1N2ZA

2.0 angstrom structure of btuf, the vitamin b12 binding protein of e. coli
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
245
structure length
245
Chain Sequence
AAPRVITLSPANTELAFAAGITPVGVSSYSDYPPQAQKIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKVMWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFGINPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITGGPDQIPKIKQYWGEQLKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vitamin B12 transport protein btuF
publication title The structure of Escherichia coli BtuF and binding to its cognate ATP binding cassette transporter
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 83
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 1n2zA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 1n2zA02
3AESB 3AEQA 3TNYA 3AERA 4K3VA 1M34A 4H59A 3MD9A 2AFHB 4BBPA 1FP4B 4MDYA 5JPDA 5CX1A 3TLKA 1TOAA 4WZAB 1N2ZA 4INOA 2PS9A 4OXQA 4WN9B 1K2VN 1MIOB 3PDIB 5BVHB 1QGUA 1L5HB 1G20B 1N4DA 4UTOA 4M7OA 2OSVA 4FKMA 4G07A 5HX7A 5KOJA 5I4KA 1KAEA 4GICA 4OXRA 2OGWA 1G21A 1QH8B 4HMOA 2M6LA 1H1LA 3EIXA 3MWGA 3AETB 4G09A 1PSZA 2PRSA 2OV3A 1N2CB 3AEKA 4FI3F 3ZK7A 1KAHA 3K1AA 5BVGB 3CX3A 5GGXA 2Q8QA 3AEQB 3AERB 3MWFA 1M34B 4B8YA 3HXPA 3NU1A 3R5TA 1EFDN 3UJPA 3U7QA 2XDQB 4TKUA 2PS3A 2QI9F 4UTPA 4CL2A 1M1NA 3ZK9A 4WZBA 5CX1B 3ZK8A 2XH8A 1KARA 3MFQA 3MINB 1QGUB 2AFIB 2XV1A 4MX8A 4INPA 5CR9A 5KOHA 5KOJB 2XUZA 4WNAB 3BE6A 4ND8A 2M6KA 1G21B 4OVKA 1N4AA 2XQVA 4H0FA 4MO9A 4XPIA 3R5SA 2ETVA 4TKVA 1ESZA 3ZKAA 3AEKB 5JOQA 2MINA 4WESA 3HH8A 4HMQA 2XY4A 3K1AB 5M29A 3ZTTA 3LHSA 5FLYA 2AFHA 2RG7A 2YNMD 5B58T 5GGYA 1FP4A 2R7AA 5JJ5A 2OV1A 5M3BA 4WZAA 1M1NB 2PS0A 1MIOA 4WZBB 5BVHA 4NNPA 5AFSA 5M34A 3G9QA 1K7SN 3HJTA 2R79A 4PM4A 3GI1A 4HMPA 4ND8B 3AEUA 3BE5A 1QH1A 4N01A 4UDNA 3AETA 1H1LB 4DBLE 5M2QA 1M1YA 2X4LA 4TKVB 5BVGA 4IRMA 2MINB 4WESB 3AESA 2WI8A 5KHLB 1K0FA 3TEFA 2XDQA 2PHZA 3U7QB 3PSAA 4TKUB 4MLZA 1K75A 5HDQA 3MINA 4WN9A 1PQ4A 2AFIA 2Q8PA 3PDIA 3EIWA 5JG7A 1L5HA 1G20A 4PAGA 4FILA 4WNAA 4FNAA 4LS3A 2WHYA 4XPIB 5KOHB 2YNMC 4LJSA 1QH8A 3AEUB 1QH1B 4NNOA 2O1EA 1N2CA 4HN9A 1M1YB 3LI2A 4UDOA 1XVLA 3PSHA
chains in the Genus database with same CATH superfamily
4P2BA 2JD0A 3UAZA 1P19A 3SVTA 2A1UB 3R9WA 1AKNA 1NP3A 2YV4A 1SH7A 1SZCA 3ND7A 3T9EA 4BX2A 1I14A 4DFDA 1JXAA 4M1KA 1M2VA 4HEHA 4ETIA 5I01A 1M0TA 1H8ED 2H1LA 4OO3A 1KH3A 3TIIA 1JHXA 3INTA 4HLCA 1VCMA 4J43A 5FI1B 5KIAA 1MX9A 5CFOA 4OSPA 2CMHA 4PGHA 2CNOA 1H2YA 1F2TA 3OU7A 5IJAA 5EHQA 3TPCA 3EGIA 2PBRA 2I7CA 1T3ZA 2WVAA 3K70C 3KQMA 3ICWA 2FA9A 3QVMA 2GCNA 4RAQA 3GHHA 5CW1A 3G79A 2DF8A 1G64A 1GG5A 1WCIA 2I71A 5C2JB 5FNVB 4TUYA 5CDFA 1LZKA 4HZUA 3HNOA 4LMBA 1E7YA 5A9TA 4RYLA 4PW0A 5DNAA 2AMVA 1KFCB 3GUZA 2QTNA 3IQWA 4FW9A 4CG3A 2GAAA 4GX2A 1NQWA 3CEJA 3DMGA 2I99A 5DTJA 3U81A 2YOGA 3UB3A 4JUBA 2GOYA 4BKPA 4B76A 2EDAA 4RDHA 2IHUA 2ZE6A 2P9GA 1TA9A 3PXUA 4UEOA 1FX0B 2Y68A 4H1VA 4F4IA 4UZEA 3HJAA 4HNVA 2EGGA 5KYVA 4N6GA 1VJ1A 3IUYA 3U39A 3E5HA 1RC8A 1IOLA 3HYCA 1GADO 5DV9A 3AVTA 1NUQA 1WSBA 2BM8A 2PGOA 3CX8A 4TN1A 1Q7BA 3VR6H 2Y9MB 4ZYYA 1VLVA 1CNEA 3CG0A 4ZHQA 5IF3A 1G9SA 1XJ5A 3KB6A 1P74A 2QLJA 3VX4A 5JQGA 1VJ5A 2NO6A 4GWKA 5TPWB 1XD2A 2Q1SA 2W22A 3K9LA 1I24A 1V48A 3DYIA 3ZDFA 2P6MA 1NN3A 1QBKC 1YBVA 3O03A 4JD5A 4Z2YA 2TSYB 3KHKA 4UMVA 3SBXA 1PUXA 2D5LA 3GG2A 2ERYA 2FB9A 2D1TA 3BK1A 1FFSA 4KVFA 4M7PA 1RRPA 3ZY6A 3MYYA 2H5EA 2P1RA 5CG2A 3OTOB 5NULA 1EQ2A 4RFSA 2OYRA 2WQ6A 4MKIA 1CB0A 2OXCA 3QHAA 4WXYB 1UMBB 2A9PA 4GYWA 3V8MA 5F2OA 5FUQA 2BCEA 4G1MB 4DDWA 3O47A 2Q1XA 3LT0A 2I4MA 4J2OA 1MV5A 3EEQA 1E1DA 3WL8A 3LT4A 4TXNA 2HA5A 1GZ7A 4MS3A 4AECA 2PA3A 1TCBA 4KBGA 5G02A 1T1RA 5TRTA 3UO8B 2E9SA 4QXQA 3W9YA 4DBLE 5IUJC 5FWXB 1RAIA 1VI2A 2IA5A 1KP2A 2BRUC 3FDXA 2C88A 3OKAA 4L6IA 4B75A 1L9KA 4B7AA 1Z7GA 2GJAA 1BDBA 1W6UA 3FMIA 5G2OA 2IS6A 4B5KA 1A69A 4B84A 2CHUA 1GQYA 2TYSB 4UBIA 5LYJF 4RLSA 5EWJB 1PLKA 3KYDA 1US8A 2AV6A 2X0NA 1X19A 2ALJA 2UVDA 3GRKA 3H4TA 3LYUA 1QO9A 4O4LF 4RMHA 2PT6A 4PHHA 4ZDJA 1KO7A 3BL6A 5FORA 2CW5A 2VJPA 3NTXA 4PE5B 1F14A 4EG8A 1UC8A 3FPLA 4H7DA 2WTEA 5ENVA 1GUFA 5LD2C 2Q41A 3ABRB 4Y1RA 4F1KA 3I6YA 3QE3A 1FVXA 4HVLA 4RK6A 1A9XB 5HOQA 5KVCA 3PEVA 4X1IB 1L8QA 4Y98A 3KD3A 4WLVA 3I23A 4R6WA 1MTZA 3SD7A 2ZUTA 5ED0A 4HNSA 3Q1KA 2WU0A 5IYZA 1XKLA 5FO0A 5GONF 1HQYE 2XLBA 1Y9EA 5JZVA 4KNWA 4L6CA 3Q3CA 4N82A 1PGQA 3U3JA 1QFJA 4QYWA 1N4DA 4X6LA 4DYVA 1Q92A 4XX0B 2I67A 1QYDA 1VPVA 3BXFA 3UMFA 3L4BC 4XVUA 1RRKA 2P9EA 4OXRA 4P33A 1ZQ1A 1DV1A 3T5DA 1ZD8A 1NBWB 3P2KA 5CT5A 1G18A 1HORA 2PSSA 4JZKA 2R8BA 3AY6A 3CW8X 2Q0SA 2YVLA 1CULC 4OB6A 3A36A 4W1PA 1Q7RA 4KQXA 3HCRA 2HB6A 5K8VA 2HU7A 1FRVA 4DQUA 4PV7A 5A04A 3R8FA 1DIOB 4Q82A 1SBTA 5EQDA 4ZO4A 2DPYA 1GKKA 3RLIA 1ZJ4A 4DLPA 4HH0A 4MUNA 5D3QA 2XV1A 2Z30A 3C87A 5F7XA 4UUAA 5AK4A 5AK5A 2XQIA 1V6SA 1PW7A 3OIDA 1G7CA 5C9ZA 2PWAA 1XXLA 5LQNA 3GD7A 2X40A 5EXPA 3HJHA 3TOXA 2ERXA 2OHIA 4BAZA 5KYWB 1FP6A 4RPCA 4BLWA 1NM5C 1JLKA 1W5SA 4LHYA 2ETVA 5EMHA 3S55A 4DLVA 5KTTA 4AO8A 2RHBA 1E5QA 5F21A 3RT9A 1HLPA 2X13A 5IWCA 3ANSA 3RFCA 3TMYA 4DW8A 2HH9A 2ZJBA 1KDYA 4IIYA 3DEZA 5LNK6 1AGNA 5H3HA 5HPYB 4R1OA 1KEPA 3QITA 1H85A 2DY0A 2KE5A 4O8CA 1ONPA 4OQYA 3CE9A 4YT8A 2CMDA 2HA3A 3ROGA 2CBGA 4X90A 1Y1TA 4E2XA 1KQGA 3DNPA 2NU7A 1QQ7A 3EB9A 4CYMA 4RVCA 5C18A 4OXXA 5G0WA 2A33A 3MT9A 5BN3A 5HIAA 4CVNA 4CLDA 4GZLA 1EQAA 1RXIA 2J5KA 4N7BA 2O54A 1W47A 4C5AA 4Z9FA 4BJ5A 3GEDA 4HK4A 4G4SP 1NJ1A 2XUFA 3AKYA 2NNWB 3NW9A 2C00A 4UHJA 1Z88A 3L06A 1AHIA 5A2GA 5BR7A 2ORIA 4MI3A 3AUYA 3GNTA 5L3SB 1ESNA 4UHEA 4RS4A 3IKTA 2XVMA 1TLFA 2JARA 3GRZA 5TVKA 2KS6A 2HW8A 2ZYVX 1WHTB 3SJBA 1SC1A 1JEAA 1ISHA 2QQFA 1J99A 3LXXA 4ZK6A 8ADHA 4XYLA 2IH2A 1MJFA 4BIIA 4OKIA 2YXLA 2FFAA 3LL4A 4EA6A 4EYGA 1LDBA 3FMPB 4OGFA 4C7VA 2A0KA 1QFYA 4KHZA 4CUJA 4Q5IA 2W2LA 3O8QB 2HJGA 1SA0A 2GB4A 3G88A 4Y9UA 2VJCA 3UHPA 2IUSA 5JFGA 1K86A 1NYLA 4KOEC 2JIBA 2QNBA 3Q41A 4W6QA 3R7WB 1T2FA 2XW6A 2XUDA 3MWDB 2K87A 1N6PA 3OLQA 2ZJ4A 1IN5A 1WWKA 2V59A 5B4TA 5BXQC 4IILA 1G6OA 5BRAA 4G5YA 2W2LD 3QEJA 4N9WA 1PT8A 2OK8A 4R8MA 5ALHA 5ETJA 3PX7A 2I8CA 2O19A 2FSIA 2PV0A 1H2EA 1HURA 5JBNA 5CIYA 4GI5A 1U65A 2IYNA 1Z5NA 3BJZA 4G07A 5DK6A 4MVXA 1P45A 4DTIA 3UK2A 2Y6VA 5JSKA 4G1UC 1GDHA 2JC3A 2SKCA 5JNSA 2UZ0A 3I2FA 3ZG6A 4C03A 1AB6A 1RYYA 2V6JA 1F48A 4G09A 4BNMA 3AEKA 1BYUA 2AEFA 4XR9A 2Y9PB 4RELA 4CM4A 1Y3IA 2ECOA 1T0PA 1CX9B 3RC2A 2P9HA 2FHPA 2FLWA 1E5LA 5CNIA 4KGVA 2CL0X 4QTUB 2VQEB 2WF8A 4PY2A 2EATA 3FOBA 1I4OA 2XE4A 3WY9A 3RSQA 4H3VA 4J6EA 5L4LA 3KR0A 2OVBA 1HNZB 1QR2A 3RB8A 1U8FO 3Q98A 4B09A 4MVJE 4U0JA 3GCZA 4I6EA 4M36A 1NIJA 1Q83A 5U1PA 3VZCA 5A2QA 4MI9A 3PNOA 4L51A 2JBHA 3KYIB 3NIDB 3ESAA 5JCJD 2ID4A 2OGTA 3I1FA 5JTUA 1E3WA 3D5EA 2FI1A 1DBIA 2ACVA 4O8ZA 5D5HA 1G60A 3BXZA 4LRQA 5CB0A 2JLSA 3BYZA 3LDHA 1OXKB 3ETCA 2ZT8A 4R5MA 1X7HA 1VBFA 3JQ9C 5KDDA 1WVIA 1Y1LA 3PKZA 1BSVA 3W77A 1EJ6A 4H35A 5A0TA 1KI3A 4W9MC 1VC2A 3TZEA 2QYTA 4XQCA 5KYYB 4MRSA 3WGJA 4Z8YA 2Y77A 2C95A 3PUIA 2VJLA 4DYHA 3CPSA 2A8YA 1IHDA 1IHOA 3JQCA 3R09A 5TR9A 4NFLA 3DFMA 3LA6A 4RHUA 5LDGA 1E61A 5T64A 1OFGA 1XTZA 3M5DA 1W5FA 2OCGA 3H2HA 3IHTA 4RHXA 2J9FB 4HCJA 3K70D 4PLVA 3T0FA 2OLKA 2O2XA 5TX7A 3AM3A 5I3CA 2M1ZA 4F60A 2VJMA 7MHTA 5I9TA 1U8XX 2Z6VA 2R68A 5CCDA 2OSBA 2XQFA 5FBKA 3WKAA 4BLSA 3FVQA 4DDUA 1RXYA 5DN6D 3LM8A 2EKQA 3D1LA 3H1TA 1YVRA 2W71A 4YB8A 3COVA 4C7XA 1X0XA 3GXBA 1Z38A 4M1MA 2ZFUA 4HAZA 3N2NA 4ETMA 4TKZA 4QU5A 2FWAA 3N59A 4HPWA 5DW0A 1SULA 3D6VA 5EIWA 1GUZA 4GYKA 4K9SA 3TPZA 4L78A 2B1GA 2DBQA 5KOYA 1DIGA 4RF2A 3TB6A 2AVNA 3U80A 1NWCA 3HCPA 4BVFA 3BRCA 1Y42X 2J9YB 1XU7A 3F6CA 2ZM6B 4QOFA 1DS6A 1WSWA 2DHCA 4JQZA 3ISTA 2C2WA 4MVWA 3IIEA 5EKSA 3ABSB 2FQXA 3CLRC 3VR4H 1T1EA 1XDWA 3VSBA 8LDHA 2IU4A 3GNLA 5LCXA 3VVCA 2I87A 3BFVA 3FCAA 3JQRA 4UEJA 1MP0A 4A6EA 5BYAA 2IU3A 1QG4A 2IL1A 2O3QA 3T3DA 1QC5A 4D9KA 1CUWA 3CVYA 3E5MA 3ACCA 3CH6A 2VWHA 3NDPA 4AZWA 1IQ0A 4CF5A 1GAWA 4J8PA 1K9SA 1N9GA 3P0RA 1EUDA 3MS7A 4HLDA 1Z6ZA 4ENQA 1EIZA 1J7JA 2ZAMA 4L5AA 5JECA 5EE5B 4U3JB 2Z1DA 4FMPA 5BN1A 2GBIA 4AY4A 3GZJA 2BRUA 1EDEA 1YRQA 4J3JA 4XIGS 3A4YA 1SCAA 5HIJA 3X44A 1WB5A 4MGKR 5HF8A 2ZSUA 3K92A 3QQ5A 4IKOA 3ZGOA 4B6SA 2P6NA 2VHCA 4BZQA 2BM1A 1YZLA 1ZC3A 2DJIA 3NBMA 2CLFB 3O9ZA 3QBJA 4LV5B 4XQGA 5BRJA 5LU9A 2C57A 2HF7A 4PQFA 2PCJA 2PUGA 1GSAA 3HRHA 1O0SA 1OLXA 2YN0A 3DV2A 2ZR9A 3V1UA 4EJ2A 5JSUA 2HIAA 4KBFA 4DJEC 3NHKA 2ZBRA 2OM6A 2J6BA 3L40A 4GEKA 3PBKA 1QCZA 9ATCA 3IQIX 5KQPA 2F00A 3JR3A 3WK5A 2EQBA 3KYCB 3NXKA 2V6MA 1QHGA 3F3MA 3AONB 2ZXFA 1UBTS 1W0KA 4H0NA 4L5JA 2M2IA 5TNXA 2E4ZA 2IS2A 4FWTA 1A4XA 4G0YA 2DQYA 4LSZA 3RS8A 4HQLA 3PUWA 4D3YA 1F7VA 3ZN2A 1UBCA 3PA8A 1WTCA 1ZRHA 4HH1A 1K0UA 3MIZA 3PHIA 5DSZA 2BKXA 521PA 1LUAA 3U3XA 4K3UA 4HNQA 1NW9B 1DEKA 2RGGA 4BFUA 2OV1A 3DXFA 1W0KD 1S9HA 2P4SA 3K4QA 3QUSA 3B82A 2A3NA 2W11A 2WD7A 4I46A 2X23A 1LS6A 2BFMA 3K4HA 1V9CA 3N0WA 2V0GA 3L4BA 4W5WA 4RV4A 4BZPA 4H4CA 4IGFA 1CY6A 4LYFA 4RVDA 1AZTA 3PJEA 3R4VA 4X24A 2QW1A 3AX6A 2IIQA 3NRBA 4J7XA 2OGZA 1H42A 2JZOA 2XE7A 1TMGE 2XNKA 4N5NA 4B3JA 5IHPA 1OOEA 1QNFA 5MDHA 4YJGA 3A1CA 4LUCA 2BMDA 2G5TA 4QHSA 4M9CA 3PFBA 5IRCD 1O1YA 2DU8A 3EAGA 3G0HA 4A6XA 2GBFA 3OWOA 2R1ZA 1FYVA 3AIIA 4DV1B 1DUVG 3PNBA 3RUDA 4P4SA 4P3NA 2VUUA 4MLZA 3HKDA 2CSXA 3AR3A 1EVIA 5JXHA 3ZHYA 2O5EA 3JARA 4YDRA 3EIWA 1ZONA 5KWIA 3KJZA 1TD1A 3LMKA 5COBA 4WNAA 2QMHA 2WWRA 3K9NA 2HCJB 4P84A 1FTWA 4U7GA 1OFUA 5AKHA 4ZQBA 4ARSA 3U1BA 5INTA 2A88A 2CK3A 1BHSA 2HO4A 3BXEA 3VDXA 4C7MA 1PNRA 121PA 2GK6A 3ZZMA 3BX1A 1WUHS 5H81A 2D8MA 1VQ1A 3C6XA 3NTQA 4WK4B 5JSYA 5TV2A 1RE0A 3NWBA 3FROA 2OZKA 2CN1A 1QCYA 2HWKA 3K6RA 1LBIA 2IYLD 4J0EA 2CK3D 1UFKA 5EGSA 1ITZA 5F76A 3G6KA 4ZXFA 5A5VA 1YKSA 3T1VA 3C0KA 5CB4F 5CGQB 4BZXA 3AL0C 2PM8A 5EI5A 3RWOA 2WHEA 3ZLVA 5AVZA 2P6UA 1EX9A 4LF4B 1ADGA 4RTRA 4Q48A 2BYTA 1J0DA 5DMHA 1TLLA 2X8LA 3ASZA 3PFCA 3T95A 5K2OA 1G21A 3PD7A 3MLEA 2Y93A 2YCLA 5J1SB 3F6YA 5HEKA 3N2ZB 3OPYA 4CL0A 1PSZA 4NLLA 1JNYA 2QSZA 4C30A 3AYZB 4WQMA 4FYIA 2ZWVA 2FMTA 1V7PC 3E1GA 3SBEA 5BMOA 3DL2A 2W42A 3LV8A 4OQ4A 2O8DA 3V8RA 3JALB 3M6MD 2RCYA 3RRZA 3RJ9A 2I29A 3EC7A 2G9VA 3ISVA 2L2QA 1Q11A 1LDGA 1PNQA 4A0GA 4DCUA 1ZKDA 1WOYA 2BIFA 1KAGA 3COZA 3ZU2A 3IR6A 1WY5A 3OLVA 4ICIA 3QU2A 1YAHA 4LTNA 4Q7MB 3PNSA 1RZUA 3PGXA 4FXOA 3W8DA 5ERXA 1ZCJA 2OECA 4W4TA 3RV4A 5BSWA 3MWJA 4PRKA 6CHYA 4PAOA 2ABWA 4MYHA 2V74B 4ZO9A 1XZQA 5DM70 2Z5VA 5IKXA 4RSGA 5CIWA 4OBBA 3PFWO 1CZLA 3VH1A 3EHEA 4XE5A 3GUHA 4FIDA 1E32A 5E3IA 3SR0A 4I55A 1GXSA 1R0ZA 4EFLA 2I7DA 2BJHA 3I73A 4FS3A 2XWQA 3RVKA 3CT6A 3DLPX 4ZOAA 5DYNA 1E58A 3OFJA 4ABTA 2ZB8A 1MFPA 3QJYA 3EGDB 4UZSA 3HU1A 4CE6A 3ESYA 1E4OA 2R1VB 2GHIA 1EP9A 3A37A 1R5OA 4R41A 5KJ1A 9ABPA 4E6PA 1TIKA 3EY9A 2QRLA 4PFJA 1L5VA 1EFHA 1EB9A 2A9RA 4NOKA 1IVYA 4OI1A 5H4HA 4ATNA 1EH5A 2NLOA 3FR8A 2IHTA 1TEVA 4PZEA 1G5HA 2Y3IA 2BFFA 5EIFA 2WWHA 2PL3A 4N5HX 2WTXA 4A9AA 3G2HA 5IXYA 4HNAB 4KQEA 4E4RA 1DC3A 5F3RA 4E5PA 3ENKA 4OL0A 1BHQ1 3PGVA 7YASA 1WZEA 2XCIA 2QSUA 3OZWA 2HRZA 4ZU3A 3OA0A 3OZXA 1CR0A 4KSYA 4NCKA 3S2YA 1ORWA 1YZYA 2JAXA 5C1PA 4HFNA 4C20A 2REXB 3CX7A 2YIDA 3MN1A 4TT8A 4YAIA 1G16A 1HDXA 1DC5A 1CBUA 4GRAA 5DM60 1WPRA 1X74A 3ZDCA 1AJEA 3PWKA 4D41A 3H2GA 3QKIA 4NYMQ 1XF1A 3R7SA 3QWHA 4FD3A 4UUQA 5AKLA 1ODIA 4CMBA 4ZJYA 4BO0A 3QMPA 2DERA 1FSFA 4GPEA 4HEJA 4KAAA 2VUIB 1YDGA 1U3CA 3PL5A 5DRTA 4C4SA 3GLFE 3IJ5A 5CYFA 2GO7A 1MJ5A 2LKDA 2ZJZA 2ZKIA 1ANKA 2VHYA 4I4CA 5K6TA 2HXGA 3V55A 1L4YA 1GG8A 2YZ7A 4ZU6X 5JPDA 4PYLA 4UW9A 2HTEA 1S4QA 2A5JA 4ZVSA 4DIDA 3P2MA 2AEJA 1KMMA 1OXVA 3RW9A 1YJ8A 4GYYA 1W48A 1UPUA 4RMIA 5FL7A 5EWMB 2YIMA 2GSWA 4CF6A 4BPBA 1DBWA 4JWTA 3L8ZA 4FCVA 2IPOA 5JBIA 4HR7A 4EJ6A 1KI6B 1R4NB 1VFNA 1ZMRA 3I1JA 1DQYA 1LLUA 3ILXA 1KOJA 2P2ZA 4PC3A 5I9NA 2WM3A 4FYYA 2VVTA 3RJ5A 4UASA 4CMIB 1NBME 1XNJA 2XVAA 3H1BA 3GLQA 4AFNA 1YE5A 5GVSA 5LQUA 3MXTA 3E48A 3GIDA 5FL7D 5JH7A 1BW9B 1JVNA 1NI4B 4X60A 4EB3A 1GD1O 1N1EA 2B83A 1U9CA 4IS3A 1JG4A 5B7NA 1D2CA 2CGEA 2GF9A 3KOUA 3R6LA 1MMFB 3ADPA 2F3SA 3O0TA 4AIRA 4AS3A 1RWNA 4ME6A 4F92B 1C3OA 5LQMA 1IBRA 3HB9A 7ADHA 2NYRA 2YWDA 3ADDA 1II9A 5KMGA 3AUSA 4F3KA 1E9BA 1Y7LA 4XWYA 5K3AA 3W2HA 2V7UA 3TQRA 4YRNA 3RQSA 2G28A 1U2RA 1LBQA 1W4RA 5CYOA 3AUFA 4DMUB 4Q7QA 4RY8A 5IAEA 5D3ZA 2V9ZA 1P75A 1U9ZA 4PHCA 1CRQA 3D3WB 5LYYA 3ZTTA 1ZMOA 1XZBA 4DYDA 2REQB 3AIOA 2SKDA 3UH0A 3W9SA 1X13A 4I50B 1ZU4A 3CVXA 2Z6AA 1NLFA 3WYGA 1KI7A 5DGXA 1NL3A 3IDQA 2P9JA 2VJKA 4P3OA 3ER9A 3UGQA 1DHRA 4HRAA 4U7TB 4XFJA 2R5WA 1UF9A 4BKOA 3MJVA 4V39A 5BVHA 3L6CA 5FF9A 3KQOA 3QVLA 4TTPA 4R3UC 2ZOSA 3GEGA 2QN3A 5T6BA 4MVJM 3ZJUA 3CLRD 1ZY2A 2WVGA 4NAUA 3AM4A 4Y8VA 1PGJA 1UBMS 4X54A 3BE5A 2FPMA 3AOGA 3GLSA 4RA9A 4PRLA 2HPZA 3VV2A 4MUMA 2R8RA 3G9ZA 3ZDEA 1RHKA 4ZP1A 4OLHA 4AO6A 3OUUA 1DEAA 3IKMB 4EG3A 3QHQA 4WLFA 5EZYB 3JWJA 4JBWA 3LVRE 1E5VA 4Y2SA 3ZCRA 4QGBA 1QO7A 2EL7A 3B1JA 5ADUS 4G81A 4GMXA 3WMFA 4MV4A 1AKTA 4Z0TA 1ATZA 3C4VA 1KI2A 1E5TA 3CPHA 1WPGA 1DCKA 1N2BA 4QGSA 1HYEA 2IIVA 3FI0A 4NBWA 5GPBA 2PPVA 4QJ4A 4FFVA 1CUYA 2D5CA 1KU0A 3R3YA 3V7FA 3V7UA 1N34B 1JQ3A 1NJSA 3UBTA 1EP3B 2W7TA 2HZ7A 1IDN1 5BQ3A 5IJ9A 3TZBA 1UZMA 3DMRA 4HDRB 5C31A 1IBMB 1JG3A 3KLMX 4LJSA 3P0JA 1IOZA 1Y8AA 2WMYA 3VU9A 5LIPA 1KSHA 2I33A 1R8SA 2P4EA 3BUSA 4WLOA 1PTJC 5DCLA 2YFQA 3A28A 4H3HB 4PXAA 4NMMA 2O1EA 3SQDA 1ZIYA 3ANXA 1TT5A 5K0JA 1RBQA 3L04A 5ALQA 2G9QA 4HG2A 3GA7A 3LUFA 5U4QA 3WO0A 3H5WA 1MIHA 1T5BA 5TMDA 3VYSB 3AK4A 5JWHA 3GUUA 3IMCA 1C50A 2XRMA 3EK2A 3QHPA 3DWFA 4U5QA 1FNMA 4BBPA 3B8HA 3VC1A 1S8FA 3DEYX 4KR0A 1PL7A 3T5CA 3FI9A 3B36A 3I1YA 1XPRA 4QVGA 1GEEA 3VPGA 3A2NA 1TAUA 4C87A 4JXXA 5ALXA 1Z07A 1RYFA 1Y5IA 4RLFA 4UTZA 2V98A 3DHYA 2W90A 5AOCA 3T9DA 1D4FA 3TVYA 3SOPA 1I4TD 4D5EA 1N5JA 1Q1QA 4N0EA 1PJLA 4CCSA 2R11A 4WT7A 4JI7B 1SHJA 2OFOA 1JDBB 2JFGA 4OHOA 3DB1A 2H4WA 1YDFA 2IEAA 1YOVA 3S6JA 4QKQA 4OXIA 5C81A 1BQ4A 2IYTA 1A1VA 2VJOA 3LQQA 3M4ZA 1YJXA 1QLWA 4ZKDA 5DYWA 1KZ7B 3REQB 3MOIA 2ZJOA 4YFYA 1ZI6A 3GDGA 4YT2A 2J0UA 3OIVA 1SXGA 5CDYA 5TT1A 1K7EB 1ZDMA 4I8XA 2GJ8A 1WKBA 1IBSA 1KZ1A 2QAGC 3TQQA 4ZZ0A 4D4JA 1Z83A 2IW1A 1T8UA 3OY2A 4FE3A 1XD8A 2YJTD 3I0ZA 2CLMB 4C1BA 2EKPA 1Z2PX 2R7NA 4W99A 5KVQA 2W00A 2DHQA 1QHNA 4KYUA 2ZB3A 5CDUA 1DIAA 1GKIA 2PMWB 1WA5A 2FZ5A 3FFXA 1VIYA 2NUAA 3EQ9A 3WWYA 4F5ZA 2JGIA 2ACEA 2NXCA 2V7QA 1P2DA 4N3GA 5CDHA 3GZTB 4JYPA 5F23A 5IP5A 3M9WA 3IO5A 5IW8A 1CEYA 4MV5A 1S3SA 1G3UA 5JPIA 3RK1A 3LW7A 3O1JC 2A0YA 1F5SA 2BVNA 3ROXA 4CM1A 2R8OA 3ML1A 1CP3A 5DZSA 4TL8A 1XB2A 2GTPA 4AP5A 2V5VA 5LZ8A 4NY1A 3G2PA 1NASA 3GL9A 4RW0A 5D2CA 4JXKA 3NJ8A 3VJMA 4KTVE 2VUHB 4W5RA 5MGNA 5ED4A 2IY7A 3FOAA 5AW0A 2WV7A 1MTOA 1L7XA 2XMDA 3N8IA 3TIVA 4DA9A 1N0UA 2NG1A 3UMGA 2R44A 4L27A 5ENZA 2QTHA 4G86A 1H05A 3SZUA 4YRAA 3ADBA 1CS0B 3PENA 2VP3A 2PHZA 3QUAA 4UEKA 3SYMA 1C81A 1IUKA 1J0AA 2WTNA 3THYA 1B23P 3KT3A 4RJKA 4JC4A 4YT4A 5CLJA 3VJLA 3IP1A 2ZVPX 3OJLA 4X0EA 1M8GA 2WT4A 5DP1A 1IFXA 4P80A 5ESDA 2Z4SA 1YB2A 2DKFA 2FPKA 2GJSA 3CLVA 3RAFC 3ITKA 2IZZA 2DHRA 2VSYA 1R4AA 3KOWA 3OOEA 4OHFA 4HAIA 1C7QA 3FZNA 4E2WA 3J7AC 3OFVA 3RVNA 3OPYI 1N1MA 4P5PA 4EPTA 3BJMA 1KZYC 3Q0IA 2V0NA 1GPUA 3HS3A 3NWOA 4UATA 1U3WA 3RSHA 3DW1X 1XSEA 2VWPA 1CYEA 4X3CA 2PT7A 3G1UA 4FZ5A 4Q6WA 4RTJA 3NZEA 3UXHA 4C04A 1XQXA 2NTNA 3TIGA 3VU3A 4PCLA 3KZ1E 3R7FA 2C2MA 4U9HS 3GGCA 5DBIA 3OQJA 3GRYA 3IP6A 4UCQA 2B4AA 1U3UA 2PR7A 1YB4A 1OBHA 3D4OA 3OLWA 4BZWA 4ADSG 1LVGA 4LW8A 3L1VA 2HREA 1QJ4A 1XHFA 5FWNA 1P9RA 3CKLA 5FIUA 2WD8A 1E2EA 1T9BA 1Y6JA 2FK7A 2O0HA 2ZUWA 2HK8A 4XUEA 3CKKA 4IH4A 1STOA 4NE2A 1TVEA 4QAJA 4U7PB 3WLAA 3RQIA 3W2FA 4F8EA 2ORVA 2FUG6 5KYXA 2FP4B 2VPIA 1E94E 2HFJA 1CJCA 2HT6A 4FNGA 3N2GA 3JYQA 1KO5A 4LXGA 4D3FA 1JFFB 5IWAB 1QP0A 1C30B 3EUWA 4B31A 1ZH2A 4ZVOA 3DMFA 4JP1A 4CIAA 1PI3A 4TTQA 3CRQA 3HY4A 1TKRA 5DNYB 1NA5A 2F90A 2LXNA 3IJPA 3KQTA 1V3UA 2KMLA 4LOIA 2XKKA 2H31A 2H51A 4LHZA 4AZ0A 3WGOA 4FQ8A 3O6VA 4KV9A 1ODKA 4C21A 5LKAA 2WOJA 1IG0A 1G2OA 2WUEA 3ST7A 2QBYB 4E03A 2XQVA 3F90A 3EIFA 3RIXA 5BSMA 1FQJA 3N3AC 3Q0EA 4AM8A 2M1XA 1HYGA 2G67A 2J59A 4DA4A 2EZ9A 1XZGA 1BIFA 5FFFA 1QWOA 1KRWA 3QV1A 1RS0A 1KDZA 2RC6A 4IDPA 3IDZA 4J76A 3C98A 5JZ9A 1UBEA 2NU9A 2D7DA 4FOPA 2R48A 3PCRB 4Q4HB 3ZH9B 2D2VA 1GNLA 2WMDA 3I8SA 2Z5GA 3EAFA 5ICSA 3UEOA 1CRZA 4U2GA 1WP9A 4MIEA 3HB7A 3GXOA 4IJKA 3JV7A 1AXRA 2CLIB 2H4XA 5K3SA 3ZWDA 4YQZA 2QWXA 1GR1A 3KV1A 3O0DA 5CTJA 2P5SA 2CFRA 5T4FA 3UYLA 4FFSA 3FNFA 3UAYA 5FQOA 2GM5A 3GJ0A 3LIPA 1QX3A 1BOFA 1CY7A 1UT6A 2WEKA 3PGMA 2CJWB 2TMGA 4DG9A 2FDCA 2ZIEA 5F1OA 3HP4A 3U2QA 5KWEA 3A7EA 1H66A 4MRNA 3FPBA 3HI4A 1E69A 3TRKA 1XTPA 1UQTA 5HSGA 1QKJA 5IDWA 4ESVA 1YB7A 2FPOA 3T7EA 1IOWA 1G6Q1 3SEFA 5JD5A 1DDIA 4ARUA 4CFZA 1WBJB 3CMMA 3M33A 1EUCA 4OM8A 3CZ9A 4QPCA 1A98A 2QLTA 4FP9A 5EVCA 1JI3A 1Y63A 3QG1A 1TFRA 3DLBA 1K92A 1LJ8A 2OUKA 2QQGA 4L5BA 3C3PA 2NOAA 5I7FA 3AQ4A 1UP7A 3AFIA 3QF7A 2GM4A 4EDHA 3VPDA 1Q50A 2Y05A 2GETA 1Q2XA 3CTPA 4CHGA 2H08A 1SCIA 3O3CA 3GJTA 5L95A 4AN1A 2VQ6A 2FFBA 2A84A 3JVDA 4Q7JB 1TZBA 2P1DA 3DTVA 3EFOB 1FFCA 1SCJA 1E7QA 2JCVA 2VTDA 3CH7A 1PTKA 4P83A 1HPLA 4URHA 5ALZA 5JT1A 3A1TA 5ESWA 5C8YA 3WV4A 3R7DA 5LNK1 3G2KA 4HWOA 1MX5A 2QN6A 5D00A 5EKDA 2B8EA 1E6EA 1H93A 5JADA 1JDUA 3COYA 3RYFB 5ICGA 3T1OA 2DUJA 3D6FA 3LLVA 1NW4A 4MPJA 3BRWA 1QZXA 2ISSD 3PFHA 3QA3E 4Y7CA 1G6HA 3N8KA 1T2UA 3DTVD 4QBGB 2J6IA 5FTWA 4EGFA 3SFZA 4GVLA 2OFFA 3EXFB 5KEIA 4MAAA 4PU0A 2QRNA 2JVIA 2PKXA 1PQYA 2Q0HA 1YZTA 1VRCA 4PR0A 1E0DA 1CJSA 2IT1A 3Q87B 4N3AA 2BKEA 3L6EA 2BFBA 3GJ8A 3VNBA 4TPKA 2GX6A 4R6XA 1T4CA 1XT6A 2QMYA 3H3JA 4B7XA 4DMCA 4B6FA 2E87A 1WMSA 3HLYA 3JWGA 3L7BA 2JK0A 4X92A 1PZGA 1RMTA 5C4MA 5K0TA 1M72A 4UTNA 5GJWC 5KNBA 3I61A 2HJRA 4IYRA 3SMQA 3SYTA 1USKA 2YXNA 3N74A 3TQSA 5LU8A 3T1TA 5EE9A 1ZNQO 1E60A 3IEIA 1BJKA 5EJIA 3GFTA 3VKGA 4FBLA 1CNMA 2ZU6A 3MFQA 4X65B 4D5GA 2ANBA 2P3QA 3WNQA 2FFJA 2BBWA 2GCIA 1NG1A 1Y6RA 3GGOA 2FMFA 1GJRA 1XTKA 3AU9A 3OMXA 4HDQB 4NFHA 5KNBD 4BY9E 2Q5JA 3A9TA 4M6WB 3FSEA 3LF1A 4KX3A 1XK6A 2XD9A 4O1HA 1QP4A 1ZX1A 1VZ3A 1WHSB 4KGDA 2VS1A 3MRXA 2IU0A 1PG0A 3JQBC 1YS6A 2VYFA 4G24A 3UXEA 5JOQA 3ADCA 3G23A 3ZX5A 3PXBA 2Q3LA 2WJPA 1H1TA 1U6JA 2IXDA 3CTMA 2HBYA 2IEDA 2G0NA 2VHEA 3O74A 4RZ3A 4Y2TA 2RSLA 4C0LA 4DM7A 2AJDA 4E13A 2RH5A 2RJOA 2HUNA 4OPMA 3V4OA 3ZWBA 1VI5A 1RZ3A 2FJUA 2HMWA 3OCYA 4FKBA 4EL0A 2E4VA 4EEXA 1E9RA 4X6XA 5JS8A 4DCVA 1SU6A 4ZQHA 3R0IA 3B12A 3NM4A 1U2EA 4X3OA 3BSSA 3M82A 4MQEB 1MXHA 2JKYA 3D3EA 2PT9A 3IYLW 5LP6A 4EFNA 5JFOA 3UN1A 1HFEL 3C1OA 4GEGA 3P9ZA 5IFKA 2C7OA 3EWSA 1VHWA 5DK4A 2B4YA 1HC7A 4TYWA 4GOOD 2AZXA 4PGFA 3VPFA 3WK7A 4PYKA 3MQ4A 2JRLA 2VK2A 4CN8A 4KSCA 1T35A 1I4DD 3PFNA 2NN3C 3KZVA 4LC9A 4E3ZA 5JSQA 4LZOA 4I08A 3KX2A 3T7DA 3UV7A 5IXJA 1YZHA 2PUBA 3IC5A 4IPTA 3UQYS 5ITSA 3TEJA 5JS1A 2WZCA 1Q2UA 4BCDA 4MGEA 3K5HA 1T1GA 2CMGA 5AI9A 3OH8A 4NFSA 4YAWA 3A4TA 2ID8A 2IF2A 2X0RA 3PA6A 3DH0A 5CPBA 4P93A 3AVXA 3K8ZA 1ORIA 4WUTA 1UBUS 4B45A 1SZPA 4TV9B 4U2DA 4F4FA 2FSUA 2ILTA 2QAGA 1LK0A 3L8GA 3F7MA 3ZNOA 3W5IA 3ETGA 3NTUA 3UAGA 4JL5A 2XMSA 1KR5A 1U1CA 3KR2A 2O8BB 5JUWA 4G0MA 4EFMA 4RPIA 3KQLA 3HBJA 4GWLA 3U7HB 3MCVA 1N7IA 2BEWA 4DA0A 1UEXC 2ZSAA 1SZDA 3QE4A 4MYDA 2H1OA 1T2VA 3EUAA 3WYCA 1D09A 4WN3A 3ZWVA 4ZIRA 2WQZA 3EEIA 4ZYZA 2O0LA 5LXTB 4UM8B 1Y6FA 4Y6QA 1LY1A 3A3YA 1N7HA 1X9HA 3A3OA 4X1KB 4ZVMA 4CCYB 3ZZTA 2XTJA 2ZJ5A 4JIMA 4FN5A 3OT5A 5KU7A 5CTAA 2BBTA 3JQ8B 1I2MA 3Q7TA 3JQDA 1KOGA 1E6UA 1AN9A 3FETA 3GUCA 2YV5A 1D2MA 2FPRA 1EWYA 3OPXA 3I4CA 4D56A 2GQ0A 2VDLB 4ARIA 2BKVA 3HSSA 1G7TA 3FMGA 3UQZA 1VE3A 3ZK7A 2F3QA 3E1SA 4HAXA 4UHHA 3SMVA 1V11A 2FPGA 4H7KA 3SR3A 3WQBA 2DUUA 4QEKA 4W5JA 1QVWA 2AMLA 3MWFA 2H48A 2WUDA 2GJKA 4NH4A 5E3JA 4GXQA 4X71A 4YJ2F 1M2VB 2GLTA 2VDUE 5AW9A 1IYZA 2LDBA 2OKGA 3OP4A 2H4HA 3D81A 2CNLA 3KE8A 1HTWA 1L6IA 1OIWA 4MWEA 4OQZA 5LMZA 3I5YA 5HYVA 3E35A 1I9CA 1PFUA 1QYWA 2G82A 1O6GA 3G6WA 1H4SA 4BJ3A 5DVZA 5LLSA 3EE6A 1WB9A 5CM2Z 1R74A 4KGXA 3HB4X 1N2OA 1WCIB 4GX5A 1T6NA 2PLNA 3ASYA 3IO3A 4TUYB 4HZUB 2WYWA 5DBOA 5G41A 4K26A 4XLZA 1V8OA 4BVBA 1R12A 1D8TA 3DOUA 1A9OA 3STUA 4RK0A 4BE9A 4R4JA 3JSXA 1DC4A 3EZ6A 3ZQKA 2WWWA 3HDQA 2JGAA 2WABA 1LB1B 4BGDA 2FSSA 3CB4A 1P5HA 2CBZA 1W36C 2I2WA 3DUFA 4FFDA 1DEXA 3KJNA 2RAFA 1VLMA 5A3SA 4EP1A 1H2XA 3FJYA 5HZKA 1BRTA 1UXKA 3FHLA 1CDOA 1PQWA 3AHIA 2O07A 1JQJC 1IWBB 1R9JA 2CNWA 2W2MA 4JBHA 1U7TA 3LPNA 3P9YA 4LXQA 2CLEB 3WTCA 3ZW8A 2PQMA 1RJWA 1GZ6A 4I5DA 5JQGB 5JDIA 3KO8A 2RHGB 3TSWA 4RD2A 1XD2B 4BV3A 2JVKA 3PC2A 1H8HA 4G1VA 4EY5A 1DRJA 4RVSA 1Y8QA 3L41A 1TZKA 5BQPA 3E3OA 2FZKA 3TD2A 1B8VA 1N75A 2CNWD 1I3LA 4XB2A 3CZ5A 1O6BA 4BCCA 4LZNA 1OAAA 3QXSA 2D5IA 1N6OA 2BI8A 3N7TA 4RFSB 4D3XA 3ASUA 1H8HD 2HU2A 5L3RA 4OQQA 4BPRA 4CTMA 2C4MA 1ZUNA 2HOQA 1V5GA 3AF4A 3DCJA 5GINE 4F9TA 1LQ2A 3V00A 1L8LA 1GNRA 3P0IA 4N8DA 4YJDA 4EQZA 5ESRA 3JZFA 1KDOA 2F43A 1UQUA 2F6RA 2IXAA 4RKWA 3COPA 4PYNA 4W5OA 1CJUC 1NDHA 1Z8DA 2C9OA 4C7OA 1KEVA 1L4KA 1GPKA 1RJEA 4N3CA 1I0IA 1N8KA 4P7KA 2Q4RA 4OYLA 4MOWA 4RF4A 3KYDB 1C0EA 1US8B 3KOOA 4P92A 5D86A 2VKTA 3EF1A 1KOLA 3HZOA 4N0MA 4GGMX 4B83A 3REFA 2OHHA 3ECSA 4AS1A 3OICA 4EB8A 4JUAA 3NJRA 4UBLA 4UNIA 1QANA 3X1MA 2NACA 5I9BA 2DPHA 1AS0A 4U2FA 1WKVA 4W1QA 1EKXA 3H1PA 2VN8A 2WJWA 3HV2A 4AY3A 1JU9A 4ARZB 2R6R1 3H99A 3QXCA 2VL7A 4OY3A 1A76A 2ZU0C 1FMFA 4D9FA 5DMXA 5ICMA 1M33A 1N2XA 4ZT3A 4JA0A 3D6MA 4CQMD 3L77A 3PQ7A 5G40A 4FDVA 4IQFA 5H9WA 5EUQB 5ALFA 2PZEA 2H85A 3HJNA 2C1ZA 3KL2A 2QUBA 3NETA 4MMYB 5CXXA 5IYZB 1HYQA 1NHGA 2E4AA 2IXGA 2QVCA 3HB5X 3EDMA 2WSMA 3MMNA 3U1TA 4RFVA 2IOFK 2JAQA 3P0FA 3M81A 5DHRA 4Z5XA 1SVLA 1TUEA 3BTVA 1NJ8A 3O8LA 1WZCA 1FZQA 1LEHA 1WB4A 3JTEA 4DANA 1XPOA 4YRSA 5EMKA 3M0EA 2VHUA 4YO8A 2X7JA 4HNGA 5C5CA 3TIFA 1DO2A 1XN1A 2O5RA 2E6KA 3NYIA 4DR7B 3CKYA 3ZDXB 3OECA 1GCGA 1YA8A 5IKEA 6YASA 1O03A 4LYYA 4D8UA 4PXSA 1HL3A 3ON5A 4REOA 1SXPA 3ZX4A 1HEIA 2ATEA 3OE7A 3ZV6A 4BNZA 3NT5A 1M2NA 4GLLA 1JJVA 1UJNA 1YRYE 2X86A 2YMLA 3OLCX 3ZWCA 2NQ8A 2IPLA 2PYIA 1II0A 5AICA 1AXEA 1L7EA 1YQEA 2PU5A 4KLZA 3IRUA 4HKTA 2ZT6A 4WOBA 4GI7A 5EXTA 4RTMA 4N40A 1I7PA 1JF8A 2KQUA 4EPXA 3C3YA 3NHWA 4QX6A 5EWLA 1BOOA 1L5FA 5DB4A 1RHUA 3VDMA 4B7UA 2G1JA 1JHPA 4XGIA 3ORSA 1CEQA 2VOEA 1KXJA 2FEXA 2VAMA 2VH2A 3BMQA 2QTFA 2XRFA 4Q4JA 1GQQA 1GUYA 1LX7A 3F5FA 4K9KA 4IUCS 3ZDRA 3PEEA 2UZ4A 3KJEA 4UVHA 3KVOA 2G5PA 1ZG3A 5E0KB 5KQRA 4B33A 2XXBA 3FPHA 1OWLA 1N5IA 1VL1A 1FPMA 2VJNA 2PD6A 3OZGA 3AMVA 4OMFG 1ZITA 5HM8A 2VNIA 3U19A 1NURA 5CBPB 1IUNA 2GF2A 1ECGA 4YEDA 4ZMRA 1NVDA 3D3QA 4DNXA 5BN3B 3I0MA 4EPRA 4D6PA 1UZNA 2BE9A 4HYYA 3JQBA 1KZGB 4EENA 4X00A 2XDWA 2E37A 2J3JA 2HJWA 3UUWA 4NPAA 1BFDA 5DGCA 3O82A 2YXBA 4RTNA 1GCAA 3S2ZA 2QUKA 2NSDA 2FWRA 421PA 4KE8A 3GJ5A 3PNMA 1LCIA 1KWGA 3WXBA 1O2DA 3WA6A 4IGKA 4EX7A 5HKOA 4Y9DA 2VDVE 1ENYA 4F2GA 4HQ6A 3KZNA 1GYQA 5FBQB 4REMA 1ZL0A 2R4QA 5ECDA 4FFMA 3U16A 4JEUA 4NFYA 5GV8A 3EMBA 2QM7A 4IOMA 4BP8A 2NO9A 5FPYA 2D5BA 3REGA 5CJJA 1Z4JA 3CINA 4J4TA 1BHJA 3ZY3A 5B64A 5HCUA 1TQ2A 1DAMA 1TTHA 3V3KA 2GN9A 5KJCA 4FEEA 4MV7A 5SY9A 1X1QA 1JECA 2ERCA 1U1DA 2RK3A 4PONA 1KEZA 2H5JA 5HTOA 5HF5A 2AN3A 3ZGZA 2EKLA 4NI5A 1PAUA 3LECA 3WSVA 1LGYA 3I1IA 1FBTA 4E12A 1Y9ZA 4K8OA 1AKUA 1EJ2A 1DJOA 1IPFA 1S01A 2GCGA 3C3DA 4GZ3A 4IZOA 1G1AA 1IHPA 4R1SA 4R1MA 2X6TA 4YHHB 1L5MA 1KQFA 2HAEA 4G0XA 2ECKA 2HYIC 3WAGA 2HDWA 4A5OA 2HHCA 3MGCA 2EKDA 3I6MA 2R60A 1TT7A 3AOEC 5ADWA 3KJGA 4GU5A 4TLBA 1JRLA 4YCBA 4POAA 1WF3A 1ZN9A 5KTRA 1RYNA 1ZUIA 5A3VA 3AEKB 1WEKA 4MEJA 3MILA 4ZQGA 4QUBA 1CNFA 3NAZA 3DEHA 4U1RA 3T9CA 3ZHQA 4BBJA 4CM4B 1V25A 4F1JA 3C14C 3OOYA 3K6SA 3G9XA 1JPUA 1A0OA 5L7TA 1H2FA 1EX1A 4DV2B 4LJ7A 2R6AA 1TCUA 2PS0A 3UCXA 1NLYA 2O2CA 3ICOA 3MT8A 1E0JA 3HACA 1LPMA 1FTNA 1V9SA 2I5PO 4C6TB 5KJEA 1YBAA 3H5LA 3D1VA 3M89A 3E9EA 2LW7A 4PPQA 3RK0A 4TYMA 5HIMA 1SY7A 4R7ZA 2HIGA 3UPTA 3EPJA 2ZGVA 3P9KA 3FWPA 2Z8YM 1I33A 1N5RA 4RESA 3OQNA 5L4SA 3DVAA 3AR5A 4GRDA 3KC2A 3T12A 3FPSA 2IDJA 3ESBA 5FA8A 2BM9A 4KQCA 2HMAA 1MGPA 2Q7OE 1T3LA 4CKEA 4YV1A 1KYYA 1R0RE 1VJDA 4DLXA 4X84A 1K0FA 1U1EA 3QMVA 3UGJA 4PC6A 3GRFA 1V6AA 2NVOA 1QWSA 2OQRA 2DLDA 3I83A 5EYPA 3SYKA 1WCXA 2PAFA 2VJDA 4EHJA 1AQNA 3T6KA 3I2HA 1NW3A 3QSGA 5E4JA 1U5CA 2CVHA 2GKSA 4IWYA 4WOJA 2E5LB 3K70B 1K8XB 4ZEWA 4Y2PA 5ALPA 1C0LA 1NQUA 2MU1A 1O9HA 4W5HA 1QH8A 2H5LA 3LC7O 4YACA 4AMUA 1NAIA 2H5IA 3IE1A 5LC1A 3F4BA 2DPXA 4PZUA 1QOPB 2XB9A 4Y6OA 3TZKA 1SPXA 4B4WA 1E2FA 5JRZA 2J9ZB 1YCDA 1NNI1 3V48A 1BWQA 1Z2OX 2YXEA 4A03A 4TLMB 3U9SA 4KPUA 1ULTA 3B60A 4YGYA 2J09A 2QQ0A 4BFSA 1V3QE 1MDBA 3E9DA 4PCVA 4BATA 4AZ3B 4YJKA 3FW1A 4C5BA 1FNBA 2OY0A 5JD3A 1D2GA 2D1QA 1J1ZA 1RIFA 4UTOA 4DBLC 5ALNA 4CM5A 1R50A 3GFVA 3KQPA 3HNRA 3EBOA 3LHKA 1BJTA 1JQDA 1YR3A 3C7AA 5LN1A 1EM8A 2Z6QA 1WZUA 3W7BA 4CKXA 3FDZB 5JY6A 1YNOA 3TE7A 2IE0A 3GD5A 2BP7A 3D8BA 1PF7E 4ZVNA 1KE2A 1NF8A 3OC6A 3TWOA 1CD5A 3N1UA 2C7BA 4ZCQA 2PWYA 1B00A 2OWEA 4I6GA 2VRWA 3G2JA 2GN8A 1NZJA 3QU7A 1M6EX 3IE2A 4WZBA 3RS7A 4RTQA 1IZ7A 5EP3A 4AMBA 1ATIA 1GGVA 2B4QA 1JE0A 1RQPA 1W5AA 1CVRA 1E1QA 1ZBQA 3EVBA 3HJUA 3IQDB 4FHZA 1X7XA 1LK7A 1GSIA 1BVUA 1A50B 1QC5B 2HEIA 1L7MA 1Y48E 1A8HA 2PXAA 2R3SA 3JQPA 3K9WA 4BMNA 2LD4A 3A1WA 1CETA 1N9GB 5EUMA 4PX2A 4DG8A 1C7IA 2QAJA 2VT7A 2VXCA 4XWTA 5KX5F 1QIGA 1OY1A 1UM8A 1EK1A 3SJUA 3AR8A 4MO9A 1PN3A 4R9RA 1RM4A 5AHWA 1FNNA 4OJQA 1KNXA 5B4UA 1ARZA 4LRSB 1QV6A 3GZNB 3H18A 4XYBA 5G4LA 1P4HA 1Z56C 1XMVA 1P0CA 1PR1A 3BZBA 4FYXA 4D99A 1FU8A 3HMKA 4J75A 2AGVA 1FP4A 2G6BA 4U7FA 1VA5A 2CYBA 1U90A 5B6IA 1U0GA 4AJ2A 4I4IA 3RYIA 5FOQA 3PQ2A 3SS8A 1OLXB 2R7LA 4KO3S 4YJ3A 4AJ4A 3RSGA 1L5QA 1VSQA 5AR1A 3W5HA 2BUBA 1DCFA 1E9FA 2YJ6A 3OFNA 4I3HA 1AKMA 1QZTA 1SCUB 4TS1A 4UFNA 4KXVA 4KH0A 1LI5A 1XYVA 2A0XA 1YSCA 2X3UA 4P0QB 3HVUA 3DD1A 3F97A 2SBTA 2WF5A 4F9GA 2RGUA 3LWNA 1BDJA 3KXIA 1KAMA 1JEDA 3IJRA 3AF6A 1QUEA 4XEHA 1U63A 1KQPA 3EXHC 3IBTA 2LIPA 2C1XA 2QTWB 4G8CA 1SUAA 3OFND 2MSWA 3NATA 3NT4A 5LMUB 3ORHA 4EGQA 4K86A 3GDOA 4GO1A 3DAGA 3RBXA 1KQNA 2BN4A 1BXRA 2XUOA 3B5IA 4Q00A 4KN9S 2WD7B 1TUBA 2PT5A 4Y3UA 2C4TA 3P2IA 3ZCQA 4CMJA 5JI2E 2OD9A 1DJPA 1G4AE 4W7IA 2HIHA 5ALLA 5EN4A 3TAHA 4BRWA 5AT1A 5JNVA 4ZVLA 4RK4A 1YDEA 5J4KA 3E58A 3HQ4O 4NNOA 4ZYXA 5C1OA 3T9AA 2DX7A 4YJGB 1XRRA 4TUYF 2VNKA 4OXNA 2NSYA 4X6UA 3A4NA 3Q0TA 5IVIA 1O8CA 2PL1A 4KO1S 1QFXA 1RVDA 1U4SA 3T7JA 1NW5A 3F49S 1U7WA 2CE2X 4MAFA 2EW1A 2B1RA 3RDPA 4P4SB 4XCXA 2CCGA 1NP6A 3C6MA 4LEIA 3HKDB 4BO9A 2H1IA 4AT1A 2P2CA 5DEOA 5IHXA 2I1VB 1NUHA 2JLQA 3N7UA 4RXTA 5EIOA 1V8BA 1LLDA 1KDPA 1MG5A 4D25A 1N5OX 1KORA 3VNSA 1TVKB 3KBOA 2QZZA 3GA5A 3TKAA 2UYCA 1PJBA 1HK7A 4YA6A 3SC6A 4DUGA 3FLAA 1SXJC 3M1AA 5TLSA 2OCBA 4EHFA 3AETB 1XMIA 2I2AA 3J81A 1A5SB 2XQKA 4ZHQF 1H4TA 2C8JA 1QO0A 5JQGF 4UCWA 2H57A 2VDRB 1QM5A 3MEQA 1LPAB 5TPZA 3IFSA 3OJCA 1FUKA 5AW3A 2Q3BA 2P30A 4DUGD 1KGDA 4KNYA 3DAPA 3HDYA 1AC5A 5FBWB 2C2BA 3KKKA 4LA4A 4BMDA 1IXZA 4B3MB 2JCBA 2AB0A 4MWGA 2ZR7A 3I9NA 5DOZA 1QO0D 1YL7A 2OO5C 3BCRA 1E3SA 1LPNA 1O9BA 2PLFA 3ITNA 3N6VA 4IJ6A 5TPZD 3SQMA 3WNDA 4EGJA 4R8VA 3ZIDA 4N49A 2OPBA 3DTTA 1Q22A 1G21B 5GWXA 4TYQA 1ZJWA 4PSCA 4EGCB 2PX6A 4KPEC 3OZTA 3IEMA 2RGNC 1GN8A 5KNCA 2NVUA 3DDZX 2ENUA 1NF3A 2GF0A 1JFLA 2WUGA 2XNDD 4HGZA 4WJKB 5IAOA 3V2UA 4GDFA 4XIIA 4MW5A 3PDHA 4UNNA 4NZOA 3FWYA 4J1QA 4RNDB 2O8DB 4FTWA 3MT0A 4OYRA 4H0CA 3W4JA 2PUWA 4H4DA 2IQ5A 3CH4B 4PICA 2BUAA 3NDIA 4F9EA 5JASA 1Q0TA 2PCLA 1I1NA 2EARA 2VP6A 3OMWA 4HNTA 1I7LA 2GNAA 4XIFA 4W8GA 3A2KA 2N3ZA 3BD8A 4QPPA 2I6SA 4TLCA 3KQSA 4G5FA 4NNJA 5FJJA 5BN4A 4Y2UA 4DDKA 4GR4A 4DCJA 3C43A 2GGSA 2AXEA 3P9CA 5J58A 4KQWA 1EE9A 3OEYA 4ZT2A 1GCIA 1FNSA 3L0SA 5JWOA 2A9VA 3RRBA 2EF1A 3L82B 1G1MA 1P31A 1TJ3A 3AWDA 3BHMA 1AMUA 2W0MA 1M2GA 4IRMA 3MT7A 5BV1A 2XYQA 4H6PA 1QG2A 1S3IA 4E32A 4JK3A 2YYYA 4Z2AA 4BUZA 3E3NA 2OLJA 1XCPA 5CJPA 5TGTA 2WTUA 1E77A 4I55B 4ARAA 5HJ5A 1GXSB 4EBFA 2WICA 4KZKA 1E8NA 3F5SA 1DAFA 4TMFA 5AKJA 4YONB 1EE2A 3DZ8A 1L0BA 1SBQA 2GZAA 1YCFA 4Y6GB 2I6UA 2V8OA 5KOHB 4NBNA 5EAIA 1PR0A 2YV2A 3AOEA 4TV8A 1AF7A 1P8AA 3QIAA 4CT0A 1E1RA 1FP1D 2WYUA 2XDYA 3LH5A 5FADA 2PH1A 2EYUA 2REOA 4MUFA 3PXGA 3INNA 3FPJA 4LOAA 3MAAC 3RFFA 4JI3B 4KK4A 3W8NA 3IMEA 2B5WA 1TA0A 1GFZA 4G1CA 4XTCS 2CXUA 5FR2A 2ZI4A 4LYDA 1B0AA 3B1WA 4Y2QA 3H2KA 5TQVA 1E1RD 1VL0A 4ML3A 4J0FA 3ZXXA 1D5WA 3EGVA 3UJ6A 4EY3A 1UANA 5G1OA 2WV9A 3BXOA 4XCQA 4GUAA 5AJWA 1V4VA 1M67A 1URPA 3X0DA 2FWPA 2FZLA 1CQZA 2X9LA 3HBAA 4GI2A 3GQVA 3KKEA 5BSTA 4QNMA 1INLA 1OLUB 2QP4A 4LF6B 3U4MA 3GVHA 5DM1A 4TT3A 4UEWA 1XALA 1AX9A 4M21A 5G1PA 3CLSC 2YVAA 2I3DA 3U26A 4B82A 4A4DA 5K0SA 3ZVNA 1ZM7A 5PNTA 1VG8A 2WSSA 4DAOA 3PIIA 2LE0A 3HPQA 2H1VA 4BTVA 1AA9A 4OIMA 5ALVA 4MP8A 3PR1A 4MRAA 3L6RA 3IQEA 3D6TB 4TT3D 1XLTC 1ZIDA 1Y4UA 3GGPA 3ABOB 4WBNF 2SKEA 3K7EA 4KXLA 3I92A 3E22A 2BGKA 3PXEA 3U3OA 5TIIA 1ISIA 3N8HA 1X1BA 4TZTA 3AHDA 2WSSD 1B93A 3EWIA 2EKBA 2JAWA 3GCGA 3LFUA 1ZSVA 4F04A 4UNRA 2LBPA 4KXQA 1SC6A 2CJYA 1WMDA 2BFOA 2DR0A 2NGRA 1WUIS 2QRQA 2WU8A 3UVEA 2ZB2A 1R9MA 3L7AA 1XZAA 2BMJA 2C5AA 3EDQA 1RI2A 3LYLA 3VC7A 1L5ZA 1HBJA 3KU1A 3WOHA 1JHDA 2DP4E 1NVTA 1A2KC 2RIPA 4FFWA 3HYTA 4XA8A 4JFAA 4JLWA 3FTEA 2WYIA 1TVCA 5JH7B 1LQTA 2WRZA 2G83A 2PLAA 4QHYA 3K8QA 5IAGA 3GVCA 4K88A 3UC5A 1T0HB 4GOMD 4H6VA 4C0AC 3D7MA 1UDAA 3OZUA 2P9ZA 4JOBA 4O2AA 2Q5FA 4WGFA 5DASA 1COWA 4Z54A 1E9EA 1W85A 3F6BX 5EKUA 3QKTA 1R8XA 2BEVA 5FBVB 4IDNA 4IZHA 3RTCA 2CZQA 3O8OA 4DJTA 5KMGB 3EISA 2D0PB 2OENG 3TI9A 5JARA 1QRTA 4MQ5A 1EFUA 3DNMA 1VLQA 3EBPA 1J0CA 3PQ3A 3DFIA 1X9GA 1COWD 3L7IA 2AZTA 3L8DA 5CVDA 1N6KA 2G3YA 3SI7A 4G0NA 5CVEA 4K46A 3KSUA 1SD1A 2VIIA 4KQIA 2XDQA 4CDRA 2ZUEA 2A92A 3F9RA 1ENPA 1FUYB 3H0EA 1JIXA 2P9BA 3IXMA 1XWIA 3LLUA 2QE7A 4N4AA 4A7PA 2V4ZA 5KWVA 4IEEA 3UMMA 5F7ZA 3MAGA 4JMPA 4PZ9A 1W87A 4DMLA 2HLHA 1KI9A 1QHHA 3R6WA 3BGVA 4EOGA 2ACKA 2FG5A 1YVDA 1SNYA 4B6OA 1MHTA 1UZLA 4YRMA 1D6JA 3H5VA 3UWDA 2ZYDA 3W5BA 1DOHA 1USVA 4F85A 1HE1C 5TMBA 4QYIA 1PK9A 3F9IA 5IZCC 4L4ZA 4RA9B 5HRAA 2QE7D 4FZRA 4IXDA 4MULA 2IV3A 1C7RA 1U2GC 2GEBA 2WFMA 4F56A 1G0NA 2FZ4A 4NCBA 3H1EA 2B1QA 3HL0A 4RGYA 4FNOA 1YWGO 1Q0SA 4XWAA 1WW3A 4CKBA 4E5NA 1V96A 4HWKA 5AI0A 2Z9BA 1IJFA 3A6HA 3GW8A 5CAEB 2IXEA 5C7OO 2V6GA 3STVA 3DHNA 3KWFA 4UC0A 5TS3A 3VDNB 4UTVA 3SXUA 5JMTA 4BB5A 4G0VA 5IX8A 4RH3A 4WZAB 5F1KA 4R0MA 4EYEA 3RADC 1JUDA 1YZGA 4DQLA 1C1XA 3ORFA 3FLEA 1T36B 4LY0A 1UT8A 3FFTA 3O93A 3UYKA 2WT8A 4PYOA 5IJ9B 3QXXA 4JT9A 2C5HA 3EZFA 2ARKA 3G5TA 4FFRA 4PNPA 1E8DA 3G13A 2FW9A 2C9BA 4ND6A 3MJTA 4I14A 3VU9B 3ZGYA 4DR4B 4KKVA 4A8TA 2FEMA 2C7VA 3K9FC 2ZCJA 2UUAB 1TT5B 3AF5A 2HDOA 4DSAA 4C29A 2X58A 3EXHA 1FTSA 1TW2A 5LA6A 3U4QB 3K3PA 1GPDG 1VCNA 1JLSA 1ZQ9A 3G85A 3AKDA 1U0FA 3FPFA 3IDSA 3R20A 1NPTO 1N25A 2AQKA 3WKDA 1KFEB 1KMIY 3UJNA 3KLBA 1FTYA 3O95A 4LVNA 1FJXA 1NJ6A 4ALJA 2BMVA 2WJYA 4JGGA 3MK31 1QK5A 2BW0A 3AXSA 1IHXA 2QD2A 1VKHA 3EQ6A 4HDMA 3H5TA 1N0IA 4GX1A 2C04A 1ZO8A 1E98A 4J0QA 4KLAA 1EVYA 4B46A 3C74A 1BO6A 2JIRA 2FUKA 3EEBA 2DWPA 4TKVA 4D26A 5ELXA 1USWA 2ZBPA 1YB5A 3PPYA 3W3AA 3ELWA 1EM6A 3AY0A 3FTDA 5TVGA 1IN4A 3WZMA 1JZSA 3NWJA 1QIIA 3K16A 4MEBA 1OV6A 2IOQA 1MJGM 1KWKA 1G6KA 1CUDA 3PJGA 4QUEA 3QXHA 1S96A 1RBYA 2CJXA 1G3IA 1IM2A 1GEGA 1JU4A 1YOVB 1MLDA 3PKJA 4DE5A 3J81k 3WQRA 4GM4A 4CV1A 821PA 3ODGA 3QLUC 4IJ5A 5DXFA 2O06A 5IDYA 5L51A 3HJTA 3W3AD 2QD3A 5A9SA 5AVOA 2QDKA 3TTYA 1GGHA 4BQNA 3DDWA 3RUFA 1LDNA 1VHQA 2HSJA 3A4VA 3SYLA 4XKJA 4C0SA 2PFKA 1B0UA 4M88A 4P53A 3A05A 3QM1A 4MXDA 4QA9A 3VPAA 1KVSA 1EGHA 1EFVA 1W9MA 4MO2A 3S1SA 5ECWA 1K66A 3M6WA 3NEPX 4JN6B 5BY2A 2DPGA 3IIKA 2LCQA 3P5BA 4DVGA 2QX6A 16PKA 4HJXA 5LUAA 2WJZB 2IX3A 1SKYB 2EW8A 2P5TB 4Y6SA 2QSJA 3UMBA 2O1WA 2P65A 4D6XA 3O8CA 2V4MA 1OXUA 3VO9A 4PC2A 3IH5A 2H0QA 1T6XA 2FKNA 2Q5HA 3IAUA 3UWKA 5JNUA 1ZI9A 1RW4A 4ASUA 3DXXA 2WB4A 2J41A 5A02A 1J9EA 2OO5A 4N6OA 3C15C 2Q3EA 1N8TA 1L5HA 4I81A 4LZZA 1R2QA 3KTAB 5E7IA 2YMQA 3VZSA 4C7JA 5BV8A 2G25A 4D8WA 2V7GA 5B1YA 4KQ9A 4P4LA 2HN9A 2W2VA 1FY2A 2RGNA 4CFSA 1G20E 5JMPA 1QPGA 3JYNA 1CF2O 2V9CA 3VR6A 3HKEA 3QNMA 4NKRA 4PHTA 4ASUD 3LVFO 2YZNA 1VPLA 2GA9A 3BB4A 4FFNA 4CR8A 4QFDA 1ACLA 3BFKA 1AK2A 3AEQA 2B35A 1P7WA 2BFAA 4NZPA 4MVYA 4DARA 1IN1A 4RTSA 1BEEA 5DHFA 3ZBQA 4JENA 1F6WA 2HA0A 3Q12A 1HH4A 1AO0A 3JZAA 3THYB 4HUQA 2Y67A 5EFZA 2O7QA 5DH9A 3IXQA 3K6JA 4IWXA 2AK3A 1GRVA 1V7ZA 4OP1A 2OXRA 4QIHA 4G0OA 5HQ3A 2E3JA 3I5MA 4JJFA 3PPIA 4YJFA 4V0ME 3KVVA 2NO5A 3GARA 2ADMA 1U5BA 3CY6A 1DBQA 4M1TA 3SJCA 1X1RA 1VCIA 2OZVA 5HQTA 2NPFA 2PR2A 4UUNA 4JYCA 2J4DA 3ZQ4A 2V03A 4ZOEA 5HUQA 5GJVC 1VB5A 4QC2A 1ZCAA 2J0EA 4N0DA 4NTZA 2BJVA 2YZMA 3JASA 3M6AA 2H8KA 1NPDA 3HDJA 4IQ8A 1QE0A 3CVUA 1EVQA 4MVJA 3AVQA 2OD2A 3IESA 1RJFA 1P3DA 1C5KA 2H07A 3ND6A 3EW9A 4IL5A 4Q1FA 5COAA 4BGUA 3TLJA 1CDEA 1R6UA 4K28A 3C8HA 3UKJA 2GZRA 3L0PA 1RR6A 2P2GA 3IPAA 2YY7A 4ND8A 4AUEA 2XPCA 3BJRA 2O3UA 1H69A 4CQJA 5F9HA 1YACA 2YJGA 2YZKA 4O25A 2NU6A 4KTTE 1PEKE 4GOKA 2JD2A 4MVJD 1EFRD 2R1TA 3KB1A 4JC8A 4YAOA 5KYXB 2XY4A 1DX9A 4HT3B 3N2GB 1E7MA 3VZQA 4TQAA 5MN5A 3H87A 1SK8A 1ESMA 2WWVD 4YLEA 4QYMA 2PUHA 2Y1WA 3VM6A 1B7GO 1QU2A 1NMXA 1XDGA 4LOKA 5DM2A 5M34A 1BN7A 4AJNA 2XI4A 1VLZA 3RTBA 1WE2A 4AZ0B 5AW6A 5KHOC 1SKUA 1L7VC 4Z1OA 4ND7A 1IM8A 4EY7A 3GLTA 4N01A 1OD6A 3U44B 4YP9A 3H75A 3P4XA 4KWHA 4TMVA 5DX1A 2AXQA 2PANA 3H4VA 2IDMA 2XLCA 2XCQA 3KP1A 3VPSA 3X1DA 1OGJA 2Z58A 4PZ0A 4EATA 1OYWA 2Q27A 3LT2A 2GA8A 2NU9B 3MUOA 4RADA 5AI8A 1R0KA 2FY8A 3UXYA 5AWFC 3VYTB 3TUZC 4LHVA 1VJRA 3CLSD 4MQ6A 3BK7A 4HLUC 1FIUA 1CUFA 4R2KA 3BBPA 4I3FA 4Y9TA 5HJ7A 3DE0X 1P1CA 1TPYA 1Z8HA 4ITRC 1EVJA 1EFPA 4WY2A 5DT9A 2AN4A 3BVPA 2QN8A 3U4HA 4J3NA 1CY0A 5K3DA 1U8EA 5KCZA 1TJNA 5KPDA 1O54A 4OBEA 1R9GA 4KR6A 1CTQA 1M7BA 2A67A 1WAMA 2H2WA 2RK6A 4M8IA 4Q3NA 3ROKA 4HMQA 2FUEA 1TO6A 5BPFA 3U09A 2BGNA 4P3KA 4Z53A 3WADA 3LQFA 1ZUHA 1QDLB 4GT1A 2YVUA 4C1NA 1GSOA 1S2OA 1HOXA 2W43A 4MWBA 3FMFA 4ZCRA 4MPDA 1UFRA 1DJLA 1JB9A 3D8UA 4AP9A 2C4NA 3OF2A 3TCNA 4AJOA 5AIAA 3WZLA 1LNQA 9GPBA 1SMKA 3OM8A 1IAVA 3NBYC 4HDAA 1UINA 3DQZA 4KYIB 1YKGA 4EHKA 4G5OA 3WIOA 4V02A 4B6GA 4EKGA 4EKDA 2Q9UA 5ALUA 4RV5A 3MBIA 4FE4A 5DIFA 4ZRMA 1W0JA 4AG3A 1H1LA 3N70A 4FDAA 1U6IA 3LUGA 1M2OA 4MH0R 4ZVVA 2A5GA 2A5YB 2J48A 4H31A 2W6QA 3T4EA 1BU8A 1OZGA 3ZV4A 1F1BA 1QZUA 2IHVA 4MKGA 5A9RA 1NY6A 1A96A 1QE3A 5DNDA 2CVZA 2J3QA 5C8YB 1W0JD 4PWYA 1C4OA 3S8EA 3E9RA 2W58A 1E5XA 3B1VA 4RJJA 2JCXA 1ND5A 4M37A 2FQYA 1E6KA 3E7PA 2AFIB 4MUIA 2FEPA 1EU1A 2COUA 1QGAA 4I5IA 4U2KA 4A0HA 4MR8B 4ZDWA 3ZI0A 1SURA 3GDHA 3ZQJA 5IZCA 4BO8A 1KTIA 2DKNA 4BS9A 3WNBA 3G5AA 1ECJA 5D5PA 2ZTHA 1C1DA 1U2GA 1Q0RA 2VDPB 3H8WA 5K01A 4XPIA 1YMQA 1ZM2A 3OJXA 4E3WA 1ID1A 1DKPA 1TTPB 1GFIA 3M9XA 3EIUA 1JKFA 2JZCA 5EIBC 2Y99A 3GPLA 1I3KA 5BNFA 1GLGA 1NW6A 1R7RA 2B8WA 3A25A 4M1OA 5JISA 4B87A 4JI0B 2D0IA 2OWDA 4FFLA 2MSNA 1KYIA 1P2VA 2W37A 2VKQA 5K4AA 4JJKA 2MSCB 3A58B 1G8GA 4NNPA 3QRWA 3ZGXA 1TZCA 4RDIA 5AW5A 4ZFNA 1K97A 5C52B 3PQ6A 1MRSA 4LMAA 1L5KA 3UJ3X 4YMGA 4F3TA 2ONJA 3QUBA 1YBMA 1XRSB 4F6RA 5M7EA 2WUFA 1C3JA 2BFDA 3LIIA 2P11A 3F0TA 3O1IC 5G3ZA 3X1XA 4GP9A 2JIZA 2XDAA 3I32A 3PNVA 1QV9A 1I4EB 3O21A 3WWCA 1RQLA 3LNCA 2IDKA 1AOXA 3UK6A 1S4MA 3V4PB 3GYBA 2O7VA 5ER9A 3TEFA 2Q4EA 4JOCA 2QTZA 1UFQA 2QXUA 1U0BB 4QBTA 2PJZA 4L28A 4TS9A 1MR3F 1GLVA 2JIZD 4NJMA 4WNCA 3ZXSA 4ZYUA 3VGJA 4V1CI 4PNHA 1K7FB 3DZCA 1Z22A 1YJQA 3BWXA 3I5AA 1TQ4A 4PAGA 4QO8A 2GN0A 4RKRA 4BX3A 3NONA 1FFHA 3HCBA 3HHPA 3RT7A 3UAOA 5A3JA 2OAEA 5AUOB 5LP6B 4UKDA 1UZAA 2XB2A 4MVJG 2CNKA 1FNDA 4ZA2A 1ZVKA 3SIWA 4CU2A 3C5VA 3STXA 2YJZA 1GPLA 1RYEA 4RPGA 1VE7A 3DZGA 4H59A 4RZQA 2NZVG 1Y7PA 3MD9A 4DIUA 2WWYA 3I28A 2RB4A 1JQ5A 2O2IA 4IIEA 1IXKA 2BDUA 2Z43A 1Y4ZA 2VSOA 3DE5X 3NNDA 3D8SA 2WUVA 3OOWA 4L9AA 4KIGA 4LJYA 5F5LA 4EA8A 2G80A 4OH7A 1XN4A 4L50A 1KDTA 2BDTA 2ZUUA 3DE1X 4QOHA 3Q6IA 2GLXA 3I9MA 1GQSA 4HNHA 4OOFA 3HYSA 1TADA 2QAGB 1V35A 1ABBA 5EJAA 4ER3A 2JCSA 2Q0QA 4XEUA 3JWHA 2RHTA 2C2XA 3C3WA 3IDOA 1NXPA 1MEJA 1AKVA 1UWKA 1VYVA 2GXUA 2IUEA 1RACA 2RGDA 3GFQA 3HCDA 3PWZA 5FWXA 3ZW7A 4S1VA 4F84A 1O6CA 3CNEA 2V54A 4MIKA 1Z33A 1J9ZA 1RYHA 2AHOA 4XQ9A 3WXMA 3ZKWA 5K45A 1K27A 2QL7A 4Q1CA 3SQOA 2D4AA 2DLNA 4OP3A 4D9IA 5JYCA 2Z04A 2IC5A 4BV8A 4ZIRB 3COJA 2XBMA 2C59A 4RH1A 3PC7A 4QXAA 3RBZA 3VOAA 3VTKA 4EF6A 4C4YA 2EGHA 1JDJA 3V2HA 2AMJA 3ILVA 5AM1A 1XMPA 4UXIA 3QPVA 4IGIA 2JDIA 3KJHA 1VP9A 2D2IA 1AGYA 2QPLA 3E3LA 3QU5A 4XQEA 5FUYA 3WYAA 1B4DA 4ZDIA 4B2LA 1OF1A 1P62B 3RV3A 5I4IA 1K98A 5JSZA 3MAJA 2QLBA 3ZPXA 2FWNA 4WESA 1O5OA 2O57A 1V11B 1R4MA 2FPGB 3TBKA 3F98A 1MX3A 2NO7A 1ZU5A 2QRKA 3OAAA 1F2UA 3OTIA 3RKSA 3MA0A 5B58T 2JDID 4H1HA 3TW4A 1J2RA 2RBKA 4K0KB 1T1JA 2ENWA 3HFRA 3O4IA 2G0TA 2Q1YA 4BFYA 1U2DC 4R8SA 3CLUC 4IHJA 5ALTA 1YBHA 1RWQA 2QRUA 3VXKA 1DO8A 3D9QX 4E15A 1CR4A 2XOEA 2DTXA 3OAAD 4WZAE 4ALMA 1JKMA 4IWNA 1LPBB 3ZUPA 1HNNA 4O4HB 2RIRA 5HNKA 3IL2A 1GITA 2H6EA 2IELA 3C3MA 3DL7A 3JYPA 4LZWA 3QXGA 3B70A 5AM5A 1PK7A 5ES3A 4UBNA 2NU8B 2PUVA 1J2YA 2MWMA 5YASA 1ZGJA 2C8VA 3PUYA 1RCTE 1DX6A 1KKUA 2Y1XA 3BCHA 3O9MA 3QLJA 4KXYA 5HIIA 3IUPA 5KWSA 1GNPA 1PJAA 2DE0X 4ZU1X 2CV2A 4RL6A 4WJZA 3HWWA 3I4LA 2AQ8A 3RHTA 2J6CA 3IALA 3KQKA 1PR6A 3I9V6 4J0HA 2Z4RA 3TLGA 3DHVA 2EEZA 5AJHA 5ADHA 3T3OA 3SZ3A 2HMVA 3DUFB 3EN0A 1RZRD 4DNPA 2YWXA 1UPCA 1PLJA 4OA5A 3VZPA 3V4FA 3TPFA 1GVNB 1C9NA 1T8SA 3RIYA 4AQYB 1WDLA 3GEHA 3DFKA 4EW3A 2X22A 1KYZA 4PO9A 5KZMB 4MYRA 4HDNA 4YK7A 1RM3A 2Y76A 5KYWA 1TA4A 3AJEA 2XTNA 4CEHB 4QBIA 2Q99A 1U2QA 5E38A 3V1LA 5KTYA 3UY4A 3GLFA 1GZSA 1DZIA 4Q21A 1LTHR 3FXAA 4Q9NA 3G9UA 3GRRA 1Y8RA 4PLZA 4AJJA 4B3CA 5JXJA 3NVKI 3DGEC 5B57C 4JYMA 1DQNA 1Y8QB 4IX9A 1FJGB 3LZ6A 1N2CE 1SG0A 4WKBA 2WILA 1U7HA 4KQKA 3H11A 4QEZA 2JIPA 3QXJA 2XB4A 3VZBA 1VYTA 1IONA 1GQRA 3QJ5A 2ISQA 3FUTA 4W82A 3PUZA 1ZUNB 4PLPA 1X0VA 1NBMA 1OBCA 2ZUDA 3N53A 3MTBA 2VF4X 3ENZA 4NBSA 2E4UA 3CX4A 1ZJJA 4NYJR 3EEOA 3U7FB 1O5IA 1PNTA 3LGSA 2BMAA 4TWBA 1YQXA 3LKZA 3C7KA 1DQPA 4QVKA 4A36A 5A71A 3E0XA 4ZOQI 1GL9B 3T5GA 3ER6A 1FK8A 2VEDA 5L3SA 1NBMD 4JA2A 4TXMA 4FXPA 2YUTA 3AHFA 1VM6A 2QMZA 2DQZA 4DLUA 3FRHA 3WIEA 3NV7A 3EXG2 4HLUA 3NAMA 1ULUA 3ONVA 5E0OA 1YR6A 1AUOA 1C7JA 3R8XA 1E3LA 2OP0A 4KUHA 4AJEA 4EHBA 1TJ4A 2AW3A 5T41A 4CQMB 4P22A 2PVPA 3CZAA 2ZKLA 5IABA 1CZHA 3RNLA 4OX9B 4GSKA 2QZ9A 1KETA 4TMYA 5JXWA 1SUSA 3ENNA 1DHTA 2ZPTX 3MMZA 4MCJA 4YRDA 5E1OA 5KNBH 1GZDA 1CG6A 1W7AA 4K9DA 3T7RA 5ALGA 4ZZIA 2DFPA 1IN7A 3AWIA 3R77A 3G2LA 3RUAA 1IWOA 2WYHA 4CHTA 3KZCA 3KTOA 1A7JA 5DHUA 4F71A 1U98A 3CF0A 1LI7A 2NXJA 2POCA 3RVRA 1O0BA 3NPAA 3PGA1 1H0SA 2R2AA 4PCAA 3FVTA 3T5TA 1DZ3A 4MS4A 5IJWA 4E11A 1LA2A 2MSLA 3TLMA 1LBHA 4II2A 1N9KA 4HYTA 4A6PA 1TM3E 1Z0UA 2YIVX 2ZEJA 4B17A 3DG9A 3QFHA 3G0DA 1JFVA 1KU6A 1E3JA 1F0NA 3CFYA 3A1DA 4MUEA 4F5EA 1Z5OA 4HC4A 1Z0FA 4G6ZA 4NYJQ 1Z6GA 1T3GA 2W6ID 3GT3A 4EMBA 3QKSA 4ZI7A 4LZPA 1TM2A 2C4KA 3NWPA 3SHQA 1R1DA 2P3SA 3WLJA 5HCNA 1CU1A 2JG3A 1XZHA 4IICA 3DZIA 4N0QA 4JZYA 3PR3A 3CNHA 3SG0A 3RAGA 4KGZA 3RVPA 3W5VA 4X66B 1KERA 3C85A 4NYIQ 3GEPA 4I4TF 3AINA 4EHLA 5JEDA 1PV4A 1C8VB 1XYGA 3QLEA 3ZWPA 1CIPA 3B7GA 1JAHA 4R8LA 3USCS 1OZFA 3OU2A 4OB8A 3AHEA 1O95C 1TF5A 1FW8A 3V9PA 5LZ9A 4B9AA 1E79A 4QDJA 3Q85A 2HUPA 2QKYA 4JY7A 4Y0NA 4CLXA 2G36A 3U17A 2LV8A 3FH0A 3S28A 1A8UA 4ZDKA 4BNNA 3VSDA 5EWLB 1JG6A 4L2IA 3ETEA 3BPSA 1IU9A 1KMCA 4JX9A 4Q4JB 5KQMA 3JVEA 1MXFA 1RAGA 3MERA 3R23A 4CTOA 3THXA 3ONDA 2IFTA 3F46A 2ST1A 4MKXA 2CHFA 3KJFA 2CDNA 1TTQB 1RLOA 4P35A 2AFHB 1ZK1A 4Q39A 4QU8A 4S3MA 3UGKA 3KQYA 2QYOA 1E0AA 3KKZA 2RHRA 3COSA 2IYPA 3FR7A 4Y2VA 2NO1A 3C3EA 4B6PA 3TDNA 3DMPA 3TZLA 1LPSA 3A6GA 2JGFA 1MD9A 5DW3A 3WJ2A 4YIHA 5AM3A 2OSVA 3ZGLA 4QBFA 5EP4A 3O38A 2GN1A 1U0HC 3L2OB 3FTFA 3BCUA 4DV5B 5C7IO 2HCRA 1EQUA 1B16A 4DPLA 2J9FA 3O8DA 3FFBA 3H97A 5A6SA 1B74A 2PSFA 3IEXA 3VX3A 2OESA 3IUSA 1FDIA 4DR3B 4U7DA 5A5EA 1EFAA 1EUQA 4KMRA 1G66A 2BKUA 1NQOA 2N1MA 3G0OA 3OSZA 4XRRA 1S7CA 5CT8A 5JVDB 4DV4B 4U6NA 1GY8A 3LSYA 1LH0A 4DC1A 3ZK9A 4X1YB 3NVMB 4Q12A 3ZR4B 5L45A 3RIEA 2HCTA 3L4JA 1J2JA 4F38A 1PS0A 3T9FA 1KMHA 4GSYA 3DSRA 3NPMA 3PU6A 3FM9A 2AZMA 3QX9A 3T5BA 1HE4A 5IM4F 3EASA 5JY1A 2UXBB 1YXMA 4ALKA 2ZWOA 4BVGA 1RYZA 4F86A 4IJVA 4L72A 2BFCA 3Q40A 5EP2A 4FJ1A 3RKUA 5K3CA 2WPDA 5LMNB 1UDBA 1G8FA 3L7CA 2WWGA 3BIJA 3FTCA 2UUBB 3ECCA 1FMTA 4S2EA 1QR6A 1SG6A 4CFYA 1MZPA 1ULSA 1M2JA 1NF9A 2JI8A 3KQNA 2G70A 2VF7A 1Z34A 3WGTA 4BKRA 4D9NA 4EYOA 3FDJA 4CDNA 1C9KA 3DMDA 1M0WA 1U2TA 3U7IA 3IUQA 2O50A 4Z9AA 2OPHA 4Y6RA 1KFKB 5BYJA 4HNRA 4M9QA 1M8JA 1JHAA 4RH0A 4RVNA 3A1SA 1W46A 4U3JA 1JFRA 2CLHB 4JJGA 3U4GA 3W78A 5GV7A 1MHPA 1CLUA 1KDRA 2CHVA 3L0YA 4JJ6A 4OB7A 5CHYA 3H16A 3UOAB 1C9EA 1Q44A 2QRPA 1OWPA 4A0FA 2G9UA 1XEAA 2Q1WA 4R71A 1KGSA 1QRDA 4DA8A 4C6HA 2PFSA 2PRJA 3BHNA 3AUXA 2GAJA 1FDTA 3OZRA 4HDOB 2X0KA 3NIFB 2C2OA 3U7QB 1G59A 2YIJA 3R5JA 4U9IS 5I8WA 5C8YF 2WJIA 4A2CA 1E2NA 1MABA 2Q6VA 3DD5A 4DIEA 2ZUCA 2BUCA 3L7KA 3HGMA 5BMVB 2DBZA 3KEMA 4EG0A 3MQ2A 5GMOA 5KUTA 4GZ5A 4K87A 3STTA 1QG0A 3KYCA 5K3FA 5L8VA 3FGPA 4HRVA 2Q3CA 2IEBA 2ZJ6A 4HHEA 3BRQA 3E18A 4PGMA 3C3KA 4KACA 5IJZA 2L42A 1RHRA 1QIKA 2BHSA 3QENA 5E6SB 3T5MA 4KO4S 5CNJA 3C6YA 1VL8A 4FCWA