1PZMA

Crystal structure of hgprt-ase from leishmania tarentolae in complex with gmp
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
183
structure length
170
Chain Sequence
b'YPMSARTLVTQEQVWAATAKCAKKIAADYKDFHLTADNPLYLLCVLKGSFIFTADLARFLADEGVPVKVEFICASMLLDVRDSVENRHIMLVEDIVDSAITLQYLMRFMLAKKPASLKTVVLLDKPSGRKVDVLVDYPVITIPRAFVIGYGMDFAESYRELRDICVLKKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypoxanthine-guanine phosphoribosyltransferase
publication title Crystal structure of Leishmania tarentolae hypoxanthine-guanine phosphoribosyltransferase.
pubmed doi rcsb
source organism Leishmania tarentolae
molecule tags Transferase
total genus 53
structure length 170
sequence length 183
chains with identical sequence B
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2003-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1pzmA00
1NONA 1QK4A 5BQOA 4RQBA 2YZKA 1BD4A 1GPH1 2JKZA 5E38A 1ECGA 1ZN7A 1A4XA 2GEBA 5KAMA 4RHUA 4S2UA 1Y0BA 5IPFA 1DQPA 1QK5A 3LRTA 3KB8A 4RACA 1XZ8A 1IBSA 4PAWA 3MJDA 1OREA 3HVUA 1TC2A 1A96A 1QB7A 4RQAA 1JLSA 1J7JA 1P18A 2EHJA 3DAHA 3GEPA 2WNSA 1U9ZA 4P83A 4Z1OA 2JI4A 1U9YA 5HKLA 4P86A 2H06A 4WMLA 1XTTA 1NULA 4RAOA 1A95A 1HMPA 1QB8A 1DBRA 3GGCA 1DKUA 4X44A 1A97A 4P3KA 1UFRA 1XTUA 3ACBA 1BZYA 1GRVA 4QYIB 1ZN8A 1ECJA 3G6WA 3NAGA 1L1RA 1BD3A 4JITA 1ECBA 1JLRA 4QRIA 4RADA 1PZMA 3M3HA 4ZFNA 3N2LA 3OZFA 1R3UA 3DEZA 1P19A 3QW4B 3ACCA 1P17A 4RABA 5EUCA 5K51A 4M0KA 5HIAA 2C4KA 5IAOA 3EFHA 1A3CA 1XTVA 1L1QA 4PFQA 4LZAA 5BSKA 4KN6A 3DMPA 1VCHA 2H08A 4IJQA 1QCDA 1W30A 4TWBA 3ACDA 1D6NA 5ESXA 1ECFA 1STOA 1OPRA 2AEEA 4P81A 1MZVA 2DY0A 1TC1A 3GGJA 5JSQA 3OHPA 2HCRA 1LH0A 1WD5A 4JLSA 1QK3A 1XZNA 2P1ZA 4LYYA 1UPFA 2FXVA 4P84A 4RHXA 1G9TA 1OROA 2IGBA 4FYMA 4LZOA 1O5OA 4RHYA 5BRNA 4M0PA 4M0UA 1UPUA 1I5EA 5BQPA 3OZGA 2H07A 1A98A 4RAQA 4OHCA 4WN3A 2PRYA 1AO0A 5JV5A 1G2QA 4LYGA 1G2PA 4LZNA 1HGXA 2PS1A 2XBUA 2VFAA 1I0LA 4X45A 1I0IA 1VSTA 3MBIA 3LPNA 4RHTA 5ESWA 1YFZA 2JBHA 1QCCA 1G9SA 2JKYA 2PRZA 3O7MA 4RANA 4RV4A 4F8EA 1DKRA 1ECCA 1FSGA 1Z7GA 1O57A 1ZN9A 4MB6A 4P80A 1V9SA 1CJBA 1P4AA 1DQNA 4QYIA 2E55A 1I13A 5KAPA 3H83A 3S5JA 1VDMA 1I14A 4P82A
chains in the Genus database with same CATH superfamily
1P9NA 5I01A 1RKUA 2Z3VA 2ZYDA 3LVRE 1VE1A 5EKTA 4LDPA 1QXSA 2AZDA 2VDVE 1XRMA 3K09A 3UXHA 1BD4A 1KS2A 4MX8A 2OXFA 1RLMA 2E4UA 3TRFA 4HDMB 3VHQA 4Q3BA 3ZZUA 3HWSA 4JDPA 4E2YA 1KMMA 3TAUA 1W8IA 3VKVA 4BQQA 4C2UA 1VB3A 1ZK4A 2Q3BA 3LTNC 5I8WA 3MWGA 3KV3O 1D6JA 3OMWA 5JXJA 1T2VA 5LA6B 1U0NA 4EDHA 2IHJA 1V5IA 5K3FA 1E92A 1YDWA 1NVBA 2X8JA 3NBFA 1FNNA 4P83A 3L04A 1IBKB 1NXTA 2QTNA 4XTCS 3EVBA 4IV0A 1MO3A 2HIAA 2E21A 2E18A 2WE7A 2QW0X 5K45A 1COWD 2R6DA 4ZXPA 3N6VA 2WY2D 1E0SA 3G0HA 5JUWA 1Y7HA 1SUSA 2E4AA 2VEDA 3M6IA 4BTLA 1HTWA 2Q3HA 3ZZNA 4ZAZA 3WB9A 4DJFC 3K6SA 2RG7A 1AKQA 2XOEA 4NVRA 3RT9A 3WP0A 2HDNB 2QZJA 5ALEA 4PC1A 3ZGOA 4N76A 2QM3A 3LYHA 5T41A 1JKMA 3B8EA 3TLJA 5F9MA 2ZTMA 1O6ZA 1XZDA 4JT9A 1TIKA 4X41A 3KQWA 4YRGA 4HB2A 3C1UA 3FYUB 3H1PA 3Q7EA 3QA3E 5HS4A 5G1PA 4XCQA 1QIIA 1J22A 1TF2A 2NZ2A 4BLTA 5JBNA 4OB8A 1PQWA 4N4AA 3ADKA 1Z5GA 1U1IA 4BX2A 2PUDA 1YOVA 3IP6A 1Y1TA 3TPZA 1IJEA 1SBCA 5FNVA 2OSVA 5JJBA 2ZYRA 1IXSB 2BZSA 5JZBA 2VQEB 3S40A 4FGLA 3G0BA 3WWPA 4KLCA 3KJNA 5JFOA 2JFBA 3THXB 3SQWA 4OSOA 1KH2A 5KTYA 2G77B 4KDEA 3FTEA 4J9UE 3H9UA 5ARDA 5FLEX 3I01A 3PXXA 1ZI6A 3DLTA 3VHRA 3DD1A 3REGA 4M9UA 4RLQA 1FVXA 1E2EA 1G9XA 1T43A 3NOXA 1I1QB 2MR6A 3OJFA 3HGQA 4HEJA 4KWIA 4NESA 4LJRA 3ZWCA 2A7XA 2FF7A 5LA6A 1YU6A 3WLJA 3L8CA 3USES 4LV6A 4WOJA 1F0NA 1GRCA 1N8TA 4X71A 2CYCA 3KVNA 3ORRA 3W5CA 1KJYA 1TCCA 3ZW7A 4Z4QA 3SJ7A 1R0CA 5AVXA 2AQKA 1PT8A 3BD8A 2AMYA 4DBVO 5LFAA 1E6MA 2ONJA 4DEVA 3A6EA 3ZVKA 1G7CA 1P0PA 4LJ5A 1G9SA 3OOJA 1N5KA 3P9CA 1YO6A 4INAA 3N28A 1BDBA 1FVHA 4L3OA 1JJFA 1LLFA 3UJNA 5IBQA 4AURA 1Z15A 2ZTLA 4MICA 2O52A 2B8TA 4BAGA 1NW3A 2QMQA 3C6KA 4LZWA 5HE9A 1R7RA 1AUVA 2EEPA 1EHCA 3L7LA 4R5HA 3VMMA 4AO6A 3JARB 4A2WA 4OLAA 3UA3A 3OM1A 4BN4A 4WOBA 3N2NA 4CT4B 2FHSA 1MW8X 1QV7A 5D3QA 1QRTA 1YR8A 3A1TA 1HFJA 4HB3A 4YMVA 3FYUA 4X8MA 3SDZA 3RG8A 3SU8A 1X42A 3ZHSA 5LXTB 3OFKA 4YAIA 2W42A 3FZNA 1NVUQ 1J5EB 1GV1A 1SHLA 1WIWA 1QG6A 2QPOA 3C6QA 3SHQA 2OC4A 4HNSA 5ARCA 821PA 1KKUA 4Q93A 2OQVA 1J24A 3QEBZ 1QK5A 2O8CA 2W2VA 1JDUA 2VZEA 4L8VA 1CB0A 1R37A 3DBLA 1Z4LA 4INZA 4B83A 3RFXA 4OGWA 1F2TA 4GLLA 2WV7A 3THXA 5JLAA 4RTPA 2GZ1A 3ENQA 3R9XB 4TSKA 4G1MB 1NMQA 3QYJA 1HZJA 1VIAA 1H94A 1ZH4A 3N5KA 1YZFA 5HCIA 3ROZA 4YV0A 5LKAA 1IJKA 2QN6A 2ZJ0A 2CV2A 1XTIA 4GHWA 5LU9A 3B1ZA 3IQXA 1XJWA 4HH4A 3O8QB 3ZWPA 3IAAA 1YS6A 2CUKA 4RS4A 3GLHB 3STXA 1V7CA 3PHIA 5ADVA 2BEUA 3WMFA 2B34A 1XV5A 2C5GA 4RZUA 1INLA 1Y1LA 2SICE 4FYYA 1M5TA 3P19A 1CB7A 1UM8A 2IYTA 1ZAKA 2ECQA 4IUCS 1IJFA 4Y0AA 1CD5A 1HT1E 3FAZA 4FQ8A 2YL2A 1HOTA 5DNVA 5I6DA 5DI9A 1PJSA 1MZPA 4RZSA 4CG2A 3EJ6A 3OZBA 5CNIA 2Y92A 1K4MA 4ILKA 4MYHA 1RQXA 3SIPA 1UAAA 3JWGA 1PZXA 3QPVA 1GAXA 2XVZA 4QGSA 3I3OA 3DFIA 2C2GA 4BQIA 2R2AA 3BIXA 3IIKA 5DTIA 3STWA 2VPPA 4FGZA 1LW6E 3OIUA 2ZRBA 4TLCA 5LYJF 3T99A 4DR2B 1SO8A 3GRFA 4YP5A 3UMYA 5LXTA 2PO5A 3NDPA 5ICSA 1FYXA 3ND6A 3GLVA 4WKCA 3B2QA 4NCKA 4CGYA 1M8PA 3BGSA 2WWVD 2JH8A 4H7EA 1Y63A 1F9EA 2B20A 3QUCA 1KO4A 3AFHA 4ENSA 1MQSA 3QQ5A 4M8KA 4IUYA 1FJXA 3F5FA 1EFHA 4HMOA 4DNFA 3ADBA 4BRSA 5D87A 3O4GA 5DRTA 3G2JA 5IH7A 3GV0A 3IIJA 2VDLB 4C03A 2J9XB 2G82A 3Q6IA 4OG2A 1WUTA 4H0FA 4TMWA 3ZNOA 2PRIA 1GPYA 3R9XA 4FGUA 3ENZA 3DOHA 3PHCA 2JAXA 1KFKB 1PLJA 2D62A 2K4MA 3LBHA 3BBPA 5EJMA 3U62A 2PQ0A 1X14A 1X86B 3ZBTA 5K4GA 1PLLA 5CCXA 5LYYA 1E7QA 3QK7A 2H0AA 1SC3A 3PQ2A 2PGAA 3O8QA 2HJRA 2WWHA 4MHSA 4YO7A 5H80A 3GLHA 5AVUA 5JNWA 3HA3A 2UDPA 3F9RA 1UOOA 1ORHA 1X94A 1TCVA 3ANXA 2J9YB 3A2MA 3BXOA 1NC1A 3ETNA 4AP5A 3G0DA 4RENA 3E3OA 1Q1GA 1VA5A 1Y3CE 3OCXA 4O4IB 3OQVA 3FG9A 1MAAA 1YASA 1D7AA 3O2QB 3VUFA 3AF1A 3NTRA 3RFFA 3UMFA 1Z6XA 3GEDA 4U5XA 1YU9A 1KE1A 1NNLA 3DQPA 4YRZA 3TQTA 1JX6A 2FYTA 2H4ZA 2X9QA 1OAOC 3A9RA 3GYGA 1V8FA 4R7TA 5EYPB 3WGKA 5EFZA 3WIOA 4D5EA 2RHRA 4TLBA 5JR3A 4KYUA 3WAGA 4DV2B 1NXVA 1QHYA 5JT1A 1YMVA 1AY0A 2VP6A 3MOGA 3C1TA 4G0OA 3KZOA 4ZO9A 1PR5A 4FFPA 4DXAA 1CZHA 3LY5A 4G0PA 5JO0A 5KOYA 3LDAA 4XSHA 5KSZA 1B1AA 4AJ9A 3TXXA 4L8WB 2YW2A 1GZDA 1NYTA 4HNHA 1Y0BA 3H5WA 3WMEA 5JYDA 4L9WA 4NCJA 3AHDA 3VU0A 2CLIB 2GNOA 1NMYA 3OD1A 3TLXA 3WYAA 5KX5B 5L95A 1RXVA 3AM1A 2BFEB 2I4TA 4G4IA 1AUPA 1NQVA 3OE4A 3B9PA 2ZJBA 2ACWA 3IPAA 3KC2A 3U4IA 5D3ZA 1U94A 3MWDA 2PY6A 4PU0A 3KS9A 3COSA 4YIHA 3TW8B 4JA0A 1QKIA 2C4UA 4NENB 3S7ZA 2H2AA 1JW9B 5I9MA 2EJTA 3WIDA 2IHTA 1KC3A 4B4DA 3HADA 1NM5A 3VX4A 1NG1A 3CX6A 3GEEA 1COWA 1LY1A 2J5QA 3DCNA 3PHBE 4I50B 5DTMA 3TNJA 2PL9A 4F4HA 3LKVA 4JI2B 4AO7A 1VE9A 4W1RA 3U7FB 3ACBA 4HPWA 2K87A 1WHSA 1JIIA 4LHXA 1E6KA 4ZGGA 3NAGA 5KIAA 1NHGA 3BGVA 4ZVOA 2K7FA 4V0LA 3AW9A 2POCA 2A9QA 4YMIA 2G4CA 3PUWA 1EA7A 3SMVA 4EUHA 2EP5A 2AR7A 1NY6A 2NZJA 3GFRA 2C4NA 2UVPB 3TCNA 4ABTA 4A2CA 2X40A 4IXTA 1MG0A 4GI3A 1SBQA 3ZI7A 3PFFA 1VKRA 1D4ZA 5H5JA 1Z5PA 3TVDA 4BNIA 1NURA 4QG7A 2EQBA 2ZVJA 1CEXA 2PGNA 2XLBA 2YVKA 1XD9A 3P2IA 3UBMA 1BRMA 2DP4E 2PKWA 5CR9A 4JC5A 4D6XA 5JAOA 7GPBA 3LL7A 5EYPA 4JU8A 1XMQB 1FP2A 4D6YA 2QSYA 4KSCA 2R8RA 1A4UA 1S2GA 3G49A 2Y0PA 1QK3A 1UBEA 3P2YA 1Z39A 3L0IB 4PONA 3ZHUA 1VL8A 1C4WA 3AR7A 4OGLA 5P21A 3KXKA 1WDMA 2X8WA 3EXG2 3IAUA 5KX5A 3R7WA 1DKPA 1KTIA 1VCOA 3S1AB 1NI4B 2BFEA 3IVMA 1FYEA 1I2BA 3LC1O 3GJ8A 3JZIA 4WCFC 2EFDB 2HF8A 2QZPA 5HMLA 4LF6B 1Y5RA 5E9JA 4PLZA 3K5WA 1GT91 1X92A 3JZMA 3TW8A 1II0A 1PTJA 2C84A 3N0WA 1FC0A 3OICA 1T2DA 4NENA 3MF4A 3C48A 4DDVA 3VR6H 1EZ1A 1L5ZA 1LU9A 2FW0A 1SPXA 1WXXA 1KI7A 4NH4A 2QT1A 3DDNA 2JBHA 3J81A 2JZOA 5DX0A 3NO4A 1MBZA 1GDTA 4G0QA 1BX0A 1AK2A 1RQGA 4MJ3A 4JY7A 3EZ9A 3H6HA 3EIWA 3LC2O 3BDAA 2PFSA 3HP1A 2OUKA 3LI2A 1RABA 1T9ZA 3N9IA 2O07A 2QORA 1WWKA 1BTOA 2QMUA 3F7TA 3ETGA 4ZT2A 4PAOA 5E0KB 3M6XA 3WISA 4AX8A 5C4MA 1Z5VA 5DH9A 4M1YA 4G0UA 1XPUA 4N40A 2UVPA 3NUZA 3ZWWA 2YJ4A 2X23A 3DMDA 1KEZA 1NGSA 2GF0A 3E1GA 3E4DA 3OU2A 4H7HA 1KI6B 4QOJA 2OV1A 4EYEA 4CBVA 4BPBA 2AKYA 2JNWA 4QQRA 5E7JA 4BUJA 3JYNA 4XH9B 4WESA 4MNTA 1Z4IA 4P4LA 2JIBA 5EN4A 2QRVB 4BYMA 4XRRA 3JV7A 3RGGA 2C99A 4Y30A 1VLZA 4ZDWA 3LUGA 3UK0A 4CVNA 1OX4A 3U7IA 5EXTA 1GN8A 1K98A 4KAAA 1OREA 4HSEA 2F1OA 2Y1FA 1FEZA 3L0SA 3NIBA 4V0QA 4QQNA 3KG2A 1WBJB 2G4LA 3GEPA 4O0MA 4GP9A 3UB3A 1S7CA 2BMAA 1ZGCA 2IQ5A 2QR5A 3WDLA 4EY6A 3I61A 1PHPA 5IT4A 4EAAA 2QSZA 2GX6A 5A5VA 3S1AA 1NI5A 2DR0A 1BXRA 5IM4F 1C8LA 2SKEA 2ZWIA 5FBKA 3UUGA 3F6EX 2LVBA 2Y9PB 4EHIA 3RADC 2WI8A 2ZZNA 4GX2A 4KAXA 2CLDX 3FFBA 3OY2A 3QOWA 3JQCA 2X0EA 3WWDA 3CZ4A 5IJ0B 4X00A 1RHQA 2UZIR 4C0WA 3UICA 2IEGA 3AL2A 1WSWA 2C54A 3I9KA 3PA6A 4ND4A 3E3AA 1Q11A 3LUJA 4K88A 3A37A 4PLCA 4DWOA 5LQSA 4DQ0A 1UJBA 4P2GA 5AM2A 5AESA 3SJZA 1VKHA 4CKYA 3O3MB 4GR5A 4GPBA 5KDOA 4Z49A 1YQQA 3LT0A 4C6RA 1A5TA 1F6WA 1NJSA 1OCEA 2F2TA 4GEGA 1F4LA 1K1EA 1VPTA 3I1JA 4X7RA 5G0VA 3AQIA 1DXOA 4Y2UA 3CBGA 3ROEA 3V1NA 4BZPA 4D9NA 5LOVF 3GMSA 4QT0A 3LT4A 4EUSA 3ZWVA 2IUSA 5E9AA 5CFLA 1XWWA 2OHGA 3QW2A 4PC6A 1Z0UA 3ZW8A 3GA7A 1C1YA 1QWSA 3ED5A 3ET5A 4O25A 2WOOA 4QREA 5K8CA 5ALTA 3CCFA 3H6KA 2G7MC 3KVYA 3OOHA 3JD0A 3ER9A 3R2JA 1XL0A 5COAA 5C8XA 1JDPA 5DYTA 4XOIA 1L1EA 3H11B 4OBBA 3D02A 4TWIA 4NATA 4XPIA 2D4AA 4Q21A 3R7BA 1DWOA 1WTCA 4DEYA 4V0OA 3AEQA 5J2UB 1I1NA 3K05A 3VAZA 2QVYX 2UYGA 2P75A 4XWGA 4EMTA 4F9FA 1QIGA 1AQUA 1SQ6A 1AHHA 1ESDA 2C9MA 2EV9A 3EAQA 4P3OA 3T5CA 4A8PA 1U1GA 5KWIA 2PRYA 1J2UA 3FPHA 3IULA 1AKVA 4ZAXA 5F7ZA 3RSHA 2O05A 3ZOKA 2I4IA 2RC6A 3P0HA 4LTDA 4XXHA 4F7DA 5KREA 3T1YB 1Z6QA 1S89A 4W5HA 2QNBA 4KEAA 4Y2YA 1NWCA 4LHVA 1XHEA 3RUPA 1NUQA 2OAEA 3W3AH 1YRHA 3IV7A 4CLHA 1EDOA 3SAJA 3ONNA 4F8EA 1JAIA 1BVUA 4WY2A 5FADA 1NF9A 2E87A 3QKRB 2FZKA 3K6KA 1RJGA 3TLYA 5B30A 1Z0AA 2ZBEA 4FILA 3H9QA 3ZHCA 4E2XA 1OV6A 2JW5A 2V03A 1Z0KA 4R71A 1YV9A 2G9ZA 4NK4A 2CLHB 2DPHA 3MILA 4EYOA 2WKSA 4YAGA 1ORDA 2D59A 1DBWA 3DMGA 4MA4A 2NSDA 4XDGA 1XZJA 2W90A 3GB9A 1TGYA 2AJTA 4FCTA 4GRAA 4JP1A 4OYLA 4R8KA 3DLCA 1V41E 3MIIA 3OLZA 5G0TA 1KAOA 2FSGA 3KJIA 5LLSA 4F7WA 3ONFA 2K2WA 1PWHA 1T8UA 1U2GA 2Q1WA 2QTFA 3MJHA 1J2RA 3FJYA 1MA0A 3KYCA 5AJHA 4YRAA 1H2FA 1V1MA 3W34A 1W44A 3T1QA 4YRJA 3R8CA 2BLNA 3BQMB 2FZLA 2D0DA 3ETJA 3CCCA 1Z2DA 4QBHA 1WVGA 1UMKA 1TZCA 2CLOB 3A6JA 2QMZA 2ADOA 3E2MA 3KBOA 4HPJB 4E12A 1EJ0A 1E1CB 3H11A 1XQ9A 5HIKA 2FJUA 3NG1A 4W63A 2W58A 3W9UA 2G1PA 5DI3B 1T5BA 4X8LA 1M1NA 2AZMA 2IC5A 2GM9A 1IJBA 3H5TA 3IVXA 5GWXA 1K5HA 2EP8A 2RH8A 2FLVA 3JX9A 4JBGA 3TGWA 3MTDA 2GJ4A 4D97A 1DOAA 1C3VA 4PZCA 2VXOA 3G5LA 3FOCA 2RGYA 2PMCA 3DLPX 3A4TA 1YB1A 2H1IA 2W4MA 1O9GA 4K9LA 3VSAA 3HWX1 5CFNA 1H2RS 2XA1A 4PNZA 3UO8B 4B4VA 4IJMA 4X90A 2WBLC 4E2ZA 4AI6A 3E3LA 3ZKAA 3NTUA 4UBJA 4FOSA 2D0IA 4BO5A 5LQKA 1ORVA 4RADA 4QXQA 2ZUBA 4YWHA 4KFRA 1A9YA 4OJYA 3QKRA 5G0WA 5DNWA 3DGEC 5EP3A 4EF4A 4E94A 3KYIB 2H1VA 2OHHA 5LMUB 4R2KA 3JCZA 3MERA 1JYSA 1Z34A 4PQRA 5CITA 4CEHB 3PUHA 3U48A 3KFXA 3AKCA 1BDHA 2BH9A 2H08A 3F47A 2VP5A 2DT8A 2YX1A 4WJLA 4EJ0A 3WMXA 4XE5A 5AW8A 2M98A 3K9BA 2NV0A 2OYSA 1WCWA 4QU8A 1OOEA 3DMTC 4LZPA 1DIGA 1GKYA 4QTZA 3LX5A 1E1KA 1X13A 2AS0A 2VDPB 1BHO1 1W5SA 4AP9A 3OH8A 2JHGA 3DWIA 2CL0X 2HPAA 5BNZA 1HLPA 4G2NA 4P98A 3V8MA 2G3YA 2O1WA 2AC2A 4AF8A 3KZKA 2GA9A 4GOXA 1I2CA 3R3JA 4HQ0A 1OVGA 4M0PA 3ZWDA 1P77A 2GEDA 4C0KA 5EIWA 1RJWA 2WQ7A 2PGDA 5K3EA 1JVNA 1QV6A 1UEXC 4G24A 5EWJA 4FMDB 1E1CA 4UOQA 5HCUA 3T7RA 4DUGD 3SR3A 1SG6A 3BA6A 2YMPA 4IAOA 2P7IA 3T7JA 5F76A 3ICVA 5DI3A 5IYZF 4MITA 1HYEA 2IZ0A 4WEOA 3ZY3A 1P7CA 2XIQA 5IUKC 2I4OA 4RCYA 1DGQA 1I0IA 2A0YA 3FFTA 4RXMA 2HWYA 2YFQA 1MABB 1OTYA 2HQOA 1UOQA 1GLNA 2QM7A 2Y66A 2ZB3A 2BFCB 5AW6A 1NQUA 3AP1A 5SY9A 4G5QA 3M81A 1S3IA 1U5CA 3K0HA 3VA7A 5FOXA 4F3CA 2DFVA 3SQOA 3ST7A 4PTZA 1C5KA 4YMUA 2ZYTX 2BMFA 5CNKA 1K6XA 3BMNB 4ZTUB 3IP5A 1CQZA 2HMAA 2J9ZB 1G4UR 3MTJA 4BZZA 5KJ6A 3TTTA 4P82A 4C22A 2O2JA 2IYUA 3SHVA 3L7BA 3LPAA 2WMOB 4AXXA 4ZJZA 3TS1A 3VPGA 2CDBA 3OCYA 4L78A 2P0AA 4DKJA 1RAGA 4NOMA 4UDOA 3IDQA 4S1VA 3RSOA 3UAZA 2WKQA 1G5TA 2B3DA 1U2TA 4J43A 4I46A 4BBPA 4W5RA 1KMCA 4BAZA 4N8DA 1WXQA 3EPKA 4S2UA 1R27A 1US8B 4JUFA 3FYTA 3MS2A 4LRQA 5TT0A 5UKDA 3EGWA 4N7MA 4L8GA 4MVWA 4PR3A 3UFBA 3T06B 3OQ6A 1WQ1R 4ZDKA 5B3JC 1BG6A 1ST3A 2HM7A 3ANMA 3BIOA 3GGDA 1AX9A 1UT8A 3B7GA 3PHHA 1P45A 5GGYA 5C8YB 5H4GA 2QE7D 1KEUA 4MRRA 3QXCA 1R66A 1EG7A 2DBZA 2WAMA 3FVVA 2MIIA 3J7AC 1VLHA 4XIFA 4GDFA 1GARA 2OBLA 1DEKA 1QBGA 3TZ6A 2X4LA 2HMUA 1VC2A 4KG7A 1JTFA 1SXPA 1BFUA 2QS9A 2FN7A 1NXOA 3FYSA 2BFAA 4XB6B 5CM8B 3ZNNA 1Y8ZA 2QM0A 5I7VA 1CJSA 3GJSA 5AQ1A 1RQLA 2RHDA 4FKZA 4MV9A 1XDWA 4KVZA 4EO7A 1QFMA 1ANKA 2IZ5A 1ULBA 3QXHA 3UTDA 3X1MA 3F3YA 1CF2O 4Q66C 4UZEA 4MJLA 1QV9A 4REQB 4Z3DA 2G0NA 2V54A 3T3EA 1Y1KE 5ESRA 4BE9A 9ATCA 1C9YA 3LDUA 4LI0A 1QQBA 5B58T 1ONPA 3IOYA 5IUNC 4PZAA 4QPCA 1HEIA 3GLGE 1P4SA 2ZRLA 3W04A 4DCSA 4UMDA 1IFXA 1BXGA 3H0CA 2BFCA 4I1VA 3UB4A 2XNJA 1G5QA 1PX2A 1GNLA 5DP1A 3T4XA 4DSAA 3IJ5A 2CD7A 1C3LA 4HDQB 3A1WA 3DJYA 4QYMA 3VISA 4BGUA 3ZQUA 1WP9A 4MGKR 3PU6A 2VTDA 4RV9A 1L8XA 1M6HA 3T7AA 1R6VA 4H3VA 4AQYB 1PW7A 3PIIA 1T9KA 2IEAA 1ULHA 3GEHA 5EJFA 4CT0A 4DLSA 2PD3A 3L18A 3IBSA 3NBKA 3TK1A 1AKWA 3DONA 4LKOA 2VPZA 1AA9A 1V4BA 2ZIFA 2YHBA 2H57A 3TIFA 4PLWA 4WERA 1HE3A 1LJ8A 3QEOA 1H5UA 2F17A 3GRPA 1ZH2A 2LP4Y 3ITDA 1LLUA 2ZRPA 4L5CA 5E4TA 3AEYA 1US8A 2F90A 2P79A 2ZRJA 5BSMA 3PCXA 1CLEA 4W8HA 4F9GA 1B0PA 4GKAA 3WBBA 3Q0IA 3KEQA 1DT3A 2B4TO 5DBFA 1LVUA 1UBFA 1YK0A 3LHKA 4DEXA 4PNEA 3R9WA 1SXGA 4CHGA 4US2R 1Q17A 1W1IA 5IMBA 4E4RA 4LDQA 3A9SA 3AYZB 4J0EA 3LPDA 1Y98A 1T6XA 2HSGA 5AUQA 4MKGA 3RT1A 3ZCQA 1ST2A 3MJVA 5BQXA 3GPBA 1Z22A 2D3WA 1PYOA 4J0FA 5LZ7A 4Q6WA 1T9GS 4NZYA 4RIHA 3WHKA 4BBAA 4HO1X 3ZIUA 4G0VA 1SC1A 1URPA 3RS9A 1S4QA 1T9BA 4EA6A 3ZVLA 3MMXA 2IOFA 5LNK6 4UHHA 4B3JA 4XVCA 5K0ZA 4REQA 4GM0A 2GZDA 4HDOB 3KKKA 2WYUA 1SCDA 1VFNA 3E61A 2ZCVA 1GPMA 4WZAB 1VE5A 1LBSA 1RP7A 4JFAA 1C0PA 2WT9A 1ZM2A 4NZPA 2EXXA 2OLEA 3EFOB 1D4OA 4BFZA 2HNBA 4H7FA 1GGFA 1NPTO 3QY9A 3L4EA 5LSAA 1KNXA 2P2SA 2J6IA 2R3SA 3FUCA 1LJUA 1I7QB 4RVCA 2I3DA 1E2LA 2GJ8A 1YIOA 5ALVA 1YRBA 3EK2A 3K92A 1EP9A 2ZJOA 4A0SA 1OILA 1QORA 2AZ4A 1UJMA 2QD1A 2WHXA 3KEFA 4UHJA 5KAMA 2HK6A 3UXMA 4CIWA 3ORYA 1PJCA 1VYVA 2GAIA 3B1KA 3V46A 4HDCA 3NI2A 3HU5A 5HFJA 5JAUA 2V5VA 3RYFB 1Z2NX 1IUOA 2CEKA 2EX1A 2GM3A 1QP7A 2B1JA 4BQPA 2WNSA 2OQRA 3UCFA 4AZSA 3V2GA 1DC6A 3IAFA 1QLJA 3MBKA 1N3BA 2DPLA 2JD0A 1TCBA 3BHNA 2VJQA 4IY1A 5AK0A 4EUNA 5HJ5A 3DT8A 4E21A 2DF8A 3CPJB 1IAVA 4JP5A 4WDRA 1C1DB 3AF2A 4KAJA 1NRWA 2W0SA 2FN8A 3IEVA 3IEMA 2QYHA 2X2FA 5HQTA 1SCBA 2FWAA 4UVDA 1QVAA 4MWOA 4YAEA 1R5BA 3VYUB 3D6FA 5ICFA 3HZZA 3CRW1 4NAHA 4PR0A 4EITA 5CFOA 2ACKA 3SY8A 1U8UA 5K0CA 4ZP1A 2QTAA 3FX2A 2NAPA 2D8MA 3Q10A 4ITRC 4ND5A 5EESA 2DFTA 5D86A 2I71A 5KJEA 4F1JA 3DVRX 3EPRA 4F6LA 1X38A 2VS1A 2JLVA 2ZEJA 4V0ME 2O7NA 4BNGA 2VJKA 4TMVA 1ZVQA 1VHJA 4R2XA 4EG7A 1XTVA 1FMLA 3NWBA 3CW8X 3GJQA 2KLBA 1A9SA 4DZRA 3W6UA 1HSZA 3OURA 5FRDA 1I2DA 2SKDA 3P0IA 4Q4HA 1YBAA 1PNQA 1L7NA 4ENVA 4P7JA 1N7HA 1QDUA 5AVWA 1JKFA 1KFBB 4GMDA 5CXQA 5JY1A 2PPLA 4AN1A 1U7XA 4DBLC 5I7UA 1D6NA 3EFOA 5BW5A 2IXAA 1BCRA 5DXJA 3SZOA 3O91A 4EEKA 5I7OA 1ZINA 1JFTA 3CO0S 2BZ0A 4AXBA 2PR7A 1FSSA 4JYCA 2X3YA 2HNKA 1VRCA 1JHVA 1NI3A 1UPFA 2OFOA 4RXTA 5IZCA 3N87A 1EH5A 2I4MA 3AHJA 5JADA 3L2OB 1O3YA 5DYIA 1J9EA 4M0UA 1PGPA 1JXMA 1XDSA 4QPPA 4ZOEA 5EKDA 4P22A 3WRXA 4JVOA 1U4SA 1IXZA 2CEAA 1LBEA 2P2CA 4UC0A 4LRXA 3RYFA 3WLTA 4F8YA 3ZXUB 1O97D 2Z2ZA 5IUJC 5M04A 4LYGA 3DTYA 3M6LA 4MYUA 4ZVSA 4B5KA 4D8WA 1QJ4A 1TU3A 3S0JA 4DUGA 4ZZ3A 1XQXA 4MUJA 5AOVA 1K3FA 2Y1LA 3HJRA 3DBOB 2C00A 4L74A 4OJMX 2Z8ZA 3RHTA 2QQ0A 4HEA6 2FPIB 4EM6A 3LX4A 4JODA 3UCEA 5JISA 3HKCB 4W6ZA 3IE1A 2VWQA 1GZ7A 5IN4A 4UHDA 4EGJA 5C31A 2E4XA 2ZJYA 4ZRMA 3D5QA 5BUZA 4FEGA 5WRFA 1FDSA 2D1QA 3K0AB 4ZTBA 5A04A 5JSKA 3D8TA 2DBRA 4FZJA 4TM8A 1ZR4A 1CX9B 1Q16A 3UT0A 4BVKA 1JFVA 3TZHA 3HZOA 2DWQA 5FUMA 4D43A 2JGDB 2X1MA 1IWOA 1QMPA 2FY8A 1E3JA 3EAFA 3R20A 4GVXA 1Z75A 2Y0DA 4JMLA 1MC4A 1LPMA 3BTVA 1ATZA 3LO8A 4AWAA 2CSUA 2R6FA 3M1AA 4ERNA 3QTTA 2PD6A 3EA0A 5HOQA 5LPNA 2B2XA 4QYXA 1GT6A 4PX3A 2PM8A 3I42A 5I9SA 2A0XA 1WLSA 3B6MA 3F4BA 2C04A 1J7JA 3IQGX 3QU7A 3FWPA 4QU9A 1U6KA 1N1DA 2FQYA 2I6XA 3FYUC 3WGLA 3RJ5A 5J2UF 1U9YA 5FPPA 5CB8A 3T5AA 1P7PA 1PD0A 2QE7A 2I2CA 1ZMRA 5BSUA 2VHCA 4OP2A 1UDCA 2AB0A 5CA0F 1JFFA 3RLIA 3NH6A 4XX0A 4RE6A 5JAZA 3RC9A 3F1KA 1TVMA 1B6GA 1OLSA 3JYHA 4ZJUA 1JHOA 5JCOA 4EFLA 4ZXFA 3BL8A 1QU3A 2JGNA 2OG2A 4IQGA 1EYZA 2FX3A 4FLEA 2BJVA 1GRVA 4M8NE 5AICA 3T15A 3PCTA 3UHJA 4NEHB 4O02B 5HZKA 1DO2A 2QTVB 1N8SA 1QFJA 2PANA 4C4AA 1K8XB 3LW8A 2JLZA 3LBNA 4BAUA 3T0IA 1U0OC 3K8OE 2PKXA 4OXIA 2OUIA 4MDYA 3HKCA 3OHMA 4WUVA 1DPGA 4XYEA 1CNFA 1BROA 4E7PA 3P9YA 4EKIA 1IM2A 3PD0A 3SXPA 3EUFA 1M7GA 2AWOA 4JJKA 1VGRA 4KYVA 2IIVA 2J8ZA 3O3NB 4GMGA 3K0AA 2XZOA 4H4EA 2Q2VA 3ZCVA 3KR9A 5A9SA 1UWKA 4IS3A 2FCRA 3BXFA 2JHCA 4RKFA 4JDUA 2AEEA 2V0CA 4YAJA 4X94A 1X7YA 2WHEA 3JQBC 5CB6A 5AI9A 3AUSA 1QDEA 4JBLA 5E1OA 2FVYA 4EI8A 4MCAA 1PZNA 3WOVA 2YJ5A 5TMBA 2ORWA 6REQB 1TQHA 1XMVA 1S4MA 4LNUB 3P2OA 1U99A 3SGLA 2Q2OA 1TL7C 2HIMA 3FRJA 3ZK7A 2JFHA 3EWNA 4RY2A 2Q5FA 1IEVA 2FSUA 4I19A 1XNHA 4BKMA 1AM4D 5EHXA 2FWIA 4UUAA 2RGAA 3M4NA 2QUHA 3BILA 2TMDA 4Y7CA 2GPJA 1MIOB 4B7AA 4DQUA 1OH5A 2PO7A 1QDLB 4ZT4A 5JSUA 1CDOA 1WCXA 3GUZA 3DMYA 4CF5A 4Z1MD 5KQGA 4YREA 2I1VB 2NVBA 4YPVA 4JYPA 2I2AA 3SHTA 3R3XA 3L40A 1FP7A 2R86A 3MT0A 4QX6A 1GKLA 2CNKA 5J59A 2CV1A 4KGZA 3HJTA 1E6CA 3NYIA 2VZ0A 4X1OA 4YO8A 2BFFA 4CKZA 1NOIA 1E89A 2OGWA 1F51E 1Q77A 4DWVA 4I9FA 3T4EA 1ZCBA 2G7ZA 2HEIA 3PGJA 4MQBA 5ALXA 3RQSA 2V6GA 5IVPA 1QG0A 3D3JA 1O5IA 3P5SA 1Q0UA 2VQ6A 5F77A 4AY3A 1HT0A 4EPXA 3QG1A 1VJTA 4NYIR 4DUPA 1NVGA 1RS0A 2QJFA 4JELA 4I3GA 1IEWA 1A5BB 4HQFA 2NM0A 3HXTA 4UATA 2WLSA 1Y9JA 1SAYA 3ELBA 2JARA 1NC3A 1OYVA 3RNOA 3VTAA 5EEGA 3PL1A 3K20A 2JH9A 3NEAA 3EARA 3ELDA 5EP1A 5JSZA 1YZHA 1KZ4A 3PGLA 1B6TA 3AHEA 4D3ZA 3DEHA 2F1HA 1AQIA 5JRDS 4QEKA 1AXRA 1SCQA 2ATXA 3JQGB 1MC1A 6REQA 2Y1KA 3MHTA 2R68A 3GI1A 3NP7A 1ZL2A 3IQEA 1Z17A 2LV8A 1J42A 1DRUA 3AX6A 3GOHA 4MP8A 2AQ8A 2EYQA 4U5QA 2VP4A 2EWWA 3A6FA 4KFUA 2WJVA 5I7AA 2IEIA 3ICEA 1TU4A 3DT9A 2MSWA 1YZNA 3RUAA 3ZK9A 3UHPA 1OFGA 2WSSD 3DXZA 3E82A 3QNWA 4P3XA 4D0RA 1EFRD 2HA0A 2O8VA 5GQSA 3V8VA 3WKBA 5BN4B 5JQGB 3FMPB 3ND9A 4P3KA 1OF1A 4WEQA 2IV2X 2VSOA 5BRAA 4PHHA 4XGIA 2OGTA 2YWBA 1J0CA 2R6HA 1NKVA 4X54A 4QNNA 2PKQO 3M8KA 4TQGA 4ZAGA 1LS6A 1OYOA 3QV1A 2AMVA 3S44A 3QV2A 4CDNA 3ILXA 3KLNA 3EGIA 3WGZA 1V35A 4FE4A 5FTJA 5T4FA 5TPZD 1A8IA 4X65B 1NM5C 2QQ5A 2YZ7A 3NFRA 5HRUA 3GQBB 4CODB 2FVXA 1KBZA 2Z2IA 4P0TA 3VU8A 2WE8A 1SCIA 1XJCA 2EF0A 2YXBA 3E9YA 3QBJA 4FYXA 1ADYA 4N1AA 4FYKA 4GMFA 3U80A 1IATA 4IIDA 1AGNA 4FCWA 3ZS9A 3VDMA 4EABA 3H13A 1NDUA 2DVMA 2JGRA 3BIWA 4DFDA 3W5DA 2LIPA 3FHLA 4ARZB 5J63A 4GPAA 1LZLA 4CYMA 1PNVA 4CL2A 1BSVA 3QLUC 3SM9A 3SEFA 1KOJA 4PGFA 1E2KA 5HYVA 3ZEAA 5CDUA 1JDBB 4LQLA 1PKEA 2P1ZA 3FKSD 3VGPA 3MIZA 1MEEA 2R6AA 3QUTA 3UHAA 4ABYA 2AFVA 3HXPA 3H04A 3KCQA 4RYLA 3TQIA 3GRYA 4IINA 4D9EA 1KEEA 4GL4A 1N34B 5CTAA 4OV6B 1J07A 3BPSA 4RD4A 2F1IA 5C8YF 3SBXA 4W1PA 1RQ7A 1CSEE 3SEAA 4ZVTA 1GPAA 1OY1A 1BXZA 3LUAA 4J6EA 4OHKA 2HEGA 3KM0A 1WDKA 4TX1A 4EF5A 4WZBA 4CHTA 4EMBA 4K6HA 2BAGA 1NBHA 4RDHA 4KI0A 4A03A 4XYMA 3NXSA 3BHJA 2J7PD 1N2IA 2FNAA 4EUEA 3AP3A 4EG0A 2GCOB 1WQ4A 1W88B 2O7QA 3M5PA 2VDWB 2IHZA 2OB2A 4MAFA 2GDJA 3HRKA 4IUBS 4WXMA 1M2HA 3CWQA 1AKMA 1CDDA 3TQRA 2UZ1B 1UDBA 1R6BX 1ABFA 1N2SA 4DDUA 4EZIA 2VDUE 2EG9A 5F4ZA 2PUCA 3GXOA 3C1AA 1PTJC 2AMJA 1I14A 3KO8A 3TNYA 1J00A 1FPQA 2CNOA 2I65A 3LUKA 4KV7A 4ZT3A 1FRQA 3NIWA 4UNRA 1YFJA 2H5EA 4DTIA 3KKLA 1KJJA 2B8JA 3C4JA 3GQBA 3OE7D 3CG4A 1OFUX 3HDJA 4FU0A 4GC9A 1HKHA 4MVJP 1F8YA 3HBJA 3MJSA 4F4JA 2O06A 521PA 1JEAA 3RIYA 3FF1A 2B6HA 3IR5A 2GM5A 3CUSA 2QXYA 5FI3A 1SCJA 3SKVA 1V48A 5LWHA 1MHTA 1F8XA 4D9GA 2ZSIA 1HOXA 1BQEA 5CIWA 1NPYA 3STYA 3ZC3A 2IS4A 3WYCA 3X1WA 1JDNA 2R7KA 3MLEA 3Q7TA 1GPBA 2VUUA 3U1VA 1BJRE 1QYXA 2AUTA 4UFOA 2BBTA 2RKOA 2L42A 1KPGA 3F7NA 5TNXA 4F21A 4D5GA 3KJGA 1A77A 2FUG6 4RK0A 2V7XA 3EGDB 2JCBA 3UJBA 4BLOA 2XMQA 4DR4B 1BS9A 1VXRA 1DG3A 3EIFA 5GZ3A 4K0KB 4PAMA 2A1UB 4O0LA 4Y9SA 4JAVC 1BWSA 3LWZA 4PYIA 5LQRA 3V2HA 1QRUA 1FXSA 4FBGA 2UKDA 2BFBB 3FD8A 5FBRB 2XGOA 4TV8B 5C2JB 4J75A 4YUYA 4MQ4A 4P0QB 1A97A 3OM8A 1S0UA 4H9GA 4FI3C 4GSYA 1C3OA 2PZKA 1KO7A 1M7HA 1MENA 1MUUA 2AVDA 5REQB 4M2LA 3U7JA 4AW9A 4CUJA 1YVRA 4NHEA 1ACLA 3FHJA 5F1OA 5HRCA 4FN4A 3FUXA 1RHKA 2O2DA 4TV9A 2BFDA 1QGDA 1UBJS 5AUPB 5JBIA 1W88A 4DILA 5CDSA 3ISJA 2DEUA 3CHYA 1NBAA 1E7WA 4UEJA 1JLKA 2AYYA 4PM4A 5BSTA 3IFSA 4HBZA 6ADHA 3Q41A 1EFKA 3V4FA 3M6FA 3ZTWA 1D2HA 5BY2A 4HXGA 3O8CA 3M4ZA 2XVYA 2ZYGA 4K6MA 5K09A 3HVRA 4MGHA 3TVTA 4IH9A 2XADA 3I5AA 2FUCA 2WOJA 3QITA 4PE5B 5C7YA 5LJIA 3ZNQA 1R8YA 2Y4OA 4Q12A 4TKUB 3C87A 2WM8A 4ACBA 3SSAA 4FFBB 1QH1B 2H5IA 5CT4A 3CVUA 2VG8A 1DCMA 1FDRA 1GPJA 1SGWA 2W48A 5TMPA 2XCRB 1ZNZA 4KREA 4J7CA 3K4HA 5BORA 1N5LA 3ZI0A 3GBVA 3PC4A 3EVZA 3RAJA 4B35A 2BGTA 1BGXT 1RU3A 3C0KA 4ITVA 4ZCTA 3OFND 1RACA 3OZGA 3TLGA 2IHNA 3ZGZA 4KIFA 4WXHA 3SDSA 4KL8S 4II7A 3IP8A 1EGMB 2IA5A 3NHFA 4PFJA 2PBZA 3HSSA 2QI9C 4F3KA 5C8ZA 3TD9A 3DA8A 3OTWA 1YQTA 5J4LA 2JJ1D 4PNPA 3JD1A 2A1UA 5H16A 3AVOA 3OT1B 3T9FA 3THOA 1RC0A 3U0VA 1RYDA 3WLAA 4HNQA 4JFRA 2XAAA 4J0QA 5G3ZA 1VSTA 3MBIA 2MJLA 4Q9JA 3SS9X 5I8PA 5JI3E 4J0GA 1N36B 4TV8A 5TIIA 4QJIA 2YWCA 1KI9A 4DLVA 2Y99A 1EZ4A 2PZ8A 1TYAE 3TIVA 5JJKA 5CEFA 3IUMA 3NW9A 1YKSA 3P0EA 3A6KA 3FKJA 4DV3B 4UUQA 2PLNA 3E58A 3O73A 2PYIA 3WJ1A 4R1PA 1VI2A 3VSBA 4DMFA 3I30X 2F8MA 1M8FA 2KQUA 3U7QB 4D8TA 2FMTA 2X3UA 1XU9A 2NACA 3WGVA 4E5SA 1YA6A 3NDBB 1EEXB 1X2BA 3H1FA 2Q6IA 4RGQA 1RM3A 3NKLA 5J4YA 1J9ZA 2DSNA 5BQOA 3OUTA 2P4HX 5TGTA 3JD2A 3OA2A 3TR0A 4D82A 1RWXA 4L4YA 5JNSA 3H4TA 1H4VB 1S3FA 4Q03A 3WXBA 5HGXA 5KMGA 1R6DA 1IUPA 2PL1A 5JVDA 2HLNA 1LW7A 1S2NA 3OIYA 3Q9SA 4MS4B 2B5OA 1EVZA 5AKXA 1JHXA 2OHFA 3I05A 3MK31 5KC8A 2G71A 4PINA 4TKUA 2GI4A 4NC9A 4QJ3A 4R1QA 1Z7EA 3AHFA 3GHYA 3NH9A 4KDCA 1QH1A 2JJ8A 3NASA 4LQCA 4MHOA 4PIVA 1KYTA 2AK3A 3FNGA 4WLUA 3SG0A 4D25A 2PUWA 3EODA 4JJ7A 3FDJA 1ZONA 4KSBA 2C9DA 4PHTA 2CJPA 3UMSA 2WWYA 2DJ5A 1JWBB 1VB5A 1T1EA 2Z09A 1T9GR 1BDJA 4FJ1A 4Q1CA 5JH7F 3OQ1A 2PXCA 2NVOA 1ZIPA 2Q6VA 4ZO6A 1R4AA 4I55F 3QLEA 3MHPA 3MTIA 4F6RB 3TECE 4KQWA 3NANA 3ZD6A 3OQIA 4OMCA 1VBMA 2WSSA 4ZOQI 5JU6A 3TOSA 1EFRA 1L5HB 2GBGA 1MAUA 2VT7A 3HZHA 4ZO8A 5JFTA 1NN1A 2FZ5A 4GI7A 3T1TA 3WGHA 3U39A 1SUPA 4N3NA 4FB4A 3PT5A 3KOZA 3VV3A 3E4CA 4EHNA 5CVCA 1MC8A 4KUGA 1A04A 2XH8A 1H9BA 3QVVA 1PR1A 1XK6A 2RAPA 2VKTA 1G16A 2I2WA 4IJVA 4LC1A 3WFIA 1NLMA 1T6NA 5AQEA 2FJPA 5TPZA 1OB5A 1FCJA 4JGBA 4CQNA 3THYB 1R4NA 2R1TA 4WA7A 4YCDA 1QCDA 3L6OO 3OESA 1YIAA 1ND5A 5EE5B 3S27A 2GKOA 1NSTA 4UW9A 4EFNA 5KJ1A 2DUMA 1TZBA 4JVNA 1R9GA 4UTZA 4G1BA 4FS3A 5JEDA 3AGPA 4HX9A 3TL2A 3UKJA 2GCGA 4H3KB 4M1ZA 1OTHA 4BASA 4LSGA 3OZDA 5CA1F 2EGUA 1YE3A 2HREA 4KXXA 5B53A 2WTEA 1Y37A 4OI1A 2Q1XA 5ECGC 4G37A 1CQWA 3UPTA 5CYGA 4MS4A 2ENUA 2ZB7A 1P2TA 3FKSA 2XYVA 1KEPA 1N3YA 2IIBA 3GK3A 3HVKA 4M9SA 5BQPA 3QYPA 4AKEA 4B3IA 3BCHA 1L8AA 2Z30A 3R5FA 2PJZA 2NT4A 4QHSA 5SICE 1DUSA 1VP9A 1NLZA 3FFAA 2C1XA 3GAMA 4MRPA 3RS0A 2FWPA 4Q0MA 1LPPA 2PSFA 3OE1A 2P3LA 3OQJA 4QXMA 5CFRA 2FX5A 1I3LA 1KYYA 2AWNA 4IXNA 2C7BA 2I0FA 1TQ4A 1EJBA 1E4OA 1S3SA 3DMNA 3FPCA 1RFGE 2O3JA 5GM1A 3PJEA 2DULA 3SEQA 4X66B 2PKRA 1RRCA 2BGGA 1JDZA 2WUWE 1P8AA 3IHWA 2J7KA 5TPWB 5EIFA 5FNZA 4IYJA 3D81A 2XZTA 2J7PA 4RMGA 4F6RA 4QGGA 3PFBA 1R50A 1HQDA 3JWEA 3QVMA 1LQTA 3QVLA 1H0HA 2AD5A 1ML3A 2JDIA 2VHEA 1VCMA 1TW2A 1YACA 3H83A 1ODTC 3TKYA 1FFAA 4J7AA 2OD7A 4XVQA 3CLUD 1AQNA 2QTTA 4BGIA 1ISGA 1KKLA 3AWDA 4K6CA 1NW5A 3KPWA 4TVOA 3OEED 3F5SA 1CW2B 4FNGA 3UHFA 1NR5A 4YI5A 3U7QA 3GBSA 4M6WB 4GBMA 2WJGA 2NP6A 5JWOA 4B44A 3RKSA 1U8XX 2IIPA 3HDHA 5TXGA 5HIJA 2OOSA 3HUFA 4MEBA 1F60A 3EY4A 3FGZA 5DCLA 5IPFA 3F1LA 4NWIA 5KDDA 2HC9A 5CD9A 2ZBGA 3EF1A 3NXKA 3K0EA 3RUIA 4M53A 4CM5A 5DM60 4P53A 5U4XA 4C7VA 3MGGA 1EG2A 4BX8A 1Z25A 3OPYA 3LUCA 4MS1B 5FQOA 3W0LB 2RMKA 5FWYA 3FTCA 1ODSA 1TEVA 1LPBB 2Q3FA 2H06A 1D0VA 2E49A 1W29A 4MIKA 4W9NA 5AVJA 5AM3A 5C1PA 3KKEA 3D3WB 3G0CA 1TT5B 1U2EA 1W4ZA 2FSVA 2O7SA 2IL1A 3GF4A 3N75A 4URFA 1JHPA 1YTLA 5EZ5A 4YQEA 4GGPA 3NAQA 3F49S 3O1IC 3VUEA 4C3OB 5CEJA 3KQOA 4YP6A 3ZVNA 1U04A 3QWHA 1KFCB 1WCV1 3I3SR 1XTPA 2D7JA 3MRTA 4J2OA 5HZMA 4RTRA 4FGWA 1YL7A 3O8OB 2BKXA 1CF4A 2BMVA 3L1UA 2FZVA 4F4IA 5F7OA 1BIFA 4AZ3B 3AM4A 2XT6A 2L17A 2DFNA 4IF4A 4P7KA 2OCYC 1QZZA 1IQPA 3AIKA 1E94E 3D6HA 1CP2A 2ERYA 3OX1A 2Z04A 4B46A 1P7VA 1WR8A 1UK6A 3QE4A 2XOKA 1ZOLA 3DH0A 2XXAB 3RTGA 2BCGY 1R0KA 4LZAA 4RYDA 3UWOA 5GVSA 2X9LA 1Q0TA 3RVMA 2MU1A 1SVNA 4UUOA 4MGYR 1T2FA 1CHNA 1B4DA 4ZAFA 2IODA 3VGJA 2R1ZA 4J1TC 3NBUA 1GTMA 1YGPA 2HF9A 1ECPA 2HGZA 3PE3A 4LJ7A 1TZKA 2QVGA 4HOYA 3WQSB 3FGNA 4M6WA 3VR3D 4BV9A 2YMLA 3G1WA 5EJ2A 5AXDA 3R7SA 2XRZA 1MX1A 3KQSA 4TWJA 1TM2A 5ELMA 5GIOE 2FR0A 2HWWA 2LXNA 1GKUB 2P4QA 4HLDA 4KXQA 4X97A 2ZRIA 3ETDA 3WMWA 4IIUA 3SVZA 2MT9A 3EZ7A 3GJ7A 1YKGA 2IEYA 4HXEB 3WS7A 1SC4A 1ZL0A 3E9NA 4DV1B 1SQGA 4X8OA 1FY2A 2ZIVB 2OCLA 4KO4S 5K0LA 1UZUA 3N70A 3FB1A 3OFNA 4FUQA 4ZAVA 4YASA 2FR8C 3H2GA 4G3XA 4MS1A 4RTKA 2MSNA 2WYHA 5F35A 1CIJA 4EMUA 3D7LA 5D5PA 2EBFX 4LWQA 1E6WA 1B0UA 4ID9A 2O1XA 2E37A 4JVSB 1ULSA 5ALYA 2IF0A 5IWCA 1TT5A 2JJ1A 4BVBA 3RAGA 5FLXA 3HDTA 3A27A 4TMZA 3I5XA 5JQGF 2X19A 5K9ZA 3DUWA 1TAGA 2ES4A 5K8LA 3F73A 2CXSA 1OU4A 1JDJA 1EGQA 5H3LA 4AULA 2GT1A 1ZN9A 1IZ7A 2E4VA 3H5AA 3WNZA 3K5IA 2EZ8A 1RWVA 3CM0A 4GKVA 4KRYA 4AS3A 3ORFA 2C7QA 5DIFA 3Q98A 3D4IA 4BO3A 2BVNA 3PRYA 4OQFA 3I62A 1EA5A 1J21A 2B5WA 3PLAE 3KD2A 3KQVA 3T0GA 3PGVA 2JI7A 3A6GA 1HXHA 1UEIA 1K9VF 2KBFA 4I36A 4ISCA 1KARA 1L3BA 4GDMA 2ICAA 3R9KA 3DVSX 4B3TB 1EE9A 1LSUA 1VHQA 4IIHA 5HJ2A 5JAMA 1D6MA 3DKPA 4FQ7A 4MUMA 4O5AA 4QQKA 4DV4B 3QU5A 4QUGA 1XCGB 4Y7DA 4GVPA 2O3UA 5LQNA 2JCVA 5HKOA 3ZR4B 3LBAA 1DX6A 3GELA 2VATA 1DMRA 1KDPA 3D3KA 2IJGX 1MPTA 3DF7A 1LRLA 2P9JA 1O0CA 5SYAA 2BF4A 2X41A 3DEIA 4EGQA 1H4QA 4N3GA 1D4FA 1IHXA 3WOHA 1RCTE 1KVSA 4OQQA 3QEJA 4OLHA 2IP4A 5LP6A 2GJKA 2H1OA 4AD8A 4DIUA 2PXHA 1ZSNA 4Q16A 4BNJA 4CLXA 2QTLA 3GLSA 3KQYA 2HIGA 1IG0A 1PEAA 2C1EA 4BO1A 3K6RA 3LQQA 5B7NA 5HR5A 5DMXA 2PSHA 3I09A 3TINA 3MQFA 2BDTA 4O8ZA 3RYCB 1U5AA 2MYTA 2Q3CA 3EOAI 4WN9B 5DXAA 1R16A 4HT3B 3L4KA 1NIJA 1AUOA 4P3PA 3EF0A 1WCYA 1HE8B 5IAAA 3GMTA 2A86A 5BWNA 2J30A 1LNZA 3BMCB 3ZWXA 2GZHA 3OEWA 5L7TA 1R0SA 4MW6A 4Q4JB 2PLWA 4IZOA 1ZU4A 2NWQA 5DHTA 4RDCA 4ENWA 1TAHA 4YQZA 5CXXA 1HG0A 4NYMR 4DY4A 5LDDC 1WUKS 3DVLA 5K0NA 4F60A 3CX8A 1J0EA 1RI3A 3ED1A 5KPJA 2FFBA 1A69A 3DOUA 4NX2A 2KE5A 3V3KA 1E3LA 2N1BA 3F3KA 4LZZA 2HMSA 4YACA 4LJ6A 1XN1A 3DFMA 5DHRA 3BXXA 3BE6A 2CZCA 5H7XA 2P2DA 1EX6A 4II2A 3SLGA 1P5ZB 1M9NA 4TKZA 5DGHA 3SZMA 3TSOA 5GOZA 3EH1A 1SB9A 4J76A 4FYMA 4HQNA 1X7GA 3EQ7A 1SCUB 3PDIA 4G6ZA 4P7GA 5JRZA 1AN0A 13PKA 4OHMA 5KSWB 2DXIA 3QKSA 1DRKA 3V3TA 3JAKA 1FQJA 5EIEA 5T7BA 1CE8B 5ITVA 4I2NA 1ZC4A 4E03A 2GBLC 1O9BA 3L0PA 4HV4A 5CDTA 1EVQA 1YQXA 1LSJA 2I3ZA 4UMVA 5FWNA 3H9CA 1XXHB 3CVYA 4LNHA 4LF8B 1XAGA 3QX7A 5FA8A 1QYDA 1H1DA 1I1HA 3L7KA 4BGDA 1CUCA 1U81A 4YP7A 2V6MA 5IZCC 1GU0A 2YYSA 1DWUA 5AKZA 1PJ8A 3Q3VA 3WRXC 4C0AC 2RCNA 1TLFA 3HEMA 5T3UA 5H0IA 1WUJS 3E9QA 3DC7A 2J87A 3PXBA 1QJCA 4ND7A 1T3LA 2YY7A 5AVSA 3RYCA 1YS9A 1M34B 2YQ4A 4OY3A 2QD2A 3GVPA 3K2BA 4AT1A 4PLPA 2FK8A 4TZ6A 3FA2A 2NMVA 1E2GA 3MT7A 4YCCA 1GGNA 1V4NA 5BR1A 2HWKA 3T1OA 2X7XA 3C3KA 3KETA 2C3PA 2XMPA 1MN6A 3QBEA 4URHA 2GEUA 4Q4JA 4MWEA 2CLEB 4GXNA 3IVRA 4Z54A 5LM3A 5IVIA 3I0ZA 1K7YA 2I34A 4DBLE 3I0MA 4C4RA 3L07A 1DOZA 3KQPA 4KC0A 4F06A 4KB5A 1ZA2A 2C3YA 4KR2A 1U3CA 1ZMTA 2F1JA 2YV1A 3STTA 1HLFA 1V7PC 2OXRA 4JJ4A 3L0CA 3QHPA 1RBMA 3K9GA 1ZGZA 1RMTA 4UBKA 1IXRC 1QP0A 4AKSA 4QD3A 1U0LA 1NJFA 1JLMA 1O0SA 3LM8A 3WMGA 3MWJA 1MDBA 1QC5B 1BS1A 2EQ5A 1L5GB 1PK8A 2BMDA 2GBIA 4QYWA 5DWDA 2CSXA 5HKBA 5IF9A 3M9XA 4CF3A 1LXCA 1PT9A 1YQEA 1ZUHA 2EJBA 4D6PA 4BBJA 2FMIA 1Q1AA 2PIDA 3CIFA 4LRSB 1QE0A 4YJHA 3GT3A 3N76A 4O2BF 4HGZA 3P52A 1A95A 1VPEA 1C81A 5E1BA 2ZTVA 4BO2A 1ZJZA 3I1IA 5G1OA 1CE8A 1AKRA 4DCMA 4DY6A 5CDFA 1VL0A 4BN0A 5IULC 4LVUA 5EINA 3PQ8A 3W5HA 1SOAA 2RDMA 3BN3A 1XXHA 1I6MA 3LV8A 3RKUA 1Z6GA 3B52X 3SMQA 3R77A 1VE6A 4CTKA 1XAHA 2I54A 5DB4A 5IBPA 2AG6A 2G9QA 3BL5A 3DEZA 5BN5B 1C0LA 2VJDA 1SULA 2GDZA 2WP8J 3GT0A 3THWA 2FLWA 2YXLA 2IYZA 1EFVB 4HQOA 4B9AA 1RQRA 3WDMA 3F7MA 3EC2A 4OYRA 1QMGA 4J16A 1M34A 3NVKI 4CXMA 4O3MA 3U3DA 4B7ZA 3FPFA 1EP1B 5ED0A 3B1VA 3W5SA 4E5NA 2VQSA 1ZVVA 1QYCA 2NVUA 3K2IA 2UZ3A 2ZITA 3D4NA 3D7KA 3WGJA 2XE6A 3DOFA 4CE6A 4TSRA 3OIGA 1UIMA 1EDDA 3G2LA 3Q1KA 5ED4A 1WDLA 1MAWA 1MJ5A 3M34A 2JL1A 4WRRA 2HU7A 1WOMA 2NG1A 4MW4A 4NBRA 2HH9A 2XKBA 2OO7A 3CEMA 1SBHA 3GZTB 5EVJA 2ERCA 4LV8B 1E9DA 3BFKA 4GX0A 3D2BA 2VKQA 4N6GA 3S3TA 4BLQA 4DCCA 1UZLA 4C1NA 3FPSA 2A0FA 4JLVA 1I3CA 5BT8A 1PL0A 3SDBA 2RE8A 2DX7A 1FXWA 1Y5IA 2GLXA 3S55A 2RGGA 4NU0A 1MCZA 4XCXA 3WO1A 1ZNXA 1N1MA 5I4BA 3KWLA 5BV0A 1QVRA 1FF9A 1VI6A 2HTFA 2NUPB 3WHIA 1U7OA 2BKLA 3UJ8A 4WNYA 3T9BA 1DBQA 3QKTA 4ZJPA 2Y3IA 3C14C 3UPUA 3MOIA 4RV5A 2G1UA 2VH5R 1IOLA 4U7GA 4KZKA 3DB2A 3VHXA 1F2DA 2JHPA 3VPCA 2BMEA 2R1VB 3OIDA 1Z88A 2NO1A 5HZGA 4V0KA 4CR6A 2I7XA 2JFWA 3GLUA 1G60A 4EP1A 3EYAA 2LCQA 1ZGJA 3GJ3A 1ECCA 4P80A 4E11A 4PGAA 2XMCA 1VOTA 2YS7A 4HYYA 4I3HA 4LQDA 4Y6SA 2GQ0A 2OCAA 2XUGA 1XCMA 3X2FA 2P0EA 1NJ5A 2J9FA 2RAVA 4AECA 1VJCA 1EQUA 3IBGA 5DDIP 5JANA 3PTAA 1O6GA 3KUDA 2DKOA 1EFVA 1MORA 3A9UA 3EIUA 1T5OA 2PAAA 3BWCA 3P2KA 5FNVF 3VI3B 5IJWA 3UGJA 4NDAA 2HD4A 4PC2A 5FFMA 3V6LA 3EZLA 2E4ZA 4L8LA 3QKWA 2O2EA 2FG7C 3DHNA 2JFVA 1G2IA 1X1AA 3VDQA 4EPVA 1GZSA 1NSFA 3LPLA 4HVTA 3HI6A 3MJDA 1IZZA 3BUSA 4OLBA 1Z9BA 3IPXA 4Y0VA 4ER0A 3HBAA 3ESBA 2GXQA 5KVQA 4K9QA 1Z5WA 3NHRA 3RF6A 4BVJA 1P2GA 2NTYC 4JXZA 1RXIA 1U7ZA 4RPCA 1U98A 2XMGA 1AB6A 4D0LB 1T5TA 4EX6A 1DIRA 1O6BA 1ZNQO 2WTBA 4NULA 1XTTA 1XOIA 1KWKA 1A2OA 1MO4A 4EECA 1ND6A 4YCSA 2YDYA 3RRBA 2HRQA 5FPSA 2AX3A 1TJ3A 2BHRA 2WP0A 1M2VB 3L43A 3LMKA 5BURA 1GWNA 3KR2A 4HAXA 2J07A 4RWZA 5D01A 5J58A 4KR7A 4C7OB 2GOYA 2AEFA 4RTMA 1J49A 2JZNA 4HFNA 1MP0A 1QHHA 3PRKE 3I73A 3WGIA 4YRSA 4J07A 1DE0A 1WB5A 1WXFA 4B43A 4UBNA 1C0EA 4D1YA 5FULA 3EQZA 5FTLA 3U7HB 3QLVC 4AAYA 4X62B 3BA1A 5FYDA 3ZZTA 4UFNA 1CYEA 2B4RO 1DX4A 1M8GA 3N6XA 4C3UA 3H75A 1NJ2A 3OCUA 3DMPA 1OI3A 3QWIA 1N7JA 1GFZA 2VRBA 3RSGA 2B4QA 4ZGBA 1GPLA 4LFAB 1KFEB 4F5EA 1MDFA 4AFNA 1B41A 2J0QA 3DVQX 2YICA 1ODLA 4BQEA 2F3PA 1Y82A 1O96B 2WJIA 1UOPA 4G9BA 2IDZA 1R0BA 2QRUA 4RZXA 4DRXA 4PC3A 4ZU1X 4WNAA 3VXKA 1O1YA 4X61A 5CIQA 1L4MA 3AIOA 3ADOA 1D2RA 4YT4A 2NV6A 1N2BA 3AM3A 5HJ7A 3SR0A 3TGLA 3DC2A 3NT4A 4G2TA 1UBHS 2B99A 4C4PA 5CNMA 5CLJA 1MGOA 4MKIA 2F4VB 2J3LA 1WE2A 3ZZ1A 3W9BA 2Q28A 1KAGA 4ZVQA 3MUOA 3NMUF 4BMOB 1QF6A 1SCKA 1II8B 1FJ2A 1FNBA 4OHXA 5I9IA 1CLUA 2WJ6A 1O4WA 1FFSA 3E0QA 3MMZA 1PHRA 3EVNA 221PA 3OQPA 4CM1A 1AZSC 1J2TA 1N3IA 1IONA 3K5PA 5JOQA 1VHDA 2O3SA 4AICA 5MN4A 2HZBA 3FI9A 3S6JA 4BFSA 4XFKA 3TL3A 1KQGA 3SS7X 3LHIA 4I1UA 4BNZA 4C7OA 2GMWA 2P1DA 2VOJA 4LPSA 4Q34A 1S9DA 3NKFA 4YRKA 3BOSA 3O3CA 4S05A 1C8KA 1SVKA 2ISCA 1VRVA 4L8FA 2VDQB 4OJTA 3FN4A 1ZMXA 3CYFA 2YV3A 4FGSA 5IVKA 5AJZA 3I6BA 3RVRA 2Z43A 5DM2A 4D80A 2E85A 4CMEC 5AWFC 1QHEA 3I4CA 1DDOA 5T67A 3UM9A 3P32A 1AV7A 1M0SA 4Z9BA 1Y5NA 1E3MA 1U8CB 1GO2A 2OCPA 2D1SA 1UXHA 3QH4A 2NZ8A 2BI8A 2J45A 4W5WA 3K70B 3DLAA 3HZRA 3ELWA 5A4MS 1AXEA 2GUGA 5E95A 621PA 1YZTA 1XBTA 2C4MA 5KUTA 1O96A 4PV7A 4QSMA 3CZPA 4ZYXA 1GL6A 2HA7A 1HDCA 1ZWKA 4U7TB 3ZGVA 3H86A 4DNOA 1IZ8A 1MFZA 3ABQB 3AHCA 2GTHA 4B2PA 4DPKA 3FWYA 2R4QA 1EP2B 2Y1DA 2DPMA 1GCAA 4XGKA 1GXSA 2IGTA 4WQMA 1SHJA 4CPDA 4MUNA 4FSHA 2W83A 4OX9B 4OQYA 4NU5A 5TSDA 4XLTA 5C3UA 3OQNA 2O6HA 3PFCA 1GPNA 4G97A 4GQAA 3FMGA 3LWNA 3M4JA 4O5OA 1NQWA 2QJOA 1JDBC 4HLCA 4HGQA 1DL5A 5ETJA 4DWWA 3TRDA 1FYDA 1V9CA 8GPBA 4QEDA 1HBJA 4DVJA 3CO5A 2EWVA 1RLUA 1UJ6A 1B0AA 4CQMD 4UPVA 2RD2A 4B09A 4NSNA 1JILA 4HQLA 4LWPA 5EA2A 2AFIB 3WL4A 5BPHA 2CLCX 2HSWA 3BWEA 3EH2A 4H31A 4HTFB 4OAPA 4OQNA 4WIAA 4JYBA 5T6MA 2WHYA 4M8SA 1YAJA 1LFDB 2QP4A 2JGEA 4M36A 5DULA 4EFDA 4J1NA 1XPRA 3V2IA 1E0DA 4GH5A 2GETA 1DB3A 2H4WA 1E7MA 1IXKA 1FDTA 4A6XA 3CVJA 4ETWA 1MB4A 3I9FA 4PSUA 4MGEA 4WT7A 3UTCA 2PH3A 4FBMA 1C8BA 3ITEA 5CFMA 3JR3A 4MI3A 4W5JA 4TTIA 1N8KA 4F11A 3CZ5A 3Q6NA 4MQLA 1HK7A 1SVUA 4IS2A 1AA6A 3TSZA 1DUIA 1HC7A 3X1JA 3URKA 3CZQA 4XSGA 5GV7A 1IAQA 2H63A 3V6MA 2AD1A 5ECYA 3VR1A 2C07A 3JQDA 2H92A 3N8NA 4L27A 2PMBA 3GJXC 2YWHA 3H19A 3PYLA 2DOKA 1PTKA 4LHSA 4OBXA 5EXSA 3A4MA 5DNEA 1UBSB 4JOBA 3KVRA 3MBOA 1W47A 2NU6B 3R23A 1EVJA 1DG9A 1GG9A 1JQBA 1Z6AA 1KJNA 2EFHB 1T1RA 3R4VA 2IH5A 4OAOA 1ORWA 1VG1A 4L5BA 5I9TA 5LMZA 9LDTA 3FHOA 1KK3A 4RJJA 1NZDA 1RW4A 3IMKA 1J2JA 5EC8A 4U2CA 5JWRA 3MJFA 4QBKA 4HXYA 1LBHA 4KQKA 5D85A 3EZNA 3R3UA 5K3CA 3MS4A 4HDRB 3DE0X 1VDMA 1REQB 1MKYA 1P2VA 2PKYX 4Y6LA 2AVNA 3HFRA 3IAM6 3JTEA 4PYLA 1BE1A 1DEXA 3CTMA 2QBYA 1W76A 3A26A 1FDUA 2OKGA 5TEWA 2AFIA 3JRWA 1U4OA 2HJ9A 4IEEA 4K6OA 1U2RA 3Q6MA 5B2ZA 5JO9A 4HTFA 3SXUB 3INGA 4HJRA 2M2IA 1W9HA 2G80A 2HQ1A 4IP0A 4RKQA 4BCCA 4Q9KA 4C20A 2V55B 4MUIA 3AERB 4LTMA 3GRZA 1OPXA 5FL3A 4YXFA 4HATA 4AJ2A 3KIPA 3D6AA 2I3GA 5I9BA 2AF4C 3KDAA 4F2PA 2ZIEA 5FV4A 4S1WA 3EXG1 4POOA 3T1NA 4TKVA 4RVFA 1YRLA 3P0JA 4ZYWA 1U7DA 3P27A 3W5AA 5ALHA 3LCCA 2AW5A 4E09A 3OZIA 5GY7A 4NYIQ 4S1PA 4JI0B 2AOWA 3V8BA 2IW1A 2OCBA 5IVDA 2ZETA 2YXPX 5KNDA 3WKEA 3L8YA 4NCIA 1AKYA 1PV4A 3CLKA 3JAMA 1U28A 1WW2A 1Q5PA 3COZA 4QGFA 2X14A 5G0UA 2HSDA 4MCHA 3T8YA 2ZSEA 5AW5A 4K6GA 2NU7A 4HY3A 2NU6A 4FKBA 4P54A 2IYNA 4FE3A 1TVKA 4WLNA 1YFLA 1PIWA 1T0HB 2ZSKA 1P61B 4UFPA 2WINI 4FUTA 4Y2RA 3AY7A 5CLQA 2IOHA 2CN1A 3N0TA 5H59A 3T3MB 2WVHA 5LB4A 1AH2A 5G0SA 4XUDA 3ZJVA 1DAFA 5LLTA 2LPMA 3U40A 1PQ4A 1I3NA 3B89A 1H2AS 2V6IA 1E2DA 3TPFA 4HDRA 1NW9B 5A3JA 1REQA 1RXCA 3BEDA 3D2LA 3DOEA 2W00A 3K9WA 1CWUA 3UOWA 4E46A 3M3PA 4NV0A 4ZU3A 1JNYA 4J1SA 3PFGA 3W5IA 1KAHA 5LDGA 1FLAA 3H65A 3WL5A 4YDHB 3IP9A 4U9HS 5ALLA 1NN5A 4DJJA 1XVUA 2JC3A 1S8NA 2XODA 2WUDA 1D2NA 3AVPA 3COPA 2OBMA 3IEIA 5IEBA 1QQAA 1QR6A 4YQFA 5C1OA 3AERA 2C20A 4DM3A 5JRJA 5KHOC 1G8SA 2BGRA 1ZZGA 3IIIA 4I7EA 1U3WA 3NHUA 2JFGA 3O9VA 2QTRA 3QEAZ 3KXIA 4M60A 1V2GA 3BIFA 5FHRA 1J1UA 4LVOA 1XRLA 2CKDA 3PNKA 4ZZIA 4GBED 1YGYA 4G5XA 1Q74A 2A94A 1BAPA 2VJMB 1L5SA 3OKCA 1D9XA 1NBWB 2BBOA 2C8VA 1VQ1A 5AJUA 4F71A 4KN5A 3T41A 4FX2A 3K31A 3I6ZA 3D7RA 1HE2A 4HH1A 1YVEI 4OL9A 4ZKEA 3V4OA 3ZWOA 1YL6A 2QL5A 2W4QA 3DP9A 1D0IA 1YS2X 2I1WA 5IC5A 1FK8A 2QPLA 4II3A 3DYIA 3CSUA 4CKWA 1N0HA 5KVVA 3ENKA 1EE2A 1UQRA 3FF4A 4GF5A 4Q01A 4B74A 1QS0A 1JFSA 1TKCA 3KSBC 1PEKE 1Y3HA 2VVTA 3C5VA 1W19A 4KRXA 2HRRA 4HNUA 5FUQA 4P4NA 5L6LB 3U31A 5K3DA 1I13A 2FSPA 1EBFA 3H2YA 5EMKA 3G5TA 1C2YA 1GRQA 2AG1A 3FHTA 1NYRA 2ZI6A 2C2ZA 4KBGA 2FRDC 1PFVA 1U9IC 2ONYA 5BYBA 4YJDA 1WTAA 1DIAA 1CY4A 1YA4A 1Z7WA 3RVNA 1E3QA 2V7GA 2ZJZA 4ZEMA 5BW4A 3PIRA 2LE0A 1M75A 4Q3OA 1J09A 1P62B 1PDWA 2P7HA 2JAPA 1AF7A 1LGYA 4OAQA 2EKZA 4Q7LA 5B7GA 3HM9A 3D8SA 3SXJA 4RY0A 1VKNA 1NHWA 4JU9A 5BXYA 2ODPA 3PUXA 4ZCLA 5DGIA 3GH3A 4ADSG 4RHUA 4QFMA 5K20A 3W1EA 1FFGA 3PFKA 2QUIA 1Z4QA 2X13A 4XLLA 3D3EA 5KTOA 1F8FA 1IHYA 4J3JA 3KJXA 4UCWA 1Z29A 3A4VA 3FZGA 2W2KB 2QVLA 4M9ZA 3X0DA 3U4MA 2R7AA 4DSOA 4N3BA 2X5NA 1BN6A 1POWA 1X77A 4AL4A 1GDDA 1P33A 1T36B 1YK1A 1MV8A 4DLAA 4QTYA 1QLWA 4N0PA 2J9GA 1SHKA 4Q7QA 1Z56C 4I1OA 4DMKA 3JQ8A 1CPYA 3IOCA 2PA0A 2OLKA 3BZBA 4HYQA 3WAKA 1GSHA 3EUAA 1VG8A 3AJ8A 1JJAA 2AN1A 1Z16A 5I5EA 4LRWA 4M1EA 1N9GB 1FL9A 3EW9A 5CT5A 1T5LA 3H1BA 2PN1A 1UFRA 3HMKA 2VJMA 3RCBA 4WECA 4UM9D 2XCUA 3OCWA 2N3ZA 1E79D 4TWAA 3RU7A 3RRXA 4D9HA 5I51A 4YQYA 3TOVA 1DRWA 1ODCA 1VYUA 5CIYA 3O6VA 1KSFX 1L7QA 1MO5A 3B7WA 3CLTC 3ZV3A 1XZMA 2PGXA 3EN0A 1CTQA 5M29A 1T25A 3MUNA 4UARA 1GQYA 2I7DA 4W9NC 5TJ9A 2AQIA 4AJ1A 5JLJA 3U5TA 1CT9A 1EDEA 2IU0A 4JJFA 3S4YA 2FSVC 5B55A 1LK5A 1SUCA 1LTKA 4LCEA 4IJWA 3SQMA 5HF6A 4C5AA 3B7PA 3UW1A 1MJNA 2VNKA 8LDHA 2WPDD 3T7IA 1IDN1 4E15A 3VU3A 2LD4A 2NAFA 4ZEWA 3UC5A 3OWXA 2GK4A 5C5CA 2CNDA 5FOUA 4B47A 1S7GA 2CCGA 3OHPA 4GLBA 3Q8WA 3B38A 4F93B 2O57A 4PCUA 2XE4A 3ENVA 2INGX 4CM4B 1WRBA 1EFAA 1DC3A 2FMHA 4WI1A 4NMXB 3H6GA 1PJRA 3F71A 4FONA 5BRNA 4BNDB 4D3FA 5IKEA 3GMIA 1FS6A 1K75A 3D2CA 3IVAA 4LBYA 2W2KA 2CDAA 2WYVA 4KUEA 1V16B 2D6FA 2HJWA 2R7NA 5B37A 5JSYA 5T6BA 3UOGA 1CNMA 5DRYA 1PR2A 2DH6A 1T36A 1ZIXA 3WKCA 2IBTA 3KOWA 2IXBA 1JG2A 4X3PA 2W8BB 5DN6A 4XYLA 2A0WA 1UDWA 3KQMA 3PENA 4FEYA 4PZLA 4QHYA 3L6RA 1O8CA 2LRHA 2PRJA 1BHSA 1M7BA 4IDQA 2BD0A 3BXGA 4OFXA 3VBEA 4EL5A 1GTRA 4IIVA 2ZR7A 2DKFA 2XWBF 2Q0SA 3PE4A 1N9GA 3WNBA 3T5PA 1NYQA 2PKQP 3I58A 4FT2A 2ZRMA 2G4VA 3EMBA 3ZWYA 1XI2A 4M7WA 4TRJA 4MKFA 2BM1A 1JI3A 1CUSA 1OGJA 1G2OA 2QJWA 1M5UA 4JT2A 2VDNB 3F96A 1CUZA 3S2YA 1EWVA 1AQLA 5I3CA 1QIHA 3ESRA 2B30A 3KALA 1SK9A 4Q4AA 4EG4A 2G28A 1BHQ1 1TCUA 3FOWA 4DSUA 1KSJA 4DR1B 3MJCA 4MUKA 1WXIA 4CIYA 5HUHA 3LT2A 2IPOA 2AH5A 3FDIA 3OIVA 1KK2A 1P4HA 3N59A 2BGKA 3LXUX 5JMTA 3L4BA 2IE8A 2Y0BA 1OWLA 4K87A 1FP6A 2VNJA 3K5HA 1E5TA 1Z6TA 1ZITA 2O0MA 3HDGA 3HVIA 1E3TA 4X9XA 5EKUA 3HO8A 4IXWA 4JQCA 4EPTA 1ACJA 1M2OB 1B1CA 3DAHA 2W71A 4LE2A 5JD4A 3ID6C 3WSTA 3ZWNA 4CM4A 4YCJA 1SD1A 2O23A 4MQMA 3LBYA 4S1OA 1QZXA 4EQ6A 1FE8A 4BZXA 1XMSA 2XECA 2O3QA 4P31A 3DV2A 2WG0A 1V16A 3OPYI 1CQIB 1HYBA 1M54A 4G81A 3BXEA 3RBXA 1L5MA 1M8JA 1DKUA 4BCDA 1UZNA 1ZM9A 3U3XA 3U4GA 3USZA 3N3BC 1DCKA 4WXRA 4MV5A 3I64A 5BRJA 3U7GA 4B5LA 5KPDA 1UPTA 1E9CA 5T5QA 3W2TA 1ZR2A 1E62A 1KYXA 3P94A 1NTOA 1NW7A 2PXAA 2OC9A 1PZMA 1S3GA 5BUCA 2QEQA 1ZESA 3GRRA 2ZYSA 4GGOA 5JG7A 4PSDA 4RBNA 4BX3A 4Z4HA 2YVAA 1K2VN 2GAFA 2LBPA 3CRRA 1S8AA 1U7HA 5ALKA 1SVMA 3M83A 1HQCA 5ER9A 1L4UA 2OY0A 3TSAA 5FWXB 4CEIA 2XMSA 2XYGA 3VMFA 4ND6A 3NHYA 1PQPA 1S8FA 2DFDA 3TLMA 3WFZA 3ILHA 5HX7A 2QSJA 2VP2A 3F9IA 1YH3A 2VJAA 4ZAWA 2BFNA 4ISBA 3TX6A 5AFSA 3NJRA 5EJ8A 3L0OA 2EL9A 5ESDA 4LE0A 3N8KA 4MR9A 3SN6A 1ENPA 2PJDA 3GOQA 2B21A 3VU1A 4M7RA 1SA0B 3DYVA 3CKKA 1O5OA 1X1RA 2V9ZA 3CRVA 4PTLA 4AZ0B 4J7UA 2IX3A 2O0HA 2VXCA 1ES9A 3K0CC 1XNRB 3NHLA 2ZT8A 3KKNA 4N3AA 1IK4A 2B2CA 2X6RA 2VSYA 3BXPA 3IQZA 4N7RA 3OBIA 1M2OA 4RS3A 3DJFA 3LNTA 2A4KA 2XRFA 2O50A 3V5NA 2FWNA 3RS4A 1T6ZA 1FRZA 3HYNA 2PKEA 2DBVO 2XD9A 3M82A 4C07A 2GZRA 4MUHA 3ZY2A 2QW8A 2VF5X 2E7ZA 4QOSA 2X0KA 1MG5A 2R4UA 2FGJA 3AI7A 3B13B 3BGOS 1G66A 1W59A 2G83A 3GZ4A 2IWHA 4NFSA 3U4QA 1H8HD 4P7BA 2OO5A 1DKRA 1VDZA 2CUNA 3HR4A 5TQ0B 2DECA 5AJVB 1SG9A 1TOAA 2HADA 2JGFA 5IDWA 1UP7A 3I2HA 3E5RA 3PPVA 1EK1A 1E2FA 1XRRA 1PGJA 2V6FA 4OYHA 3OX3A 1Y8RB 2PK3A 1QE5A 1N6OA 1UC4B 4P38A 5AI6A 4DYHA 3UAYA 4NDZA 3PF8A 2PT9A 1JKXA 3B12A 4G4GA 2BBSA 3N39C 1BFKA 1Y9DA 4J7XA 2QK4A 5A4IS 4OIMA 1DX9A 2GEFA 4OTZA 5JY6A 1Y3IA 4E30A 1NF2A 4ZC8A 3UK7A 1TUEA 5LQUA 4QT4A 1MXHA 1LRKA 5C18A 4RVUA 2HJHA 2HCJB 3HHPA 3SF8A 3A14A 3HB5X 4JB0A 4XVUA 3F5MA 1Y1RA 3CX4A 3HTXA 2GN8A 5BPFA 1OE0A 2RHMA 4JJ6A 1YR7A 1Y8QB 4NV1A 5P8WA 2X5XA 3RV3A 3P2EA 3GCGA 1AZWA 1VMAA 1ZNWA 3D3QA 4HNVA 4HDSA 5E1DA 4DXHA 4B0PA 4FHFA 3UF0A 2ATVA 4WZAE 4DC9A 1MFPA 2F62A 3VRHA 1B15A 1KNQA 4CR7A 1I3MA 5FI0B 4F45A 1RRPA 3BRQA 1HL7A 3K2QA 4U7WA 4UCQA 3VYSB 1YQ9A 4AZ0A 1AE1A 4PZZA 1M66A 4W5QA 2GERA 4V2IA 4B40A 4YFVA 4LDJA 4PZYA 3DCJA 3S2FA 3D6MA 3D43A 3VC1A 1VMEA 4MV4A 4ZYZA 4DHWA 2WD8A 1G63A 2WJYA 4RE5A 2XUHA 3GLFB 2P9CA 1DBSA 1SD2A 3QIVA 4PXYA 5KYVA 2YS6A 4LF9B 3A1DA 4OB7A 4Y9TA 2Q4BA 4DLUA 1QPBA 1XG5A 4DIDA 3CT6A 3EG9B 3RU3A 3QMPA 1F6DA 3MC1A 1LI5A 2HA2A 3EY9A 1E79A 2VHWA 4JS0A 2KWIA 1C1XA 4ZV4A 2R66A 2XGMA 1IY1A 4B7XA 4QUJA 4EY8A 1Y89A 5C9ZA 2H7VA 3CZ9A 3KQTA 2E1PA 1ENZA 3I6YA 3QW4B 2Q2NA 1GEGA 1XB2A 2ZUWA 4XWKA 2DETA 1G0OA 3E7PA 1GY8A 3EFHA 5A71A 2G5GX 4CKCA 1O87A 5ALDA 4X85A 4ZI7A 1XGKA 1YL5A 1Y8RA 2FPOA 2V0NA 4NCHA 4EVQA 2P90A 3RYIB 2VYFA 1HYQA 2WJPA 1A76A 1ZBDA 4UHBA 3ZWMA 2YN4A 1WV1A 4IQFA 3DFZA 1OPRA 3SE7A 4ATNA 5AVRA 4N48A 2ZQZA 4KO3S 3JVUA 4PO9A 4E13A 3JRXA 1NW4A 1PVVA 2HQSA 4U7PB 5DO9A 2OVFA 3T5DA 2O19A 4KH1A 4YLGA 5IP5A 1RYFA 2H2IA 4Z99A 2C77A 1KO5A 2OFFA 1P4JA 2QAIA 3AYXB 1NAIA 3WV4A 1V9LA 4R7ZA 1Y8QA 5DLDA 1HE5A 1YQGA 3W05A 4BVLA 5CMLA 2ZRCA 3TNFA 4IHAA 3KOOA 3CISA 3LC0A 2B4KA 4OA5A 1OLOA 1J2YA 3KKOA 4B6PA 5K0JA 1XEXA 3DPSA 4CFYA 1JPUA 4XASA 3NWPA 4IL5A 3IO3A 1N6LA 4C6TB 3H42B 5LUBA 3RD5A 1F38A 1U7UA 1UBLS 4KKVA 4EB3A 1HT3A 5B7QA 1P1RA 4YK7A 4F5WA 4HRVA 2QGFA 1QOQB 1E1NA 3QPUA 4NCNA 3WO0A 1WMBA 2VBCA 1PEYA 2AIRA 5ESWA 3V8QA 2W22A 2Z9DA 3QF4A 3LYLA 1KK0A 3GLFA 3C7TA 2ODBA 3CWCA 4G0XA 4NI5A 3AK4A 4BMVA 5D7NA 4PPGA 4Z6KA 1JN0A 2ZR8A 1QO9A 1WY7A 1Z2OX 3H1EA 4ID3A 4MTCA 5DBGA 3EG9A 3TB6A 3GCXA 4YRDA 4AUMA 1AIPA 4Y2QA 2YV2A 4M98A 3ROPA 4DREA 1GSIA 4CV1A 1Z8FA 1D5WA 4ZCPA 1VPWA 1XDZA 2HK9A 3A3OA 2AJCA 1N32B 2OZEA 3KSRA 4WBXC 1IQUA 4YRTA 1AB5A 1SVWA 4U0KA 5DPMA 5IJZA 1F6BA 4TL9A 2Q0XA 5L4NA 5CCEA 3L5KA 5CTJA 4JLUA 1WB6A 5DLQC 3KZVA 1TFRA 1UKAA 1ZN7A 3MTGA 5H83A 1M6WA 1RE1A 5MGBA 4NBKA 2GEBA 3DPUA 2V7PA 4GWLA 4YMSA 2PSEA 4BVAA 3S8YA 1XVIA 4R8LA