1PZMA

Crystal structure of hgprt-ase from leishmania tarentolae in complex with gmp
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
183
structure length
170
Chain Sequence
YPMSARTLVTQEQVWAATAKCAKKIAADYKDFHLTADNPLYLLCVLKGSFIFTADLARFLADEGVPVKVEFICASMLLDVRDSVENRHIMLVEDIVDSAITLQYLMRFMLAKKPASLKTVVLLDKPSGRKVDVLVDYPVITIPRAFVIGYGMDFAESYRELRDICVLKKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords hypoxanthine-guanine phosphoribosyltransferase
publication title Crystal structure of Leishmania tarentolae hypoxanthine-guanine phosphoribosyltransferase.
pubmed doi rcsb
source organism Leishmania tarentolae
total genus 53
structure length 170
sequence length 183
chains with identical sequence B
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2003-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1pzmA00
5BSKA 3O7MA 2H06A 1G2PA 4S2UA 4JLSA 4ZFNA 3S5JA 4IJQA 1ECFA 1U9ZA 2IGBA 3EFHA 4RABA 1A95A 1GRVA 1OROA 1ZN8A 4Z1OA 2HCRA 4RACA 4RANA 3ACBA 5BQOA 1ECJA 3MBIA 5KAMA 1A4XA 1AO0A 1G9TA 4RQBA 1XZ8A 4QYIA 1QB8A 1G9SA 1QK4A 1A97A 1NULA 1VSTA 2C4KA 1P18A 1I5EA 1ECGA 4QYIB 1XTUA 4RHYA 1DQPA 1BD4A 1P19A 2PRZA 4RAQA 3OZGA 4RV4A 5BQPA 4OHCA 1BD3A 4LYGA 5ESXA 1W30A 1MZVA 1TC2A 1UPFA 3HVUA 5E38A 3G6WA 1CJBA 3KB8A 2EHJA 2H08A 4P86A 1NONA 2JKZA 1R3UA 4RHTA 4X45A 4RQAA 2FXVA 1WD5A 5EUCA 1JLRA 1XTVA 1Y0BA 2XBUA 4PAWA 1XZNA 1I14A 5JSQA 4P82A 5IAOA 1DKUA 1ECBA 3DAHA 3M3HA 1QK5A 2JBHA 3OHPA 3QW4B 4RHXA 4RHUA 1A96A 1QK3A 5JV5A 1I0LA 1D6NA 1P4AA 1ZN7A 5K51A 3NAGA 1STOA 1HMPA 4WN3A 5KAPA 2GEBA 3GGJA 1VDMA 3DMPA 4M0KA 4WMLA 2E55A 1UPUA 3DEZA 1Z7GA 1DQNA 1XTTA 3MJDA 1I0IA 2PS1A 4MB6A 4LZNA 1BZYA 4P3KA 5HKLA 3H83A 1QCCA 1ZN9A 3ACDA 1YFZA 4LYYA 4LZOA 4M0PA 1O5OA 2PRYA 4FYMA 4P80A 4PFQA 4P84A 1QB7A 1A98A 2YZKA 4KN6A 1O57A 1JLSA 3ACCA 4QRIA 5IPFA 1GPH1 2AEEA 1J7JA 2VFAA 1OPRA 3LPNA 3GGCA 1HGXA 4F8EA 4X44A 5HIAA 1A3CA 4P83A 4RADA 1L1QA 1VCHA 1DBRA 1PZMA 1P17A 3GEPA 4JITA 4P81A 4RAOA 4TWBA 1TC1A 2JI4A 1FSGA 1IBSA 1LH0A 1V9SA 1I13A 2P1ZA 1G2QA 1QCDA 5ESWA 2H07A 2WNSA 2DY0A 1U9YA 4M0UA 2JKYA 1UFRA 1L1RA 4LZAA 5BRNA 1ECCA 3N2LA 1OREA 1DKRA 3OZFA 3LRTA
chains in the Genus database with same CATH superfamily
1XJCA 3VR4D 1QS0A 5D1HA 1LNZA 1V7QA 3AFHA 4IMRA 5IK2A 5LVAA 1XDWA 4A2QA 1A2BA 1QYVA 2ICAA 4C7XA 2HA5A 1MO4A 4AZ0B 2PYZA 4ZVLA 5NLLA 2X0NA 3EVEA 1XZDA 2BCGY 3A28A 1WCIB 5JAZA 5ILOA 2I80A 5AIBA 5I7OA 1N3BA 5EEGA 4C78A 2RBKA 1DCMA 3QVGA 5ARCA 2YYZA 2KSQA 3OT1A 1PD0A 3EAQA 3U1VA 4XDGA 3G88A 2XMCA 1XZPA 2ZRFA 3PLRA 3UV6A 2DF8A 4KNVA 4FLMA 2WSLA 2J7PD 2XD9A 4YJ2F 1VL5A 3QLUC 2V8BA 1UC4B 2EAUA 3EBLA 1UKAA 2XZOA 1DP4A 4LOHA 3RC9A 1G8FA 4G0MA 3BBLA 1I6KA 4PQRA 2G17A 4RTNA 3NM6B 3EPJA 4AY3A 1ZR2A 1V16A 3JRXA 4MS4A 1M0WA 1FQOA 1MV5A 3CX6A 2LR0A 1XXHB 2WDZA 3BGSA 3K7EA 3P5SA 3PD1A 3QPBA 1D4FA 3W0LB 1MAUA 4LSZA 1BDHA 2X2EA 3TLYA 2WPNA 3GAZA 1AURA 4ZC1A 4KE9A 3MUOA 1P62B 3FHJA 3CA8A 2ZAYA 3DV9A 5JAMA 4FZ5A 3L8CA 4IIBA 4LRUA 4HQOA 2VHYA 2DWQA 3PEWA 1IBCA 1K6IA 4MUXA 4KVFA 3LD9A 1NR5A 2HA7A 3UWOA 4RHUA 4TMKA 5IULC 3F6EX 2WYVA 4WKBA 1E0KA 3CZMA 5KSOA 3TKLA 1IB0A 1Z6ZA 3KEFA 3T0IA 4CL8A 2PGLA 4N40A 1TKAA 5THQA 4GWLA 2IHYA 1XOIA 2OFXA 5DKFA 2GUGA 3CISA 1FTGA 3WMXA 3R5TA 1P0PA 3U7EB 3NR2A 3O2SB 1LTHR 3ZE1B 2YY5A 5KB3A 1II8B 1XJ0A 1UZUA 4IILA 3ANTA 1VPVA 3KE8A 1GQSA 1O5TA 3GW8A 1Q0ZA 2J3KA 2J6CA 2O4UX 3KYBA 3PUYA 4YEDA 3E9DA 5TS3A 4D5GA 3ILYA 4ZO8A 1NQ5A 3UJ9A 1UFKA 2A92A 3ICEA 1ACMA 1P2BA 1NPDA 1XF9A 4ZQGA 3B6KA 3IS3A 4F1WA 1J7KA 2OZKA 5IN4A 1QUEA 4Q7EA 2DB3A 3SC2A 5K8TA 1P9RA 5TT0A 3VNQA 4I4CA 1JHAA 3KXIA 5SV2A 4I14A 3VUFA 2QTGA 4LJ8A 4R7GA 1EBBA 5HE9A 5FBKA 5L6MB 3ONNA 1H23A 2A86A 2JLQA 3CX3A 4G5SA 3DUFA 4HGPA 4AC9A 4CI9A 3QX7A 3AEXA 4JGIA 5IJ0B 4WOCA 1F7UA 2W83A 3UJPA 3SU8A 1KHTA 5JOQA 2WNSA 2JI6A 2I55A 4LNHA 3U3ZA 2BEWA 3BMQA 4K6KA 4ZYVA 1J39A 1DEKA 5E1MA 3PQ3A 2ANBA 1TQ8A 4LMBA 2A0XA 4LZAA 5EKTA 2FEWB 5LQSA 2IV7A 3CTMA 1LSOA 4F4FA 2Z09A 3FH0A 3OZSA 5KTNA 1W4AA 1EGMB 2WYIA 4DGQA 1TZKA 1VLMA 3G2PA 3IAFA 4J4TA 3AF2A 2F9MA 5KYKA 4U3JB 3SDBA 3A1VA 5CFRA 5BUSA 3L0DA 1K3FA 1O4WA 2WVAA 3DBLA 5CB4F 3EVGA 3JQ7B 5I3ZA 5A03A 4XTRA 5TGDA 3H1GA 3IP3A 4NK5A 5BQOA 4BMXA 5L53A 1HT1E 5AOBA 5AKZA 2E7ZA 4DWOA 3EGWA 3OMWA 1KGSA 3QVLA 1KH2A 4FMCB 2AOTA 3PT9A 5JYCA 5K0GA 2O6HA 3WLQA 3D1JA 5HKKD 2DKOA 1BKSB 2Q9AA 4N3GA 5FNZA 5IRCD 2C0QA 4MRNA 4FEEA 3AH8A 5CLFA 2PQ2A 2I8CA 4WFQA 4C6RA 2CMFA 1J06A 1JHOA 1W4CA 2I3AA 3DOOA 3O0TA 5DULA 4ZVVA 3UENA 2AJCA 4BMZA 4EG4A 1Y1TA 3KLNA 2WPDA 1R8XA 2CVOA 5B37A 3HCEA 1WDKA 2L19A 3L8YA 1E79D 1HC7A 1L5SA 4HBZA 3GNSA 3GU3A 3EE6A 3V6LA 1DEAA 3RIHA 2Z58A 3IPLA 1RM4A 1P7ZA 1DEXA 3QUCA 2BSXA 2PD4A 1ZM7A 3WOVA 3M6VA 4D3YA 3CE9A 1DOZA 2MINB 2N1MA 3I6QA 4MS3B 1CE8A 4Q18A 3V8BA 3RSCA 4KRXA 1EDEA 3IA7A 5EUBA 2XOEA 1NVFA 5KIAA 1JG6A 1IH8A 3L8FA 2IEGA 2YYSA 4ND4A 2MYUA 4KWEA 2IBMA 1VE9A 2D1RA 2VC2B 2PKXA 4B87A 1KFCB 2AHRA 1Y48E 4UNPA 4WDQA 3VHLB 1NVAA 3AI2A 4FBLA 5DHAA 3HBNA 4B71A 1AOXA 1JG1A 1NIPA 2ZB7A 4NNJA 4OLJA 3SR4A 1Q84A 3L7DA 4CLEA 2O5CA 4UKDA 2JGDB 4DQUA 3V1NA 5B4TA 1F51E 2JIMA 3Q12A 5HBRA 2QG6A 3ZI0A 5CFZA 4KHPB 4HYTA 2HIHA 3LCMA 4PZDA 3BXEA 3ANYB 1GPKA 3NASA 4X41A 1OHHD 3NRBA 4P1ZA 3SM3A 2QTWB 3FWZA 2UZ0A 3DVQX 1URPA 1JSRA 5AM3A 1DLIA 2P2GA 4DCOA 2ONZA 1XQXA 2FUG6 2OMEA 1XYVA 5K20A 1QHXA 2E3JA 3K16A 3RGWS 4CI0B 3A1SA 4BVAA 3FCAA 3AHEA 1OTXA 1KARA 2R5NA 2WTMA 5A0FA 5LZ7A 4O4JA 3BCRA 2JHAA 3ABSB 4ZEOA 3PQ7A 5CA0B 4RYDA 2X3YA 2JC3A 4XJVA 2F43B 2IHJA 2GPNA 1Z47A 2WNIA 2FPWA 1P9LA 2PRJA 4M9XA 1LVGA 4B73A 2E5FA 2LDBA 4B7UA 4CL2A 2HSEA 4DLVA 5AOAA 4A5OA 1GZDA 3AF5A 1VMIA 3GRVA 3I2YX 1Z56C 4J6FA 3ONVA 1RLIA 3NKLA 1IY2A 1XRSB 2AC2A 4EY5A 1ND5A 5ALUA 4B6OA 2KQUA 2LGJA 4OSPA 3V80A 4JBLA 4IDCA 3EGXA 4E46A 4KVGA 3G2KA 4PS1A 2EG5A 1WMBA 4QXAA 1S1MA 1EVYA 1N8KA 1XTKA 1U2GA 1VFNA 2O0LA 2JGLA 4CETA 1LI5A 5CDTA 4PIVA 2IOHA 1UJ4A 2GCPA 1SXJB 5K0SA 1Z5GA 1F4PA 2BWJA 2Z6QA 2FUKA 4BO4A 1EZ4A 4GMHA 5LKRA 1G19A 1QKJA 4M1SA 1BKDR 5ALPA 2PT5A 3P4XA 2CJWB 4KXWA 3RVKA 3KV1A 3KETA 2I9KA 1RACA 3GAAA 3NT2A 3RLFA 2DG2A 5JZ9A 5BNFA 4ILKA 1CF9A 4TYMA 4E2XA 1TIKA 4EY4A 1VJCA 4LDPA 1H5UA 3CRRA 3IMEA 4BGUA 4EGFA 4QJ3A 5ITSA 4W9NC 3PQ8A 4I55F 5F73A 4HB3A 2QZSA 1J0DA 2BKEA 2XE7A 4CCYB 2D0DA 3UGQA 5HVNA 5K01A 3PI7A 5EJ9A 1JVSA 2ZE7A 3PXGA 5HYVA 1PFQA 1CJMA 1QNFA 1ZFNA 1Z2CA 4S1VA 1VTKA 4R1PA 3I39X 1XWFA 2H1RA 2WT8A 3JD2A 4C4OA 1U1CA 2I6UA 3MJRA 1OOEA 1HL7A 4Z4GA 3T5PA 4P35A 1E8MA 1YL6A 3T12A 5HOQA 1WX1A 2RE8A 3VZCA 1LRLA 4FNAA 5EUQB 1DELA 3WJ7A 2NO4A 2ZUEA 2DEUA 5AW3A 1Z38A 3CPEA 2Q41A 3IEMA 4RPGA 1NZDA 1WKCA 1DRUA 2Z30A 3KALA 4UE3S 3NDBB 2YXBA 4YY3B 2PBFA 3W5UA 4ZTBA 2OZPA 3MIIA 3VVCA 4ICIA 4G5OA 2R8EA 4EFKA 3VKVA 5JJBA 2ORVA 1D4OA 1E61A 3LC1O 1OLUA 1YL7A 2XV1A 3D4PA 5TQ0B 2JFWA 2HLHA 3CBQA 2ADOA 4PSVA 2X5NA 3TH5A 4KXYA 4BNDB 4C0QC 1CY7A 2O52A 1EK0A 1DV1A 2OC9A 3L1JA 4LX0A 5BYJA 4B7CA 1GTRA 1ZI6A 1NF8A 2B4KA 5DFAA 5FR1A 3CGGA 4EM6A 5FULA 3TLMA 1JWAB 3NTQA 3JASA 3WYDA 1U31A 3PTAA 1P5HA 4ROSA 1NNI1 2GZSA 4P7GA 5LU8A 1ULZA 4X1IA 3R5KA 1WP9A 2VIIA 2WHPB 2XNHA 4RK4A 1X94A 1XAHA 5H4HA 1VP3A 3OHSX 3O3CA 2NZ8A 1AC5A 2XAUA 1IC6A 1EWYA 1OLOA 1N6NA 1YOBA 3N2GA 4FYJA 2OCDA 2ZR8A 3FDXA 4HFMA 1SQFA 1TCUA 1XDSA 4K03A 2A5JA 4CFYA 5JFGA 1GGJA 2OZVA 3F6RA 1BGXT 2PAFA 4UD2A 1FFSA 2XMQA 1JW9B 1U3GA 1Z0JA 4M9RA 1RSZA 2A30A 5DGDA 2IDMA 3R41A 1T8WA 1VIDA 1XJ5A 3LYHA 3LWNA 5J4VA 1Z5VA 2FZKA 4HYQA 2PWAA 3RYFA 2VK2A 2Q0HA 2PSEA 3K71B 5DSTA 1FSSA 2JFZA 1FDWA 1FMTA 2V7UA 2XQJA 3LC0A 3Q2KA 3K70B 1Y1SA 1W2GA 2R8ZA 4DC1A 3U0VA 3KSUA 2FSPA 5AJYA 4JJ8A 4E70A 2AOTB 3DULA 1CULC 3PIIA 5EIAA 2PRIA 2H2AA 3LKZA 1X87A 3TECE 3FOEC 2A1TR 3NT5A 4ARSA 5GM1A 3LCRA 4P4NA 2YVUA 1GKIA 3H7AA 4JVNA 3ZJ4A 3TUZC 1O95C 4WA7A 4YJ2A 1X80B 4RTPA 1A9XB 1H6BA 3IUBA 3MJSA 4ZZ2A 1MVOA 1YVEI 3P97A 3FTPA 2PBRA 3UYKA 2AMJA 4MV8A 2CV1A 4JXKA 3OJLA 1SXHA 1N2CA 3EQ6A 4O33A 5EUMA 2PX2A 1ENZA 2QT9A 4UQLA 1R5OA 3SJZA 4CF3A 3GDWA 1A97A 2JJ2A 1P7CA 2DH5A 3UJBA 5LYJB 1MB4A 4CQLB 4LF8B 1CUYA 4R51A 1OX4A 3C7DB 2PCLA 4FSDA 5HKOA 1IJFA 5JJCA 3BFXA 2CVQA 4FW9A 3PF9A 3GG9A 1P19A 3A6FA 4ZI7F 2AWOA 3D6FA 5K8VA 2OG2A 3GLSA 1JG7A 4ZJYA 1ZW6A 5IZCA 3PRYA 1E1RA 2FVYA 4RGBA 4XFJA 3FOWA 1L8OA 3N8HA 3N9IA 4BFTA 4NCBA 1Z4NA 4JCOA 3IIIA 4RY2A 3GCXA 1PV4A 3OE4A 3SSNA 2EKLA 1W19A 3WGZA 1DAFA 1RI5A 2YTZA 4AMUA 4TMTA 4C7BA 2PX6A 2QTNA 2FW9A 2XE6A 1QQ7A 1LLDA 1MO3A 2P79A 4JKYA 5HJ2A 5DP2A 1IHXA 4Q7KA 1ITZA 4ENTA 1L7QA 1U90A 1XMIA 1XBTA 4FTWA 4LZJA 1MF7A 1PUXA 2Q5IA 4XOUA 5FBLB 3QJGA 1ZOSA 2ZJ0A 3MCVA 3VKUA 1TK9A 4V3BA 1T9HA 4JY7A 2R66A 3LIPA 1OQAA 1BFUA 2JF0A 3IRUA 5AW7A 1Q0TA 3EGVA 1N5MA 3ABIA 1CY4A 1N2IA 2OBYA 3AEQA 3Q15C 2VHEA 4BRUA 4O4LF 5JATA 1FW6A 1W36D 4KR2A 3PR1A 1TQ4A 2FGJA 4UBKA 3AUYA 1E5TA 4WN3A 2CLMB 1KH3A 2K87A 4K9KA 1GGKA 1G20E 4RSMA 2Q0QA 1YIAA 2GAJA 4E09A 1YR7A 1BS2A 1EB8A 2XKAA 5ICFA 1WUKS 1U3FA 4H15A 3JQ6A 3VYRB 1DB3A 3LT2A 4AO7A 1RLTA 4DIOA 5JC8A 1XJQA 1CUZA 1O8BA 2BRUC 4K05A 3G5AA 1AN0A 3JR7A 3NIWA 1XA3A 4BNKA 2O8FA 1GAWA 1JSZA 1A50B 1NVGA 2GNPA 2HF9A 2NO6A 2OAP1 3NGXA 5CVDA 2ZR9A 4EQ6A 3UJHA 1J8DA 3MXTA 3KSBC 1ZYUA 4XEUA 4XWAA 2AG0A 4WZAB 4YFYA 2R5WA 4JJFA 1B2RA 2F4NA 1I7QB 4NK4A 2VHUA 3BB4A 5AICA 3RANA 1IHDA 3R0ZA 3CEMA 5KVCA 3K20A 3TQRA 4DA8A 4DLBA 5KQRA 4NCNA 1WO8A 3O9VA 4JENA 2R11A 4MGIR 2WQ6A 4AQ7A 1QGUB 2FLWA 5ALTA 2YN2A 1B41A 3HJCA 4LSGA 3SICE 3T9AA 2ZDHA 3QLTA 2DP4E 4YMLA 2FFJA 5CB4A 2GAAA 2XXAB 5IASA 4E3WA 1FNNA 3E3LA 4QX6A 4URVR 2QVBA 2VAPA 3CF0A 3F6PA 4UHDA 5JWOA 5ES3A 4U2GA 2XOXA 4RV9A 3WDSA 3CF4A 2B7BA 4DCSA 3OCJA 5DVZA 4WV3A 3RWOA 3CNNA 1JBEA 2BFBA 3OAAD 2Z8YA 5JD6A 3HI4A 5JHGB 2CFTA 5IN5A 1JP7A 4EHFA 2JLYA 3VNVA 1H2HA 1VMKA 3WE7A 1IY0A 1G5QA 1Z37A 2QN8A 4GBJA 4HS9A 1Z13A 3SN6A 1Y6QA 3E82A 1F6BA 4MYHA 3OLCX 2CLLB 1SIBE 3FPHA 1QB8A 4RHCA 4DRXA 2OB1A 2O2IA 1P2VA 2WI8A 1IK4A 3DEIA 3MTAA 3OSUA 1L8XA 4H7PA 4HLUA 4BQQA 4Z5XA 2FRXA 3IAHA 5KVQA 1CX9B 4JKOA 2IFTA 3IAS6 4ZCQA 3I45A 4LCEA 1OIVA 3QH4A 2C54A 3AVPA 5BSTA 2BM0A 3CMCO 3ZWDA 4D9GA 4RESA 2ZDQA 1DAMA 3QITA 2MTBA 1Y7HA 1UIMA 2J4DA 3GYBA 4H2DA 3MGGA 4OH7A 5J58A 2W0SA 2WVJA 4GP9A 1NNEA 1QLJA 1LS6A 1N0VC 1B43A 4IRXA 5BUCA 1YRYE 2NOAA 4U5XA 4X20A 4LDRA 4ZT4A 3ZU4A 1M2NA 1IE3A 2V7TA 1FVHA 3F3SA 3L5OA 4BGDA 3I4CA 5G2OA 2VRNA 4UBJA 4AYTA 3IIKA 3BXPA 1Z5UA 1YZVA 3C6MA 4EELA 5HNKA 4DXDA 2YN0A 4F12A 1R88A 4AX8A 1M0TA 3HYNA 4B5KA 1AGNA 4WCFC 4XQCA 2IHUA 4Y9UA 1ECBA 4W5NA 3CV3A 3KJIA 4OLHA 3Q7PA 1BNCA 4PLZA 3TLCA 4RZSA 3ER9A 3FHOA 4BKMA 1Z88A 3X43A 4OP3A 4B17A 2H1SA 3QEMB 3SZLA 3N2GB 4RIEA 3TBFA 4BVLA 3JWJA 3NMUF 2KE5A 3FCUB 1SC3A 5DEIA 4TMXA 1KMHB 3RDPA 3M6IA 3J7AC 2Z08A 3BCHA 4GR9A 4EVQA 4NU6A 2E37A 3LWBA 3EW9A 3RVPA 5GIOE 4LK3A 1IQ0A 1W0KA 1CB7A 1JHXA 2O8DA 2ZJYA 1XK6A 2PV0A 2B61A 2ZSDA 1CYDA 2Q2WA 2XWSA 5HKLA 5AW5A 1GL3A 5CCDA 1FYWA 5JASA 4C0BA 4ZI2A 3P0JA 2P1DA 1DKQA 4FGZA 2J30A 5K99A 3KHKA 3BTUA 3NVAA 5BNWA 1EM8A 2YZKA 2QSUA 2UVPB 1GFWA 3IDFA 1KYQA 4NMMA 2NUTA 5ABPA 3ZD6A 2LIPA 1TJPB 1BO6A 1V48A 5ALVA 5BVGA 3H8VA 3U80A 1RC1A 1YS4A 2DBRA 4UVGA 4C4XA 1MQSA 2PLNA 1JXAA 3ETEA 3I04M 1KK0A 3SIWA 3WB1A 4Z1MD 4K9DA 1XHEA 1VCHA 5FRDA 3EYAA 4DUPA 1AJEA 3ED5A 2DVMA 4RAOA 1PJTA 3O0DA 4GS5A 3T99A 4E5VA 4C87A 4Z7NB 5L4NA 4KTVE 1BA3A 4OGLA 3DNPA 3SYRA 1WVGA 2LE0A 3BERA 3TTWA 1N2CB 2ZYWX 3TAHA 3ZHBA 1JEQA 1IQPA 4OI1A 3MJCA 1RRKA 1KZ4A 4EF4A 4RZ2A 4R1UA 3OFND 2Y1DA 2CZGA 1WZUA 3RLIA 2DPXA 2MMCA 1CVLA 3UXHA 3GT7A 1N32B 1TO2E 1Y8CA 3DT6A 5LR6A 4NBUA 4Q4CA 1Q6ZA 4MKRA 1NFQA 4U6QA 1Z4PX 4I55A 4IVPA 1R5JA 3G8CA 4GUAA 1FFAA 3GWZA 3QI7A 1ZVVA 5AKXA 4QUHA 3ZWYA 5IJZA 5KC8A 1XU9A 4HZGA 2C88A 3E05A 3RYIA 2REQA 5J63A 3ZHXA 1JH9A 1TW3A 3NBZC 5KX5B 1I1QB 4CN8A 2IY7A 4AG6A 4U4AA 1B0UA 4TTPA 2Q2QA 1GXSB 1UKYA 2D5IA 3LBNA 2XR1A 4TLLB 1L5MA 3MTBA 2Y27A 2AI2A 3GLRA 3NOOA 2GZ3A 3TQTA 2RDMA 1NXTA 2WKRA 3C6ZA 1H66A 3IR5A 3FXAA 2C2OA 4HMPA 2VAMA 2GFIA 2OM2A 1YL5A 1QAOA 3JQCA 2HDWA 1NBME 1E2GA 1XROA 2FB9A 4QG3A 1VHWA 2Q3BA 2Q2VA 4AO6A 1V8FA 1SBHA 2H0RA 1YI8A 4MW6A 3B3QA 2RSLA 2Z9DA 4F72A 2FR8C 4C03A 3WIOA 3CKKA 3HYRA 4P4LA 2Y6VA 2ZLBA 3UF0A 5LBTA 5C8VA 1OXTA 3HB7A 1CUJA 4A6XA 1G41A 4UBMA 4YV2A 3W5BA 1JAHA 2XMDA 2BJVA 1IZ0A 1FFXA 1AB6A 3F4KA 4L8LA 1R0LA 3WRVA 4MJXA 2BFCA 4G1UC 3OZUA 5JSQA 5IAOA 3RNOA 1DKUA 3KQWA 2EFHB 3OPXA 4TS4A 2YWRA 4P53A 3O3MB 5FJJA 4EH1A 4EVIA 4EQ6B 4ABYA 2WF9A 4KQXA 2EQBA 2WIAA 3FZEA 3GFSA 4U7GA 3W9SA 1AK9A 1IXKA 1XP5A 1PHRA 1BVRA 5BPFA 3NHRA 4PSDA 5TQVA 3PL1A 3U7FB 3EH1A 2QAGA 4GOMD 5D01A 4FUQA 1SUPA 2NG1A 1ZIDA 3HS3A 4NFLA 1Y34E 4PCLA 1MAHA 2FQQA 2WTEA 4FCTA 4LE0A 3I83A 1GCGA 1JILA 2HQ1A 2WWGA 1MVLA 3C5CA 2YIVX 4Z4QA 1LLUA 2C2YA 2CF5A 3HLYA 4JC8A 4YLYA 1UFQA 2XCIA 3B8EA 3EEIA 3QI2A 1X70A 3JQEA 4JOBA 2WFLA 2HM7A 4KQCA 1Y63A 1ZOLA 2Q3CA 3DMTA 4DMMA 3N7UA 1F3LA 1LTQA 5CK5A 5AXAA 1UOEA 4ROTA 3E8MA 3HC7A 1JTFA 3OC6A 1H8ED 3HHEA 5B7GA 5AKGA 2RH8A 2AI1A 4NFYA 2V0CA 4YI3A 3G13A 4ARZB 1XD2B 1M1YE 1X7HA 3LE8A 3DEKA 3CEAA 1NF9A 2HGZA 3PQCA 5EXEA 4IDPA 3VH1A 2ZM5A 1QH1A 4MMZB 1TCAA 1LBHA 3O83A 1W36B 2BBTA 3NYRA 4M8SA 2W37A 3A4NA 2JCBA 4DRXB 2TMKA 4DXAA 2X5OA 2ZIVB 1NXSA 1VKHA 1LBTA 3M6XA 4WL0A 1GR1A 1TYDE 3AMVA 3OZFA 3RO7A 1CVRA 3WMWA 3KYIB 2A9PA 4KC0A 4LE1A 5DISB 2IYYA 3MRVA 3NPAA 4TKLA 2B2NA 4YTEA 3F97A 4IM7A 4G3XA 1SZDA 5J5VA 3VC2A 4Y1FA 1XPRA 2VHWA 1U0JA 1DCFA 2IYAA 4MVJE 5BSUA 4EPTA 1UP7A 1VIVA 4GPIB 1DKPA 3TLJA 4UNNA 1N3LA 3IDZA 1AU9A 1MA3A 1WP4A 2PQMA 3W9YA 1ZH0A 5KOYA 4E2ZA 3ZR4B 3LDAA 1O94A 3SX4A 5A5DA 1UODA 3UMBA 3UUEA 4KH0A 1GRCA 2H85A 3KAKA 4X20B 4MQEB 5BW5A 3PFBA 4YAEA 2XI4A 1YQUA 2I2XB 3AOGA 3WIUA 1GEGA 2FVXA 5CCXA 3STVA 4WXMA 5EKXA 1P18A 1PUIA 2SICE 3AESA 3CLSC 5C8XA 4JH0A 5DOVA 3UNXA 3F7MA 3LQ4A 3NHMA 5BURA 4DR4B 3CUSA 3F8WA 1QBKC 3T4XA 5ES4B 3SZ3A 3HKBB 2IYXA 3AM5A 5KNCH 4DY4A 1M72A 2IEDA 4PQGA 3P9YA 3IYLW 2GF2A 1K89A 1PX0A 2X7HA 2OXIA 4Q1FA 4Q19A 4GGMX 2PKEA 1PQWA 4MW0A 3HN7A 2IIPA 1IBRA 4D9CA 2PH3A 2AMLA 2CLDX 1TADA 2VKQA 1UBFA 2HJVA 5FAXA 3LLVA 1PVDA 2B2CA 3OLWA 3TLKA 4LF6B 2JARA 3GGGA 2RD2A 4KMMA 5BP7A 2IP2A 1LFDB 3LA8A 4G65A 1DUVG 1CTQA 3ZQ6A 1N1EA 1LD3A 3PNVA 4O4LA 3D5QA 4R2WA 5CTJA 1K7FB 4QWWA 4WZBE 3DHVA 3ORSA 4E21A 1KIFA 3DDWA 4Y2PA 5A9RA 5CTAA 3WBJA 4JX9A 4DCNA 2HCBA 3MGBA 3O8NA 4M37A 5GOZA 3IJ5A 3EXAA 1DOHA 4WLFA 2R60A 1UXHA 5FDFA 3D54D 2WQ7A 1PT9A 3CU5A 4PVDA 6YASA 4LUCA 5K6AA 1IN5A 3HXOA 3U44B 3EG9A 3VPXA 3LZCA 2AF4C 3AG6A 5JCJD 1P1KA 3FAZA 4H7EA 3H9QA 1EM8B 4RTRA 1JQEA 1R00A 4LXGA 1UC9A 2C9OA 2QMEA 4RZQA 4AZVA 2XT6A 1XCLA 1V1MA 3OX3A 5CNKA 3W8DA 1Z4KA 1KO4A 3JARB 3EBOA 3HDQA 1PJ8A 4N39A 3HL4A 4FQ8A 3V2UA 4DLUA 4PC3A 1F6DA 4QUJA 2JANA 3MOGA 3AUSA 4J1QA 4BU0A 2AKEA 1ULBA 1ORTA 1I10A 2Q4RA 2H1HA 4MYDA 4OBWA 3UAZA 1R8QA 4KITB 4MPDA 3TMAA 1YT5A 2MR5A 4HGQA 4L0QA 1RPZA 3AVVA 1XVAA 3SXJA 4JQOA 4TWIA 3WBKA 4EW2A 3D5TA 2W6JD 4FN4A 5B4UA 1D5CA 3UW1A 1OA1A 3EVCA 1GADO 4CKXA 3BF8A 3TLGA 5KWEA 5FYDA 1L7PA 3U5TA 2J5BA 1IY9A 4PV7A 4E4TA 3TGWA 2YUTA 4NCXA 2DPMA 4S1NA 3H6KA 1T5OA 3B82A 1KFBB 2Q5CA 3BSWA 3DEHA 2DBVO 3KZMA 4A8HA 3MHTA 4CKCB 3IAM1 1XNGA 3ITDA 1A9PA 3E53A 3CY6A 1KK2A 4PG4A 3ISJA 3LP8A 4KGVA 2FPMA 1SBTA 3BTOA 4BWVA 2ISSD 4RGVA 3T1HB 1NW8A 5K8UA 3RODA 3RYIB 2OCBA 3RVSA 4GLOA 1FBNA 4O2AA 5TQJA 3PHJA 4LXHA 4HNAA 2UXBB 1OGYA 4G0ZA 3W06A 2WJWA 4V0LA 5A4IS 3IBGA 1TYCA 3FRJA 2XBLA 5C7YA 2ZTUA 1GQFA 3EC1A 3KJNA 3LT5A 5DXFA 2I22A 1EP3B 1X9HA 4WK2B 4DQVA 2XWQA 1TK2A 1U63A 3CZCA 4S2UA 1D2AA 1IB6A 2PX4A 8MHTA 4ZO7A 4L6IA 1M1NB 2FNAA 4WLOA 5JMWA 4UZSA 4GMFA 4ZT3A 4BEVA 4H4EA 4I1IA 4MQFA 2GBLA 2WMOB 4RABA 3RRJA 1FP2A 1CY1A 3CH4B 4XI9A 1V6SA 3PEYA 3HU5A 1PR5A 4HDKB 5G0TA 1TVCA 2X3FA 3FJOA 3Q5DA 2K2WA 2NLOA 3ET4A 4YECA 5T41A 3FDFA 2EDAA 2OG1A 2B6HA 3CONA 3L8GA 2VVTA 3ROKA 4PCAA 1ID8A 1I5EA 2E21A 3EXHB 4JSRA 1X8JA 4WVLA 2QG9A 4HGZA 1QZTA 2AEMA 2BHNA 3K8QA 1P31A 1P80A 3K6JA 3OA0A 4XLZA 2BFCB 4N0MA 5GONF 2OQRA 1I24A 1HF3A 5KKNB 2I0FA 2AG8A 4H4DA 3T3IA 4MW2A 2BGLA 3CIFA 3S55A 3VJMA 2O0JA 4ARUA 1W30A 3Q88A 4G24A 4ASUD 1CD5A 2GS9A 1NV9A 2B1GA 4UU7A 5IVKA 2WM9B 3L2OB 4FK8A 4RH0A 2HKIA 3B6EA 2BTOA 3HU3A 5KWSA 1Z2DA 4K9PA 2BM9A 2X9VA 2A6PA 4WESA 4ZHQB 2XGJA 1H1TA 4HXYA 2IYPA 4M7OA 3RU9A 3GLIE 1NJGA 3TRDA 2PAAA 4OHXA 1GARA 1GZ4A 2OHJA 1CUBA 1ZVQA 2Z8ZA 3NIFB 1NBAA 2IS2A 1N77A 1MG5A 1XE3A 1F3OA 1SCUA 1ODJA 2B9EA 1HORA 2RHHA 3AUJB 4JWKA 3VAZA 4BZZA 1BWQA 3EOBI 4JEIA 1A72A 2BGWA 1EE9A 1G6KA 1SQGA 2H2IA 5EHNA 5FLXA 3WTBA 4X95A 2DE0X 3UB2A 2AG1A 3C5WP 1KMMA 4KLAA 1R0BA 2EQ5A 4UFNA 1PLLA 2NU6B 4PRLA 4OHKA 1EQAA 3WLSA 1OZ0A 5GZ1A 2P9GA 3PE4A 4FDVA 3AI3A 4ETIA 3BM5A 3QFHA 2PPLA 3NBAA 4GC9A 3LDHA 1F8GA 2F90A 4MRSA 2C3MA 5ARBA 3VHXB 5CDSA 1T1IA 4EUFA 2JBWA 2AH5A 2NTVA 1VG8A 3GJXC 3I2GA 2OC4A 3PF8A 4OHWA 1WR8A 4C20A 1OA0A 1FU8A 2ZS8A 2ZU0C 4BN4A 2W6NA 2QLMA 2R79A 2O3SA 3GUCA 2WWWA 4V0SA 4F2HA 4F06A 1G8KA 2OORA 4KQFA 5HW0A 4H18A 3LHKA 3VTFA 1SU6A 1SXPA 1QF9A 5TF4A 1UMBB 2PRKA 4U7JA 1JJAA 2ZR0A 2N3ZA 2VPIA 1F8YA 2YMPA 3AKDA 3JTMA 1WXHA 1PO7A 5C5DA 2YN4A 3O74A 1PJBA 3DWGA 3GYGA 3NM4A 3P2YA 4NZYA 4UASA 3R8XA 2HSJA 2YMQA 3IEPA 4LPSA 3IJRA 4XGRA 1EE1A 5FOVA 5HQJA 2CXRA 2ZXFA 5B7NA 1QF6A 2HSWA 4YMHA 2H9AA 2YCBA 3OE5A 1DAIA 5D3MB 4B4UA 1EK6A 2WWYA 3UBMA 3WLJA 3OURA 4EZIA 3GA5A 4FJ1A 1V2GA 2IHKA 3ONEA 3KPYA 3GELA 5EP2A 1ZJYA 3HPQA 5MN6A 2PZGA 1QOQB 1K63A 3DAGA 4RWEA 3HA5A 5IJWA 3D6JA 1KQGA 1Z5OA 1C30A 5T57A 4BC1A 3CEHA 4BYMA 3T9EA 1P45A 3FG9A 3W7BA 2XCSB 3S28A 4M9QA 2GNOA 4BLPA 2XJ9A 4HWSA 1PSDA 4QG7A 2UZAA 5BWLA 4LG1A 2DHCA 3SMVA 4A2PA 4PW0A 2QTCA 4CTNA 1ECJA 1NF3A 5E6UA 2XUOA 3UB3A 1C41A 1WY7A 3P71T 1Y3HA 1G6OA 3E84A 3GEIA 5LN1A 1Y6FA 1MW9X 3D4NA 2IUEA 4CR7A 2AZ4A 3OCVA 3NAZA 4MMXB 1E6LA 3LT1A 3IOMA 2Y8EA 4IIJB 1VL6A 3WISA 2XRZA 4TTRA 4KIWA 2FFQA 1U4OA 3OU6A 2QX8A 4NG4A 3VJKA 2J0UA 5B7QA 2BTEA 1D4AA 4JD5A 5AK0A 3LQKA 1BMDA 3DD5A 2R6AA 2GBCA 5B1DA 4IDGA 2EZTA 4N4AA 1JIXA 4RIGA 5JY6A 1U2SA 2PKYX 5AJXA 2J59A 3FVQA 4H0FA 5BSMA 4BEWA 4RTKA 2H4WA 1DZIA 2QX9A 4G5RA 4IOLA 5K8CA 3C98A 3COVA 4PHCA 3LKVA 1RI2A 3M1LA 3M0EA 2YWDA 3WZ2A 1GG9A 4Y6GB 5AKKA 3VOSA 4NE9A 5CB6A 1PL7A 5AM2A 1RWVA 1K1EA 3GJZA 5JUWA 3GLFA 1UXJA 1ZL2A 3ZZTA 1E9AA 1XTBA 2DSNA 5DJ5A 3EBPA 2DZDA 2E85A 3M6WA 2V6FA 3D9QX 3E03A 1I14A 3VV2A 3VDXA 3R0JA 2ZRHA 3ESDA 3R3VA 4B3MB 3L49A 1M2FA 3G9QA 1E32A 4X85A 2O57A 3DMNA 4BX9A 5HDQA 1F5SA 5CYGA 1G4UR 1AO3A 1Z26A 5L95A 4MVCA 4C0SA 1GQQA 1UMDA 3EGDB 1GTVA 2FMUA 2GZAA 3FUWA 2MR6A 5AHWA 4G8BA 2C5FA 1KWGA 2P4HX 3QSYA 1UZAA 4FKMA 4JNKA 1XI2A 3UA4A 1B93A 2YCLA 4I5FA 1RQGA 1Z5PA 2A0UA 1UK7A 3W6NA 1FB5A 1UEJA 3LC7O 5JWRA 2Z2YA 3ND7A 3I37X 4BAUA 3LPLA 3GB9A 4XEHA 4EAAA 3ME5A 5IC6A 4REQB 4DA7A 2PSDA 5CFMA 1X1RA 3JAKB 5JD5A 3GOHA 4NEQA 3N0TA 3OUTA 4O2AB 4PGMA 5M3BA 3VX4A 4FGUA 3WLTA 3VKGA 1IUNA 2QZ4A 1Q16A 2QX7A 3PGLA 2QRQA 4GP7A 2IXFA 4TV8F 4X94A 4A8JA 4AWBA 4PBTA 3DSRA 4BV2A 1UT5A 1TUBB 2JASA 4OXYA 3A1EA 4Q7LA 5A3QA 2I67A 4ZMBA 1DMRA 2EC5A 1VE1A 5I5GA 1NL3A 3ZD8A 3I62A 2MSWA 5L6LB 5I9BA 4FKBA 5TRTA 4YJ3F 1DHTA 2P35A 1H4QA 4XYBA 4V2IA 3PFIA 2PLAA 2C5AA 3H9JA 1WUJS 1Y42X 3KT6A 4U7TB 3MEQA 4EG6A 5DV9A 2VH1A 2H4XA 5TQ2B 1KKLA 4JYBA 1NJ8A 1YIOA 3R3HA 3FPGA 4LRXA 4IEIA 4U00A 2BW0A 1HA3A 3O6VA 3F47A 1IRIA 3OOSA 2IP1A 1IZYA 5FOSA 3Q8WA 4GXTA 5HKAA 1LX6A 1O97C 4UAVA 4L4UA 4MV0A 5F98A 1M7GA 1PVVA 1ZK1A 3RIGA 3RT7A 1Z0DA 3PUVA 4JI2B 3EF0A 3ROZA 1Q0PA 3FHCB 5ER9A 2DETA 3IURA 4TWJA 1H42A 1SCAA 2ZRDA 3DE5X 1NT2A 3FFWA 4L8GA 2V6BA 4MRMB 3VX3A 3O8OA 1M2KA 4HS4A 4LFCB 2IZ1A 5D85A 4FHCA 2VTVA 3NJ4A 2FX3A 3TPZA 3ZXYA 4ZYTA 3AB3A 4WKCA 4RMGA 5L7TA 5EP1A 4I7EA 3DA8A 5CLGA 3AUXA 4AMGA 3HKDA 3KZ1E 1BOFA 4LA4A 1OH5A 5EVJA 3NEJA 1SH7A 1THTA 5CXSA 1T9DA 1E63A 3TR6A 1PQ4A 1T1RA 4QYIB 3ELUA 1SCUB 4ZP1A 3VPBA 5H59A 4M49A 1ZD8A 2XUGA 1GAQA 4N3CA 4Q3AA 2DFLA 2XSZA 1G3QA 4RELA 5L3RA 1M73E 1LJLA 2K4MA 4B9EA 1O6GA 2OYRA 1UBGA 2BR4A 4L9RA 4LY0A 3D5EA 1PE0A 2NU9A 4OQNA 4ETNA 3R5SA 2EWVA 3OM8A 1XNRB 3QGMA 5G4KB 4XUCA 2BJWA 3WLEA 2Q1WA 1C9NA 3MWGA 1O0SA 4L74A 4JUAA 3IOCA 4RKFA 2DWCA 1EX9A 3THOA 3L9XA 5HRAA 2FZGA 5KOIA 2J48A 3BJZA 5CDFE 2XMZA 2R0QC 2LTAA 4MWZA 4CEHB 1BWRA 1WMSA 2ZRNA 5EVCA 3COJA 2Q6KA 1RMTA 5B36A 1CS4C 2GLTA 2QK4A 3Q41A 4D0NA 1W5BA 2XGSA 5BWNA 3CINA 3ESBA 3R09A 1GGFA 4EO4A 3GLGE 5IARA 4FSHA 4PQFA 3LMKA 2QQEA 4QT0A 1E9CA 1UBLS 2Q2NA 2A4MA 2YHBA 4F8JA 1P4AA 4X65B 3A4LA 3KK0A 3GCGA 1ZHHA 3P9PA 1E7SA 1NU8A 1SC9A 5DTQA 4QJ5A 3EZYA 3RSZA 4PANA 3BH7A 3ZKWB 1SIOA 2VF5X 1D0SA 3DE1X 2BHSA 1JU4A 4WSOA 3HKEA 4PE5B 2KLHA 3AERB 1QVRA 4N47A 1PNVA 1JE1A 1Y3BE 2M98A 3AU9A 5BR1A 5KOJA 4IHKA 3WO1A 1XCJA 3I64A 5AVUA 1R0ZA 1FIUA 4Q9JA 2Y3IA 5LOVF 4TPKA 3VOTA 3EQZA 4E5SA 3UMSA 4UCQA 5CFOA 1ZKDA 3COYA 4IY1A 3BE6A 1ZUNA 2ZVQX 3V8QA 2JB9A 2ZBVA 3L8ZA 1GPH1 1ZGHA 1ULTA 2VYFA 4IEEA 4JASB 4TKMA 3OZXA 4N03A 4ES6A 4YUAA 4CLHA 3A7EA 1A4UA 1R6BX 1C30B 3MWKA 4RK6A 2DY1A 1BXKA 2NUAB 3X2SA 2UUBB 5IM5A 5BSVA 1KEZA 4PSKA 2ID8A 3AKCA 5T6BA 4BQOA 1UPXA 2FUG1 4N7MA 1FSGA 1PSWA 3OMLA 4TQAA 4US2R 1KQPA 1G21B 4YRPA 1U7TA 1TMOA 4UU1A 1L5WA 1E60A 4PVCA 2J3HA 4ENSA 3UGJA 4EYOA 1BXZA 4XFDA 5FHQA 4RMNA 3CVUA 1QRSA 4ZVNA 1N4AA 1Z83A 4Z8YA 1J2EA 1NVVQ 3CF4G 4DYDA 1E1CB 2VTBB 3FJ1A 1TA0A 3HB4X 4HH0A 3S68A 2GK3A 2J85A 4DABA 3SJUA 2DJ5A 3QYAA 4IIVA 2J0UB 4WNAA 3ZWNA 5EMMA 4FOTA 3V1MA 1BH2A 2P90A 1QAQA 1P3DA 4MPRA 1MCZA 3UAYA 2VNKA 3OY2A 3ZHVA 5JSUA 5GONA 4KQ1A 3UXYA 4BIMA 1MOQA 2GJ9A 3E9RA 5TIIA 4QEZA 3ZJYA 4Q9AA 1DAHA 4JC5A 3PKJA 4FILA 3WK9A 1SRRA 4OBEA 3MTGA 3UB4A 1FLNA 3MWDA 1VYTA 4JX8A 3DE7X 3K8ZA 1GNSA 4YONB 2HDNB 2XQIA 5JJLA 2BDTA 2J6BA 4KREA 2AUMA 4G01B 4NBLA 4BGVA 1GZVA 4IS2A 2PM8A 3E7XA 5I4CA 1RBZA 3EZGA 3G89A 3GJQA 2HNAA 3U6BA 3K1AA 5FV4A 3FPSA 2AN9A 2UUPA 2VHXA 1WB9A 1OVMA 4B6EA 1YZ3A 4QYTA 3JAMA 1P44A 2OLEA 1GA1A 1UDRA 2G77B 4PNZA 4WBXC 3LECA 4CNQA 3EASA 3I9V6 3V4ZA 4H6VA 2CN1A 3C70A 2RK3A 3AFIA 2GSDA 4MVJF 1HQKA 1HDXA 4W8HA 3BMNB 4CODB 1JTVA 3UM9A 3VKHA 5ALLA 5ICEA 2CNWA 2PWYA 2VAVA 1K0FA 4HQFA 4M2LA 4R1MA 3EGEA 4NMHA 4W6QA 4IYRA 4P08A 2YWJA 1B42A 1ZNWA 5CR9A 5FWYA 1RYHA 5CAEA 1TTQB 1T8PA 3CVWA 5MF6A 4R41A 4Z3KA 5DGTA 5EWMA 3UIEA 4F3YA 2Q1SA 1A8SA 2YUIA 3BWCA 3HJBA 3MLAA 4KO3S 4XVHA 3O2QB 3IUPA 2FEOA 3M8KA 1Q7BA 2ZUFA 4NV0A 3MYRA 1E2NA 2OK7A 4MGYR 1VOTA 3SFZA 1CUGA 4B43A 2JLXA 1L0BA 3RADC 3ASZA 4WLUA 2LXNA 2O07A 1PJSA 2OCPA 2ZB2A 4UEJA 4F4IA 2FCRA 3SDZA 4IZIA 4F92B 1WNFA 1PEDA 3N59A 1ISHA 5DBOA 3GVPA 6LDHA 1Y8AA 1N2SA 2HUNA 3LHDA 3T7JA 4RCYA 1ZK3A 2QUAA 3MB8A 4QDXA 2ECFA 3JTEA 2XUFA 3ICOA 5K4AA 5KQLA 3LHIA 1N5DA 1VCOA 2CMGA 4F93B 4OQEA 1D1TA 1VYHA 1JE0A 4H31A 1M54A 3JATB 3PXUA 4MYRA 4KQWA 3WMEA 1B16A 4KN6A 2NVUA 4QGHA 2HX1A 2V3VA 2ZWIA 1GSIA 4GPBA 3ZWQA 1YJXA 2YQ5A 2EEPA 5KYVA 1YE8A 4TSFA 2F7SA 1U5BA 2HF8A 1YKFA 2WAAA 1PGOA 4QBGB 1Y37A 4HDOB 3IPRA 1MV8A 4P32A 3ESYA 4JITA 3EVBA 4YJFB 3SEAA 3O8OB 4HUJA 1P2GA 3S5UA 4DFDA 1TK3A 4LMRA 4RXUA 3BRWA 4JI3B 2IHVA 1OAOC 5CFLA 3WAKA 3HO6A 3QF4B 2IPXA 4KXNA 4UARA 4US0R 5DW0A 2NSHA 1JB9A 4KRGA 4E5MA 4YALA 3OLXA 3R76A 1QTNA 2E4WA 4FR2A 4C6TA 2HBRA 3HKDB 4L22A 3EZFA 1AQJA 4YRKA 2W8BA 5LSAA 4NHEA 5A1JA 1U2EA 4J0IA 5IFKA 2VBIA 9GPBA 1YTUA 3UZUA 4PYJA 2MU1A 2FHPA 3PTLA 3OH8A 1JLKA 1HTBA 1UKCA 3DF9A 3QJ5A 5J47A 2EU8A 2NUPA 2R00C 2IUUA 2YW2A 1I6MA 1G3UA 1YV9A 2QA5A 1HLDA 3WSTA 4Y98A 1P2FA 1C1DA 3URMA 5DDIP 3G49A 3VR6H 3MBIA 2DTXA 1U6KA 5H9WA 2GYWA 1K2WA 1KIMA 5J5CA 1E1QD 2QTRA 5BSEA 1NW9B 5B3AA 1Z6XA 5IUNC 3AEKA 1YZTA 2WA1A 5FLKA 5BSHA 1XTUA 4GPAA 1QRAA 1YBFA 2EX1A 1G3RA 1M1XB 2J9FB 3D1LA 5DLPA 4QU0A 4HAWA 2VT3A 2WM8A 3HA7A 2I4OA 3JQBA 3PDIA 1N7HA 4NFHA 3VR3D 2G0NA 2I3DA 2NO5A 2WPDD 1TJ4A 3DCIA 3DE3X 5JYDA 3QG5A 1RHJA 3GDOA 5PNTA 5JO9A 1PNTA 4EL0A 3QUQA 4CDMA 3ZUPA 1VDZA 2VRCA 2AJBA 2MCFA 3L6CA 3KKNA 5M04A 5JW6A 4P7BA 5BUZA 4POOA 1EBUA 4I50F 2JJQA 3UOWA 2CW5A 2IOYA 4Q05A 3WDMA 5A62A 4ENVA 3HDHA 2IRWA 2WY2D 3CB4A 9ABPA 1JR3A 1MHTA 4YMIA 2NSYA 4G4GA 4D1YA 5JS8A 1QZUA 1DX4A 3JQFC 4BLWA 1DWUA 1F0YA 1XZHA 3BRQA 5LQRA 3CRMA 4YI5A 5REQB 2WUVA 1UQTA 4TRRA 1SKMA 1CUFA 3ZHCA 1T2EA 1LDMA 2ZVPX 3I58A 1O4VA 1BOOA 2QE7A 2WLSA 1OAAA 2Z9BA 1GG8A 3D6AA 3N76A 5CHEA 4WE3A 4RIFA 4KX5A 3KCNA 1ZN7A 4G86A 2XKKA 3I01M 1T36A 3HJFA 2XDQB 2BF4A 4ON9A 3PPVA 4TV8A 3G0GA 1GILA 4FPXA 3ZD9A 5A5FA 3QMWA 521PA 3PYMA 4DR2B 2HWKA 4EP1A 1EVQA 3VU8A 2SCUB 4HAUA 4AIRA 3KQHA 1UKEA 3E70C 5LM3A 1FK8A 1SUCA 4LXIA 4YJ3A 2YWCA 2WICA 1EFVB 4F6RB 1YDWA 1D2MA 4Z4HA 4XQEA 2IS1A 3NTRA 1JLSA 3KWJA 3SYLA 1EHIA 1E20A 1SCKA 4ZOBA 2XDWA 4L3OA 2ZIZA 1QIMA 1JBQA 3D7LA 4OIFA 4NXMB 4MSUA 5FWXA 1NP6A 2IU6A 3ORHA 4OHZA 4YT2A 4F8EA 5JANA 1H9AA 1G8MA 4HK4A 4C9BA 3HQ4O 2J8ZA 3E35A 5JEDA 2H6EA 2PUDA 4BN0A 4EB0A 3VR5A 2X13A 2VZ9A 2I4NA 1ZEJA 4KQGA 4MGEA 5LZ2A 4TGLA 2IUFA 1XELA 3UY4A 1I4DD 2ZSHA 4M4SA 3BK2A 4EENA 1OWOA 1GPDG 1WZIA 4EEZA 4P4SA 1CYEA 3SS9X 3FTDA 4EX6A 3W5DA 2ZIXA 4K9LA 1SG0A 3VBCA 1L7DA 3TZQA 4YJHB 3QIVA 2E6KA 5LMUB 1Q11A 2G71A 3RBVA 3L02A 1GAJA 4KKXB 5BMVB 3T35A 5KNCA 3QX9A 2ZR7A 4TTVA 1LPAB 1QO0D 4HX9A 1W35A 4KPFC 5IS2A 4IG4A 1ZD3A 4K1XA 2VN8A 5TJ9A 1J20A 1L7VC 3AI1A 5E7MA 4O4IF 3LBIA 5CXXA 2A0KA 2DGDA 3GEGA 4IDDA 4OCZA 5C81A 4N12A 2P2LA 3W5CA 5IKXA 4QQ8A 3P20A 4PNPA 5IM4F 3GUZA 2HDOA 4YRTA 1QKIA 3EXFA 3KVYA 1EDBA 1VL8A 1X74A 3MMXA 3R6LA 1CUCA 1I3CA 1QTRA 4WLNA 1T0HB 2WM3A 1NPTO 3GUYA 2H16A 4OJNA 3KLMX 2MSKA 5LA6F 2ODTX 1JQJC 1KI6B 1X38A 4O2LA 3LT0A 3RHZA 3ENVA 3RM3A 2I4LA 1M1ZA 1JR6A 1VJDA 2OE2A 3SKXA 1ECGA 5LIPA 3HR8A 1CEYA 4I1SA 1YHYA 1USVA 3PITA 2ZBQA 1C2YA 1RMQA 2IY8A 2AFVA 2FGKA 3BIXA 3DZJA 4OLBA 3F90A 4FYIA 2GK4A 4OPMA 1YVPA 2G80A 1TXGA 621PA 2BKXA 1I4TD 4YP5A 1NE7A 3AC0A 1XZQA 2XZDA 1QONA 1D7OA 2FPRA 4DDTA 4AD8A 1W75A 2R6DA 1W0CA 2DR2A 3EVNA 1UBCA 1FFHA 3GJ0A 3KQYA 1K92A 3UW3A 4P2GA 1OXBB 3TNDA 2EERA 4DAEA 4I08A 2RC5A 2JGKA 1H2XA 1N6HA 1CT9A 2CGEA 4RYLA 4Y2JA 5CEJA 3IAS1 4U7FA 2PMBA 4AMZA 4Z53A 1T4CB 3ZBTA 4O2BA 4UZFA 1ISFA 4QU9A 4J7CA 4AG5A 5G1PA 3HCAA 4L5YA 2Q1YA 4PAOA 1PCXA 1JZSA 3LP5A 2ODQA 3ANLA 2WZCA 3KOZA 1NM5A 2GPSA 1A77A 1IPEA 4K6CA 3MAAC 1YS2X 4NS4A 3VZBA 3NOQA 1XF1A 2B34A 1YZQA 3ZHQA 3VXKA 3MSXA 2NVUB 4HT3B 4HXFB 4IOKA 3KELA 4ENRA 3HEAA 3KSAC 2A1TS 2VCYA 3C0KA 3WL7A 4QFDA 3HB1A 4PSCA 5CM9C 1U5BB 1LWNA 4OBXA 2YBEA 3PFNA 3VU3A 3EQ9A 4FXOA 1N5JA 1IOWA 3MINA 1UJCA 3V97A 1H4TA 4G0WA 3KR1A 1RCFA 3MBKA 3MWEB 1MAVA 4D99A 5DK4A 1HI9A 4PYLA 1E18A 2Q5QA 2ZU6A 4LGMA 4N5DA 5C4IA 1VQ1A 5HE8A 4LCBA 4Z8XA 5AQ1A 4L5CA 2QJWA 1XRQA 3H0CA 4EECA 4RC9A 4OFZA 2VNIA 2HSDA 1CZOA 2X0FA 3BXFA 2PMCA 3MMNA 1AHIA 1LX7A 3MW8A 4R9UC 1D04A 4PG7A 2YW9A 3KQSA 4GI1A 2I1QA 5CYFA 1DRWA 2HBYA 5SY4A 2HZBA 5KINB 4OXKA 4DM4A 3FFBA 5ALFA 3Q9UA 2BZSA 3UUWA 1YTLA 3SIXA 4CTKA 3M2PA 4CEJA 3IXMA 2QZ9A 2J0SA 2V5UA 3MUFA 1DJPA 3RUAA 4HZUA 4BNHA 1K8YB 5DGXA 1HETA 1J5PA 1JV2B 3K53A 5BN1A 4Z3OA 5JARA 3QX3A 5CCBA 4LHWA 1RLOA 2ZQYA 1Q3KA 2W43A 4ZYXA 2R8PA 2ODNA 4MKFA 1ZD1A 3MLEA 5AHRA 3C15C 1Q5PA 4JT2A 4EG5A 4RTMA 4YMSA 4QGAA 3LY8A 3WQRA 5SZIA 5JFOA 3UK6A 2CC2A 1KO5A 1J5XA 1NHGA 4C29A 4J0FA 2G07A 1E8NA 1U7HA 3B9PA 4RQBA 5G53C 3U7QA 5BSFA 4K8OA 2GSWA 2VYNA 3EH2A 1CY2A 4L5JA 3ZBUA 2G7ZA 4U9UA 1W2HA 3ZZ1A 1IN7A 3EIHA 1OKKA 4BFZA 4BRZA 4JYAB 3IP8A 1RT9A 1C3VA 1ZITA 1BCSB 3NHAA 4EZBA 1QQBA 3TDNA 4TRNA 1N6KA 1FTSA 3GLHA 4L2IB 1KDPA 2Z2IA 2XTZA 4RVSA 4KDFA 3THWB 2XBMA 1J49A 4LYGA 5ESXA 4Y67A 1RZUA 2DR3A 3PCTA 3VPGA 2X76A 1QX4A 3PIRA 4HX5A 3EA5A 3IQIX 4RKYA 1ZD2P 2E4ZA 5JPCA 4KJZA 5CG2A 1HEYA 5CITA 4E13A 3GH1A 1XKXA 4K1LA 5DI3A 5BOVA 4B3FX 4BX0A 5FEUA 3QEKA 4B84A 1K7SN 2F64A 4BCDA 2PA0A 3NKFA 4Y0NA 3THYA 3TRHA 4GEGA 3R7LA 1M0EA 4RPLA 4QTUB 4XGKA 1QFMA 1G59A 4KFCA 3GA0A 3H97A 3LWZA 3O91A 1KDZA 3W8NA 5KOHA 3W05A 2IE0A 4J16C 1M75A 1QK5A 2AL7A 3W90A 2PLRA 4U63A 3UT5A 1ZVJA 1UPTA 4ZU3A 4WOBA 2ILVA 3WA6A 4AT1A 4PLHA 3IVMA 2P27A 1FQKA 1RBMA 4N5IX 1ZD5A 2BT4A 1J1ZA 2PH7A 4BQIA 4BGIA 5I7RA 2BZ0A 2P4UA 4HDMA 5ENZA 1W9HA 5E4JA 2GZRA 5FA5A 4RK0A 2JL1A 3KR0A 3OE7A 4IIYA 1THMA 4FGWA 2AFRA 2BE9A 2CEKA 1Z7GA 4CKWB 4NV3A 1XN4A 2IXGA 2JGEA 3SQNA 1TYZA 2W2LD 2BMAA 1M6VA 1JEAA 1PV1A 2X8AA 4JLNA 5DBEX 1L4FA 4P4SB 2JIZA 1POWA 2VS1A 4Z2YA 4MRPA 4CL3A 1Q0RA 4V1CA 4RTJA 2X14A 3PCXA 4KCGA 3SPXA 4PG6A 1KI4A 3T54A 2OBLA 1PR6A 2GN4A 1EXMA 2QYHA 3GHHA 3TW0A 1JFLA 3V8VA 4FQ5A 4NXNB 3LBAA 4OB8A 1Q44A 3LY7A 4H1TA 4WPGA 3L6RA 3OPNA 4AP5A 3IOEA 1JQAA 2C57A 1ZA1A 5FYQA 5D6OA 4DLTA 3RPEA 1VA5A 2J6IA 3W7VA 4I1OA 4K9MA 4C0AC 1RPJA 3RFCA 1EEXB 1XEAA 1PKEA 2UZ3A 1PS8A 5LP6C 4NV1A 1ZU4A 4BO9A 1Z35A 3NTOA 2HO5A 3BE5A 2YXEA 1SA0A 4P93A 4O02B 4WVFA 2XAAA 2JHFA 4Q24A 1KJNA 3AWDA 3V33A 5EL0A 5JYBA 4RENA 4DW8A 5ISMA 1LC3A 4FE3A 5BQ5A 1O9GA 2QLLA 3W4KA 3WLMA 3GROA 5CDYA 4BMNA 3K6SB 2O5RA 4CKZA 3NBFA 1KOJA 4M53A 2A33A 2VBGA 3QFTA 4QUBA 1S4QA 5FUQA 1W2WB 4S3MA 4BBZA 2MSCB 4PN7A 2VSXA 4GLJA 4QKQA 3L7AA 3CLUC 5CM8B 2JD1A 4YBZA 3TRIA 1ENPA 1XQ1A 1QYIA 4PZUA 3UAWA 3UOGA 3ZCPA 1E9EA 2RH5A 1MDFA 2FPPB 2JIRA 2P2DA 2QN1A 2I7DA 3KRTA 5AVSA 2LCFA 1RM0A 3BDIA 4OFWA 4KGDA 1LCIA 2OCKA 3UA3A 3DHWC 2P62A 4ZAWA 3KB1A 4YMTA 2QZPA 1XZ8A 1J09A 2A5FA 3KKPA 3WRXC 3AINA 1FFYA 1UWVA 2GD1O 3O2JA 3RF7A 5BO5A 3RQSA 4B8YA 1G5PA 4C88A 3GO4A 2CFSA 4I50A 1KBZA 3GDGA 1Z6TA 4O2BB 3V4PB 1RYFA 3D6NB 2V8OA 3IKLA 3HXQA 3R4CA 3MT8A 4QU8A 5DYNA 1C7QA 1A2QA 2WHXA 3N70A 2ZE8A 3R0QA 4HUQA 2VJCA 2HADA 4OI0A 3B13B 2HF7A 3D6UA 1E2JA 3GX1A 5JT1A 4XH9B 3CLVA 1Q6YA 4F9EA 1DAEA 2OPBA 3H8WA 4B3BA 3K0BA 2NZVG 1LRKA 3RFUA 1WSBA 1ML3A 3HG7A 4D9KA 2G25A 1GRQA 3B9BA 2X8JA 1OJ7A 1YZHA 3K09A 4GKAA 4Q03A 4PG8A 2VQFB 3A14A 1WMEA 4ZANA 2OWEA 2QM7A 3LTEA 2IV3A 2VJDA 4RM3A 1KYZA 1JLRA 2J5QA 4UVIA 1TMYA 3QYJA 2C8KA 4F45A 4DC0A 2V7XA 3K5PA 3BFPA 3DTVB 5HHTA 2RH4A 4TQUS 1O6BA 4HQKA 1CUEA 4Y8VA 5J59A 2VP9A 1G7SA 1OR8A 4I8IA 1I0ZA 1N2HA 2GCEA 3PHLA 3ICQB 1AQLA 3R4VA 2ZQZA 2D2FA 1JQKA 3C3KA 1X77A 4PXAA 1MOSA 3KOUA 1QLHA 1ORHA 1W0KD 4EATA 1GTSA 4UNRA 4ZI7A 2HC9A 1JIUA 3A9SA 1JYSA 2O3QA 2DFTA 2NAFA 1PWZA 2Z3VA 4KX3A 2HHJA 5ERGB 5B3LA 2MDTA 1HK7A 2ZI9A 1CHDA 5DTJA 3OHMA 3A9TA 1V7PC 4UHFA 4EG0A 4CIYA 3VSAA 4DIDA 2V4ZA 3MS2A 4DL9A 2E89A 4GT1A 2WWTA 1K0UA 3FFTA 4G07A 4XRGA 3FY4A 1XXLA 2RCYA 1O2DA 1E0DA 3KPJA 1DPFA 3TE7A 3G7SA 4W9RA 2VQDA 5LQNA 3SVTA 2QDKA 4C05A 1HG1A 4Z0PA 1T1SA 1W85B 2Q5HA 4H27A 3T0GA 3STYA 2XTMA 3WLNA 4GP6A 1TUGA 2CWWA 1AZWA 3OY7A 1ZMOA 1ZSNA 3L7OA 1V3QE 4RIIA 5GQSA 1AQYA 1V5EA 2PK3A 2B5OA 1I2CA 2DAPA 2ZCUA 1QZXA 3PTZA 4H7DA 3JVVA 3TD9A 1P1CA 2MIIA 2WFAA 5FO1A 5GZ3A 5HIKA 2IYSA 1MEEA 4Z4EA 2NVWA 4J9VA 3UHJA 2IH5A 3B89A 1C9KA 5IM4A 4KAAA 1MNAA 1M33A 2I03A 4LRQA 4AF8A 4YQYA 4QO8A 4IUYA 1JDUA 3AOEA 4B6RA 1R9MA 2YHSA 1PK7A 3HJTA 4HB0A 5LWQA 1C3LA 1P5JA 3NRCA 1GYPA 4YLEA 5DB4A 4AJOA 2CYCA 4ENPA 4KR6A 1DAKA 2BGKA 2FKAA 5LA6A 1X1SA 2OK8A 3BQNB 2F17A 4KXUA 2JFNA 1M7BA 3AONB 4ND6A 4BB5A 5JSKA 1MX3A 1G2PA 2VZLA 5MGBA 3RUDA 1T2VA 3G82C 1GGEA 2VYCA 2VWHA 5F1KA 5JMPA 1X1EA 3MS7A 3V9PA 5JLJA 2YKGA 3RRYA 3FOAA 1NJ2A 3NONA 2QN6A 4K9QA 3G2IA 1JFFA 1KAGA 1L1EA 5A4AA 5H70A 1TF2A 1G9TA 2QRPA 4K26A 4Q4HA 3EHDA 3I09A 5KSPA 3T8YA 3S2EA 4JJ7A 1SIUA 2X0JA 3IQDB 4RTOA 4EJ0A 1F0NA 4UUNA 4K81B 4TL6A 3NWEA 2BPOA 1J97A 1Z17A 4N7JA 4HFRA 1CUUA 5HTKA 5J4YA 2YWXA 4OL9A 4GW3A 5F7JA 4OLAA 3KFXA 1Z3IX 1QQ6A 3HE3A 3O3OB 1L4BA 2H7XA 3DMRA 1PJ3A 3QVSA 4QDTA 3HB9A 5TVGA 3SE7A 5KOHB 3M6FA 5AXBA 2XITA 4UJ5A 3RS9A 2Q7XA 1Y1LA 4NCKA 4G4JA 4N5NA 4KSBA 1S0UA 3NANA 1H3EA 5JDCA 3CO5A 3OBIA 1NI3A 3I1FA 4G5YA 5AFSA 4F4CA 2GYVA 1E8DA 3WGNA 4Y1EA 4JLPA 5LNK6 3OO1A 3EY4A 1FEZA 2F3RA 3AVXA 1PDVA 1VLJA 2XEDA 1E7RA 2YV4A 4TTQA 3R7AA 3RK1A 1AQIA 1KXZA 3PLAE 3TVTA 1FTWA 2GDJA 3QXCA 4RVHA 4C07A 2X5KO 4LI3X 2B8JA 1KNXA 3RV3A 2E4VA 2PXAA 4TS1A 2ROQA 1JQLB 3P9QA 3E5NA 1VHJA 3PXEA 4D0RA 1DFGA 4IV8A 4Q15A 1XCBA 4RETA 2PUTA 4M9UA 3VPFA 2YJNA 2QPOA 1OZFA 3WQSB 4HQNA 2OYCA 3R74A 1K6EA 5CB0A 2CMKA 2WILA 4NZOA 2ILTA 3HVHA 2J3LA 3U39A 1X6VA 3WJ2A 1PG2A 4BATA 1KTIA 2H2DA 1Y1PA 3H1EA 1DNPA 3UICA 3SWWA 4CT5A 2RGUA 2O8VA 4YCLA 5JIBA 1RYNA 3L0SA 1GFIA 1FDRA 2NWQA 1KYYA 3NHWA 4KAXA 2J31A 3RS8A 4WN9B 4MB2A 2EW1A 2Y0PA 3FFAA 3RVNA 3IJEB 3UV3A 1ECPA 3A31A 3DOHA 1C3OB 3DDNA 3N8NA 4GXRA 4IJWA 1M10A 2QR3A 1DCTA 1RJ9B 3DWIA 2X41A 3CCBA 3LX8A 1IPHA 3AJ8A 4XPIA 4KR9A 4D6PA 3W3AA 4L8YA 1Q20A 4EHNA 2DH6A 3N5KA 3ANSA 3RYCA 1KEPA 5CPBA 3OOJA 4XFKA 3TYXA 4DRYA 1D3AA 4YUVA 4YAIA 3EFBA 2RK4A 3BK1A 1I5OA 3HNPA 3OZTA 4RORA 3TI9A 4TYWA 3T95A 3ZVRA 2YYAA 5HIAA 3WWYA 4AULA 1M5TA 3P4UA 1H94A 3CNEA 1KS9A 4ZQFA 3HH8A 1FUIA 2ZSKA 4NARA 1RXVA 2LCQA 2BONA 2JA2A 4HRVA 3WMFA 4YMWA 1INLA 2A1UA 3REQA 4DVGA 5JXGA 4LF4B 4QC2A 4HN9A 3U4CA 3QKRB 3U0BA 1KZ9A 1ODSA 1JN0A 4NOJA 3U56A 4A4DA 1SKYB 2J9YB 2WJYA 2KHZA 2LKDA 3EB9A 3MCZA 1FYEA 3K35A 4I81A 1GPAA 2LPMA 4G56A 1VMDA 2V65A 1KO8A 4AJ4A 4BLOA 1IIRA 1T26A 2HJSA 4HYEA 2QMYA 1EK1A 5ALRA 4N7BA 4CR6A 2HWXA 3ZDBA 2FPUA 3T15A 3IVXA 2ZWPA 4GOKA 4NE7A 5FNVA 2C31A 3FUVA 3PEEA 3IPCA 1K6MA 1EXWA 2AFHB 3F4LA 1GYQA 1Q92A 1VLLA 3CRW1 3G2OA 3KJQA 1K27A 2WJPA 3UK1A 4BPRA 5C80A 5CH5A 2VDWA 3BSSA 5A4FS 1ZGBA 1L3BA 4E1AA 5A7FA 2BD0A 5BWBA 5T4EA 2V59A 2GH1A 4FMDF 1GNTA 1Y1RA 2PZJA 1QZ3A 2W6IA 1H1LB 2GZDA 2XUJA 3SC4A 2VTDA 3JVEA 4M6WB 2P78A 3U60B 1P60A 1F60A 4E33A 2Z83A 5DEOA 2ZBRA 2PL1A 2RBEA 1Y80A 3A2NA 1QIJA 4MLDA 5FI1B 5AVTA 2GMWA 5DNWA 4IH9A 4Q3NA 1WDWB 3NVKI 2YYYA 4XCXA 3WIBA 3VR6D 4MAFA 2BCJQ 2Q9BA 2M1ZA 5EIBD 5AESA 1TAQA 1NSFA 4CIVA 4MEJA 3ECCA 2WJ6A 1KYTA 3AF6A 2ZZKA 3KYCB 2YL2A 3AVQA 2CLHB 2D1FA 3T0FA 4J4HA 4KK4A 1XNHA 2CZCA 2L69A 3QA9A 4C3VA 5L3QA 1QH0A 4M0LA 2DX7A 1E3TA 2BL4A 3BHIA 3OESA 4NBKA 1KYVA 4I9NA 2F59A 5JMTA 4G9EA 4LW8A 5ADUS 1T34A 3CQ9A 3H2BA 5ALOA 1ZC4A 2VHTA 5JS6A 1T4GA 3JV7A 3TVDA 4BNUA 2Z57A 5M7EA 2C7PA 4HMQA 2VBCA 2DPHA 4QDJA 2FOLA 1QFYA 2YWBA 5BXQC 1U1FA 2J3IA 1BN6A 2BEKA 4GIBA 5EI5A 1P0MA 5EMJA 3G9TA 4B7XA 1QZZA 4HNQA 4EUNA 1U8UA 3N1UA 1QK3A 1HT2E 3TSWA 1J21A 1QOZA 4WEOA 1NVUQ 3CH6A 3OZBA 5EJ8A 1HMPA 4G1EB 2IDZA 4C76A 3OIFA 1O6CA 3ORFA 4CM4A 2BGMA 1ECLA 3H9BA 2UYCA 1WB5A 2NYUA 3MJDA 4IH4A 2I33A 3LZDA 3IT1A 4NWIA 3CEPB 4FS8A 2YFKA 2FN4A 3ZZNA 1BE0A 2NO1A 2CHQA 3LT4A 2C61A 1D5WA 2P9CA 3JVUA 3R8CA 1XR3A 2I3BA 1EUCA 1CCWA 3VDMA 3WHKA 3M3DA 4UAGA 3UQYS 3MPOA 2NO9A 2GVZC 3PPIA 4I2VA 2HW8A 3L79A 1EH5A 3JQGA 3OIUA 3ST7A 2GN8A 3E6AA 3GD5A 3GEHA 3I0ZA 1TVMA 3TXYA 3BXZA 3QVTA 4LJ6A 2O6LA 3T1OA 4G2TA 2CDBA 1AXRA 4F2DA 3ADOA 4U8HA 1H1DA 3U48A 3WC4A 4OGFA 2FWNA 1DRJA 3KFLA 4ZRMA 5FP0A 2C82A 1ZOOA 1NUUA 4C2BA 5JD3A 5DRYA 1H4VB 4Z7OB 1W4RA 1NQOA 3GEEA 4C0WA 3WGQA 3R3YA 2UYYA 4OAOA 4HC4A 4FONA 1NIJA 4UPDA 4ZQEA 1ZVKA 2VO1A 1QGED 5D84A 1L2TA 3EMBA 1IZZA 1TKCA 2B25A 4JIGA 4RJIA 1T24A 5T3YA 3H5WA 3ZBQA 5CB8A 4TN1A 2G5CA 3L8EA 4QBKA 2GF0A 1G7RA 1GZ6A 3HV2A 3K9LA 3LL4A 3OZDA 3UAGA 4AUEA 3EFHA 2ZT7A 3FNBA 3QWBA 3ZXSA 1XPJA 1U0FA 1DUSA 2ZTHA 3FVRA 4UATA 1JSCA 3TFQA 4ECEA 1JDZA 5JY1A 2G09A 4CCAA 4F5WA 1L9KA 3TO5A 1E1KA 2JLAA 4CTMA 1M34B 3FCEA 4DGSA 3U5ZB 1ZLXA 4QOEA 1NKSA 2ZQ5A 2A9VA 3NH9A 4MXDA 5P8WA 1TA9A 2V55B 2FDXA 1S2LA 2AWNA 2IYOA 4W5HA 5CCEA 3BGOS 4XYMA 3SQXA 3O4FA 3CVYA 2NU7B 2JFHA 2CE7A 3F6YA 4F86A 1AQ6A 2GYUA 4GH5A 3E5MA 4R40A 1GTJ1 3SYMA 3HI6A 1FU4A 3U7IA 5COQA 4C43A 1JX6A 2CLCX 1N2EA 2H4ZA 1D6MA 1GPJA 2X58A 4PX9A 1RJDA 1S2DA 5K3DA 5HX7A 5FUMA 2PUCA 1MZVA 4J7XA 4FFBB 4QU5A 4L78A 3O1JC 1VLHA 2BEUA 4U9IS 1O95D 3TW6A 4ND8A 4NBRA 3C85A 3AFOA 3IV7A 4TXHA 2WT4A 5CA1B 2XB9A 2EP7A 4LHZA 1BW9A 3UH1A 2FETA 1YCHA 4H77A 1PV2A 5H5JA 4TXNA 4BCBA 1Q0QA 2CCGA 3D4LA 1NRJB 3T7RA 1Y0BA 1HNXB 1E2MA 2FV8A 2WHRA 4DWJA 5IF9A 1U02A 3PIDA 3JD1A 4X7RA 4JB8A 3KBBA 3AL0C 3OWHA 3DZ8A 4FYHA 1QYWA 4CM6A 2KX7A 4RU1A 2UZ1B 5F4ZA 3IUQA 5JSHA 3K0FA 4EHIA 4A91A 1Q50A 4X66B 2ZYSA 4K6OA 5M29A 2BTQB 3ZTYA 1KZ7B 5CM2Z 4IKPA 1VL2A 2AR7A 3RAJA 2A0FA 4CR8A 4BTEA 4AKIA 3DDHA 3WADA 2QIPA 2YFQA 1AK2A 4J6EA 3ZDYB 2WHQA 1UKZA 4IRUB 3I9FA 4R9VA 5HK8A 3WO0A 5JDIC 2GFHA 2VF2A 3TW4A 1DMSA 3SQDA 1VZ3A 2VLBA 1ZIYA 2C4MA 4S04A 5J2UF 1T1GA 3V42A 3WIVA 1E6CA 4B85A 4AIIA 1XAJA 1C7ZA 1GT6A 1UP4A 1A9QA 1D6SA 2XRMA 2Q6VA 3GUUA 4NZNA 2QXYA 1QV6A 2AEEA 5HJ7A 4XQGA 3GBPA 5LYYA 5H80A 4OJYA 4D92A 5B12A 3U4QA 1G5FA 4G09A 2B82A 4Q7MB 1M2EA 2EW2A 4H6XA 1T35A 1HGXA 4XAQA 1AIPA 2VUTA 3E9MA 2EJVA 2EJWA 2HZ7A 3I9OA 1TU0A 4G1CA 4G1FA 2O8BA 1YAHA 1NUTA 3ETHA 2B7CA 4NY1A 2X6RA 3NIBA 2R9VA 3FCYA 3QRWA 3I01A 5FNVB 3SY8A 1I3LA 3TTYA 2B5WA 4GYWA 4UQPA 5H4GA 2GJ4A 2OLJA 1Z39A 2Q29A 1JSXA 1V37A 5EE9A 3S2SA 4RHFA 3NJRA 2O0MA 3OZ7A 1WCWA 3D2AA 5EYPB 3CHYA 1CDEA 4BLVA 2WB4A 4EA8A 1ADGA 1E7WA 5I6DA 2VDWB 3DBRA 5FIUA 4GF5A 3JXEA 1VG9B 3JVIA 4JHXA 1X19A 3HKCB 4WUVA 3QVOA 5K8IA 1OI7A 3PA8A 4LYAA 4MS1B 4WHMA 1UMCB 4Q9NA 1RQ7A 3TD6A 3FBGA 4NESA 2B1IA 1YGYA 1KNQA 3QOFA 3EHEA 2QD2A 3V00A 3UWKA 2WT9A 2Y1LA 2Z1NA 4D9FA 3HPRA 2ZGVA 4F56A 1SOVA 1Z0ZA 2JGMA 2OT3B 2TECE 3N3AC 4PSUA 3DZIA 1UJMA 4UU0A 4OQDA 1R5BA 4D45A 1CEEA 1JEYA 3A1DA 4D79A 5JHHB 5FF9A 1JDSA 5HOEA 4GI2A 1PEKE 5KTOA 4V0RA 3CF2A 2RARA 3DO5A 4C7JA 3EXIB 4FFOA 3GRUA 2HMUA 2P9FA 4F2WA 3BN3A 3MBOA 1X7YB 2B9VA 3FROA 2BYTA 3ABQB 2O2GA 4CQNA 3UGTA 1XO1A 2QL7A 3FYHA 4L8VA 5DNDA 1DQPA 1UDWA 4ER0A 1R37A 1GLGA 4V0ME 1PK9A 3CRNA 2IW1A 1WEKA 4W5WA 5F9FA 3AM4A 4DPKA 2FFAA 3S2IA 3R44A 4M87A 5BN4B 1E2LA 3L1HA 3R0VA 4X93A 2CHVA 3IE1A 3ZIAD 3DYVA 1YB6A 2NZUG 4TSKA 3KB8A 1YFJA 5IYZA 3ED1A 2WA2A 1W49A 1UZNA 1JHPA 2Z4TA 3AKYA 1OU4A 1VE3A 1K8QA 3DEAA 2BMJA 1TZCA 2R7KA 3AK4A 4YAKA 3H5IA 1GRNA 1AQUA 4QBIA 4LXTA 5DIFA 4KPUA 3NGMA 4TVKA 2AMYA 4RS4A 1NSTA 1WF3A 1WTAA 1XU4A 3AX6A 1C29B 3M6MD 4IIGA 3I9V1 4FR5A 2PU5A 4BFWA 1LS1A 2CKDA 3SNHA 1BXRB 1MA0A 4PTYA 4RGYA 4URXR 1CQXA 1MO2A 1HE5A 1I0LA 1F48A 2E48A 4CMJA 3HVRA 1SWVA 3MLBA 5I9SA 3D2CA 1YZKA 1ETHA 2XMGA 3BVPA 1FOEB 3PR3A 2QB5A 4IG9A 2IUTA 5IBRA 5IXYA 4ZV9A 3S27A 3C1OA 3FOBA 3T4UA 3VKWA 4B4DA 5CBKA 1X7ZB 1RIIA 3C97A 4DAOA 1ZCBA 1AHPA 1H9BA 1Y9JA 2WHYA 3AI7A 2ONCA 3FMOB 5C1PA 1AB5A 1Z12A 2A8YA 1CZRA 5KTKA 2WIJA 3KQPA 3PUXA 4M36A 2ZI4A 4CQMD 2HWYA 3RC3A 1XRPA 4DDKA 1A7KA 4P7KA 5DYGA 2BMDA 5HZKA 2PUEA 1NATA 4LI0A 3BWXA 3FUUA 4HQRA 4AJLA 2WKWA 1H6CA 1LNSA 3C41J 3ZE6A 2A5YB 2ZJAA 1L7OA 1JDNA 1MORA 2VNSA 4RS3A 1E9RA 3EW7A 4Q48A 5LQCA 3KOMA 4O4HA 5DBFA 4NNPA 2BMFA 3L0YA 1N5KA 3ISTA 5AM1A 1B4DA 4IV0A 1N78A 3BWYA 5ERXA 2VPQA 4QPNA 5TJHA 1Y6RA 2D00A 4BO8A 1QHHB 2Z1MA 1YZNA 3U9SA 2QAIA 1EA5A 2Z2XA 3JZIA 3KQOA 1IPFA 1TMGE 2AFIE 2PY6A 3PFCA 4JCCA 4BNMA 1JIKA 1RQPA 1AKNA 3I6ZA 4BMVA 3E22A 3GJ7A 5JCOA 3CB2A 3U4AA 2QUJA 1MABA 2VJAA 4ZFNA 2UYHA 2O8FB 2EDCA 1E1MA 1Z6QA 1UBHS 1TDJA 2FZ5A 5HCNA 2EF1A 1T9GR 2SKDA 2YASA 3ELBA 5ECYA 5NULA 3TIGA 5JALA 2PCJA 3LY5A 1WZCA 4OREX 2I2WA 2J4FA 5LBUA 3DVAB 1IWBB 3H1AA 1T5LA 4ND8B 4CV0A 1L8QA 2JGIA 2P69A 5KSYA 1H93A 3FM9A 4RNDB 3QU5A 4RWZA 4YCAA 3DV0A 2ATCA 1KY4A 3I53A 3MOSA 4ZOEA 2FSGA 4B6SA 5EZQA 4BVEA 2RI1A 2CDRA 1RFGE 2FN3A 3LUDA 2CVZA 3CN7A 5FQOA 2V7EA 4IHJB 4R2KA 3RSLA 4EIWA 4HUTA 2EYUA 1P8JA 1DC7A 2WNHA 2VEOA 4RV4A 1RZVA 4WGGA 2UUAB 1L5KA 4E5NA 2FEMA 4V03A 3GQBA 4K6GA 1PFVA 2D62A 1W44A 3F6CA 4JHLA 4M8NE 3BIFA 3FSJX 3UXEA 2P6UA 4G67A 3WYBA 2WWRA 3A25A 3L06A 4F4JA 4MP8A 4LOLA 1UC5B 1CUVA 3V3TA 1FP6A 4FWIB 1VRVA 4MARA 1LSJA 3BMCA 3H18A 2W6OA 3GBSA 4I5DA 2QTVA 3JQDA 4JLUA 4V0KA 4Z3DA 4YYEA 1ZWLA 1VPLA 1E9VA 4F60A 4XASA 1RQNA 4F6CA 3FAKA 3RVDA 2YQZA 4C4AA 3ZGZA 4IICA 5IDXA 3CKMA 4WGFA 3QHAA 3U9TA 3E1KA 1BDIA 4KBGA 2G9UA 2NU8A 2VBFA 4J03A 4CMIA 2EBUA 5IJAA 1JEOA 5FPSA 3O90A 1KEVA 4CMKA 4DEVA 3K9FC 2JD2A 4KPEC 1VKJA 4WY2A 3BQMB 3EVTA 5F5NA 1E4EB 2EZ8A 2PUBA 5AI4A 4KBYA 5AVRA 4X84A 4QL3A 1X7XA 3Q7EA 1HE4A 2ORED 4K8RB 2I8LA 4RPHA 4U8GA 1PI3A 2OVFA 1U9JA 4LECA 3B85A 1XLTC 4Y9TA 3ERCA 1NN5A 1V45E 4TLEA 3NHBA 1MPTA 4JBGA 4BO0A 2WOOA 1EFCA 3W9BA 4L7VA 2O9JA 5ECWA 3TM4A 1CUXA 3B2NA 3WK5A 3ZLVA 3RAFC 4B3RB 4MKHA 4RD4A 3SXUA 4ZD6A 2Q3LA 3ENKA 3IHKA 4L73A 1YRLA 3GA7A 2OBMA 5UKDA 16PKA 2BKVA 1EBFA 2C5GA 1C4KA 2BKAA 2DWPA 4PYMA 3FPEA 5CGZA 1X1CA 1D0IA 3K1TA 4N5MA 5JAHA 2OZLA 3IEIA 3TAUA 1CUHA 2R6FA 4GHWA 1CNFA 3OQJA 1QCDA 2PJUA 3PB3A 2FPGB 3K32A 1CEQA 3ENZA 1WMFA 4Q21A 3TOZA 3QTLA 4BX8A 3HO8A 2B1JA 3HSSA 2F3TA 3ZU6A 1IRXA 1I32A 1XTRA 4CM1A 4W5TA 2VDRB 3R3XA 4MOWA 3LFUA 4OD0A 1P1BA 2NP7A 2CMHA 3TR0A 4BE9A 3HZRA 5F2EA 4KE7A 4Q7QA 3NBXX 2H06A 3H2ZA 1VRCA 2HHAA 6GPBA 1PZGA 5HXAA 1N34B 2BFNA 2PKRA 3HYCA 2GN6A 4R0VA 4AJHA 3UEOA 2EARA 2OCYC 2GESA 1JHDA 3G0IA 4OUDB 1W94A 5FPYA 2HCJB 5AMXA 3R7FA 4D9BA 4X0EA 4OGGA 4JJGA 1RRPA 2OXCA 2TRSB 4L6AA 1OI4A 5KAMA 1ONSA 1VYVA 1E5LA 1YRQA 2FPIA 3FCXA 1EFPA 4G97A 1YDHA 1DWOA 4CU5A 5IYZB 2FN8A 6ABPA 5AM5A 4D4JA 3EG5A 2ZT6A 4UTNA 4DJFC 3GFOA 2C99A 3TTSA 1VKRA 3L8HA 2C9BA 1JWLA 4DG5A 1BH6A 4IDFA 1ODFA 3M4JA 4M1YA 3ZDAA 2A9QA 1NXXA 1AV7A 2WF5A 1KP3A 1L4EA 1XB2A 3AR2A 5DTMA 2CVPA 4Z4FA 4KU4A 3VM6A 1OWMA 3HN2A 3FBTA 1YJQA 2FEAA 4NZPA 3P9IA 3HN6A 3AHHA 5EZ6B 3LUCA 4DANA 5JC1A 4FEAA 1AD2A 3LBYA 3OIYA 3ETLA 1TZJA 4BJHB 2HK7A 2YVLA 3EAGA 5EKSA 1SUBA 2FWJA 1PG5A 2G82A 3T5AA 4U0JA 2PX0A 1OFIA 3L18A 1UCFA 3A8TA 2XW6A 4EGSA 1Z2NX 5KJFA 4D8YA 4MDHA 1RU3A 3RH0A 4OQQA 5GJVC 3DBHA 3K15A 3UMRA 4JUBA 1XVIA 3AJRA 4LZWA 5J4HA 4X71A 2GGSA 2UV8A 2C5LA 2O54A 2C59A 2A88A 3EEQA 2G1AA 2V5AA 3QNWA 5J2UA 3LWDA 3K5HA 3NW9A 3MA0A 1AGYA 4RV5A 4LMPA 1IN4A 5K51A 4KXMA 1KZ1A 2P77A 2IWRA 3RSQA 3V34A