2MYTA

An arsenate reductase in the intermediate state
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
131
structure length
131
Chain Sequence
MKKVMFVCKRNSSRSQMAEGFAKTLGAGKIAVTSSGLESSRVHPTAIAMMEEVGIDISGQTSDPIENFNADDYDVVISLCGSGVNLPPEWVTQEIFEDWQLEDPDGQSLEVFRTVRGQVKERVENLIAKIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaredoxin arsenate reductase
publication title A Hybrid Mechanism for the Synechocystis Arsenate Reductase Revealed by Structural Snapshots during Arsenate Reduction.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Oxidoreductase
total genus 42
structure length 131
sequence length 131
ec nomenclature ec 1.20.4.1: Arsenate reductase (glutaredoxin).
pdb deposition date 2015-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2mytA00
4W5TA 1DCKA 5KC8A 3CZ5A 3FFXA 4N03A 2FEPA 1YS7A 2N9UA 1U8TA 4G86A 4MS4A 4TLMB 4ETIA 4F12A 2FTKE 1ZAYA 3K4HA 3RVSA 4N0QA 3LKBA 4MYRA 2IPMA 2IPLA 4NQRA 2HJ9A 2PKXA 1R8JA 1DG9A 2B1JA 4XXHA 3HUUA 1DCMA 2R47A 3CZCA 3LUFA 4D6YA 2B4AA 1JYFA 4QPJC 2PJUA 3GV0A 4EYQA 3KTOA 4ZYLA 3QLUA 2RJNA 3SNKA 4LDAA 2WB4A 1JH9A 4F06A 3MM4A 4Z9AA 1DBQA 5PNTA 3KCNA 7ABPA 4ETNA 2L19A 4S05A 3RVNA 1RXIA 1PNRA 1USGA 4B09A 1XHEA 3JPWA 1TM2A 3EULA 3P9YA 4IGAA 1JDPA 3DBIA 3H1EA 4LE2A 4EYGA 1JLKA 1MAVA 5HQJA 4ZJPA 2IPNA 4G0ZA 5ED4A 4G0XA 3TD9A 3N75A 4EUKA 4RK5A 2FQWA 1GUDA 1BDHA 4XAQA 4O1HA 1Z2EA 4H3KB 3EQZA 4FE7A 3F73A 3RH0A 2PUAA 4KNYA 3T8YA 5IEJA 2YHAA 1D4ZA 2ZWMA 3T38A 1JFVA 1P6QA 4G0MA 4YCSA 4NICA 5ABPA 4YS6A 4MPTA 3I09A 3N53A 4RK1A 1FFGA 3GBVA 3HK2A 1JX6A 2A9RA 4XFKA 1BVHA 3QEKA 2NUBA 2AYZA 3QLUC 2GI4A 4JASB 1B00A 2JRLA 1ABEA 4QYWA 4LDZA 3OO1A 1HEYA 4ZMRA 4YGXB 3SG0A 3CHYA 3IDOA 4D6XA 4D74A 4IF4A 5JNTA 3HM9A 2A9PA 3GYBA 4Z4IA 1D1QA 2J48A 3G85A 1C4WA 2FQYA 4RK0A 4CBVA 4WXEA 2FW0A 3CTPA 3HDGA 4G0YA 1T34A 1S8NA 2IPAB 3KS9A 1QP0A 3LFTA 3NHMA 3O2QB 3F6PA 1QO0A 1J56A 4XARA 3B2NA 2VUHB 1SXGA 2R4QA 1FQWA 3BRSA 4RK6A 3RVLA 2ZAYA 5T7BA 4RK4A 1Z16A 4IRXA 4ETMA 1L5YA 1NXWA 3IP9A 5DKFA 3EODA 5JS2A 5FWYA 3EDCA 2MSWA 3M9WA 3N0XA 1QP4A 4YV7A 3H5IA 3CG0A 1ABFA 1DBPA 4LRQA 4MAAA 2WY2D 3H6GA 1NTRA 2NT4A 2IKSA 1AB5A 3LUGA 4LZLA 1DRKA 2WWVD 4OG2A 5IC5A 1DP4A 3MF4A 1WETA 2E4WA 5DTEA 1K66A 3A10A 3ROTA 4MS3B 4JP1A 4MS3A 1PEAA 2FEWB 4YRZA 4S04A 1JYEA 1BAPA 2WJAA 1KRXA 3HEBA 3N8IA 5FBHA 5BQ3A 2F8SA 5EWJB 4OLBA 5JS1A 2PUGA 2PUDA 2JVJA 4RY0A 3OLXA 2FN8A 1MB0A 3DGEC 4W5OA 1APBA 2IOYA 3S99A 1PNTA 1GUBA 4Z4GA 1NXOA 3C6QA 2FMKA 3QK7A 1JF8A 4MS1B 4MQFA 1QKKA 2YHBA 3GA5A 4MQFB 4MS1A 5DLEA 3NNDA 4EY3A 3IP7A 3OQOA 1RZRD 1EHCA 2FEKA 3RVQA 3CRNA 1NY5A 5GQSA 1E6KA 1MIHA 1VPWA 2L18A 4YP9A 3CU5A 1LJUA 3C3MA 1SXHA 3H75A 1EAYA 3O1JC 4PEVA 2TMYA 2R48A 3RVOA 4LE0A 4RSMA 2LIVA 5EWLB 2HQRA 1Z17A 5EWLA 4FB4A 3SAJA 3KLOA 2FQXA 5KQMA 5GOTA 4G97A 6CHYA 4TLLB 1C0EA 3OMXA 1NXSA 2E4UA 3CFYA 3CS3A 2M1ZA 2R25B 3Q7SA 1EWKA 3O1IC 1ZESA 3HCWA 5TPWB 5TPWA 2DRIA 4KMRA 3UKJA 2GKGA 2O20A 4NCAA 2PUBA 2AYXA 1D2AA 1UDRA 3FFTA 4EVRA 2F8TA 1KRWA 2QW1A 3GWGA 2H0AA 2HQOA 3OLVA 4RXMA 3RVJA 1A0OA 2GX6A 4RU1A 4RXUA 2PAFA 1Z18A 4EGSA 4O5AA 1Z13A 4DQDA 5FWXB 1E2BA 5FWXA 2PMCA 1U04A 1BDIA 1K68A 3L6UA 4KQCA 2P9HA 2JBAB 4YO7A 2JBAA 4PICA 2Q5CA 3CNBA 2WJWA 3HS3A 5BRAA 3DZDA 4E7OA 4ZPJA 1A04A 1YK1A 3NNSA 4PZ0A 4F8JA 1XWWA 2L2QA 3KSMA 2A9QA 1LBHA 2CWDA 5IBQA 4MQEB 4P98A 4MQEA 2QSJA 2VUIB 1JFSA 3BREA 1TJYA 3GT7A 4PE5B 3N6VA 3QELB 3GBPA 1ZH4A 3ILHA 3QELA 4XLTA 5FBKA 5KWSA 3ROFA 2PUCA 4WUTA 2RDMA 4Z4FA 3KHTA 1ZGGA 2H3HA 3D02A 2E4VA 3OLYA 3DLBA 2JK1A 2WMYA 4JOQA 2FMHA 4IILA 2QVCA 1GLGA 2M98A 1FSPA 4RZSA 4KREA 1USKA 3HVRA 4RS3A 4DADA 2ID7A 5JNSA 3DLHA 4Z99A 4MR7B 4KPYA 4MR7A 1CHNA 3C3KA 3QLTA 1GCAA 3T6KA 1P2FA 2NT3A 4RWEA 1XHFA 5CNMA 1YMVA 2QU7A 3TO5A 2WRZA 2I6FA 1VRVA 1DC7A 2IDMA 4QICA 2FLKA 3HZHA 1D5WA 2FSPA 2X7XA 1RXEA 2HSGA 1JL3A 3H5LA 3MMNA 4M88A 4N0PA 3LKVA 4Z4EA 3CKMA 4KZKA 1DJMA 1A2OA 4W5NA 3IP5A 5KC9A 1SXIA 2MYTA 1OXBB 2QXYA 4G0OA 2JVIA 4IMIB 5JNVA 4G0QA 4Z0NA 1YIOA 3LTEA 1JDNA 2JVKA 3BBLA 3H6HA 4Z9BA 2FLWA 3N0RA 3FDFA 3FFWA 1E6MA 2HPHA 1RZRA 1NXXA 4ML3A 1URPA 4F3TA 4LE1A 5TQJA 5IX8A 1PEYA 3Q7TA 5D2CA 5E3JA 3LUAA 2MYPA 4HNSA 2BGGA 3H5OA 3LUCA 4KK4A 5EWJA 5C5CA 5BR1A 5JNRA 1JWLA 2NZVG 3JTEA 2W42A 1TMYA 2V0NA 1NXVA 3JY6A 2MYNA 4L85A 3DGFC 3UUGA 5JNWA 1QQBA 2PL9A 3IPAA 2FN9A 1P8AA 2LP4Y 3N0WA 1LJLA 3H5VA 4OTZA 5KQLA 2FMIA 1PHRA 3GRCA 5CNJA 3HSYA 4F11A 2E4YA 1YS6A 4RK7A 5KQPA 1Z26A 2QR3A 4PYRA 3OQNA 3F6CA 5IUKC 1L5ZA 4XASA 2LPMA 5C5EA 3H5WA 3RVKA 2PE5A 1M5TA 2QVGA 4MR8B 3FGZA 1TVMA 3A3KA 4MLCA 4MR8A 4TMYA 4DN6A 4Z4HA 2LUOA 4KK3A 2OQRA 2OENG 3NHZA 8ABPA 4O1IA 3OQMA 3NBMA 4RY9A 4EVQA 1ZN2A 3A0RB 1EFAA 4N41A 4KRFA 4Y9TA 5IUNC 3RQIA 3KYJB 3EQ2A 3O75A 2HQBA 2IYNA 4HYEA 4RKRA 4WT7A 5KI6A 2LBPA 1F51E 1M2FA 1SRRA 3W9SA 2MSKA 1U2QA 3OM1A 5TPZD 5T3YA 1M5UA 3QX9A 1CYEA 1U2PA 3LUJA 3O74A 3OLZA 1CEYA 5EWMB 3RVPA 5EWMA 4FE4A 1ZHHA 4MS4B 4KQ9A 2JCGA 1P6UA 1DZ3A 4QYMA 1Z2DA 1QQAA 4Q6BA 1D1PA 1KMIY 5B3JC 3MIZA 1RNLA 3VNBA 4OATA 5JNUA 4N76A 3IP6A 3QX8A 4YLEA 1DRJA 2PUFA 3ILYA 1VLZA 1YTUA 1Y1LA 2QV0A 5F64A 1EWVA 3KYIB 3M9XA 4NCBA 3OM0A 2PLNA 3OMWA 3GL9A 2VYCA 2E4ZA 3O2JA 3BILA 3SM9A 4RDCA 3HJFA 2GWRA 3A0UA 1I3CA 3HDVA 1SD5A 2A9OA 3BRQA 2CHEA 1DBWA 1AB6A 1QMPA 4HNQA 4YWHA 4GPAA 1ZDMA 4EYOA 3D8UA 1ZGZA 3MYYA 1TLFA 3F7NA 1PUXA 4ZMSA 5DGCA 4EYKA 3TX6A 1QP7A 1VKRA 1ZVVA 4TN5A 3E61A 4MR9B 3K9CA 1W9HA 4MR9A 1W25A 3SQNA 3O2SB 1EWTA 5DCLA 1ISRA 3O21A 3IPCA 3I45A 2RJOA 3HO1A 4G0PA 5TQ2B 5TQ2A 2FKAA 3QLVA 3RVMA 4WXMA 3LOPA 1Z12A 5IEBA 9ABPA 4NV3A 3C97A 1U0SY 3Q41A 1NXPA 4JB2A 2CHFA 1E6LA 3MQ4A 4JB0A 2QZJA 4KV7A 1GCGA 3EAFA 4Z4CA 4H60A 3HXMA 5CNKA 4Q6WA 3TMYA 3LMKA 3R0JA 4H3HB 4RV5A 3C3WA 5BRJA 4P1ZA 3KLNA 3M6MD 3JVDA 3CG4A 1NXTA 1YK0A 1H9CA 1JBEA 4WZZA 4LX8A 3MA0A 4KFCA 1MB3A 1ZH2A 1YVUA 1ZITA 4MRMA 3HUTA 1BDJA 4MRMB 2CD7A 5IUJC 3I42A 3LUHA 1Z25A 2ID9A 3G1WA 5FWYB 4JAVC 2KYRA 6ABPA 4N47A 3JS5A 1JFTA 3Q7RA 3LUDA 4JA2A 4W5RA 3KJXA 1JHZA 4RKQA 3O1HB 3QLVC 3JVIA 4KVFA 1BA2A 3SY8A 1OXKB 2FXIA 1DC8A 3I5AA 3T95A 3UK0A 4EVSA 4E7PA 1FFWA 1QO0D 2E4XA 3JPYA 1IIBA 4MGEA 1RPJA 3Q9SA 3LUKA 3OO0A 1QNLA 3RVRA 4GNRA 2XDYA 1FFSA 3CLKA 3KKEA 4OBBA 1M2EA 1USIA 3H5TA 3URMA 1ZY2A 2PL1A 2JB9A 3FMVA 1YMUA 2GBPA 4UHJA 3OLWA 4HNRA 5TPZA 3EGCA 4Q7EA 5B3JA 2PUEA 5I4CA 3NNNA 2NZUG 1QPZA 4UHKA 1ISSA 3EJWA 4IMJB 4WWHA 1KGSA 2P4UA 3QEMB 3HV2A 5HSGA 3QEMA 1DCFA 1F4VA 2MYUA 5TE9A 3VNAA 5HKOA 4YR7A 1NATA 4W5QA 5CHYA 2RGYA 1LK0A 3E3MA 2L17A 3TB6A 1Z15A 3H1GA 2VK2A 4OLAA 4RXTA 5TQ0B 2FMFA 3H1FA 5TQ0A 5HM6A 5IULC 1LBIA 1MVOA 4L4UA 5CNIA 3KG2A 3Q15C 3L49A 4RY8A 5KQGA 2MSLA 4MLDA 2FVYA
chains in the Genus database with same CATH superfamily
3FXAA 4W5TA 1DCKA 1O9GA 2Q6OA 5U1PA 1GQ2A 1VXOA 3LT5A 1IL0A 4JENA 2N9UA 4IQFA 5F3RA 1LA2A 3QVWA 4D9BA 3IFSA 1USUA 2Y27A 5L3ZA 3ME5A 3VU9B 2AEJA 1EEXB 1Y6JA 2C0PA 1P2TA 4TLAA 5CLFA 2IPMA 1K7EB 3IXQA 5FF9A 2WWWA 1RHQA 2PKXA 2XD9A 2IS6A 3LU1A 1H0SA 2OO3A 2VAWA 2Z2KA 3D6NB 3MRXA 3DEFA 4HQ6A 2ZGVA 3IJPA 3NEYA 5J2UB 3T1OA 4JL8A 4FJ2A 4URVR 5AIBA 5BURA 2VOJA 1U7WA 3IV9A 4KPGA 4JT2A 1QM5A 2RJNA 3ZZTA 6NULA 4I4TB 4WCFC 5LM3A 5IT5A 1JH9A 4F06A 4IDCA 2VSXA 2RAVA 5D84A 5BOSB 4XJXA 4WOCA 4B8YA 5JROA 4H4EA 4U5QA 2VAPA 3ZQ4A 3B85A 4F91B 5IYZA 1BN7A 3O8NA 4B7XA 3QU5A 4BNKA 4X1IB 4A5SA 5C37A 1PNRA 4CU5A 2OFFA 4ZYUA 1SHLA 2QX4A 1R6BX 3TLXA 1BKDR 1TDJA 1U3VA 1OXTA 5TR9A 1YC2A 3AKDA 2JFNA 4TVOA 2Q5HA 2QN6A 4PLPA 5ALYA 1OX4B 4DREA 4QEZA 3R3ZA 4KXWA 3C14C 2HZ7A 2BWJA 1OJ7A 2P3OA 1R88A 2XKBA 4IUCS 4AN1A 3NALA 4L73A 3STYA 1LPAB 5KU1A 2FI1A 2NAFA 1R9JA 1CRWG 2BTQB 5D5HA 5FR2A 5TMBA 1U5CA 3WQRA 3D2BA 2ZYIA 1WF3A 4NICA 4EW3A 4WL0A 4MPTA 5B4VA 8MHTA 2D0IA 1KI7A 1RAEA 1GZHB 5AVWA 3VJLA 5DULA 4PZCA 5JSQA 3RIGA 2J3HA 4FJ0A 1HXHA 1LF0A 2I8AA 3KQVA 4NMWA 4CQMA 1RHKA 1H5QA 4WACA 4KDRA 3K71B 1VBFA 4IHKA 4M1EA 1LKZA 1J8MF 1M83A 2J48A 2XBUA 1THGA 4RK0A 1B41A 2PUHA 5CRIA 5J47A 3AVPA 5A7HA 1JVSA 1JBQA 1UXJA 3K1YA 5J5VA 4PC6A 1PGQA 3QYAA 1SUSA 2FE1A 3HCEA 3V80A 4D0NA 3GX1A 3TOSA 1X3LA 2CLKB 2FWRA 2X8JA 3GEMA 4M46A 1QO7A 1WBDA 2UUAB 1K9SA 4LPSA 4MIKA 4MVJM 5KU7A 4X8MA 3K2IA 2QMOA 1EP9A 3N7TA 3VOBA 1OXXK 5LKAA 3I12A 3IP9A 2XTNA 1NI4B 1THZA 1NSFA 3B78A 2V7XA 3AESB 2QX7A 3C3DA 3JYQA 2WBLC 1S1CA 4GOKA 1H69A 3S0JA 3ZU6A 1H42A 1XT6A 2WHQA 4RF2A 5J4KA 3UXYA 2HMWA 3EZXA 3L8ZA 4ZAVA 2CB9A 2EEPA 2VDRB 4FSHA 4QDUA 3IUPA 2ZLBA 1EG7A 2VNAA 4B9EA 4HDMB 2ZAGA 1HETA 3DVAB 4R71A 2GZAA 2FR0A 5H4GA 1ACMA 1B8PA 4P3YA 4Q3NA 1GL6A 4PAGA 4CMGA 1DLIA 4HADA 3IEKA 4CF6A 4E5PA 1IOZA 4D81A 1BVYF 1OZAA 1KO8A 3NOXA 4QYIA 4U7WA 1GTZA 1DDIA 3W3ZB 3SHOA 1L4KA 1V5EA 1I0ZA 1K5PA 1WJGA 2HMSA 4BMCA 3QWFA 5HUJA 3D2CA 1E2QA 3A4LA 5DM0A 3O8LA 2Q8NA 4U00A 2P7HA 3UJNA 5EWJB 4QUAA 4UUMA 4EITA 1ZRSA 3UK2A 1NLZA 1ONBA 2K5UA 3LT2A 4IIGA 5DCUA 1FL9A 3OLXA 4WDRA 3WDKA 2V5UA 2J4DA 1GARA 1NLFA 1YS2X 3EVZA 4RBNA 3VTAA 3AJ9A 4BO5A 2YHBA 1VSUA 2CFOA 1K6IA 4A6DA 1KJYA 1C2TA 4LSGA 4MQ6A 4C0KA 5ENDA 1EHCA 1JNYA 3DLIA 2FEKA 4KX3A 3UEOA 1E6KA 1SIOA 3OJEA 1L4FA 5IJAA 2L18A 2OBMA 3QTTA 1R66A 1IBKB 4DSUA 3SU8A 3ZDBA 6GPBA 5BT8A 5DNYB 4J49A 1CJMA 4IZHA 2IDJA 1JDBC 1WHSB 3H75A 1FJHA 2JGFA 4HMPA 4OYLA 1L5NA 4EKNB 2Q50A 1E66A 2XMBA 1N9GA 5E4FA 2R48A 3FMGA 3EZ9A 4J0FA 2CEKA 1NP3A 1Z17A 2BUBA 4QBIA 4QJ4A 5EWLB 3WHPA 4D0LB 3BSFA 1ODKA 1FYXA 3QKUA 3UMCA 2FPMA 3EXEB 4B3FX 5C81A 3FNBA 3RC9A 5B1YA 2DE0X 2N47A 4NDNE 4EHNA 1W88B 1V0JA 4WNYA 3KB8A 5KREA 1GAJA 5EXDA 2ZQZA 3RS9A 1N36B 4BATA 2R2GA 2A57A 3UJ9A 3N59A 2PH7A 2ZU0C 2VJNA 3OZCA 5ERXA 1JILA 3P4YA 4RXMA 3L9WA 2B9VA 2FMXA 4B3JA 4DJFC 5F9HA 2EBUA 4L8FA 1VHTA 2CXPA 2PKQO 3NDJA 1G9TA 2B1GA 3ND6A 4EY4A 1H6CA 2BEVA 4D99A 4HQ0A 1D5CA 2GJ4A 2ODPA 1JKMA 2BH9A 4JCOA 4JX8A 2GPWA 3LDGA 3EY9A 2P7IA 5C8VA 1DUIA 3NNSA 2VWHA 3VZCA 3KPJA 4LMRA 2FU5C 3MUEA 4AXXA 2F3TA 1PZGA 2CWDA 3PQFA 4X92A 5CPBA 3GGGA 5B36A 3V4LA 2Q6KA 2QSJA 2GM3A 1R6VA 2AHOA 5ULLA 1NR1A 1VL0A 5DM2A 5KWSA 4IJQA 1ZZEA 4PV7A 1Y4SA 5G02A 1KDYA 2JA1A 4QGGA 5AIAA 2G1AA 1BMTA 2P91A 2VPTA 5KMGA 4DCCA 3LP5A 1MO5A 4IX1A 5K45A 2C2ZA 1T3GA 3O8CA 1PD1A 5BMVF 2PEZA 1JGTA 4X44A 3D02A 3KQYA 3R9XB 4RPLA 3BMQB 4L8LA 4LC0A 2FMHA 2QVCA 4EKIA 4ZEVA 4S1TA 1K08A 2JJQA 4PG8A 2Q0SA 3K0FB 2UUOA 4KPYA 4FFBA 3DO8A 1L5QA 4FLMA 1NW5A 1WR8A 1FMLA 2W58A 3KQOA 1W52X 3D1LA 3QKRA 4LCBA 1CQPA 1HLGA 1VG9B 4RWEA 4EA8A 1X7ZB 4MV4A 3W6OA 1EESA 5CNMA 4L8WB 1YMVA 3AK4A 3DG9A 1JAZA 1UBMS 3OPXA 5IAOA 3FUXA 2FPPA 3S44A 3WAGA 2J3LA 3KJIA 3T5BA 2FLKA 1K7FB 2HIGA 3C3AA 2PS0A 5EL0A 3Q2OA 4RFSA 1MXHA 3BE4A 2XNHA 1OVGA 2QZSA 1V41E 1FXUA 5AHXA 2UXDB 1WB5A 4B3DA 1COZA 4EG1A 2BEUA 4N18A 2YY6A 2XUHA 2H1VA 3L7AA 3HL4A 3AR8A 2Q2QA 2PSEA 1G64A 4JI8B 4TV9F 1LX6A 4FBLA 4FI3F 5EJ6A 4Y2XA 4LQLA 3RJZA 3I3OA 1LX7A 1JDNA 2YN0A 1G8FA 4JJIA 3BULA 2MSCB 3H5NA 3LRPA 5LZ7A 2LVBA 4F6RA 5ALVA 3OPMA 3IT0A 4ZTZB 2ONJA 3FFWA 1PT8A 1S01A 1XNQB 1LW6E 3VR2D 1J7JA 2OBLA 5K0JA 1JSXA 1T43A 3AW9A 4IIYA 4FNMA 4X84A 5TQJA 5EEHA 1G2PA 1QZTA 4PCVA 1VL5A 3OBBA 1LLDA 4Q7KA 3PCXA 5EMLA 5AW6A 2GJKA 2JGRA 4XQGA 4A1FA 4QDJA 4XPZA 3VH1A 4BB9A 3N07A 1G66A 4HN2A 5T4FA 5KNDH 4LS3A 3Q12A 3TTSA 4NP6A 4IDPA 3P2IA 5CG1A 2HDOA 3DCNA 1BTOA 3DB2A 4JBLA 5E95A 4UDXX 1KK3A 3TRDA 3UMGA 3RGWS 4CMEA 1P1IA 3DNMA 2P6NA 5AMXA 4DJTA 1KI4A 2ZJ4A 3E3OA 4GGMX 4YAWA 3VYTB 1I3MA 1RKVA 1N6OA 1P8AA 2R7AA 1K27A 3EMVA 3BB4A 4OMUA 3RDPA 5KQLA 1KZYC 1L5GB 2GD6A 4B3HA 3K92A 2VT7A 4UBNA 4YAFA 4HRAA 1FS6A 4P58A 4WRRA 4E46A 1WMDA 2XTJA 3DEKA 4LI0A 3PQ2A 5IUKC 2IS1A 4YRSA 3LLSA 3BFKA 1SVMA 1ISGA 2DFLA 2GA9A 4JUCA 4B84A 1P29A 2JFHA 2OCXA 4IS2A 1XRLA 2ZYUX 3G89A 4WLNA 4R31A 2HV8A 1NBME 1L3BA 2GHRA 1KYVA 3I2KA 5DASA 3NOQA 1AX9A 2HA5A 3J80A 3KR0A 2EKBA 3C5HA 1Y3HA 4G23A 5K3SA 3LF2A 2JFFA 3WKDA 3DWEX 3RRXA 1XTKA 2AVNA 3P52A 5IUNC 3KZCA 1PFYA 5KJFA 2IRWA 2WD7A 1ID1A 3WNQA 5IDXA 2VF2A 3GVHA 4NABA 1SKAA 4HCJA 1IZ9A 3IQEA 2XXBA 4NPCA 1M2FA 1RWKA 4OIFA 4R8MA 5G40A 4NS4A 3U7EB 1GPDG 1SRRA 1XIVA 1ZRMA 3S2SA 3SJZA 4BTVA 1VSTA 4OP1A 2CT8A 1J7KA 1Q1QA 3FCXA 1JKXA 1CYEA 5ELLA 4LK3A 5AVOA 3U3DA 4PRYA 1F1BA 2X14A 3L46A 1ZYUA 3GFRA 1QLWA 3KKOA 1Y1QA 1DZ3A 1EK1A 1Z2DA 5CDHA 4DAEA 1AKVA 2ZI9A 5JNUA 4N76A 1DRJA 3JV7A 3LC0A 3O4JA 3QUQA 2IHBA 1P4JA 2ZETA 1POWA 4GVPA 4BMSA 3DDHA 4CNQA 3DO6A 1ZIOA 1XLVA 5BUZA 1UJBA 5K20A 4FVTA 1H8ED 4P2BA 3J7AC 2VYCA 2VJLA 1IM5A 1UIRA 3QQ5A 3W5HA 1IZ8A 3BZUA 3HKBB 4MJ3A 4QX6A 4AZSA 5A1JA 5A9SA 5IJ9B 2Y67A 2HA0A 2NVUA 4ALMA 2JK0A 4RDCA 3HJFA 4ZN6A 3ZBTA 4HQLA 3A26A 1NE7A 4OD0A 2GILA 4OU4A 4B35A 3PLRA 1DBWA 1RU3A 3HPRA 1G6OA 4AS1A 1FSZA 2F8MA 3SQXA 2EXXA 3IUSA 3JD1A 4KQ2A 4U3JA 6YASA 5BPFA 4WXHA 1HA3A 1E77A 2VUUA 3I1IA 3BWVA 2GCEA 2PH3A 4NBVA 1PI3A 1JFLA 4X93A 4PIPA 5DGCA 3ZE2B 2ZYDA 3HGQA 4LV5B 4IH4A 1VKRA 2IJGX 2EG9A 4RDHA 2IOHA 4GKJB 2C97A 2H5EA 2Y05A 3DAHA 4JBYA 3EFOA 4PWYA 4CR6A 1UBCA 2ORIA 3A9RA 2DBQA 1E1NA 1CF9A 1X1TA 3CZQA 1N6NA 2GQ0A 4H7PA 4HPJB 1A27A 4IQ4A 5HUHA 3NBQA 1PVVA 1QV7A 1Y6QA 4YRQA 2Q3FA 5E1OA 3ZY6A 2Q29A 1MV8A 2H06A 2YFQA 3AONB 3G1TA 1BRTA 3FE2A 2NV0A 3TNYA 2GCOA 2YMMA 5AI4A 1P91A 2R85A 5IEBA 1ZAKA 3LSYA 3NYQA 3IEXA 2IEIA 4DCOA 1GZ6A 1HQCA 3R41A 2YBEA 2ZSHA 4WINA 3ZS9A 2ZSUA 7ADHA 4MGKR 2GPSA 4U2CA 3E5NA 1LSOA 1GG8A 4I1PA 4H3HB 3JRXA 3ZE0B 1XTVA 4WMLA 1WP4A 1RYNA 4YJHA 4WJLA 5JNLA 4LRWA 2D2EA 1I7LA 3E22B 1DV2A 1U2DA 3RFFA 5KKAA 1JEOA 2BUAA 5JAMA 3JXEA 4J4HA 2NPFA 4MYSA 1PAUA 3AQIA 4KFTA 3TLEA 1NNUA 2RGGA 2P5UA 2XMQA 1V35A 2IXDA 3DONA 3M4NA 4MIOA 4NE9A 4PONA 4R0MA 2Y0BA 3HZRA 1ZD4A 1GYPA 2EZ4A 4JLMA 2AZ4A 2PX3A 4ZCLA 3JWEA 1KP3A 2JPDA 3PSHA 1CRQA 3ILSA 5LSAA 2G70A 2GBFA 1T36B 2NNLD 1KP2A 2OHXA 2ZUVA 3GLVA 4JA2A 3HCDA 1SAYA 5D01A 1FIUA 2IP2A 3KEGA 3QLVC 4TQGA 3S4YA 1T9DA 1X77A 2BMVA 3AC0A 3KSRA 4JLVA 3PPWA 3T95A 1KZHA 3AY6A 4UMVA 2EWMA 1FJXA 2CY0A 4CR8A 4UEOA 5K3FB 3PFFA 2H7YA 1Y81A 3V7YA 2Q1UA 2ZB4A 2BFFB 4EHDA 1FF9A 3CLKA 1USIA 4P3XA 2C9CA 3AEKB 3W5DA 5AKLA 3RYCB 4JOBA 1XCJA 1CFZA 3HPQA 4QFCA 1TEHA 1XVLA 3P19A 1XTUA 2CD9A 1GCOA 3EXIB 2PH1A 1YZTA 2NZUG 1Y63A 4Q5IA 4W99A 4ZI3A 4RPIA 2CHVA 5MN4A 1AVTA 1RTKA 2Z5FA 1ES9A 4OJTA 1LJ8A 2VSNA 4KXQA 3V6MA 1WTAA 2FWJA 1T8SA 3GLKA 4HGPA 3UQZA 1AQJA 4UZFA 2P3LA 5FPPA 1VBMA 1VJ1A 1KH3A 1T3SA 4N0DA 5DYTA 3STTA 3WJAA 2HBZA 3C8ZA 3SK0A 4MUFA 1U6JA 4Z8XA 1NVGA 1T2CA 2XE7A 5LYJF 2PSHA 4FFPA 1PN3A 1E7MA 4EUHA 1TADA 3CF2A 2VP9A 4BX2A 2D0OB 1T9GS 2PZJA 4TMKA 1I10A 2IF0A 2VRNA 1EFKA 4QHTA 1X8KA 4TLMB 1BXGB 5IT0A 1QHNA 4FS8A 1MB9A 3DL2A 3E9DA 4G01B 4HT3B 2HCJB 3SSOA 2SKCA 3T7CA 5ELMA 5E8JA 4LYHA 4LC9A 1NIPA 3G82C 4XXHA 3FNIA 1Z9BA 3QEBZ 2PRIA 1XEXB 2PLWA 3GV0A 4GM1A 4BPRA 4E5UA 1SVUA 2G9QA 3TFWA 2C3PA 3WRXA 4MI3A 2DCMA 2YIDA 1E6UA 1Z68A 3G9UA 3NJ8A 4RGVA 4D4IA 4N6OA 3ZXIA 4TTTS 2RH5A 2WM2A 5FI3A 1EUQA 1JSRA 2G9UA 2KW5A 4MZXA 1OT5A 4J03A 1G2OA 2WUDA 3D4LA 3E2IA 4BHTA 1EFLA 4F3KA 4EWLA 1AKUA 1CS0B 2E5FA 4DZRA 5IXYA 2W11A 1B43A 1EFUA 3R3JA 4KLCA 5FTKA 4MTCA 1MT3A 5KVQA 5KWEA 3DYVA 4EUFA 1ZFNA 3BMNB 1JQKA 3KT8A 1UEXC 4DGQA 5KAMA 1ILEA 1PV2A 2KB0A 4WCVA 2Y0PA 3M6XA 5DWVA 5ED4A 2I2XB 3TLKA 2J41A 4H27A 5CW1A 5KDDA 4H3KB 4G56A 3DNFA 4LX0A 1RZ3A 4P36A 2H52A 5SV2A 1CZNA 2JIPA 3K9WA 1J20A 3G13A 5IEJA 1ABBA 2PBRA 1I5RA 1R5BA 3T7EA 1ULTA 4I2VA 1YVPA 3A2LA 3R6WA 1JX6A 3EGDB 3ZKWB 2RAUA 3ZCTA 2NU9B 1DDGA 2HN9A 4H35A 4AZ3B 1HDOA 4Y6RA 2XEDA 4DG5A 3HWSA 2JRLA 5KYGA 4RE6A 4HAWA 1N77A 3Q7EA 2FW7A 1LW7A 4R98A 3K6RA 1W2GA 3FM9A 2HCRA 4D74A 1R37A 1XCGB 2ZTMA 2YN2A 3GYBA 2YNMC 4L72A 1CG6A 4MHOA 4PLGA 3P4XA 5ICEA 1Q92A 3H0EA 3HU3A 3PFGA 4Z4IA 1M54A 2RB4A 1K5DA 1LC0A 5DHFA 1CEQA 4UU0A 2Z6VA 4DLZA 3OF5A 3WYEA 1J07A 4A27A 1FRVA 1PWHA 3ED5A 3R7AA 4EMUA 4NOLA 4U2EA 3LFTA 4QDZA 3Q72A 3O9ZA 1L4MA 1GNRA 4R4JA 1DIOB 3HJNA 4PPYA 3UN1A 3I2GA 1VKOA 4JZYA 3O8QA 2XWJI 1E4YA 1JRLA 1PKEA 2FPRA 3CA8A 3L0ZA 4ME6A 4CF7A 2ZAYA 4LBVA 4WE3A 4CDRA 1QZ3A 4GF5A 3LBAA 2R3SA 2PD3A 1OFGA 4JCCA 5JS2A 1XPJA 2G04A 2Z2YA 2WINI 3A70A 3AETB 3IVXA 3GNLA 3KJZA 4UCFA 3B3JA 2FPGB 1PFVA 4WXPA 3V97A 1DCTA 4FYPA 1G3MA 2ZRPA 4RLSA 5JYBA 5AH0A 1Q3KA 5DOZA 3TB4A 2BHNA 1NW9B 5AKZA 1VZ3A 3MN1A 4YALA 1ZUNB 1DP4A 4EHKA 5DTEA 1JVBA 3RU9A 1Q0UA 4NE2A 3IDQA 5CLLA 4OHWA 3WDSA 4JP1A 4EEKA 2R8EA 1EZZA 2XDWA 4CKEA 5K0BA 2BKVA 4EMSA 3ASUA 5JVDF 1Y5RA 1YA4A 4X3CA 3N8IA 1EFPB 2QUKA 4QLOA 2JLUA 3CKYA 3V1TC 5ALTA 1N7GA 3KLMX 2ZANA 4QG7A 1QHGA 3SC4A 4UPDA 3ORFA 3LAWA 2A6PA 1QB8A 5TGDA 4NS1A 3BN3A 2BFOA 2JVJA 4RY0A 1BN6A 1O8BA 2ECOA 3ETLA 3WGYA 4CU2A 3CW9A 3H83A 3SDBA 1TZKA 4AJOA 4R1SA 4NMHA 1NXOA 1S2DA 1YB7A 2HLDD 1QH1A 2W0SA 3C6QA 3EUWA 1XCMA 1QKKA 3DJYA 4BNDB 4BXOB 3GUUA 4HLNA 2AG0A 1AQLA 1Z7WA 1WDTA 1I8TA 3G3EA 4JJ8A 4RZXA 5C3MA 4YAUA 3WHKA 1H5UA 2EP8A 4BO2A 1FVFA 1W35A 3CISA 4D0RA 2O54A 1K3FA 3CU5A 5EMMA 1GIAA 2VHWA 4MGYR 3C3MA 4HFJA 5CFNA 3KKQA 3QF7A 3F4KA 4DJ5X 2IEDA 1MENA 2WWGA 3BZBA 5L4LA 2C1EA 2X3YA 2JJ1D 4LE0A 2R66A 4EB6A 1K5GA 5IWAB 4CDNA 3OX2A 4Z9FA 1EHYA 2ZG6A 3L8YA 3BQ9A 3TGLA 3LCVB 4P2GA 2FSSA 4LKOA 1GUZA 1UJ2A 1LC3A 5LC1A 3RTCA 3JYNA 3CS3A 3ONDA 2R25B 4GBED 1XAIA 5LA6F 2HJSA 3L41A 4PANA 2KMLA 1XCBA 3SS9X 4RHXA 5TPWA 3FMIA 1HFEL 3RYIA 1MZPA 1M2HA 3T7RA 3E15A 1J0BA 1P75A 2BRUC 1NN5A 1QAQA 2YC4C 3ADPA 1FMFA 2L69A 3QPAA 4GRIA 1YJBA 4URFA 1GFWA 3EY4A 2A1UA 3BERA 1Z18A 1FP1D 3OTHA 1Y3DE 5C8YF 3UV3A 4D9MA 4C20A 5FWXA 3VVLA 5I7VA 2X22A 1NBMA 2AQIA 1OLSB 3EVDA 3O94A 4OVKA 3DW1X 5KYXB 1SC4A 4DSZA 3RUDA 4QJ3A 1LDEA 4CV0A 4B6RA 4UMFA 3K1ZA 4WZ6A 4EJFA 4H6WA 3JQRA 1W5EA 4OHCA 4OQYA 4A10A 1FDRA 2JLSA 2CZGA 3FDXA 2AN4A 5E7MA 3JASB 4RKWA 4MQEA 3VO2A 1N5IA 4WOBA 1W94A 1M3SA 2GJSA 3N2NA 3ZE6A 2C2BA 2G5PA 1F2UB 4LWPA 5A0FA 5E2BA 1NHGA 1PK8A 1JHVA 4OXKA 5AOAA 5KKCA 2EZTA 1IC6A 5IVHA 4DUGA 3PV0A 2O8DA 1H2FA 5KYTA 2A7QA 3WA7A 4BJHB 3ZOZA 1W87A 1CYDA 3VAAA 4EYSA 1JJ7A 3DQPA 5B6JA 1CKEA 4FOSA 2DFDA 3BCSA 3PGMA 1SXJE 2QJWA 2QVXX 1LSUA 1XMXA 2VJBA 4JITA 3NBUA 3PHGA 4YV2A 2CYCA 1HYEA 4UBKA 5FIUA 3DBHA 4IDDA 4KRGA 4P08A 4ZHQB 4KRYA 4FLEA 1BEEA 1J0EA 1CHNA 2X15A 3FTNA 2XCQA 2ZULA 3FVRA 4FWBA 4OK6A 1GR1A 4TTSA 2D5IA 3HABA 1YR6A 2VJMA 1QCDA 1VPVA 2I1LA 2I7DA 3X1YA 5H68A 4HAOA 3BXEA 2XBLA 4S2EA 5EQDA 3KVOA 2PGXA 3LVQE 4K87A 3QVUA 5CFRA 2QPLA 1DC4A 3CZRA 3O3CA 2FWPA 3G6WA 1YR2A 3T4PA 3ICOA 3GT4A 3LUPA 4S1OA 3WS7A 1RXEA 4N0PA 3OF2A 1AK2A 3Q2KA 2NP6A 5ALSA 2ZRAA 1SCUA 2OHVA 3DKPA 1GEEA 1OWOA 3MELA 4R9RA 4ZVOA 2OV8A 1OZ0A 5JE8A 4LXYA 3UOAB 4F1KA 5JH7F 1NWHA 2R60A 3R44A 5FOSA 1BDMA 1PBNA 3T3IA 3A25A 1JJAA 5BWMA 1BROA 1VMIA 2F90A 5AVTA 3BBLA 1YS4A 4JB3A 1GTG1 4UNIA 1NQWA 4NATA 1YDEA 4RVGA 3KXKA 1BGWA 2YZKA 3UUWA 4TWBA 5IMSA 5A2QA 2FAXA 5TGZA 4D7AA 4ZAZA 4RYDA 3X2FA 1BFUA 3HJAA 1Q22A 1Y33E 3MPUA 3DB1A 2Z6AA 2QRMA 1O95A 4GAEA 2V7TA 2BFAA 2YFYA 2O2CA 2IYRA 4D8XA 3TNLA 3FTCA 3HYNA 3E6AA 3RYHA 3I8SA 4YCBA 5TQVA 1EIZA 1P1HA 2OP1A 4KE9A 1THTA 1TI7A 1UEIA 1MAAA 2OY0A 1JLLA 1TO2E 3FGPA 3FFBA 2AMFA 4AP5A 1NXVA 3K35A 2MYNA 3A3PA 5C35A 1AD2A 5D7BA 2YV3A 5BWLA 3UMFA 3B52X 4TKLA 2ISSD 4KWIA 5IYZF 3OJLA 1R0ZA 5GONB 2UZ1B 3O8OB 3UXHA 1A9OA 2Y1WA 4LCEA 3MFQA 4IIJF 4RK7A 1SZCA 1IBSA 2PUVA 3SEFA 4G25A 5TXGA 1P0MA 3ZHRA 5BORA 1AHNA 1TQ2A 4P38A 2O8CA 2FK7A 4GIBA 3HRKA 1GQRA 1KVQA 4RF4A 2TSYB 3ZV4A 3H9JA 4RHTA 2VWQA 2Z9CA 4MR8B 1NZFA 1FTYA 2Z43A 2HK7A 4YCDA 1XYGA 5DM1A 1HBJA 3ZV6A 3FPGA 2LUOA 5E4JA 3TQCA 4F2WA 3FETA 3DSRA 4DM3A 3I6MA 1KEEA 1EJBA 3QU7A 3Q8WA 1MN6A 2I7TA 1I7NA 1JEQB 3IELA 4U2BA 1TT5A 5L7YA 1Z4OA 1F4PA 3VDMA 3HN7A 1ZLXA 4QULA 2NPIA 2R1TB 5CBPA 3V6LA 5JH7B 1P3DA 1NFFA 3QU2A 4K9DA 1J5EB 2EERA 1AH2A 4QTXA 3BVPA 4RKRA 4K1LA 3IHLA 2I91A 3G2NA 4FFNA 5H9VA 2PA0A 1ADGA 2I6GA 1QYCA 5HM8A 1NU8A 1NMEA 3OM1A 5IABA 1W6RA 4ZO6A 4BUJA 2Y66A 3QI7A 3EXFA 1ZMBA 2QJTA 3FBGA 4A8TA 1QYIA 1AUOA 1TA4A 1Q7EA 2JBWA 3FVVA 1SKYB 1F8GA 1X39A 2NLOA 1T26A 3AUTA 3TR6A 3PXAA 2XRMA 4EFDA 1E0KA 3QBVA 1D1PA 3UJDA 1TD1A 1TQ6A 4DILA 1JXQA 1L1RA 5CU7A 4JQZA 5G1NA 1MG0A 2XUPA 1KXZA 1Y4ZA 1HE4A 1W8IA 4PXAA 1TO1E 2ATEA 2B7BA 1I33A 2GZ2A 2WWFA 1JECA 3UG7A 2MT9A 2Q49A 5ITZA 2JHGA 2VVTA 3JAMA 4CM8A 2DPMA 5ADHA 4BYGA 3GYGA 1RIFA 2Y77A 3PD7A 4ARSA 3M6WA 2YS7A 3KIPA 121PA 2A5JA 1VQ1A 3KZNA 4GSLA 4YNBA 1A8UA 1SD5A 1Z0ZA 2A9OA 1ADYA 5P21A 3RSZA 2IXAA 2D2IA 1ORHA 1BXZA 2H31A 4U7FA 1RYFA 2OCIA 1GTSA 2FPIA 5H02A 5CW2A 2Q8QA 3I01M 2ADOA 2CB0A 4HGNA 1FDUA 3INYA 3WLQA 5IHPA 3EXHB 3DH0A 2I66A 3ZOKA 4EYKA 5LQDA 4YY3B 4IFEA 3OEED 2ODWA 3ZLVA 4HD8A 5KSPA 3DWFA 2BUCA 3C7KA 2HX1A 5ALRA 4OGWA 1SOUA 1MJ5A 1IY0A 1X2BA 3QITA 4JKIA 3VDNB 3W4JA 2F59A 2DYKA 2YZGA 5B64A 2VEOA 3D43A 3GHYA 3HCOA 2NGRA 4UHBA 2DULA 1AK9A 4PN3A 4DCGA 3CNNA 3N2YA 5FB3A 4RENA 3P9ZA 3RVMA 3MJ4A 2FSUA 3RUCA 4CQMB 4LYYA 1JFFA 5IJZA 1DV1A 4ERNA 4H3SA 5IM4A 5CVTA 2FPKA 3UWDA 1B73A 1IJKA 4RUKA 3V9AA 1VPTA 3Q41A 3VR5H 1YJ8A 1OAOC 3QPWA 4GI2A 5D3ZA 2WDPA 4JB2A 1ZM4A 3HMKA 1KFEB 2R00A 3JQPA 3V8BA 4LUCA 5M5BA 2H18A 1GCGA 1J90A 1GVNB 1YNSA 1L7EA 1O6BA 3EWIA 4Y3UA 1VGRA 2YV1A 4H6XA 4IZOA 1ECLA 4C21A 2BSQA 1XEFA 4GS5A 3TJMA 4JSYA 5T4EA 1XX6A 3PX7A 1BNCA 4Y18A 4CR7A 3G8DA 3DHYA 2C78A 2PGAA 1OXVA 3B3QA 3BKWA 5EIBD 2B2NA 4KWCA 4V1CA 1ZH2A 4MLPA 1ZZGA 2G4CA 3AFOA 1BO6A 4MRMA 4AG5A 2AOWA 4U2KA 2O8BA 2AW5A 3ADKA 2WUVA 4REQA 1G7RA 1KEVA 3MT0A 4Y6GB 4JNKA 4Q1EA 1JKJA 3X43A 3REQA 1N75A 2PH5A 3V4OA 1E59A 2BTOA 3O03A 3PT9A 4L7VA 4RKQA 2RHGB 4YRCA 4L9SA 1JQ3A 4PZ9A 5I9MA 1FXWA 1A9SA 3C5CA 5AM4A 4QD3A 4EFMA 1RQ7A 1UWVA 3SZRA 2GHIA 3DDCA 1O89A 3IQIX 5YASA 3MBKA 3V8PA 4DF3A 3IXLA 4U5XA 5LZ4A 2R8ZA 1ZD1A 1R15A 3DOCA 1HURA 1PGPA 2XDYA 1G60A 1UKBA 2QT0A 4OBBA 3A2MA 3FOZA 3Q40A 1M2EA 5JEDA 4H18A 5JSHA 1KKLA 2FOIA 2DUWA 2IZ7A 2CNWD 1SZJG 2RIRA 4HNRA 3TLZA 1D6NA 3C4JA 3C6YA 4D8WA 3I2HA 5J23A 1XPUA 1NVXQ 1BD4A 2PGDA 3VX4A 4A8JA 1Z35A 4UTVA 1EGVB 3ND5A 1QRTA 3LBYA 3NUQA 2G5TA 2ZREA 3QU4A 1DEKA 3SBDA 3FKQA 3TOZA 4BDTA 2NTEA 3ITDA 4MRSA 1DCFA 5DVZA 3VNAA 3WL8A 5B57C 1G8KA 2CXXA 4YFVA 4FZVA 5JHHB 5FT9A 1V6AA 5ALHA 2IPXA 4IOLA 3TQFA 2QM7A 1XZFA 2EBFX 1XMQB 3GLUA 3EMDA 2RB5A 3NHWA 3FMOB 3NM4A 4AJJA 3SKXA 5IDYA 1NBOA 1L5FA 1FDSA 5DX0A 1WOMA 3E5RA 3FGNA 4FNGA 1UINA 3EGXB 4WA8A 3GI1A 1R12A 1NY6A 1IHYA 1OHHD 5K51A 4FWTA 1N9GB 1CIVA 1YZQA 3OOSA 3OEHD 4QBKA 3UWPA 5DXFA 4EW2A 2R6GA 3IA2A 3MGCA 1SC9A 4G86A 4G1MB 1P73A 1T5SA 1VCOA 5CFMA 3I83A 3TPZA 4F7DA 4JVNA 4WASA 4GOMD 3M82A 1TU0A 2ZS9A 1E3IA 1R8JA 1CUBA 2VHXA 3TDNA 3D54D 4E14A 4JYBA 2XOKA 3AOEA 4DA4A 3VSEA 1KMMA 1ZGJA 3FUUA 1G9SA 1CY7A 1U28C 1X7GA 3OZGA 3ZBUA 2WTBA 5FPKA 5ELXA 4C7OB 5KNDA 3A9SA 1BQEA 2V7VA 1YBMA 2C82A 3MJDA 4WY8A 1K98A 4EAAA 3EIXA 5HNKA 5FV4A 1KGDA 3WR5A 2VQDA 2BFEA 4LGCA 3AG6A 3QPUA 1W1IA 1H9BA 1MVLA 3HKEA 2IU3A 2XTMA 4Q3DA 4DTIA 1KFJB 1UWCA 1ZM9A 4AG6A 5B7PA 4B73A 1C8BA 1Q0SA 1H1LB 4I9FA 2ETXA 3FSRA 2XNKA 3KB6A 5DF1A 3U60B 1AUPA 1EB9A 4KFRA 2YS6A 1OASA 5G4LA 3AR5A 4F5DA 1FU7A 4EVIA 2AKAB 2XB8A 1SHTX 2ECQA 3A4NA 4U1RA 5IJXA 3RH0A 4H7HA 2Z1NA 5MFZA 5KMGB 2JJ2A 1G2QA 1PGJA 1NVKA 3WRYA 5ABPA 2VHJA 1IE3A 1XL0A 2W22A 4HAVA 4R2JA 2C04A 4G36A 1M7GA 4RK1A 3KHSA 4WH0A 4JMPA 4YDRA 2DPHA 3HK2A 4TLDA 4XIIA 5CVVA 4FNAA 4FX2A 1EGMB 3TPFA 1E2IA 1B00A 1XZKA 4EGCB 3WADA 3PVCA 3SC2B 1WXXA 5C7LO 2QGFA 2AC7A 3IDOA 3BUSA 1CUEA 1O97C 3M3DA 4ZCMA 4FFBB 4JT9A 3N1UA 2JCBA 5DX1A 4PWZA 2O3UA 4IV5A 5F78A 3RSSA 3U6KA 2OAQ1 4G0YA 2GTHA 4I55B 5KX5A 3WMGA 3DKRA 3GR6A 1RXVA 3QXXA 2CLMB 1E5DA 4GX2A 3AL3A 4F5WA 5JZSA 4U7JA 3PNMA 3ICPA 3ZV3A 5C7OO 5A1TA 5HQ3A 1NVAA 1Y1SA 1GPJA 3IURA 4PF1A 4UCQA 3UENA 4C4ZA 2GXSA 5HMMA 2HT1A 1SXJA 4HNAB 4QNMA 1N3YA 2V7PA 1L1QA 2B1IA 4PY2A 4RTOA 2B5VA 3EODA 3QOFA 3M9WA 2JG3A 2C2OA 3QWBA 4QQRA 1Z2CA 2EBWA 4WKNA 1F2VA 2FOLA 1TA0A 5H3LA 2EW8A 3CG0A 5GM1A 1AGYA 4WJZA 2WY2D 4NOMA 3AM5A 3ICWA 4R9UC 2XCOA 1AB5A 5LP6C 2QEQA 1C3VA 3SSNA 3SXPA 1J0XO 3P9KA 4F6RB 2FW1A 3T5AA 3R7LA 4YIHA 5EP1A 2PX2A 2QUBA 4P9NA 5JI2E 3GAAA 3M6IA 2QX9A 2IDKA 3JQ7B 3ROTA 4K9RA 2VNSA 4JYZA 3QI2A 5KYNA 2C4TA 1YGYA 3DZBA 3OC6A 1MR3F 1B3RA 2OC9A 2X0DA 3QVOA 3W6PA 1PRYA 1E32A 3R40A 2IXBA 4G09A 4M1TA 4M7PA 2M9MA 2R68A 2F48A 2OILA 2Z9DA 3EMBA 3R6DA 4QAQA 5FTNA 3MEQA 2QLBA 1H0KA 1Q0QA 3D6VA 3DXFA 1PS9A 2C8VA 1WMSA 2P9EA 2QVBA 1CZLA 2VQ3A 2W8BA 3GDGA 3MCAA 4AIRA 3ENVA 5LMZA 2UZ3A 3PGJA 4JELA 1TZBA 1LS6A 1ZH8A 4B3BA 4BVLA 1RM0A 3S70A 1H22A 3T34A 4YLYA 3ZVNA 3EFHA 4CCYA 5MGBA 4UCWA 2GLXA 2WIJA 3F7OA 4MRVA 1FTSA 2PWPA 5F5NA 2OHHA 3AFIA 4B40A 4XIFA 3WGGA 4EEXA 2P27A 2V6GA 2M32A 4MWOA 5JZVA 5C32A 4K2HA 3RB8A 3ONNA 2CSXA 4PRZA 4IEFB 1ZOLA 2G3YA 4ZDKA 4BP9A 3D7RA 3FBTA 3Q0TA 4XWTA 2C9DA 3N05A 4PEVA 4IIXA 1T0HB 2DU8A 2ZRCA 4HLCA 3CRVA 5DE3A 3H4VA 3VQTA 5EY5B 1MTZA 4B0PA 4JJZA 3HXOA 4K26A 3TJZA 3CNLA 4MUEA 2O59A 1XVUA 3S55A 3KOUA 3OTQA 3K6SA 2NVBA 2WD7B 2ZR9A 3L6DA 5BNWA 2VI5A 2VZ8A 4W9NC 3CE9A 1YZLA 4CIVA 3MHTA 3HU5A 5JAZA 1JPJA 2G9VA 2ZRFA 4FCCA 1A9TA 3RCBA 1EI9A 1ILWA 3K9GA 1UFRA 1TVKB 1HTTA 3UTDA 1UC5B 1RLTA 4IIHA 2W83A 4ARAA 3WGIA 1FCJA 2PAFA 5CDSA 1CLEA 1A2QA 4I14A 1Z13A 1Z6GA 2PA3A 4HAXA 4L2IA 4M0PA 4MV0A 1TCBA 4N54A 4QJ5A 4OKNA 1X8XA 4S2UA 3TD6A 3TLYA 4E2WA 2PJDA 4Q00A 4PICA 3LO5A 3CNBA 2DH5A 5IDVA 3UFXA 1YK1A 3MB8A 2Z3VA 3PTZA 4OK5A 4Y1RB 2LIPA 1P7WA 4YHBA 5K7SA 2GEBA 2IYVA 2AIRA 4TWIA 2ZM5A 4GOND 1ORVA 4F86A 3IV7A 2PNJA 1JMVA 3AILA 1PG0A 1DQSA 3GGSA 1U0RA 2WHEA 2GAIA 2ZIEA 1VGQA 1WAMA 4LRUA 2I9PA 3GBPA 1FVHA 1ZH4A 2Z1DA 2ZRIA 3W6ZA 5HGJA 1J1IA 3SNHA 3SHFA 2JFGA 2Y71A 2YZNA 3FROA 2C5AA 4R68A 4JC5A 3RRYA 4CM9A 2EYQA 2NVUB 1G5FA 3HYTA 3GT0A 3L6RA 1HV8A 1Q1GA 3HJHA 3ES9A 4EI2A 4ZYXA 3EZGA 4Q82A 3UJ8A 3I9KA 2O2IA 5KDLA 1I2MA 1CLUA 2C5LA 2NYRA 3E4DA 4ND5A 1OX6A 1TKCA 4YBRA 1Z3CA 4MPPA 3VYWA 5LDHA 3M1IA 5T8KA 3ZI0A 3QPCA 3EFEA 2Q9AA 3ZWQA 4DG8A 5L9AA 1EE9A 4R1LA 4CMIA 2OECA 3G0GA 2QU7A 1ZI6A 3CLTC 1P0QA 2WUFA 2WRZA 1RRGA 3D8TA 3RAEC 1MOZA 5FV7A 4HUQA 4ZVPA 1T9GR 4L57A 4RTKA 4JWKA 4C4XA 1RAGA 2O0MA 2B21A 4YDQA 3OF3A 4M88A 4MV6A 1VDMA 4WZAE 3WKCA 1J9ZA 2WM3A 3NUGA 2V3VA 5AK3A 3CKMA 4ZOAA 3TLGA 4Z4EA 3VH2A 1I3NA 4EI9A 2GXQA 1GKIA 1Q91A 2P4QA 1HDCA 4IMIB 1JIXA 3T1QA 2HTFA 4PQRA 3L3BA 3QE4A 4HB2A 1XLTA 4YRJA 3TD2A 5DHTA 3BF8A 3STXA 2Q46A 4MB0A 4TTQA 1IVSA 4AUEA 5JSUA 3V8VA 3CZPA 1J24A 1GAXA 2VIIA 3A06A 4YJ3A 1Y9EA 3VR1A 1WMFA 4QL3A 1PT6A 3AY7A 1R4MA 3KEQA 4KVZA 4JC0A 2QI9C 3MBIA 4CM1A 1BXRB 3LP6A 1OPRA 1Y3FE 4QIHA 4GYKA 3PFHA 3YASA 3JU3A 1V39A 3QXSA 3MS7A 4CKZA 4UU1A 3LUAA 4F5ZA 1ZUHA 5CM8B 1GUFA 1S6YA 4J1NA 3ZIAA 3LQYA 2II6A 5HA5A 4FMDF 1SCDA 2IIQA 4XB1A 1Y98A 2J0UB 2NZVG 3GDOA 4Q0MA 1KE1A 4PZYA 4Q3KA 1Z6ZA 3HCNA 1DSSG 1O5IA 4GPZA 4UAJA 2IZOA 1NKTA 2W6JD 4P7KA 3MINB 3K9BA 4R9VA 3V8NA 3AIOA 3S2FA 1R6UA 3DV0A 2VF5X 1RWVA 2Y99A 5CNJA 2JF0A 4XOUA 1Z0SA 2J85A 1SHJA 1EUCB 3IUQA 3R7WB 3RQSA 2L42A 3ZJYA 2ANBA 5EKUA 1TK3A 4JUIA 3KZKA 3RRNA 3U1TA 3KQMA 1VJCA 2CL0X 3WMXA 3H9EO 3AUAA 4ZAGA 3TLMA 3ZE7A 1SCKA 4IZ6A 3F78A 3E8SA 3M1YA 3WYCA 1O5TA 4AB1A 5FBVB 2X8WA 3AX6A 1DIGA 3L6CA 4KYIB 5G0TA 3OZFA 1EMDA 2G6BA 2C4WA 4OXRA 4TUYF 4WHMA 4YP5A 3ZWCA 3FJYA 3BGDA 1TQHA 3QVVA 1WV1A 4C78A 4N41A 4RIIA 3L1HA 1RM3A 3QWHA 1Q5PA 4RVCA 4FGWA 3ON5A 4QNRA 3LOQA 3NIDB 1A4IA 4EHLA 3UJAA 1RC8A 3Q1LA 4ZC1A 4IJVA 3PPYA 1M66A 4XWGA 2W6CX 1PL0A 5HQTA 3GLGA 2QVZX 5EZYB 5CB4A 1K9VF 3QY9A 1TLTA 5IK2A 4L74A 2CCKA 3WAKA 5EWMB 5DEIA 1G3QA 1E9AA 2XQVA 2FFBA 1IOVA 4DXDA 1J2JA 3OU2A 3TCXB 5HCUA 4YP1A 1QHFA 4R2LA 3PQ5A 4B6PA 4N7RA 4P54A 3WIOA 5IH3A 4UHDA 1OD6A 4MB2A 3AKYA 5B1DA 3INRA 1VLZA 1AURA 1E4VA 2QV0A 2O1EA 3FJ1A 1YTUA 3TINA 1YL5A 3RS0A 2A86A 1ZICA 3ECAA 3H8JA 4D42A 1YB2A 4Q9HA 4FZJA 3VR6D 4QEKA 4YO8A 3OETA 3R9KA 2LW7A 3RJMA 3WK7A 1SVSA 1WKBA 1YL6A 4GPEA 4KBYA 1NGSA 3SZLA 4L07A 1QF7A 1S8AA 1A9PA 3E84A 4TOIA 3A4YA 4LXGA 3LCJA 3BYZA 1YL7A 3JQQA 4BLRA 1G7CA 4TQ9A 4CKWA 1MA0A 1OH8A 2HBQA 2VPWA 4O4LB 3M6FA 2AFRA 4IOKA 1L5LA 2HCFA 1PWEA 1EK6A 3PQ6A 3X1XA 2ZJZA 2GZDA 1QH8B 2WIFA 1KIMA 3O73A 3FVWA 1N6KA 3ZDRA 3OQPA 1P18A 2E0IA 1WQ1R 4IY1A 1PSWA 4CIBA 2VTBA 4EELA 3CR7A 5JOQA 2HJVA 1G1AA 1CY8A 3O21A 3H17A 4LYAA 5GIOE 5DLQC 3HO1A 3R9XA 1J9EA 1Z0DA 1F2DA 2QNBA 2VZ0A 4L15A 4QNNA 4EIWA 2IVFA 4WKBA 1N5LA 2MINB 3ZZ1A 2CNNA 3ST7A 2B2XA 4XW2A 3O8BA 4PG6A 1SZDA 2I62A 4NV3A 2J7KA 2W93A 1P3JA 1U0SY 3ELWA 3IOMA 4J76A 3RRFA 4ZYTA 4M1SA 5KWIA 1YRQA 4DLVA 3S8YA 2CDCA 2X2OA 4P7GA 5CT8A 2Z8ZA 4J4TA 1PGNA 5FULA 3LNCA 5HIKA 3AR4A 5EJ8A 2BKXA 3TMYA 1DX6A 4DCVA 4A5OA 2J08A 2H1WA 2GCPA 3HBAA 4KDCA 1WB6A 3CRRA 4DDUA 4DM4A 2HO4A 4YUVA 4BKMA 1SQSA 3ZHSA 1PJBA 2XSZD 3DEZA 3B6JA 1RAHA 4RTLA 1FUUA 2FRDC 3I30X 5I7RA 1TYEB 1SZPA 1U9IC 1L7MA 3C3YA 3FNRA 3GUYA 3NT4A 4HQRA 4CQMD 1RJFA 7REQB 1H2XA 3G1WA 1Q7BA 4QA9A 2K2QB 2P8JA 2RGDA 4FS3A 5F5LA 4QSMA 3TUJC 2XUAA 5DYGA 4QLBA 2DMRA 4B2PA 3ECSA 5J63A 3ROPA 4DYHA 3DCIA 1KOGA 1HMYA 1PIWA 1V5GA 4NMXB 3O1HB 2GYUA 3AJEA 3R75A 3O0DA 2EGGA 3PUXA 1C30A 3OIWA 4MMYB 2CNOA 5DGTA 4V1CI 2DUNA 1CULC 1IPHA 3VJRA 4BLOA 3UAGA 4HEQA 2BMAA 3GFVA 1EA5A 1I13A 1QH0A 1ZUD1 1IB0A 4GDMA 4IFIA 1QNLA 4C0AC 5B58C 3GRYA 4WEQA 3RE1A 4MYTA 3SCZA 1RFLA 2B7LA 1VI6A 1V96A 3W3AD 4CKEB 1KIFA 4F46A 3LM8A 3MD0A 2X1MA 3AEXA 1NFRA 4KYVA 2AV6A 1MD9A 3ELUA 4QDKA 2ZJ1A 3K16A 4N3AA 5AKHA 5MHTA 4NAVA 4KX5A 3OAAD 3Q8XB 1BC5A 1IN8A 2IZ1A 3D9QX 3F4BA 1JDTA 1DJQA 4PLYA 2OD9A 1QDLB 3DYIA 4K8OA 1HE2A 4DSAA 1OLUA 3AUKA 4FYJA 3E9CA 1Z15A 1P5JA 1RYMA 5CK4A 4CKYA 3H0KA 2REQA 4I46A 5CP8A 1W4LA 1Z34A 2NV6A 5DXAA 3GBSA 5H80A 4BBPA 1BX1A 2H5JA 4QUGA 5K3EA 4XGQA 2ZAMA 4ZAYA 1Z7GA 4D43A 1P33A 1X1RA 1SG6A 2C20A 5F5XA 1BGXT 2P0AA 3AJAA 4C4PA 1TK2A 2VXBA 3A32A 4N82A 2OR3A 3FFXA 1F7VA 4Q03A 3KOYA 1U8TA 3LYHA 1XEWY 1RYZA 1U81A 3GFTA 4OI2A 1G41A 5M04A 2WQZA 1T1EA 5AUOB 1YI8A 2WK1A 4B7AA 4B43A 2OEPA 1FYWA 3RUFA 5CFPA 3QSYA 2R97A 2BFCB 2WMNB 3I64A 2RHDA 5AVVA 1TPZA 3JAKB 5CYOA 2PJUA 3BWYA 1ZOIA 3KYBA 1CQWA 2WI8A 2G83A 3SNKA 4LDAA 1HOXA 2WB4A 5CDFE 4OLHA 2LTAA 2EFJA 1SC6A 3SSMA 2YBDA 2RHMA 3WYBA 3UB4A 4LV6A 4E51A 4OMFG 3IQHX 1R6TA 1USGA 3NH9A 1IPFA 1XHEA 1PX0A 1KDVA 5CVUA 1NZDA 5KVCA 3ZXSA 5BMOA 3DBVO 4IHAA 4WNIA 4YT8A 1SQGA 1VE1A 1SBQA 4FOTA 4M6WA 2GGSA 1IY9A 1K4KA 1UBSB 4MI6A 4C01A 5HKBA 2YHIA 3PUZA 2ZAOA 1G21E 4PZPA 5C9ZA 2FPXA 4RTSA 5SYMA 1G8GA 2BGIA 1QIMA 4XE5A 1VKZA 1BE1A 2PUAA 3NBZC 1MO3A 3W06A 2YHAA 2JIRA 1EE1A 3F71A 1GA1A 3TTYA 1JFVA 3G8BA 3CE6A 1C7EA 1TJNA 1ZCZA 3WDLA 2O8DB 1F6BA 3SIXA 3N53A 2WWHA 3OA2A 1W85A 2PX6A 3GBVA 1Z7BA 3L7YA 2CNLA 2JIZD 2WUWE 3BB3A 4QDXA 1TUBA 5A7GA 3ZHYA 4G0UA 1DG3A 2AYZA 2R6AA 4U2DA 2J6IA 2XKJE 3DE2X 3PENA 3R7NA 3A1TA 4BGIA 2ETVA 3IEUA 4PC2A 3EA4A 1EFDN 4ZMRA 3DBHB 2QMQA 4U6SA 2XVMA 1SIBE 4WY2A 1QVRA 2J59A 2BZ1A 3T54A 1FP2A 2Q3HA 2NSYA 1N3LA 3DF9A 3BL6A 3G7NA 1TM1E 3HDGA 4PVCA 4WOJA 4E08A 4AJNA 3LHDA 1D09A 2ZJ6A 4MKHA 4RPKA 2IODA 1IWPB 1J56A 4D3YA 1C8LA 5IF9A 2Z04A 2K2WA 1SXGA 2YN4A 3H42B 3BRSA 3MGAA 1E1QA 1ESDA 2A1IA 3CF0A 4A9AA 4A0FA 4YUXA 2YJ4A 3GJ7A 5GY7A 5KBYA 2QDKA 4LNHA 2P5YA 4EJSA 4UNPA 4WESA 3EDCA 1H66A 2OKGA 2CHQA 4LDJA 3GRUA 4CT5A 3EPLA 3C98A 3UV6A 1F8YA 1ABFA 1G55A 2W4QA 3EIEA 4IGKA 4QPPA 1VCHA 1I24A 4BN5A 3ZPXA 4ZQHA 5TT0A 4IVPA 1L4BA 2VNJA 4LZLA 4IJKA 4LF5B 3VVBA 1AS3A 1T2FA 1XMOB 1GNPA 1ID8A 3FKSA 3BC1A 3VKVA 3CT4A 1A2KC 4KE7A 4GRAA 2WU4A 2FH5B 3HLTA 5CLGA 4LTDA 1Z4QA 4DY4A 1ONOA 3UIEA 1QV6A 1Y5LA 3I1FA 4FT4A 5JBNA 1IQUA 5KQSA 4WZAA 2V6IA 2P68A 3UT5B 1V6SA 4BIIA 2REOA 3LP8A 4FR0A 3EEYA 4NHOA 2O50A 1M8JA 1MEJA 1TF5A 2WJAA 1OWPA 4LGMA 2BW0A 2V0GA 3RYHB 1THMA 1YC5A 4OJNA 4DQKA 4WBNF 4ZARA 4PGAA 3ZGNA 1ACJA 5K0TA 4YGYA 3WP1B 3ZZMA 1UOQA 1E1CB 1JIKA 3AU8A 2NVOA 3PDCA 3QUCA 2BMEA 3I6IA 2B78A 1V95A 1S2OA 4IGFA 2BF4A 2E1PA 4P7BA 5IBRA 3PQ3A 4CN9A 1GNTA 1T6XA 2QRZA 4IINA 5LCXA 3TAUA 3TCNA 1T0JB 1I6MA 2ISQA 3LX8A 4MS1B 1XA3A 4PGGA 5J2TA 3WOHA 1TRHA 1V9CA 3ZDQA 4EJMA 4R51A 3G5UA 1NVMB 3A2NA 4LOHA 3CRNA 2BM8A 1ZEJA 1NVVQ 1MGOA 1VB3A 2FUCA 1DIHA 2O3SA 3QQPA 4GSKA 4QU9A 3VI4B 1P39A 2QB5A 1E18A 5DHPA 1KSGA 1YDFA 2WYOA 8OHMA 1TJ4A 5CJPA 2Y2UA 3ZE8A 4ANFA 3AUSA 1GU1A 1ODSA 3BWCA 4XGIA 4Y6OA 1O77A 1JMKC 1NWCA 5T57A 1VC2A 4XZ3A 3SF0A 3TEFA 3W7AA 5A5GA 3OZRA 3WXBA 1UAYA 2OCGA 2QTCA 5EFZA 5I3CA 4KGVA 5ALMA 1L8AA 2Y68A 4M7RA 1C0EA 4NEHB 1TT5B 3OD1A 5JLJA 4NFHA 5FJJA 3CW2A 1UPCA 3ULKA 1CRZA 1XRMA 2X0JA 1BWPA 4N5MA 3O1IC 3JQBA 3PZRA 2P2NA 2QTWB 3HSKA 4G1BA 1TVEA 1LD3A 3L1VA 2CUTA 2EWWA 4YRLA 3BF7A 1PJQA 1Y6GA 2AYXA 5AJXA 1ZK0A 5F12A 3UGQA 3LYAA 4R3NA 2MMCA 5K09A 2C4UA 3RAJA 4ITVA 3ZWNA 4Q19A 1KAHA 5FR1A 1MABA 1GDDA 1A0OA 5TVKA 3GPCA 2QENA 4NNOA 3AJDA 5EUBA 2XQJA 2ZITA 2Y6UA 2XYRA 3ANXA 3UJCA 3TW0A 5ERGB 4LCJA 5IAEA 1GSIA 5BRAA 2AC4A 1MNQA 1UEJA 2PKQP 3F8SA 4OB8A 4ZPJA 1JA9A 1SCJA 1VI5A 2AZDA 3GHHA 1HQKA 2ZM6B 3MYRA 1EP2B 1AT1A 2CVZA 1WLYA 4CGZA 3ENQA 3I04M 2EOAA 2HTEA 3O4IA 2OAEA 4LVOA 4R6XA 3W2GA 4ER0A 3RS8A 4NFSA 4WECA 2FE4A 3JR7A 4GZ3A 4MW4A 2WLSA 1JJFA 2E21A 4CM8B 3QX3A 4MTLA 4OUKX 3UOWA 2IYTA 3NFYA 3D6JA 2ZTUA 3FHOA 3SI7A 2HQ1A 1IZZA 3FPFA 3EZLA 4DC9A 5JJ5A 2E6KA 3JVUA 1EGAA 1VP9A 1TA9A 5CFQA 2HU7A 1HYGA 4M1WA 1FXWF 3D8NA 4BUCA 4BE4A 1ZSVA 2LRHA 4JR2A 4R1PA 2M98A 5M7EA 4RZSA 1J1UA 1OKKD 4TS1A 3VNUA 3VHRA 4WFJA 2QQGA 5JEEA 4R1OA 3RBAA 4NY1A 3QLTA 2P9TA 3I4FA 1P2FA 1WSDA 1E1MA 1PCXA 1EXWA 1WXHA 3PYMA 3WLLA 4O25A 2HO5A 1JDJA 3WZMA 1QOQB 3FJOA 3B5JA 4RVSA 2WNHA 1TQDA 3D4OA 4DLSA 2ZSBA 3DQQA 1XRNA 3EMKA 5L7WA 5AFSA 2ZBVA 4UVIA 3TW8B 1P4GA 1X19A 1RXYA 2BBSA 2V6JA 5KSOA 4JI4B 4PAOA 3GDWA 1C1XB 1JFFB 2GWHA 2HSGA 3FPEA 3FYUA 5F21A 1HE8B 2DPYA 3PEYA 3GDFA 3KQKA 1X1AA 3BD9A 3LXMA 1JTFA 4XDGA 2QRNA 1HNZB 5CA0B 1K97A 3TEMA 5AOCA 3ZW9A 1ZN8A 1YQXA 3UWOA 4BN0A 2HWYA 4F4FA 3VISA 3A6ZA 1CZOA 1KR5A 2ZPTX 2BCJQ 2V5AA 4AKGA 1NJ5A 1JJBA 4TSRA 4RGBA 3G17A 4NE7A 4X97A 3QKWA 2NUTB 3K09A 3GVCA 3O90A 1G0NA 1DFGA 2PJZA 2ID8A 3Q7IA 3OX4A 4KIFA 2WP0A 4AO6A 2HPHA 4Y0NA 2PN1A 2YFKA 3Q5EA 4EUEA 3OT1B 1T15A 3PJFA 2HMTA 4YJKA 2JLRA 3G2LA 3OIDA 3W1VA 5C4GB 5ADWA 4TL6A 2O8BB 3GJ5A 4REQB 3WZ2A 4ZO8A 1P4SA 3PEUA 3REQB 2ERXA 1PE0A 2H63A 2QUAA 3KQUA 4ZVUA 2KSQA 3H5OA 3RG2A 3VO8A 2GF2A 4ERXA 2DB3A 1KAOA 4NSNA 2HIAA 1QQBA 2C4NA 2AJDA 4YI5A 1IZYA 1HUQA 2PL9A 3ZGLA 3VA7A 2AF3C 3I9JA 3A4IA 2OQIA 2O5RA 2FP3A 1B93A 2CDBA 2W2NA 2CMFA 3P0EA 1NW3A 5IKPA 3OE1A 1PK7A 3HG7A 1Z2NX 4KO8A 2CBZA 2WOJA 2NU6A 3W4IA 3O83A 3ZLUA 1TF7A 2WYIA 2UUBB 4B7UA 2IK8A 4MOWA 3ZGXA 2DG2A 4Y2UA 5F9FA 1VHLA 1CHDA 4BMVA 5CFLA 4QKQA 3RG8A 1N2IA 1RBQA 5K5EA 3EOZA 3NI2A 3ZD7A 2AH5A 1TVMA 3WSTA 4WADA 4RAOA 4Z4HA 5AM2A 2CVPA 3OPVA 4G5YA 3FSEA 4DLBA 2OO7A 4O1IA 2HCTA 3FPBA 1AGNA 1LFDB 1WM1A 3PQ4A 3D0QA 1M72A 1RD4A 3WLOA 4C5CA 4B3MB 1OA0A 5B3KA 1A76A 2QTLA 3ICVA 2ZI3A 4ZZ1A 3DE5X 2XODA 3HN2A 1FX0A 2ENUA 4B32A 3LLCA 2PVCA 1JE1A 5CPFA 1UJMA 4E88A 5AQ1A 4K2AA 3ZUPA 4ZKEA 5EIWA 2NWQA 2WM8A 2P6RA 1XZJA 1Z74A 4J1TC 4W6ZA 3A1SA 5IJ0A 2PO5A 3PXGA 2H4JA 3H16A 4N40A 2PWZA 4Y2VA 1Z73A 2NUAB 2QLNA 1MGPA 2ZE7A 3L18A 4QOHA 3MWDB 3TL3A 1QYWA 4MWEA 3ZWOA 1K5HA 2D4HA 1YO6A 3OCCA 4F60A 1KO1A 2MHCA 1Y7PA 2RG7A 2ZUFA 2O3RA 2QN1A 4MUGA 1KRHA 1ADBA 2ZU6A 1UC8A 1NMZA 1VLJA 2X6QA 4RGYA 4F72A 2V3WA 4PHHA 3T3PB 3X0DA 3KZOA 3VSCA 2HWXA 1EWVA 2H9AA 4L5JA 3NVKI 2DHEA 3EAQA 3A31A 3I0MA 4BWVA 4IUDS 5A4AA 2QL7A 3COYA 1GGVA 4CT4B 2INGX 3PE4A 2J5QA 4JS0A 1W76A 3HCFA 2GUWA 1LS1A 1T6YA 1KMCA 3F5DA 1RRKA 3HKEB 1RXWA 3C7CB 4PPQA 4B6QA 1YT5A 2OPBA 2MSEB 3DZ8A 4PQFA 4TV8A 5FORA 2D54A 3B6MA 3RS2A 4AM8A 3J81k 1I3CA 1XI2A 4XSGA 2I33A 3RREA 1R00A 3TFOA 4GW3A 4I4LA 2OQVA 1FFDA 1ZGZA 2QSZA 4E03A 1A82A 1PUXA 4A0GA 1P17A 3WGTA 2I4TA 2XRFA 3NHSA 2VP2A 1JWBB 2AB0A 1CEXA 2SBTA 5KPDA 4WFKA 3E61A 2IYZA 3FDZA 3KD2A 1W9HA 3LF1A 4C1NA 1HT2E 4W1QA 5AKGA 3EOAI 3PWTA 1CJSA 3I39X 3DXZA 5JDIC 3UK6A 1I4LD 3R3VA 1ISJA 3LGSA 4NPHA 4DRXB 4NBTA 4FFMA 3B1VA 4ICIA 4MX8A 1YCDA 4Q9AA 1RYBA 3B9RA 3NTQA 3P27A 2I67A 3PIIA 4R81A 1AN0A 1Z4KA 3NKFA 5EKSA 2DCUA 4FDUA 9ABPA 3AF3A 4BBJA 1NT2A 3ZLBA 2GN2A 2WV7A 4GX1A 1G21A 4IHQA 1NASA 3HHPA 4NLLA 1MQAA 1TZ2A 3VTFA 3P9NA 5D86A 5JQGA 1UDCA 2GAJA 1SBTA 5KX5B 4H60A 1E1KA 3A04A 1QRDA 3B82A 3CPSA 1NP7A 3L7OA 3PEFA 4IDBA 5BNFA 4IXMA 1V25A 4NK5A 1T13A 3V8QA 2I6QA 2OFXA 4A2WA 3FNGA 2PKRA 3JRNA 4DMRA 5HS4A 4FGZA 1RMTA 1XF1A 2ROQA 5ITWA 3GD5A 4HAUA 1J8QA 3WXMA 1SXJB 1QGUB 1ZITA 3QBDA 3EXG1 4JP5A 2CD7A 3KWJA 3I42A 3OLQA 2KPOA 3DOOA 2VK4A 1R4AA 2XMDA 4BNIA 5JMPA 2ZRGA 3ROZA 3O7WA 3DC7A 2V4UA 4KQIA 3HC7A 2GN9A 5C1BA 2XQIA 4UTRA 1L4LA 2FXIA 2VXCA 1DC8A 3I5AA 2HUNA 4EVSA 3N8GA 1RCUA 2FFHA 2UYGA 2JARA 1W5BA 5CT4A 3B1FA 4X85A 2ZUEA 1AMOA 3G0IA 1MCZA 4BQQA 8ADHA 1UKZA 3IPXA 5JY1A 2WFZA 1IJFA 1L5MA 2HXSA 3C3XA 3IUEA 3MTJA 4TLCA 4X7RA 1Y8ZA 5T4HA 2C3MA 4HDNB 2V7GA 4I66A 4INPA 1M6HA 1Z8HA 2VXYA 3URMA 5IXSA 1M74A 4BLQA 4BNVA 4QPCA 3ZWXA 4Q7EA 3IBCA 1ZP6A 2B5WA 4AUNA 1YASA 1PJ3A 1V8BA 5I51A 2FDCA 1X1DA 3GLQA 3I3SR 3T7IA 4LQ4A 4WFQA 3C5WP 1OAAA 5K3BA 3TL6A 1D8AA 2FZWA 5EKXA 1TL7C 2H85A 4UASA 2I3BA 3QTLA 1DNPA 4IXWA 1F4VA 4EG3A 4O8ZA 2JH9A 1O9BA 4CCYB 4YR7A 4TKMA 2ZIXB 4M53A 2R8XA 4C2BA 1Z5UA 1MC8A 2HF7A 4TVSA 1OBHA 3KBBA 4W5RA 2PBFA 2FMUA 1XLUA 3H1FA 3ZGYA 4M0DA 3P5BA 4Z0TA 2I2AA 3BM5A 1EM6A 3L6OO 1I6LA 1SBCA 4JMLA 4RFLA 2R6CA 5BSHA 4U7HA 4DSOA 1V5FA 2ACKA 3PRKE 4RCVA 4EH1A 4HH0A 1RE0A 3OE4A 4N3NA 3DV9A 3W2TA 1NSYA 4N03A 5HRCA 4CYMA 3GP8A 5LKRA 2OHOA 1YRHA 4BNHA 2FTKE 3CF6R 2C00A 5BRNA 3O0TA 1DKLA 4KGDA 1MH9A 1GILA 1BX0A 1TM5E 3LWDA 4QOFA 3TIGA 5JADA 3B7PA 4PX3A 4K6FA 1I7QB 5KHAA 3K6SB 4DDTA 4N49A 2X0RA 1H65A 3I28A 2B69A 2CW5A 5HPYB 2I2FA 5GM2A 1KJWA 3TG8A 4DWOA 3QLUA 2OLJA 3TSOA 2I54A 4Z0HO 1P2GA 3B1KA 4LWZA 2UAGA 3B1JA 1G5HA 3V7UA 2B0JA 4BNGA 1EEHA 5I7EA 3ELYA 3TSAA 3WWOA 2Z8YM 3FH0A 2L19A 4LISA 4BJ1A 2Y1KA 4L2IB 1WCXA 4ZCPA 1D2EA 1C4KA 4QFDA 2QG9A 3LFHA 3PRHA 4ENTA 2AS0A 4FI3C 2F9FA 2LR0A 4KQ6A 4DIDA 2OL4A 3UFXB 1OH5A 1MAVA 3CUTA 4XCQA 1RFGE 5DISB 3RBZA 3L8CA 3H2GA 4CFZA 4YJ3F 4XB2A 2Y1DA 4HN4B 3GEBA 1ML4A 4PHCA 2GERA 3UFBA 1I3LA 2XUOA 5NULA 2VK8A 4PRLA 5BSUA 1Z2EA 3HE3A 1K6JA 1SH7A 3B38A 1Z5PA 3QOXA 4NOJA 5FWDA 4DR6B 1HDYA 3WTBA 3U4QB 2WJ4A 3RTAA 4OH7A 4X41A 1WU7A 4QVIA 4FMBB 2J87A 4HTFA 4UXHA 1Z8FA 3CJQA 4LYDA 5EXPA 3R74A 1W4RA 1CUFA 2I3AA 2NUBA 4ECAA 3F3MA 3WL4A 2P8SA 4JASB 4DMKA 4JL5A 2VAMA 2BFNA 3LC7O 4FE3A 1ONNA 3TIFA 3H2KA 4BMZA 2WZDA 2EIXA 2D62A 3H9BA 3T7KA 2HJGA 3DOIA 4G3XA 5KTYA 3N2ZB 1XZBA 2H1CA 1JB1A 1FFYA 4J91A 4DA0A 2AFIE 4L1KA 3T5GA 2XR1A 2I6UA 3N2IA 4HP8A 4EA6A 3R7DA 1DU4A 2C8KA 4K46A 3ZLTA 4C3VA 1NUPA 2EP7A 3VTKA 4DJAA 4LF7B 1C0IA 1NKSA 1Q17A 1UPAA 1WW8A 4DUGD 3HI4A 2VUHB 2VFAA 2O8NA 1W19A 1M33A 3EA0A 5LYYA 2PZBA 3CKKA 1CQXA 4BASA 4RJIA 4FW9A 3VH3A 3C8DA 3X1ZA 3ZVLA 4X1YB 1I4TD 5ES3A 1V4NA 1JJVA 1SCIA 3HO8A 4GX0A 4IWXA 5FLXA 1CNFA 2BEJA 1UZLA 4HZIA 5F33A 5KB3A 2I4MA 2P2ZA 3GNSA 4H7JA 5IANA 4RMHA 1JEYA 1LNQA 2WSLA 2H5IA 5EZ6B 4XB6B 4TVBA 3IIIA 1X38A 3RJ5A 5AKEA 3DV2A 2F3QA 3E58A 3SM3A 5K0FA 5CB4F 4WNCA 4DDMA 4AJ4A 1H2ZA 1OFUA 2CE2X 1R9MA 3BMOA 2GAAA 3C74A 3QMPA 4K9KA 4GZ6A 4WCDA 1KAGA 4E12A 2DP4E 1TTTA 1WETA 1T3ZA 6REQA 1BCSA 5L6MB 1IN1A 3E7WA 1ZGBA 2HAEA 4OF4A 4BNZA 4YDHB 4MS3A 4ZREA 5KTOA 3E27A 1EUDA 1IZ0A 1C9KA 4G85A 3FNQA 4EAQA 1EH5A 1KRXA 3Q88A 5FBHA 1QZXA 5BSMA 3RHTA 1DLJA 2G36A 4G8JA 5JO9A 2G1PA 4LJRA 2PCLA 1A9YA 2VDOB 4P32A 5SY6A 4MUXA 4M9SA 1GU7A 3O4RA 2ZE6A 3QW2A 1LY1A 4NBKA 3VO1A 5THQA 1UFOA 3L84A 3CWCA 3P2MA 3FPSA 1MB0A 2VXOA 3A1VA 3FPJA 4JUAA 4NONA 4PC7A 1IXSB 1GUBA 3D6MA 1APBA 3COVA 5BVGB 2P1RA 3QK7A 1JF8A 4FC6A 1F3LA 3FR7A 1WHTB 4AMBA 1PT9A 1WUYA 4RJ2A 2LCQA 4DPLA 2H1IA 5BOVA 4HGZA 3VPDA 1QB7A 5AXBA 2QK4A 3ZGOA 1O1YA 1XU4A 5L3VA 1T1IA 3QUTA 1P8JA 4MA4A 5CA1B 4KWHA 2IWRA 4BS9A 5I3ZA 2BLNA 2LKDA 2R6JA 3Q3EA 4JLNA 2C0QA 5F51A 3FTPA 5KNCD 2JFOA 3HKDB 1N34B 4R1TA 2GVNA 1DFHA 4NMLA 1QQ5A 2PX8A 1SXPA 1LSJA 1NNLA 5D87A 4I5FA 4CEIA 3PC7A 2XGOA 5GOTA 2QLJA 3DE7X 1YKSA 2C98A 2OZEA 4M0UA 4O4IA 1YOVA 1LZKA 2WYVA 4ZIRB 5H3CA 1O87A 3DFZA 1WBBA 4F2GA 4B71A 1O94C 5B7NA 1VG1A 1RRCA 1E60A 1P5HA 2YIMA 1C3EA 3UA3A 3AHFA 4R2IA 3VU0A 3FFTA 2QLMA 3RTEA 3ZW7A 3IP8A 2QL9A 1G63A 3R0IA 2WFLA 5TJHA 1MIOB 3A6GA 3EA5A 2YYZA 4K81B 1UZAA 3D7NA 1LI5A 3DZCA 3FF4A 1Y8AA 3PXXA 5A4FS 3MQ2A 2JFWA 4MULA 3ZY4A 3WQHA 3AW8A 2EU8A 2PFSA 2VF8A 2IU4A 5BW5A 3B5IA 1GG5A 4LK2A 4YO7A 3C5EA 1KQFA 2WFAA 4ZO4A 2H4FA 3WLNA 5FI0B 4YX9A 3EVBA 2X58A 3KSMA 3JWJA 3VPXA 4WK6A 2GRAA 4YXWA 4RA6B 1MB4A 1L6RA 3I01A 3NGXA 3DAPA 3SX4A 3AI1A 3C1OA 1Y9JA 3GMSA 3HQ4O 3ZHUA 1ATZA 3I0NA 2YWGA 3DE3X 3ROFA 5JFGA 5AR1A 2R6ZA 3E70C 4EW1A 4QODA 4DR7B 4H1VA 4MWTA 2GZ1A 4ZQBA 1B15A 3QHQA 4J3NA 1DKNA 5JYEA 3QV2A 2JLAA 2ORWA 2XWQA 4IDOA 4M9ZA 4I8IA 5E38A 3E9NA 4B8WA 3T12A 2DTEA 2E4VA 5A3RA 3OLYA 2XY4A 4JOQA 4F4CA 3TIVA 1M2VA 3C1UA 2X42A 3GELA 4UUBA 4YQFA 4XYEA 4YRBA 2VAVA 1DC5A 4AROA 1WXFA 1S2LA 1Z0FA 3EPRA 1SUDA 3L8EA 1JHOA 4MUHA 1ZPDA 2C4KA 1P7PA 4JBIA 2HMUA 4RVOA 4TXMA 3KUCA 4L8GA 3LJKA 1HZJA 4BC0A 5FL3A 5FUXA 3VGJA 2X5XA 3U1VA 4GKAA 2DR0A 2CZCA 4MJ7A 2LD4A 2IBSA 4QICA 1C0PA 3VR2A 4HZGA 2HLNA 4IXDA 2I6TA 5F23A 5CUQA 1F2TB 5FEUA 2FPLA 4U0JA 2VDLB 2ZCJA 4FDLA 1X86B 4WVLA 3SIRA 1DJMA 1PT7A 1M2GA 4LBYA 4D56A 1XDGA 2F7SA 4MV3A 3X3HA 2MYTA 3ZXYA 4F0JA 2R7KA 1Y7HA 5JWHA 4QXPA 4JBHA 2NSHA 5JNVA 2BFWA 4V2IA 3BL8A 2COUA 4ND7A 4NJOA 3KQPA 4KQJA 5HTKA 4DS3A 4ENSA 2VDNB 1ZJWA 2FLWA 3RKRA 3VOTA 3N0RA 3ESCA 1N78A 2UZ4A 4XPIA 5E9QA 2G71A 4GD3Q 3RAPR 3R5JA 1U1GA 1K06A 2VUSA 4TMTA 4NU6A