKA 2HJHA 3A10A 3FR7A 7ADHA 4F4CA 1NASA 1FNSA 3ABRB 2V3CC 1ATIA 3A3PA 3PE3A 5CT5A 4MGYR 3M6IA 4KI7A 4PG4A 3I9V1 4U7HA 3WNBA 1Z36A 2OOKA 3L02A 4B3XA 2C57A 3PJDA 4BCCA 2OKCA 1E92A 4F92B 3KUKA 4DRZA 2DHDA 2RGNA 3KSAC 5IRCD 2H48A 2IBSA 1G9SA 1N2BA 4YP1A 3MJDA 1G5FA 4QBHA 5E2BA 4CLHA 1ACMA 3EFOB 5K3CA 3THXB 2CB0A 2HM7A 3R3WA 4TSRA 3TCNA 4HSGA 2A59A 3MCVA 5HCIA 3N39C 5JFOA 4IVPA 4BE7B 1AUXA 4FBMA 2NO7A 4GEGA 4IIJF 4JNCA 5KWVA 3I92A 1CY4A 5HZKA 1T2NA 2AYXA 3R7BA 1F5SA 2QMUA 2OV8A 3WK4A 3B9QA 3IMCA 1IBMB 4S05A 1ID1A 1H4QA 2R79A 5DMHA 1U28A 1ZMXA 5CTAA 3SHFA 2YKGA 2ZETA 2LZ0A 3EGVA 3KO8A 1W1UA 3SLRA 4IP0A 1U7UA 1ZN8A 2OGUA 5KB3A 3CKYA 3B78A 3LS2A 5BNFA 3OZBA 1NMSA 5CD9A 3I28A 2TRSB 4AB1A 3ICCA 3GHYA 4LXQA 1QH1A 5IT5A 4QU5A 4V0SA 5LD2C 2F62A 2ZI3A 5FF9A 2WSYB 1X0XA 1OBVA 5CRIA 5I01A 1Y8RB 2AF4C 3GARA 4Y2QA 3RVKA 5BO5A 3BIWA 1BXGB 2R4TA 3DZBA 3OLYA 4J2HA 5LOVF 1E0DA 4EB0A 1NF9A 1OOEA 1KP2A 4FFDA 4TLDA 3UMBA 3COPA 4J0IA 5JROA 3Q3JB 3KR9A 3RPEA 4AMVA 3ZVMA 1J0XO 1A9PA 3FUTA 3E1KA 3N70A 1H5QA 1LVGA 3TNDA 3KSBC 3B8EA 3DE1X 1N3BA 2GAFA 3OZFA 2O8FA 2XUOA 3SR4A 4PM4A 3EC7A 3LPNA 2IXFA 4JJIA 4FKZA 4XXHA 4ME6A 4YCDA 5AI8A 4LYDA 3AVTA 1L5KA 1ODLA 1UXOA 5DYTA 1MX9A 4B3BA 3UBTA 4L08A 4TZKA 1OB5A 4ARIA 1L8XA 4QNNA 3RWMB 3L7AA 4O2AA 3DKPA 3TIGA 3ZE2B 3FFWA 1DJOA 3OOSA 1SXPA 2O8FB 4NZMA 1NHGA 3TR6A 3ZJTA 3Q9NA 2WWGA 2DPGA 4ON9A 2DTDA 2QTNA 2ZXEA 2NM0A 3WGTA 1F8YA 1SQ6A 1QMPA 2EZ8A 1NBHA 5CM2Z 2YMPA 1W49A 1F2TA 3M6AA 3GJYA 5GGXA 2W6JD 4FHCA 1XVTA 4RSMA 3RYHA 3VUFA 4RTSA 4I3FA 2DU8A 4YR7A 2V7QA 3LWDA 5WRFA 5K3EA 1E7SA 2EFEB 4MVJD 4LRYA 2XTNA 3IQIX 1FFCA 4XE5A 3TL6A 5JU6A 3IJEB 3OQ1A 3TM5A 3TXXA 4OM8A 3RYHB 4U2FA 3EGXB 3PWSA 4YDSA 3JWGA 4UHHA 1OXKB 5ENVA 1GQOA 4DWOA 3G2PA 3EFHA 4IWNA 4TZ0A 4BC1A 1W2GA 1VXRA 1XHFA 2BFEB 2WP8J 3GCZA 4GXRA 4WFIA 2PZEA 4HQRA 3STWA 3N8IA 4UW9A 1V3VA 5AMXA 2NQ8A 4DMCA 5AICA 2XD9A 3KJFA 1FTNA 2WJYA 1IY2A 1RFGE 1T4GA 1ZK3A 3D0QA 2X0FA 4BV3A 3IAEA 3GJZA 1E62A 2O3RA 2DWUA 3AU8A 4ALMA 4AWAA 2PTHA 1D6JA 1YRYE 3KLMX 4INZA 3ZLBA 2JJQA 4NDZA 1N3YA 3FPFA 1DWOA 4QJ5A 1RC1A 5E0KB 3UIEA 3QXHA 4J8PA 1OFUX 1WXXA 4BN4A 3ADOA 5JVDF 4LI0A 4A0FA 1CTQA 2ZE5A 3BMQA 1EJBA 5G1NA 2PM8A 1QIIA 3FMPB 2FPGB 2ZJBA 1AT1A 2WD9A 1FL9A 4JP8A 3T9BA 4MUNA 4FE4A 2V7TA 2GEVA 3T3NA 1ZOSA 2GS9A 4HL6A 2QIOA 3A58B 1GN9A 1FFYA 2G70A 2IYSA 3R2JA 4G09A 3RDPA 2H5LA 1ZMRA 1K5GA 4FGSA 1NT2A 2JASA 5COBA 4Z9AA 5A6SB 1XZDA 4TYMA 3SYRA 1C7QA 2IWHA 4RXTA 3VR6A 4DMUB 4Y7CA 2HF2A 3ZU5A 3I0MA 3D81A 3KFLA 1E32A 4QQFA 3AFGA 1I5OA 2ZRFA 4HNHA 4OHKA 4PNZA 3AB3A 3O74A 3ZZ1A 4KXWA 3BM5A 1H66A 4I8DA 1FXWF 1XTRA 2CE7A 2XODA 1H3NA 1CSEE 4W82A 3UUEA 1AKMA 2ISCA 4IDBA 5T3UA 3LPMA 5TB5A 1IBKB 2Y2VA 2KS6A 1Q95A 3OZUA 3IQFA 1G3UA 3F2VA 2VHXA 5JQGA 3ZGZA 2OXTA 4E5DA 4FS3A 4N82A 1P4SA 5JO9A 3W9UA 3AH8A 1O87A 4EPYA 1K6IA 4PINA 4ZCLA 5AVZA 3RU7A 1WZUA 3KEQA 3I32A 4IS3A 1Z82A 3UAVA 3S8EA 3PA6A 2RJOA 3R09A 1R10A 4WBNF 2LCIA 2ZDHA 1X74A 4PZ0A 1M2VB 4ZV9A 4CFYA 4YAKA 2JW5A 3OPQA 4ZJZA 2D00A 1A7KA 1V48A 2BH9A 2O05A 1WA5A 2JC3A 3KWMA 3IEPA 1WPXA 3PDWA 2CXOA 4W8OA 2HT6A 1N2CB 4NHOA 5D3ZA 3ROXA 4DJJA 3TG8A 4BBZA 4MA4A 1NW7A 3EQ9A 2YXEA 3KBOA 5CJ2A 5IJXA 3DHVA 5CB0A 4RJLA 1SD5A 3LDAA 3R5HA 4POOA 1WW8A 2FX5A 3GEBA 3QW4B 3T4UA 3H2YA 4GXNA 3A1UA 3L2OB 5E4JA 1VMKA 5TQ0B 2X0RA 3C5WP 3I2YX 2YHIA 4FSHA 4BWVA 3AHIA 4B40A 1DEHA 6ADHA 1IXRC 3LDHA 4EBBA 1JE1A 1DKMA 2VYVA 2WG0A 4BQEA 3ETNA 4IJKA 4ZQFA 2I3BA 1IBLB 2QYHA 2WKWA 1HYEA 1N8TA 1T8WA 3H13A 4I5DA 1YR7A 4EG4A 4UAUA 1PQWA 1FBTA 4C6TB 5IBQA 1BA2A 1P1CA 2AFIB 5HJEA 4F56A 3EVEA 3I9KA 4DPKA 1XEAA 5BT9A 3ZBQA 5TPWA 3HUDA 1YVRA 1ONOA 1XR3A 4XPIB 5DHFA 2VO1A 2OQ2A 5TARA 4DIOA 1UPXA 2BFOA 2CDBA 3D54D 5JS2A 4ZAGA 3MF4A 4DZRA 5LZ9A 5EAIA 2NP6A 1F7UA 1MJNA 1H8HD 4J2TA 1IOZA 1Q7EA 1TT5B 1OJ7A 4G4SO 1EXMA 2QJFA 3T9AA 1PFGA 2CNOA 4QGBA 4U0JA 4LSWA 1X87A 1XEFA 4H15A 4PFKA 1LTKA 1W4CA 1CQIA 2YY6A 2R84A 3SJ7A 3GELA 3KOYA 1RI3A 3GVCA 4CV0A 1L7NA 3CONA 3PXCX 3FYTA 2VHYA 5BSHA 3A06A 4NDNE 5B4VA 1L4LA 3LU1A 1AIPA 3VO8A 3WO0A 5C35A 1V47A 3R40A 1IJEA 2HUPA 1A5TA 3AG5A 2W2VA 4LOLA 4OH1A 5F7XA 1Y6QA 3S55A 4HO1X 4F11A 1TJ3A 1N7JA 1C9MA 1E1QA 3JQPA 4ND4A 3U9TA 3HJHA 5E6RB 1Y1LA 2QL7A 4MUEA 3IS3A 4FQ5A 4R8VA 3RUDA 4KPUB 3G2QA 1DMRA 4D9MA 3BX1A 3V1YA 2IZ1A 1M74A 4TWZA 3DO6A 4YJ3B 1JKIA 4BLPA 4HDCA 1TLLA 3STUA 3LECA 1C1DA 2JLAA 2Q1UA 4Y6SA 4CN9A 2VJPA 2XEXA 4CL3A 1U98A 1I13A 1MX1A 3CZCA 4C05A 4AT1A 4BO7A 4E33A 2KLHA 3IPXA 4ARVA 2UZ3A 1L7EA 1Z6PA 1I6LA 4JT9A 3AWIA 4IMIB 2EKDA 2IYNA 3HJRA 3I83A 4W4TA 2HTFA 3U7QB 2JLZA 3KQNA 3CEMA 2O2GA 4K9SA 4UHEA 1WCIA 3RFXA 2GPSA 3BBPA 1NFQA 1IONA 4HLDA 3ELDA 3UXEA 1GPWB 1SUSA 1I6MA 2WWXA 1O96B 1B23P 2DFKB 3ND9A 1I2DA 1T8SA 5H9VA 2O2ZA 2VPPA 3ZTYA 5CA0A 2PLNA 2W6QA 3FMFA 3FYUA 1OPXA 3VHXA 2OWEA 2XNKA 1WU7A 4ER0A 2GCEA 5E7JA 4NU0A 2WYWA 3NDPA 1O77A 3I23A 2GF9A 2K7ZA 3L0IB 4TVBA 5AKEA 3UQYS 2FZ5A 3VPDA 1Y7PA 4BJHB 5CBKA 3ZG6A 4LSZA 4EJSA 3CN9A 2D1RA 3I39X 2PRSA 3I52A 5AKGA 2O54A 1RYDA 3VR6D 4H7JA 4HVAA 3QJGA 3PHIA 2RONA 4TMFA 1ELOA 2KBFA 5E1MA 1QE3A 3EGXA 2KYRA 3CGGA 2O06A 4BVFA 4C22A 3W8DA 2UZIR 1T10A 4OXYA 4H35A 1LXCA 5ALOA 1I3CA 1TD9A 2FWJA 2IXTA 2P5UA 3C7TA 1LZLA 4CTMA 4NXMB 4RZQA 1Y8RA 2CYBA 2DWCA 1F12A 4WW0A 5A9SA 2CL5A 3IMFA 3Q2OA 4DARA 1PKEA 4NOKA 3T5AA 3D3NA 2FEXA 4OF4A 1S4QA 2JH9A 1U3DA 1PR6A 2JGMA 2AD1A 1ENZA 3HYSA 1XDDA 1KFCB 2J30A 2XOKD 4P93A 4WERA 3VU9B 4WX2B 2FSFA 4DA0A 4H0NA 3L93A 3A9WA 5J4KA 4O3MA 3DDUA 5AM3A 3WLMA 4B7XA 4WEOA 4MUHA 1C14A 3CLTC 1GADO 1P9OA 5C3MA 1MZVA 1CS4C 1FBNA 3NIDB 3A0UA 3CJQA 4B7ZA 1ABBA 1DJMA 1NDHA 1GU7A 4R83A 3IILA 1R6XA 1AE1A 3PE4A 3GJ8A 4Q1DA 2X3UA 3N2EA 1VKZA 3LD9A 1VL6A 4G36A 4OGKA 2JCGA 4UUQA 3PL5A 5CVCA 1CY0A 4MWZA 3WL4A 5KHLB 4ZGBA 1DELA 1GPDG 3H9CA 3K73O 4IIYA 3U4CA 5HZMA 5K5EA 2UAGA 3KDPA 4QUGA 4ER5A 3P7MA 1IY1A 4EO9A 3ILHA 3GNSA 1NURA 3AFMA 3GOQA 2ONKA 3WB1A 4YXFA 2PNFA 4U3JA 2A4MA 3LA8A 2Q4OA 1GXSB 5DW0A 5J4LA 1LVHA 5KNDA 2WEKA 3H99A 3X2SA 4B2YA 1QLHA 4RIHA 1QHIA 4TUYA 1ZX1A 5DB4A 1KQPA 2NO9A 3FYHA 3P0HA 1C8BA 5CLLA 5K8IA 3ZDZB 1H9BA 3GYBA 4JQYA 3ZOZA 2DJ5A 4ZCMA 3PDCA 1HY3A 4LE2A 2C3OA 4X3PA 2B35A 2W6JA 1WMSA 3QTLA 4H9GA 3HCNA 3WRXA 4FIDA 4JXXA 3S1AB 5G4KB 3TJMA 3NI2A 6REQA 5LUAA 2I7VA 1XC7A 5EZ6B 5DYWA 5LB2A 1BFUA 3CX3A 2RAPA 2EJUA 4BO6A 2ZIWB 3PFGA 5E6RA 6Q21A 4TL7A 1C7FA 1GZSA 2XCUA 4BX3A 2QW0X 2F3QA 5LP6A 3CPJB 2NU9B 3VA7A 2B6NA 1EZ1A 1YI1A 3RASA 3WP0A 1RRCA 2QUIA 4CQLB 4BYMA 2W2KA 2B8JA 5DLQC 3W78A 3TLXA 3I5YA