1PZMA

Crystal structure of hgprt-ase from leishmania tarentolae in complex with gmp
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
183
structure length
170
Chain Sequence
YPMSARTLVTQEQVWAATAKCAKKIAADYKDFHLTADNPLYLLCVLKGSFIFTADLARFLADEGVPVKVEFICASMLLDVRDSVENRHIMLVEDIVDSAITLQYLMRFMLAKKPASLKTVVLLDKPSGRKVDVLVDYPVITIPRAFVIGYGMDFAESYRELRDICVLKKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypoxanthine-guanine phosphoribosyltransferase
publication title Crystal structure of Leishmania tarentolae hypoxanthine-guanine phosphoribosyltransferase.
pubmed doi rcsb
source organism Leishmania tarentolae
molecule tags Transferase
total genus 53
structure length 170
sequence length 183
chains with identical sequence B
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2003-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1pzmA00
4M0UA 2VFAA 2FXVA 1ZN8A 2C4KA 1TC2A 3QW4B 3HVUA 4RACA 3GGJA 3M3HA 1ECGA 4LZOA 1UFRA 3ACDA 4Z1OA 4P83A 4P86A 1J7JA 4KN6A 4LYGA 1BZYA 3S5JA 5IPFA 1DBRA 1I5EA 4LZNA 1QB8A 5E38A 3EFHA 2JKYA 3H83A 1QK4A 1U9ZA 4RQBA 2H06A 4P3KA 1QB7A 2AEEA 1XTUA 1O57A 3GGCA 1CJBA 4RV4A 2H08A 2H07A 1VCHA 1OPRA 1P17A 1GRVA 2HCRA 3DMPA 1VSTA 4MB6A 3KB8A 4F8EA 5KAMA 1DKUA 2XBUA 1ECBA 1OROA 1A96A 1I0LA 4RADA 1VDMA 1XZ8A 1I13A 1PZMA 3MBIA 3NAGA 3ACCA 1QK5A 4PAWA 3N2LA 1I0IA 1HGXA 2PRYA 4RHUA 2DY0A 2PRZA 1NULA 1R3UA 1XZNA 2YZKA 3OZGA 1TC1A 4RHXA 1UPFA 1YFZA 3OHPA 1I14A 4P82A 4RHTA 2P1ZA 2GEBA 1LH0A 3ACBA 4WMLA 1ZN9A 4X45A 4P84A 2E55A 1G9TA 3OZFA 1HMPA 5HKLA 2IGBA 5BQPA 5EUCA 1ECFA 1QK3A 4X44A 4OHCA 1P18A 1BD4A 1ZN7A 5IAOA 1QCCA 1NONA 1BD3A 4P81A 1DQPA 1O5OA 4JLSA 1V9SA 1G9SA 1L1QA 3G6WA 1OREA 3LPNA 1XTVA 1WD5A 4LZAA 4RHYA 4RAQA 5JSQA 1A4XA 1A98A 5BRNA 5HIAA 1A3CA 4TWBA 1A97A 1P4AA 1FSGA 1Z7GA 3O7MA 4QRIA 1QCDA 5JV5A 1DKRA 1ECCA 1MZVA 5BSKA 1D6NA 1L1RA 2JI4A 3GEPA 5KAPA 4QYIA 1G2PA 1IBSA 1UPUA 3DEZA 1W30A 1DQNA 1AO0A 1Y0BA 4S2UA 2EHJA 1STOA 3DAHA 2PS1A 1JLRA 1XTTA 1P19A 3MJDA 1G2QA 4RANA 4PFQA 5ESXA 4FYMA 4IJQA 3LRTA 4WN3A 4M0KA 2JBHA 1GPH1 1U9YA 4RAOA 1A95A 2WNSA 4ZFNA 1ECJA 4M0PA 4RABA 4P80A 5K51A 4JITA 4RQAA 5BQOA 4QYIB 2JKZA 5ESWA 4LYYA 1JLSA
chains in the Genus database with same CATH superfamily
1QRAA 3SC4A 2XJ4A 1G4AE 1Z34A 3E81A 3M6FA 4ZO9A 4PZ0A 3TM5A 4DEXA 1X0VA 4G81A 1AQNA 1W4ZA 4GMDA 2UYCA 1ZGJA 2DERA 1X2BA 3FTDA 2ZJAA 4P9NA 1A5AB 1SEPA 3DYVA 3OJFA 5FBVB 1U9IC 2R8RA 5EMMA 4IIGA 3TEFA 4Z54A 1FNDA 5HUJA 2F1OA 4N0PA 4LRTB 1DAFA 2A9PA 4DGSA 4ENPA 1BQEA 7AT1A 4HMOA 4NFHA 2D3TA 2G6BA 4L57A 4E5YA 2Z4TA 3MYRA 4UVGA 3P0RA 1SQ5A 3MUEA 1FFSA 2R6HA 2NUAB 1Q0UA 1WY5A 5K4GA 3UBTA 1AQJA 1OAOC 3DKKA 2JANA 4DJAA 5MFZA 2R2GA 1KIMA 2RGAA 1F1BA 1U8EA 2Y1OA 3MGAA 5KSOA 1N78A 1PJ2A 3FKQA 2R6JA 1PEDA 4OREX 3ZXXA 5JATA 3R3JA 4CKCA 3ASYA 4NENA 2ARKA 4M89A 4Q1DA 4YV0A 2A58A 1K68A 3R23A 1COZA 2OAP1 2P3OA 3ZXUB 2FUCA 3EYAA 1X7ZB 4II7A 4BVEA 1ZJ5A 3MWGA 4P4LA 1SIOA 4LMRA 2XDYA 1Q7CA 4JHXA 3DHVA 4QGHA 2QROA 2ZREA 3GJ8A 3RS7A 2ETXA 3ZHYA 4CR7A 1NDUA 3HJBA 2VDLB 3QFHA 1BYIA 1FL9A 1T8PA 1UKEA 1IEWA 1YB6A 3IHLA 4Q15A 4WPGA 3ABQB 1R74A 2OEPA 3OOHA 3W4IA 1KEUA 2F1KA 3V1NA 5IJAA 3G8YA 3OBBA 3PDJA 3K1YA 4ARIA 5DBIA 1PT5A 3K73O 1P7PA 1C7EA 2X2OA 3T7DA 3W5IA 3IPLA 5ALOA 4EJSA 1XU9A 2R9VA 2XCOA 3K6JA 5K3DA 4Z2AA 3JTMA 4DBVO 1AN9A 1Z15A 1P1RA 1XDWA 2ZE8A 4RZ3A 2V4MA 3IVXA 3LT4A 1I33A 1PR3A 3L4SO 1O5OA 5IBPA 1W9MA 2FWPA 4YQFA 5A5GA 3LVQE 4P4SA 3SHWA 1MVLA 1XTVA 4NI5A 3KOZA 1JHMA 1XKLA 1FSFA 5TSDA 4DY6A 3HRIA 4I81A 1VHTA 3RK1A 1Z5NA 2JAHA 1ETUA 2O9JA 2VYQA 3O47A 2WOOA 4FDMA 5TLSA 2JA1A 4K6KA 2QMOA 4UU8A 3E23A 1KAMA 1X14A 3FDZA 3SDZA 5A5EA 3VYWA 1ISRA 3B20A 3DMFA 4G97A 4P7GA 1NDQA 3W5VA 2C2OA 2ZCUA 3NJRA 1M1NA 1WUTA 3U61B 5K0GA 4V0SA 3EIXA 1PS8A 1EVJA 1BCRA 1NX6A 2H7YA 3JD3A 2CLLB 1Z0FA 4Z9YA 3NOXA 2DH6A 1BA3A 1VLHA 3TW4A 4OI0A 3IIKA 2C8KA 2BN4A 2JBHA 4UFNA 5AJUA 2V5VA 2GCOA 5E4YA 3KLPX 4EIWA 1YASA 5C9ZA 1JKFA 2AHOA 2C9OA 4KYTA 4EYOA 4JV5B 1SHUX 2VH2A 3NHSA 4RHEA 3ON5A 5KHOC 3BXZA 3L6EA 4Y1RA 1R27A 2GNPA 2QDXA 4EGCB 2XQVA 3TX2A 2XCSB 2C4KA 1KY5A 4QU0A 4HDRA 2FXIA 2QMEA 3VNQA 4E33A 1HPLA 1Z5UA 5IAKA 5M04A 1N0IA 1VL8A 1NUAA 1O4WA 2H2HA 2QU8A 3KXKA 3NT4A 4FNGA 4IJUA 4F2DA 3RUPA 1FA9A 5AW5A 4ZZ0A 5DMXA 3OURA 4QBFA 3UKDA 1X3LA 1RJ9A 1BMFA 4O4JF 3NT2A 2IDMA 5IJ0B 2QLBA 4LXYA 2J8ZA 3IA2A 4R2XA 1RQXA 2QD5A 5ERXA 4C6HA 4XAQA 1EJBA 1N3LA 1XCGB 3OEED 3C8DA 3AF6A 5BR8B 5B6PA 4WECA 1R6BX 4MS4A 4L73A 1R9NA 4C14A 4DSAA 3DMTA 1XE3A 3I83A 5JDCA 2ZUFA 2BUCA 1Z3CA 2D54A 2XF2A 3SJ7A 5JYBA 2V6BA 3K7EA 2OC4A 4TQUS 4X3CA 4ES6A 5BNZA 2D3WA 4G3XA 2YHIA 2IY8A 1JDBB 3DFUA 3GXOA 3JQAA 5DT2A 2J45A 2LXNA 3AEKB 5DW0A 5AVXA 1MB3A 3HRKA 5JVDB 2V6JA 1RWOA 4F1WA 5JBNA 1JHZA 2DX7A 1XA3A 2IHTA 4M99A 1ZGBA 4JFAA 4Z4CA 3EY4A 2W37A 5L9AA 3SAJA 4MUHA 4L85A 1QRSA 1KDVA 3E8SA 2Q1XA 5JO9A 5A9RA 4GI2A 1ACLA 1U8CB 1DG3A 2FQYA 5M29A 3HP7A 3JVDA 2W6JA 1U0BB 2QP3A 5IT4A 1JHYA 4Q1AA 3G23A 3PXGA 3NT5A 3J7AC 4OP1A 5I4KA 2V97A 3FSEA 4UM7A 1P5JA 1VHQA 2CCKA 2R8ZA 3MCTA 5G1NA 3V8BA 2FN3A 4TGLA 3T99A 4F6LA 5KZMB 1Q0QA 3DOFA 1E2PA 2X7HA 2VXYA 2YC2C 4R98A 4HVLA 1KSHA 3FOAA 4MUFA 2AN5A 5EJ9A 2I87A 3V6MA 4EJ2A 2FQWA 2X9NA 2ZUSA 3GFSA 3WV5A 3EBPA 2PUHA 3CX3A 4U2EA 2RSLA 2JI7A 2J3KA 3QOYA 4UXJA 4CKCB 3A06A 4NENB 2V8OA 3QXSA 2IBSA 4BZXA 1IHOA 4B6SA 2AXEA 1NVEA 5ECWA 4J2TA 2AR7A 3C1AA 1ESDA 3UOAB 4HNAA 3NZEA 1X7YB 2IZ0A 3I23A 1U1DA 2FPGA 1NE2A 3PBKA 4J0JA 4MLPA 4TTRA 4PX5A 3WS7A 2RHWA 1YB4A 3K5IA 2YVUA 4JN6B 1TZBA 2UZ0A 3HYRA 2FYTA 3R5JA 4H4EA 1PN3A 3AYXB 4I5IA 4LRUA 3UTDA 1AA9A 3ZIAD 1BN6A 4AIRA 2GH1A 2O0JA 2BFMA 1FDVA 1XTSA 2JGJA 2VXBA 3OQVA 4M9QA 4DC9A 2FW1A 1GUBA 4M0PA 2EJTA 4CT5A 3WKEA 1K6XA 2B5OA 2VTVA 1YAJA 2WJWA 3NIDB 1KTVA 3T61A 2XMQA 3EAGA 1U7XA 2BCEA 2D4HA 3GRUA 1Y48E 1ZJ6A 1L7BA 2KS6A 2OV6A 1TLTA 3M8KA 4ZEWA 3GAFA 2NZ2A 1WBDA 3A4VA 3I04A 3JYLA 1SHTX 1DJPA 2WJHA 4R9VA 5L4SA 3E4DA 1H85A 2VYNA 2CFTA 1OQAA 4IGKA 3NMUF 4P4SB 4JKYA 1HX7A 2EXXA 4BO5A 2AG6A 2L19A 1QWOA 2CLOB 5I7FA 2X4LA 3UH1A 4KV9A 1XDGA 2O2GA 3H87A 4IHJA 4TV8B 1HZZC 1LI4A 2J46A 3UIEA 3V3KA 5HKAA 3Q15C 2GEKA 2RONA 1BS1A 3D3KA 4G0OA 3GNLA 4U6NA 5CEJA 1S4QA 4KQCA 5CFOA 1S96A 2HQ1A 2YL2A 4TXJA 4XJTA 4GLJA 1FXSA 5HCNA 4X7BA 2BHSA 2YW2A 1BXKA 4GI1A 4NNPA 4DMLA 2H4FA 3JVIA 1RI5A 3TUIC 3EH2A 2GZAA 2HMTA 2IIBA 1L5MA 4N0EA 2JAUA 1ADYA 1M1YA 2JJ1D 3ORQA 5CH5A 4M9XA 3AU9A 4RZ2A 4YRBA 1F8FA 2WF7A 2SBTA 1E79A 3DTVA 2Z56A 3YASA 5LDDC 1H3EA 3I2FA 4HGYA 2V7GA 3EGEA 2HHLA 2A78A 3B2EA 2BPOA 1ZW1A 2ILVA 3FTCA 3OECA 4U3JA 4DNPA 2GCOB 1IXRC 1NUQA 2PIDA 3IR7A 3SY8A 5JLJA 1W36D 3O8CA 2X86A 3KFXA 5LLSA 4DL9A 3A32A 4F1JA 5C5EA 5LU8A 1HY3A 1OIVA 1Z8NA 1TEHA 2XAAA 2NIPA 1AKUA 3NXSA 1NJFA 4H6XA 4KVZA 1RM5A 1Q44A 3PUWA 1PR1A 4Y1RB 5FUBA 1ZEMA 1BWPA 1G5QA 3FSGA 3PQ3A 1ULTA 2HU2A 2WVAA 1XWFA 3EVCA 2NO4A 3KQVA 1KZ7B 2YMPA 4L4RA 1I4EB 4KITB 2HNAA 2RGNA 5KJ1A 1AKQA 4ERXA 5CVUA 1QIKA 2BMAA 5ITSA 1LPBB 2E55A 2FUG6 3GRYA 3I8SA 5ULLA 3ZHRA 1RJ9B 1SC9A 1UDBA 1Q0RA 2P1RA 3KLOA 1CFJA 1RWBA 3MMXA 4ONEA 4J7UA 1TMKA 5SY6A 4HK4A 4ZVKA 2A94A 4UHFA 4R8RA 3ZCTA 1EG7A 3Q7TA 4MV9A 5DGHA 3K6RA 3KKLA 3S1SA 3IDSA 1O54A 1HTWA 1J00A 4HZGA 3WGGA 3KSDO 5JRZA 4TL8A 3IHWA 3KZKA 2JCBA 5CFQA 2FQQA 3AUUA 1R0XA 3MD0A 4C4TA 3BWCA 4B3IA 1H0HA 3RUDA 1S01A 4GEGA 1N8TA 2VOEA 2B92A 3IIEA 5C7IO 1XWWA 2F90A 5DIFA 1YULA 2YHIB 3IH5A 1UKCA 3C5CA 4DCSA 2JI6A 4JI4B 3GBPA 3P19A 5FWXA 2GCGA 2GSDA 2YVKA 3B1WA 1L1RA 2J3IA 3CEPB 3CPHA 3C6ZA 1SU7A 1D9XA 4MGIR 3VBCA 1E2GA 2Q3JA 3S27A 3DKVA 5BMOA 1TA9A 4FW8A 5GOTA 1FDOA 2GZRA 2X5KO 3DEJA 4Y1EA 3HV0A 5JADA 3ODPA 1ZD3A 2FP3A 4MDHA 4E2ZA 4KKXB 5KEIA 2FHSA 2A7XA 4JGBA 3H1TA 1KS2A 2AEFA 2OZLA 1POWA 1P7WA 3DMHA 1ZEJA 3PJGA 2DQYA 3JATB 3LCJA 1DXHA 4GC9A 4QPZA 3LOPA 4CUJA 5LB4A 3HXOA 4A0HA 1MRSA 2QOEA 5DK6A 4ZI5A 3IMGA 4CEHB 1MB9A 1HYEA 4NP6A 5H81A 4A36A 2NO1A 3N07A 3CWCA 3FHCB 4Q9AA 1NSYA 5SZHB 3RRZA 5CCXA 2P6PA 4NG4A 3TJZA 4TMTA 1R8YA 2OV3A 5BSTA 4YAEA 4B0OA 1MJHA 3KSBC 3E0XA 4X1KB 2ZSDA 3N8DA 4RMGA 5C4IA 3QE9Y 3PX7A 2HH9A 3D1LA 2J0SA 4ZVMA 1J24A 1SVKA 1A4UA 2HZBA 3K4HA 3VAYA 3H18A 2XITA 2OQIA 1A5BB 3AI7A 1ULUA 3HB5X 3L07A 4O02B 1BGXT 3STXA 5I3CA 3VHRA 3O4FA 2A6PA 1INLA 1AVTA 2YIJA 4YROA 5BT8A 1YE3A 1PT6A 1TKAA 3WJ7A 5EJ5A 4HNAB 4D8XA 1RAIA 3AVPA 3LUKA 1QC5B 5E7MA 2ZXEA 2BF4A 5BV0A 3WRYA 1EX9A 4G0XA 2G09A 3C5EA 4JLUA 3P71T 3UK1A 3V32A 3QUCA 2AA3A 4CLRB 5BXQC 4PRYA 2NX2A 2PKXA 4JSRA 3K94A 4BO7A 5IDXA 5JS7A 4F97A 1I4OA 3CH6A 1GRQA 1OTHA 1YJAA 2IRWA 2QN1A 2WFZA 1Z7BA 3LG2A 4BIIA 5JPCA 2LCIA 2OSVA 4IMRA 1CUXA 4B74A 4BRSA 4NCXA 2VP0A 3DOHA 3ED1A 1DKPA 1GQRA 1KOFA 2Y92A 4Q7EA 3TQIA 2J4FA 3HI6A 1E1QA 2OCXA 3HKCA 3HE3A 5IEJA 3T9FA 4BV9A 2EJVA 3PI7A 2GFHA 3CBGA 3H4MA 1P44A 1BVYF 4TSFA 1R0WA 4EHFA 1G9TA 4N5IX 4NCKA 2QQGA 1UWCA 4IHJB 1QK3A 4IXDA 2F3RA 4TMFA 3MM4A 2Q8PA 2ZJOA 2LV8A 4CU2A 1WSAA 4UOEA 1GQOA 2GM9A 3RBZA 2I5PO 4WEQA 2CLEB 3NASA 2EDAA 2FN4A 4KPGA 4LY9A 3QKWA 1QX3A 2P41A 3FNGA 1T4CA 2Q27A 4XXHA 1Z29A 3H5LA 4HFRA 5BUZA 3BFVA 1GL3A 3B36A 4DUYB 3PJRA 5FPSA 1J0DA 3DZBA 1IJBA 1GYPA 1OKKA 2AXNA 2W6PA 3G8AA 4E5SA 2HYIC 5A06A 1NBAA 3PP8A 1SKYB 4U2BA 3ZBPA 1M1YB 3OCWA 4YI3A 3QLTA 4WUVA 3NHLA 2OILA 4W5QA 2H17A 4PPFA 5K03A 1TKRA 2YFQA 3L7OA 1K5DA 1WPGA 4EJ0A 1YVRA 4EPWA 1IL0A 2A5DA 1LRLA 2VPYA 2RG7A 5EJ7A 3A70A 3DDSA 3IOEA 3R6WA 3WSVA 2HJWA 3W06A 4V1CI 1AKEA 3OTGA 4DR1B 2I6QA 3D0RA 1JALA 2JGKA 3ETDA 5HF9A 3NYRA 2CB9A 3D4LA 2O1XA 4MGYR 4WBNF 1I8TA 4RCYA 2JEYA 2W58A 4HH0A 2OCIA 4Y2RA 1K08A 1ZGAA 2JIBA 1T6NA 2FKAA 5CUQA 4YASA 1V48A 4DNOA 2D8AA 1WKVA 4BE4A 5C8YF 5J4HA 2IOQA 4EENA 1GU7A 3NTLA 2Q3CA 3GJ3A 3OZVA 1YUMA 3W3AH 1V96A 2W6CX 1MGOA 1E7MA 2B21A 1X87A 3AIMA 2AKYA 4BKUA 2ZRPA 1QYVA 3L4KA 1K8RA 3OSZA 1SCDA 2BEJA 4K9LA 3MUOA 4HAYA 3DYBA 2F48A 2Q6VA 4OAQA 4R69A 1NG9A 4D42A 3U7QA 4K9RA 3UATA 5CDSA 1U9IA 1H0KA 2OHXA 1MENA 6LDHA 3L8EA 4F12A 4H35A 3BUSA 3F46A 4BLVA 4ZPXA 4KN6A 2AD5A 4KZPA 5BYAA 3SYMA 2A1TR 4EB3A 1IQPA 1ZUNA 4EKEA 3ZTWA 3G0DA 2X5NA 5BXYA 2B37A 4EW2A 1DT3A 1E18A 1U98A 4PLVA 1OAOA 4WXEA 4CG0A 3HNPA 4ER0A 1KGDA 2H57A 2Z6VA 5F7JA 3GGCA 1T8SA 4GECA 3F6YA 3JPYA 5BN4B 1S8FA 4G1BA 4ZDKA 1EUQA 2ZBVA 5FYQA 1YDHA 3DZFA 5JSFA 2TRSB 3BD8A 4Z7OB 3GYGA 4FN4A 4X41A 3KKEA 2QL9A 4G07A 3ICQB 3AFMA 2I2FA 3W2IA 1WBJB 4QDZA 3FWZA 4ZALA 2OUIA 1OR8A 3C1OA 4C5AA 2OBFA 3LMKA 3N59A 3QX7A 4MARA 4FFSA 4X90A 1RKUA 1VLZA 2HGZA 1UJ4A 1F0KA 2OZLB 5IMBA 2JAWA 2C4NA 4BO4A 3GRZA 2GI4A 2R96A 2GRUA 1A9OA 1K5PA 4KN5A 2EEZA 5BNFA 4A0GA 4WJLA 3W5BA 4C07A 1E2JA 3GGGA 3UMJA 3ZE9A 2RBKA 1CRPA 5DWVA 3PQ6A 1Q50A 2PAAA 5I45A 1M2HA 5FAKA 4RTLA 2W90A 2GZ2A 1ZONA 4GZ6A 4DNFA 3DAOA 4ZO6A 2EGHA 3ZIAA 2RGUA 3RFVA 4QA9A 1A9ZA 4E70A 3ESXA 3TTVA 1OB5A 4H77A 1IHUA 2PGXA 1JZSA 2XQJA 4OMCA 2C54A 2FRDA 4WMLA 5AUPB 5D2CA 4A4DA 5CDHA 1T2NA 1TUIA 1XC7A 3HEMA 2IC5A 3TR5A 4B3RB 1IQUA 4GD3Q 1JHOA 4FBMA 4YUVA 3C74A 5C4MA 2EBWA 3ES9A 2WWVD 1JIVA 1BE8A 3IGFA 2GJ9A 1Z0SA 3L7MA 3NH9A 5I8WA 3GJTA 1BJRE 3IUMA 1ODJA 4B8WA 3GLFB 4LMAA 2QIPA 3KL2A 4I19A 1OREA 1UBEA 3HWRA 2Q99A 3L9WA 2ZRLA 1XG5A 4BAUA 3ZLTA 4J9VA 4DAOA 4BC1A 3E84A 3JRNA 4O4IB 4DDHA 1OFTA 3QFFA 3UICA 4QGAA 2OGSA 4WWHA 1KYYA 2SECE 5ALWA 2PUDA 2GF2A 1B3RA 3UM9A 4XDHA 2Z1NA 1UMCA 4F5ZA 1EXMA 3LDUA 5COQA 5TIIA 2ZWMA 3RRBA 2AEMA 2DBYA 3HBMA 5JISA 4IMJB 5CX1A 4WHMA 1O94D 3PI6A 1WV1A 2C82A 1FU4A 4MQFB 5ARBA 1OSNA 3HVKA 4ZT7A 4HXEB 2GASA 3LA8A 4RSMA 3T52A 3ZCXA 4Z4IA 2HIGA 2ADFA 2VYVD 2X77A 1RCUA 2WWGA 3PL5A 3QXXA 4OB6A 5TGZA 1PGQA 3JXEA 1GJRA 4FYMA 4V3BA 1Z0DA 1CUSA 2ZR9A 3BBLA 1E5XA 2A3NA 3NAQA 1QGOA 3NPMA 3P9CA 3PNSA 2HWWA 4OLBA 5BYJA 1F5NA 4R1NA 1E6KA 2O2YA 4FILA 5BSHA 4KPEC 1CDOA 4QPNA 2R6FA 4EA7A 3TQOA 1RKXA 3AFIA 3E9MA 3WVNA 3PGLA 3AB7A 2BF7A 1PP4A 2DKOA 3NOVA 3Q11A 1YE8A 4YH1A 3THRA 3VV2A 1AKRA 2VYFA 3VTFA 3EOBI 3VH1A 4YRDA 1E2UA 1KK1A 1IG3A 3EVAA 3MJCA 1E3IA 121PA 4EO7A 1G3QA 4FSHA 1TGYA 3KVNA 2NM0A 3AOGA 1RWWA 3GUUA 4GHWA 4GQBA 2VNIA 5FTNA 3OM1A 4MZXA 1PR5A 1YTLA 4DBZA 2VHTA 4NK5A 3H2YA 2JVIA 4JP8A 4M8IA 2W2XA 4NYMR 1RLIA 3S2SA 5BNWA 1F38A 1NPTO 1SUAA 2Q6OA 1K27A 3JALB 2HA4A 3KELA 4GMKA 5E1DA 2WILA 4KQMA 2AF3C 4F3NA 4XOUA 3H5TA 1PJ4A 2DH5A 3PGA1 2UUOA 2P2CA 3AIOA 1P60A 4RLSA 3HYSA 5A05A 4Q93A 4DCMA 3RSGA 2I6SA 4BNHA 1BE1A 3BCHA 1CEEA 4X62B 3FI9A 3K0KA 4DLAA 4Q4AA 1C8BA 4N7MA 3KQSA 1PT8A 1F60A 2HD4A 1IH8A 5KNCA 4PX2A 3VX4A 3A6PC 3JARA 2OAEA 3VPSA 4ZXPA 2AT1A 4R4JA 1PQWA 3AM5A 1TMYA 1PK8A 3ST7A 1PEAA 2IEDA 3LQQA 5L6MB 3H9BA 4KU4A 4RPIA 3E05A 1TJ5A 4HWPA 4HB4A 4CIBA 1ZH6A 1WDLA 1TVEA 3PD0A 4P3YA 4PIMA 2DUUA 4MA0A 5ERGB 3P2MA 1UAGA 4I1IA 2W6MA 4CTNA 4R0MA 1LJUA 2AUNA 3QEBZ 2VQSA 3IHKA 4TXNA 3BL5A 4R9UC 4UUBA 1BDIA 3ZD6A 5ALMA 2FWJA 1PK9A 4EFMA 3VXKA 4K9DA 3OFNA 1VCNA 4C9BA 1ZUNB 3PEEA 1F48A 3UPDA 1UWLA 1WMAA 1PTJA 1Q74A 2PLFA 3RVNA 3NM6B 3QSGA 1FE8A 1O87A 3H0KA 1J25A 3BAFA 2DBVO 3HCOA 3RU2A 4ZIRA 3U37A 3C45A 1EVZA 1CRZA 1I7LA 1N1DA 5HZHA 5DYGA 1TZKA 1AHHA 2JF0A 2BTOA 2GYUA 1XYVA 1C0EA 2P69A 2RK6A 3BXPA 5EWMA 4E13A 5FYDA 3WWCA 4DGQA 5C51B 2BKEA 1DC6A 8ADHA 2WQ6A 3PJDA 3TLZA 1H5NA 3DVSX 1XMOB 2JLRA 3CX6A 2ZYDA 1C9JA 4GUDA 4FOLA 3IV6A 1I9GA 3MTGA 3HR7A 3B3JA 2PD6A 4IIUA 1N2CA 4URVR 4AN4A 1R8QA 4KWEA 2PMWB 2HA7A 1Z2OX 4MI1A 3QYJA 1VE3A 1FJ2A 1JQAA 1FP6A 1V5IA 1VI6A 2GFQA 3RR2A 4A1FA 3MWEA 1XTKA 1JHRA 5IJXA 2WUWE 2XNCA 2OMEA 2PS1A 4AP9A 1XELA 4P3OA 2X0RA 3D7NA 1Z74A 2DBRA 2QI9C 4O3MA 2BLLA 2GUWA 4KRFA 4EL5A 4H4CA 4M88A 1CD5A 3AXTA 5EP2A 3CSUA 3ESDA 3DUWA 3WWDA 4D0RA 3R3UA 2G5TA 5DTQA 2J9FB 1VCMA 3R5KA 1X1QA 3NX4A 1LRKA 3WZLA 9LDTA 2C7BA 2Q9AA 1B00A 3HKDA 4QBIA 1XZPA 5ENVA 2GK4A 3LX6A 5EKUA 3TSWA 2QW8A 2RHJA 2J6IA 3MS7A 4JQOA 3T1TA 3D8HA 3H4IA 1UR5A 4PPYA 3K6SA 4ICIA 1SPXA 1DMRA 3L8ZA 1FYDA 4QUHA 1HZZA 1RQ7A 2JC3A 4AY3A 2G72A 3S8MA 3GT0A 1KP9A 3IALA 4YCMA 4KK3A 2I7DA 4AW9A 2CDCA 5LOVF 5K0CA 4TN1A 3A4NA 1PZHA 2CLHB 3AOEC 3E7DA 4TLMB 4HTAA 4L5CA 2JLBA 3F8SA 4UNIA 1I5OA 1JMKC 1ONNA 3DC7A 3UJ6A 3JYPA 1W75A 1XZEA 3R3HA 2G83A 2DUNA 4LY0A 1Y6GA 2BMJA 3IKMB 1MB0A 3JY6A 3O1LA 1MQAA 4LFAB 1P7ZA 3UQYS 1M33A 3TLBA 1PVOA 1P6UA 4MMYB 221PA 3ABRB 1QFJA 3QBVA 2VS1A 4GC5A 4UE3S 3UCEA 2FPRA 2QPAA 1FYXA 5LYJA 4M0LA 3TNFA 1ORTA 3B1KA 3HWWA 1QVVA 4LDJA 4IILA 4JDUA 4WCFC 3INYA 3R40A 2EQAA 5D3ZA 1I3MA 3P9KA 4IUDS 3LT1A 1R0ZA 4JMPA 4DW8A 5GQSA 2GTPA 5TXGA 4AY5A 1JMVA 4NS4A 1P73A 3DFFA 3F6RA 5ILGA 3ADCA 1RXSA 3Q7EA 1X1TA 2VO1A 2A33A 1HXHA 3KT0A 3NEYA 3PXBA 2JCGA 5AXAA 5B5SA 1D2CA 1PEKE 1N5JA 2OK7A 3IVGA 1RXIA 3NNSA 4RGVA 3T3EA 4YAUA 3QVVA 4BB5A 1JDNA 1YDEA 2Z6QA 1N7JA 2ZXFA 3BHJA 4PIPA 1JYFA 3WKDA 3W2EA 1V45E 3QFRA 4GOMD 4EY4A 3U48A 3NUZA 3HN6A 3G2OA 4BYGA 1YZQA 2IEBA 3EMBA 3OKCA 5D3QA 2Z2JA 3BGSA 3LP6A 1MOSA 3BK7A 3GEMA 5E8JA 4BAZA 2PN1A 3DTYA 4CM4B 3QQPA 3BYZA 4YT5A 3IT0A 5K8CA 5HIJA 3GZTB 1U4OA 4JBWA 2DPGA 3HUTA 2ZB3A 2OQVA 3SFZA 4Q4AB 1KKUA 1WUJS 3VZRA 4ZJZA 1YZLA 1DQYA 3JARB 3F5FA 5JAIA 1SVNA 4TRMA 4DTCA 4LNHA 5G3ZA 4LGCA 5K0BA 4OLAA 2G25A 3HYCA 3O2QB 4NOJA 1X9IA 3V7NA 3U60B 5JI2E 3L4BC 2OXCA 5K09A 4G0WA 4ND5A 3HPQA 4AVYA 1CY7A 1AXEA 2QRVA 2RIRA 1T5LA 1EJ6A 2NN3C 4ZRMA 3ZWAA 5SY4A 4FYIA 1V41E 1GTMA 3FLMA 3H2HA 3KJHA 3FPFA 1IU9A 4JQYA 2GLTA 3AILA 4QQKA 5L45A 1LFDB 1N4DA 3RRNA 2FOIA 2UV8A 2ZTHA 5LQRA 2V7VA 4OU4A 2ZIWB 1SXJC 3ABIA 4L6IA 4N5HX 3O03A 3ECCA 4JIGA 4RY2A 2OPHA 2N46A 2GCIA 4MRMA 1PZFA 3BULA 4BNTA 4PN7A 4R2KA 4Y6SA 4EYKA 4ZIRB 3SCZA 4OGKA 4BNGA 4HUTA 4RE5A 2X4GA 1IBKB 3AHIA 4RENA 4AMUA 3E1KA 2BZSA 2WUFA 4KSYA 5EWMB 4YAKA 4A6DA 2G4LA 1B73A 1PLLA 1E96A 3E9DA 3A6ZA 4L02A 3T3HA 2PG3A 2XCLA 1XTIA 3I12A 3N7TA 4X5OA 3CZPA 3DAPA 5KYNA 3T3OA 4HGOA 4CBVA 5A4DA 3JWHA 4CIWA 4OKIA 3TNYA 1R0BA 4LGMA 1J8FA 4BNKA 1SVWA 2A30A 2DZDA 3C8ZA 1U9JA 1J20A 1QQ7A 3G0GA 2I78A 3ONVA 5J59A 1XZCA 1LV8A 4CIYA 4HHEA 4MWEA 1COWA 2K6GA 3P94A 4RVHA 1N2CB 2P68A 4JSTA 3WLKX 2VUIB 4I9HA 1USGA 3ZN2A 1UC5B 1NSTA 3O95A 3RSFA 1EI9A 3LDFA 2IUTA 2P5TB 4UEJA 1NJ1A 1W94A 1ABBA 2HU5A 4FZ3A 4XJVA 2QTVA 3D6TB 3MWEB 2H48A 4ZZ1A 3CG0A 4JBGA 3VPCA 1ZXXA 3MPUA 4YLYA 1LSUA 1SC1A 1TYZA 3JYNA 3QUTA 3G2JA 4IYRA 4YCDA 4A23A 4CCYA 5HM8A 1BHQ1 4KN9S 3BHIA 4FVTA 3C98A 4UEWA 4AZ3A 1U4NA 3RTBA 4B6RA 5TMDA 5ALNA 4RESA 4WAUA 2GJ8A 3CE9A 5LBTA 2QM8A 4YQEA 3NEAA 4DJFC 1DX6A 4XUDA 2D1QA 4NDNE 5ELLA 3HKDB 5JBIA 2Y67A 2PL1A 1JT9A 4R2LA 1Q7BA 3GCWA 3PIDA 3R0IA 1DT5A 1E60A 1Y8RA 3D4OA 3VHLB 1WM1A 5CHEA 1RPTA 4IX1A 3GWGA 1KFBB 3UAYA 5ECDA 2F3UA 1QVZA 4UZFA 5AW2A 3K6SB 4OOEA 2ZUUA 3AKEA 2HHJA 3R6GA 4GEKA 4I9NA 1V3QE 1GAQA 4I0WB 5JNRA 1G19A 1FP2A 4GKBA 1VYVA 2J09A 4MRSA 4NMXB 4HXFB 2ZR7A 2QF7A 1YK0A 1WXFA 1Y42X 2HNKA 3SKXA 4YT2A 2FSVC 1TU4A 1B0PA 1QNFA 1RJGA 4MROA 1SKQA 1QRRA 1VOTA 1RM0A 2ZYTX 4NZYA 3ZZUA 1MN6A 3KQMA 5JOQA 3UMRA 2X3YA 3C3WA 1U81A 2I9PA 1SURA 1UMDA 1BIFA 5IJZA 3JAMA 5C80A 5ADHA 1T0UA 2NXCA 4FXOA 3ZU3A 3KFVA 4ER7A 4US2R 3CEMA 2DUMA 1C8LA 2HLHA 3LI2A 1FPQA 4TYMA 3NWJA 1FB5A 3D8UA 3T6KA 5THXA 4IIJA 4A2QA 3FHJA 1EK2A 4S24A 2WU3A 4ZK6A 3ZY3A 1GV1A 4AFNA 1QCDA 2JJQA 1AU9A 3AESB 3CR7A 1YB2A 5DULA 5LYJB 3IEMA 3CVUA 1Z26A 2W98A 5J40A 3TIVA 1H5QA 2LDXA 4J03A 1X1RA 5L3QB 5DK4A 2NUPB 1OHHD 2I8CA 3GCGA 4ZVLA 4YRRA 2PRIA 1SCQA 3KIPA 3HZHA 2WD7A 1GNRA 4HLNA 2EBFX 1A0OA 2EATA 1MJGM 3DEIA 3NORA 3WGOA 4E14A 3UJHA 4IQ4A 1LBEA 4DSZA 2CXXA 4JC4A 5EIEA 4CEHA 5LJIA 4ZTUB 1P0PA 4M0KA 1UPCA 1ZK4A 3LKBA 3KQOA 2BYTA 1RPAA 4MR8A 1H2YA 1A7KA 3FPKA 3U7IA 3WWPA 1DIOB 2RHOA 2CL0X 2HWXA 1QF7A 2PO5A 1JNYA 2PGOA 2X8LA 4NX2A 2JARA 5LZ4A 4LA4A 2H08A 3DAFA 5FNZA 2ZAOA 2CV2A 5HW0A 4PGFA 3RAPR 3NP7A 1LI5A 5IZCA 1QGYA 2PGIA 3QXJA 3IIMA 2P3QA 1NF3A 4WKOA 1M6EX 3DOCA 4B3DA 5I7WA 1BGVA 4YONB 2DKFA 3WADA 1DRWA 1FNMA 4JNCA 2IS4A 4IM7A 2R8OA 4L4XA 4MGEA 4PRZA 1BFKA 1N33B 4WFQA 3VYTB 1UMKA 1JX6A 2I71A 4R2WA 4ODIA 1CFZA 2JKYA 4K2HA 5LBIA 1A9PA 1X1CA 3ROGA 3UF0A 2FZCA 3P52A 4V0RA 3AVUA 2XJ9A 5DN6D 3WI7A 2G7ZA 2G8LA 3IILA 4TUYF 1ZXLA 3UHJA 2OBNA 4LJ7A 1FNBA 2E4WA 4W1PA 1XR3A 4DLUA 4ZEXA 2XLBA 3MAJA 3PHHA 2VJPA 2BFFB 2QRVB 3PPVA 2IS2A 4A2CA 3KFLA 1V71A 3DXXA 3NM5A 4RA9B 3VTKA 1JNXX 2C58A 1A96A 3FGNA 3MG9A 5D01A 3NAGA 4RH1A 4D80A 2QTLA 3BXXA 5FOUA 2W2QA 2NVOA 1RR6A 5CDFA 4KPYA 5I9MA 3DKRA 1GZVA 2IY9A 2Q62A 1P62B 3NHPA 4AKGA 2COEA 1D7AA 1A2BA 4Q9JA 3TJMA 2HSJA 1GPMA 1GD1O 3KHUA 4FINA 1KSFX 4MRMB 1HO3A 2DHEA 2E21A 4UTOA 3WLAA 2FW9A 1QX4A 1PQPA 1QG2A 1UXHA 3ZEIA 3A1UA 1EKXA 4FMDF 4K6MA 1XKTA 2C4WA 3OZWA 4OXKA 1WPQA 2ZI6A 4Y1FA 3H3FA 3KVYA 3ORSA 2VWHA 2RGBA 2OBXA 3GK3A 1KJQA 3MS4A 4NZZA 4QE3A 1I6WA 3DEKA 4IIVA 2NPFA 1J99A 4QBKA 5JR3A 3HSSA 2MSCB 3QEAZ 5J4KA 1IXZA 2BSAA 3CZCA 4I2NA 5DNVA 3SFTA 4RTKA 4O2AF 1VL1A 1L5WA 2PX8A 2OB2A 3OWHA 2K2QB 4GGOA 3G6WA 4Q21A 4WCDA 5EIFA 1ZM7A 5TEVA 2FN8A 3ZZ0A 4DRXA 1U9CA 4NULA 2ZJBA 8LDHA 3URKA 4WK2B 2QTVB 1KY3A 2H00A 2CMHA 3K1AA 1XEFA 1RHQA 3PC2A 4RKFA 1JVBA 1AGYA 1SHLA 1VFNA 1K2VN 1IQRA 2I1LA 5EG5A 4CCYB 3E53A 4DWOA 5B4UA 4PAGA 1OJLA 3LY8A 4FFMA 2WPDD 3KR9A 5DN9A 4ZV4A 1QZXA 4CTOA 1OVMA 5AHKA 4QG3A 2WLSA 4Y9TA 4KMOA 3HJUA 3JR7A 1RRFA 4K9QA 4RMNA 3CISA 4X3OA 3DDHA 2YNMC 4N0MA 3GPCA 4YDQA 4B32A 2F8TA 5HFAA 1PVDA 2VT3A 4TZ6A 2G1AA 3JD1A 3JQCA 4ZO7A 3VZPA 2JGNA 3I9KA 3T8YA 5AK5A 2A57A 1X70A 3NB0A 1U3GA 5FV7A 3KC2A 2C57A 2P3SA 4R2JA 5ESRA 3UA3A 4BMZA 4CQMA 4XDGA 1OGJA 3WMWA 5E3JA 4HMPA 1L8QA 3OOJA 2ATXA 2X19A 3IDQA 1GPAA 3QMMA 4FGLA 3GUHA 5FUQA 1Z73A 4X94A 4C3OB 1PQUA 2J5BA 2ID9A 1KDYA 5EXPA 2ZAYA 3TOCA 2XBLA 3ZIUA 2I62A 5ALDA 4AECA 1Q11A 1UEXC 4CDGA 1M2VA 3SVZA 3LRPA 4FB4A 5CLJA 2A0XA 1EEHA 1GR0A 1BDJA 4O4LF 3T0IA 1PHPA 5EKSA 2Z2XA 3GLUA 1ZQ1A 4KI0A 1L3BA 5F21A 4E5PA 3SLRA 3JASB 3AB8A 2Z2IA 4IIJB 4MIYA 3RF6A 5CDUA 5AMXA 5F52A 1EB9A 3ADOA 1K7YA 1YK1A 4N48A 4PSDA 5GJWC 1FQOA 3MXOA 1W85B 5DH9A 4CL0A 4A82A 3BF8A 2YQ5A 3OBIA 4EELA 3CNHA 4ZKEA 2QLTA 4YJ3A 3RH0A 1SXGA 1ZOLA 2HA6A 2XIJA 3A0UA 3EXG1 3T9BA 3VNVA 2C5AA 5EZ6B 1QYWA 2WD7B 2QR3A 2VBIA 5BQXA 3LX4A 4JJ8A 4XLZA 3RHSA 2BKLA 4PC1A 1N36B 3FVRA 4LGYA 1N6OA 1LJ8A 1XALA 1QO0D 1P7YA 3I2IA 1RCTE 1U65A 4MR8B 2R6GA 1BQ4A 1YZYA 4N8SA 1EESA 4ZVNA 4I1SA 3VAZA 4ZZ3A 2FV8A 4ZAVA 1VHDA 5THKA 1QQ5A 2VC2B 1RACA 3DE4X 3EEIA 3PNLA 4H0NA 3W5UA 4D74A 3JVVA 3AR4A 4HZUB 2C00A 1OYWA 4JU8A 3GUYA 1G8AA 4QM7A 3OT1B 1JXQA 2EU8A 2VIIA 4HEA1 3J80A 4KO8A 4A9AA 2D1FA 1X7XA 3CIFA 3T35A 2G0NA 3MC1A 3ISJA 3OLXA 4CMIA 1M6WA 3OA2A 1G8MA 4N5LA 4YX9A 3PHGA 4UZSA 3LTNC 2I3AA 3GT7A 3IS3A 4GZLA 4KO4S 2ZRJA 4WI1A 1AQUA 3IXMA 1YR9A 1DC4A 3T5MA 4GOND 5CHYA 2IH4A 2FG6C 2PJUA 5EIHA 2IGTA 4RF5A 5IAOA 2GK6A 2QTNA 1M73E 2CEAA 1Q2XA 1YRAA 5TJHA 3LBYA 5I4CA 1P2VA 1YL6A 1I2DA 1P4GA 1B8OA 1EHIA 1JHQA 1HFWA 1E1KA 5F1PA 3TLCA 4DHWA 3OZUA 4JUAA 3ZJYA 2DQ4A 2A2ZA 1T24A 2XMPA 2Y0PA 5DP1A 4L6AA 1LX7A 1GGHA 4HVCA 1FFWA 4BS9A 1I3LA 3EPKA 2YWGA 4MCAA 4ARVA 2EW2A 1XAGA 4KACA 4JDPA 3FNQA 3VR4H 3IP5A 1P2SA 5DNAA 1AOXA 2A0FA 4NYJR 1XO1A 2FTKE 5IANA 4BN5A 2QY6A 1N8KA 3GFRA 4PFKA 4WERA 3URMA 1B76A 4HCJA 2VH1A 4EZBA 2XB8A 3Q3JB 4FHZA 2R97A 1ZZEA 3ZQ4A 5KREA 2ACEA 1RLUA 1NVBA 1TJYA 1W30A 1PX2A 2P9JA 3CN9A 1OLOA 3PCRB 4K88A 3ZDEA 3FB1A 3ZWCA 3LC0A 1W0JD 4I6JA 1A5TA 2X1VA 3LOUA 4HUQB 3RYCA 3UB3A 5CGQB 2NNLD 1U3VA 4EKYA 1GPBA 2GDZA 2H3EA 2AJ8A 2VRWA 3KG2A 3PFGA 4IPTA 3BXEA 3NHWA 3PFWO 3C6QA 4N3NA 3NWPA 3IULA 3KEFA 4EW6A 3A9VA 2RK3A 2HMWA 2VBFA 2FMUA 5IKOA 5TQ2A 3HK2A 1SN7A 2L0XA 4IP0A 4QHYA 1DADA 1N3BA 2I2AA 2FLVA 5A4FS 3FOEC 2A5GA 3RGGA 3PUJA 4D92A 5H82A 1VIAA 1Q7EA 4FCVA 4LBVA 4DRXB 2WAAA 5B64A 3M9LA 4EBBA 3QMPA 4HYTA 4INJA 1BFUA 2F2TA 3DPSA 3EIOA 3VYUB 4BEJA 3KWFA 3EBOA 1DBRA 4IO1A 4LI0A 4PCLA 4ENSA 3FPCA 2PUBA 2ZIZA 4F9EA 2GO7A 4A92A 3IQHX 4ZODA 2XH8A 2H5IA 2JVJA 2P0AA 3R7WB 2AKAB 4KDFA 5K05A 1OAKA 1EIZA 3NS7A 3PF9A 4ZRNA 2OZKA 1TEVA 5JCXA 4Q66C 1SAYA 1TRHA 1WQ1R 4PG5A 1J0CA 1Y8CA 3ESBA 5EHQA 1CUZA 3E4CA 4MO9A 4XCVA 4YCLA 2COKA 3GAAA 1OXVA 3PPYA 4GP6A 3RIYA 2WZQA 5AXCA 3TFOA 1K75A 4C7XA 4C0AC 1D7OA 4RTPA 4GLFA 3X2FA 4J2OA 4KIGA 4GKJB 1KGSA 3KEGA 4WCFA 1G6HA 4J0EA 5T7BA 1RRGA 3W0LB 3WNVA 2DPHA 4EITA 1CUHA 4A16A 1MC8A 3R3VA 2OL4A 4B80A 3MIIA 4PO3X 5DYIA 3IOBA 1OHHA 1XZHA 4K46A 1EP9A 4PTLA 4CMJA 1EUCB 3RIHA 1IXKA 4ZN6A 5KNDH 4LF7B 2ZIXB 4MJLA 1DP4A 2X9QA 3EQ2A 4NU5A 3WLEA 5ICFA 4BXOB 1UZLA 3K16A 5B3LA 4FE3A 1TFUA 2QN8A 4M8NE 5KJ6A 5H8WA 2R62A 2AK3A 2VK8A 5AWFC 3R0JA 3QNMA 4JT2A 2TMDA 3I0ZA 1RXEA 1VKZA 2V59A 4TM7A 5FO1A 5L3RA 2CD9A 2EJUA 2ZT5A 4IUBS 1SCJA 2ON6A 3O84A 2OWEA 2DFNA 3C3PA 1HM5A 3M5WA 3OZRA 2BCJQ 2UAGA 5DNUA 4KLAA 1PAUA 2V3VA 3DZ8A 4OSPA 4QTTB 2ODWA 5JEEA 1LLCA 1RBYA 2VWGA 5T6MA 4CCSA 4EFKA 3WMFA 3CS3A 1TMGE 4QEZA 2JGRA 3CBQA 1CUEA 2OT3B 5IF3A 5KYXB 2EAUA 4N6OA 3W3ZB 2GM3A 4YRCA 4YJ3B 3MTAA 1JR4A 1TOAA 3RSOA 1JHUA 1FC0A 4MPPA 3I45A 2CXUA 5FL7D 2H16A 3ANTA 3C1UA 3KUXA 2XRMA 1AQLA 4ZQEA 4X0EA 3U16A 3Q5DA 2IH5A 1KE1A 3TWOA 3C2QA 2O5RA 1PCXA 3OZIA 2RJOA 4YFVA 3QVGB 1L7PA 1R12A 4LSZA 5ITZA 1BMQA 1UBGA 2YWCA 4EJFA 2QMYA 3P97A 1LWOA 4J4TA 1YJBA 5DYYA 5IG2A 1GKUB 3AIKA 2YWRA 3H5IA 3IESA 3TW6A 3ZV5A 4CM6A 3HCDA 1LSJA 2GJKA 2XDWA 2WM2A 4LDRA 1TQDA 4YAOA 4OB7A 4EHBA 5LKAA 1LPPA 4A03A 3JYOA 1X7XB 5SICE 5T5QA 3AR2A 4ZCRA 1EFDN 5KSZA 5T3YA 1SXJA 3U1TA 4BUJA 1BKSB 5FBLB 4MP3A 3AUXA 4AN0A 3EGCA 1JDJA 3CT6A 3QJ5A 2QD2A 1IEXA 4X7MA 1DLIA 2JBWA 4M7OA 4QU9A 1OH7A 4TL6A 2JGMA 2AOTA 3ZEAA 4LTDA 4M1OA 4BGIA 3I2YX 4MQEA 5TVGA 3QMVA 2QT1A 1AF4A 4PWZA 3T41A 3DBLA 2QJOA 2VZEA 1RC8A 2EW8A 4RL4A 5AVRA 1P5RA 4JH0A 1XL1A 2OCPA 4A5OA 3FYHA 4HT3B 3PDCA 1NXQA 3EHEA 2HI0A 3EMVA 4GX1A 5DNWA 6ABPA 2YIDA 1Y1TA 4HGQA 4LCBA 4Y9SA 1GFIA 3H83A 5KC8A 1KPIA 2HSGA 5IBQA 1FX0B 2FWAA 1J9EA 3IPYA 2ENWA 1EXDA 2AEEA 4PGGA 1Z2PX 1O57A 4YRGA 4BFSA 2NYVA 4A2WA 1G1MA 3VR6H 4XDZA 4YJHA 4QJ4A 3I4LA 3RODA 3EVEA 4DWWA 1U0TA 3EQZA 5AKKA 3T5CA 1Q1QA 1XAIA 1EB8A 4RKRA 3LK7A 1XTZA 1U0LA 3LWNA 4F46A 3RYCB 2O8CA 1YOVB 4X60A 2QZ9A 4LWOA 2FQ1A 2IOHA 3G9ZA 2MYTA 1CDDA 4KJXA 4L2IA 3WDLA 5KNBA 3QYFA 2C7PA 5F2EA 5A6SB 3U44A 4N41A 3FM9A 4F11A 1WZEA 3LWDA 1CUVA 4EJ6A 2Y4NA 2ZTUA 3OE7A 4LJ8A 1MAAA 4L78A 2CLFB 4BMVA 4YECA 4UTXA 2RB4A 4AS3A 5AW0A 4GLLA 2GEBA 5DXFA 1ZNZA 3IJPA 3U9TA 3HG7A 2GSWA 3ECAA 4XASA 5ILOA 2XGJA 1PL8A 2GCPA 5FLXA 2C9ZA 3D2LA 1S9HA 1DKMA 1GA1A 3GLQA 4XWKA 1U7ZA 2FVYA 2FSVA 1UOPA 4M36A 2BH9A 3D6NB 1EIWA 3P9XA 4E6PA 3WJ1A 3WWOA 4P22A 3TUJC 3G2IA 1ES9A 4K6FA 1MT3A 2X8BA 4TZTA 4GVLA 4LW8A 5DXJA 4C08A 1S2MA 2PL9A 2IY7A 1ODTC 1IWPB 4PQGA 1USKA 3BKXA 1UH5A 4IWXA 3C39A 4RJTA 3P7MA 4G0NA 4XOIA 1X3SA 2W9XA 3ZG6A 5L53A 3N2ZB 3NTXA 5CYFA 5LP1A 2BR3A 3HCFA 1KPGA 1W6UA 3AUFA 2BGMA 3JZMA 2ZWAA 5JH7A 2C2WA 3KBOA 4QSHA 4R9NA 4WCFB 2WB4A 5BSKA 4D2IA 1JDVA 4JB3A 4FKBA 3VGJA 4JI6B 1TUBA 3JQEA 3O4HA 2GN6A 2WUGA 3SU8A 3RABA 5TC4A 4TMWA 3VU9B 1QYDA 4GSYA 1DE0A 3JX9A 1GGEA 3ET5A 4C1BA 5BSVA 3BN3A 1TD9A 2BR5A 3DS8A 1QUFA 4LNAA 1B16A 3ZHOA 2XDQA 4JZKA 3PGJA 4XYGA 2KE5A 1LGYA 4G5SA 1R66A 3ONDA 3EXFB 3L5OA 4MYCA 4XUEA 4F4DA 5I5EA 2H1IA 1C1DB 3DHNA 1B3BA 3IXQA 3N2IA 4M2LA 4TTJA 4WZBA 4D57A 1JKXA 1QFZA 5AM3A 3LZCA 3MLAA 4JGIA 4GQIA 1M2FA 2X7JA 3NTOA 2X0KA 3FCXA 3GJ0A 2ZT8A 5AHXA 4BP1A 2GBPA 2RGRA 1XP5A 4K9MA 4NU8X 4OQLA 1C4XA 1CJKC 5JNUA 1EVQA 2Q5IA 3OPQA 4HNSA 1OTYA 1NVGA 1S9DA 3MJVA 1J39A 1PL7A 2REBA 3EEYA 3ETJA 1NXSA 4GOKA 4AJLA 2IXAA 5A6VA 2XB4A 2CV0A 1YVUA 2RK4A 2DGDA 2JLVA 2W2LD 1QFMA 4QDUA 3AI2A 3UJPA 2MYNA 6AT1A 5B2ZA 3ETHA 1TYCA 3U9SA 4RSRA 3STTA 1PHRA 3FBGA 2VSFA 5ITZB 5KYGA 5CBPA 3GBSA 1GRVA 2APJA 4C0QC 3PQ2A 3HXQA 1LQUA 3C70A 4R8VA 2DPLA 1AGPA 2V0NA 1JHPA 1ZNYA 2GPWA 1KVTA 4E0BA 1XPRA 1YU6A 3O9MA 1XLUA 2QPOA 4DA7A 4GKAA 2XECA 5F7OA 1X7DA 4OHOA 3UHAA 3THXA 3OPVA 2DQSA 2R7LA 4XGQA 3TCXB 1EGVB 2O1WA 1SXJB 3VNBA 1JWLA 1E58A 3AF4A 3CSDA 1J33A 3OF3A 3ZC3A 2Z6AA 4B8ZA 3VC3A 2JGIA 3GVHA 1U8AA 1S7CA 3RVLA 3T3PB 2W6NA 4I8XA 1OXTA 3SWWA 3BRQA 2AOTB 4HEJA 4LYHA 4M49A 4WJZA 3NFYA 3LWBA 4MQEB 3HFSA 4ND7A 2AC2A 1F8YA 1I14A 1UPXA 2JIDA 4N5DA 3DBLB 1O2DA 3HU5A 3LF1A 5KYYB 4C30A 4QARA 1RFGE 4KWIA 3V4OA 1OI2A 3LLMA 1NPYA 2ZSFA 4I1YA 2YYAA 4G65A 1OE0A 3UO8B 2VHZA 4YJKA 4TT3D 3H6HA 3HVHA 4YBZA 4FBGA 4N0DA 3IP7A 1CR4A 1UDCA 3LQRA 1ZN7A 4YPVA 5K0FA 4EPVA 5A3QA 1IUOA 3SYTA 5FI3A 1UFVA 5IABA 1OWNA 4ITVA 3FRHA 3V8VA 4PTZA 2X9VA 2FWRA 1S4MA 4YJHB 2WF5A 2BI8A 5CEFA 1GVNB 2J5KA 2HTFA 2ZRCA 4G0MA 4NIMA 4OFWA 3OTOB 3BORA 4IGAA 2I91A 1C0PA 2MOKA 3ZU6A 4ISCA 4ZEOA 1EFVA 1A97A 1QHEA 3VKWA 1P2BA 3H9EO 4INZA 4WLVA 2A4MA 4MKZA 5HE8A 3I1YA 3MSXA 1R88A 1VJ5A 4L2IB 5GY7A 2RGYA 2EZUA 4LZLA 3ZV4A 1X92A 2WHPA 4BLSA 4Q9HA 2BGNA 5DP2A 1OMOA 2DJ5A 3FAKA 2YNMA 2PWAA 5HFNA 3U7RA 3ZLUA 4UTRA 4B85A 1G2IA 4P3PA 3KQHA 4Q3NA 3EWNA 1JKMA 2F3TA 4PFQA 4ENTA 3NDIA 1FDSA 3A7DA 5B6JA 1L7XA 1PWHA 4RD2A 2VK1A 3IVAA 1YDFA 2INGX 3H04A 4HGNA 4JWTA 3DLHA 1CZKA 2RGDA 4YCBA 1OI4A 3DV9A 1NYLA 3GAZA 2RHMA 4NPCA 4RM2A 3F98A 2FXVA 1VIDA 3AKDA 1XTBA 4DMRA 1KMQA 1NL3A 4YJFB 5TR9A 1U1IA 3W7VA 4ENQA 3HEAA 4WA7A 3UMGA 2JKVA 5AOBA 1ADCA 5DNDA 5ALUA 4F84A 4XA8A 1YMUA 2V54A 1EK6A 3N0XA 4QU5A 1OV4A 1G66A 4N3AA 3U4IA 3W9UA 1SKMA 3U3XA 3MWYW 4HJRA 3VSEA 2H92A 2CFRA 4W5HA 5TE9A 2O7RA 3S2IA 4B3GA 3K0CC 5BMVF 5JH7B 3OQIA 5DWDA 3RBXA 1GZ4A 3CNLA 4OHBA 1E63A 1UBLS 2O3UA 4CJXA 1W47A 3EOZA 2Q3EA 5DLDA 1CZLA 1L1EA 3NNNA 4B6EA 4M55A 1TUBB 4ZCMA 2H65A 5LXTA 2KHZA 3UAZA 1T2UA 3I28A 5J5VA 6YASA 1U8XX 3SDSA 4NSNA 3E9ZA 4NC9A 3ZBTA 4BE9A 1CUFA 2E89A 1RFLA 5LZ7A 2XDQB 3NHJA 5AI0A 2FGKA 5HFJA 3I2JA 3PDHA 5DPMA 1BKYA 1C3VA 2Y1EA 3R41A 5F3DA 1D07A 3D5EA 3HUDA 3UXYA 3HY3A 5JCOC 1C41A 3ISVA 3C5VA 5FBQB 3CH7A 3FOZA 2REQA 1LTQA 1NI5A 4ZVOA 1ZOIA 3OP1A 1FSPA 1AS3A 1WUHS 5IEBA 2CJFA 4C0BA 1RRPA 3NV7A 1T9CA 1EVEA 1T6YA 2XHEA 4Z9BA 3QPWA 3SIXA 3ZJUA 4ID3A 1N5KA 5EP1A 2AFVA 4JVMA 3ZV3A 4DCPA 3AERA 2YR0A 1RBZA 3KD3A 4M8KA 3V4RA 5JQGA 3A6HA 3DL7A 2IV2X 1MOPA 2XHZA 4L15A 4ZQBA 4Y7DA 5C1OA 1XA0A 1G3MA 1S8AA 3D6HA 3JQRA 5LQKA 2MR6A 1F0PA 2Q29A 3D3NA 4HQOA 4DZZA 1N1MA 2NUTB 3ANYB 3CJRA 4OCZA 2ZITA 3RSLA 3KQUA 1JN0A 2I03A 1TTPB 1X15A 1UANA 3AEXA 3JWJA 3TCNA 2J6BA 3LVBA 4S1OA 3R74A 3DFZA 2D00A 2QRUA 4RZHA 1PUJA 5FUYA 5LQDA 5EHNA 3R75A 2NO0A 4X6XA 4QDXA 2NSJA 2A7QA 2ZCJA 2Y1LA 2JH9A 5CBPB 5J4YA 1OILA 5HCUA 2C1EA 3QY0A 4FLFA 2IV7A 2HRQA 1TGVA 1Q95A 5FTWA 4B87A 3F2VA 1A77A 1YXMA 4OK5A 1E1DA 2AV6A 3ROEA 1T6BY 3RB8A 3GJ7A 1XTQA 4AY2A 3HH8A 1QGED 3U1BA 5JDCC 4HLCA 2IF0A 3AG5A 1JE1A 2OO3A 5GM1A 5G4KA 3H05A 4YP9A 1XBTA 5A3JA 1RNLA 3GZJA 3VR3A 1YBFA 2W2TA 2I1VB 4MYTA 2EV9A 5DM1A 2XMZA 2B2CA 2XKJE 4ZT3A 4EI2A 1QV6A 1L5HA 3MLBA 1EJ2A 3GD5A 1DKOA 2PUGA 2JD1A 5TGDA 4Z9XA 3H1EA 1L0BA 3GJSA 4DV0B 4GPEA 2WF9A 3A1CA 1FZQA 1WS6A 3LZDA 1Y9JA 3GA5A 4TKVA 1XMSA 3PZBA 4XD7D 4CT0A 2HYDA 4GF5A 4NYMQ 1BW9B 2X4DA 1ARZA 3ELBA 4ARAA 3G1UA 3DDOA 4ZRDA 4Q4JA 3I5XA 1W25A 5A04A 1CY2A 3IKJA 4OQFA 5EMHA 3N5KA 3ZNPA 4E7PA 1P4HA 1X77A 3QIAA 6REQA 1O08A 4G2TA 4MLDA 2HBQA 4U6SA 2IEYA 2OBBA 3NONA 4CMHA 2G08A 1EFVB 5JTUA 3HSKA 5KSWB 1M6VA 2XYGA 3KHTA 4GP9A 4MEAA 2AN1A 3FNIA 4LRSB 3F9IA 5HQTA 4DTIA 2B82A 4L7VA 2P2GA 4FX2A 4R83A 4UFOA 1KI9A 3O2NA 3C8MA 4XGIA 4L5JA 1TL7C 3Q85A 2WJPA 3AQIA 5IKEA 1MB4A 4BHTA 1V3TA 2EKZA 2FB9A 2H07A 3QW2A 3WQRA 4LK3A 5JW6A 1R50A 1RBMA 2WHPB 1SXQA 3RREA 2VTBA 4GPTA 1E69A 1EHCA 5AVYA 3LUJA 1TEZA 2YBEA 3SQNA 2AXPA 1G5IA 2RAVA 4NG5A 4FOTA 4G63A 5T4HA 3HS3A 2AOUB 2OPBA 1NP7A 3ORYA 4KXUA 3AI3A 4HNGA 1NC1A 5F73A 3SJUA 3NTUA 1UZMA 2PH5A 3D0OA 1AMOA 3X1JA 1BX3A 3EUFA 4V0QA 5C18A 1Z18A 1NVMB 1YQGA 2WKQA 3VKVA 2CSUA 3R8XA 1BQ3A 3AW9A 3A04A 5NLLA 4Z3KA 1S6YA 2IBMA 2R7MA 3H65A 1YQUA 2RCYA 1KR5A 3I9JA 4JJIA 1XUOA 4XR4A 5G0SA 3U7FB 4CV3A 3K96A 3L3BA 4J8PA 4W5RA 1E1MA 3VYSB 1J2RA 1BH2A 3L41A 1R0CA 1IYZA 4MV6A 1KAEA 1DJLA 3VISA 3WB2A 4R1UA 1DMSA 3HB4X 4K8RB 4PZ9A 3PHLA 1HDXA 2V96A 1U6KA 4QDTA 3T7SA 4BP8A 4D5EA 1G16A 2X4IA 3TL3A 2EX4A 4PBTA 4LX0A 1E98A 1QVRA 1TTTA 4FHDA 3IDOA 3WGIA 2IYPA 2XNDD 3VZDA 4A8JA 3LYLA 4ZT2A 5CJJA 2GHIA 5TV2A 1LBTA 2HJRA 1IIBA 1JSZA 1OT3A 1Z07A 1H3FA 3VPGA 1KAOA 1R10A 1ITZA 2YRXA 5CDYA 1MJGA 4FCTA 1ZH2A 4D3DA 4GYKA 3M6AA 1CT9A 3V1KA 4DQ0A 3G5AA 4DG5A 4HAUA 2FUKA 2N42A 2GB4A 2C77A 4DREA 5BP7A 1DKRA 2QRJA 3HL4A 4EEXA 2REQB 3AM3A 1QH1B 3D8RA 3WZMA 2IYNA 3QKSA 1G3UA 4N9WA 3U2QA 2EWVA 5FPYA 1J8QA 5HEKA 4AULA 1FXWA 1PUXA 4US0R 3WHPA 2I76A 1UFKA 1RM3A 2ZWIA 4HUJA 1Y9AA 1DZIA 2NQ8A 4MHSA 1SUIA 1MVNA 4WVFA 5CXSA 1E9VA 5WRFA 5IVPA 4ND3A 3QK7A 2DY1A 4PNHA 4WLOA 4TV9F 1VCIA 5DCLA 2F7SA 1FSSA 5GONA 3ZQJA 3AERB 4E4RA 4G0UA 1SBQA 2A5LA 1FDWA 2G5CA 4EI7A 4EPTA 4F3RA 1IBCA 2UZ3A 5H5JA 5BN3A 3CLHA 1EGQA 1RJEA 2CE2X 1MV8A 4M9RA 2V4UA 1RZ3A 3SLKA 4ALIA 4R8MA 2IBTA 3VHXB 1TVMA 2AFIE 1NF2A 3AV0B 1EUDB 2HXSA 2YY7A 3BSFA 4FSXA 4G4JA 3LHIA 3C5HA 2Z43A 3LPMA 3IPRA 2QK4A 3JR3A 1Q20A 3QEOA 4Q05A 4BRZA 3B1XA 3KPYA 3MJFA 3DCJA 1NJ8A 3C3JA 5FWAA 5L6LB 4D3ZA 1MORA 1L5RA 1WULS 5AVKA 2HLDD 5JTTA 3LH5A 3F3MA 5LMNB 1J2EA 4NZPA 2O14A 5BWNA 3WQQA 4C0HA 4F04A 1ZK1A 4UMDA 4LV5B 4F96A 2PH7A 1NY6A 1JWBB 4H7DA 5D51S 5B7NA 1Y1SA 1AUXA 4RQBA 2O05A 1CEQA 3IAHA 1ZCBA 1P8AA 2ZT7A 3ICVA 4X84A 3BGIA 5K3FB 1L5LA 5KTNA 5I7UA 2YV3A 1C3LA 1I1QB 2ES4A 4ACBA 2ZWOA 3K70C 3CUEF 4LXTA 3PPXA 1ESNA 1G5HA 1LDNA 3ZJTA 4UHJA 4L9AA 3P45A 3ABSB 4WBNB 4Q34A 1LF5A 2FW7A 1JR3E 2XBUA 3ER6A 4JYMA 3GFFA 1L5HB 1R0SA 5HKKD 1ZGCA 5C8YB 3QUBA 1XZ8A 4DIFA 1PZMA 1WCYA 3IQDB 2VDMB 4U5XA 3QWHA 2WYUA 4F2GA 1P6QA 5EJAA 2II6A 3L8GA 5KYUA 3FFWA 1LLUA 5EXEA 1I0IA 3B2QA 4JLWA 1E2KA 3BZBA 4LDNA 3QPDA 2G9VA 4KBFA 4YLGA 3STHA 5JQWA 3ETCA 1DV1A 3F8TA 4XX0B 4CMGA 4AF6A 4EA6A 1HYQA 4JEUA 2HF2A 3DLIA 4Q4JB 1N4AA 2YXEA 3COVA 2D2IA 1TQHA 2B25A 4RTJA 1N77A 3H9GA 4ABYA 4LWPA 2BHTA 1GNSA 4E2FA 3FYSA 2JFWA 3BGWA 4KL8S 4F60A 1XRPA 3GOHA 6REQB 1NM5A 2EC5A 3N39C 1HORA 1POXA 4YCSA 4RFSA 4BQRA 4IOMA 4G9EA 4P4GA 1XRSB 4FGJA 2C61A 3NTRA 1KJZA 1DI0A 2CHVA 6NULA 1C9DB 5LUAA 5F2OA 3PTAA 3H8SA 1NUHA 4LE2A 4EVIA 3A4TA 5HKBA 3A9SA 3ZZ1A 3NALA 4YP6A 3DE5X 1UXJA 2BI4A 1QYIA 4S1NA 4BVAA 5EGSA 4F7WA 4EUHA 1TF2A 3WLMA 5IJ9A 8ATCA 1PFYA 1QHYA 4J75A 3R24A 4DARA 4CIDA 3VKHA 1KEEB 1R6DA 2OFOA 3NHFA 1DPGA 3JW8A 2DM6A 4UASA 3SQWA 4X8LA 5K20A 1ULHA 2E82A 4EHLA 5J2TA 4FK8A 2VDUE 4TMYA 5I5GA 2DECA 2CL6X 2XVZA 4ZVQA 1M6NA 2J0QA 4JVNA 3SR3A 4HFJA 4KKVA 1UPUA 3WBFA 4YDHB 3H4TA 4QRDA 5B30A 2C94A 4Q48A 3SVLA 1PVVA 1KQNA 1ZITA 1HMYA 4M22A 2O4UX 3DZGA 2Q0XA 3CCFA 2IIQA 2HF7A 4MIKA 4UHBA 1Q2UA 2OCLA 2P9HA 5ALPA 1G9XA 1MO4A 3SEFA 4UOZA 4MKFA 2DB3A 3K72B 4PFJA 1G8KA 3V3TA 4H4DA 4IR7A 4UPDA 4C21A 3G8CA 3UHOA 2JPDA 2P9CA 4KXVA 4F8JA 5IXYA 5DYTA 2WUDA 3C97A 2ZW9A 3GCDA 5CP8A 5MGNA 1D03A 5J2UF 3ERCA 1HKHA 4BE7B 5L51A 3UFBA 1NXVA 4FONA 2G28A 3UAOA 4ARUA 2YVAA 1OVGA 2HSEA 3EUEA 2EL7A 3GFPA 5E2AA 1VG8A 5IZ4A 2QQFA 2ZRKA 1S1CA 2SKDA 4D9NA 4EKIA 2ZZKA 2NU8B 4GZMA 1VLQA 4OUDA 4CFYA 3G2QA 5IULC 2PMKA 2R1VA 1J09A 2V7BA 2F1IA 3LXXA 1W93A 3KU1A 3W8RA 3FOWA 4CV1A 3BB1A 3D6MA 1ZL2A 1RI2A 3M9XA 4LXGA 4X7RA 3TZCA 2F8SA 4H7HA 1WL8A 3QKSB 3GFTA 4KODA 3ZY4A 4AMGA 3NW9A 1NBIA 4FQ8A 2HIAA 1SUBA 4HS4A 3ZY5A 3GGOA 4MMZB 2B8NA 4OAPA 3T0FA 2QTTA 5HQJA 2EP8A 3TL2A 2Q5QA 1KI3A 3B3AA 1WRBA 5GONB 3ZHBA 4R6WA 2Q6LA 4QOFA 2DQKA 2HF8A 4I66A 1QORA 2ZANA 4EB6A 3DDZX 5BN3B 4DUZB 4HADA 4L0MA 2VZ0A 4I8DA 3UC9A 4UVEA 5A9SA 5IHPA 4GIBA 1JG2A 4Q9DA 1VG0B 1TYBE 2K4MA 3FROA 2BR4A 2B20A 2C99A 2OYCA 1ZLYA 3VI4B 3G2HA 2VF7A 4HPXB 2FPIA 2IZ5A 2A9VA 4EB8A 1Q7TA 3WA7A 4FW9A 4FEAA 1P1CA 1IE3A 4WA8A 2VTDA 4FM9A 2E2WA 1W4RA 1GKLA 4U0KA 5HP4A 3OC0A 4WL0A 3UYLA 4BVKA 4Q1BA 2JRLA 4JENA 1FBTA 1SKYE 3BRCA 2ST1A 3EUWA 4LOKA 2HFKA 2R8PA 1ZUHA 3DAYA 1AZTA 1VIYA 1Z88A 2ZVQX 1XP8A 3HKBA 1V5FA 3ORFA 4IZOA 3USCS 3BXFA 2O8FA 1OZ0A 3CGGA 3SQDA 4KUEA 5JYDA 2NT4A 4RZUA 5J1TB 1QQTA 3DVAA 4HYQA 4Y6QA 2PKEA 5KCZA 1V9SA 1PL0A 3ESCA 2IWHA 4FJ0A 4G9BA 1WXWA 4C3VA 1GG5A 3PXEA 4NJOA 4PC3A 1GPDG 1O5TA 3PSAA 3TXXA 5JVDF 1WD5A 5F9HA 3A3PA 3WBKA 4QVIA 2VSXA 2X14A 4J0CA 3DHEA 4RK0A 4RJIA 4ER6A 1NOIA 4R7GA 3GRCA 5FWYB 4C6TA 3DV0A 5C7YA 2I33A 4K0KB 1FNSA 1Q6YA 2PSEA 5EIOA 2I65A 3LLUA 1WB6A 3T4EA 1GZ3A 1EGHA 5KYUB 3KT8A 2PUFA 5HUHA 1Y82A 2V7QD 4X61A 3QTLA 4MVJG 5JCJA 1FMFA 3AINA 3O8QA 4AKHA 1EWYA 4QDJA 1I9CA 2J7KA 4K5QA 3V4VB 4EH1A 2PTGA 3RHTA 2M1ZA 3W3AD 1G2QA 3NVMB 3RYFB 5JZOA 3PD1A 3FTPA 3QIVA 4JLMA 3CRZA 1TK2A 3HDJA 1UF9A 3Q7RA 1W2GA 2NXJA 4AXBA 4DDUA 3DR5A 1VA4A 4O4HA 1FUEA 3WGNA 5JARA 2EFHB 3IE2A 1JBQA 4RFSB 3PA8A 1CQIA 1QH9A 4G4IA 4WY8A 3S1AB 3EWSA 4IGFA 4MWOA 1DTSA 5EEGA 5ADUS 5K8VA 7ABPA 3M6UA 4H3SA 4DG9A 3UNXA 1A5SB 2IX9A 3G5UA 5J4LA 1N8SA 2ZBPA 3EXAA 3LQKA 4LWQA 2HK6A 3A1DA 3O5AA 4RF3A 1FJGB 3PUIA 1J7JA 2EWWA 1DO8A 2F1JA 2QW0X 3C3AA 3CA8A 3HP1A 4U4AA 2FKNA 4RTRA 3K0CA 4JT9A 4TTQA 4XFKA 4O0MA 1T10A 1VZ2A 2QRQA 3LYHA 3MFQA 5K01A 4PO8A 3KPUA 3BILA 2O1SA 3NI2A 5J2TB 1QP7A 5FBZA 1VL5A 1WCIB 5MFPA 1N7IA 4HGRA 1EFTA 1QF6A 2I22A 1GAEO 2ICAA 2XUJA 4PFSA 2ODAA 3R1IA 4UBJA 2D5BA 1USIA 4MCIA 1YNOA 3OZSA 1OXUA 4JI0B 4OGLA 1Q1NA 4MWSA 2DWQA 2H1LA 1JFSA 3O1JC 3P9YA 3LP5A 3SHOA 5DOZA 3ZHQA 3TE6A 3WGKA 5A62A 3W79A 3VR2D 3V48A 2E6UX 4FHCA 5F77A 3ROKA 3S99A 2YFHA 1P72A 2UVPA 4OLJA 4QOEA 3LGAA 4F72A 4NLLA 2J0UA 1C4OA 1IHPA 1QYCA 4H3HB 1LBHA 3B6EA 1Q3HA 2QNRA 3IEVA 4BMSA 3TTUA 1T6XA 3RRJA 5ER6A 2YXLA 1G1AA 2ZI9A 2FRVA 4FQ5A 4WUTA 5DHRA 3T3MB 3I58A 2WM8A 5ICGA 4DM7A 3PDIB 1PX0A 3QFSA 1GNTA 3L7IA 2VDQB 1W5FA 2R1VB 5TNXA 3W5SA 2EFCB 1QOQB 1ZD5A 1BD3A 4H59A 3UWMA 4C7OA 5E0KB 4L6CA 5F3WB 2XCIA 3B2NA 3VVCA 2B5WA 3NYWA 4MITA 1EE2A 2AC4A 5E8RA 2BTEA 4CQLA 1N32B 3IQGX 1WVMA 2YZGA 2IIVA 1KQPA 3VMMA 2OQRA 2O7VA 1CVRA 4YFYA 3U4DA 1FTYA 1U0HC 2DFLA 4L9WA 5GV8A 4KIJA 2EZ4A 2I54A 1X6VA 1RHMA 2P2ZA 2J6HA 4DLLA 2KW5A 4BGUA 4EB6B 1PWZA 3AY3A 2Q0SA 3N0VA 4LJAA 4AO7A 5BR7A 1SXHA 1XJQA 2X7XA 1AS2A 2OZVA 2B1QA 5A9SB 1DO0A 1DC8A 1CY6A 2IUEA 2PKCA 3E5HA 1HUQA 1RXYA 2YHAA 5H9WA 3D7SA 2FPIB 1XPOA 2PLAA 1XTTA 3VDNB 4X1IB 3TAUA 2Z09A 4HVAA 4B7XA 5EYPB 5KTRA 1DEKA 5TEWA 5BW5A 2YOHA 5GM2A 3GU3A 3MWDB 5BSEA 4IJQA 1R5JA 3CB2A 5B3KA 3OWOA 4FWTA 4P80A 5ALYA 1CEYA 1Y3AA 4A26A 1GM5A 4MLZA 4IIFA 3PHJA 2Z4SA 5JWOA 2I6XA 2PVCA 4IS3A 2O8FB 3QWFA 2F55A 1GRCA 3L7LA 2P3LA 3A6LA 1YQDA 3QLJA 1MTZA 1TB4A 2GN2A 1JIQA 1ZNQO 4TS9A 2R751 1DBSA 2ZUDA 1KMNA 1P2DA 1JYEA 2HGSA 1NMXA 2O2HA 2QVGA 3DVAB 3OPYB 4JLNA 4OF4A 4XIYA 3F5SA 3TOVA 3NV9A 4BFYA 3V2UA 1NXPA 2C98A 4B47A 3WA6A 1T1JA 5CR9A 2PO7A 3LD9A 4XSHA 3MFYA 1ZCAA 4ZDWA 3UPTA 4PZYA 5SYNA 4EF5A 3CM0A 1EZ1A 5EL0A 3BMQA 2RMKA 3DV0B 1YSCA 3UJBA 4I5FA 4L8FA 5BSMA 4C6TB 1ODLA 2WICA 3TF5A 3OIDA 4KIUA 1YAHA 4ENWA 2EGUA 1P1FA 1W5BA 3I3OA 3A0RB 3QUAA 1FTQA 4IIYA 1CJBA 2ZU0C 3AF2A 5F5LA 2O20A 4YRFA 3E2MA 1KU6A 5ER9A 4YXWA 2ZZMA 4Y2QA 1A27A 1B6RA 3BCRA 3MJ4A 3T1QA 3KKZA 2P6RA 2VA9A 2ZSAA 4LHSA 3JAKA 5I51A 2VF4X 2VF5X 4NZMA 5EJ2A 2ADMA 2ZTMA 4IQ8A 3UV7A 1CNMA 1KI8A 2ODEA 2PHZA 2WYIA 4IEIA 4Z1MA 5JSKA 2ODTX 2XE8A 2R0QC 4NBWA 3LZ6A 3L4JA 1S1MA 1YHZA 2ZPAA 1HV8A 4KGDA 5C8VA 1QAMA 4O4HB 3ZI7A 3CF6R 3D6JA 1QPGA 3SOZA 4J7CA 2GA9A 2PRZA 4E11A 2P9YA 1CQIB 2CMDA 3W6ZA 1MOZA 5EIAA 3DYIA 4DPMA 2EF1A 2M6RA 3VO9A 821PA 3JQ8A 4K0RA 4EQ6A 4LXQA 2BH2A 1H1TA 3VJKA 1FQWA 3JVEA 3X1XA 2WZBA 1G5FA 1ZCJA 5E7IA 2XPCA 1Y7TA 2JFGA 3PFCA 4Q1CA 2XKBA 4DUGA 2VUUA 4DLWA 4XWWA 4YGXB 2VCEA 5CM2Z 3C6XA 4R8SA 1S3FA 2WY2D 1G8SA 1D4AA 3BERA 4IYJA 4GSLA 5H9VA 5ADWA 1SZCA 4Z5XA 6CHYA 3E2PA 1Q91A 3PV0A 3EGDA 3L0DA 1JAYA 4C2TA 1E2BA 2P90A 3KEMA 3N0TA 1NW6A 3GGPA 4HRAA 3RW9A 1RABA 1ISPA 3REQB 2FLKA 2ZIEA 3CMMA 4DSUA 4U6QA 5CT8A 1NJ6A 4M1ZA 4NZ9A 3CH4B 5EZSA 2HV9A 3PFFA 1IRXA 1ENPA 5TARA 5BSFA 4FLMA 1O95A 4B2YA 1WMBA 1Z4IA 4D8YA 2YJ5A 1EDOA 1WVGA 1H94A 3QH4A 3TLGB 4ZICA 4O59O 1OH8A 3C3KA 1GKIA 2B98A 5MGBA 3EZXA 7MDHA 2PMFA 4U9UA 3CMCO 4W7SA 5KAPA 3ABOB 2YTZA 2HQSA 2XWSA 2UVPB 1QIJA 1CUGA 2VJNA 2HAEA 2I2XB 3OE1A 4PSKA 2D7DA 1BNCA 1ZM3A 5KB3A 1HEUA 1SBCA 3I9V1 1ENZA 1KZ4A 4IFBA 2J0UB 1HT3A 4HPWA 3IT3A 1WOYA 2BJHA 1BE6A 2ZIAA 4IHJF 5DCUA 4JBXA 4JR2A 1SK8A 4KSCA 1F7VA 2HIMA 1KXJA 4M9SA 3FAZA 3G9TA 3H2ZA 2V1XA 3MWKA 3R3XA 2I1QA 5ALLA 5LC1A 3VYRB 4F9GA 5L95A 1IXYA 1CWUA 4X85A 2HA0A 4NE7A 2YZMA 3R0XA 5EJFA 5FXMA 1J49A 1QIHA 2PUTA 4DHEA 4ZMBA 1KI2A 2OFPA 5DTJA 4JSYA 1T9KA 5HE9A 4YJ2A 4JYCA 4AKIA 1H65A 1SUCA 2HCFA 4FR5A 4GM1A 4ZPJA 5AYVA 2BD0A 1L4BA 2P62A 1XDZA 3KYDA 4GI5A 4MEJA 1VGVA 1EAYA 3UOGA 1D0IA 1BRTA 1BROA 2N1BA 3FI0A 4YYEA 1MAVA 4CKEA 4UDOA 1THTA 1U8FO 1OWPA 3KTAB 3T7TA 4ZI7A 4CQLB 2RH5A 3AM4A 4LXIA 1OYVA 4TRJA 3TG8A 3UWOA 1PV4A 3RHZA 4R0VA 3NWBA 2HJSA 4Y67A 3G5MA 2D7CA 2OMKA 4L8YA 2HFJA 4PICA 5DX1A 4YV1A 1Q14A 3LT2A 3U44B 1NNEA 2G67A 4C03A 1SBZA 2JJ2A 3WYAA 4JMLA 4I55A 3ZOZA 2GEVA 4UBIA 3SNHA 4L3WA 4E2XA 1GSHA 4Z4QA 3MILA 1K8ZB 2QJTA 4HO1X 4E5KA 3ZCUA 1PK7A 2LKDA 3BGVA 1ZSVA 4BKMA 3RT7A 1Z0IA 1DAKA 4UD2A 2G1UA 3O75A 2YZNA 2EKBA 2O5VA 3HN7A 1C7ZA 1LQ2A 4KBGA 2GZMA 2JHFA 2AJCA 4RULA 2JRCA 3I37X 1VL0A 1RYHA 3WLLA 1UINA 2XB6A 1CS4C 1FK8A 1YI0A 3KUUA 3PLNA 4QQRA 3UFXA 4DAEA 4IO0A 3WQHA 2B9EA 3Q8WA 4RVDA 3TQRA 1CDZA 4WESB 2C2KA 2JW5A 3QU2A 4OHZA 3U4CA 5AI6A 5MN6A 4KPUA 2ZIFA 4QU8A 3QBEA 3T7AA 1EMDA 3AHGA 1LPAB 3KVVA 3GG2A 3S2EA 4L8GA 3B12A 5KTSA 3QLEA 1J07A 4E46A 1WHSA 4WEOA 2VP6A 3RVBA 3BF7A 1M2WA 4KP7A 4IHAA 3VC7A 4BV8A 4BV3A 5JO0A 2V7EA 3MCVA 3KJXA 3ZY2A 3DAGA 3HDGA 2R6R1 4BBZA 1E6LA 1GGVA 2HX1A 4ZU1X 3BMQB 4AP5A 2REXB 1Z39A 4TMZA 1VGQA 1BD4A 1C81A 1Y5NA 1IHYA 2Q0HA 1UOEA 4CDNA 3X3HA 3I39X 3BIJA 3SQMA 1XTPA 4PZDA 3TRFA 1SBNE 4M83A 3FTEA 3PE3A 4XB1A 3B7WA 2O19A 2HRRA 1MHTA 3DHWC 2IXTA 2PX2A 4YS6A 1PD0A 1A7JA 1Z5WA 5SYAA 4YGYA 1G17A 2ZJYA 1CR6A 3GLRA 4YUWA 4NF2A 3JAKB 2K7ZA 3IAS6 3TB4A 3N74A 4CEJB 4N9QA 4G0VA 2D13A 2GKGA 2ZBUA 4P4NA 4U00A 3D3QA 3EBLA 3AUSA 4QYIA 2DQZA 3EISA 1OXKB 3HC7A 1Y80A 1IJKA 5KCMA 5KOJA 3D8BA 1U2DC 3QOXA 4XTRA 3TTWA 4MRNA 1DQRA 3VA7A 1XYGA 1N7HA 2I7TA 4MV7A 4DQVA 3JQ8B 3UJDA 4B35A 5KOYA 4EQ6B 1ZESA 1N0HA 2GNOA 4DY4A 1Z75A 3RRFA 1HZJA 1GDDA 4MW0A 2NYRA 3H6KA 5AM5A 1Y8ZA 4OUKX 4PEVA 5H3LA 2WIAA 4P7FA 3ORHA 2XVAA 4IWYA 3I8OA 1YIOA 1EE1A 4IF6A 1YS2X 3L0SA 3ZPXA 2BZ0A 2IXDA 3L7DA 4PHHA 4RTOA 3J81k 2HW8A 3PWSA 1Y6JA 3KXPA 1UZNA 3R20A 4Z4HA 4RZIA 1X9GA 4KH0A 1ZAYA 3S1LA 2DWUA 3GDFA 3EGDB 5K1ZA 1YRWA 2CHEA 3QHPA 4G26A 2XMCA 4JUBA 4N6NA 4R16A 4Z1OA 1OIWA 1TAHA 3Q72A 3IA7A 4RVNA 1NW3A 1TCCA 4LRQA 4PLTA 1JZQA 1J4AA 4JC5A 4PZPA 4EA9A 4WLEA 6PFKA 2KYRA 1NPDA 3FUCA 4JK3A 5TPZA 2RGEA 1GCUA 1CZNA 2IXBA 5E7JA 3V4FA 1PRYA 1UXIA 2H7CA 2H06A 4C4SA 2FPUA 5D86A 3FOFC 3RUAA 2QD4A 3D0QA 3KVOA 3NG1A 3WIOA 4D9FA 2C4HA 3A6JA 1QH0A 4FFLA 3ETLA 1NBMD 2C84A 5KYXA 2DR2A 1JFLA 3GA0A 1RQNA 5JMPA 4D9EA 1JVSA 3BD7A 2E0IA 2WA1A 4ZOAA 4I3GA 1R64A 4MDYA 3QNWA 3DF9A 3PWZA 2Z58A 2WAYA 2VDPB 3MRVA 5KWVA 3RWBA 2PU7A 4Q82A 5D6OA 2JAOA 5ITVA 2JFBA 2XDAA 2PUVA 1TKBA 2JLXA 1DELA 4LJYA 5B7GA 1KC3A 4JYZA 2V6GA 2V0GA 1YB7A 1E3WB 1L2TA 2AFHA 4WNYA 4C4ZA 2VHWA 4ALNA 1YTUA 1B74A 1DVRA 2J3LA 4HV4A 2BFPA 1PJZA 4AJEA 4RDIA 5LZ5A 3KYDB 4FYVA 4PVDA 4Q1FA 1GQFA 4AK9A 3PEWA 3C7KA 4V2IA 5EP3A 1YRHA 2CNWA 2FJUA 2NTVA 1XJ5A 4NJEA 1C4WA 2J31A 3C16C 4TYQA 5AJYA 5ANRB 2QVZX 2YUIA 1XZQA 4ZI7B 4LQDA 2FX3A 4WKGA 1U7WA 1DQZA 4CF5A 1Y81A 4CEIA 2VRCD 1GGFA 3KYBA 4GWLA 3KM0A 3LVFO 4XUGB 1ODIA 5BY2A 3KKQA 3NTVA 2BGLA 3CW2A 4JB2A 1PNRA 3K70B 3EDRA 3OZEA 2NXWA 3K9NA 3GMIA 3DA8A 4I55B 1QONA 3SKVA 2ZRBA 3M34A 2ZSKA 1GUFA 3AP2A 4CV0A 2ROQA 3F6SA 1VJTA 1SIUA 1G8PA 1AUVA 1X8LA 1MO3A 3OJ0A 4WZZA