2MYTA

An arsenate reductase in the intermediate state
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
131
structure length
131
Chain Sequence
b'MKKVMFVCKRNSSRSQMAEGFAKTLGAGKIAVTSSGLESSRVHPTAIAMMEEVGIDISGQTSDPIENFNADDYDVVISLCGSGVNLPPEWVTQEIFEDWQLEDPDGQSLEVFRTVRGQVKERVENLIAKIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaredoxin arsenate reductase
molecule tags Oxidoreductase
source organism Synechocystis sp.
publication title A Hybrid Mechanism for the Synechocystis Arsenate Reductase Revealed by Structural Snapshots during Arsenate Reduction.
pubmed doi rcsb
total genus 42
structure length 131
sequence length 131
ec nomenclature ec 1.20.4.1: Arsenate reductase (glutaredoxin).
pdb deposition date 2015-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2mytA00
3KS9A 2E4XA 3LFTA 3QEMB 5IBQA 3CNBA 3IP7A 5KI6A 2MSKA 4UHKA 4Q6WA 3HSYA 4W5RA 3NNDA 4YV7A 5FBHA 3GV0A 3O1HB 3E3MA 3KHTA 4RSMA 3HS3A 1E6MA 1QO0A 4HNSA 3N8IA 1VPWA 3A0UA 1AB6A 3HM9A 2YHBA 5BRAA 2PUFA 3BRQA 3OQOA 3OM1A 4Z9BA 1DRKA 4S04A 1BDIA 3OLXA 3M6MD 2IDMA 4YWHA 1QP4A 1RPJA 5FWXB 1YK1A 1NXPA 1ABFA 2O20A 3SY8A 1JLKA 3C6QA 3C3KA 2LPMA 2FN8A 1NXTA 3QX9A 1FFWA 4JB0A 1F4VA 3I09A 5TPZD 1NXVA 1ZH2A 4OLBA 3MMNA 1NATA 1U0SY 4JAVC 3O75A 2F8TA 1SXHA 1ZH4A 2IPNA 1OXBB 3QK7A 2VUIB 3O74A 3GT7A 2E4ZA 3EAFA 3QLTA 3BREA 5GOTA 1DCKA 1TMYA 2NZUG 3CZCA 3LUKA 2PUDA 3OLWA 4E7OA 1Z25A 2JB9A 3CS3A 4Z99A 1ZAYA 1KRXA 5KC8A 1VLZA 4Z0NA 5IULC 3RQIA 2E4YA 4KQ9A 5BR1A 1M5UA 2KYRA 1P6QA 2LP4Y 3NNNA 4G0QA 2JCGA 1KGSA 3TD9A 2FEKA 3ROFA 2QVGA 2FLWA 2WWVD 4FB4A 3Q7SA 4FE7A 2IPMA 3H5OA 5EWLA 3F6PA 4LE0A 3LUAA 3LOPA 4JA2A 2L19A 5CHYA 3C3MA 4MS4B 4MYRA 4PYRA 2MYPA 2ID7A 4ML3A 1BA2A 1BDJA 1EWTA 2PKXA 4KK4A 1DC8A 1SRRA 5IUKC 2FLKA 2R25B 4XFKA 2HQOA 1DRJA 2FSPA 2GBPA 4TLMB 1QP0A 4N41A 3RVLA 4RK6A 4TN5A 2L18A 2L2QA 3LUGA 4RXUA 3LTEA 3LUDA 1Z18A 5HM6A 3I5AA 4RK7A 1DBQA 1JHZA 3H5TA 4Q6BA 2HPHA 3D02A 4MS4A 9ABPA 2WB4A 4ETMA 4D74A 1D1QA 5KC9A 1IIBA 3QLUC 4G0OA 4MGEA 5CNMA 1QMPA 3SQNA 2JRLA 1DBWA 3LUJA 2QSJA 4IILA 1Z16A 1YTUA 1SXIA 1TVMA 2WRZA 1JWLA 2B4AA 7ABPA 4W5OA 3UKJA 3GBPA 1LJLA 2LBPA 2Q5CA 3IP9A 2PUAA 1ISSA 1SXGA 3Q41A 3C3WA 4HNRA 1TLFA 3MF4A 2E4VA 1YK0A 4G0MA 4W5NA 2DRIA 3H5WA 2J48A 4RY8A 2PUBA 2LUOA 3F7NA 4LX8A 4MRMA 1JL3A 1K66A 2GX6A 2MYTA 4G97A 4YR7A 1MB0A 3OQMA 4MLCA 3DGFC 5TPZA 2CHFA 2YHAA 3GRCA 5T3YA 5ABPA 4W5QA 1D2AA 2FMFA 1FFSA 6ABPA 2R48A 1Z13A 4JOQA 2XDYA 4YGXB 4LZLA 1DJMA 2FQYA 1T34A 2V0NA 4Y9TA 3SNKA 3OLYA 3FMVA 3HUTA 4H3HB 4IMJB 1MVOA 3RVJA 3UUGA 1C4WA 4XARA 5IX8A 4RK4A 2QVCA 1E2BA 1MIHA 3LUFA 3OLVA 4NCBA 2FMIA 2IOYA 4JP1A 1JBEA 3IP6A 4WWHA 2WJAA 4OLAA 4YS6A 1DBPA 5BRJA 2MYUA 4EGSA 3A0RB 3T6KA 3RVPA 2MSLA 4QYMA 1LBIA 4EUKA 4GPAA 4KQCA 1MB3A 1DZ3A 1XHEA 4LDAA 4WZZA 2JVJA 2VUHB 3OO0A 3N0RA 3RVMA 3FGZA 4EVRA 1YVUA 2FW0A 3H5VA 3NBMA 4O5AA 3LUCA 4WT7A 4RDCA 3A10A 3CFYA 1USKA 2MYNA 3JS5A 4RKQA 2CWDA 1PNRA 4NCAA 1PNTA 1URPA 1LJUA 1PEYA 2CHEA 2GWRA 1QQAA 1RXIA 5HQJA 1USIA 1S8NA 3KYIB 2QU7A 3HCWA 1NXSA 1ZGZA 3B2NA 4EYQA 1W9HA 3LMKA 4ETIA 3KSMA 1HEYA 3NNSA 3IDOA 5TE9A 3TO5A 1M2EA 2X7XA 4PZ0A 1QP7A 2N9UA 3IPCA 1C0EA 2QV0A 1APBA 1PEAA 3CHYA 1M5TA 5EWJB 3O2QB 3LUHA 4PICA 4OG2A 1XWWA 3RVOA 1TJYA 2HSGA 3SM9A 1CYEA 4MQEA 4RXMA 3A3KA 4KK3A 1QNLA 3N6VA 3T38A 3OQNA 5ED4A 4KNYA 3H1FA 3O2JA 3M9XA 4MQEB 4KVFA 4F11A 1BVHA 1B00A 5FWYB 1A04A 3JPWA 8ABPA 3O21A 3EODA 1P6UA 3QX8A 5E3JA 3HDGA 3HJFA 4MQFB 3Q9SA 3RVSA 3RVKA 1YS6A 1ZGGA 1L5ZA 1OXKB 2HQBA 4ZPJA 1E6LA 3MIZA 2WJWA 4WXEA 2IPAB 1F51E 3H1EA 4OBBA 2H3HA 4Z9AA 1MAVA 3QLVA 1RXEA 3R0JA 4OTZA 1GCGA 5EWLB 1QO0D 3QEKA 5FBKA 3EJWA 1K68A 4RS3A 5IEJA 2OENG 4O1IA 1ZY2A 4QICA 4QYWA 4EY3A 4E7PA 3K4HA 2JBAA 4N76A 4Z4CA 4ZYLA 3FFXA 3UK0A 1GLGA 5JNRA 5DGCA 2WY2D 1BDHA 1YMVA 2FXIA 4KMRA 1Z2DA 1TM2A 3DGEC 2WMYA 4M88A 4RK1A 4RU1A 1UDRA 4F06A 1VKRA 2R4QA 4H3KB 5HSGA 3Q15C 4ZMRA 1NXOA 4G0ZA 1QQBA 3N0XA 4D6YA 4F8JA 3N75A 1ZN2A 3BRSA 3CLKA 5IUJC 1EWVA 2HQRA 3Q7TA 2MSWA 5TQ2A 1U2QA 4B09A 5JNSA 1Z2EA 4KPYA 1A0OA 5C5CA 1DCMA 2P4UA 1QPZA 2VYCA 1SD5A 2JVIA 3JY6A 4NV3A 1GUBA 3SAJA 4TMYA 3HXMA 1AB5A 5CNKA 5DKFA 4W5TA 2I6FA 2M98A 4RK5A 3OMWA 5C5EA 5JNTA 4YO7A 1DC7A 2IYNA 1FQWA 4PE5B 1LK0A 3H5IA 3QLVC 2RGYA 4JASB 4MAAA 4QPJC 4CBVA 1P2FA 3MYYA 3EGCA 1I3CA 2OQRA 5I4CA 5KQPA 1ZESA 3EQZA 3OO1A 2PUGA 3KJXA 2PL9A 2A9PA 4MS1A 5EWJA 2B1JA 3KKEA 1CEYA 3OMXA 3EDCA 2GI4A 4YRZA 4YCSA 3CG0A 1PUXA 2ID9A 3MM4A 1VRVA 5DLEA 2JK1A 4HNQA 2RJNA 4TLLB 3H5LA 1DP4A 1J56A 4F3TA 1FFGA 3ILYA 4HYEA 4MS3B 4LE1A 2QZJA 3EULA 3GBVA 3ROTA 1Z17A 1USGA 4S05A 1WETA 1RZRA 1Y1LA 5KQLA 3C97A 3JVDA 3LKVA 1NXWA 2FTKE 4EYOA 3EQ2A 2JVKA 2RDMA 3H1GA 2PJUA 2ZWMA 4GNRA 4MR9B 4XLTA 4RY0A 3F73A 1NY5A 1CHNA 3GYBA 4IRXA 1YMUA 2VK2A 4IGAA 5BQ3A 4O1HA 2A9QA 2NT3A 1U04A 1H9CA 2FEWB 5EWMB 1RNLA 4IF4A 3DZDA 3CRNA 1JX6A 2JBAB 4MLDA 4RK0A 2AYZA 4XAQA 4P1ZA 3VNBA 2QXYA 2PUCA 3T8YA 2R47A 4KFCA 3M9WA 1QKKA 3GL9A 4DN6A 4Z4GA 1E6KA 4Z4HA 3K9CA 2QR3A 3CKMA 3CG4A 1ABEA 2PMCA 3KCNA 5DCLA 3JVIA 4DADA 4RV5A 5FWXA 3CU5A 5JNVA 3H6HA 1DCFA 5TPWB 4DQDA 2AYXA 4LRQA 2PAFA 2PL1A 4RY9A 1BAPA 4G0PA 1JDNA 1D1PA 4MR9A 3RH0A 4OATA 3E61A 1L5YA 2A9OA 1FSPA 2NUBA 3Q7RA 3HDVA 3L6UA 3O1JC 4MR7B 2TMYA 4IMIB 4N0QA 4MPTA 2PE5A 5CNJA 4N03A 3IP5A 5TQJA 4KV7A 3TX6A 4H60A 2ZAYA 2FMHA 4RXTA 2PUEA 4G0XA 4MR8B 4XXHA 4KREA 2PLNA 4WXMA 5PNTA 3RVNA 3QLUA 4N0PA 2A9RA 5JS2A 1Z26A 3QELA 1M2FA 4L85A 5B3JC 3HK2A 1KRWA 3URMA 6CHYA 3MQ4A 3IPAA 1R8JA 3SG0A 3HV2A 3TMYA 5IUNC 3F6CA 3G1WA 4ZJPA 4XASA 3RVRA 2GKGA 2HJ9A 4LE2A 3I45A 4RKRA 1RZRD 5JS1A 3KYJB 2H0AA 3L49A 2FQWA 4MS1B 5IEBA 2LIVA 1NXXA 3QELB 3VNAA 5KQMA 3OLZA 1YS7A 4NQRA 2NZVG 3KLNA 4F12A 3P9YA 3I42A 5T7BA 2CD7A 2QW1A 3CTPA 1A2OA 4Q7EA 5IC5A 1ISRA 4N47A 3DLHA 4KRFA 1DG9A 4ETNA 4LDZA 1U2PA 2FQXA 4L4UA 4P98A 3S99A 1GUDA 2P9HA 2NT4A 3NHMA 3OM0A 4EYKA 3DLBA 5CNIA 5TQ2B 1NTRA 3HO1A 3KTOA 2FEPA 5HKOA 1JYFA 1JDPA 3O1IC 1JFTA 3GWGA 2FMKA 3BBLA 1JH9A 1XHFA 4MR7A 2W42A 4Z4IA 1PHRA 1D5WA 5DTEA 3KLOA 3HZHA 3N0WA 3CZ5A 1EAYA 1U8TA 1D4ZA 5F64A 5TPWA 4WUTA 2RJOA 4PEVA 4Z4FA 4EVQA 4MRMB 1ZDMA 4ZMSA 4Z4EA 2E4UA 1YIOA 1Z12A 3TB6A 3NHZA 1ZVVA 2BGGA 4FE4A 3HVRA 4G0YA 3GA5A 5TQ0A 3LKBA 1LBHA 3D8UA 3O2SB 5TQ0B 4RZSA 3RVQA 1Z15A 5EWMA 2FN9A 2FVYA 4JB2A 4MQFA 2F8SA 4YP9A 3H6GA 4YLEA 1JYEA 3JPYA 5GQSA 4RWEA 5FWYA 2FKAA 3KG2A 2M1ZA 3HUUA 5KWSA 4UHJA 3DBIA 3FFWA 1ZHHA 3BILA 3W9SA 1EHCA 1JF8A 5JNWA 3T95A 3ILHA 3QEMA 4EYGA 5JNUA 1EWKA 1ZITA 2IPLA 2L17A 4MS3A 3G85A 5KQGA 2E4WA 4MR8A 4NICA 4D6XA 4EVSA 4KZKA 3FFTA 2IKSA 3HEBA 1GCAA 3H75A 3MA0A 5B3JA 4G86A 1EFAA 1P8AA 5D2CA 1W25A 3FDFA 3N53A 1KMIY 3JTEA 1JFSA 1JFVA
chains in the Genus database with same CATH superfamily
1N5IA 2BDEA 5IBQA 4GOMD 2I78A 3ROKA 3QF4A 4MW2A 2IUEA 4ZZ1A 1AS3A 5KUTA 2XZOA 2HEGA 2VBGA 4YCDA 4J76A 4NXMB 4MPDA 3LX8A 4Q6WA 5DGHA 5ES3A 3VC3A 2OVFA 4YV7A 1NVUQ 2CFOA 1KHTA 3HEAA 4IXTA 3TIFA 1FQOA 3OTOB 1GPNA 1DFGA 4MQ6A 3EN0A 4MZDA 4E21A 1H2YA 4TWRA 1KEKA 2BF7A 4DNQA 5L3SB 1XG5A 2J09A 4TT8A 1TQDA 2WKWA 4UFNA 5AVJA 3OOHA 3LPNA 1Z83A 5F76A 2ZPUA 4UBKA 4NATA 3VX3A 2B2CA 1VCIA 4TV9A 4EJSB 1F60A 2HIAA 5FOSA 5T41A 5TC4A 1TI7A 2AOVA 2X0DA 1JR6A 2NIPA 4NF2A 2J6BA 2WJ6A 2POQX 2ZE7A 1H0KA 1L5FA 1XJ0A 5GOZA 5ALXA 3MUFA 3THRA 2FMTA 1P2VA 2DT5A 1NURA 3TLBA 4F1KA 4TXNA 5A4DA 3AXSA 2WFAA 2OV6A 4JMPA 1RM5A 5IC6A 3V7UA 4MRAA 1DADA 1E2JA 4DBLC 3VOBA 3DE6X 4DLXA 3M81A 3UWKA 4URXR 1KOGA 1Z0ZA 3O75A 3A6GA 2O8CA 3ZCVA 3NONA 1EUDB 3QLTA 4RIIA 3SBEA 4CMIA 3R3ZA 2CDNA 2VJCA 3X1ZA 1D2GA 3EFOB 2C4MA 2X8JB 4ZT7A 5FD8A 4BCDA 1EVJA 1JMKC 2F3QA 2V0GA 4LXUA 1ZAYA 4BFXA 3S55A 4EHFA 5KC8A 1VLZA 4LYDA 4MROA 3Q9NA 3O8DA 3V1MA 2KYRA 1IRIA 2WNIA 4HQ6A 4E4TA 4UTXA 4MX8A 3PD0A 2VPWA 1T0PA 1X70A 4JBXA 2QVGA 2FLWA 2J0VA 4FINA 4EVIA 2A0KA 2DTEA 1GJRA 1RT9A 3B5EA 4BASA 1SM4A 2A8YA 2WYIA 5I7RA 3EGDA 3ZZ0A 2FR1A 1JAXA 3VQTA 1JPUA 2Z2KA 5KX5F 1LSUA 3GDFA 2NSDA 1KJQA 2A35A 4X66B 1F2VA 4IOLA 3CE9A 1AQJA 1L5OA 2NV6A 2XMGA 2AJCA 3CZPA 3QXSA 2JAWA 2K5UA 4IDAA 5JG7A 3VDRA 3A6EA 4US1R 4IJKA 3R7WA 1C7IA 3TECE 4L16A 5IM5A 2I8LA 3MTJA 1KQ3A 3H11A 4D43A 5BV1A 1T0JB 4KN5A 1OKKA 1PZXA 1Z18A 3LTEA 1Y4AE 2R2GA 2WM2A 2P6RA 1BA3A 1ZWLA 2ESRA 2QYHA 3WGMA 1ZCJA 3IDSA 2V7VA 1IN1A 4R2XA 1WHSA 4O0MA 2ZG6A 2G5PA 5JASA 1SXJA 1WTCA 3QLUC 4YK7A 2H9IA 3JQ6A 3PFBA 4ZVRA 4RAOA 3IOBA 3U0VA 4BWVA 4PAGA 1O77A 2B69A 2RHBA 3A06A 1QHHB 4IF6A 2IYSA 4FGLA 4NZPA 1C0IA 4LY3A 5DH9A 2PHZA 2YL2A 2G4LA 3UKJA 4H0CA 2R9VA 1I51A 2R6CA 3PQ2A 2OY0A 4Q4JB 5BW5A 1UMKA 1UZMA 2VHJA 2QLTA 1QQ6A 2H7VA 1LS1A 4MVXA 1YDHA 3WKBA 2CGEA 3QG5A 3LHDA 3DC2A 5E4YA 4AN0A 5KX5A 4W5NA 4R5HA 1XZQA 2I6GA 4E4YA 1Y9JA 3F7NA 4OHRA 2GJ8A 2J6IA 4D81A 4CIBA 2NSLA 2A5DA 1L5WA 3GELA 3PKIA 1FS4A 2VJMB 4MLCA 4QULA 5SY9A 4XQGA 1L8OA 1P5ZB 2WYOA 4WKOA 3G9XA 4G8JA 1A3CA 4FYJA 1W9MA 2X19A 3C8ZA 2XYRA 3M0EA 2O19A 2EIHA 4YJFB 1RTKA 3PPYA 1WSAA 3L40A 5AW8A 1XPUA 2F90A 2FPLA 2BJHA 4DV2B 3NHUA 1KQOA 2O7SA 2QD2A 2VSYA 4XWYA 1DIAA 1PT6A 4BTLA 3GAFA 4NLLA 4RK4A 3ZW8A 1TC2A 2OYRA 4ABYA 2Y0PA 3LUFA 2R7LA 1B1CA 2FV8A 4JFRA 2HFJA 5DI3A 2OHHA 4M8LA 3PKJA 2VSFA 3AUAA 4JP1A 5EZYF 3RAJA 4YIHA 2XB2A 1QE5A 2I3ZA 3SK0A 1W6UA 4GXRA 1MH9A 4KHZA 4YCNA 4BNKA 3FR7A 3VFDA 3V1UA 1LLCA 1AJEA 3M6FA 1RRKA 2WWHA 3H86A 3ZDDA 2DE0X 3PZBA 2RK3A 4U02A 4XGNA 1M2JA 5BVGA 1BCRA 2B21A 3PD7A 1PSZA 1HURA 2QJRA 1MW9X 3VKUA 3NBYC 2BTQA 3IAS1 3QV1A 6PFKA 1YR1A 4DGQA 4FZRA 5SYAA 5L3QA 5FP0A 1R9NA 4BX3A 1P2GA 2QLNA 1ZK4A 1UMBB 1YVUA 3TX2A 4Y6RA 4CW7A 1W47A 3BMOB 4KX5A 3AHDA 2MINA 1LPNA 4KQEA 3HNOA 1WG8A 1TUGA 2VBCA 3EXFB 1M8KA 1N2OA 3N59A 3NUGA 4U0JA 4PG7A 4HX5A 4ECEA 4HD8A 1T8SA 2DKNA 2PM8A 4U9HS 3RSFA 1JHXA 2WV7A 3SM3A 4FCCA 1U65A 3BK7A 3KEOA 4F4UA 2GQ0A 2PUJA 2HMVA 3LF2A 4N65A 4KH0A 5GIPE 5HCNA 5LQRA 1HEYA 2W2TA 3UV6A 1W29A 4GSLA 4HLNA 3I0NA 3ICPA 2OB1A 4NNPA 4NZNA 2QV0A 4YT5A 3ZY3A 4MV6A 2FEXA 3H11B 4U39A 4R2KA 1PEDA 1ZNWA 2GASA 3QLEA 2ODBA 2E1RA 4H6PA 1JFLA 4PLPA 2CLOB 3TE7A 1Z7YA 3TLMA 1N7JA 3UGJA 3E9CA 3TR0A 1KI2A 3R7NA 4L9SA 2VATA 3A1UA 1VB3A 3VU0A 1SCUA 3W6OA 3JAMA 4CEJB 5KBYA 1M6NA 2XUOA 4HC4A 3Q85A 4BQFA 3O21A 4Q48A 4NNOA 3VBCA 2XMZA 1K5PA 2V4ZA 4UM5A 2DY1A 5E3JA 3HPQA 4J0FA 2UZ1A 5KYVA 2HFKA 3VU3A 1VE1A 3Q9SA 5FRDA 5EIBC 3RU7A 1TAQA 2YMPA 3O4GA 3TLGB 1RCTE 3PK0A 2Y1OA 3DOIA 3MIZA 2F48A 5DMHA 4C0XA 3FTEA 2R85A 5FNVA 3ZGYA 5HJ5A 1PJZA 4AO8A 4C2AA 5U9CA 5J4VA 1E4YA 2G0NA 4G3XA 4GE0A 4BFZA 2JK0A 2EZ4A 4BKPA 2H5EA 3H87A 1N5RA 2Q27A 2YFHA 2FP3A 4N3GA 1Y98A 5FBKA 3SDBA 1ZSYA 2IEYA 2YY5A 3A6LA 5ARCA 2OENG 2PJRA 5SY6A 3I04M 1C9MA 4KFRA 4II3A 2IH4A 4ZCTA 4N76A 3GAMA 1IFXA 1GGHA 2YYSA 3FFXA 4MGYR 3I83A 4DB4A 4NBKA 3AFIA 4OQQA 1QHXA 5AVVA 3NV7A 3R6DA 3UNXA 1KYTA 3NWBA 2JAXA 1YF3A 3UCFA 4KR6A 1ZOSA 2PT6A 3T94A 1TM2A 1WEKA 1WCYA 4DNOA 4F06A 5LWQA 3KR2A 2B7BA 1QCCA 2X9VA 5GVSA 5LA6A 3BK2A 3L9XA 1QU2A 1C9KA 1R5BA 2CLDX 5ENZA 3N75A 2VJNA 4JS0A 5FPHA 4ZCSA 1CTQA 3AC0A 4CL8A 4ISBA 2NAFA 3UN1A 2L69A 5EESA 4ZZ2A 4DXAA 4CPDA 2I3DA 4J0HA 4S12A 3D1LA 1SD5A 1GKIA 1HDEA 5EP2A 1HT1E 1Q44A 3EFHA 1ZP6A 1JMVA 4EB8A 1EBFA 3LL7A 3NWPA 4CM5A 1N2SA 4Z1MD 4XDHA 4KLAA 3UJHA 4FFLA 3I2IA 4JJAA 4C4YA 2ISCA 5CX1B 3E8SA 4LGYA 2EJTA 1NPYA 4DG8A 1IZ7A 3I72A 1YJAA 5A06A 1OLUB 1DEKA 2OQRA 3PWSA 1YZQA 3MRXA 4JIMA 3GFGA 4R1NA 3RTGA 2WAYA 1IOZA 3DEHA 4C14A 2TMGA 3IYLW 5G4KB 4DMLA 3Q3EA 2HR1A 5LU8A 3S27A 3OOYA 1PN3A 2GI4A 3UJ6A 1R9JA 1H2AS 4OHMA 4TZ0A 5CXUA 1AURA 4ZCMA 2AZXA 1WCV1 2ID9A 2MJLA 3RF7A 1SPXA 2C2BA 3R7BA 1Z56C 2IZ7A 4UDOA 2VZLA 1GSHA 3SXUB 3OEHA 1ZR4A 4HYEA 2ZAGA 2PZMA 4R2HA 1ZHOA 2UUCB 1UQUA 3HFGA 4CFZA 1WETA 4ND8B 3B51X 3HCBA 1UXGA 3L7OA 2D5CA 1L3IA 5L95A 1H5QA 3QXCA 2X15A 3O31A 1EBUA 2SKEA 4TLAA 3U7QA 1GVHA 3EGIA 1QGOA 4P35A 5ALLA 1HOTA 1J7KA 1Q0HA 2J3KA 2V74B 2VH5R 4P36A 4REQA 4XLTA 2PMEA 3WWOA 2ZIAA 3TXYA 3EPJA 1VLHA 5J3JA 1SQ6A 3MN1A 4IM7A 5LBTA 3N2ZB 4GMHA 4L5YA 3C8DA 4KVAA 2QTCA 3PUIA 3GIWA 3EEFA 3ZBUA 1WY7A 1Q14A 3HCCA 2R7KA 1PVDA 2G08A 4UPEA 2VSXA 1KDYA 1OX6A 4FSHA 1VPLA 4XPZA 3QRWA 3C85A 4DA9A 1Z08A 4ZQGA 3NAMA 4GP7A 4WBNB 3RRNA 2HI0A 3MLBA 2G71A 2P3LA 4G63A 1GA6A 2MU1A 5DI3B 2HDOA 3UVEA 2GT1A 4LBYA 3V9PA 5AHKA 4B17A 3OM8A 1F8GA 3IDAA 3SR3A 4DF3A 3DE1X 2Z0MA 1UWVA 1YA4A 4MUFA 4DANA 2XUPA 3D3WB 4MULA 5F1OA 3QWFA 3QVUA 3KQVA 1CQIA 1EQ2A 2XRMA 3RUAA 3ZVNA 3U4MA 4LJKA 4R1MA 5ALNA 1J1IA 2IUYA 3C39A 1Z6QA 1PJAA 1VB5A 3DPSA 3I4FA 4PHHA 4QBGB 2GK6A 2NV2B 3GFTA 4PHCA 2EVWX 2MR5A 3K8OE 2A9OA 4Y6GB 4GE3A 3AIMA 2KMLA 3WIUA 3KOYA 3O5AA 3UXMA 5CEJA 1DIBA 2VJLA 3UWMA 3OX3A 4ZK2A 1FJHA 3KJIA 1GPJA 5TQJA 5TDHA 4DZRA 5AVTA 1CEXA 4KV7A 5DASA 1H1LA 4H60A 4GZ5A 4CT0A 2D8AA 3JVVA 1XCOA 3NTVA 1ID8A 3RREA 1QOZA 3WXMA 1C0LA 4Q9DA 3AJDA 3U0BA 1B42A 1NKSA 3L8CA 4Q4AB 4WXMA 4MRNA 5PNTA 3RVNA 1Q6ZA 2QJWA 4ZO9A 1TPYA 4CMJA 5FTNA 3M83A 5L53A 5IFKA 1W30A 2V4MA 2OSBA 1ZNZA 4L85A 5B3JC 2IOHA 4A10A 3KQMA 2AOUB 1Y7LA 3ONNA 4MA0A 3LGXA 3P4XA 4R8LA 5AJXA 1TKCA 4JEUA 4E0BA 4RO0A 2JH8A 1BKDR 2WKRA 4PAMA 3W5DA 1D8TA 4ER6A 3USCS 4BJ6A 5BWNA 1HE1C 3A4NA 5D1HA 4PAWA 5JS1A 4BPBA 3O83A 1SEVA 5IEBA 3UWDA 1CZOA 3SQWA 2JCBA 4XB6B 1NRJB 3QELB 4LHSA 2J3DA 3DBRA 1EE1A 4B7CA 5C51B 4HDCA 2BBTA 1BGWA 1NQWA 2C97A 5IC5A 4IYJA 1IG3A 3T7IA 5K09A 3DO8A 4LDZA 2YFQA 3OTWA 3PSAA 2FR8C 1M2OA 1P72A 3DKKA 3BCSA 3I6ZA 1YZ3A 1R88A 1M1YA 1X1CA 4UHDA 1A4UA 4OAQA 1IQPA 4C76A 4PCAA 4CLHA 5BORA 5C5IA 1NUPA 2NO1A 3V8VA 4ZDKA 3UWSA 2PXAA 4Y1RB 1Q15A 2BEUB 1YQXA 1N2CE 4R2IA 1JYFA 4OFXA 1I4OA 2IYLD 3ZE0B 2BMFA 3MWLA 2ZPAA 3BBLA 3CM0A 1OZGA 2NTVA 4KSCA 5GJCA 2O5EA 1YS4A 1VE3A 5I9NA 1D5WA 4G5HA 3GOHA 3N0WA 2H7YA 2R6ZA 4OQFA 4BFCA 2ONJA 4F56A 1V5GA 1B15A 5JJ5A 2WW8A 2OESA 5I7VA 3PHIA 3CW9A 5J43A 2ZDQA 1DWPA 2WJVA 4B1FA 3UM9A 1CSEE 2WF6A 1E1RD 1MOQA 2OXEA 2P2YA 2AQHA 2Z1DA 3GEIA 3K72B 2F9LA 2WILA 4XOUA 4ZAZA 5K1ZA 1A1SA 3W5VA 5LYJA 3L6EA 2WTNA 1WLYA 2G1KA 1P0IA 4GQAA 4O2AB 1ZD1A 2XOXA 2O2YA 4TTIA 1T91A 3K8ZA 4BKRA 1Z8FA 3KUXA 6NULA 2ORED 1K63A 3FOAA 1F4PA 3D8UA 3DT8A 1SR8A 4L8VA 3ZKAA 3WYCA 2FK8A 1KVSA 3SJAA 1ML4A 1GSOA 3DZHA 1N4AA 4ADSG 2H85A 1H2BA 2PRJA 2ZAIA 4YLEA 1P1KA 1GN9A 3FG9A 2E7ZA 1GTVA 4Y8VA 5FWYA 1CJMA 3L3BA 2NZ2A 3OOEA 4JP5A 4BNLA 1OBVA 1KQNA 4DR4B 1JF8A 3UOWA 3TEFA 4WLFA 5ALIA 1EDDA 4YIKA 1LPAB 2DUJA 2P9EA 3H97A 4YA6A 1K88A 3QEMA 1GADO 2B4RO 1VMIA 3DVAB 3LXXA 2UYHA 1AZLA 5JMPA 2JGDA 3ECCA 3K9HA 1VA4A 3FVTA 3IA7A 3IEVA 4YP7A 5JH7F 2XDQB 3AR4A 5T64A 1E9SA 1PJRA 3EXG2 3U09A 1DC6A 1QAOA 1P8AA 4TQ9A 3HKBA 4J0JA 1EVZA 2YJ6A 2DBRA 3HO8A 1JFFA 3KDSE 5D5QA 4C04A 1SC6A 3WYEA 3LU1A 4EKIA 2DWQA 3D2AA 4EX7A 3TGLA 2C58A 1CUBA 3EF3A 5IAJA 1CP3A 4Q12A 3HKEA 4JR2A 3R3JA 5A0FA 2B1GA 1TQ4A 1Z0DA 1G66A 1ZGHA 2BSAA 2YMMA 3LY7A 3ADOA 3O95A 3Q10A 4QREA 5ALGA 3A0UA 3V97A 2FPPB 1X80B 2YVAA 1JXQA 4A0HA 1O96B 2VPIA 1B2RA 2PWPA 4X9XA 5LP6B 1HOXA 4BVHA 4NESA 4RETA 4K26A 3VPAA 1WDLA 4DGSA 1NJ5A 2GH1A 1QP4A 3CVWA 4OFWA 2BGLA 1NW7A 4A8HA 1RWKA 4Q7JB 4ZT3A 2AZDA 2IZZA 5IVIA 1GG5A 3QTBA 3RW9A 3A8TA 5EXXA 1TZCA 2NNWB 3I9OA 1WULS 1HKHA 1UK6A 3L8DA 3NBFA 4B74A 3OX1A 3PIRA 5G53C 3EDMA 5AHXA 4BX9A 3ZLJA 2C4KA 2XE6A 1N1MA 3NH9A 1IJKA 1EUCB 2ZYAA 4HRXA 5A9SB 2XQKA 5A9RA 1U9YA 2J07A 3O4HA 2VK8A 3V4SA 4D0LB 1XNHA 2GJSA 3B9BA 1OH7A 1DG3A 1MNAA 2GAOA 2VTBA 4IGEA 3N7AA 3GT7A 3AP3A 4BYMA 1H3FA 4JVLA 2AZTA 4Y2QA 3UHOA 4AI6A 2Z09A 3F5QA 3WP0A 5LQAA 4JOSA 2J8ZA 4JI1B 4AP9A 3EIWA 4KV9A 3G2OA 3RQIA 1WMEA 3SVLA 2PGAA 2YZMA 2JCVA 1OXTA 1P6QA 3A6FA 3FJYA 3OIDA 1AY0A 2B99A 3Q1KA 3F49S 4P4GA 5E9AA 4AQ7A 5AUQA 2BKAA 4C0AC 3BM5A 1XYYA 2WYWA 1R27A 1PK9A 3F97A 2H2DA 1FP1D 1M7BA 3BUSA 3PP8A 3DZGA 1EWYA 1LPOA 4KMSA 4ZVKA 1NZFA 1VJ1A 3OCXA 3RF6A 2QN3A 8ATCA 3FVRA 1NNEA 3BC1A 1QDEA 4L2IB 5JZOA 5CB4F 5CHYA 3BXFA 5KTKA 4IHJB 1IMJA 3UXHA 2WP0A 2NACA 4LECA 5ITZA 1GAEO 2GVNA 1AKUA 4GYYA 4UHBA 3ZLBA 5KOHB 1E7MA 2YXLA 3KXDA 4MPRA 2DM6A 1BH6A 2C95A 1U11A 1ZUIA 1NBOA 1TUBA 2WF5A 4RK6A 2L18A 5KYGA 3FOEC 3LWDA 1EDBA 2XCIA 1DQYA 1TVCA 4BIIA 1YQTA 2ZUDA 4DXHA 3E5RA 5DSXA 1GYPA 4ZT5A 5CLJA 4MUXA 2IYWA 1ZBDA 2RHHA 4CKWB 1EXMA 4AROA 1E3QA 3FWHA 3OJOA 4ZVOA 4GT1A 1C7QA 4QGFA 1YFJA 3D6FA 2W2KA 1P3DA 3NWJA 3F5SA 2X0IA 1H5NA 3ABRB 1X7WB 3KQQA 1J49A 5K3OA 1XZBA 4W9NC 4EG5A 3GHHA 1FRVA 1YD7A 2ZWVA 4Z0TA 3M2TA 1GA4A 1R6AA 4BZQA 1RXVA 1NDHA 1VL8A 1BYUA 1C5KA 3EB9A 3NI2A 2VP9A 2HK8A 4P53A 2IWRA 3W7BA 2HTEA 2PV7A 2V9ZA 3P26A 2YJTD 2ONYA 3PPVA 2J3QA 1GZ7A 5CM8B 1GQFA 4D82A 3DAGA 4OI0A 5FTJA 1Y3AA 1B16A 4OK3A 2Q7OE 3E1SA 1GOTA 3ZE6A 2GX6A 2BP7A 3RTAA 1CLEA 1JKFA 1TW3A 1T25A 2VSQA 3NT4A 4HL6A 2WHPB 3JQAD 1YRAA 2FZGA 3AETA 3EUAA 4HB3A 5F4BA 1D04A 2L42A 1QX3A 2V6BA 4IOJA 1O6FA 4UNIA 2R48A 1GUFA 1ODFA 4ZVPA 4OSEA 1A8QA 1RJGA 2FW1A 1H85A 1FDSA 1I4EB 2H18A 2HCFA 1PLJA 4QO7A 4RV9A 3WLRA 1HZJA 5FNZA 2XD4A 5JO0A 1QR6A 1F2UA 2ZULA 3CUVA 4PNEA 7GPBA 3VNVA 4OHZA 1EZ1A 3WIEA 9GPBA 5AJWA 4JLVA 2V7XA 3IB3A 2WJAA 1ZXBA 4CKEA 1O5TA 2VPXA 1ZU4A 4FCTA 4PLHA 2A5FA 4GSKA 4I9UA 1TYBE 3KJQA 4TV9B 3GLRA 3BDIA 2V7QD 5EFOA 1MAUA 3PGXA 1CR0A 3Q6IA 2WUEA 1FNSA 3ANMA 2EWMA 2ZKLA 1DZ3A 2D00A 3MOGA 3RR2A 2DPYA 4ZJYA 1XTKA 2HYIC 3M5CA 3ENVA 4UFOA 2JFPA 4CEIA 3OCVA 1KMQA 3QMVA 5JSKA 1YZGA 3FRIA 3TOSA 1G5IA 3AQ4A 4ESEA 2O8NA 4O5AA 4TKMA 5BMVB 4MWBA 3JS5A 4MUHA 3EDOA 5E6UA 4PYOA 1BXGA 1WZ2A 4YHHB 1S3GA 5HKBA 2BFWA 2C4WA 3LT4A 1LQTA 1NP7A 1ZGZA 2GEJA 3K4PA 3NVAA 2JFNA 5AICA 1DU4A 3IEMA 3IOEA 2QY9A 4K1XA 4WCFB 3HNPA 1O97D 1V7PC 1PV1A 2W2NA 2X7XA 1RWNA 1TJPB 3BIJA 3FSEA 4FGZA 4ND4A 1H4VB 1KDZA 1APBA 5A04A 1UXOA 2PKCA 4IDCA 2FCRA 3O2QB 4EATA 2K2WA 4NARA 5A5DA 3M6LA 1N6RA 2IELA 5DBIA 3ND8A 4IMPA 1BJRE 3D7KA 2BEWB 4ZQHA 3T3DA 4A15A 1CYEA 3WJ1A 4F5DA 1P2UA 1VSBA 3TNDA 3THXB 1SELA 3VKHA 4IP0A 4D1YA 3OQPA 4QXAA 1G19A 4UD2A 4DCSA 3JPWA 8ABPA 1R6VA 5FUQA 3L92A 1VCNA 1GDDA 3HYRA 2IP2A 2JKYA 3PBKA 4KRXA 1N36B 3KZNA 2OOSA 3CX7A 3DZJA 4QYIB 4X8OA 1JILA 3JD1A 1HLFA 1YZTA 2C3PA 1OX4B 3QUQA 4FFVA 4MVJD 1ZIYA 1UBMS 2P9FA 2X9QA 1K7CA 1U7UA 2XKBA 3OIYA 4PR3A 2HM7A 3H17A 3MIIA 4R68A 1KPHA 2OD9A 1MO2A 2PSEA 4PSKA 2VK4A 3E2MA 4D3YA 1QO0D 2IVFA 4GL4A 4ZYXA 4DCGA 1KXJA 3ZW7A 3LO5A 4E03A 1NG9A 4DIUA 1FLVA 4O1IA 3IUEA 4E7PA 1M0EA 2QP9X 4EJ2A 2JBAA 5ADHA 3HVJA 3B6MA 1MU0A 1OTYA 4JLUA 3EGWA 1RLJA 3LV8A 3IBFA 4E09A 2CJWB 3D6AA 2FSHA 4S1VA 5CXXA 4N3BA 3UZUA 1M6YA 2EEPA 1MPXA 2JATA 3OX2A 1OXUA 4WZBA 4OB6A 2ZE6A 3K16A 1UDRA 3H5RA 1VKRA 4AMBA 2Q5IA 4PC7A 5F35A 2ECKA 1KOFA 2X5KO 5FOWA 3K0CA 4DZZA 4NX2A 5PGMA 2VEOA 5IUJC 2HQRA 1Z73A 1AMOA 4TVBA 3K15A 3OFKA 3TBFA 4I66A 1EM6A 5JBNA 5JNSA 5COBA 1ZJ4A 4QGBA 4AJ9A 1SBCA 2W6PA 1GUAA 2YIVX 3WK9A 4D4IA 5IAOA 2XMSA 2YWJA 1BEEA 4TTSA 4C9BA 1QKJA 3QVVA 4JCCA 1L5SA 5ALPA 1G5HA 2E3JA 4J29A 1VPTA 5DNEA 2Y1XA 2HEIA 4JOCA 4QELA 3RVBA 3C7DB 1NT2A 1ZUWA 4JASB 4CBVA 4UDXX 4HEJA 4O4LF 1X42A 2I1VB 4INZA 2WV9A 4ZO8A 2CEAA 2Z9CA 3K5WA 1QE0A 3OD1A 1NF3A 1Y8QA 2P67A 4URHA 5F2EA 2DBZA 1ZESA 2W2OA 1TCVA 3H65A 3OO1A 3OZFA 1A9SA 4YI3A 1D6MA 3ZLVA 1FF9A 2C7QA 1G8FA 3CXRA 4XDZA 2JAHA 5JECA 5REQA 4ZV9A 3KKEA 1TKAA 3DKRA 3QITA 2O8DA 2IXEA 2WBLC 4ZPXA 2FOLA 3MJVA 4NBNA 1S0UA 5EMNA 4RIEA 4ZI3A 1ZO8A 2FWAA 3BF7A 3ESXA 1V96A 3RABA 1PR2A 3CGWA 2Y1DA 1P5HA 3CUSA 4WFKA 2D59A 1M5RA 2CY0A 1BRMA 1FFGA 3QVGB 1BWSA 3K5HA 3RWOA 3DXYA 4H27A 4B2LA 1EB9A 1KDPA 1Q17A 2VRCA 1KNXA 4FBGA 4FWBA 4P92A 3UY4A 1RYZA 4A2QA 5KQLA 2B20A 2FTKE 1ID1A 5AYVA 2AI3A 3LQRA 4EY7A 2PX0A 4LXGA 3B6JA 2P75A 4C6TA 5JWOA 2I2AA 2UUOA 3AP1A 3IT0A 4ZD6A 5HDQA 1IOWA 3L84A 4YNBA 4RY0A 4GWLA 3GYBA 4DMCA 3PNMA 3HGTA 3SQDA 5KNBD 2J9RA 1GA1A 4Q82A 1KAQA 1QRAA 1RNLA 2WPDD 2QGZA 2WU3A 2KPOA 1FYWA 1XRPA 4MMZB 5F98A 1GFWA 2JBAB 4ES6A 1Q50A 2OCGA 3G0BA 4OQ4A 1E9AA 4H7KA 3JVUA 1R1DA 5KDDA 2HWYA 1GZSA 4HGZA 1R4ZA 1E0DA 2PT5A 3KOMA 4PX2A 3HXPA 1J5PA 4ND1A 3CN7A 1OVGA 4LCEA 4P5EA 4P5DA 3KJZA 5A71A 4X92A 3DCIA 5LCXA 1Y1SA 2IJGX 4FYKA 3N2LA 4CL2A 1N0UA 5CDUA 1ADFA 2BCJQ 1CQJA 5BXYA 4UVIA 4UEJA 3R41A 4GI7A 1IY2A 3LPAA 3P2OA 3IBSA 5AW5A 1ZKDA 3RRZA 2XNKA 2KSQA 5B3LA 4DRYA 1IUNA 2YICA 1U8YA 3FY4A 5FQNA 2YY7A 4XJTA 2I55A 3B85A 5TT1A 2Y0EA 3QOXA 3TCKA 2I6UA 1CQPA 2D7JA 5AUNB 1ECPA 3OURA 2ZBEA 1VE6A 1W5TA 1Z5GA 3DE3X 2R60A 4A5OA 3GVCA 2IWHA 3U44A 1Y89A 3ZHRA 4CYMA 2DOKA 2N3ZA 3KTAA 3UIEA 5JOQA 2D74A 4JLNA 5ETJA 4M7PA 5AH0A 4YQEA 2WJJA 5B1EA 4RJIA 2V7BA 1OFVA 4X8HA 1ZVMA 3M1LA 2V7QA 4N0PA 3BCHA 4UM9B 1I2DA 1F2TA 1K8YB 2R6AA 1NJ1A 3I2HA 3S81A 1M2FA 2AMLA 4Q1BA 1SXJD 4AAYA 2JFBA 5AW0A 1T4MA 3W5BA 4W1PA 2FI1A 4Q0MA 5DXAA 5AXAA 1XB2A 1QYVA 5HJ2A 5H9WA 4KE8A 1FUYB 1N8KA 1XVUA 1WP9A 4XASA 3H0EA 1ILWA 4EB3A 2W4QA 5CB4A 4Z4QA 1P62B 3FHLA 5AP9A 2JCXA 1HYBA 2O8DB 4HADA 1N3YA 1NBIA 1UBEA 3UJNA 3U62A 1XA0A 3ZV5A 1JTVA 2XIJA 3I6BA 3OLZA 1RWQA 3ZGVA 5FO0A 3DEIA 3CTPA 4ZVVA 2H2GA 1T2DA 2PPVA 4DDUA 3FN4A 4ZVMA 2FG7C 3I30X 3PE6A 3ZXYA 3TI7A 4EWLA 3DOCA 3EEIA 4NBUA 1IDOA 3VVBA 3PFNA 5TB5A 1DQSA 3T7DA 4D2IA 3Q6MA 4V0NA 2ZQZA 3TG8A 4ZTZB 3EZGA 2ZATA 5HFAA 4EA8A 3HO1A 2CKMA 1NPDA 3BAFA 2AXEA 3N3BC 4F0JA 1JDPA 1MDFA 2ORYA 3C6MA 1NYRA 3L0CA 1N9ZA 1XLUA 1YZFA 2CJXA 2JFWA 3CN9A 4IGKA 4C7MA 1EVQA 2YQ4A 5CDGA 3TEMA 3WRYC 5IJZA 3AP2A 4LYJA 2BDUA 2FE4A 1DTWA 5FUYA 1KEPA 2GKOA 4D56A 1P39A 4HN9A 1K89A 1A8IA 2GUGA 1ACJA 3O1LA 2B5OA 4IMRA 5JDCA 1AMNA 2O52A 4GKBA 1JVNA 5DTMA 3CLTD 4HGQA 4J3FA 2A1IA 3GJ0A 1J23A 1JR3D 4R2LA 4YP1A 3SZ3A 2DKFA 1NQAO 4C5AA 4FEYA 4MV1A 1K27A 2X4IA 2X0KA 5FBLB 4BMPB 5KYXA 2D0DA 4I55F 2DULA 3C5EA 3CH7A 3EGXA 3KZXA 3O2NA 2X2FA 3VOTA 4HQLA 1I6WA 1U3FA 3AL2A 3GA5A 4WGFA 4I50B 4ZEMA 3PE3A 3LKBA 2J7KA 3P7MA 1UDXA 1GWNA 5JZ9A 3SZMA 1EX1A 3TKLA 1K2WA 2VJPA 4P6VF 1A72A 4JB2A 4R0VA 2PRZA 3VHQA 1C7EA 1FDWA 2AMYA 3HC7A 4YP9A 4FIZA 3RFTA 3L6DA 2OGSA 4PX9A 1NBME 3KC2A 2W2LA 5JCXA 2FKAA 2RGGA 4CWAA 4MTCA 4XFDA 1DPGA 3NEYA 3LI2A 1G9SA 1QGUA 4ZRDA 3BMNA 3AR8A 1PZGA 4FX2A 1NBAA 2A94A 3T3NA 2EL9A 2G8NA 4MYTA 4CKXA 3LX4A 4I9NA 3NJRA 2OXIA 4ZYYA 1WRBA 2HNKA 1WMAA 4PWYA 2IHUA 4QHYA 2IOFK 3SNHA 4OKNA 3FHOA 3T5PA 1V0JA 4YB8A 3CWZA 1U1EA 4KI0A 3KT6A 5TEVA 1XDSA 2YWEA 1KJ8A 2R62A 1XMSA 1U6IA 4NDNE 5DPMA 2X6QA 3VISA 3MA0A 1RWVA 1GZVA 4O0LA 3AGPA 3IAEA 3QE3A 4TLBA 5B3JA 1U2DA 2BC9A 3H8SA 5JCJD 3TW8B 3V42A 4GPZA 3OQOA 1A9QA 3W0LB 3JWHA 2AC7A 5FUWA 3ESAA 2E4XA 1EI9A 1VL5A 2OORA 2RCYA 2YV1A 3IOYA 5LZ2A 1O97C 3ZJUA 3TZCA 1NZDA 5CPFA 4U2DA 5K5EA 3B9PA 1C8VB 2B6HA 1SBNE 4NV0A 4DMKA 4W5RA 1YVRA 4X6LA 4LHWA 5E8JA 3DB2A 1JVSA 1KDVA 3T3PB 1NJ8A 3RJMA 3DONA 3C7KA 1T6XA 4PLGA 3EPRA 3Q5DA 3FR8A 3N8IA 3Q7IA 1SCAA 4GYKA 4PZUA 5AKYA 3HP4A 4DS3A 1U0BB 3RUHA 4G4SP 3NX4A 3UG6A 1V71A 1LU9A 1IY8A 2BM9A 1I0LA 1HFEL 5AUPB 4HATA 1GQYA 3T7KA 3SLKA 3L2OB 1GP2A 3I0MA 5CLFA 2PXHA 3SVTA 4WE3A 4BB6A 5JSUA 4QRIA 5KYXB 4QDUA 5KJEA 3ZCXA 2RI0A 2PDAA 3A9SA 2Q3DA 2ZRFA 2X4GA 2O9JA 2WM3A 2BF4A 4JXKA 3P96A 3W04A 3SN6A 4A0FA 5CD9A 3WNDA 4ZVUA 4LHEA 4MW0A 1CZRA 1ZH2A 1WB9A 1IZ8A 2XODA 4J1SA 1H05A 2AWOA 4B31A 1ATIA 5IT5A 2G9NA 2GERA 3BE4A 1FY2A 2IPNA 3CRVA 1VZ2A 3I1IA 3I8SA 5EZYB 1JAYA 1TA4A 1SUPA 3U7FB 1B8NA 3RTCA 2I9PA 2NZUG 3ZWKA 1CEEA 3ABZA 1G21B 1QRRA 3CPSA 3I92A 3ROPA 2QTBA 2YUTA 1CUFA 3B1WA 3KVVA 2Z2IA 2D8MA 3CLRD 1NVTA 1U02A 1W0KA 3THYB 3L7JA 1QVVA 2PYZA 4G8DA 3H1AA 5C1DA 1KI7A 1KVTA 2C3YA 4DT1A 4DR7B 2PX8A 1KP2A 1U8FO 3A36A 4J2OA 1P44A 1W52X 2QPTA 3OQIA 3ESYA 3PEVA 4ZCIA 1VBKA 3U3XA 4FEGA 5HKAA 4RKWA 1FYDA 2ORWA 1N2XA 3AHGA 4H4EA 2FUG6 4NABA 4GLLA 1WU8A 3UHPA 5F23A 2QMZA 1FXUA 1JU4A 3JQFA 1V8ZA 1E4OA 2L19A 1N1EA 3FRJA 4A92A 2NN3C 1FYXA 2C3MA 4TSFA 2QP4A 5DT9A 1YVDA 2EKZA 1COWA 3VTKA 4LXTA 2FX3A 4ALIA 2V7EA 3OA0A 1X80A 4LJAA 1CIJA 1MZVA 3ONVA 2QQ0A 3KO8A 4YAJA 3PLRA 3JRNA 4TZTA 3LUGA 3OU6A 3R0XA 2PO5A 4GC5A 4OUKX 4A16A 2WE7A 1Z0FA 2KLHA 1KJ9A 4GDMA 4F5YA 1WXGA 4YT4A 2E1PA 4AWXA 1WCIA 2IZ6A 4QX6A 3D3EA 4EW6A 1OAOA 1LQ2A 1MT0A 2X76A 1DIGA 1RCFA 4MGEA 1YBHA 4PSAA 5K51A 5HOQA 1XMQB 1FZQA 3SQNA 2R66A 4BMSA 3H4MA 4HAZA 1AQLA 1YTUA 1LF5A 1M54A 2FWIA 2JAOA 3OHSX 5BNZA 1JWLA 3KB8A 1GR1A 4E5KA 3A9CA 1VE7A 2EFHB 4Q9LA 3I1YA 1JJIA 3H9CA 2EC5A 1UM9A 3A14A 1BE6A 3RHFA 1QORA 1ULHA 4K03A 1C29B 1TCUA 5BSKA 5BSTA 4OGGA 1PR3A 3AEZA 2IGTA 3G2NA 2JKZA 3VR3D 1NNLA 2I1LA 4QLAA 2ZREA 2C4TA 1TLFA 3KEFA 2P9YA 3AKDA 5B64A 4RVUA 4G0MA 2A59A 2OG2A 1ONBA 4RY8A 1NASA 2IODA 5DN6D 1JL3A 2XF2A 4TUYB 5DB4A 3CSSA 2DH6A 2VYVA 1ZUHA 1YBFA 2C2ZA 2HHLA 2VI5A 4FFBB 3EXHC 4OF4A 4Z9FA 1L5HB 4FGSA 4XQ0A 2DUMA 3REOA 2HBZA 4YUWA 2WJ4A 1T5IA 2BR5A 3EXIB 3OJXA 3HL4A 5I9LA 4P7JA 1TM4E 1DBSA 1CEQA 2O2DA 2W58A 3ET4A 1KMHA 2LE0A 4UNPA 3DEFA 1F6DA 2QL5A 1ZMTA 2E6KA 3UH0A 3SI7A 4FJ2A 4BFSA 4GRAA 3ZDYB 3I9V6 4UMDA 3P9NA 5B58T 1MTZA 3CNEA 1CJKC 2O3JA 2R6FA 4JQSA 3KPWA 4K6FA 4O4HF 4WY8A 4ZT4A 4AJNA 4EUEA 5BR8B 3VO2A 4I2NA 1X86B 5G0SA 5EZ5A 5BURA 5WRFA 3ZGZA 3OTQA 1A27A 3R4VA 1OLOA 1DBPA 2BM8A 5AOCA 4JELA 1U8AA 2NSJA 2W98A 4DRXB 1QZXA 1V7ZA 1VYHA 1TMOA 1LDGA 4HWOA 2P2NA 1J0EA 3DMYA 1NC3A 1KZ1A 1E5QA 1QPGA 3RYIB 2QS9A 4RJLA 3OI7A 5FBVB 3NU1A 5A05A 2B8WA 1PDWA 2H1IA 1A9YA 2F2TA 2XUDA 2ZVDA 3BICA 3NR2A 3PA6A 4RADA 2ZTSA 4UD6A 4F6CA 4LRUA 1XTIA 1GNSA 2H1LA 1YL5A 1NJ2A 4GGPA 3CNNA 3IA2A 3GJ3A 3JZMA 4AUMA 4E5VA 3AOEC 4EMTA 5A9SA 1P91A 1URPA 2A5GA 3L01A 3JR7A 1SVMA 1Z4MA 4H1UA 4O3FA 4I81A 5EHIA 1ZLXA 2YMQA 2QGFA 4ETIA 2B1QA 2VHYA 3MWJA 2BGTA 4GU5A 3GLFE 4EKNB 4LXXA 1TM5E 4KDEA 2XZPA 3UMRA 3ZVRA 1OV4A 3YASA 5CK4A 1D6SA 1AKRA 2PZKA 3P0HA 2X0EA 4Z1OA 1MC8A 4UCXA 2C2WA 1Z06A 3GVIA 3A3YA 3JCZA 4LNUB 5F7OA 1NI5A 4KR9A 4S2EA 5IM4F 3AVPA 3R6LA 1QZTA 3IAS6 4HLQB 3RTBA 1YR3A 4PNHA 3IE1A 4REMA 3REFA 1JT2A 3F78A 4A8JB 4O08A 1GL7A 5AI6A 5L6LB 4TV8B 4X6YA 4ZN6A 2GN0A 2GF0A 3OQVA 2KM1A 5LB4A 2J4DA 1YS6A 3UWOA 3F9IA 1Z28A 5FA8A 3U5ZB 3QVJA 4E6EA 5KOIA 3VYSB 2RKWA 4MA5A 3R7FA 1F51E 4OBBA 4RGBA 3V7FA 3PQ4A 2FCAA 1RXEA 1XTZA 2Y66A 1NULA 3K35A 5J5VA 2X8AA 2P41A 3QEKA 5D86A 5HGJA 3WGLA 1EGQA 1J9GA 2JARA 4GLFA 5CA0F 3TNYA 4FK8A 5E3HA 5KOJA 3CX4A 4KQXA 1ZY2A 2ZRKA 1H6AA 1FVOA 3QV2A 4OYLA 3T3GA 1WV1A 3B78A 1TO2E 1UK7A 1PV4A 1H3NA 1EWRA 2XUKA 4BUCA 4RZHA 1GGNA 1BVUA 1GU1A 1ZR2A 2ANBA 4JJ7A 2COEA 1IWBB 3I8OA 4WLVA 5IAAA 3FPSA 2XGMA 3BFVA 3EAGA 3RUCA 2OA0A 1MCZA 3HYTA 3DF9A 1KSHA 3UB2A 4DLYA 2J08A 5L7WA 1NP6A 3KYCB 1DKUA 4ZAVA 2HADA 2H3EA 3RNOA 1KSJA 5F7XA 1J5XA 3CZQA 3RK1A 1RPTA 1SK8A 1T4CA 2CBZA 1ZOPA 2EP5A 2PJDA 3OAAA 5C8YF 2XUGA 2JVIA 3SAJA 5BMVA 2XE4A 4YJDA 2J9FB 4UEWA 4JLWA 4MQBA 2P2CA 3QVMA 1BOFA 1L7AA 1XDGA 1YO6A 3GN1A 4WBNA 4QASA 3WGOA 4CM6A 2GJKA 4EZIA 1IZ9A 1WPRA 2WKPA 1K6IA 5JU6A 2QN9A 1DC7A 3VZQA 1DMSA 4LBZA 3F96A 1HG0A 1I5OA 1KAHA 2UUPA 1GPLA 4QEKA 4QPJC 3F6SA 1MIOA 3H7IA 3RV3A 2DC1A 1J0DA 1X1TA 2Y67A 2YOGA 3KT8A 1A5TA 2YXBA 4BFLA 3BK1A 3WSVA 5LMCA 1I32A 4MQ5A 4OKSA 1HDOA 2GPNA 2FR8A 3PUZA 4JLKA 4X91A 5LMUB 1NXQA 3EMKA 2B34A 3PQCA 4KVGA 3G7UA 2QQEA 4UZFA 4NPHA 4PYIA 2PCLA 3T12A 3ZE1B 4DHEA 1ZNXA 2GEDA 3BSFA 3FYCA 4FQ5A 4RFVA 5F3WB 2RJNA 3R3YA 4LX0A 2XYVA 4WNAB 3CWCA 2HSWA 1IIRA 3FBWA 5EHQA 4A0QA 1NV9A 3JQ8B 1PFVA 2P9GA 3LCCA 4W7HA 3LBHA 1KJIA 3OPXA 4M0KA 4K6MA 5KNDA 4Y0AA 2UXDB 2Q49A 1KZ4A 3F8SA 1OC4A 1SMKA 2VYFA 2JVKA 2RDMA 1KIFA 2QK4A 3ORYA 1I9CA 4P22A 5SZKB 4WOCA 1S2NA 2ZIZA 1NSTA 3QNWA 5DDIP 1AO0A 2J85A 1DEHA 4O2BB 1Z6TA 5BQ3A 3AW8A 1UODA 3HQ4O 2OYCA 3U4AA 2HT1A 1H66A 4QYSA 5JCZA 1IXZA 1ULTA 4J07A 5KDOA 5AVOA 2ZUUA 4G36A 3C3DA 2PGJA 2HKIA 3B1VA 2PUCA 1SUDA 3FDIA 3I9KA 5LPNA 4D44A 1LFDB 1S96A 1QLHA 2WMNB 4COOA 3PRKE 3GL9A 1I6MA 4C3ZA 3HBFA 3M82A 4AVYA 4LF7B 3ZNOA 4GAEA 5J40A 5LOVF 3AJRA 3FYUB 5I3CA 3JAKA 5ESRA 3DMHA 2Y1LA 2CUTA 4QPZA 2GXSA 4RV5A 4B3HA 1YGYA 3L06A 4NU0A 5JNVA 1SCUB 3CF4G 4GGMX 3V2UA 3C1AA 4FYXA 2YIDA 5ED0A 4JR1A 3HU3A 3HDJA 2JGIA 5ESWA 1TJ4A 3ZHTA 6REQA 2CUNA 3H3JA 2AZ4A 2H2WA 1QRTA 2P27A 1U3DA 1QXSA 1Z36A 2H6EA 4RW0A 4H08A 3ZJVA 3UO8B 2VP6A 4WGGA 3V8MA 3HDVA 3ORRA 4KXWA 5E3IA 5EJ8A 1W4RA 1OZ0A 5AK4A 3RBZA 1CUUA 4BMDA 2WUGA 3LDFA 3OLQA 5DRTA 2PE5A 4EHBA 5CNJA 4DNXA 4FNGA 2GJ4A 3E35A 5T6MA 5DGXA 4RXTA 1JXAA 4C0LA 5C1IA 1E1MA 1WZCA 4Y2YA 4NH4A 1I4WA 1YBVA 3JX9A 1E2PA 1C9NA 1KJZA 5D87A 3ZQ4A 5HZHA 4YREA 3CLUC 4GQBA 5K0BA 5FPTA 4YO8A 1MABB 1V3VA 3DWGA 2NU9A 3QYPA 4ND7A 1F06A 1E3DA 1NY6A 2O2CA 1NTOA 3PYMA 1UBGA 4X5OA 4ZJPA 3PVSA 2NXCA 3S2UA 2HJGA 4K5QA 4PLVA 3WIBA 4HMQA 2M1XA 1UJCA 4LE2A 4KYTA 4UATA 2R65A 5CDTA 2ZOSA 1GKYA 4A9AA 4DJJA 5L4NA 1TYCA 4ZYTA 5JRZA 4J7XA 3CPEA 2GFQA 4JN6B 2VAPA 2GR9A 2QA5A 1E5LA 3JR3A 4Q7EA 1UJBA 4AZ0B 1UIRA 1I3MA 4MV0A 4C30A 5MN5A 4OHWA 2WYUA 3WBJA 3E18A 4G1UC 5ALZA 5EG5A 1IRXA 4HDAA 4DREA 1KK3A 3S2YA 2P2ZA 5K2OA 4FFRA 3AGQA 2IA5A 2PD4A 1QH1B 3CKYA 2Z6AA 3CRMA 3QJYA 4ND8A 1Z6GA 1U7HA 1BDMA 1OE0A 3E8MA 1I7NA 1U9IA 5IJWA 1CE8A 4LXHA 3RRFA 1PJCA 3GGCA 1B76A 2D1YA 1E18A 4P81A 2VRBA 3SSAA 4C6HA 4YCJA 2V1XA 5FYDA 3AIOA 3NMUF 1UXKA 3QIVA 3RGGA 4WKGA 2GN9A 1D4ZA 2QTVA 5H68A 5EQTA 2QAGB 4EG3A 1Z8DA 4L4YA 2ICAA 3KPJA 3B7PA 3H3XA 4LJ4A 3UKDA 2ZJFA 2G9RA 3RSGA 4ZMSA 3U6BA 3ZKWB 3RS3A 2WZDA 4M86A 1NBEA 3OE1A 3PUHA 1ETUA 4WAUA 3KUDA 1R4AA 1JA1A 1TJ3A 3GEHA 3H2KA 4G0YA 3VU9A 3OPVA 4V0KA 5H9VA 1C7FA 5LD2C 1MNQA 1RHJA 2QD4A 5A7HA 4GM0A 3NIFB 2VJKA 4F2GA 5FIUA 5ALTA 4RTKA 2LTAA 1SEPA 3QM1A 4NEQA 3KAKA 1AGYA 4KC0A 4G5QA 1M6EX 2QX8A 2HN9A 2QUIA 2YYAA 3JPYA 2W0MA 3WRXC 1H6BA 2P0AA 3KG2A 2M1ZA 1CRWG 2Z56A 3VR4H 4OQXA 4CM4B 5IVHA 3F74A 1Z37A 5KSPA 3PB3A 3LWZA 4BNIA 2RIRA 3W9SA 3HG7A 2J33A 4NR0A 3QE2A 3CRQA 4HG2A 1DG1G 1OREA 1ZGBA 4JWTA 3LHKA 3AHEA 1L1RA 3PGVA 3I9FA 3WFIA 4R0MA 3EGOA 1JLSA 1NVXQ 4PINA 4BO1A 1YQWA 4P0PB 1A8HA 1ZK1A 3ZS9A 2Y76A 1PGJA 2EZTA 4PYMA 4RFSB 4E12A 1P0CA 1UEXC 2H1RA 4IQGA 3IAUA 4RM2A 3F1KA 1ZEMA 3NTRA 3FFTA 2IKSA 1H22A 4NENB 2XTZA 2JGDB 4O2AA 1XV5A 4QUEA 4F97A 1W2HA 4G86A 4C3OB 3FZGA 1JAIA 1CZKA 3N53A 1KMIY 2JANA 4F4CA 4I1PA 1JFSA 1JBKA 4I9FA 3IBYA 4OFZA 2QMYA 4NC9A 5FI0B 4CDMA 1D2EA 2FWNA 1S4MA 2GARA 3ASUA 3B3JA 4QOIA 1V7CA 3EFBA 3FMFA 3TQIA 1Q0QA 2W0SA 5AI4A 2BTQB 4PQYA 2X22A 4Q18A 1ISMA 5JPIA 5HM8A 2FJ0A 2F8MA 2D2VA 1XVTA 2AG8A 5F9FA 1QHIA 3M6AA 2OXFA 1CNEA 5JCOA 5BWOA 1OU0A 5BVGB 1C30B 3PYXA 3ZYCA 1M2KA 1KYZA 1KDTA 1CUEA 1CUDA 1IH8A 2XECA 3E53A 2NXJA 3RT9A 4XSGA 3AFNA 3RSLA 5IBPA 5IYZF 4GR9A 2ZRDA 2BLNA 3GT3A 3L1IA 3EIUA 1NMXA 4MVJG 3GYGA 1XU9A 2GXQA 2Y05A 1TEVA 3ZHOA 1GXSA 1JV2B 4UDYX 1ADYA 1UMDA 2NOAA 2ZYUX 3SY8A 4IDFA 3FPKA 4F3CA 5FV4A 1C14A 3M7IA 5G41A 3WYNA 4NH0A 2PN1A 3MELA 1FFWA 4FJ0A 2ISQA 3OESA 5AW9A 3PE4A 5TPZD 4X94A 3HI4A 1YNOA 4Y1GA 3RIEA 4WPGA 3JALA 1SUIA 3AVOA 1ZH4A 3QXJA 4BQPA 3QK7A 1WUHS 1P75A 2GZRA 5JQGA 1FPMA 1XAGA 2RH9B 4RD6A 5KJCA 1AO3A 4U6SA 1TMYA 3E70C 4X44A 5JHHB 1N57A 2E0IA 2BFDA 4RDXA 1BN7A 2OZLA 4N82A 4YLGA 2XBLA 3VUFA 3KZOA 2IZ0A 4CLOB 1BWRA 2O3TA 4Y1RA 4D8UA 3MAAC 3O3MB 2CYBA 1K6XA 3OCYA 2EWWA 1EZZA 1D07A 4KBGA 4M1ZA 1M5UA 2BMAA 1JFFB 1DJLA 2C5BA 2ZRMA 3C8HA 1BVRA 3L0ZA 1TCCA 3C3BA 3DE2X 3U56A 2H7CA 4PWZA 1DUVG 3LQQA 4QE3A 4H9GA 3JD0A 1VZ3A 1JG7A 3F6PA 1CUCA 3COZA 2LD4A 4G5OA 4G84A 4LE0A 4WFJA 5CIWA 5EMKA 5FOQA 1NQ5A 2GSDA 1K7YA 1KPIA 4FONA 4PYRA 1JQ3A 3CH6A 1MXFA 4JUIA 5DO9A 1XTTA 4NKRA 5C8XA 4NJMB 1SFRA 4KTVE 1DTEA 3TZKA 1V1JA 4CKZA 1JKIA 3COYA 1T6ZA 2VTVA 1EFKA 3C3EA 1V43A 1D1TA 1JZTA 2II6A 1J07A 1ESEA 3H9BA 1QQ5A 2R84A 4Q9HA 2L2QA 4CI9A 5F52A 2AOTB 1ENZA 2X8BA 3KD2A 4NZ9A 1J22A 3HCPA 2RGRA 3VKGA 3INNA 3MJ4A 2AEFA 3Q9LA 4LC9A 3UMFA 2NXNA 2J59A 4G2TA 4N40A 3IPRA 1G64A 4ZI7A 2DQSA 4EHJA 2ENWA 2EHJA 4G0OA 2EKPA 1SJ9A 2D5AA 2MT9A 3RD5A 5L3ZA 1DVRA 3LS2A 1N1DA 2C7BA 2QSJA 3HB7A 2XDQA 1Z16A 5ESXA 5CT9A 3N07A 3ZWVA 1NRWA 4TSRA 4Q4LA 1U3TA 4QPPA 5JAQA 2DP4E 3NETA 1DKMA 4IEIA 3VSEA 2NVUB 4B35A 4TKVB 1IN5A 2AI1A 2OC9A 2PA3A 1Q0ZA 4PZPA 2PUAA 1L7NA 3DL7A 3WB0A 1ZGAA 2OV1A 1T8RA 3P9XA 1G21A 2PX4A 2EBHX 2H4ZA 1PSDA 3K0EA 4P0TA 4XSVA 3WGHA 4BGDA 1XEFA 1ORTA 2J48A 4Q9JA 4LNHA 1KAOA 3AG5A 4IDPA 2UVPA 4ZODA 4B2IA 4M6WB 3HN7A 3U48A 5KTTA 3EY9A 4DJTA 2Q1XA 4LV8B 3SHVA 5EJMA 1QF9A 3SIPA 3I2GA 5EJEA 1S9HA 4XD7D 2X5OA 3RJZA 4C01A 4NXNB 3AW9A 1CY8A 3KFVA 4PG4A 5LXTA 3AL0C 3A1SA 3MC1A 2HDNB 1O58A 2JIQA 2J7PD 3T5MA 4F2HA 4JOQA 3ZW9A 3RYFB 3R8FA 2Q3JA 3KSRA 2I66A 2YWBA 3FZQA 4K87A 1B0UA 1GNVA 3ANTA 3KEQA 3R76A 3I6QA 3NCTA 3RVJA 4D9GA 2UYQA 3EG9A 3Q5EA 4EPVA 5BPFA 1WBDA 3VU1A 2PL5A 1VL1A 3HP1A 2RGUA 4UQOA 2EFDB 4D9NA 4XQEA 5JROA 4L72A 3GLHB 1G8HA 1HT0A 3B53X 4FKZA 4LJLA 3MTQA 3RKUA 1JQLB 4OLAA 1RPNA 1TTQB 1PT9A 3TTUA 2AEEA 3D2CA 3W8NA 4Q5IA 1O96A 5BSHA 1FLNA 1QGYA 1FXWA 1BS1A 1C9EA 1JG6A 1I3NA 3DHNA 3QG1A 4RH0A 3TJMA 1JEYA 3RFVA 3LRTA 5HPYB 4FX5A 1FFCA 5HKLA 2I6XA 1LBIA 1KO7A 1PQUA 1QIGA 2JJMA 1MB3A 4GPAA 4H4DA 4NJMA 1VCMA 1LA2A 2VCEA 1MC1A 1JLLB 1YDWA 3OO0A 5LOVB 1TZKA 3D3QA 5TXGA 5KNLA 1BHQ1 2AXNA 4TYPA 2P9ZA 3QFHA 3O03A 4G6ZA 3S1AB 5D3QA 1Z0IA 1QP7A 1KXZA 3A10A 3CFYA 4NCAA 2OO3A 2J4FA 4QDKA 3I53A 4EEXA 1C1HA 4Y2TA 4CTMA 2XZLA 3W6UA 2CXTA 1RXIA 4ZQIA 1QTNA 4Q47A 3EG5A 3HCWA 2FUNB 3B2NA 4DC0A 4GG1A 4NYJR 4QFDA 5CYFA 1G5TA 4O4LA 2YZNA 4FR2A 2E49A 2VAWA 3O8RA 3TO5A 2HQ1A 1Z74A 3IALA 4JP3A 4BO4A 5FPPA 3BE5A 1CUXA 2EWVA 3FWYA 1HX7A 4KKXB 1XTBA 2DGDA 2FF5A 3IJ5A 4L9AA 2ZBUA 2YXNA 5HUJA 2AW3A 2QZPA 4HFRA 4ITVA 2DBYA 2NU6A 1Z2AA 2C94A 3W2EA 1L8QA 2ZJ8A 1DMRA 4LZWA 1CQZA 1V11B 3DT9A 2I4MA 3GO4A 3W2IA 2O0JA 1SHJA 2V65A 3CLSC 3NIDB 2C1XA 1Y63A 2VPZA 1ODJA 3EODA 4RPIA 3PITA 2C9OA 4LF8B 5KCZA 1UMDB 4POAA 1YRLA 5DN6A 1IHXA 4PTYA 2COUA 2BSXA 4OB8A 1QH0A 3ETNA 3EX7C 1BOOA 4UULA 1J7JA 2DFKB 2YJGA 4XD7A 1CJSA 3GFVA 3IUPA 3R9XA 2H7XA 2FZLA 2AMJA 3I3OA 2VC2B 3L1VA 4WERA 4MYSA 4XFJA 4D9HA 1J70A 1ZJ5A 4M9SA 1R4NA 4IW3B 1YE8A 3GLGA 3D8NA 5JE8A 5CITA 3ZKWA 2AN1A 1O9HA 2PTHA 4MO2A 4OPMA 3FAKA 2Y9PB 2W8BA 3GZNA 2PX5A 3X1MA 4GZMA 4DMMA 5BNFA 1USVA 3AF4A 2EYQA 1WUTA 2WWWA 5AUOB 1SG9A 2ETVA 3VI4B 1JSZA 2GDJA 3LQ4A 4B7XA 1Z2DA 4Q7QA 1PD0A 3WLFA 2AJDA 3M6XA 3WLKX 3GNQA 3ZHXA 4DBZA 4H3KB 5CA1A 2CHQA 3ZXSA 3Q15C 3QJGA 1GPYA 3L8MA 1BJTA 4TTVA 4DSTA 4RWZA 4PYNA 1SXJE 3O47A 4F8JA 4DV6B 1PQWA 4FYYA 3CLKA 1NVEA 1AUOA 1XCLA 2BEUA 1J09A 2AJ8A 2Q50A 2PFKA 2XNHA 1G63A 3KB6A 4RQAA 3B52X 3SF0A 1JZQA 3SYRA 5IC4A 2FLVA 3C45A 3W7AA 4JMLA 1NVGA 5BUQA 2BGWA 1ULZA 1Z0JA 5JYCA 4GZ6A 1N5KA 3OZUA 4G5XA 4NCXA 4QT0A 1VHWA 5HP4A 1J2UA 3HR4A 3L5OA 1Y3DE 2QRUA 5FBQB 2QQFA 3L4KA 4Q15A 1XJWA 5BN5A 2GF9A 4ER7A 4NK4A 4BFWA 3OLCX 4KE9A 2YN0A 5G0UA 4TV8A 3U1BA 3RAGA 2D4HA 2AWNA 4JJ4A 1T5LA 4L3VA 5AW4A 2H1SA 2FP4B 1G41A 2IQ5A 2RG1A 2VPQA 3AYXB 4DMHA 1TXGA 3LC7O 1KY2A 4G9BA 3UJ3X 1Z88A 2A9PA 4L95C 1TA9A 3ZJ4A 4O8ZA 3WFJA 3EDCA 4LPKA 1JQ5A 4M6WA 4YRZA 3GJ7A 1UPAA 4G1MB 5EYPB 2FPIB 5FOVA 4HHEA 1R8QA 4BVAA 2C2YA 4CGZA 1JHQA 2Q4EA 2N46A 2ON6A 2X0RA 4BQRA 3SHWA 2VDNB 4LIPD 3KE9A 2N42A 3I39X 3EEYA 3DZFA 4M76B 4EKDA 1LI5A 1T3LA 1GGVA 4LE1A 4AO6A 1M8GA 5EAIA 2QT1A 4WMLA 4G5SA 1OXVA 1W2WB 1KFCB 3C7TA 1L5QA 4RZ3A 3N70A 1E3SA 1Z9BA 5AXDA 4WK0B 1SG6A 2GN2A 4LCJA 4QJ5A 4XVHA 4C4AA 2V96A 2A1UA 2R7NA 3FB4A 3MAGA 4RV4A 2FPGB 5C81A 2ZUBA 2MR6A 1I6LA 5KTPA 1HBJA 2CVZA 2ADMA 3ER9A 1ZVJA 2C2XA 2NT3A 3BFJA 2GF2A 1YU9A 1JLRA 1KC3A 2AR9A 1M1ZA 1NUSA 1VIAA 5DWVA 5EWMB 2Z4TA 2QRGA 1WVMA 1VSTA 3CRNA 4MLDA 4WFQA 4WLOA 1AK1A 4BO9A 3CT4A 1YRQA 2C88A 4LAFA 1K75A 1R8SA 3PEEA 1MV8A 2DQ4A 2OPHA 1S9DA 2VXYA 4HDRA 1Z4QA 4XCQA 1OCEA 3IMKA 4W8HA 3GJSA 3LKDA 2HA4A 3O8LA 4Q19A 5DCLA 3TWOA 2ZYSA 1NDUA 1UJ6A 4CMBA 1RAGA 1UANA 4F5ZA 3THXA 4RL4A 4MEBA 5P21A 3V6LA 5EIAA 4BQQA 3KU1A 1K97A 3E4DA 3STUA 2B83A 1E1RA 2OM2A 5A03A 1XYVA 2QAGC 2EERA 1U99A 2GO1A 4GI1A 3UC9A 1WVGA 2MMGA 2V6GA 3F9CA 3MCVA 4BTVA 1R2QA 3BA6A 4K6GA 3BXXA 4NL4H 1NVKA 3A2KA 1D1PA 1Q20A 3B9QA 2XA9A 4FOTA 3T9EA 4E5SA 3JRXA 2WNSA 5H8WA 3VJKA 1M8PA 1XMOB 4QFMA 4WV3A 1SQSA 3I73A 4X3OA 4NYMR 5C4IA 4LTNA 5FHRA 2LCQA 2I2FA 3TIXB 2UYYA 2NPFA 1V5IA 2VYND 1EH5A 4H7PA 3HDTA 3L0BA 3PI7A 3QIAA 1XJQA 3UYLA 4J6FA 3VVCA 1XA3A 3LDAA 3BSWA 1CR6A 1DEOA 5DLDA 2Y0CA 4ZCLA 4EF6A 4IQ4A 2C8JA 1M83A 5IDYA 5K3AA 5GJBA 1H2HA 3HN2A 1Y5NA 3SIXA 1R50A 3F2IA 2IUFA 4BLOA 1VOTA 3VM6A 3MFYA 3GEDA 4QRDA 2CV1A 3F67A 4FILA 3HXOA 2RONA 4FNMA 3FAZA 5JVDB 5KWEA 2Y4NA 4LFAB 1LX7A 2EAUA 4YC7A 3I45A 5SZIA 3UCEA 2QTTA 1OH8A 5KTYA 5CFQA 1C0KA 3OQJA 4RJ2A 3DH0A 2FPXA 3UMVA 2C1EA 3E03A 1Z0SA 1EGVB 2CMDA 4E5MA 4KUEA 4FN4A 2QZSA 3PJDA 2PD3A 4G0NA 3RFUA 3DLHA 1RKBA 2BVNA 4TLDA 1YZHA 5GADl 1AXRA 2ST1A 1AHNA 2CVPA 1QLWA 3G82C 3MXTA 4JLPA 4ZWNA 4R1PA 2J5RA 3SYLA 3LGSA 2QX4A 3KETA 2ORIA 1QFZA 2CLKB 2PLWA 4HPWA 3DZKA 3WNCA 3D6NB 3N6RA 1P18A 5BVHB 5C2JB 4P86A 1WXQA 2WIBA 3ROZA 4D9MA 2VDJA 1JH9A 4FMBB 1X7ZA 3TAXA 4J7AA 3I3SR 2XRZA 4IVPA 3BN3A 4M0MA 2C5SA 4PRZA 3D8RA 1T2UA 3QPDA 1PS9A 4PYKA 2BYTA 2XB6A 3MTBA 3SJZA 5IX8A 1MOZA 2H0QA 2IL1A 3LIIA 3AM3A 5IW8A 3RC3A 2W83A 3DWIA 3EZLA 4LSGA 4N5MA 3PGKA 3UMCA 3W5JA 1KYVA 4HDKB 3PKZA 1P3Y1 2C9BA 4TMXA 2YJZA 1X7GA 2GXUA 3H2GA 4EHLA 1YA6A 1SKYB 3TB6A 4CVNA 4B3GA 3R44A 3PV0A 2ZJ1A 5A9TA 1ZI9A 4HP8A 3UJPA 5TQ0A 4H7EA 4N7JA 4A7PA 1UC9A 5F2NA 1L4NA 2KE5A 1N9KA 3BKXA 2DCMA 3R0VA 2PFSA 4V3CA 5JATA 1G2IA 4CFSA 3LZDA 2JEOA 4X54A 2JZNA 1FZTA 2FN9A 3E7XA 2B3TA 5TMPA 2YZ2A 4Q4HA 3LL4A 4RYDA 2OFPA 2Q3MA 5K0CA 3I9JA 1QX4A 3UANA 2NYVA 3VX4A 2HPZA 1RPZA 2CF5A 3BMCA 3NTXA 3R24A 5A02A 5ICCA 2BTEA 2ERXA 1YB5A 2EJVA 2ZSJA 4MP8A 4R8VA 3WNZA 4B7AA 2V1UA 5LNK6 3BB4A 4QTYA 3D43A 3PUXA 4AB1A 1T1JA 3LYHA 4Y2XA 3WLJA 2VTKA 3M5DA 5D3KA 1FYVA 1RAHA 1P17A 2R8ZA 4IV8A 1GRCA 1QBGA 1NNSA 3U31A 4D9KA 1ZRNA 2QX6A 4X20B 3PCTA 4LMPA 4M98A 3G85A 4ME6A 4BIMA 2E4WA 3STTA 1KZGB 4YRMA 4EHAA 2ADFA 4RAQA 1COWD 5J2UB 1M8FA 1QRDA 3BJIC 3NOXA 5FV7A 1LUAA 3J80A 1YRYE 3ZJTA 4QU8A 2ZI4A 1CB7A 1U9JA 3EWSA 3G49A 1M7GA 3BT7A 1TRKA 1JBQA 1QG4A 3L4EA 4YBRA 1R00A 2OZVA 3MK31 4EELA 3PDUA 4QJ3A 4IQ8A 1PJTA 1L4FA 1XRLA 2ZVPX 4ZAWA 4AP6A 5JBIA 3AEUB 3P4YA 4HDNB 4LC0A 4ZDJA 3IP7A 5JDIC 4D6PA 1FU7A 1JHVA 2IP4A 3CUEF 1LC0A 3WDMA 5LQNA 1MKYA 2ZZKA 4MI6A 2O8EB 1D0IA 1O9GA 4K28A 4ESOA 3NBUA 4QWMA 3U9TA 1F3LA 3E3MA 5ERYA 1BX1A 3Q6NA 4BJ5A 4G0WA 2Q9UA 1T1SA 1OI2A 2I6TA 4NNJA 3OZBA 3HUDA 4FHDA 1QIEA 3WIVA 1BXKA 1G2QA 2PWYA 4FSDA 4UOQA 1T8YA 3X1KA 3X44A 3ETJA 2JFHA 2OO5C 3VPSA 5H81A 2AK2A 3IV9A 2RHJA 5JSZB 1YT5A 2H1HA 1TGYA 4ZRNA 2OGTA 5JXJA 2NPOA 3WWCA 4Z8YA 3T0IA 2R44A 1HT3A 1DX6A 1MHTA 1Y9DA 3B7GA 3RLIA 3H5NA 1ABFA 3ER8A 4KLCA 4B83A 1MVNA 1Q1BA 2GK7A 3MWYW 3E3LA 3EIOA 4MVJP 4E3ZA 1RJEA 5JBQA 5JAIA 5BNWA 4YGYA 2IU6A 3A3OA 3PR3A 3WTBA 4JB0A 4DARA 2QN6A 1B0PA 1M1NB 1G7TA 1ECBA 2GHTA 4YWJA 4H6WA 4URZR 3NO4A 4OA5A 4R0NA 1E8DA 1VCHA 2NZXA 2C7RA 3E2IA 5GOTA 5EKUA 4EMSA 4GPEA 1ZNYA 5G3YA 4HVCA 2BUCA 3FLBA 1BH2A 3A1WA 2CFSA 2JGMA 5BRNA 1G3IA 2B4YA 1XWIA 2M6RA 1GIAA 3AY6A 5LBIA 3ZD7A 2HRQA 4DABA 1NVWQ 4S3MA 3RADC 2QTNA 1JLMA 5FOUA 2H07A 4AMVA 1E1NA 1KI8A 4LW8A 4FVTA 2BE7A 3HJGA 3S8YA 3LDHA 2AG0A 5EIHA 4W7SA 3RK0A 4A82A 2GD6A 4QUDA 5B1DA 3QPVA 6GPBA 1PJ2A 5DX1A 3BD7A 5EWLA 4M89A 2ZXUA 1E2IA 1EFUA 2C07A 2PKYX 3AUJB 1N2CA 3LOPA 2AE1A 5EEHA 4CDRA 3IO5A 4Y2PA 2XUFA 1BDJA 1XGKA 2XYPA 3CNHA 3DZCA 1B3RA 4LRXA 3W2HA 5IUKC 4B3DA 2FLKA 4DC9A 1VMAA 1DRJA 2PQMA 5LN1A 2UXCB 1ZIXA 2QSUA 1QQTA 1GEEA 4CIVA 5A6SA 2R11A 1GQ2A 4JNKA 1T0IA 5TIIA 4LGMA 4H7JA 2LKCA 2EBWA 4F4HA 1AVTA 1ZMRA 2A57A 3IJPA 2OWDA 4IDDA 3JQPA 5I7UA 1I1OA 4DCNA 1E66A 4B3MB 4CL0A 4B4UA 5A5FA 4FGJA 2HXYA 1T2VA 2XAAA 4KWCA 3UUEA 1G59A 3FETA 1IK4A 1P4GA 4F71A 2EF1A 2B61A 4ZEVA 2DTDA 3WLIA 5BXQC 1CRQA 3HCAA 2V5UA 1WL8A 3JQCA 1YVEI 3NT2A 2TRSB 4XGKA 2E9SA 3KJNA 3T1VA 3VNRA 2V3CC 1U3CA 2EW2A 3INRA 5GONF 4HVAA 3L7LA 5IK2A 4IUDS 2B4AA 4N48A 4HWGA 1OXXK 4OHYA 2BFEB 2C5HA 2Z5LA 1DWOA 4AY5A 3BGVA 2LBPA 1QTQA 2DB3A 2ZANA 3NHLA 3QVKA 4M7OA 1S8OA 4Z51A 3WGIA 3HJNA 2IS6A 3BTVA 2J9XB 1CKEA 5P8WA 3EASA 4EFLA 4B3CA 1ORVA 3NC0C 3GLKA 3HCRA 2CLMB 1LS6A 2X4LA 1V39A 1X1BA 2AE2A 2JLQA 3K9NA 1OZFA 4IZ6A 2ERCA 4TKLA 1FIUA 2IYEA 1WXDA 3K70D 1DB3A 4HFJA 4DKJA 4GKKB 2DR0A 2VHCA 3DP7A 1XKTA 2G4CA 1B0AA 2PZ8A 3VYVA 2INGX 2Y8EA 4PW0A 5T3YA 3SQOA 3UXEA 2IEGA 5J23A 4PQFA 1TYZA 3L4BC 1E6EA 1Q7BA 2VOJA 3E1GA 2E5LB 3LD9A 4NZMA 1L4HA 1HQCA 1I2CA 1LBEA 2QR2A 1JALA 1REQB 1YHNA 3LC1O 3OLYA 1HORA 1TEZA 3MWGA 2H0RA 2NUPA 2H54A 4OP3A 2QSYA 2HX1A 1VHTA 2ISSD 1I1NA 5E9JA 4RKFA 5ERGB 5EXTA 1TK3A 1P7YA 2FRXA 2IOYA 1Z4IA 2R5FA 4GI5A 4L4SA 5FA5A 2FOIA 1WNTA 3MNFA 4B3BA 5JISA 1IEWA 4XPIA 1Z62A 4M37A 1GQSA 1QIFA 4HDMB 3UMSA 1MAHA 1UBNA 4YJGB 4XGQA 1HE5A 1U5BB 4LDJA 4HVTA 1PP4A 1RD4A 3MTDA 3PGLA 4XM2A 4MLPA 1DDOA 2FB9A 1QV9A 4XYEA 4CCYA 2BFFB 3RVPA 2G9UA 1SG0A 2DQKA 1R8XA 2C2KA 1L4LA 2AEJA 3T1QA 1MX3A 1T8TA 4MVJI 3KZ1E 3ZE7A 4IS2A 2YBEA 1EFVB 3O4JA 3SEQA 4P4UA 2QUAA 3ZGXA 3G13A 5ULLA 1NNUA 1CRLA 4QBHA 5ISMA 1HR0B 2MDTA 3NBMA 3OJLA 5FLEX 1OX5A 1EP9A 4RDCA 3RWBA 2F8SA 3PF9A 2PZFA 4G23A 4D98A 1VP9A 4FZVA 1ZD3A 1VIVA 1A88A 4UNSA 4YN3A 1GT6A 3WLEA 4AK9A 3FIJA 2ZU0C 1H1LB 3IIKA 5A5VA 1U1CA 5ALJA 1AN9A 1Y6FA 4NFLA 1E59A 2XYGA 3JYHA 4RLFA 1CNMA 3QWAA 5ILGA 4NFSA 1C9DB 4RTPA 2NAPA 3FCEA 4HYYA 5BV8A 1F8YA 1CUGA 2NYUA 2O1XA 3O3CA 2QLFA 2B8NA 2ZYDA 3LUHA 4E1VA 1TPZA 2HNBA 2I4OA 1BCSA 2WJPA 3K0AA 3KALA 1RM3A 4LXQA 5GONB 3CRZA 2P5TB 3HCOA 4JYAB 2GCNA 3MT9A 4YFVA 2CXXA 3A4VA 3IVGA 4E51A 2XR1A 3QSGA 2IIQA 2FPSA 4B75A 3OSUA 1G9TA 1HSZA 1I1HA 1MXHA 3DW3X 5BYAA 1B00A 3ZHCA 1T4BA 1YTLA 1PS0A 1A04A 4OGKA 4ZV7A 1Z6ZA 2OBMA 3HABA 5K3DA 2YINC 5CA1F 1RIIA 5EJIA 2HRBA 2OB2A 3PC2A 1XPRA 3GLHA 4A3SA 5J5AA 4DSOA 3VYWA