2MYTA

An arsenate reductase in the intermediate state
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
131
structure length
131
Chain Sequence
MKKVMFVCKRNSSRSQMAEGFAKTLGAGKIAVTSSGLESSRVHPTAIAMMEEVGIDISGQTSDPIENFNADDYDVVISLCGSGVNLPPEWVTQEIFEDWQLEDPDGQSLEVFRTVRGQVKERVENLIAKIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Glutaredoxin arsenate reductase
publication title A Hybrid Mechanism for the Synechocystis Arsenate Reductase Revealed by Structural Snapshots during Arsenate Reduction.
pubmed doi rcsb
source organism Synechocystis sp.
total genus 42
structure length 131
sequence length 131
ec nomenclature ec 1.20.4.1: Arsenate reductase (glutaredoxin).
pdb deposition date 2015-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2mytA00
3LTEA 5B3JA 4WXMA 3TMYA 3JVIA 4PZ0A 4XXHA 4DQDA 1TJYA 6ABPA 1E6MA 3KSMA 2M1ZA 1FFGA 3CHYA 4H3KB 3NNDA 3EQZA 2GKGA 2QU7A 2QZJA 5FBHA 3LOPA 2E4ZA 4PICA 1NXOA 1ZH2A 4GNRA 3DLHA 1SXIA 4G0MA 2WJWA 2QSJA 1BVHA 4O5AA 1ZHHA 3RVKA 1DCKA 3OO0A 4HYEA 3RVNA 3HXMA 5EWJB 2GX6A 3BBLA 4XLTA 1SRRA 2AYZA 3GT7A 3HV2A 1R8JA 4Z4EA 2CWDA 1JYEA 3EDCA 2PUEA 1YTUA 2JB9A 1D2AA 4EYOA 1BA2A 4YLEA 1W25A 4Z4GA 2L19A 4G0YA 3OMXA 1JH9A 2ZAYA 3RVRA 2V0NA 3SG0A 4XASA 1DBPA 2R47A 5DGCA 2FXIA 4IILA 3ROFA 2AYXA 3NNNA 4MGEA 5EWLA 4S04A 4NICA 3H5TA 1QNLA 5DKFA 1YK1A 5IC5A 2PUAA 3MA0A 4MR8B 4G0QA 4QICA 1A2OA 4LE2A 4B09A 3F6CA 4MR7A 5EWJA 4PE5B 1F51E 3SAJA 3CTPA 4MR9A 1DBWA 1HEYA 4N41A 3A10A 1E2BA 4KK4A 3SM9A 4O1HA 4LE1A 3N75A 1IIBA 3O75A 2MSKA 5TPWA 1GCGA 1P8AA 3B2NA 4EYGA 1A0OA 3JS5A 3QK7A 3K4HA 4G97A 2IPNA 4ZYLA 3QLVA 3H5LA 5KQGA 2IDMA 7ABPA 2E4VA 4MYRA 5KI6A 3IP5A 4MR7B 1JYFA 3UK0A 3HK2A 1NXWA 3H5VA 3M9XA 2PL1A 4MR9B 1APBA 2CD7A 1OXKB 2NT4A 3TX6A 3URMA 2FLWA 4ETIA 1CEYA 2WJAA 3KLNA 3LUAA 4JAVC 5TPZD 4RK4A 3HM9A 5TPWB 4RXMA 4Z4FA 5IUKC 4PEVA 1L5YA 4MQEB 5BQ3A 4Z4HA 3DBIA 3H1FA 2NT3A 4RV5A 2MYUA 3C6QA 3LUGA 4WT7A 5DCLA 5T3YA 5TPZA 4QPJC 4RY0A 1J56A 1SXHA 1P6QA 3D8UA 3F6PA 3G85A 1JBEA 4W5QA 1DP4A 2TMYA 1BDHA 4NCBA 3HCWA 3O74A 1U2PA 5HKOA 1EFAA 2FLKA 1DRKA 2PUBA 3KJXA 4JP1A 1D1QA 1E6KA 5JNVA 3O1HB 4ZJPA 2FTKE 4ZMSA 5CNJA 3OLZA 4YCSA 2CHFA 4E7PA 1DG9A 3CG4A 4OTZA 3DLBA 3N53A 4FE7A 1ZH4A 4LE0A 3H5WA 1JDNA 1A04A 2E4UA 2E4XA 1DC7A 4G0ZA 3CZ5A 3QLUA 3A3KA 2DRIA 1QP7A 4OBBA 1TLFA 2MYTA 1MIHA 2FMKA 3M9WA 5PNTA 1QQAA 2N9UA 3EGCA 3GV0A 3E3MA 4Z0NA 1GCAA 3HUTA 5CNMA 3RVJA 2FEKA 3TO5A 3UKJA 3RVPA 3TD9A 2WY2D 2QXYA 3SNKA 1EWTA 2CHEA 4LDZA 4NQRA 4EGSA 3N0WA 4RK7A 1YMUA 2GBPA 5JNRA 1M2EA 4ETMA 4N03A 2IPMA 4E7OA 4RK5A 4TLLB 2GWRA 1RZRA 4RK6A 2OQRA 4EYQA 2IYNA 3A0UA 2PUGA 3FDFA 1LBHA 1ZGGA 2ID7A 3OM0A 3VNAA 3QEMA 1JFTA 1CHNA 1ISRA 3LUHA 1P6UA 1NXSA 1ABFA 2LIVA 3I5AA 2VK2A 1D1PA 3D02A 1NXPA 1URPA 3RH0A 3H6HA 5FWYB 3NBMA 2J48A 2WRZA 4TMYA 1M2FA 3A0RB 4QYWA 1ISSA 4MS3B 4P98A 4XFKA 4MR8A 1Z16A 1RXEA 2B4AA 3JTEA 2LUOA 3JVDA 4MS4A 3FFTA 4NCAA 3QEMB 3LUFA 1ZGZA 4FE4A 1JX6A 1FSPA 3BILA 1YIOA 4Y9TA 2FN8A 1QQBA 1GLGA 2PLNA 4UHJA 1T34A 2YHAA 5CHYA 3RVOA 2VUHB 2PUFA 3KHTA 5HSGA 3CLKA 4KZKA 2RJNA 2F8TA 3KG2A 2HPHA 5HQJA 1TM2A 4RU1A 4RZSA 6CHYA 4LRQA 4MLDA 5JNWA 3MM4A 4F3TA 4HNRA 4MS4B 4Z4IA 4RSMA 3C3KA 3I42A 5CNKA 3LFTA 3HDVA 3NHZA 4L85A 2L18A 5TQJA 4ML3A 1KRXA 5TQ0A 5KWSA 2IOYA 4PYRA 4QYMA 1USIA 1Z26A 5HM6A 4RK1A 3FFXA 1ABEA 5JNUA 2YHBA 4MQEA 4G0OA 5IEJA 3OO1A 1ZDMA 1DCFA 2F8SA 2LPMA 3RVSA 3CG0A 4Z4CA 5KC9A 1P2FA 3HZHA 2LP4Y 2PAFA 3HUUA 3S99A 3SQNA 3F7NA 4EYKA 3CFYA 1F4VA 3BRQA 4YGXB 4RDCA 3LKVA 2MYNA 4LDAA 2MSWA 3H5OA 4MLCA 4IRXA 3C3WA 2OENG 5TQ0B 1D4ZA 3IP9A 3IPAA 4JA2A 9ABPA 5KQLA 4XARA 3KLOA 3LUKA 3LKBA 2HQRA 3BRSA 4D6YA 2L2QA 2PL9A 1SD5A 3FMVA 1BDJA 2PE5A 1CYEA 1H9CA 3KTOA 4OLAA 5DTEA 4KQCA 2A9PA 4HNQA 4JB2A 3RQIA 3SY8A 2RGYA 1DRJA 1RNLA 4W5OA 2WMYA 3IP6A 2HQBA 2WB4A 3MMNA 4HNSA 3EJWA 3LUDA 4EVQA 4F06A 1NXTA 3HS3A 3NNSA 2HJ9A 2MYPA 2PUDA 3OQNA 3JY6A 4RK0A 3JPWA 1PEYA 4RXUA 1JHZA 2H0AA 1U0SY 4YRZA 3I45A 2IKSA 1VKRA 4TN5A 4WZZA 1JDPA 1MAVA 3N6VA 4N0QA 5BR1A 3IDOA 4G0XA 1BAPA 3G1WA 5B3JC 4W5NA 3H1EA 2QR3A 3T6KA 8ABPA 2A9OA 4RY8A 1KMIY 1EAYA 3L49A 1JF8A 4M88A 4MAAA 5GQSA 4L4UA 1OXBB 3OLWA 5KQPA 3KS9A 3O2JA 1LJUA 5IEBA 4KMRA 2A9RA 4WUTA 1RZRD 2I6FA 4OLBA 4YV7A 4G0PA 3ROTA 3O1IC 3EODA 4KV7A 4YP9A 5KQMA 1ZITA 3JPYA 3H5IA 1QKKA 1VLZA 5FWYA 1NXXA 1PHRA 4OG2A 2HQOA 5IUJC 5I4CA 5IX8A 4O1IA 2B1JA 3DZDA 3GWGA 4IGAA 2FKAA 5F64A 4D74A 3M6MD 4MS3A 3R0JA 1DC8A 4YO7A 1K68A 2JCGA 4W5TA 4G86A 2R4QA 2FW0A 4IMIB 4RY9A 3EAFA 3Q7SA 3T8YA 1KRWA 1MVOA 3LUCA 3MIZA 4EVRA 2ID9A 3GL9A 2BGGA 3ILHA 4Q6BA 3OQOA 4JOQA 3O2SB 4RKRA 2JVIA 3Q9SA 4MRMA 3QEKA 2FMFA 1RPJA 2IPAB 3KKEA 2W42A 2A9QA 1PNTA 3HVRA 1QP4A 1B00A 4YR7A 1JFVA 3Q15C 5JNTA 1EWVA 2QVGA 3N8IA 4KRFA 1YS7A 2FMIA 3HSYA 3KCNA 4DADA 1Z2DA 1NY5A 1QMPA 1Z15A 5C5CA 3HO1A 4Q6WA 2PJUA 5IBQA 3VNBA 2JVKA 2FEPA 4FB4A 5DLEA 3OM1A 2QW1A 1BDIA 5ABPA 1I3CA 1USGA 4MRMB 4ZPJA 4YWHA 1UDRA 2IPLA 3QLVC 3QX8A 1ZAYA 3NHMA 1YVUA 5D2CA 3ILYA 2P4UA 2FQXA 4MS1B 2JVJA 3O2QB 4RWEA 5T7BA 1FFSA 3MF4A 2PUCA 1USKA 1ZY2A 4RS3A 1VPWA 2FEWB 1FFWA 4KVFA 4Z9BA 4D6XA 1MB0A 3K9CA 1JFSA 1M5UA 3DGEC 4KQ9A 3F73A 5E3JA 3GBPA 3QELA 2XDYA 2L17A 3DGFC 3KYIB 2FMHA 4WWHA 1XHFA 2WWVD 2O20A 4IF4A 3H6GA 3HJFA 3N0RA 1JWLA 1AB5A 1Z13A 3H75A 4JB0A 3Q7RA 2FQWA 1U8TA 1NXVA 4TLMB 1PUXA 4W5RA 2JK1A 4N47A 1LBIA 3T95A 1QPZA 1Z17A 1Z25A 3CRNA 3TB6A 3QELB 1TMYA 1PEAA 4EUKA 3MQ4A 5CNIA 1EHCA 5JNSA 2QVCA 3BREA 5BRJA 1WETA 1LK0A 1Z12A 1MB3A 2PMCA 2RDMA 4JASB 4ZMRA 2E4YA 3LUJA 5EWLB 1Y1LA 1D5WA 3P9YA 3QLUC 3OLYA 3KYJB 3HDGA 2VUIB 2PKXA 2RJOA 3RVQA 1GUDA 1QO0D 1K66A 1GUBA 4KK3A 5TQ2A 4EVSA 1C4WA 4WXEA 1XWWA 1LJLA 4DN6A 3O21A 4F12A 3GYBA 1TVMA 2E4WA 1EWKA 2FSPA 3GA5A 4LZLA 2M98A 3GBVA 4RKQA 3IPCA 2R25B 1U2QA 2MSLA 1SXGA 1AB6A 3UUGA 3N0XA 1ZN2A 4EY3A 1C0EA 1QO0A 3CKMA 3IP7A 3C97A 5EWMA 1E6LA 1DZ3A 1KGSA 3L6UA 4LX8A 4CBVA 4KPYA 3Q41A 1XHEA 4KREA 1DJMA 4KFCA 1FQWA 4ETNA 1U04A 3QLTA 4NV3A 5TQ2B 4KNYA 1L5ZA 1S8NA 1RXIA 2JBAA 4F8JA 1VRVA 4YS6A 3OMWA 2R48A 5ED4A 4OATA 3RVMA 2QV0A 5FBKA 4F11A 5KC8A 2KYRA 3OLXA 1JLKA 4MQFA 3E61A 5TE9A 3OLVA 5JS1A 2H3HA 3O1JC 3HEBA 4RXTA 4Z9AA 5EWMB 5IULC 5IUNC 3CZCA 3GRCA 1Z2EA 4H3HB 3CS3A 2X7XA 5FWXA 4P1ZA 3FFWA 4N0PA 1YS6A 4UHKA 3EQ2A 2GI4A 1DBQA 3LMKA 4Q7EA 2LBPA 4IMJB 4XAQA 4Z99A 3RVLA 5C5EA 2JBAB 2JRLA 3EULA 2HSGA 1Z18A 3CNBA 3QX9A 2VYCA 1M5TA 3MYYA 3FGZA 1ZVVA 4GPAA 2P9HA 4MPTA 4MQFB 5JS2A 3OQMA 4N76A 5GOTA 1QP0A 3H1GA 4H60A 1JL3A 1NATA 1NTRA 5BRAA 4S05A 1PNRA 5FWXB 1ZESA 2Q5CA 2ZWMA 3W9SA 3T38A 2FVYA 1DCMA 2NZVG 1W9HA 2NUBA 3C3MA 2FN9A 3CU5A 3I09A 4MS1A 1YK0A 2NZUG 2FQYA 1YMVA 3Q7TA
chains in the Genus database with same CATH superfamily
1KQFA 1J2TA 1QC5B 4MYHA 1A7UA 4LQLA 5AKXA 3EEFA 5JR3A 1P75A 3I3OA 4TYQA 4I4TF 5JCOA 1A7KA 2UDPA 4U9IS 1H9AA 3CHYA 2V4UA 3ABQB 4JUAA 5CLLA 4P8RA 3RUIA 4D3ZA 1IHPA 3OEYA 2DKNA 3LX8A 3LX4A 4A0SA 2ENWA 3M81A 521PA 1PS8A 2MIIA 2RGNC 1DOAA 4D82A 2VXBA 2GM4A 1W85A 2QQ5A 3ZDBA 1VE9A 3D8BA 1XFDA 4TMKA 4UU0A 4ZVQA 3NFYA 1DQNA 1WSBA 1IOZA 4Z53A 3LUPA 1CNMA 2IBMA 3BQMB 3GLIE 1X38A 2AYZA 1R8JA 4P32A 4LXGA 5DNAA 3VVCA 2H8KA 3QENA 4WADA 5EOVA 2NMVA 1RWKA 2HLHA 3ACDA 4ATNA 2WEKA 1K4KA 4W7HA 5HK9A 4BY9E 2Z8YM 3KQWA 2BFOA 2V0NA 5EP3A 1JKXA 4EATA 4WFKA 1DXYA 1GSOA 2XZPA 3NXSA 3TUZC 2NX2A 1LX6A 2X7HA 1WW8A 5LQDA 4ZYXA 1GL3A 1JPUA 4H7DA 4RJIA 5IF9A 3PR3A 3TLEA 3VYVA 3QPDA 2GHQA 4M0PA 3DR3A 1AC5A 2JAUA 4ESOA 3VU8A 2VZ9A 1SM4A 3GN2A 3RYFA 1KK0A 1M1YA 1V2HE 2GCNA 4IXTA 4PE5B 5EA2A 3KT3A 1EK2A 5EHQA 3B6KA 5DNVA 2I5PO 4IZHA 4AY2A 4DJAA 1XRNA 3DHVA 3TW8B 5JS8A 3CLUC 3JD0A 5CGZA 1GT6A 2I3GA 3UMSA 5ERYA 1E2BA 2HEGA 1W87A 1XWFA 3O94A 4YALA 5AM4A 3ESQA 1DFGA 1JIIA 2GRAA 2PVCA 5TLSA 2QI9F 3LUBA 1TIPA 4U02A 4Q4AB 4KQHA 4ZYLA 1HRDA 2IPNA 3WKEA 2BFDA 1D2RA 4PHCA 4X94A 5AJXA 2IOFA 3R0IA 4J4HA 3QF4A 2O7VA 3DD5A 5KREA 2JK0A 1QH1A 2Y93A 3PCXA 4V2UA 3H5VA 3JQ7B 4HO1X 3AHIA 1GG5A 4ILEA 5A03A 1CBUA 1BHQ1 1ETUA 3K0BA 1CEYA 4N8SA 2IHBA 2ONZA 1HDIA 4G9EA 1A1VA 1NVBA 4YJFA 2W2VA 5TPWB 1RAFA 4RXMA 1EU1A 5I7HA 2GA9A 2GZSA 1U6KA 2C7BA 2D7CA 2B30A 2C88A 4IVPA 3PE4A 3VDRA 2RGAA 2G77B 2VQ6A 3NYRA 2ZJ5A 3OZCA 3ZS9A 2BDEA 3E5MA 4YX9A 1JIVA 2IZ0A 1J7JA 2BSQA 4B6RA 3WMEA 2GCIA 4BE7B 5U4QA 2WFLA 2Q9CA 4HQFA 5IXYA 1DB3A 3O74A 3AUUA 4WDQA 5H80A 3ZHYA 1D1QA 1DBVO 2V97A 2EL7A 4JYPA 2C9DA 4PTZA 2DSTA 3EVEA 2OE2A 2ZR9A 1SCDA 3N74A 5CG1A 4A0HA 1C7JA 1CUIA 1EHYA 4IV8A 3V2HA 3VX4A 1PWYE 1RXUA 4OTZA 4GXRA 3G1UA 3OAAD 3SYKA 3T0GA 4WJLA 2IS4A 1KKUA 4PFKA 5FWAA 1Y4UA 4NLLA 2JGMA 3BMOB 2NN3C 3H5WA 1UKCA 1WXWA 4TGLA 4YJDA 3HYCA 1B7GO 2CBZA 4UW9A 1DC7A 1I2MA 3L4SO 3QOXA 4I6GA 2XCIA 2FE4A 4X60A 1NIJA 1XL0A 2IYSA 2O2CA 3K20A 1QANA 5GZ6A 3E9MA 1VB5A 3TO5A 2ZJFA 2ZWPA 4HNHA 3TFQA 1A82A 4BNFA 4AAYA 1B73A 2Y0DA 2WVHA 4UVHA 3SFTA 1VMDA 1OB5A 2GK6A 2VZEA 2XNHA 3R9WA 1ZYUA 3ENQA 1NOIA 2XRYA 1K8XB 2BF4A 4EBBA 1QJ4A 2O0HA 3UV6A 4DF3A 2PLAA 4IINA 5DNYB 4I19A 4ZOAA 2ZJBA 1EB9A 2Y0EA 2ESRA 3DW1X 5I5EA 4ZAFA 1QG2A 1U2RA 3AP1A 1OREA 2W0MA 1QDEA 3PHHA 3R4VA 3E9EA 1GZ7A 3U6BA 2WILA 4ISBA 4L4YA 4NP6A 1GFIA 3W4IA 5LZ5A 2H4ZA 4F5ZA 1DRUA 1K89A 1Y37A 4BX8A 2ONCA 4A6DA 2XRZA 1U7XA 2LIVA 4HMPA 3W90A 4UPDA 5HCIA 1G5FA 2V03A 3MD0A 4M46A 1ADJA 1AO0A 3OWOA 3JQAA 3G02A 4R2XA 4F2GA 1K5PA 4RA9B 3SE0A 4QIHA 4IXNA 2PT6A 4F93B 2I9PA 4QREA 3R6LA 2ATEA 2P6UA 4DM7A 3PYLA 2O1EA 4UM9B 1EVJA 3WI7A 3UF0A 3IAS6 3HJRA 3ZW7A 3SCZA 1YE3A 4FKBA 3ONFA 4G41A 3QVXA 3V8BA 4B80A 3BZBA 4IDNA 3NETA 3QSYA 5ER9A 1IFXA 4GX0A 2QMEA 2PUVA 4BLTA 4EO7A 5HNKA 1ZSVA 1N5IA 4UU1A 3LW8A 1M6YA 2FJ0A 4FMCB 5B64A 2GUWA 4E08A 2F8TA 4JXZA 4HH1A 2HLNA 1K92A 3ZDYB 4PAQA 3WXBA 2C4NA 5MN5A 3FNEA 2VP5A 2IF2A 1YGYA 3DEIA 2D1SA 1YRYE 4P7JA 4JENA 1YZTA 1OFHA 3FPSA 4XIFA 1A9YA 2GF0A 2ID4A 1JPVA 2HFKA 4IQFA 2YBDA 3AC0A 5CPBA 3LVRE 4KO3S 5JVDA 1P1BA 1V1RB 4E70A 3U19A 1OYWA 4BEBA 4L85A 1SJ9A 3QVUA 5TQJA 2EJBA 3CCFA 3A4MA 4O6VA 4BGVA 1XEXB 1BMQA 1G5QA 5CVTA 4PNEA 3I01M 2X1LA 2JFHA 2YVAA 4DA8A 3R5SA 2JAOA 4IVRA 3AHGA 1CJMA 1ABEA 2BJWA 3EDRA 3EXG2 4C9BA 4AKHA 3AU9A 4M60A 4AU1A 4OBWA 1LD3A 3CG0A 1TO1E 1BCSA 3FZQA 1B0PA 1AHNA 3NGXA 5B1YA 3RT1A 1B6GA 1P2FA 1XROA 5T8KA 4BAGA 5CDYA 1T0JB 1WVMA 1Z82A 5D1NA 4EYKA 3WVNA 4XPIA 1TK9A 3QFHA 5G53C 4QBHA 3C8HA 3BB4A 2XCOA 3L7BA 4G0WA 3PJFA 2OGSA 3M6FA 4NDNE 4DXDA 1Z4NA 3AY6A 2OENG 4B4UA 1XTKA 4TWAA 1P9NA 1I6MA 9ABPA 4IFTA 3GRKA 5T67A 1KXJA 2JJ2A 2UZIR 5SZKB 3KLBA 1GTG1 3L84A 4HAVA 3QKRA 3VYRB 3PLAE 3FMPB 5TJ9A 1X2EA 1IE3A 1S8FA 2RFLA 2RHJA 1Y7TA 4XX0B 2BRUC 5AJUA 1L6RA 2KBFA 2RGYA 2F17A 2WMYA 3E3LA 2YR0A 2IZ7A 3W06A 2IQ5A 3CEMA 1ZRHA 4XI9A 2FPXA 2MSCB 2X5XA 1IWPB 3JZMA 4BMNA 2ZYIA 5GIOE 3HO6A 4HFRA 4Y1FA 1U11A 1WHTA 3X2FA 1N5KA 4LJYA 1QTRA 5ES3A 5C1IA 3GRFA 1O5TA 1R8XA 2N47A 1IG3A 3HJHA 1QB7A 3JSAA 5CYGA 5BUQA 3I45A 4Q4CA 2FNAA 1ACJA 3H9UA 3IDOA 3M70A 4QWMA 2V54A 1R64A 2HIAA 1UJ5A 3FGOA 4H7HA 4MWSA 3FUCA 4DKXA 3H84A 2B2CA 2VDPB 1RYZA 2P1ZA 3ZUPA 4CG3A 9MHTA 2GDZA 2ZRDA 4O63O 2H54A 3L8ZA 1IHUA 1KNQA 1U1DA 2WW8A 3O93A 4V0LA 3UJ8A 1VI5A 4ITVA 1JQ3A 2R8RA 5DN6A 3AVOA 4WUTA 1X1BA 4L5AA 2FZVA 2CE7A 1UXOA 3RIYA 1YJAA 5FXMA 4YMTA 5COBA 3F7MA 3V8PA 2F00A 3FDZA 2WT4A 3F8WA 3O26A 1FUYB 1TCBA 1VLZA 3VR4D 1GDTA 1NA5A 5BV1A 5K0JA 2J3LA 3GK3A 2OZEA 1V1MA 4BU1A 1C1DB 4EJSA 1P0FA 5CA0B 3S44A 5CDFE 1JDJA 4G86A 2UV8A 2AN3A 4EL5A 3OF2A 4RY9A 3Q7QA 1EUCB 4JH0A 3U7QA 2GXUA 1VBMA 3I32A 2X42A 4A8JA 1N1DA 3R7SA 1UKVY 4WXHA 1KJYA 4LYHA 1WBBA 1BO6A 1NUAA 4JMLA 4WJZA 3FMIA 4N49A 3CX8A 2ZZMA 4UQPA 4UXHA 2VJLA 1PNTA 2O2HA 5DXAA 3OPMA 2CDBA 2PY6A 3GBSA 5J59A 3RBVA 3UWDA 3WGOA 2H4WA 4MVWA 3KKZA 2O1WA 3A4TA 3PK0A 5GJCA 1RQLA 4UTNA 3LYAA 5ALMA 3N2GA 3TLGA 5DE3A 2XYHA 2ZBGA 4CPDA 1PWEA 3FFAA 4KYUA 2LWIA 3T3NA 1QR6A 1KJWA 5C5CA 1JHPA 3I4LA 3IV6A 4IIJA 4YP6A 4X85A 2FEPA 1N92A 2IIQA 4FB4A 2QAJA 1FTSA 1P4JA 3JYPA 1C1XA 1PEDA 3DC7A 4K2HA 1ZM9A 2YXBA 4BEVA 3P2OA 2B9VA 3ZHSA 4ENPA 2XNSA 1M0EA 5KTNA 1XFAA 1GAWA 1OA0A 3NHMA 4OJTA 2FQXA 1CEXA 3MQFA 4HCJA 2FG6C 2VT3A 4J16A 1GPYA 1XDSA 2CJYA 1SIUA 3MF4A 3C7AA 3O4GA 2VHUA 3QU7A 2OLKA 1CVLA 2G17A 4X91A 5J40A 4OYYA 1M0SA 1CUEA 4QX6A 3JQ8A 1CUDA 4D79A 5CITA 1JFSA 1DC5A 3IOEA 4UDYX 2XDYA 3IDZA 2UVPB 3DGFC 2NACA 1J42A 4KSBA 1WXGA 3N0TA 4ZXPA 1VRCA 1L4KA 3EBOA 3KVOA 5EFZA 3BDAA 4Y2HA 4GF5A 1E2IA 3DAPA 3FUWA 4QO7A 1G18A 2OXRA 3LBNA 4E2XA 1EVLA 1MMFB 1U9CA 2WICA 3BD6A 4U5QA 1R2QA 2GM3A 2XX3A 3R5KA 5DI3B 3RFXA 4OJYA 4N47A 1POWA 1QPZA 5DYYA 1X7HA 4CF7A 3PFGA 5MFZA 1N2EA 3PQCA 1D2CA 2QGFA 4IY1A 2P41A 1DEOA 4TLCA 5DH9A 1BYUA 2GCOB 4XD2A 1UQUA 1Y7HA 5IHXA 1KI2A 4CQMA 4QBGB 3ZE6A 1ISGA 4NWIA 2W8BB 3HBJA 3HZRA 1PV4A 3O8QB 1R0WA 1J00A 3CTMA 3G82C 5AHOA 3AY0A 1PR0A 3NHFA 4GSKA 3EZFA 1GZ4A 3VH4A 1VYTA 1I13A 1Q20A 4J6FA 4NOMA 3RHZA 5BYKA 2HTFA 3QLUC 5KPDA 3C5CA 1IPEA 3LXMA 2AJ8A 1VE6A 2A1TR 1D03A 3HJBA 4GE0A 5A0FA 2D5IA 2VUIB 1MEJA 2BGNA 3TGLA 1J2UA 4HDSB 4HLUC 5JAMA 1EFTA 4WXEA 2BBTA 2QPLA 5J3JA 2W4IA 3B8EA 4IGKA 4QD3A 3SYTA 3TL3A 1LGYA 1ZD9A 3O92A 1X9HA 4JUDX 1O9GA 1YE8A 3IUJA 4M1WA 2PSEA 4RDHA 5ALTA 5BNIA 1YE5A 3OHMA 1KIFA 4O4HB 5EJ8A 1FJGB 3LW7A 3QA9A 3WGZA 2Q1YA 4ZI5A 1KYZA 1K63A 3Q8MA 2WFZA 2VQ3A 2VWQA 4FYWA 3RJ9A 4JJ4A 3EXEB 1DUSA 1R5JA 3L6UA 4ZARA 1P5HA 2REQB 3B13B 1EEHA 1LRLA 4ZYZA 4DEXA 3RUEA 4HNAA 4M38A 1A9TA 5C8XA 2YWRA 3NT5A 3DDWA 2R79A 3U3JA 3BIJA 4DA4A 4KNYA 2ACEA 5C4IA 1ZNQO 4KX5A 1N36B 2IUYA 3B12A 2WWTA 4IOMA 3SEAA 1G8PA 2K87A 4X66B 1X7ZB 4IXDA 3ICOA 4CIVA 1ZU4A 1XI2A 5K01A 1WXDA 2VR1A 1IXKA 2I34A 2ODPA 3AEUA 1M67A 3OTWA 3QVGA 4KG7A 1BS1A 1DJNA 4Q4HB 5TE9A 4Z9AA 4CHTA 4RIFA 4U9HS 1NASA 1G8KA 2P6RA 4P1ZA 2MWMA 4LJLA 2A7QA 1JLMA 1YVEI 2DR0A 2OV1A 2AJTA 4BO0A 4F3YA 2RGXA 1WKCA 1C9DB 3DLCA 1T8RA 3L5OA 3A2KA 4J0DA 2QZPA 1P1CA 1GAJA 4YCBA 3QPUA 4KQ6A 4M0FA 1TCVA 1TVEA 4G09A 4OGKA 4Y1GA 4R8MA 5H83A 1K9VF 1SQSA 3QFRA 5I8PA 3ENNA 2P9HA 4MPTA 2Y1FA 5G3ZA 4PM4A 3IUNA 1RKUA 5GOTA 4U7HA 3NJ8A 1VYVA 3PGXA 1IBSA 4CCSA 4HX9A 4KAFA 5A71A 3D4PA 3RVDA 2O57A 5CVCA 4BKQA 4EPRA 5B58C 1P9WA 1PG0A 2HLDA 3OG9A 1EFVA 1YCDA 2X76A 4FZVA 1XYYA 4CEIB 2ZANA 1OWPA 3LI2A 4AY4A 3DKVA 4O25A 2FN9A 3I09A 1VDMA 3BGWA 1YK0A 2OCIA 4RQAA 3B70A 2YIDA 2ZULA 5FLKA 1IN7A 1P1KA 1TYZA 5JSHA 2VNHA 1EBBA 2B83A 3F1LA 2JKZA 3NBXX 3PF8A 3HMQA 4UULA 2CY0A 3GRPA 4B84A 4TS3A 2K6GA 5AVRA 4TROA 5K05A 2C9CA 3WRYA 1KWKA 1TT5A 2ONJA 4RFVA 4HQKA 1NLMA 1U81A 3BYZA 4WNIA 3WMWA 5AVVA 3VOSA 2W22A 4KDCA 5DSZA 4PIMA 3UJPA 4REQB 4EGCB 1Z0ZA 4JLAA 3K8YA 3WQQA 3MWFA 5AHRA 3BHMA 1ZJYA 2R8YA 3L7DA 4B3DA 1OXSC 1SY7A 3HJCA 5BMOA 3UPTA 4JODA 4N7RA 3MJ4A 3KSZO 1RZ3A 4QE3A 4AUMA 3K09C 3BIOA 4LXYA 2NZ8A 5BSHA 4ZVKA 4ZVNA 4AL4A 1G20B 1U65A 2ISSD 3OTGA 3QY9A 1VE1A 4HRVA 4Y98A 3WKBA 2P69A 2LNDA 3AL3A 4WXRA 1H8EA 1IULA 5IWAB 4B3IA 2FRVA 3BMXA 3BGOS 2Z6UA 1W25A 2QR5A 1RI2A 3PQFA 4DZTA 1SXJD 2A84A 3TS1A 3OZGA 4X6XA 3H9BA 3KR0A 1CE8B 3Q9NA 3KK0A 2R47A 3B2EA 3CZPA 4XVHA 4MKXA 3ICQB 4Y9RA 3N3BC 3FNBA 2WPDD 1Z9BA 2FFAA 1EG2A 2I62A 4EHIA 3SHFA 3H5TA 5KJ1A 4PANA 3U4AA 4D4JA 2NUPB 1NVFA 2C3UA 4M9ZA 4YFVA 5E1DA 4C5CA 4O1MA 3TIFA 4KXXA 3AUTA 4GDFA 4IV0A 2R0QC 2PZJA 4B83A 3OFVA 4OGGA 2PWPA 2UXDB 1GQ2A 1U7TA 2HL6A 3KHUA 4KQEA 3A1FA 2ETVA 2I65A 5KYKA 2GRJA 4L4SA 4DV4B 5KX5B 1FQKA 3IV9A 3SM9A 4OXKA 1YT5A 1JKIA 3KOUA 2IBTA 4Q9AA 1XMOB 4N18A 1UIMA 4YIKA 4DNPA 3GWZA 4PG6A 1OC4A 3F3YA 3O7WA 3IT2A 1A0OA 1NW9B 1ZICA 1FYDA 2ZTMA 3U44B 3M82A 1GNSA 5EHIA 1WLSA 5IYZA 2IH5A 1G9XA 1YB4A 3AXSA 4R9SA 2DFKB 2ZBVA 3O3OB 1RHQA 2JAPA 2QZ4A 3A9RA 3MN1A 1P1RA 5B7PA 4ZA2A 4NRDA 1C0PA 1RHJA 4X41A 4G2TA 2JHFA 1CDEA 1I2AA 2RG1A 3PXBA 4B5LA 3I4CA 2FLWA 4YDHB 1GPDG 3NKLA 3PDIB 3AJAA 4V2IA 2OKCA 2NO0A 2OORA 3NAZA 3O31A 3RGGA 4H9GA 4BJ6A 4C76A 3FRIA 3JAKB 5CA1F 4ABTA 4NATA 1B15A 1Y3IA 2R7MA 4MVJI 1L5YA 5HIMA 1C1HA 2FSGA 1XU9A 5G0VA 1P2SA 3G0GA 1PTJC 4W6ZA 1ZUNB 1RAGA 2Z8XA 3H1FA 1X7DA 2C4HA 2YRXA 3QMPA 5B2EA 2FW7A 1VPTA 1ZO8A 1OAOA 1EK1A 2P9GA 1Y1PA 3EVBA 3ZI7A 1BDHA 4CV3A 3ZVMA 1AE1A 5F23A 3L1VA 2QTBA 2PUBA 2MMCA 3R24A 1HM5A 1HRKA 1R6AA 2E7ZA 3VPFA 2Q6IA 2AW3A 1Y4SA 2WHPB 5B6PA 1X74A 1EVIA 1KZ1A 2QX8A 2WKQA 5JAPA 1U0HC 3K1ZA 4BNXA 3BRWD 4FE7A 5K5EA 1ZSNA 2NU8A 4UFPA 3CR3C 2AF3C 4YRSA 3ESZA 1H1LB 1X39A 3QX7A 5KAPA 1YAHA 5HF6A 4RD3A 3AETA 5JJ5A 5DBIA 2JIDA 2HI0A 1REQB 3KB1A 1QHFA 2O1XA 4FFDA 4NG5A 5CT8A 2JLCA 4LOAA 5LQSA 3TBKA 3C48A 4PGMA 1K7SN 1KO4A 3SZUA 4KZPA 1QKJA 2E55A 1WUJS 2WB2A 3L1JA 3QBEA 2CLIB 4Q48A 2N9UA 1W47A 1PBNA 1LPPA 1P4SA 4KMSA 3D0QA 1QSGA 4LC1A 1PUIA 1KH2A 5BVGB 1SR8A 4A92A 2HWKA 1R8SA 1EUQA 4U2EA 4HDMB 4ENQA 1NURA 1UWCA 3N0WA 4ERNA 4KU4A 1G20E 3JARA 3C5EA 1G5IA 2BUCA 1ICEA 2HUPA 4IEEA 4R1SA 4X64B 1Z6TA 1JA9A 4ETMA 4NH4A 2RKWA 4RK5A 3NTXA 4FR2A 2CZGA 1HORA 2J5KA 3K94A 5IT5A 2DEUA 2HF8A 3HUFA 1AS2A 3WLQA 5LQCA 1UFQA 4F3NA 3FYTA 3RRFA 2UYCA 1UAAA 4MV1A 3BXOA 1O94A 3OZVA 5CVVA 2ID7A 1JFTA 2QYHA 3KJQA 1FBTA 3R3UA 1SK9A 3PXGA 4MQLA 3IKMB 3RC7A 4C4YA 3C8ZA 2DHDA 2Y05A 3GJ5A 1G8JA 3DTYA 3FMOB 4RIHA 4OP3A 3SWWA 4CQNA 2CHVA 1XQ1A 1GXSB 1N6HA 4L16A 2C58A 1TL7C 3PPWA 3Q3HA 4UAUA 1UEJA 2JJ1A 3P27A 3VH1A 2TRSB 4DHEA 1S7CA 5J2UF 1U0BB 5HS6A 4ETWA 4DXHA 2CMHA 2M1XA 1SUPA 1E2FA 4C0QC 3NPAA 1CRWG 2EGHA 2Q1WA 1IB0A 1NG1A 2Q4DA 1RXEA 2RARA 3PNPA 5LQJA 5A6SB 1KP3A 5J4LA 3TB4A 2NSYA 3LZ6A 1PR2A 4CMIB 4D9EA 4NCAA 1MDFA 5BSTA 1E2GA 1A8UA 3GU3A 5AJTA 4INZA 1VLQA 5NULA 3FSEA 4AMUA 4LDNA 5KCZA 1DTWA 1T2VA 4MUBA 1G42A 2O7NA 4JJ7A 5DN9A 1V8OA 1ZISA 2IVZA 3UGKA 2WQ6A 4V3CA 4N3NA 2P7IA 2FCAA 4E88A 1Y1SA 1YQUA 2GZDA 4DNOA 1YDGA 1GCOA 5HSGA 5MHTA 3SF0A 5K3CA 3R3WA 1YZKA 4CF4A 4ZOQI 1EM8B 3LGSA 3TXYA 3RJMA 1GJRA 1PW7A 4GFDA 4Y7DA 2W6MA 3ITKA 1CG6A 1N2CA 3EN0A 3AGPA 4ALMA 4DPMA 2HOQA 3DT8A 4TT3D 2NU6A 1T9KA 3QKSB 4H6VA 3RNLA 3DE5X 4R1TA 3DDZX 2Z5FA 4AICA 1OI7A 3AVYA 4C14A 3GFSA 1QPGA 4HX2A 5H70A 3X1ZA 3LLVA 3WIOA 4DY6A 3L8CA 2WNHA 1SCUB 3R7WA 2I8LA 1DUIA 2D2FA 2NSLA 2CFIA 2GAFA 1Q57A 4H3SA 3WSVA 5BNWA 1YFZA 1H2FA 2AUTA 5K0ZA 1L5FA 4WBNA 3SVLA 3DE7X 1JAXA 1M10A 1UAGA 1JAIA 2BDTA 2DPMA 3MAGA 4MV9A 4YEDA 3IESA 2Z4SA 3CYFA 1NW4A 3C3YA 3O0TA 4RGVA 1KAEA 2F3UA 2ECPA 4IUYA 5HK8A 2HRZA 4A2PA 2OLJA 4MDYA 3CVJA 2I22A 1X1TA 4XQEA 1KFEB 5FUQA 4Q5IA 3IEXA 2C9OA 3HCAA 2OSVA 3PQ8A 2DULA 5HDBB 4F6CA 1XDDA 1ZU5A 4NU0A 4IH4A 2ATXA 3OZIA 2IIBA 4RJLA 3T15A 1ZK1A 3TR0A 2QUJA 3IALA 4UAGA 4XARA 3BIFA 4RETA 4D4IA 1L7QA 3QJ5A 4JX8A 5CW2A 1SD5A 1Q1BA 3N8KA 4DEVA 2HRCA 1QIIA 4HVCA 1M0WA 3TG2A 1KVTA 4FMDB 5ESWA 4UZEA 1VL0A 5F51A 5L45A 5JIBA 4EG7A 1RNLA 3WTCA 4B6GA 1H22A 3H16A 4HNSA 5CLQA 1NWCA 1MNQA 4GMXA 2NU9A 2R2AA 2RHHA 1GPUA 1SKQA 4N5DA 2QM0A 3T9DA 2J3HA 4FN5A 3AJDA 2CHUA 5CFPA 2AE1A 2F1HA 2ZYDA 4RK0A 4OFWA 1KI1A 4FEYA 2XGGA 3RSGA 2JD1A 1G5HA 3ZZNA 1SCJA 3FMGA 1SELA 4TKUA 5ESRA 4MAMA 1C80A 4WZZA 4ND6A 1NQUA 1TLLA 5DFAA 5EEHA 1VMKA 4S35A 4Y6GB 3RW9A 1E66A 1AIPA 2BHNA 5TY0A 1KEVA 1RHRA 1V8PA 1VJGA 3NAGA 2ZUTA 4OHPA 1H1TA 2C42A 2QUHA 4NBSA 3O9VA 5JCOC 1T36B 2AV6A 3R5JA 1MAUA 3OEWA 3S3TA 3Q72A 2QROA 5HZKA 2KM1A 1YI1A 3ZWPA 4L57A 1XA4A 2CDAA 1XQWA 4NJMB 1SC1A 3LY5A 2POQX 3WLNA 4ALNA 1XXHB 3FOEC 2C1EA 2Q2VA 4HJRA 2CUNA 4EW6A 1T1EA 1RKQA 1U99A 2VLIA 4MKZA 4X3OA 3V1TC 1FE8A 2QRHA 3AR7A 3EODA 4OKSA 5LJLA 2GD0A 1PJ2A 4JIGA 3TRHA 1MRZA 2VP9A 3A6EA 1NLYA 4LYFA 4D0SA 5ICMA 1DFHA 1LDEA 1RYFA 4QNMA 2B1JA 1XJ5A 3R3YA 2BZ1A 2QUIA 5I4CA 3UGJA 5F64A 2DPGA 3N9IA 1EEXB 4BQIA 5AKIA 3I8SA 1CY4A 2JCGA 2W6QA 3K73O 4IVNA 2QTMA 5KWVA 2P30A 1YWGO 1Q83A 2GEUA 2RONA 5H4GA 5JEEA 4ZP1A 4EVRA 4R2WA 2FPLA 2J9YB 3VDXA 2PBZA 4GWLA 5CB4A 1Y8QA 2GQ0A 2PH3A 3LNTA 4IHQA 4LJSA 2FP4B 1GPKA 5CIWA 5HF9A 3QI2A 1MLDA 3WNBA 4Z1MA 3UT6A 2A9QA 3VPSA 4V1CA 3V4RA 1XLWA 4UHFA 1YFKA 1HC7A 3JWEA 1UFVA 1T2EA 1Z33A 3ITNA 1BD4A 1E89A 2PYZA 2ZJ3A 3EUAA 2BELA 4PHGA 2HJHA 4PC6A 1P2TA 4UMVA 2AGVA 1JB1A 2ORYA 3RV4A 4DADA 3G2HA 1JUDA 1Q7RA 2FZ4A 3P9XA 1OFUA 5A5EA 1EHIA 1SKYB 4KKXB 1OMOA 3VJMA 3WWPA 3A1TA 4Q3BA 1QTNA 4D4GA 1ZRNA 3EVGA 2V7GA 4Q7JB 3BC1A 1AUXA 3FTDA 3FJOA 3FGNA 4KQWA 3DOIA 4QEKA 2H08A 3MRVA 1B26A 2DG2A 3SFZA 2WABA 2VN8A 2OAQ1 1J2EA 5C8YA 4MCAA 1Z6XA 4CR8A 1Q7TA 4A0GA 2JIQA 2PK3A 3O2QB 1VJ0A 1F9AA 2R6ZA 2CXXA 5CBPA 4TXJA 2FWJA 5KTOA 5A0TA 2BI7A 4R2JA 3D6TB 2WT9A 4LXTA 5LIRA 3CVVA 3AP3A 1YB6A 3DGEC 1V41E 2NTVA 1B4DA 1ONOA 1EFPA 1GQOA 1T25A 2G4CA 2HA0A 2I2XB 2JLQA 2ZR7A 1T1JA 3IRUA 4TV8A 4H0NA 5B1HA 2WZQA 2GAJA 3D4NA 3DUFB 4QJ3A 3GLIA 2GPWA 2C7RA 2BGWA 1M6VB 5K3FA 1RMQA 1Z2OX 2PKQO 1L1RA 2X3YA 2XGOA 3H6GA 4LSGA 4QUBA 5CB6A 3TGPA 1CEEA 1CW2B 4L8FA 1I3OA 1GNTA 1QCCA 2G25A 3HXTA 3Q7RA 4ND2A 1E2EA 1U8TA 4Q3NA 5E9QA 1GLVA 4W5RA 1DX4A 1OFGA 5G2OA 1Z17A 3VPGA 5ALVA 4ZQGA 2QJWA 2O3JA 2YMQA 3GVPA 1J39A 3R0XA 1X6VA 4BQEA 3WAGA 1CUSA 1MB9A 1DPGA 3QYJA 3HXOA 3K1AB 1CRZA 4KO8A 1T5OA 4QJ4A 1QF9A 3QPWA 4IS2A 4AMZA 4E1AA 1GQYA 4L5YA 4KWTA 1PJLA 4TN1A 1G7TA 1MJHA 2IHYA 1L2TA 3WDLA 4BMXA 2WC1A 2HHJA 2QVCA 2JLZA 5K0CA 1E2MA 1QV7A 2YRFA 3MGCA 3MRTA 5JECA 3VKHA 1G4UR 3TQIA 1Y1LA 1D5WA 3Q40A 1O0BA 1BWRA 4QULA 2C2KA 1E3JA 1CDDA 2AI2A 3CSDA 1F8GA 3KYDB 1ODSA 3DV2A 1ISJA 3L9XA 4QYIB 2BVNA 3RDPA 3H11A 3RVQA 3ZYCA 4CM9D 5A5VA 3HR8A 1XXHE 3LBHA 1O95A 4M4SA 2GPAA 4M9QA 2I2WA 3ZWNA 2Z8ZA 4AYTA 5C1BA 2GSWA 3B9RA 1TVMA 3H6KA 1IG0A 2GFQA 4JFAA 4MWZA 4P4SB 3QU9A 3TVDA 3IPCA 1RQRA 1HDYA 4NBVA 3KDSE 1ZN2A 2PU5A 2EBFX 3OA2A 1QO0A 1Y89A 4G9BA 5ULLA 4A6PA 5JW6A 1WZ2A 2BUBA 3AHDA 1YMQA 5DGXA 5I4IA 4MYTA 1GPWB 1DJMA 1SHTX 1DWOA 1VYUA 2XE8A 4IFEA 5DTJA 2QXUA 3EIWA 4NV3A 1AHHA 2R68A 2W4MA 4X7RA 5DTIA 5IDXA 3ZVKA 4D2IA 2O3TA 2BR4A 5AIBA 1NX9A 3NBQA 4I55F 1O4WA 3E7PA 4AJ1A 4KLRA 2W43A 1NVUQ 1RLIA 1XKLA 4D97A 1NL3A 4YNBA 3SYRA 3KEOA 5HF8A 2QRLA 2R66A 4P9NA 5CJPA 1A5BB 4TSFD 4IJMA 3ZZUA 2VJYA 4GUDA 3OP4A 3GMSA 3BWEA 3U81A 3U60B 4K05A 1ZCBA 3HR4A 3KJHA 4FEGA 1G66A 4OQQA 1WDKA 3DG9A 1KMMA 2VPXA 5HOEA 3HJFA 4U4AA 4X3PA 1OZ0A 4O4JF 1N2ZA 2FB9A 3I72A 1IH8A 4QOSA 2OB2A 3DEJA 2BGLA 2WAYA 4BNKA 4EITA 1Z18A 4LTNA 1QC5A 3JQRA 4M76B 4XE5A 1II9A 1ZD8A 4I2VA 3W5HA 3MCZA 1GO2A 2R6GA 5FIUA 4Q9JA 4PG8A 3CIOA 2GESA 2WSLA 1E3WA 1I5RA 3HYLA 4P58A 2PRYA 4L8VA 5KYVA 1GFZA 1XU7A 2UYYA 2Q3LA 3E7XA 3N7AA 3MGAA 1ZESA 5DTMA 2G9ZA 1QRRA 3AR6A 4LOJA 3S5UA 1RJDA 3LCUA 4MV3A 5AJWA 1NPYA 1GIAA 2VNSA 1ENOA 1NF9A 3HUDA 3IFSA 3KVVA 3ZY4A 3SIWA 4BMPB 4C04A 4XD7A 2EFJA 3LTEA 4HAXA 5B3JA 3VH3A 3C3BA 3JVIA 4AF6A 1XQ6A 5EJGA 4XVUA 3NHBA 2BAGA 4V03A 2Q1TA 3OQBA 1IL0A 2PUJA 4Q3CA 4K9NA 1OAAA 2BMWA 3VVBA 1GT91 3MTEA 1CJCA 1FA9A 4IPTA 1JHDA 3E1GA 5I45A 5JSUA 1FK8A 3NBYC 1DAGA 4U00A 2E4ZA 3HJNA 1NMYA 3SLKA 4EECA 1QOQB 2H92A 4GOLD 3LYUA 4JBLA 2B8JA 1A76A 1SXIA 4FLEA 1QQ7A 2REXB 1CYDA 4N0EA 3F5MA 1VE3A 3IO5A 4QHSA 2VQDA 5T8KC 3FLAA 1FDVA 2BP7A 4MGIR 5EWJB 5ADUS 1ZOIA 1DEXA 4ZU1X 1C2TA 1TFRA 4R9RA 1DKMA 1YCHA 1YBFA 1JYEA 1BDBA 1V8ZA 3GELA 4CQJA 1RU3A 2IY9A 3HA3A 4MSUA 4OHBA 1K6XA 1L8LA 1TZMA 2NAFA 3A1SA 4MJXA 5HG0A 4CKEA 1JQDA 3IVGA 3QVVA 4UUBA 4D3FA 5KSWB 1JH9A 3TW8A 2YIMA 4WKGA 2DY0A 3GQBB 4BLOA 4YAKA 1AD2A 2H1VA 3EZNA 1L7DA 4MJLA 3CUTA 2G0AA 3FPEA 1XXLA 4FSHA 3M89A 3UOWA 3X1JA 4EFMA 2PFSA 1QLWA 3WGYA 1ZM7A 1JBQA 1VL1A 3J81A 2KWIA 2VPWA 2EX4A 1YRAA 4HH4A 4J0JA 4E5VA 1XZBA 2GT1A 5EERA 3BE6A 4IQ8A 4Q4JB 3PWKA 4PRYA 5BV2P 4MULA 4MEBA 1U9YA 2CLEB 2D0IA 2GK7A 2FSIA 2PD4A 1QHEA 2YJGA 2ZUBA 1I51A 4QO8A 5E4YA 2ZIUB 3BTOA 4M7OA 3N2YA 3CJRA 4B7XA 4P34A 3HEMA 2FRDA 3BWYA 5HCUA 3HCCA 4UAJA 4WNCA 3HLTA 1ZMOA 1JFRA 1GPMA 1T2CA 3QVJA 3A10A 4ZAVA 5JMPA 1DIHA 1C4KA 2Y66A 3ASUA 1YXMA 2WINI 2WQZA 2ZWOA 3UN1A 1CWUA 5JHGB 3U4QB 2FX2A 1PS0A 1JKJA 5TPWA 1J5XA 3PJRA 1P73A 3JRNA 2G5PA 1RAAA 2X8WA 3IKLA 3B2NA 1XJ0A 3EA4A 3LOUA 1FVXA 3X44A 4EYGA 2UUCB 2NZWA 1A9PA 1RI5A 3K4HA 3UHOA 2R7NA 1SXJB 3PXUA 2ZS9A 5J2TF 3W6NA 1K86A 4NE7A 1GFWA 4M1EA 4A6EA 5DWVA 3OTQA 1E3LA 4JLPA 3UJBA 3NHLA 3RKSA 4DE5A 2AFHB 1TUIA 5EMKA 1WEHA 1A2BA 1FYFA 3KUUA 5K8LA 5SY4A 2I7TA 5FPYA 4PLWA 1IVSA 4ZGGA 1U94A 5K09A 3MTIA 1JHYA 3LBAA 4Z9FA 4F3CA 1FTYA 2H2HA 4IEFB 4IIGA 3NP7A 4Z4FA 2XDQB 4JVSB 3ZWXA 3VNQA 2JCSA 4PEVA 5DW3A 1UBMS 2HMWA 1DINA 5BSRA 2NU7B 4HQLA 5FNVB 4BRZA 3QI7A 2R6AA 3H86A 3PITA 2NT3A 2W6NA 3MMPA 4FDTA 4M22A 5T3YA 5TPZA 3KZXA 4I4NA 1UXKA 5B1EA 3GLRA 3PC6A 2I29A 4A8JC 4EMTA 1P5JA 5FB3A 3FPHA 2QT0A 3CURA 1DE0A 2CF6A 3SS8A 1QYIA 1M2NA 3O6VA 3QBDA 1ZIPA 1IEQA 5AUOB 4XUEA 1ZQ9A 2JATA 3UPDA 1RJEA 2Q3HA 5CNJA 2JDIA 3TTTA 3WO1A 4YCSA 3UHAA 3CQ9A 3RIGA 3V7NA 3EZXA 4O4IB 2QKYA 2YWEA 1K6MA 3USZA 4P2GA 2PA0A 3D6JA 1V5IA 3NONA 5CTJA 1HNZB 2QPAA 1C3VA 2H07A 4L95C 4M8SA 1G2IA 1Z0KA 4PC1A 3CN9A 1XR3A 4OQPA 2OEPA 4DDUA 4QPPA 2XQJA 1KAGA 5I8WA 2V5VA 3DAFA 5LZ2A 4DIKA 1SCKA 1COWA 1CQZA 2P77A 3DL4A 5IBCA 1FCJA 3EUWA 1TLFA 1UC9A 1YR1A 3RSZA 3I62A 1QE3A 1BKYA 3CRVA 3DB2A 3EGCA 3RVJA 1Z8FA 4UNRA 2XGJA 4HMQA 1GNQA 1PU2A 1E0KA 2F3SA 3FW1A 3W5CA 3GGGA 1TYDE 2FWBA 4J16C 4PSDA 2POCA 5D3MB 5EMMA 2OBMA 1N2SA 2N75A 2WLTA 2YOHA 3PI7A 3KT0A 3UK7A 4D02A 5B7GA 2I66A 5D5QA 3NOXA 4HFMA 4EMBA 3QE9Y 3PDJA 1L4FA 1QBGA 4RA9A 1ILEA 2ZXUA 4BNIA 1A8SA 1UP4A 2IYNA 3H2JA 3RC3A 4JY7A 2Z9CA 3EEIA 1CQJA 1QVRA 3FN4A 1R6TA 3R3VA 5FOVA 5CDUA 1H6DA 4O2AB 4YAEA 4EB8A 1F48A 3UWOA 5TV2A 1AXEA 3RM3A 4DPLA 3TEFA 1RHMA 2O7QA 2EP8A 5CDFA 1ZFNA 4OXIA 4I1RA 3VYUB 5L4NA 2DETA 2LR0A 5IK2D 1E18A 1U1GA 4UEQA 4DSZA 1C41A 1C7ZA 3SE7A 4K81B 4V0SA 3KZVA 2HK6A 3U7FB 2DFVA 2H5JA 1D1TA 3RSFA 1KYWA 3E35A 4RKWA 2AQ8A 3U62A 3LK6A 3T4XA 3UCFA 3WL6A 3D5TA 5KOYA 2GBGA 2W90A 3JQQA 2LUOA 1K7YA 5DHQA 4RV9A 4FE4A 1R0ZA 4KC0A 4PYOA 5DHUA 1NJ8A 1XTVA 2A0WA 4GXTA 4J1NA 4LJAA 4PPNA 4EG3A 4BBAA 2Z6VA 3QIAA 1II8B 3UZUA 4EJFA 1SXJE 1P2UA 1XEXA 3GUVA 5BY2A 3IAM6 1Y3BE 4IUBS 4ZD6A 2IA5A 4MW7A 4N8DA 1SG9A 4RMHA 2HK7A 2AFHE 4QPDA 3QTBA 4WZAB 1IAQA 2OFPA 2PWAA 3EVAA 3FCSB 1JIQA 1DOHA 1Y3DE 4G1CA 4IM7A 2O14A 1PGOA 4L2IA 4U7JA 5F21A 1IB6A 5FR1A 3SBEA 2GS9A 1QBKC 3C0KA 1L8XA 2RKBA 4RSMA 1KMQA 4OFBA 1TGYA 4K6HA 1NP7A 1K7EB 3OC6A 1KRXA 4L50A 2HIGA 2VEOA 1R6DA 4W6QA 5DISB 4AYXA 3EHDA 2Y4OA 2Z57A 5CURA 1W6RA 5LMCA 2D2VA 3PJEA 1QYXA 1JIXA 5HM6A 1H4QA 3BFXA 3FFXA 4BN5A 1F9EA 3D3JA 1T91A 3D31A 4P83A 2WVJA 4XCXA 3UAYA 5JNUA 4R9VA 5IEJA 2C7QA 3GPDG 1ZDMA 3ZLJA 2LPMA 3I12A 4J76A 5KDLA 4OQMA 4XX0A 1Y9EA 1V5EA 2HA5A 4CM8B 5B12A 3QE2A 2F3QA 4GPZA 3TDKA 2N1BA 4M83A 1LX7A 1XPJA 1U7WA 3WLKX 2RB5A 2PKEA 3AHCA 4EENA 3C1OA 1WZUA 5JQGA 1NLUA 5GV7A 1W2WB 1U8XX 4DLLA 5A4FS 5KNDD 3C8UA 4XGIA 4GZLA 1C7IA 3NBUA 4AO8A 3LF2A 4ZV9A 2B8EA 3M7IA 1I9CA 2ZKIA 3T9FA 3EEQA 4LJ7A 4PY2A 4IBOA 3FMVA 2F1RA 3M6WA 4U2BA 5EQJB 2P9ZA 3U1TA 3AVUA 4HNQA 4J0GA 4MUXA 4DG5A 2PAAA 1C0KA 1EXNA 3VO2A 3U37A 1YA4A 3RFVA 3MWYW 4G3XA 1TU3A 1AS3A 1EKXA 2AOTB 1H5QA 2XA2A 1NXTA 4DCMA 4DV0B 4X63A 3OU7A 4GNKA 4QGGA 4EEKA 2ROQA 4RJTA 1N1MA 3OLCX 1CY0A 1S1MA 5FFMA 2ZRIA 1M8PA 3PXDA 2YWXA 2NQTA 5TR9A 2VTBB 4TLDA 1W5EA 1QV6A 2CNWA 1Z5NA 2I2FA 2Q2OA 5K8JB 2ODNA 4H1WA 2Q5FA 3NWJA 4KN8A 5CJ2A 1YB5A 5FL3A 1D3AA 4KLZA 5AVWA 1G3UA 1XTRA 2ZXEA 8ABPA 1HDRA 1BGWA 1NU8A 3JYQA 1EAYA 3WRYC 3KSUA 2Z1NA 3H4VA 3NP9A 3L4JA 3LV8A 4TTJA 1EUCA 1NVTA 2A1UB 2NIPA 4FB5A 1NOKA 1KVQA 4ZYWA 1TQDA 2ZI6A 4KMRA 4C06A 2Q7DA 1VKNA 2KJQA 4KO4S 1F6WA 1L5HA 1LPMA 4DL9A 1JR6A 3R6WA 4B31A 4OXXA 2YKGA 2CBGA 4P36A 5K45A 1FYVA 4A26A 2QMHA 3KE9A 4FX2A 4TLBA 1ZITA 4DMLA 3RYCB 1IY1A 1UWKA 2CHGA 1WQ4A 2VAPA 5UKDA 4Y6QA 3RKUA 1T6XA 5IUJC 3CR7A 1E0SA 3R9IA 5J9FA 1TQ4A 3DZDA 5CFNA 3CISA 1KQGA 4K6GA 3DV0B 5IT9A 4AS2A 3RUDA 4E5KA 3QUSA 4G1MB 4W5TA 2CFTA 5ALRA 3F0TA 5FI0B 1ZVQA 4I6JA 1O9BA 5FTWA 4BL5A 2YQ4A 1V8DA 2IL1A 2Q0XA 4L28A 8GPBA 2XA1A 3G8CA 4LKRA 5ICEA 3S2IA 3EC7A 5JBIA 4WZAE 1A50B 1B2RA 2F7SA 1J23A 4RKRA 3Q9SA 3TTXA 3R77A 3HA5A 6PFKA 2J3DA 3ZDCA 3FHCB 1FMTA 4NBTA 2G1AA 4P31A 1QP4A 3AEXA 3QFCA 1VJ1A 2QDKA 3DOJA 3L8FA 4RF3A 4FEAA 1JE0A 1JFVA 3OJLA 2JLWA 3OZ7A 4TSKA 1VHJA 2DX7A 2C2WA 2YZMA 3N8IA 4FGUA 1DKQA 2HHCA 1J0CA 1YS7A 3DAHA 4RD1A 1GA1A 3K6KA 1ZD5A 2A9KA 2XMGA 3LWBA 5D85A 9GPBA 1KY3A 5A06A 3OECA 1UFOA 1SUWA 1E8MA 3OVMA 2AD5A 3PDWA 3U48A 1KS2A 1NONA 3T5GA 1JKMA 1G6Q1 1T5LA 2JS7A 1QU2A 1UDRA 3GCWA 3TSAA 2Y0CA 4KR6A 2E9SA 1UJBA 3LRTA 4ODIA 3G7UA 3V6MA 2XUJA 3T1OA 2FYTA 1VG8A 4GBGA 3TUIC 1ZD4A 2BFFB 4UNQA 4RS3A 5DI3A 4DCVA 2GAAA 2RGWA 1PFWA 2ZI7A 4PLHA 4D6XA 5A5GA 1GUYA 3F3KA 4WESB 2ZYHA 5DM0A 2QRGA 4KMOA 4XZ3A 3ZDDA 2X9VA 2QW8A 4LZOA 2GCOA 5FOWA 2OORC 2L17A 4CKYA 1BW9B 1HURA 1Q77A 4OGFA 4NOKA 3RRYA 2W8BA 3FTNA 1KAMA 3O8QA 2NUAB 2V0CA 4GX5A 4L22A 4NNPA 1CR6A 1P2DA 1EUZA 2CNOA 1AB5A 2VDNB 4JUFA 4BGIA 3VPDA 3PLNA 2P3OA 5JALA 5LA6F 3QEOA 2RHLA 4GX1A 5HBGA 1KI3A 1OAOC 2PWBA 1IYZA 1E69A 2V7UA 3CH6A 4FYIA 4MAFA 4EEZA 3KOWA 1X1DA 5ALGA 5KJ6A 1FB5A 4ROTA 4I5DA 3FHOA 2QJOA 4HDSA 3QELB 3H2BA 1AMNA 1IM5A 4XCVA 3IIMA 5DHRA 1BROA 1G6OA 2P65A 4R3WA 3EWNA 3FTQA 4LYGA 4XDGA 1A8HA 1CR2A 1J8QA 4EM6A 3JAWB 3M1YA 1UODA 1J21A 4O4HA 2RG7A 1YJQA 1G6KA 3BREA 4IHJF 3RGWS 4QEZA 1Z7WA 1EGHA 1Q12A 3UJHA 3UQZA 2WWGA 1R9GA 1XVUA 1TVKB 5EWLB 3FOZA 4R6XA 1X87A 3EXEA 4S1OA 2REQA 4P5PA 3FKSA 1KKMA 3ELDA 2WPNA 1FMFA 5EAIA 4J6EA 3H18A 5ANRB 1P31A 4F2HA 1ZGAA 1EXDA 1X14A 4HR7A 3T7SA 1PLKA 3HDYA 5JQWA 1E79D 4D5EA 5IJWA 2XSZA 3EX7C 1HMPA 4RBNA 2JEOA 4JUBA 1LUAA 2O54A 4JI3B 3DOFA 5C9ZA 2PTGA 3M49A 4P4NA 3ZBPA 5EUQB 3A27A 1X7ZA 3W5JA 3UUGA 2XQKA 4F5WA 5BPHA 1RHKA 4BWGA 1KY2A 1C0EA 1U3WA 4JKYA 2EW2A 3OZAA 3PB3A 3F8SA 3D2LA 4P38A 1C9EA 3CBGA 4Q4HA 3EGIA 4Y67A 4YDSA 4D3XA 2V59A 3WICA 1MORA 3G8AA 4R9NA 2ON6A 3CEPB 5I7OA 1OH6A 1AGRA 1DU4A 1YDHA 2VBGA 4L9WA 2QMUA 4NMWA 4HSEA 2Y1LA 2PGLA 1O94C 4M9CA 5D84A 1POXA 3ESXA 2A3RA 4HUQA 1L5ZA 2GJSA 3R8XA 1VZ2A 2GEBA 4UVGA 4DLSA 5FULA 4CL2A 3RVMA 1OFUX 4M7WA 3MG9A 3WLLA 2IELA 3PXEA 4HNVA 4F9TA 2AVDA 3B36A 1MG5A 1RWPA 4ANFA 5CD1A 1VBKA 2WMDA 2ZVDA 3MJRA 2ZYWX 4IDPA 3OWHA 1P4AA 1VFPA 1FNDA 3UWPA 5DHTA 4LRYA 1RAHA 2WK1A 1TO6A 3TSCA 4CEIA 3V7YA 2NW6A 5IM4A 2ZJ1A 2R9VA 3D4BA 3DYVA 3THYA 4XQCA 2PQ6A 3AB3A 1E98A 5B6IA 3DQZA 5BWBA 5C5EA 4O29A 1QH8B 3I04A 1D0SA 3T3GA 4A7PA 4ZO4A 1GTMA 1Q50A 1ORTA 1ZGBA 4B2LA 1EESA 3OQPA 4NCJA 3DXFA 4PNHA 4RKEA 2NZYA 1D9ZA 3R75A 3SMQA 3H1TA 3CONA 2PSSA 1IXSB 3HFJA 4UEOA 4S05A 2P2CA 1JHMA 3AF0A 3HEAA 2A0YA 2ZWMA 3O47A 1H0HA 1SG0A 3QW2A 1E4EB 4REQA 5L6MB 4FD2A 3K3PA 2B99A 3QPCA 1W9MA 3ONNA 1EM6A 5BSEA 2FSSA 4RLQA 3VDMA 1GPH1 1RLMA 3DH0A 2VDRB 1PT5A 4OFZA 3ZHXA 4HV4A 2J0SA 3AESA 3UICA 2PGJA 1G20A 4CDGA 3AZQA 6ABPA 1E6MA 1LI7A 4QXPA 3KT8A 3W6ZA 4BZWA 3ZGZA 4TZ6A 4O2BF 3EQZA 1H2WA 1EQ2A 3JYHA 1YC5A 4Q4LA 4ZXFA 1Z4QA 1UBCA 1XDZA 2ONKA 4FW9A 4PX2A 1GZHB 4Q4DA 4P3PA 3C3AA 1BVHA 5C46F 4PLTA 2WDPA 3GIWA 1U0EA 1AK1A 2CXRA 3DEYX 4XUGB 4H15A 1YZVA 3K9BA 3UCEA 1V5WA 2NUPA 3QU5A 4C20A 1SRRA 1YIDA 4MK4A 1GRCA 3HU5A 2GPYA 3DZJA 2O0KA 4KI7A 1I94B 3G9UA 5KKCA 1KJZA 3TPZA 1KI7A 1MAHA 2C92A 4NPHA 5FORA 7REQB 2CLSA 4QPCA 3IMGA 5GIPE 1WXHA 4FSXA 4BBPA 5KX5A 1M5RA 4FHFA 3BDIA 5FI1B 5JAUA 3KTDA 1U8AA 2NAPA 1DQPA 4KWHA 3FYCA 4OL0A 3FR8A 2AKAB 4MHOA 4BMDA 2ZGVA 4BUJA 1K8RA 4MGEA 2DVMA 1XZDA 2YJTD 4B44A 3OZRA 1QNLA 4XIYA 5IC5A 2X1VA 5FV7A 1LF5A 1MG0A 4HAUA 2AS0A 2G7ZA 2H3EA 2X13A 1NR1A 3AVTA 4BZXA 5DTRA 5KAMA 1GDHA 4NBWA 4DRXA 1NE2A 1FLVA 5T4EA 1XPOA 4QUKA 2RH5A 4YMSA 1WNFA 3N5KA 3TIGA 5ITZB 3CLTD 3W8RA 3BQ9A 2VYVA 4N41A 4K88A 3BH6A 2VVTA 3AM5A 2QTVB 4NE9A 2O2SA 3PDIA 2EL9A 4LE1A 3CVWA 2CKDA 4WEQA 1Y6ZA 4UUMA 1BE6A 4H16A 4Q66C 1LCIA 1GCGA 1BC5A 1QHHB 3DFIA 4YO8A 1PD0A 4BPRA 4BGDA 1E3TA 2C2GA 1H8HA 1HEIA 1ZCFA 1ZUNA 3AHJA 4L8YA 2XVMA 1G8GA 1R18A 3I4FA 2O59A 4YRKA 4ZYUA 3T99A 3HK2A 1NXWA 1C3LA 1Y1RA 3MUOA 3MWJA 2P9FA 1QIMA 1UDXA 1U2GA 4MR9B 2Z83A 3HXKA 5REQB 2FPGB 2O6LA 3U26A 4E22A 3O8RA 4XFDA 2UXBB 1BFDA 4LFAB 1B1AA 4GI5A 1NVGA 5I9BA 2IRWA 4GR4A 4PPYA 1JBKA 2VPIA 2WWFA 1JDZA 2WAAA 3CUWA 2EERA 3Q5GA 3WGNA 1F8FA 2WHPA 3A05A 1Z3IX 2DKFA 2K7ZA 3P9CA 4QA9A 3UB4A 2ZREA 4N1AA 4ENUA 5EJ5A 1IEXA 1IQUA 1XD2A 3I2HA 4X95A 3WWCA 5BQ3A 1T24A 1JWBB 2C2YA 3ABOB 1E9EA 3E22A 5COAA 2VTDA 1XELA 1LF0A 3KEMA 4BO7A 1X86B 4CW7A 3NHAA 2QTRA 5GWXA 1SXHA 1J56A 1REQA 3TEJA 2OFOA 4AG5A 1K98A 1X7XA 1RACA 1KI6B 2JIBA 1QFXA 3QPVA 4IG4A 4L7VA 4QHTA 1Z5GA 4M1TA 2OV6A 5DT9A 1L7MA 3H17A 3W7VA 3REGA 4IDQA 4JOCA 1A95A 1SBTA 1XCMA 3A6FA 3HYTA 1IZ9A 3TQCA 4EZIA 5JV5A 1G8FA 4HDMA 4X7MA 3UJ9A 4OK3A 4PCUA 2W37A 4DIFA 1UMBA 1H23A 3FOCA 3JYLA 3LNCA 3VNRA 4BXOA 1M1NA 3MBIA 5LN1A 4LDQA 4LISA 3ADKA 3DA8A 1OU4A 3HB9A 1M3SA 4Y2QA 1J9ZA 1FFYA 1YHYA 3ORHA 4FXOA 4ZQHA 3R7NA 1CS0B 3OAAA 4J0KA 1QQAA 2BGJA 3L79A 4NZNA 1GCAA 2O19A 3CW8X 1IMJA 2YWDA 2ADFA 4TYMA 3AF2A 5EHXA 5LXTF 3SNKA 2RBGA 3WLTA 1O8CA 4ZQEA 2XBMA 1VIAA 2Q45A 1B14A 4TVSA 2ZRNA 1P33A 1M6WA 3A04A 4AJ4A 3GEDA 4R71A 4U6QA 5FTKA 1Y5LA 4G5QA 1M8JA 1G5RA 1W44A 1A3CA 4Y18A 3T5MA 5KNBD 3UBMA 2O2YA 4EYQA 4G37A 4EGFA 2J3IA 2NZXA 4U8GA 2J3EA 2JFYA 3OM0A 1FYXA 3RG8A 5EE5B 5FPPA 2WFAA 3C16C 1F3OA 1U63A 2ZB7A 4CYMA 2K5UA 1MJFA 1D1PA 4U0KA 4UU7A 3AF1A 1TYEB 3ITEA 2JF0A 2ZS7A 3T3MB 3WK8A 3ZZTA 2HRQA 2WTEA 3O9MA 2OCXA 2R1TB 4UCXA 4RPHA 2VWHA 4FS8A 4LMRA 1USWA 3SEQA 3H8SA 4FYXA 5BYJA 4BAUA 4JLSA 3TQHA 2FJUA 5TXGA 1EM8A 4QYWA 3KQOA 3DBLB 1G2OA 3WYEA 3JQCA 2H2DA 5DU2A 1ZHOA 3ED1A 5HS4A 4KXVA 5E3HA 1N57A 1T1IA 1UT6A 4YAJA 3QKSA 3V7FA 3D7SA 4OHKA 2ZAMA 4F4CA 3WA7A 2GD2A 5BYBA 2PV0A 3EFOB 4RTMA 2P5YA 2Q3DA 1LWNA 2D1YA 3P2JA 5K3AA 4DV7B 1P3JA 4DMCA 4JJ8A 3N87A 4J49A 2PS9A 1SCUA 2R8PA 5LBUA 3X2SA 3M6XA 4E6PA 4KH0A 1Q16A 4YJ2A 1ODIA 1XZGA 3G2MA 3L1KA 4BV9A 1RIIA 1E8NA 2AK3A 1O95C 1TM2A 2ZRGA 1T9AA 4BMVA 3RIXA 1CEQA 4LRQA 2Q6KA 4MLDA 3WTBA 2IYTA 4BFSA 4DLXA 1U28A 3L40A 4RC9A 1W4AA 1W0KD 1E1LA 1K8YB 3IQWA 4JFRA 4ADSG 4HXEB 5AUNB 4JI2B 1RBZA 4P7FA 3C7KA 5DYGA 5CPFA 4YRFA 5T6MA 4OQ4A 3HCBA 1PVDA 3IA7A 4PYRA 4EIWA 5BMVA 4LG1A 3RTCA 5BN4A 4O3FA 3GEIA 2RBKA 4EB6A 2ZSDA 4MV5A 3N8GA 4H6PA 2BMVA 3X3HA 3Q1KA 2LCIA 1ZH0A 5HMLA 1DCFA 3KKPA 2PMWB 4UE3S 2J9RA 1H66A 2PRSA 2N0SA 3SZGA 3L1HA 5KYXB 3D3WB 3DOEA 2DU8A 2JGAA 2X0NA 4TL8A 5K3SA 3EDMA 5K51A 1FS5A 1J4AA 3O7MA 1MNAA 2DOKA 2G76A 2Y1CA 1D4ZA 3IP9A 3IPAA 1R6VA 2ZRFA 4JA2A 1P7ZA 1OLUB 3NTVA 3S2FA 4BUZA 5KVCA 3N07A 1O6GA 3AF3A 3S27A 4LDPA 1NG9A 4QTZA 2C4UA 5TSDA 2QLBA 5KTKA 1BVYF 1WULS 2IDJA 4BO4A 2AOVA 4PW0A 4YWJA 2XE6A 3OJEA 4MVJG 3R23A 2QX6A 1G6HA 4I1VA 1B6SA 3CV3A 3NVDA 1Z6AA 4G5RA 4EUFA 1CCWA 1FXSA 2HCTA 3NOVA 4HD8A 4RZUA 2X0EA 4F06A 4TYWA 3DMFA 4TWIA 3VBCA 3ZCPA 2MYPA 2MINA 4MWEA 4B43A 2JCBA 4NJMA 4ZCMA 2XJ4A 3AUAA 1XXHA 4KWIA 4H1VA 4Z51A 3QH4A 4B3XA 4BMSA 4KLAA 1W7AA 1WBJB 3G17A 3I9OA 5B3JC 2FOLA 3ZV4A 3H1EA 3KL4A 2GF9A 5AK3A 3W4JA 4ALKA 2C2XA 4OMUA 3ONVA 2DHCA 1KTIA 3M9LA 2XVAA 2WUGA 2OBXA 3G0CA 2ANBA 1OFIA 3A9UA 2D3TA 4X9XA 4ZAXA 3M4ZA 4M88A 4DV5B 2W98A 3MHPA 4JC8A 5AKHA 3G0DA 4EW3A 2P7HA 3USES 3KHKA 1B93A 3LH5A 1FP2A 3ESBA 3LHKA 3PHJA 1VRWA 4MIKA 4P35A 3O8OA 1SXQA 3ERCA 2YYAA 3WB9A 4YP9A 2FSVA 5K3BA 4N5IX 3SIXA 3JQFA 2N42A 5BP7A 2CLKB 3H1PA 2ZE6A 1FFHA 1ESZA 5EXXA 1QKKA 4HTAA 1BFKA 1DTSA 1DDOA 3K31A 1EVZA 2BONA 4IIFA 4F56A 4LVCA 4ZGWA 2QBYB 1BEEA 1B74A 3SS9X 2Q3EA 4XTRA 3G5AA 4I50F 5HCNA 3ZQ6A 8OHMA 2YQZA 4EY6A 4IMIB 3ZNPA 3EA0A 3EGDA 1XZKA 1D2NA 4B71A 4EI9A 2I3DA 1W75A 3PRHA 3VR4A 4KIUA 1Y1KE 1KAHA 1YAJA 4CLOB 2VK1A 4LZAA 1UWVA 4H1TA 3GJ6A 1ZUHA 4LV6A 4B4VA 2H00A 3MB8A 1PZNA 2HF2A 2QGNA 4LPKA 4C08A 4LGVA 4D8VA 2W42A 2ZSBA 1S2MA 1EVQA 3B1ZA 4RLSA 3VQTA 2QW0X 3ZGYA 3OCYA 4M0EA 4LMAA 1MVLA 2JH8A 1ULUA 2WHXA 5J5AA 3M6AA 3SFVA 3LP5A 4D96A 5LWHA 4E51A 1RI3A 2FRDC 2IX9A 4DCSA 1KVUA 3WJ7A 1QS0A 3WX0A 4DBLE 2YZGA 3CEHA 4I9UA 4F1JA 4D42A 1JR4A 3FTFA 2FR1A 2H9IA 1CQPA 5GONA 1W5FA 4X54A 1TLTA 2BKUA 3FB4A 2IUTA 3GG9A 3IVCA 4C43A 3R41A 1BDIA 2QAIA 2V55B 3NH6A 3HB0A 5FA6A 4KUHA 5LJIA 3N2EA 4DMFA 1KDTA 3TQTA 3UHPA 4RWEA 3Q98A 4G5GA 2Q1UA 4ZCRA 1JT2A 2DYKA 4ZJZA 3BEOA 1KI8A 3GFGA 2SECE 3H0KA 2VS1A 5KQRA 2I91A 4CIAA 3ELBA 3CXUA 3HY6A 5AXDA 2L42A 4YUWA 1QB8A 2R3SA 1NRIA 3K1AA 2OCBA 3A32A 3IAXA 4RGQA 1O77A 1JPJA 4ZVLA 1XVLA 4QUHA 3TNYA 3WK4A 2AHOA 4TM7A 3F96A 3MERA 2FMUA 2HU7A 2ZXFA 5HIAA 1RPTA 4I46A 1HDOA 4GSLA 4QLAA 4TV9F 5F3RA 2OBLA 2ZPAA 4J2OA 3KJFA 3LWNA 3EXIA 1KJ8A 1LDGA 3JQGB 4HWOA 3EY9A 2IWRA 3S1AB 1IHDA 7AT1A 1CY8A 2A4MA 1R9JA 1OFVA 2C0QA 4TLMB 4ZHQF 3KYDA 3W2GA 1FUUA 4WA8A 3D6UA 2G9UA 4QYIA 5T41A 1SQFA 2E6KA 3V46A 3PYXA 5F5NA 5FQNA 4DA9A 5K0BA 2VKTA 4W7IA 5D7BA 2YFHA 1VDZA 3AYXB 4FHEA 5COQA 5AVUA 1LH0A 1VXOA 2G70A 1CUWA 3GB9A 4P4SA 4ZZ1A 2EEZA 2IYVA 3AYZB 3T52A 3FI9A 3JCZA 1I9GA 2Z08A 4HQ6A 4P4GA 5EESA 2X0DA 1M6NA 5CCEA 5IKEA 2PMCA 2VNJA 3ABSB 3R5TA 3UQYS 2HRBA 1HQKA 2EGGA 3K8OE 4KI0A 5EZQA 4BKOA 1QRUA 1W73A 2IYPA 3RC2A 3G0IA 3U3KA 3BORA 4FHZA 2PX3A 4EFDA 3HL4A 4FR5A 1Z2NX 1AK2A 1U2EA 1BVUA 5AVKA 4RJ2A 4EVSA 5CFMA 4JI0B 3HNRA 4M1MA 4Q34A 4B8ZA 3S7TA 4B3BA 3EBPA 1CT9A 2OMKA 1KDPA 3AF6A 3SI7A 4S1WA 1MX5A 1KO5A 3F7TA 3OJOA 4KB5A 4YONB 5IMSA 2Z3ZA 1SXGA 3BWBA 3G9QA 1AB6A 4MUEA 5KYYA 3WGTA 3N0XA 3UFXB 3REQB 4KO2S 1V25A 4EY3A 5AW9A 1XTTA 4PO9A 4Z0TA 4EG0A 2DWPA 3IP7A 5CA1B 2IC5A 5KVSA 2YXPX 1CJSA 1DZ3A 3QQPA 1JJ7A 1KGSA 2FZWA 3GJ7A 4BATA 4DR2B 2KHZA 3DPIA 1IHXA 3G6WA 2W9XA 1T8WA 1NBEA 2PH7A 3OCUA 3CGWA 1L8OA 3Q6NA 1GTL1 1SCBA 5T57A 3ZHQA 1E5TA 4KFCA 4U7DA 3LT5A 1HO3A 4P5DA 4KDRA 1GA4A 1TA9A 3E5RA 1ZL2A 3KL2A 1NMXA 2E37A 4HDKB 3ECCA 3LT2A 1BXRB 1O2DA 2QUAA 3NDJA 4WZBB 1MUUA 4KUGA 3VKFA 1G7RA 1M1ZA 2L69A 3KB8A 3RUFA 1W0CA 4JLBA 5FL7D 4RAOA 1E5XA 3W3ZB 4HLNA 2HGSA 2BR5A 1R74A 2ZJ0A 3HZZA 3RK1A 2VK4A 4TRRA 5JJKA 4XIGS 2K4MA 4RPKA 3MLAA 1Z4MA 3B3FA 4HGZA 2YS6A 4ZEOA 1N6LA 3OJXA 5A6VA 4A2WA 4LF9B 4BP3A 1YR3A 1J07A 4KIGA 2PX5A 1N0VC 3ZWVA 1DIAA 4BMCA 1VMIA 1T8UA 1XCBA 2EDAA 3C1TA 3QWIA 1B42A 4HHEA 3B1JA 1ECBA 2WD7B 3DOCA 4LY3A 3TJMA 5J4KA 1K88A 3FROA 4OYRA 4WXYB 3O4VA 2UU9B 4V3BA 2PS0A 3VGPA 1YS1X 3MTQA 2RK3A 3AK4A 5ILQA 4CM1A 1Q0SA 3NDBB 1WMFA 3DF9A 3PGVA 5LYJF 4QUDA 2Q5CA 3V33A 4E15A 1L4LA 3KJNA 5JC1A 1GL6A 2FSFA 1O6CA 2P5TB 3I9FA 4Y6LA 1VA4A 1Y4AE 2FEMA 3DHWC 4P3KA 4JT2A 4MVXA 2P27A 5EWJA 4ZCPA 3GJ0A 3V48A 3WHLA 4DCPA 3IUMA 3OIGA 3Q7EA 4RH1A 2ZJYA 2QD5A 1ZA2A 2BFEB 2VBCA 3CRMA 4II7A 2JHPA 1UZNA 4II2A 2UUBB 5CM9C 1I2BA 1KJNA 4MARA 1ZINA 4ZOLF 4CV2A 1BX0A 4RZQA 4IYJA 2GKGA 3Q8WA 2RGGA 3RYHB 4F5EA 3N2ZB 3DHNA 5IF3A 3GQBA 4WE3A 1KZHA 4KR9A 4AJEA 2IUEA 3BK2A 4TTIA 4B17A 4J4TA 2YNMD 4KYVA 5DHAA 4BP8A 3H0CA 5J2UB 4PXAA 4GSYA 5G40A 2WMNB 3HXMA 4W9NA 2A0XA 3HU2A 4QG7A 4Q4JA 2H16A 4ARAA 2Y76A 3IJRA 3BXPA 2OHIA 3KQYA 5DWDA 5KYTA 5E6RA 2Q1SA 3EW7A 2GLUA 3L7LA 3R1IA 1N0UA 3SZOA 1YR8A 1YTUA 2QWXA 2JBHA 4D0NA 2BTEA 3F9IA 1RVV1 2P68A 1HLDA 2ZETA 1WAMA 3MC1A 2X6TA 1OT3A 4GBED 2B2NA 4NYIQ 5P8WA 3P2YA 4P4UA 3RYIB 2DWQA 3MSCA 3WYFA 2QLJA 5K4GA 1CZRA 3U4QA 2XBLA 3FWYA 3WQHA 2H1HA 5I01A 1D2GA 4NICA 3BKWA 5DKFA 1Y1QA 4OCZA 3ET5A 4OQNA 3L02A 2XIJA 1I33A 5CK4A 4ZZ2A 1SXJA 4L8LA 3PC7A 4IV5A 4URFA 1A2OA 1TJ3A 4RHFA 1SBZA 5ALHA 4CTKA 1B76A 2ZITA 1T0UA 5HW0A 2ZIAA 1EX6A 1PO7A 2F8LA 1V4NA 3CTPA 4ACBA 2AFHA 3WB1A 2WPDA 4YRGA 2G0TA 4BGEA 4F21A 5KOJB 1FRFS 1LQUA 3KKLA 2BFAA 4HEA1 2XEDA 1WUYA 3E82A 2ZRQA 4U63A 5ADHA 3VJRA 3WL4A 1GOTA 2YBEA 3A1EA 4CKBB 4D26A 3MIIA 4LHXA 4JV5B 4BNJA 1P44A 3A37A 4YQYA 2X8AA 3R8FA 3CF0A 4IH1A 2Z95A 2Y0PA 4KAXA 5K8TA 2E4VA 4WZBE 2EJWA 1LC3A 3GEEA 3IP5A 3BHNA 5CT4A 3TTWA 2H2IA 3TX2A 5KYUB 2EX1A 2XZLA 4U5XA 5FDFA 2RK4A 2OWEA 3E9RA 3QV2A 4JITA 2EBHX 2OQ2A 1LLQA 1S0UA 3I9V1 3LQ4A 1U1CA 4M9UA 4OXQA 5EJEA 3LSYA 3FYUB 3OESA 4OIFA 3GGJA 1G21E 3E2PA 4UHBA 5B1SA 1UKAA 3MYRA 4N0MA 4O4IA 1OF1A 2BFWA 2BLNA 2QZZA 4C5AA 3TECE 4OH7A 2R5WA 3K8QA 4FFVA 1R0CA 1PSWA 4PAWA 2YYZA 2XMSA 4HZGA 2MYUA 2CYBA 1VHTA 1PJRA 5DCLA 1APBA 3EIOA 1MC5A 2ZT8A 4RY0A 4W63A 4Y9UA 2ZQ5A 5BW4A 1E1NA 4HVAA 2AEFA 2QJRA 4PC2A 3G3EA 3D9QX 3BZUA 1BOOA 5K6AA 4DTCA 1CF4A 3THOA 2LZ0A 2OAP1 2A3NA 3ZIAA 4BVHA 1WPXA 3ORYA 4OMCA 5FBLB 5JAQA 4H17A 2J59A 3IMCA 4R7TA 2EAUA 4GAEA 1W0JD 4WHMA 3VKUA 1ZXXA 3BSYA 4UVIA 2NQ8A 4WJKB 4ZO8A 1JHUA 1ZN8A 3ONDA 3LY8A 2QZ9A 5H5JA 4ZYYA 4LV8B 2QPTA 1J33A 4FQ5A 4MKRA 1Y1TA 4XSHA 5C8DA 1DAKA 3H2IA 2JASA 3B51X 5LZ9A 1FFBA 2CL7X 1GY8A 4LBVA 2W58A 6Q21A 5HZMA 3LCVB 1W4BA 4M9RA 2RGEA 3FCEA 4XM2A 1MIHA 2FMKA 4WFJA 3BRWA 1JJFA 3HL0A 2H4HA 3E3MA 5CNMA 3TGWA 2VDMB 4O2AA 3RVPA 2WWYA 1V9SA 3CA8A 4W7SA 2IXAA 2WY2D 2YY6A 1NN0A 4PHTA 3AY3A 5JHHB 5AW6A 3DEZA 4JJFA 1TKAA 4PSCA 4L4XA 1Z83A 4F1WA 4DSOA 2GFHA 3IULA 1W5TA 4CWAA 2GCPA 2D3WA 1EAMA 4LWOA 4F2DA 2IHUA 2A7XA 1WBDA 4DYHA 3HABA 2CT8A 3OPNA 5I51A 4L07A 5ELLA 1PKEA 2GRUA 5CLHA 1IPFA 3RUPA 2F9LA 4C4ZA 2AZXA 3LC7O 4CKZA 3B60A 2VF2A 1S96A 3S2EA 3Q2KA 2CWWA 4ZVUA 5BUZA 3ON5A 3A2LA 5I6DA 2ZM5A 5F1OA 3K2BA 1GKUB 1II8A 1KPHA 2HMSA 4EKYA 1G59A 2VL7A 4FC7A 5DLDA 4U39A 2PBFA 3EVNA 4E07A 4QQNA 4EVIA 2XMRA 1SZCA 4EKNB 4J1QA 1D4AA 4MS3B 2B37A 2I4TA 4UBIA 4WZAA 3SC6A 4E0BA 1UK6A 4ZT4A 4JVNA 3IOMA 3NV9A 3C4JA 4L4ZA 2PS3A 4J0CA 2WMOB 5KSPA 4L74A 2Q62A 4CL0A 5LQAA 2RCNA 2FN8A 4Y9TA 1SIWA 1T5DX 1PWHA 3PUWA 3VYWA 4I4CA 4MUNA 2GBFA 2O3SA 2Q5QA 4KGXA 4KFSA 1BJRE 3OTOB 1E0AA 1IVYA 2E3JA 2HY7A 4YPVA 1B23P 4YQEA 1FDOA 2VSOA 5FUYA 2JD0A 2NXCA 1PV1A 1F5SA 3O83A 3PUXA 3OSUA 4WKNA 4NCNA 3SXJA 4YASA 2R6R1 1T4MA 3EPKA 1FP7A 3TLKA 4HMOA 1XAIA 5FT9A 4CM8A 2CXOA 4ZO7A 4NCHA 3UO8B 5CNKA 3V4VB 3IIJA 3JD2A 1WB9A 5AK5A 2ZWIA 3OCCA 2QN2A 4C2BA 1PQUA 4MTLA 2COEA 2EZ4A 2GTIA 1C8VB 1QWSA 1U4OA