4JSTA

Structure of clostridium thermocellum polynucleotide kinase bound to utp
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
171
structure length
171
Chain Sequence
SMKLTIPELSLVVLIGSSGSGKSTFAKKHFKPTEVISSDFCRGLMSDDENDQTVTGAAFDVLHYIVSKRLQLGKLTVVDATNVQESARKPLIEIAKDYHCFPVAVVFNLPEKVCQERNKNRTDRQVEEYVIRKHTQQMKKSIKGLQREGFRYVYILNSPEEVEEVVFERQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metallophosphoesterase
publication title Structural and biochemical analysis of the phosphate donor specificity of the polynucleotide kinase component of the bacterial pnkphen1 RNA repair system.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Transferase
total genus 64
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 2.7.1.78: Polynucleotide 5'-hydroxyl-kinase.
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jstA00
3VU9B 1R0WA 1KAOA 721PA 2FU5C 4H9GA 1S0UA 3CB4A 4V0KA 5FL7A 2CVFA 3KKMA 4LHWA 4RD4A 3RRYA 4OL0A 3HJNA 2A5JA 2VF8A 4LHYA 4GNKA 1RYFA 1E6CA 3V4FA 1T3SA 1ODFA 1I4LD 2JJ8A 4KFUA 1VPLA 3EWSA 4P31A 3DPUA 1DO0A 4KU4A 1G3MA 1Z0IA 1R8QA 5KNDA 3OIUA 4ZCMA 3T1QA 2FFAA 3BH7A 2ZS9A 1E2JA 1IXRC 3GLGE 2ZSAA 4FMCB 4P33A 1ZM4A 3KZ1E 2QPOA 2C9OA 3C16C 1FNMA 2JASA 221PA 1OLOA 2VYFA 2RH5A 3RWMB 3DEFA 4AC9A 5KPDA 3A37A 3CNNA 2WKRA 3U3RA 5JCPA 2OUKA 2PEYA 1AKEA 4JS0A 4HDOB 5K8UA 1JQJC 2IYTA 4AI6A 1OH7A 4DCSA 3AQ4A 3VHXA 2F43A 3A8TA 4XTCS 2GZDA 2O8CA 3MAAC 5GJCA 2Z0MA 1D6JA 5B30A 3EIEA 4WA7A 1P2TA 2J1LA 4IFBA 3MFYA 5FPKA 4FIDA 1EFUA 2RGGA 2GBLA 4TN1A 4LI0A 1P61B 4LHZA 3CNLA 3T12A 5K8LA 1U94A 1X8JA 3PUWA 2BV3A 4RJLA 2B8WA 2QE7D 4IEEA 4PQFA 2RGAA 3SS8A 3NEYA 2OFOA 4Q1AA 3MMPA 4A82A 1DAFA 2BKUA 3PVSA 3QXCA 3AF1A 2CCGA 5J4HA 5EP4A 5JSZA 3AF0A 1MH1A 2RGCA 5C1BA 1BYIA 1HV8A 3I62A 3THXB 2XGJA 3KFXA 3P4XA 5CJ2A 4Q48A 3THYB 2YWHA 3U44B 3AVXA 4B44A 1AIPA 1XCPA 2GK7A 4B2PA 2DHRA 3I8SA 1AM4D 2NG1A 3Q72A 4QJ3A 1BKDR 1UKYA 1CR2A 4M1MA 2KWIA 1Z07A 2IXFA 3IHLA 4Q03A 1XRJA 2HDNB 5JI3E 2RAPA 4Q1BA 5FUXA 2X2EA 1T5LA 2O8DB 4IOKA 1P6XA 2OCBA 2ZRBA 3BXZA 4NKRA 4CEJB 1BH2A 1OYYA 1NVVQ 2VO1A 2RHMA 5SZJA 3U4QB 1LFDB 2F1JA 2ORIA 5FBLB 2PJRA 4WZAE 1PUIA 2IHBA 4Q4AA 5CIWA 3LH5A 2O8FA 4PSKA 3GLFB 1NBME 3EZ6A 4B3DA 4D4LA 4O2LA 3TKLA 1F6BA 4JBYA 2C9YA 3FFAA 1GKUB 2AWOA 4AG6A 2GA8A 3SFZA 2QTFA 3NBXX 1UPTA 1QHHA 2OAP1 2XNDD 3AVQA 4PTLA 3OAAA 1AK2A 3ZQ6A 5KDDA 4HAYA 2YOFA 3UG6A 4LV5B 4DDWA 2O52A 4PXAA 4L5BA 2IYRA 3CO5A 2KI5A 3RS0A 2DFNA 1RE0A 4O3MA 3BAFA 3GLHE 2A30A 3L8YA 3LDAA 1MO6A 3IILA 4HZUB 3LA6A 3EPHA 4LSGA 1NN3A 4A6XA 3AVTA 3NBYC 2J7PD 3DHWC 2ZI5A 2ODBA 1WBBA 4EDHA 4E03A 5KUTA 2DWQA 4W9MC 1IM2A 1DAEA 5KNBA 1NSFA 3CX7A 1KO5A 3AF4A 4DDUA 2WWXA 3GFPA 3U3JA 1G5RA 3WMGA 4DXAA 5KYKA 3LBIA 4D81A 4R7ZA 5BN3A 4YDSA 1ZU5A 1ZYUA 2UZIR 5KU1A 5CYPA 4PO1A 3KFVA 3CRQA 3QG1A 3GJ5A 1TUIA 4DUGD 1ZBDA 1RJ9A 4M9ZA 1TU3A 3OEEA 1MKYA 2WTUA 4G01B 3NH9A 4GDFA 1OFHA 5EXPA 2DWOA 2VQSA 2F55A 2OV2A 3F8TA 1E79D 3NHAA 4GZMA 1CRPA 3I4LA 3CRRA 3UXMA 4NCJA 4Q19A 2P5SA 2ZJZA 1F2TB 5AUQA 1OB2A 3AP1A 5CLLA 4QC2A 5J4YA 5FTJA 3TRFA 2H8KA 1KJWA 4B34A 3JZAA 5FTNA 4D0GA 2IYZA 3EASA 3VNUA 1CF4A 1DE0A 2ZAMA 2WOOA 3R8FA 3KX2A 3KKOA 4UNPA 2QNRA 3CNOA 5HPYB 1ZU4A 4DSNA 1NLYA 4HUQA 4PX9A 2GCPA 1WB9A 1G7CA 4QHYA 1L8QA 5F2EA 1U8ZA 1W0KA 1NMYA 1G4UR 4BWYA 1W46A 2GCOA 4ZI2A 1YRBA 2VP0A 4HSEA 5DNYB 4L8GA 4LYHA 2ZRIA 1TNDA 2D74A 1W36C 2FFBA 2MSDB 3GLGA 1Q1QA 2CCJA 3EPLA 1YZTA 1E9EA 3NWJA 4PSVA 4TSFA 3LXXA 4Q02A 3VKWA 4GZLA 4HATA 3VTKA 1FMJA 1I4DD 2CJWA 3Q7QA 1P4SA 5CB6A 1EG7A 1N6RA 1HUQA 3IIKA 3LD9A 4JLOA 3FMPB 1X6VA 4OI4A 4Z51A 2IYLD 4Q1FA 4XIGS 1Q0UA 4A2PA 5JEDA 1CKEA 5JZVA 4RD2A 4KV9A 1Z0FA 1OHHA 4E09A 4IKEA 4MKHA 2V4ZA 4RCZA 2X1VA 2BOVA 2FSGA 3ZS8A 2F6RA 4US1R 2ZS7A 2VSFA 1KMHA 4M9SA 2G77B 1OKKA 1VIYA 4EFNA 5C4MA 1YR8A 2GXQA 1OXXK 1TUEA 4OKSA 3RS2A 1AS3A 3R9IA 2G1KA 2GKSA 3Q85A 1FOEB 1Z83A 3FDIA 4KYIB 3RRNA 4CEHA 2J0QA 1CEEA 2VP9A 4Z1MA 1J70A 4D0LB 1D2EA 1JAHA 3F5FA 4F7WA 3SE0A 1KI6A 1LVGA 3AH8A 4MGKR 2P67A 5BYJA 2CNWD 1XU4A 3CR7A 3B1WA 3L0PA 4V03A 4F4CA 4GPTA 2Q9BA 2OILA 3T34A 1GNPA 1KSHA 2AR7A 2BCJQ 3OZXA 4D2IA 4DLUA 5JEEA 1M74A 2IA5A 5EZ6B 2IXGA 3QXJA 4US0R 5KTYA 1FUUA 1WA5A 4EFLA 2ZEJA 2AXPA 1SKQA 2ZE6A 4X8MA 4ESHA 1DEKA 2OO7A 2ZR0A 3MRSA 4NMMA 3KXIA 4F38A 2ZROA 5HE8A 5HKKD 2I1VB 1Z22A 3LNCA 1SULA 1R0ZA 4QHTA 1FW6A 2F1HA 1T8TA 1Y63A 1KSGA 3VKHA 3GLFE 2XZPA 4Q7KA 1CU1A 1UKZA 2GJ9A 1KDPA 2BC9A 2ZJOA 3B1YA 1NBMA 4A9AA 1X1RA 4DLRA 1FQKA 5CM8B 3X2SA 2JLVA 4KFRA 4B35A 3A58B 1Z29A 3X1DA 2GJKA 2OT3B 3FFBA 5CITA 5D3MA 3PEWA 3HR8A 4MYTA 1WBDA 4MDEA 4O25A 2CLDX 5IK2D 5TV2A 4P4SA 5BN5A 5CDFA 3LQRA 2EWWA 2ZRFA 1OIWA 4QJ5A 5JHGB 4U7DA 4WOPA 3AKDA 1CRQA 1ZCAA 2CVHA 2JA1A 1F60A 1VHTA 2C78A 3GLHA 4MGYR 5KSZA 4AKGA 3TSWA 4QBHA 2ZUCA 1RZ3A 4GBMA 2W00A 1OYWA 3W8NA 2FZLA 1W47A 2FMXA 3C41J 3CZQA 2BEJA 4BECA 2FE4A 4TT3A 2PCJA 2PLRA 2X77A 2A9KA 2YWFA 4OJKA 4TLAA 1GILA 1OXUA 2B21A 1PZNA 2R6GA 2YOHA 3HDTA 3PITA 4P4TA 5A5GA 2G83A 1P5ZB 2XJ4A 5DI9A 3N70A 2B6HA 3CM0A 2AFHE 2QGNA 3IIJA 4NPHA 4Y0AA 1CJKC 1KDTA 2JIZD 3P4YA 4TZ6A 2D4HA 4ASUD 1GKIA 2OG2A 3VX3A 3K0CA 2ZYWX 4G5SA 2B92A 2FF7A 2PH1A 3MCAA 4CW7A 2WAXA 4HZIA 2OXRA 3NC1C 1E9AA 4IVQA 1Z0DA 1II8A 1V43A 2FFHA 3B78A 3I8XA 1DAMA 3DMDA 1KY3A 4FMBB 5FI0B 5C2JB 2CL0X 3KQUA 3FE2A 3R7WB 1XMIA 3PUVA 1EK0A 2OZEA 4BRWA 4A8JC 2IS4A 2YC2C 4GI7A 3LVQE 3VU9A 2ORVA 1AJEA 1FP7A 2YNMA 3CUEF 2BBWA 4DLSA 4Q18A 4DRZA 1QG2A 1UKEA 4KO8A 4DVGA 2J3EA 4IEIA 1XPRA 2R6AA 4PPFA 4DKXA 5KOYA 3ZZUA 3E5HA 4WZ6A 1ETUA 2JLXA 1QHYA 3TGPA 3B6EA 1R4AA 4LPSA 2YWGA 4AKHA 2A5GA 4Q00A 2XTMA 1L4YA 4KHZA 2GJSA 3KL4A 5E7IA 1UF9A 4EPVA 2BBOA 4KCGA 1IONA 2FFQA 2WMOB 3OF5A 1DARA 1OB5A 5EXSA 1E2EA 1VG9B 4TYPA 1OE0A 4EPRA 3OFND 1P7CA 4DHEA 4ABYA 1B23P 1N5IA 2XTZA 3H2YA 3H1TA 2DY1A 3QXHA 4LBVA 4PR0A 1AKYA 4JSTA 3VFDA 1J2JA 1AQYA 2O0KA 4B32A 3HU2A 1ZRHA 1EFHA 1Z0KA 3IEUA 1NVUQ 2N1BA 2F1IA 1N3BA 3DDCA 2O8BB 4C0HA 2Z4SA 4B76A 3A1UA 3WXMA 4GOJA 1MABB 3TUZC 2CLCX 4D80A 1X8LA 1IN5A 4PHTA 4LYJA 2YYZA 2DFKB 4S35A 3VR5A 3AF3A 4NE2A 2GHIA 3LLMA 1M7HA 3A4LA 5DI3B 3U7FB 5G40A 2FG5A 4BRUA 3O8RA 4DLZA 3SHFA 1DG1G 3MUFA 2EFCB 3A1VA 3EIHA 1YZLA 4LZZA 5DYIA 3T1OA 3PFIA 4GT1A 1OV4A 2ZE7A 3M4YA 5SZKB 2QG6A 5E95A 1NF3A 1E99A 5GJVC 3TW4A 1A82A 1Z6XA 4ZKEA 1KKMA 3THXA 1P2SA 4BUJA 3QIAA 1XPUA 3QKTA 1W48A 4QFMA 3THYA 5IT5A 2AK2A 4H1VA 4UNRA 1KO7A 3GEEA 3VX4A 1U9IA 2JLSA 4HB2A 2X8AA 2GK6A 2H7VA 3QOFA 1L2TA 3K0AA 2W0MA 2PLFA 1SVMA 1T8UA 1XXHB 5D3QA 3PEYA 2AFIE 2NMVA 1COWD 3VMFA 4PAMA 1UDWA 2O8DA 3HWSA 4RCYA 1IY0A 4CEJA 3IEVA 2IUTA 3AVOA 1QG4A 3A36A 3MWYW 3U4QA 3IO5A 5SZHB 3EXAA 4F4JA 4JVNA 1SHKA 4PSAA 4DC9A 3GLFA 2HT1A 4R2IA 1NY5A 4PHHA 3DZDA 2C5LA 1D9XA 4JL8A 4CDGA 3TAHA 5H1YA 2QSYA 4IVRA 2O0JA 5AJYA 1YR6A 1F2UA 2ANCA 5EE3A 3WRYC 5AJVB 4M9QA 2IYYA 1YQTA 4ZIRA 1E2DA 3CPJB 4GOXA 2H18A 3O8BA 1I2DA 5GADl 4KJZA 3TVTA 1DELA 1YHNA 4UNSA 1CJVC 1JBKA 3GEHA 1N5LA 5JBQA 1TTTA 1S2MA 2QA5A 3ZS9A 4ACAA 4QBGB 4HUTA 5EJEA 4NYIQ 3MJHA 1G21E 5FUWA 4GMDA 4A0HA 1E0KA 1R8SA 3CF6R 2OHFA 3E2IA 1QHGA 5KHOC 2PX0A 5GVRA 3QKUA 3ZGXA 3ZYCA 1QVRA 5BW8A 2ZRHA 1GVNB 4NP6A 2N42A 3EA0A 3REFA 3NC0C 3TAUA 4TQ9A 1YZUA 1KIMA 2HLDD 4G5RA 3VR6A 4JT2A 4DCUA 4HDQB 5J5CA 3K0FB 4LYFA 5DN6D 3T5GA 2QMHA 2ZRPA 5GJWC 3O47A 3S1AA 1HY3A 5A0FA 4EJSA 521PA 3KKNA 1FTSA 1MO4A 4A0GA 1GRRA 3RS4A 5EUMA 1DAHA 1W0JA 1ZUNB 1Z08A 1R7RA 1E2IA 3AVVA 5HE9A 2Z83A 2I1QA 1T91A 5EZ5A 1LB1B 2GEDA 3B7GA 3T5DA 1PLKA 4XWAA 1FL9A 4YQFA 1G17A 4LPKA 4JLMA 3W34A 4URYR 4DLVA 1F2TA 1N0UA 2VPPA 1CXZA 1RRGA 3KB2A 3SZRA 2ZJYA 1CR1A 4RD6A 1XDBA 4Q47A 5ANRB 2OAQ1 2WWWA 2OCYC 1MRNA 2R9VA 1GTVA 4EKDA 3BB4A 1M34E 2ZI7A 1YR7A 5EE9A 2DB3A 2IBMA 1JR6A 5FUYA 3BK7A 4M2LA 3U3OA 1YZQA 2GBLC 2IC5A 2NO9A 2QUZA 2ZU0C 5FOSA 2VA8A 2GF9A 2JDID 2R62A 2QL6A 3FYHA 5KNCA 1XJ0A 2R6CA 1IQPA 1M2OB 2AN9A 2IYUA 4NH0A 1TAGA 3M6AA 4BQSA 4LX0A 2V7QD 2CHVA 1CS4C 1DPFA 1DS6A 2XITA 3NG1A 4Q66C 5H70A 4ILEA 1GL9B 3T1TA 4AKEA 5TVKA 4M4SA 4DLTA 2NO1A 4NCIA 4ZO4A 4DB2A 1ZM7A 3BJIC 2GAAA 3NHBA 4C0AC 5FBWB 3NXSA 2QAGA 5EP3A 2JJ2A 3B85A 1W36B 3W6NA 1S8FA 2ZRNA 1XP8A 5JS7A 2XX3A 4DCTA 4BE7B 4FI3C 3R9XA 3FKSD 4YMWA 2QBYA 4TYNA 4LK2A 4BFWA 1XJQA 2Y8EA 4KBGA 2F9MA 5AJZA 5DISB 1E9CA 1XCMA 2JJ1D 2IW3A 2SHKA 1NN5A 4FINA 4LJAA 3UWOA 4YMVA 1WDTA 4FMCF 2ONKA 4Q7LA 1UBEA 4D26A 1NL3A 2GILA 4Z8XA 2RB4A 4B47A 2FPKA 3LX5A 2RGDA 4OHZA 2WSSD 2DPXA 1P3JA 3RC8A 1S96A 4GSYA 5CJPA 2GTPA 4ZDJA 3GJ3A 3KJHA 1US8A 2P6RA 1ZD8A 1W4AA 2GWHA 2C2HA 4JLJA 3KB1A 3UWKA 1NJGA 3Q7PA 3SEAA 2HXYA 2WPDD 4L4UA 2CHQA 5EXXA 3T15A 1RRFA 1G6OA 3NIBA 1A1VA 4GL2A 2XSZA 4ZCLA 4QBIA 3EC1A 4DT1A 2P2LA 1U90A 1B0UA 4G5QA 1SKYB 1W44A 2GNOA 2VP4A 3OEHA 1KI7A 3UPUA 1QVAA 1ZM2A 1KGDA 4BFSA 4BZPA 1ZW6A 2EQBA 4YDHB 2ZREA 3L0OA 1NIPA 2YJTD 4QM6A 1XXHE 3QF4B 3LAWA 3ND9A 5LPNA 4JKYA 2J87A 1KDOA 3HYRA 4YXWA 3FHTA 3QVUA 1PVOA 4XWOA 3CONA 3SJAA 2A5YB 4OHWA 2CHGA 3LVRE 1NG1A 4BLSA 4L9SA 4R2HA 1E0AA 3LW8A 2ZAOA 1Z06A 1A4RA 4NYMR 1KK2A 1XZPA 3PENA 1X3SA 1OH5A 3B2EA 4LJYA 2Q9AA 3EZ9A 1DO2A 2GEVA 3IPYA 4EQ6A 1TF5A 4LJ9A 2ZR9A 5FBVB 2HUPA 3L82B 1KKLA 4R98A 5CK4A 4ZDKA 1U8AA 1BYUA 2FA9A 2BEKA 1R0YA 1IN6A 4F93B 3ADBA 2EFGA 2IEYA 4MGZR 4CT4B 5DH9A 4X8OA 2EFDB 2LKDA 3CX6A 4LJ8A 2ZRDA 4XTRA 4WXPA 4KLNA 1ZM3A 2V7QA 1GWNA 1Q22A 1XTKA 2NZ8A 3R9WA 3CPHA 4B73A 3WP0A 4BFVA 3I32A 3MWKA 4JLKA 2ZM5A 2CXXA 4JLDA 3TVDA 4XD7A 2AK3A 2ZYVX 4B3CA 1YKSA 5JFGA 1N2CE 2PZGA 4IXMA 3WMEA 5K8TA 3U6KA 3T61A 2PL3A 2WJHA 4D6PA 4YMTA 2YOGA 3K09C 4PQRA 5KO2A 5J40A 4JVMA 2ZJ5A 3IIMA 2ATXA 3BE4A 2WBLC 4JLBA 3TLXA 3ZDQA 3PEVA 1ZCBA 4JKIA 3AP3A 3B1VA 3FHCB 1P9NA 3O8DA 3OIYA 2A5DA 4PAQA 1NVXQ 1XZQA 2ATVA 1C4OA 1U0LA 4LGMA 3TR0A 1L4UA 4U02A 2O8EB 3IQXA 1RC8A 2CE7A 3SHWA 4MGIR 4CVNA 3IQWA 4DSUA 1OPXA 2WSSA 1BMFD 4BZQA 1AS2A 1E4YA 2GESA 4OJQA 2BMFA 4BEJA 4FMDB 1JALA 4US2R 3PV0A 5JRZA 3EZFA 2ZPTX 2QMUA 2W6JD 3U7HB 2ZRLA 3W6OA 2JCSA 1J90A 2J0VA 821PA 2UZ3A 4WIAA 3Q5DA 1UDXA 1E3MA 3GEIA 4C4PA 5JMTA 1DVRA 1I4TD 5EE0A 5CDFE 3TUIC 4A8JB 4MRRA 1K6MA 2ZRMA 2QROA 1J7KA 2ERYA 2QSZA 3CF2A 1Q21A 3VR1A 1UBFA 2O5VA 3A4NA 4S2EA 4TMWA 1OT3A 2P6NA 4KI0A 1RW4A 2F3TA 3QSYA 5FPTA 1IN7A 1NMZA 3FPAA 4CT5A 1SVSA 1WE2A 5EUQB 1IN4A 1Z6GA 1RRPA 1SHZA 4PANA 5F98A 3F3YA 1DAIA 4B6FA 1WXQA 1KHTA 4KLZA 1E1RD 5M04A 3K53A 3P26A 2VBCA 3FKQA 4JVSB 1CJUC 4LHXA 4DLYA 4ON9A 2IK8A 1FMLA 4QXAA 3ONWA 1JXMA 2FZ4A 1II0A 1NLZA 1UBGA 3MSXA 4MKFA 2IYVA 1QF9A 3I61A 3QI2A 5HCIA 3G0HA 2GZHA 3FVQA 2QU8A 2WV9A 1XEFA 2I3BA 3GJ0A 2O8BA 2WJGA 2QT0A 2J41A 4M1SA 1H8ED 2ZJBA 2QE7A 1MABA 4QBFA 3PUZA 4KITB 3QY0A 5DSZA 2ZSBA 2Q6TA 2XOKD 1HYQA 1FTNA 1VG0B 1NI3A 4QGGA 2FPMA 4NHOA 3CBQA 3K9NA 1E2NA 4JJKA 1N0WA 3WYAA 3ZQJA 4PQYA 1UJ2A 2YKGA 3AVYA 4GP7A 3L8ZA 4KAXA 5L3SB 4FD2A 1R5NA 2IYXA 4TMTA 5AR1A 4NONA 3LW7A 3AGPA 2WHXA 4FXPA 4Z8YA 1W1WA 2E87A 1MO3A 3O8CA 4FN5A 3EIQA 4GOKA 2DWPA 1T3HA 1N5JA 1G8GA 4U5XA 3TNFA 2F9LA 1OIVA 1SKYE 1IY2A 1UAAA 5GJBA 4MKIA 4Q7JB 2C96A 4D25A 1E0JA 3EW9A 4M21A 4TLEA 3D31A 1K5DA 2KE5A 3AUYA 2R6DA 1XXHA 1P72A 4W5HA 1KZGB 2DCUA 4C0BA 2GJAA 1DAGA 2HCJB 4C3ZA 2V54A 1JR3D 4PZLA 3NDPA 2H5EA 3ASZA 4XVUA 3ECCA 3QEJA 4AYWA 2QQ0A 2KBEA 4RKEA 4Q21A 2XNDA 2EFEB 4CRWB 4EPTA 3BFVA 1X86B 1N6LA 4RZ3A 1KDRA 1Q1ZA 1GKYA 1NY6A 3BC1A 2ODNA 1CJMA 4PHGA 5AK0A 5FUVA 1LV7A 4LDJA 3SYKA 3PG5A 1W36D 4C7OB 2RMKA 4F91B 4YC7A 1FPMA 3AKCA 3SQXA 2H57A 4JYCA 4L16A 2P5TB 3D3QA 3IUYA 3KUCA 3U3KA 4HAWA 1ZUIA 3K0CC 2ZI9A 4TMKA 2Q9CA 5HZKA 1XB2A 4IRUB 2O0HA 2IX3A 4HLUC 5C46F 2J7PA 1CIPA 1KI3A 3QKSB 1SVOA 2ZVPX 4K81B 4MQBA 1IHUA 1ZD9A 4Q4HB 2J0UB 2Q0HA 2X19A 5AUOB 4II7A 4MKGA 4RD1A 3AV0B 1UFQA 1R5OA 1GITA 1SVLA 1VECA 3WYGA 3VKGA 4QOSA 1PLJA 2D3WA 1VG8A 4MA4A 3GJXC 3TQCA 4IDPA 4BLQA 1VDZA 2ZVQX 2WIBA 5FR2A 1HURA 3ADCA 1E2FA 4YLGA 3HR7A 4DUGA 5B64A 1N25A 3I1FA 2G0NA 2QMOA 1Q20A 1Q1BA 1G3RA 4QKQA 2ASEA 3K0FA 4YONB 2VH5R 3SN6A 2YZ2A 3CH4B 3H0KA 3EAQA 1EXMA 1E79A 1U81A 4WVFA 4DWJA 1AQUA 4WZBE 2FEOA 2CBZA 4KSBA 2H1LA 2ZE5A 4GFDA 5JS8A 2A3RA 4B43A 1EFRD 4N0DA 3AVWA 1A7JA 1MRSA 4M0LA 4ZDWA 3W5JA 4E5UA 1CULC 4MUAA 3DMNA 2IL1A 1M6NA 1O87A 2WIAA 4IDQA 3IDQA 4RZ2A 1HA3A 2Z4RA 1W49A 1IAQA 5B2ZA 4B33A 3E1SA 3BH0A 4G0NA 4LWZA 2V55B 1MO5A 3GMTA 3PXGA 4OI0A 1U2RA 2ZETA 4TLCA 2W2TA 2GDJA 2CK3D 3AKYA 4L15A 1KSFX 2BMEA 3QKRB 4OHXA 4NYJQ 2C8VA 2F43B 3R8CA 3GJ8A 1S3GA 2C98A 2FEMA 1JQLB 4JLPA 4HLCA 3SJBA 1AGRA 3WRXC 2NO0A 2GRJA 3OE7D 3W9YA 5EP2A 1R2QA 4C0LA 2HYDA 3B8HA 3NTUA 4RZUA 4WW0A 4TMZA 2RGNA 3RC3A 2AD1A 1J8MF 3NVAA 2NQ2C 2H92A 3KKQA 4HYYA 2VHCA 2ZRAA 4JVLA 2OFWA 3QPVA 1EESA 3FGNA 4YMSA 3AVUA 3EARA 3RANA 3P27A 2BHRA 1NVVR 2WSMA 5JSZB 1LY1A 1HTWA 1G6HA 1CJTC 3L2OB 2B8TA 2WKQA 1G4AE 2XNSA 1U99A 2C03A 3QPWA 4TZ0A 3QBTA 3SFVA 1U9IC 4ZI3A 1NVWQ 4TYQA 2B7BA 1R0XA 1TEVA 2V1XA 4NCHA 1G8HA 4N0EA 1WCV1 3IO3A 4B48A 2HYIC 5AUPB 5LD2C 4X8LA 2FSIA 2HEIA 3U2QA 4BFUA 1Z8FA 1RKBA 1XFAA 2CL7X 4UJ3A 1TQ4A 1Z28A 3PIRA 4C0JA 2YC4C 3RWOA 5E7MA 2IYQA 2CNWA 2NO6A 5EE5B 3X1XA 1A2BA 2OLJA 5JHHB 2ZJ8A 3ADKA 1AZSC 1NRJB 3TJZA 4XWKA 2C9CA 2OCPA 2VP5A 1KI8A 1GZSA 1FQJA 3CX8A 1DADA 2OCAA 2NO7A 3N5CA 4AWXA 2C77A 4Q9JA 5B58C 4V0OA 2XB2A 3W3ZB 4Q4JB 4AKIA 3D7MA 2O8FB 1SXJC 1TEXA 2BBSA 4MITA 4DDVA 3IGFA 4I81A 3TR5A 2FGKA 4RVCA 1HT2E 1R10A 1M7GA 1QRAA 3AUXA 1W4RA 3HP1A 1NJFA 5JCZA 1Q3HA 2DFLA 2Q21A 4C30A 4DBLC 4JL6A 1QHIA 2NIPA 5HKKA 3TE6A 1QHHB 1KK0A 3ZVRA 2OFXA 1H8HD 3PCRB 3WMFA 2GVDC 2XXAB 2ZITA 2QORA 5E4FA 2R44A 1ZNZA 2ZS8A 3C5HA 4TTRA 2JLRA 1EFCA 1T0HB 3KJIA 2KSQA 1GNRA 3QG5A 1ONBA 5B57C 1SXJD 2E1RA 3BFXA 1E98A 1JNYA 1VCIA 2ERXA 3P32A 4Q1DA 5JJIA 5J4VA 1P9RA 3QF7A 2QY9A 4LYAA 3KTAB 1PV4A 3PUYA 5EQTA 5KSYA 3CPEA 4HB4A 2FGJA 2VHQA 5IK2A 2ODEA 2QP9X 3EA5A 1OFTA 1P62B 3NBFA 1XMVA 1OXSC 3T06B 1EFTA 2QN6A 1VYUA 3NKVA 2HV8A 2WMNB 4PC2A 1E1QD 2JLQA 1WRBA 4EJSC 3B1XA 3SQWA 2RGXA 3B82A 4JSYA 1F48A 3DO6A 2C04A 4B3FX 1D2MA 2G9NA 3V9PA 3WNDA 4CIDA 2FOLA 2J45A 2W6ID 1RJ9B 3LY5A 3TUJC 5FTLA 3KQLA 4PHFA 4ZPXA 3X1WA 1ZJ6A 1IJEA 4IOJA 3PJRA 3WY9A 2D2FA 3ND8A 3SBDA 5TARA 2JIZA 4OQNA 5L8VA 1VMAA 3U44A 4ASUA 3KUDA 3K0EA 4C9BA 1SQ5A 2ANBA 5FBQB 1R5BA 3RNLA 4QNRA 1N6IA 2EYUA 2A78A 2JLUA 1JB1A 5FOXA 4QJ4A 2NOAA 4QM7A 1ZIPA 4HAZA 2JLWA 2L0XA 3DOFA 2R2AA 1JI0A 5TMPA 1GM5A 2O8EA 2BVNA 2OESA 2MSEB 4LHVA 4PPGA 1WP9A 2FWRA 5FPYA 5TY0A 1XNJA 3WHKA 1U8YA 4HUQB 1ZP6A 1Q3TA 5E3HA 1DOAA 3K8YA 1XWIA 1E2PA 4ZKDA 1Z2CA 4A4DA 5LBIA 3U5ZB 1QHNA 3RSLA 3V4RA 1KNQA 1X8KA 4C2UA 3P20A 1L7VC 1W5TA 5IRCD 2QAGC 2WWYA 4B3BA 3SC3A 3H86A 2ZRGA 4NZYA 4KVGA 4NCNA 3AM1A 4XSHA 1GAJA 4URVR 3GLGB 1SZPA 8OHMA 2BJVA 1ZM9A 3QE0A 2VHJA 4G5OA 1E9BA 1U0HC 4LJ6A 4AG5A 4BFZA 1TX4B 1GL7A 2CJWB 4DB4A 2ZTSA 1KO1A 1XD8A 3KXKA 2XB4A 4OYHA 3KDSE 2MMCA 1U0JA 3KJGA 4OK3A 1Z3IX 4AD8A 1G5TA 3OFNA 1T4GA 1Z6YA 2CLSA 4HZUA 2UVQA 4X8HA 3A1WA 3MJRA 5LB2A 3LBHA 2D7CA 4JT4A 3CR8A 2QEQA 4HAXA 2YVUA 4ESVA 1S3SA 4DZZA 1OIXA 1RFLA 4NCKA 3RVBA 2WM9B 2QI9C 3G5UA 1KI9A 4NTZA 1XCGB 3RRMA 1E2GA 2QP3A 5JI2E 4KFSA 1Z5ZA 5BQ5A 2Z6VA 5JRJA 4OQLA 4M9XA 3M0EA 2GJ8A 1P2VA 5G41A 4LY6A 2OBLA 1O3YA 4V0ME 2LKCA 5DE3A 5JWRA 2OLKA 1KI1A 3VAAA 4PFSA 1GRQA 1M7BA 2HF9A 4L9WA 5KDOA 1ZD1A 2QTVB 2WVJA 3TW8B 2PCLA 2VLIA 3GPLA 1Z63A 2BCGY 5FL7D 1OXVA 3BOSA 2EVWX 2D7DA 1LS1A 4C0SA 2WWIA 3UMFA 4EAQA 2JLZA 5F3WB 1N6HA 4LUCA 3QBVA 4UXJA 4B2IA 2FNAA 1KSJA 4R9UC 1XX6A 1G8FA 3GCGA 3H84A 2GZAA 5UKDA 1FX0B 5H68A 5BWMA 1G8YA 2BBTA 1P75A 3CH5A 2ZUDA 2ZJ2A 4UNQA 2YWEA 1PJRA 1Y3AA 1BOFA 3CZPA 4JZKA 2QPAA 3I5XA 1XTIA 2IS6A 1KMQA 3T35A 3ZD6A 2QT1A 1IJFA 4PC6A 2F3RA 1GOTA 4OI2A 1FFHA 3AGQA 2ODWA 4DLWA 2J59A 2FJUA 2ZRJA 1BO6A 1COWA 3I3SR 4PZYA 1A2KC 3IBYA 1YRAA 4CYMA 4EPXA 4URWR 3QPUA 5FR1A 3BWDD 2V9PA 5D3MB 4DCNA 4V02A 1EWQA 2V6JA 2XZOA 4IJMA 4PAOA 5A4JA 1DAKA 2IEZA 1NKSA 3BORA 1XEXB 1W4BA 3DM5A 4B6EA 4BFYA 1EX6A 2GEUA 2PMKA 4MH0R 4P3YA 4QGAA 2AL7A 3L0IB 5FPHA 2GETA 3GJ7A 2BM0A 4FWIB 1KOFA 3WBJA 4RZXA 2VF7A 2VHUA 4FCTA 4HB3A 2H17A 4YMUA 5AUNB 3LBNA 1JPNA 5ELXA 2GXAA 3RRZA 4P0TA 3ZJYA 3RAPR 2C99A 2OXCA 4C7OA 3H4MA 1XPOA 1G7SA 3I73A 1TADA 2VP6A 3VNVA 1KI4A 3GD7A 5CLQA 1NKTA 2CE2X 1NG9A 2FV8A 2RHDA 3DVLA 4Q5IA 4RY2A 5CB8A 4CEIB 4IOLA 2TMKA 1NMXA 4BLRA 5L3QB 4LBWA 2ZSFA 4Q9KA 5CIQA 4MYUA 3FMFA 4BFXA 4I99A 3FMOB 2J0SA 1G7RA 2AKYA 3KKPA 2J0UA 4AY2A 1G291 4QRHA 1N6NA 4IOMA 2ONJA 1JAIA 4M1OA 2HLDA 4KXFB 5C4GB 1HE8B 1JXOA 2KB0A 5DN6A 3I72A 1LF0A 4CGZA 1N6PA 1KJZA 1G9XA 621PA 4HLQB 1DG3A 2HXSA 2DFTA 1KI2A 2J7KA 2A7QA 4A6PA 4W7SA 4MRPA 5J4LA 4C2TA 2ZJAA 2VSOA 3GJ6A 2OBMA 3C14C 2ZI4A 1FUKA 3QUSA 4B75A 2MSCB 5F9FA 2Q3FA 3TSOA 1XTQA 4LV6A 1J99A 2GCNA 3Q5EA 2CL6X 3OAAD 4DSTA 3UKDA 2HCBA 2W58A 1TMKA 4GP6A 5DHAA 2YV5A 3K70C 1FZQA 4JMPA 1ZMXA 2OSBA 4TL6A 1Z6TA 4OHYA 2ZXUA 4AIIA 4UXHA 3SYLA 2IS2A 3W5IA 4A92A 2WJJA 1E2HA 1N5KA 1Q12A 4G3XA 1YVDA 1T9HA 2QTHA 2BIFA 2JDIA 4OQXA 4OQMA 2FPLA 3U61B 1D8TA 3KQNA 3MGCA 3EZ7A 4IVPA 2LCFA 1ELOA 3QKRA 2VHTA 3CIOA 1FNNA 2GXUA 2JEOA 1G1MA 2ZRCA 4FMDF 3K70D 1XMJA 3RHFA 1C9KA 3KQHA 3GLIB 2AXNA 2QRNA 4A36A 1EGAA 4AURA 1VIAA 1ZC4A 4TQUS 3B13B 2IF0A 3GJ4A 4OK5A 1XTRA 2D2EA 4UXIA 3JVVA 3FKSA 3VQTA 4CZ2A 2AKAB 1T0JB 4W5JA 1XD2B 2BKEA 3OEED 1P73A 2ZR7A 3EWAA 2QRZA 3ZZTA 2JJ1A 2GVZC 1KTVA 2FDCA 1IBRA 5FFMA 5FPSA 3VR2A 4BLTA 4PC1A 1D9ZA 3AKEA 1CTQA 4I1VA 121PA 1J8YF 1AZTA 1LTQA 3QENA 3WP1B 3ZVLA 4V0MA 3U7EB 3UANA 1W7AA 4GRAA 1M1YE 3FWYA 4TMVA 3MLEA 1AS0A 1ZIOA 4OBEA 2V6IA 1K8RA 1CP2A 4DLXA 4PZZA 2J5XA 3AEZA 3U6BA 3B9PA 3V00A 3SR0A 2KJQA 3B5JA 2F7SA 2WPDA 3TH5A 3X1YA 1JPJA 1NSTA 4DIDA 2VSXA 3LWNA 3K0AB 5LD2B 3R7WA 3GFTA 3K9GA 4UKDA 1YJ5A 1N6OA 4HI0E 1K5GA 4TMXA 4NDZA 1W0KD 2EW1A 3B60A 1TL7C 3K9HA 3W3AA 4KBFA 4Q4LA 5G53C 2QM7A 1WF3A 1XMSA 4NYIR 1AGPA 2PBRA 4Q4JA 4G1UC 3C15C 3C8UA 4TL9A 3JZMA 3UK6A 3FMIA 4TSFD 4TYWA 2GXSA 3C5CA 3CLVA 4QNMA 1A5TA 1ESNA 1QDEA 3RYTC 3JVUA 1JR3E 2EYQA 3DKPA 1SXJB 4K46A 4LJ7A 3ZZ0A 4RD0A 4MDFA 1II9A 4ZV4A 3SJZA 1F2UB 1JJVA 3P1JA 2CEAA 1E9SA 2XXAA 2ECKA 1Z6AA 1OH6A 1G16A 4ZIRB 5JJKA 1OHHD 2WWFA 1Q1EA 5HTKA 1Z2AA 3NDBB 3K0SA 1GSIA 4RKFA 3SU8A 2IF2A 1G3IA 2VP2A 1OFIA 3THOA 1S9DA 3GFOA 5G3ZA 1HEIA 5BN4A 1OKKD 1RIFA 3ADDA 1E4VA 4KSCA 2HJVA 2ZI3A 5J47A 1W5SA 3KTAA 5DHFA 2IYWA 1OW3B 3IKJA 4HDCA 1KK1A 2ZQ5A 5G3YA 2RKOA 4LBYA 5FOVA 2AWNA 3I92A 4B3XA 3W90A 4EPWA 4Z1MD 3DM9B 4BLPA 2EU8A 4JLAA 4WAUA 4RSGA 2FN4A 1SVIA 2PEZA 2QGZA 4D4JA 3Q9LA 3BB1A 4NL4H 5DI3A 1JEDA 4A1FA 4BASA 1E2KA 2ZYTX 3S1AB 4LBZA 2W83A 3SYNA 4XVRA 4EJSB 4DDTA 4ERNA 4C0KA 4D4KA 3SJCA 5EXTA 2D62A 3HU1A 3AP2A 1M8PA 4QGHA 2WKPA 1G18A 5AJWA 3ZIAD 4BPBA 2NPFA 4POAA 3CRW1 1GIAA 4DSOA 3EX7C 4PPNA 3N2EA 4JBXA 2FH5B 4UNNA 4XJXA 3CW2A 4F4IA 3Q3JB 1BMFA 3K09A 1PLLA 1VKJA 2PX3A 3D6TB 4A0RA 1U98A 2VTKA 4FWTA 4KODA 5AWFC 2WOJA 1NBMD 1SVWA 1T5IA 3LXRA 3M1IA 5DGXA 4TL8A 1XTSA 2W6JA 1G19A 2RGNC 4PPQA 1OH8A 4EUNA 3LFUA 3W8RA 3EPJA 4O2RA 2PZEA 2RCNA 3RSOA 3TIFA 4B2LA 1UADA 1UBCA 4ARZB 1W4CA 4UQOA 4Z54A 3BH6A 3OHMA 3KQKA 2QP4A 2QM8A 4OI1A 3UMRA 1TPZA 4FW9A 3I5YA 3ZVMA 4V0NA 1AA9A 2PJZA 421PA 1ZVQA 4JJZA 2QAGB 3TQFA 3REGA 3ICQB 3VHLB 1QHXA 3QXXA 3EC2A 3WNCA 1UKVY 3ZD7A 4V0LA 2XTNA 1G64A 4B74A 4JBWA 4LRWA 4TT3D 2QBYB 1I2MA 3THWB 2V8OA 3UG7A 5FL3A 2WJYA 2QMEA 3BGWA 4A2QA 1KYIA 2QENA 2ZYUX 1E1RA 3NH6A 4PC7A 5FOWA 2V3CC 4XOIA 3GLIE 3UIEA 4M1YA 3RABA 1XBTA 4QGFA 4IFEA 4MUBA 4IXNA 1T3LA 4RFSB 3TK1A 3PEUA 3WHLA 3CRVA 1SGWA 5FOTA 3F0TA 1WMSA 4LV8B 2DR3A 2N46A 1AN0A 4IDOA 1US8B 2XAUA 2W2XA 1KNXA 1H8EA 2PMDA 3DZ8A 2D06A 3CKLA 2NPIA 3QNUA 2XOKA 4M22A 3ZVNA 2RGBA 4D4MA 1N6KA 3L0SA 3WYFA 4I1OA 2NGRA 1NIJA 3K9LA 4DT1B 1IXSB 4M8NE 4JLNA 3ZLJA 4MYCA 4LC1A 2WWGA 1GRNA 3C4JA 2P3SA 4AK9A 2XJ9A 1VCMA 3DOEA 1E2LA 2Z5FA 3PUXA 4FCWA 2BMDA 2DYKA 5IF9A 5GVSA 1G8PA 2HF8A 4M53A 3ZIAA 3TBKA 3IBGA 1IN8A 1FX0A 4QL3A 5F9HA 1Q44A 2BJWA 2MMGA 1W2GA 4RFVA 4Q9HA 4MRVA 4Q1CA 3FTQA 4G5GA 4EQ6B 2O8CB 3OIWA 5FI1B 1YU9A 2KBFA 3RS7A 1OXTA 1IXZA 4FCVA 1SXJE 1E0SA 2R65A 4TWZA 3TMKA 2ZSDA 1VCOA 1ZAKA 2ZE8A 5AJXA 2GF0A 4K8OA 1JR3A 3DKVA 5IHPA 2EWVA 3C7KA 1WQ1R 2OBNA 4IHQA 3R20A 5KDLA 3A1TA 3G82C 3HYTA 1XF9A 1QHSA 1XEXA 1HT1E 4LJ4A 1TQ6A 2G0TA 1C1YA 1LF5A 1KO4A 2A5FA 4I4LA 2DBYA 4ITRC 4BLOA 4OHVA 2QAJA 4OK6A 1KY2A 3Q8XB 1YZNA 1VYVA 2VIIA 1HH4A 5C18A 2ZIAA 1SVKA 2Z43A 2ORWA 2YHSA 1ZNXA 1GFIA 2AHOA 5FH9A 3RLFA 1Z0AA 4DIEA 2R8RA 4O0MA 1ZNWA 1NN0A 1ZC3A 3B9QA 1ZINA 5J4KA 4CEIA 1HQYE 2VL7A 3K1JA 4Q01A 3FOZA 1FP6A 5L3QA 1Z47A 4P32A 4AYTA 4A0FA 2J9RA 1E9FA 1S1CA 2OM2A 2ZU6A 4DCVA 2CCKA 2QZ4A 1CLUA 4N3NA 5CYOA 1XEWX 3TSZA 5JWOA 4HLUA 5IDVA 2REXB 4Q4AB 2AD5A 1OF1A 1GNQA 1G7TA 4WXRA 4AYXA 2RGEA 1LNZA 1T6NA 3RS3A 3RDPA 5JECA 5HR5A 1KZ7B 2W2VA 1TF2A 4P4UA 1GP2A 4HLDA 4MRNA 3PQCA 3NBZC 2ZUBA 1IY1A 2OEPA 1EFRA 3QJYA 2OE2A 4ACBA 1H65A 3ICEA 2ZI6A 3CWQA 3QF4A 4KFTA 1MR3F 4Q1EA 2IUUA 1Z0JA 1D2NA 3WBKA 4LC0A 1MOZA 4PO8A 1DBSA 4DEXA 5CK5A 2QPTA 3PR1A 2WWHA 4TQAA 3HPRA 4F92B 1QBKC 1OJLA 1VCNA 2CK3A 3U3MA 1Q57A 6Q21A 5HCNA 1GG2A 4D82A 5FTMA 1V5WA 2IUSA 2WJIA 4Q9IA 2F1RA 3L43A 3K70B 1YZKA 2W0SA 1TQ2A 4ZDIA 3EG5A 3CF0A 2BMJA 3LQQA 4BEBA 2EFHB 3OE7A 3BERA 1TU4A 1G3QA 3SNHA 1RYHA 2G3YA 4NBSA 2UKDA 1QZXA 1TQDA 4WBSA 2FX3A 3GLIA 2REBA 4NYMQ 5HZHA 1CR0A 1CBUA 3KJEA 4IDHA 5KSPA 4D0NA 1HQCA 1XD2A 2CMKA 1E9DA 1W0JD 4I1SA 1E69A 1YZGA 1D5CA 3FB4A 3J81k 5JJLA 1HE1C 1VHLA 2NTYC 1OSNA 1YE8A 4PC3A 3SDZA 2I4IA 2P65A 2VEDA 4M1TA 4NU0A 2IWRA 4ZCIA 4KYUA 2JLYA 4HB0A 2HT6A 4UJ5A 5KPJA 1G5PA 2XZLA 4TYYA 5E7JA 1DTSA 3NEJA 4DJTA 5TXGA 3UATA 4TTQA 3LO5A 5LB4A 5EP1A 4GMXA 2G1JA 2G6BA 2REOA 1S1MA 2Q3MA 3BFKA 1E2QA 1F5NA 2GCOB 3HU3A 4I1UA 4IW3B 5TB5A 1RPZA 3VR3A 3MWJA 3B1ZA 4MYHA 4QG7A 2IHYA 3OIVA 3RS5A 2R6FA 1P9WA 3QQ5A 1JECA 4R71A 4QHSA 2FSFA 2Q3HA 4EPYA 1PUJA 4A15A 4JL5A 1X1SA 4A8JA 4RD3A 2BWJA 3KXLA 2PT5A 1H8HA 2BM1A 3BBPA 4HAUA 4TTPA 2ZSEA 3DL0A 4IDNA 2JJ2D 5H8WA 1E2MA 5CM9C 1NLFA 4JIMA 3X1ZA 3ASYA 3D8BA 4M1KA 1SXJA 4HEJA 1KMHB 4TLDA 2BDTA 2LWIA 2IT1A 4A2WA 1BIFA 3FHOA 4U00A 5FOUA 1VYTA 2NZJA 3UMSA 4BGDA 4CEHB 1YR9A 4URUR 1MT0A 3IHWA 3LV8A 2PZFA 3LLUA 5K8IA 2IS1A 1KI6B 4BZXA 4DEYA 2IXEA 3GQBA 3EZ2A 1NP6A 4N1AA 3U60B 4C0QC 1NN1A 1E1QA 1JJ7A 1XD9A 3ETLA 4XVQA 1GL6A 1ANKA 1KK3A 1GUAA 4HAVA 5FBRB 3SBEA 4XH9B 4TL7A 5EE1A 1R6BX 3LX8A 4B71A 5DLQC 2W6IA 2XEXA 3SOPA 2QQEA 1RVDA 2FSHA 2WZQA 2XSZD 1E9RA 5BXQC 3A4MA 2G88A 1ZUHA 4NYJR 4URXR 5FTKA 4LOAA 4JYBA 1N0VC 3A1SA 3BB3A 5L3SA 1UEIA 2AX4A 2H16A 1E94E 2WAYA 3QEOA 1E32A 5LDDC 3OEHD 3AB3A 1XJCA 1UEJA 3CWZA 4B3GA 1E96A 3OESA 3BRWD 4H1UA 4TLBA 3E70C 1S9HA 4KVAA 4Q7MB 3HPQA 5TDHA 1JEEA 2ZRKA 4YXWD 1ESMA 3T1VA 3W6PA 2P6UA 1TF7A 2CDNA 4Y0VA 1GDDA 1W2HA 2A2ZA 3BD9A 1LW7A 1EWRA 3U7GA 3IPXA 1EX7A 1NNEA 4CF7A 2ZANA 4BFTA 2X2FA 3MWLA 4P4SB 5L3VA 1F3OA 1XTJA 2JAQA 3ZH9B 2WICA 5JLJA 2GAOA 1VTKA 2K5UA 1KAGA 3QXSA 2V1UA 2C95A 2WJVA 2B7CA 3GLHB 1P60A 1BS1A 4JLVA 3WNBA 4ARZA 1UM8A 3EPKA 4W5WA 4MRSA 3BIFA 1LS6A 5JWHA 2HJGA 5DIFA 3AVPA 4Q9LA 3AF2A 1P2UA 2IWHA 1OFUX 4XSGA 3MG9A 4LJ5A 4J0QA 4XD7D 4OQFA 2J46A 5BYKA 4PO9A 1VG1A 3QVVA 4E07A 1CR4A 5KSOA 2VRWA 3BS4A 3SI7A 1IOZA 1MV5A 1G41A 2PT7A 3QKSA 3THWA 3MD0A 4LCBA 5DYGA 1KO8A 4Q4HA 2YINC 3GP8A 4M1WA 3CRMA 2JGNA 3LRPA 2IYSA 4EIWA 2JATA 1RRCA 1G3UA 4URZR 3N2IA 4EFMA 5L3RA 4E22A 1II8B 4RFSA 3VR4A 5P21A 5DO9A 2P0EA 3A6PC 1KJYA 5SZIA 1ZNYA 1S4QA 1G20E 1XEWY 2E9SA
chains in the Genus database with same CATH superfamily
1H6AA 1GJRA 2B5OA 4RIHA 3RTCA 2QQFA 2X4LA 1GD1O 3V7WA 4RL4A 2FU5C 4H9GA 721PA 5FYDA 2WJPA 3NANA 3OM0A 3TBFA 5JR3A 3KQNA 4R2KA 3AB7A 5HQ3B 5FL7A 4NBTA 4H7HA 1NJ5A 1YL6A 3RRYA 4C4YA 2VF8A 3U9TA 3NHJA 1RYFA 2I6GA 2ZT5A 5AO9A 1RI1A 4F5YA 1I8TA 1T3SA 4MW7A 1IRIA 3ACCA 3NWOA 1VPLA 3EWSA 2B8EA 3GB9A 1E6EA 3V4FA 3PNOA 4P31A 1ECJA 1DO0A 3FGOA 3AHFA 2TSYB 1QFSA 1Z0IA 3A9TA 2F3SA 4RM3A 4AZTA 1JXAA 3T1QA 2FFAA 2K6GA 2X2OA 1V37A 4QLAA 5DTQA 3WGQA 4KH0A 2D1FA 5JDCA 2FEAA 4AZWA 2YVLA 5JS8A 3C16C 3I5UA 4KZPA 4R84A 2VYFA 1NXXA 2RH5A 3PL1A 3NTQA 1RJWA 5C51B 3MERA 3O4FA 5F3DA 1NPTO 3RWMB 1DNPA 1FP4A 5AKZA 2OECA 4JS0A 5K8UA 1ATZA 1LBTA 4LOIA 4AI6A 5AKYA 4F0JA 3G13A 1VRWA 5I48A 2O8CA 2Z0MA 1D6JA 3QQPA 4WA7A 5B30A 4R2MA 1ZJZA 2Z8XA 3KSMA 3MFYA 2HF7A 3KO8A 5B58T 5TQJA 2QMQA 5FPKA 3E82A 3B38A 4QXPA 1DOZA 2HRBA 3S3TA 1LJ8A 3U4DA 2Y0CA 4D57A 3F9RA 4E7OA 2LPMA 1P61B 1RQRA 1SIUA 1YQGA 3DLTA 4L4ZA 4LHZA 3T12A 4EABA 4ATNA 3E8SA 4EB6B 3HSSA 2QF7A 1VKNA 2WAOA 4NZMA 1QOPB 2ZIEA 3LQ1A 3N3AC 2QE7D 3UC9A 2MOKA 2RHTA 4IEEA 3RSSA 3NEYA 1I3LA 1YXMA 3B6MA 4NVRA 4P7FA 2CCGA 5JSZA 1YOBA 4MA5A 3OFJA 5EP4A 1P39A 1YRWA 1Z8HA 2HQ1A 2JI6A 3AHCA 4JZYA 3U40A 4CLRA 4YP7A 4YCCA 5LU8A 1GR0A 5I47A 5FA8A 2EHJA 3HKEB 5HSGA 2XGJA 5JCOA 1G21A 1KFCB 1R74A 3SXPA 1HDCA 4N6OA 5H4HA 1I6WA 3I01A 1FNDA 5G0WA 1A96A 1GRVA 4LRTB 4FC6A 3WI7A 1JTVA 1U3CA 2YV2A 1AM4D 5FJIA 3Q72A 4ZRNA 4NJEB 4AO6A 4E0BA 2WF8A 2VDVE 2KWIA 1Z07A 2R7MA 2RHCA 3DOIA 1V8DA 3P71T 1XRJA 3K0BA 4L27A 1LNSA 2XD4A 2RAPA 4Q1BA 2HZBA 3RWBA 2VJMB 1T5LA 3DV9A 2Y27A 4D96A 4EY8A 1RLUA 3JYLA 3LM8A 1P6XA 2FFJA 2OCBA 3BXZA 3HXLA 4IOKA 4NKRA 5EKDA 4F4FA 1BH2A 1N32B 1Q77A 5SZJA 4UBKA 2F1JA 2GX6A 5L3QB 5FBLB 4BVEA 1USGA 5CIWA 2IHBA 1BXZA 5DGCA 2O8FA 4LYDA 3A31A 4HADA 4XPZA 4FB4A 5JD6A 4DABA 4R2XA 4P54A 1CQJB 1C8LA 2PGNA 4JBYA 4LGCA 4Y6PA 1E5QA 2C9YA 3FFAA 3O3OB 2AWOA 3ZDXB 2XRMA 2GA8A 2HMYB 4G0OA 3GVCA 1YS9A 1GGVA 3AETB 3C6ZA 5AXAA 4AS2A 6REQB 2WG2A 4PTLA 5C34B 1F1BA 4MW4A 4FGKA 1IZ7A 1YKFA 2XDQB 4YI3A 1QBGA 3OZCA 3V33A 4L74A 1G9TA 2EIHA 1KH3A 3PZRA 5C0OE 1R0CA 3OQOA 1V3TA 3K1AA 4LF5B 5L6LB 3A4YA 1N0IA 1B4DA 4D45A 2BZ1A 2Y6VA 3KT0A 3IILA 1U28A 1NUHA 3LUAA 1LDNA 3LA6A 4HZUB 4BNKA 1ZVVA 3EPHA 4A6XA 3AVTA 2PL9A 3NBYC 2VP3A 4RF3A 1M3SA 3DHWC 3VVMA 2CDCA 2AZ4A 2EDAA 3BL6A 4YRJA 5J2TA 4KUEA 2DWQA 5ESRA 4PBSA 2CMFA 2XA2A 4LOJA 4F6RA 1NSFA 3F6CA 4G4IA 5EJGA 2ST1A 3AF4A 3H75A 2PUBA 4DDUA 3U3JA 1PDWA 3WMGA 1R6AA 5LR6A 2XF8A 4LQCA 1P19A 2X4DA 4BMCA 3D3WA 3LRTA 4N03A 2JJYA 3EGOA 3KFVA 1UOOA 3CRQA 3QG1A 1JJFA 4HFMA 1TUIA 5HIJA 4DUGD 4U7GA 4KNYA 2YHIB 5CR9A 3OEEA 2CF5A 2X5OA 3MBOA 1DHRA 1PL8A 1XTUA 2DWOA 3GUYA 4D99A 2ZBUA 1O08A 4NK5A 4PLWA 3N07A 4NG5A 3PQ8A 3KJQA 3I4LA 3LKVA 4P84A 3J81A 4CTJA 3AESA 2CW5A 1LTKA 3VYRB 4IJQA 4NCJA 2C31A 2P5SA 5HFAA 1WBJB 2QX7A 1F2TB 2J6BA 5HQJA 2WZCA 2WFMA 1N8KA 2TMGA 4OG2A 1VA4A 4R31A 3G2HA 5K0EA 1SOMA 5J4YA 4X92A 2FN7A 3BICA 3GLSA 5EMJA 5ITWA 4RA6B 1R6XA 4OSOA 5FTNA 4D0GA 1YTLA 2IYZA 3EASA 3V7UA 3DTYA 3LXMA 3VNUA 1MF7A 1UP4A 2ZAMA 1SUPA 4LJKA 1XYGA 5C8YB 5IS2A 1QK4A 3JS5A 2IUEA 4NOLA 3UK7A 5IKPA 1SCNE 1O97D 4E12A 1SKAA 1MLDA 3ILYA 5I3ZA 2F62A 3E22A 3S68A 1AOXA 2YFKA 3HJTA 4QHYA 1AMUA 1PJTA 1W0KA 5AOAA 4FLFA 5B12A 1PX2A 2W8ZA 5BSFA 1Z12A 1S2GA 1NXWA 1TD9A 4RHUA 3PNYA 1RCTE 2MYTA 2YQ4A 4LYHA 1HFKA 2ZRIA 3AX6A 4MUYA 5ETJA 2C8LA 3RKUA 1JEYB 5AHKA 2LTAA 1C5KA 3NWJA 5CXUA 4NR0A 4QYSA 4JUCA 3TKYA 3JQQA 3VKWA 2IU0A 3VTKA 2IHUA 2EKBA 3E53A 1EG7A 3AINA 1HUQA 1Y8RA 3LD9A 4JLOA 3FMPB 4OI4A 4MPRA 3V2IA 1C2TA 3S8EA 4H31A 5JZVA 3W2FA 4RMGA 1SR8A 3D8SA 2FWMX 5KNDH 4X62B 4E09A 3DZGA 2VWHA 4G0YA 1ZD5A 2H4JA 1ETHA 2PYIA 2GH1A 2DJIA 3H2GA 3NHUA 5G2OA 1EXVA 5ALHA 4EB0A 2J6CA 2Z8ZA 3ORHA 2R2GA 2CD7A 3IC5A 3K9QO 3ZHXA 5C4MA 1VIYA 5AKHA 1RTTA 2H4HA 2R00A 2YUIA 2WSIA 4OKSA 3JXEA 3ZY3A 4BQQA 2EARA 1XMXA 4CUJA 3IPLA 4KYIB 2B0CA 2FWAA 3R9KA 1VPWA 2Y92A 1XCBA 3OUTA 2QOEA 1J70A 1VI6A 3A6LA 5EMKA 1D2EA 3WLTA 5CFPA 2ZATA 4P34A 3TZCA 2ZOSA 1H9BA 4RPHA 3BQ9A 3DE6X 2E4AA 2CNWD 1XU4A 1JQDA 1RFGE 4A7PA 4N41A 3ID6C 2Q4TA 3CR7A 3WWOA 1NBAA 3EBOA 3R77A 1KDVA 4O0LA 2P11A 4V03A 5JQGA 4ZEWA 5KQGA 2Q9BA 1AGYA 2JRCA 4AJ4A 5CGZA 1KSHA 2AR7A 5BSWA 3UFBA 1WB4A 3P2YA 1M74A 3MT8A 2NZXA 3UWPA 2DULA 3PNBA 1SQ6A 5HRAA 2ZEJA 1XLVA 2D4AA 2ZJ3A 2AXPA 2ZE6A 4QSMA 3I8OA 4EVSA 4N8SA 2OO7A 4NF2A 1Z4PX 1WXHA 2ZR0A 3EEFA 3MRSA 5DGDA 4C29A 4E08A 1JLLB 1NW5A 4G5FA 5HE8A 3TCXB 4KL8S 3ISJA 1FRNA 1FW6A 1Z22A 5JANA 1SULA 1SQGA 3VSDA 2FWNA 4OHUA 1U3GA 4Y8VA 3VKHA 3ZBPA 3GZNA 2GHRA 5G0TA 1UKZA 4ZOQI 2GJ9A 1KDPA 1OWNA 3M2PA 3FUWA 3OD1A 2QVYX 1X1RA 3IVXA 4KP7A 1FQKA 5REQB 4PX2A 4GKVA 4Y67A 5JSYA 3A58B 2GJKA 2EKPA 2GN8A 1VL2A 3ZHYA 4ENWA 5BUSA 2WP0A 2Z30A 4ZZ1A 1K9VF 1XKXA 2W2OA 1KOGA 4FKMA 3PEWA 2X9GA 2JIMA 3HFJA 4QUJA 2IKSA 4R51A 4OAPA 4MDEA 5IK2D 2BGMA 3L07A 3K15A 4GLLA 2L18A 2IDZA 4MQEA 1YE5A 4O6VA 3KKEA 4P4SA 4I3HA 4Y9TA 1OLXB 3LQRA 3P0FA 2FRDA 3UWKA 5BVGB 2XY4A 5M29A 5KHLB 4U7DA 3T1NA 3PWZA 2ZBVA 3Q2IA 2Q28A 4NH4A 4PSCA 3HVIA 1F60A 4R0VA 5B1SA 1VHTA 1RZRA 1FJXA 4AKGA 3HZRA 2OXEA 4YECA 1EIZA 1S7GA 1WIWA 4GBMA 4D3DA 1MD9A 3W8NA 4C7VA 2KW5A 2B83A 4GDMA 2UVPB 2FPSA 5DYTA 1MQ9A 4GQBA 4K9PA 2YWFA 3B3FA 4TLAA 5EESA 2B21A 2NSDA 3KU1A 2R4QA 3D0RA 4I50B 4P4TA 1KQPA 1P5ZB 1FK8A 1O54A 3CM0A 3N70A 1RRMA 2QGNA 2GSDA 4G9BA 4Z99A 4HV4A 2UUCB 3L41A 2C3UA 3DBHB 1L4BA 3P4YA 4D9MA 4TZ6A 3U48A 5JPIA 4MLZA 2D4HA 1GKIA 3FPKA 4L4XA 3SY8A 4ND4A 3S2ZA 1ZUD1 2IY8A 2N47A 2QU7A 1TT5B 1V5EA 2PWYA 4NECA 1B26A 3HUUA 2PH1A 2I2FA 2Y1LA 2FEXA 3B89A 1VP9A 1EJBA 3QI7A 1T0IA 3FFWA 2AJ8A 5SYMA 5JAPA 3CVXA 5L3ZA 2Q2OA 4IVQA 1YFKA 1PK8A 1GPKA 2ECFA 1CUSA 3CKKA 4B85A 4V1CB 5EIEA 3UNXA 5K8CA 2G06A 5BNIA 3B78A 3I8XA 3IT0A 3DMDA 4YAJA 3KQUA 1JMKC 2CL0X 1J5XA 5HS6A 3V3KA 1XMIA 2H5LA 1EK0A 1WCIB 2OZEA 1QYIA 3JQBA 3K70B 3FYUA 4GI7A 3SMQA 5JS6A 2ORVA 4O1MA 3F73A 4BTVA 1OD6A 4X93A 1CNMA 2BBWA 1W5EA 1HG0A 3NIFB 1QG2A 3W1VA 4CQMB 4DRZA 4KO8A 1DV1A 1M34B 1MC5A 1Q14A 1U3TA 4PPFA 1XPRA 2B8NA 3ZZUA 3A7DA 5IVHA 4ZVPA 3ENZA 2FI1A 3D0QA 3B6EA 2AIRA 3BG5A 3D4NA 4D8TA 1AKRA 1L4YA 1N2JA 3KCQA 2GJSA 3KL4A 4KHZA 4MDHA 3COZA 4I2NA 5CFZA 3T1HB 1R3DA 4WUVA 5A5VA 3CLHA 3TZLA 4DV0B 1F51E 4CQLB 5CG2A 1UC8A 1E2EA 4RWZA 4UM8B 3WJ7A 3OFND 1P7CA 4DHEA 3Q88A 4ABYA 1X42A 5TEVA 1OUMA 3H1TA 3QXHA 4LBVA 3ZCPA 2ZVJA 1VMDA 4GE0A 2ZZNA 4MW9A 1AQYA 2HO4A 2O0KA 4DJEC 4BE4A 2AI2A 1Z0KA 1ST3A 2XYHA 4JN6B 5D8DA 4MULA 3DA8A 3K5HA 4C0HA 1VE3A 3A1UA 4UDNA 4AP5A 4DR1B 2FR1A 2CLCX 1L8LA 4D80A 2A9RA 1D0IA 5IH3A 3NFYA 1VMKA 3UT6A 4JELA 1MAUA 1ULAA 4K0KB 3CX4A 5EIAA 5E4JA 3VR5A 4NE2A 4RMHA 3SVZA 4ZU3A 4CMEC 4WK2B 4DIFA 2P69A 2GAIA 4OQDA 4EYOA 1NYTA 4RHYA 4BVLA 2H2WA 4DLZA 1HDIA 2DG2A 2VLBA 5CD9A 2EFCB 3JATA 3IOCA 3EIHA 5G4LA 3ROKA 4X65B 3I9FA 4KXMA 1RPNA 1H4TA 4GT1A 3ONNA 3TFQA 1P4AA 2XTAA 1J7JA 1I4EB 3GOQA 3MBIA 3M4YA 4IL5A 4PBRA 1YH3A 4XARA 5SZKB 5T4FA 1PTJC 3AZQA 3SSNA 1COZA 5JAIA 2JFWA 1Z6XA 2VS1A 3TW4A 3PTAA 3THXA 3Q9UA 4Y6GB 4BDSA 4ARVA 1ZG3A 1ZJJA 5GOTA 4ALNA 2AK2A 1MAWA 2A33A 4UNRA 4QATA 4ZO6A 2DT5A 4UNIA 2LNDA 3EF3A 2PRKA 1E2UA 3FCYA 4JD5A 1CZUA 1MOPA 2IHTA 2SBTA 1SN7A 2KLHA 3VO1A 5KVSA 2DUMA 1RMTA 4HB2A 4BKPA 3AR2A 2QTMA 3QOFA 4KR6A 2PFKA 1L2TA 4RV9A 5E6UB 3UK0A 1T8UA 3F2VA 1P2FA 2AFIE 2FDRA 4WLNA 4ENPA 2W6ZA 3NW9A 2O8DA 3HWSA 3KLBA 1PR3A 3KOWA 3OM8A 4KDEA 3IEVA 1VJ1A 3QTLA 2V98A 1I5EA 1FFSA 2IUTA 3AVOA 5NLLA 3RTDA 4E5VA 1GN8A 2VZLA 2R4UA 3R7FA 4BBAA 4ILKA 1X87A 4EGSA 4XVCA 5K0BA 5SZHB 1W88B 2G0AA 1SHKA 4PSAA 2ENUA 5ALJA 2XVZA 4L3VA 4LZWA 4MPTA 3FNIA 1NY5A 2HHLA 4II2A 3C43A 1WU7A 1K7YA 2X6QA 4JL8A 1D9XA 2QG9A 5SYNA 4DAOA 4CDGA 5AKXA 3NGXA 2G9ZA 4UAJA 4OIFA 1PHRA 1WAMA 3WRYC 3V97A 2BFMA 4M9QA 3JTMA 1QO0D 1V9SA 3AHEA 3BA6A 4ZGGA 4ZIRA 1AD2A 1ABFA 2EJBA 1SHJA 4GOXA 1F6DA 4KIWA 1DXYA 5K3CA 4ALMA 5GADl 1L7PA 3TVTA 1X7ZB 5BWLA 1YHNA 2XVAA 3RO7A 4B0PA 3C3KA 1TTTA 4MPDA 4D0SA 4U7JA 5DM0A 4D9EA 5E6RA 2KMLA 3MJHA 3UKJA 5FUWA 3F97A 3G2OA 1X0VA 1ZKMA 2OHFA 1QHGA 2YVKA 5A6VA 5KHOC 3G85A 3ZGXA 2A3NA 4KJXA 3AHDA 1QVRA 2PNJA 1EDEA 3WWYA 5C37A 3I6ZA 4NP6A 3KPVA 1QYCA 5EJMA 3RT1A 3NC0C 4WLVA 1X0XA 4GYJA 4TQ9A 3TAUA 3LZDA 5IZ4A 4I1YA 1R9NA 2WUGA 4G5RA 4XDGA 3S29A 3VR6A 1GPMA 2R47A 2VNKA 4DCUA 2O6HA 4GE3A 4JP1A 5J5CA 2QDKA 5BP7A 5FEUA 4GLFA 3UAGA 4L2IB 3O47A 4OQ4A 4QVGA 3RAFC 2Y1KA 3S1AA 3DAPA 1L8AA 3LC1O 1LGYA 3JZFA 3N28A 3NDIA 4OBXA 4UREA 1Z4JA 5F7JA 5AW2A 5INTA 1TFUA 3K9FC 1S2IA 2AG5A 4A0GA 4RV4A 1WLYA 2R8ZA 1VGVA 4GO1A 3HZHA 4GC9A 4YAFA 1DAHA 1ZUNB 2PXAA 1K9SA 2PKWA 5IYZF 4A23A 2WUVA 3LQYA 3O2JA 1WEHA 3PXCX 2Z83A 2I1QA 2C3PA 1V1MB 2PMEA 1M2WA 1TUGA 3SQLA 1PLKA 2DFVA 4M76B 1IBSA 4FM9A 2RBKA 3R3YA 3GVHA 4RE6A 5D2CA 2ODQA 4PNEA 1TJPB 4DLVA 3PX2A 5EKXA 3WGYA 5LVAA 4FTWA 5H9WA 4BTLA 4UHKA 1V45E 3A6HA 1C80A 1P5HA 1J06A 1XDBA 3KQSA 3HN7A 3O75A 1K88A 1RPJA 3EVFA 4B6PA 4BNWA 3Q15C 3L8HA 1MRNA 4O4IB 4EKDA 3RAGA 1QMPA 1YR7A 5CT9A 1A9XA 5AVKA 3IMCA 5FOSA 2NVWA 2QUZA 2ZU0C 4BU1A 2O2CA 2VA8A 3IERA 3IT2A 3NKLA 1M6VB 1LH0A 1C9MA 1OGJA 2EX1A 2R62A 3ZEIA 2QL6A 5KNCA 3U7IA 2V96A 4G63A 1UZMA 2IVZA 2R6CA 4NRDA 3QK7A 1M73E 3VZRA 1OZFA 1QG0A 3EAGA 1WSBA 1XVLA 4DRXB 1SIWA 3CY6A 3F78A 2A0UA 3QE9Y 4HS9A 4Q66C 2FSSA 5H70A 3WLLA 2BP7B 4TKZA 2Q07A 3FPHA 2VT2A 4AKEA 1TYZA 2GN9A 4NCIA 2AZTA 1D4FA 2CFOA 4QYXA 5JW6A 5JTUA 1ZGZA 1H42A 3GH3A 1BX0A 3SE7A 2PK3A 3WLJA 3O84A 4YRIA 2JJ2A 4CKCB 2FMHA 1QZZA 2AG1A 3W6NA 2P35A 3DV0A 4HQLA 2QX9A 3IDOA 4YMWA 5DNAA 3WFZA 3S2SA 2E89A 1EBBA 1PFKA 1ZJYA 1E7MA 2BSQA 3UHFA 4BFWA 5DISB 1KEVA 2F9MA 4Q39A 3WGZA 2QUHA 1ZGCA 3L7AA 2SHKA 4M3NA 1EJ2A 1ICIA 4MAAA 4C0WA 3JR3A 5AJTA 3IPAA 3VR2D 4E1BA 2ZZKA 3CEPB 3FPFA 5CLHA 3WAGA 2C5FA 1B8NA 4YRFA 2P68A 3A04A 1Z3CA 4V38A 4DQXA 1UBEA 4EHKA 1E7RA 4P9NA 1EEXB 4Z8XA 3U4GA 4AZ0A 5A5DA 3U09A 1UC5B 2J4DA 4IMIB 4U0JA 2YS6A 4OHZA 2OD9A 2DPXA 2JGKA 2WSSD 1S96A 2JGRA 3PIDA 4GSYA 1XVIA 2ZWPA 5FULA 4ZDJA 3HDYA 3GJ3A 2P6RA 1TRKA 1JU9A 2HMSA 1S5PA 4E6EA 2VZ0A 2HXGA 3FM9A 2EKQA 1L7DA 4MWEA 1R8YA 4TKVB 3SEAA 2HXYA 4JHLA 4L4UA 3M6LA 4LNUA 5A5EA 1WUJS 3RARA 1O96A 2PA3A 2WE8A 4F46A 1W85B 3ILSA 3OOEA 4BAUA 1ZLXA 3NIBA 1DKLA 1GU7A 1MO2A 3WSTA 3EC1A 4TKMA 3E15A 5BNTA 4QUKA 3FR8A 4MVJG 5LA6F 1T9DA 4G5QA 1XROA 3OZEA 3I53A 4K40A 1YBVA 4N5NA 2P3OA 4EY4A 1TYAE 1W44A 4KRGA 5HKOA 4CL8A 3OEHA 3B1FA 1KI7A 4ZQCB 1PGQA 1GHTA 3TWOA 2CNOA 4X7PA 2G09A 1XKTA 4FDMA 4H0NA 3VSEA 4EQZA 1EUCB 4OY3A 1KZ9A 4ZT3A 5CA0F 1XLWA 2JB9A 1YJ8A 2QUJA 1C1DA 3MMZA 4BUCA 2VJYA 1QP8A 2IITA 4HDRB 3SJAA 4Q1VA 2AFIA 5EC8A 1U2TA 3RUAA 3IVRA 4L9SA 3AR5A 4R2HA 2JNWA 1U31A 1X19A 1Z06A 1DO8A 2R8OA 1A2QA 3AZOA 4NYMR 2YDXA 1XZPA 4LVUA 1BOOA 2HA7A 4WTOA 3DC2A 5GWXA 1DSSG 1GUYA 2FMIA 3KWJA 1EI9A 1YD7A 2PBFA 3QWIA 3W4IA 4B87A 1F0PA 5IT4A 1WMBA 3JAWB 2HLHA 5CK4A 1KKLA 3MN1A 3D8UA 1U8AA 1BYUA 1YU6A 2V45A 2BEKA 5FWAA 1KRWA 5JU6A 1E60A 1E63A 1T4DA 2IEYA 2JKZA 4MVJP 5U1PA 1K6IA 3GDGA 3IIIA 4X8OA 3WDLA 2V7EA 3CUWA 3JWHA 3PWTA 3GJRA 3PVZA 5D00A 3KT8A 4KPUA 1YZ3A 2HV9A 3BA1A 4M6WB 5IEBA 2GM5A 2G08A 4JLUA 4LJ8A 4MXDA 4Z9FA 4D46A 5EJIA 3KELA 4E70A 3QHAA 4M0EA 5ELLA 1YC5A 1OXBB 3F9CA 5JH7F 3ZWPA 3UWDA 4IMJB 3S2IA 4B73A 3I32A 1L4HA 3NHPA 3MWKA 3QYPA 2ZM5A 1K2WA 1I30A 1QC5B 3L4KA 3LCMA 1GEGA 3IR6A 2AK3A 2UYYA 1XT6A 3C4QA 2GPTA 4PTYA 3DPSA 4Y2VA 1YKSA 1XA0A 1N2CE 4Y6SA 5AJHA 1RLJA 3WSWA 2GAFA 3EOBI 4S1NA 3WMEA 5K8TA 1NP3A 2ZQZA 1XTZA 4KGVA 3K7EA 4DDKA 3NHWA 2V7XA 3FCSB 4JC8A 5ALPA 2FJ0A 5KO2A 3PQDA 3NWPA 4GLOA 2FCRA 3BE4A 2WBLC 3TLXA 4BBZA 5ARDA 3RFVA 2A7XA 3B1VA 3O8DA 5CEEA 4U7WA 2A5DA 3C3WA 1NVXQ 3I05A 1QRRA 4PAQA 4R9SA 4JMLA 4U02A 4KQ9A 1ID1A 1OI4A 3WLAA 3O1LA 2R6JA 4MI9A 4ZT7A 3SHWA 1ZWKA 4V39A 4BEVA 3HQ4O 3A32A 1OPXA 3ENVA 4A10A 4E15A 1IAVA 1SY7A 3OQPA 3SFTA 2GESA 3CC8A 2X7HA 3NPAA 3P9IA 3UEOA 2LR0A 4H1TA 4BEJA 1KJ8A 4KGDA 1JALA 4RK0A 5GY7A 5BWBA 4US2R 3PV0A 5ABPA 2ZPTX 1AC5A 4XCVA 2Z57A 2WINI 1IHYA 1UC4B 2JCSA 3EPRA 4U2CA 3ZY4A 1K4KA 4B3SB 2VG8A 3FXAA 1ZEMA 4BPRA 821PA 2OMEA 5CBPB 5CD1A 3LL4A 3CN7A 3WGUA 4Q4CA 1DRJA 3GBSA 3JQEA 4WBNB 3L6DA 3JQ7A 1ZN2A 3H0EA 3H42B 4JNCA 5AI0A 1IMOA 3PR2B 4KIFA 4H16A 2HJSA 3FFTA 4K26A 1R4NB 1I4TD 1V4NA 4PFQA 5EE0A 3COPA 4MRRA 4DNOA 3DAOA 1ZO8A 1K6MA 4WI1A 4EA9A 1H9AA 4XB6B 5TF0A 3HI4A 4DS3A 1XUOA 1J7KA 3EOZA 2C88A 4ZREA 3H2BA 4Y2XA 2HSDA 1UBFA 2O5VA 3A4NA 3CLRD 1MC8A 4BCCA 1WD7A 2AG6A 2P6NA 4X91A 2CV1A 3QSYA 4CMGA 3MCZA 5FWYA 5KQRA 3N2GB 1NMZA 1V8FA 2VJPA 4FVTA 1GO2A 4NJMB 5TMDA 1MZPA 3WO0A 1YHZA 4G9EA 1JIUA 1IN4A 1Z6GA 1RRPA 3DD5A 1USIA 1C0KA 1VP3A 3F3YA 1KHTA 2JFVA 3AEYA 1FCJA 5M04A 3GAMA 1H2BA 1L5OA 3A1FA 3P26A 4LHXA 3EC7A 5CDYA 3OZDA 5CX4A 4PCVA 1ZONA 3RV4A 3AW9A 2CHFA 4LE0A 4OLHA 1UBGA 2CGEA 5TT1A 2XKJE 5IW8A 3NRBA 5ITVA 5M2QA 1FRFS 1RM0A 1DJQA 1PK7A 2BGTA 4ZVKA 3G0HA 2AEEA 3GJSA 3R74A 2QU8A 1H4QA 4Q3OA 1ADJA 1O6BA 3ECAA 3ANTA 3GGCA 3GJ0A 3Q40A 4K6GA 3VOBA 1V2GA 3KQTA 4AWBA 1SQSA 1FSGA 2ZJBA 4QBFA 4O4LB 3QY0A 2Y0EA 1A5AB 5EMLA 1FTNA 2IEIA 1BJTA 1ODKA 3FCCA 4YJFA 1BDJA 1ISGA 1I3CA 1ZMOA 1MIOA 2ZUUA 4NHOA 2C5EA 4A1OA 5FLKA 2FR0A 4K87A 2I7XA 2ZBDA 3FWPA 4GP7A 5K3FA 1UP6A 2X4GA 5AR1A 3D3JA 1LV8A 3LW7A 4RHEA 1X7DA 1E3WA 3DEAA 5HJ5A 4FXPA 4UMEA 3NR2A 4Z8YA 3WGOA 3JQFA 5CLJA 3MUNA 1E20A 4P6VF 2YWJA 1VZ2A 3W2TA 1VE6A 1XIVA 2ILTA 3MINB 4QQ8A 3VZPA 4B6OA 1HFJA 3EIQA 2B94A 3VH2A 2DWPA 2XI4A 4DUPA 5AVYA 2NZYA 4U5XA 3DEHA 5DT9A 3NZEA 3TNFA 3AI1A 3DWFA 4CWAA 2H07A 1PZHA 3OJOA 3CRNA 2NYUA 3CW9A 1LRLA 2CFCA 4FHGA 2NU8B 1C14A 4DV6B 2PBZA 1DIGA 2ZB8A 2UZ1B 4AU1A 3N6VA 3AO0B 1E0JA 3UKOA 1MJGA 2IUYA 2VJDA 1KAMA 3D31A 3ILHA 3T38A 4DQLA 2VJBA 1F2VA 2R6DA 3P9YA 2RFLA 3LDUA 2FOIA 4HX2A 1SB9A 1KZGB 5FCDA 2J5QA 4NC9A 5LIPA 1IXYA 2GJAA 1DAGA 4C3ZA 5GM1A 1E1NA 1UZAA 4RHCA 3ZOKA 3FHLA 5H3HA 2JGJA 1N2ZA 3KEGA 3N2ZB 3O73A 3U3OA 4DBVO 4Q21A 1U1IA 1GQFA 2EFEB 4IQ8A 4EPTA 1ZR2A 5ELMA 2C0CA 1R0SA 1KDRA 5L95A 3M82A 2Y1GA 1CJMA 1KZ4A 4GL4A 1L4MA 4C7OB 2RMKA 5D87A 4F91B 3TN7A 3OZSA 3SQXA 2H57A 3I37X 3DWEX 5LLSA 3MMXA 4PXSA 2X76A 1G0OA 2YRWA 3GEDA 3SSMA 1ZUIA 2CEKA 2HHJA 3LWBA 4H0CA 3CEMA 4RDIA 1UINA 3BIOA 4XWTA 1C7JA 4YH1A 3VNRA 2GCGA 4QGSA 3ZGZA 2EKLA 3JV7A 1LUAA 1CIPA 2Z8YA 1KORA 1SVOA 2J08A 3QKSB 4K81B 1SG0A 2OGUA 4BVHA 5MHTA 2O8VA 1H93A 3PZBA 4OGFA 3A1CA 3D7KA 5FLYA 3OOJA 4GG1A 1ZLYA 1TQ8A 3EHEA 2BFPA 2XCOA 4MKGA 1WF6A 1UM9A 2CKDA 1OTYA 2PV7A 4QEZA 4V3BA 2ZJ1A 1GITA 2OGZA 2YS7A 3A1NA 4IX1A 5A6SB 3WYGA 3FG9A 4EGCB 1KC3A 3T3OA 1N2CA 4C4XA 2G70A 5I7SA 1PF7E 2CNBA 3GWGA 4NDAA 2BJHA 4XGIA 4BLQA 5JUWA 1HURA 1H2ZA 4NSNA 2H1VA 1E2FA 1EK5A 1O94D 2OHHA 3OZWA 1XNRB 5B64A 5I4BA 1I94B 3ESQA 1Q20A 1AGNA 1G3RA 5B7QA 3RVMA 3DMPA 1AA6A 4LF8B 3INNA 4YONB 1ZK2A 2QD2A 2YZ2A 4WCFC 1W29A 1ZXXA 1EXMA 2RD2A 2GARA 4RPCA 1VYHA 4K03A 3WLIA 1FNBA 2Z9BA 3Q98A 1EVYA 2RI1A 2GI4A 2X86A 4FSHA 4Q7EA 1Y1PA 4BNYA 1MB9A 1MW9X 2BFNA 2H1LA 5T4BA 3ZUGA 4B43A 3USES 5TLSA 1PFUA 1Z7EA 4JR1A 1YOVB 3EIXA 4GR4A 5EHXA 5CLGA 3HL0A 2A0FA 1G2OA 4DV3B 1JG4A 4M0LA 2VC2B 3N0XA 4E5UA 3D7RA 2QTLA 1LQ2A 2PGDA 3ELUA 5IZCC 3W5SA 4MUAA 5DB4A 1WG8A 4WK0B 4K1LA 2JIOA 4ZAGA 1H1LB 3WE7A 3HJGA 3IS3A 4QYTA 3RU2A 1X1BA 3MT0A 5IT9A 3DL7A 4YDRA 2Q5CA 5E6SA 5E4TA 5B2ZA 4B33A 3VXKA 2R1VB 1JKJA 2VUTA 1MO5A 5IFLA 3B6IA 4GBJA 1RJDA 2W2TA 1TVKB 3TGWA 4DJ5X 1NYLA 4FFBA 1FDRA 1IM8A 2O4CA 4ZMRA 1PFGA 3TZ6A 2WTAA 1NW3A 3R8CA 2OPHA 2X3FA 3ASUA 3GJ8A 3O0DA 2X14A 2FEMA 3QEMA 1AGRA 1UUFA 5CVJA 4XWYA 1SUFA 1O2DA 1RWNA 2GPNA 2RARA 3DUFB 3OE7D 3EVBA 3OY7A 3W9YA 3MS7A 3K5PA 4K86A 2E49A 3WIVA 1BHO1 4IXWA 1J8MF 3NVAA 4J1QA 4GLBA 1TJ3A 2PR2A 5IYZA 2WY2D 4EFDA 1V39A 4MWOA 4YRRA 3ZXYA 4DMFA 4TV8F 1Z15A 3AW8A 3I5MA 3ZHBA 4M8LA 3AVUA 2VDUE 4F97A 2H51A 1Y6FA 1XRMA 5BVHB 1H2FA 3P27A 4KNWA 1E3DA 5DCWA 5BT9A 3PXDA 1LY1A 3BMOB 3L1VA 1KIAA 1EB9A 1FS5A 5AVRA 1GNTA 3L2OB 5CFQA 3T6KA 2HF2A 3BL5A 3F3MA 3QPWA 1TE2A 2GBGA 3K8QA 4TZ0A 2OSVA 2M2IA 3QBTA 1IYZA 1ML3A 1R8XA 1PBNA 2B7BA 4DY4A 1XELA 4NOKA 3ZU4A 1PG2A 1YS4A 4B48A 3HEMA 4QYMA 3ZCUA 3U2QA 3E5RA 3VAYA 4TPKA 4BKOA 2IIQA 1SD1A 4UJ3A 1WY5A 2K87A 1IBCA 4C0JA 4C07A 2M1XA 5E7MA 3KSZO 5GONA 3V4LA 2PXXA 3OCWA 3GG9A 2WUWE 4PGHA 3WNVA 2CWWA 2C9CA 3RM3A 3HKBA 1JB9A 4I5GA 4HEHA 1DADA 1QKKA 2OCAA 3N5CA 3TXAA 1E92A 2GN0A 1MA3A 4MAMA 4P2BA 3VR3D 5F1KA 2R751 4AWXA 8ABPA 2WT4A 4F5WA 4Q4JB 3TYXA 2YWCA 1S6YA 1YJBA 5A03A 5KYNA 5C53B 4MTCA 1VI2A 1EKXA 2O5CA 1TEXA 1JFRA 4K6MA 1FYEA 3MRVA 2Q6LA 3IGFA 3TR5A 3ZE8A 1PNVA 4DG8A 4HNAB 4P3KA 4NABA 3T3HA 1ZD3A 3SDSA 4XKJA 5LZ9A 1I01A 3DFKA 1WL8A 1O9GA 2NIPA 2XV1A 3WMFA 1KVRA 2R44A 1VKOA 1ZEJA 4BP3A 5A9RA 1UPBA 2JLRA 3D6VA 1S2DA 5CW1A 2HMVA 3KQYA 5F5XA 1KQNA 3VTFA 2BRUA 4CLOB 1GNRA 2V0NA 3FOCA 3QG5A 4RAOA 4UPEA 2IHNA 3PEEA 1SXJD 2OMKA 2ZRQA 4MEJA 1LVHA 3KBBA 1JNYA 2PYZA 2BEVB 4Q1DA 1E4OA 3NNNA 3WXBA 2ZUTA 3DMFA 3AEUB 5A06A 5K0FA 3KETA 1ATIA 1B14A 3QF7A 3SX4A 1T4CA 2Z56A 4FDVA 2O8NA 4OFBA 4YP1A 3RVLA 4MS3A 2CSUA 4OQQA 3WMXA 3NCHA 3Q41A 1MIHA 5KSYA 2Q1XA 3RS9A 3CVWA 2BSXA 2YW9A 3KS9A 2ODEA 4IHAA 5EGSA 1OFTA 4RSHA 2NPOA 3SC6A 4BMNA 4CLHA 2XDWA 5C9ZA 3H9CA 5KVAA 4ETIA 5JBNA 3T06B 3WK4A 5M34A 1EFTA 2X5XA 4WLOA 5LA6A 1KMNA 3I6QA 4PC2A 2DKFA 2Y1XA 5K1ZA 1WRBA 1YBHA 3DE4X 4EJSC 4W7IA 2N9UA 3E1KA 3BRQA 1NLMA 1SU4A 3LWDA 2G9RA 3DOHA 4IEFB 2O3RA 4LTMA 2XMZA 4I14A 1JFFB 2PS3A 1QYVA 2C04A 3CLTC 3DO6A 4B3FX 4D3FA 4XRGA 5CA0A 1DFGA 1RJ9B 3PNQA 5FTLA 1C9EA 1J8VA 1BMQA 2X9NA 1NBEA 3X1WA 2PZKA 5AM5A 3OCXA 5KI6A 4MCHA 3VJLA 4B09A 5C31A 3STUA 2YQ5A 3ND8A 1PE0A 2QD1A 4AN0A 5JSKA 1SU8A 2C07A 2C2BA 3NS7A 1KRXA 4OQNA 5C8VA 1XLUA 5EG5A 1ZSNA 4PTZA 2XYQA 4ASUA 4B7CA 4DPKA 1U1EA 4AP6A 4L73A 2A9OA 3WR5A 2F9FA 4OXRA 2WNSA 5CA1B 1NI4B 2VOJA 4N6GA 4QJ4A 4LE2A 5IDQA 1IUPA 3G79A 5G4KB 4ZHQB 1F4VA 1VDMA 4V3CA 3TGLA 1T5BA 1GM5A 2O8EA 2BVNA 2Y6UA 4QASA 4LHVA 4FC7A 2FWRA 4J0JA 3QUAA 2H0AA 1EWYA 1ZP6A 5IC6A 1Q3TA 4QG3A 1DOAA 3K8YA 3DQZA 1GVHA 2OCGA 2FR8A 3UUEA