1N2ZA

2.0 angstrom structure of btuf, the vitamin b12 binding protein of e. coli
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
245
structure length
245
Chain Sequence
AAPRVITLSPANTELAFAAGITPVGVSSYSDYPPQAQKIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKVMWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFGINPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITGGPDQIPKIKQYWGEQLKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vitamin B12 transport protein btuF
publication title The structure of Escherichia coli BtuF and binding to its cognate ATP binding cassette transporter
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 83
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 1n2zA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 1n2zA02
2XY4A 2XDQB 4WZBB 5B58T 5BVGB 4G07A 2Q8QA 3ZK9A 4OVKA 5CR9A 5JOQA 1G20A 2X4LA 4TKVA 1L5HB 3U7QA 1N4AA 4UDNA 4FILA 5CX1A 3ZTTA 1G21B 5I4KA 3LI2A 2WHYA 4WESB 3HXPA 4HN9A 4K3VA 3MINB 3BE6A 2Q8PA 5GGYA 3PSHA 5KOJA 3PDIA 4TKUB 3MWGA 5HDQA 5M34A 3AEQA 3ZKAA 2AFIA 1H1LB 5GGXA 1QH1A 1K75A 2OSVA 2O1EA 1QH8B 4LS3A 1MIOB 2PS0A 3BE5A 1KARA 2MINB 1KAEA 1M34A 3AEKB 1FP4A 3TLKA 2OV1A 3CX3A 3AERA 3TNYA 3R5TA 4NNOA 5BVHB 4HMQA 1EFDN 4OXRA 2PS3A 4ND8A 4H0FA 3AESB 3K1AA 4WN9A 1QGUB 4LJSA 4WNAA 5KHLB 3AETB 2YNMD 2PRSA 5M2QA 3HJTA 2QI9F 1N4DA 3ZK7A 4PM4A 4GICA 2XV1A 5M3BA 5JPDA 1M1YA 1N2CA 1KAHA 1K0FA 2YNMC 4INPA 2WI8A 3AEUA 4CL2A 4HMPA 4FI3F 1K2VN 4XPIB 1M1NA 4FNAA 2AFHA 2R7AA 4WZAB 3AEUB 5KOHA 4WZBA 2XDQA 3TEFA 3MWFA 3EIXA 4MLZA 2OV3A 1G20B 4TKVB 3U7QB 5CX1B 4B8YA 1G21A 3K1AB 2M6LA 4WESA 3NU1A 5JJ5A 4G09A 3MINA 1K7SN 1TOAA 4FKMA 5KOJB 2XUZA 3PDIB 4TKUA 1PQ4A 3HH8A 2PHZA 3AEQB 4M7OA 2OGWA 1H1LA 2AFIB 4N01A 4HMOA 1QH1B 4UTOA 1M1NB 1MIOA 1ESZA 3PSAA 4MO9A 2M6KA 2MINA 1XVLA 4INOA 5M29A 2PS9A 3AEKA 1M34B 1FP4B 2ETVA 3AERB 3MD9A 5BVHA 5BVGA 4MX8A 3EIWA 4ND8B 1L5HA 3G9QA 3AESA 4UDOA 5AFSA 1QGUA 4WN9B 5JG7A 2R79A 4WNAB 5FLYA 2XH8A 3AETA 3UJPA 2XQVA 3LHSA 3R5SA 4IRMA 4DBLE 4BBPA 4UTPA 3GI1A 3ZK8A 1N2ZA 4H59A 5HX7A 4OXQA 1M1YB 1N2CB 3MFQA 4NNPA 4PAGA 4MDYA 1PSZA 4XPIA 1QH8A 2AFHB 4WZAA 2RG7A 5KOHB
chains in the Genus database with same CATH superfamily
1GR0A 2A5YB 5ESWA 1ZMBA 1U2DC 4JXZA 2JRCA 1SU7A 1A9XB 1VGQA 2YH2A 5GM1A 2LWIA 2FI1A 3CLRD 4CM6A 3AM4A 3LNCA 3GLQA 1KC1A 2QL6A 4GDMA 3C39A 5HF5A 1HT3A 1VG8A 3A1UA 1X14A 1K9SA 3CLKA 3ABOB 1DKPA 3A9WA 3Q98A 1IN8A 1QCZA 1Y89A 1JKJB 2FFRA 2VRNA 2ID4A 3KJHA 5J63A 5L6MB 4I4TB 1XD2A 1S8OA 1AUOA 2C20A 3Q3VA 3W4JA 2RMKA 2IA5A 4B6OA 3ACCA 1AM4D 2ANBA 2UVPA 2B5OA 3OFND 1L7XA 4EO4A 2G9VA 2A57A 5HRCA 3BILA 1PFQA 1AN9A 3M6UA 3DBRB 1RLIA 2OM6A 3H5VA 4FUQA 2JI6A 4ND2A 3TVDA 4ENRA 3AERA 1RMTA 3R3WA 4HNSA 3E18A 3L7MA 4CODB 4EFKA 4YTEA 4AJEA 4LHEA 4DSTA 4MW9A 3MBKA 1HT1E 3CGWA 3QXSA 4O4JF 4WVFA 4E46A 1SVNA 4IJWA 5FTMA 4JQSA 4GMHA 2H3EA 2BR5A 4EJSC 3W8RA 3DAYA 4OD0A 4K88A 4V2UA 2XHZA 2QJOA 5DJ5A 3Q8WA 1KAOA 4KVFA 4DKJA 3MWJA 4MIOA 2VHWA 2VPTA 4BV2A 2V6MA 3EVEA 1FTWA 4YN3A 1FC0A 4EHLA 5LMUB 4REOA 1WSBA 3DVQX 1PR4A 2EP7A 2QRPA 1UPCA 2J5KA 2OXFA 1HE1C 1RM0A 1UKEA 4HH0A 2WOOA 1CEYA 5EKSA 1PJ8A 1UZUA 4FJ0A 5KVCA 1URPA 3U48A 1QIIA 1AUVA 2WP8J 4H16A 5FOTA 2WJJA 3O4RA 3U5ZB 2VYVA 1NRJB 4OH1A 4BWFB 2AQIA 2JI7A 2R6ZA 1KH2A 3QWAA 1K86A 3EAQA 1O77A 1O6FA 1GAQA 2WNSA 3KU4A 2OCPA 2DZDA 5J4VA 3ZHXA 1F2UA 3M5WA 4LHVA 4MYRA 4NZYA 2IYZA 1WP9A 4S1TA 3KXIA 3ZY2A 2HPHA 5C31A 1LBHA 1U3VA 2GKGA 3X1XA 4QUKA 1TO1E 1ORVA 5A3SA 3RSZA 1P0MA 4JLDA 1W29A 4TWRA 3DV2A 1U02A 2P2DA 2AN3A 3ZE8A 1Z17A 2N75A 5TV2A 3K09C 1N5LA 2VUIB 3HJRA 3NBMA 4XYBA 2NTEA 4HP8A 2JJ1D 4JHXA 2CL0X 4HDMB 3FB1A 3GK3A 4F5EA 4YQEA 4CM9D 4HEJA 3AFOA 4AJIA 4RS4A 5K03A 3EY4A 4LMPA 2RHBA 4C4PA 3B5IA 5IASA 1W36B 2C5GA 1Z29A 4KRGA 4LK3A 1UZAA 2FEPA 3CLRC 3IOYA 2WT4A 4AW9A 3C6MA 4GHWA 1NE2A 3V42A 3VHQA 5I47A 2QBYA 2NVBA 5FUMA 3RVSA 4RPJA 1KI8A 1A7JA 4MUJA 1KEUA 4MMXB 3ZX4A 2R751 2O2JA 2P62A 4F4DA 1A5BB 2Q7OE 3ASUA 3NAGA 5FADA 2Q49A 3ICEA 3C43A 4JEIA 5AI5A 4O08A 2WFMA 5CA0A 3VTFA 3IVCA 2OBLA 3OJXA 5HIIA 5AKJA 4F9TA 4P81A 2I7DA 1G8GA 3IQDB 3SJCA 1W36D 3D0KA 1YV9A 4BVKA 4Q9DA 5DM2A 4ZALA 1FJHA 5LB4A 2BGJA 2ADMA 4RQAA 3HYCA 4K9KA 2UYCA 4I8IA 1V7QA 3ADKA 1EWRA 5AXDA 1UEIA 4AX4A 4LF9B 3GJ8A 2GPYA 3B6ZA 1E8DA 3JRNA 2JZNA 4EW6A 5DIFA 5DVZA 3AKZA 1W34A 4IKPA 3N3AC 3OQIA 4LJAA 5GGYA 3V9PA 2TMGA 1QIHA 5KJ6A 3U1BA 3KPUA 1LPSA 4TKUB 1WOYA 1ZOSA 2I33A 5ILOA 1TFRA 3VUEA 1KKMA 4NP6A 3QEAZ 4TM8A 2YJZA 2XF2A 5EHQA 5KTKA 4II7A 2IV7A 4ENQA 4NZOA 1TUBB 3FFXA 1X7GA 1FPQA 3JZIA 1U31A 4B33A 1IEVA 3E70C 5C5CA 4CEHA 1SUEA 2OSBA 2HLDD 2LE0A 4G5SA 5IH3A 4EFLA 7YASA 4AO7A 3MTIA 1T9GR 3JD2A 3SFTA 2H4HA 2EZUA 4ZOLA 5BYBA 2PNJA 1IVNA 1QCYA 3CUWA 4JVNA 3EC7A 2JIOA 4L27A 1LLDA 1Q11A 1XPUA 2PYZA 5JDCA 5LQNA 3A1NA 2BMFA 3PGMA 3QSGA 1X7ZA 3K0FB 3KLNA 2GCEA 5FIUA 2W6JD 4UHHA 2W2OA 1Z36A 3KZXA 2ZR7A 4EEXA 4DR6B 3OQHA 2R4TA 5LP6F 1PV1A 3L4KA 2VP5A 3IB6A 1EE1A 3TDNA 2ZAGA 3ENQA 3L1VA 4YMUA 3NHSA 4Z4EA 4V0ME 3AFHA 4JJ6A 2HV8A 3SBXA 4BE9A 3QPCA 1N7GA 3HVHA 4OGLA 3W5CA 2FQYA 3UBMA 2QORA 2EW2A 4UNIA 1BNCA 1DAPA 3TI9A 4F92B 3K71B 1NY5A 4X8MA 2NV2B 3WQSB 2RBGA 5F51A 1XRQA 2CW5A 2GLXA 1GU7A 2O8EA 4MQ5A 4UUAA 3JQ8B 1R0XA 4R2IA 4D74A 3JVUA 5HMMA 3LD9A 3OHMA 5LZ7A 5C7YA 3SF0A 2PFSA 3FTCA 3D3JA 3M9XA 3E9RA 3LTEA 4YJHB 3MIIA 1MV5A 3W77A 2WUVA 3RG2A 5TMBA 1JZSA 1Y8AA 3UHPA 2GKOA 3D3WB 4DNOA 2GWRA 1XRSB 4M0EA 1W4AA 2BGLA 1P77A 2IC5A 2GJ8A 4XX0A 4NV1A 3L3BA 4M8KA 1WD7A 2WB4A 3Q72A 4EI7A 1E9EA 1DAOA 1L8OA 1FP4B 2FPRA 4KKVA 4W7HA 4E2FA 2VT2A 1C5KA 5DCUA 2PTGA 4AF6A 1R6DA 1K4KA 1MENA 1S7CA 3Q7SA 4R05A 1KBZA 1W36C 3KE8A 5DI3B 5A5GA 4G8DA 2HHJA 3SSOA 4CEJB 4NPAA 1HOXA 2W8ZA 3L93A 4IXMA 4QPPA 5F1KA 1X7WA 4ZO6A 1ECFA 4A5SA 3KR9A 4EKNB 3OT1B 2YZKA 1L7MA 1I2BA 3WRXC 1CVLA 4IOJA 3FWYA 2B1RA 1RXUA 1UQRA 2OD2A 1CQXA 3D6UA 4MKZA 4W1RA 5DCWA 3WL8A 1Q2XA 2IHVA 2Y2UA 4YMIA 1GL3A 4KGXA 4PXSA 4MQEA 4JVOA 2F55A 2OFWA 6GPBA 3ZWQA 5AW3A 1NNLA 2C0PA 5THXA 2AKAB 1QVWA 2CDCA 1HLGA 3FNQA 1Z26A 3C3CA 3IP9A 3A1VA 3OZAA 5CT6A 1WBBA 4AY6A 1P2UA 5ALTA 2PU5A 1BRMA 3GPDG 2ZBRA 2C9CA 5FWXA 3TCKA 5J2UA 3WLMA 1OZAA 4TRJA 3FSRA 3DF9A 3INYA 3UJAA 1NI3A 4GLOA 1UWKA 2FKNA 4TTPA 2XB2A 3UFXB 2JGMA 3H9CA 1VP9A 2DMRA 5A0VA 4JP2A 2IHUA 4MS1B 3ZVMA 3ETJA 3DQZA 1WB9A 1TM7E 1U0FA 2B2NA 2YXDA 1ZH6A 4MYCA 1F38A 1KI9A 3JD0A 3JRWA 4XI9A 1NC1A 1KFBB 2A0UA 4LE2A 4DDKA 1MC8A 4BNLA 1YQDA 3SOZA 5LVAA 1IDOA 1I4DD 3TINA 1NMZA 5U9CA 1ABEA 2D2XA 1KY2A 3O8QA 3UG7A 4BZXA 5EP4A 3HTXA 5GTDA 2VRCD 1U0HC 4QOSA 1NAHA 2DY0A 2WNHA 4L5JA 4UARA 3GJSA 1D03A 4YCBA 2C95A 1AF4A 3QG5A 3FMFA 4H77A 4ND8A 4YI3A 3WADA 1BMFA 1BS1A 1TRKA 5ICFA 3VVMA 2JGDB 2C5LA 3GB9A 4LCJA 1BWRA 2P9TA 1N2IA 3QKIA 3B6JA 1BVRA 3KQWA 4JDUA 3ERCA 5A4IS 4Q4HA 1J9ZA 3IAFA 1JR3E 2OPHA 4YT4A 5BWMA 2A5LA 4EJ6A 1PAUA 1GNVA 2QG9A 4LPKA 1P1KA 4X84A 3PA8A 1K0FA 2XGOA 2WI8A 1D4FA 2XMQA 3BZBA 1WU7A 2DFDA 1TEZA 5DF1A 3UAWA 1JA0A 3VNBA 3I73A 2YY5A 3NHZA 3V2GA 3CTMA 4GZ5A 1BDBA 4BNHA 4QICA 1T4CB 1PNOA 3H9GA 1EQUA 3WK7A 4QU9A 2ZE7A 1IIRA 4B76A 3A6LA 1KYVA 1ZDMA 8ATCA 1E7QA 4CU2A 3AUAA 1R37A 2YRWA 1L3BA 2QTHA 4MZDA 4AJNA 5LQCA 2F8SA 4R40A 1KIFA 4YUVA 4BLTA 1JSCA 1K06A 1WB5A 4LJ9A 4RXTA 4MVYA 3ZWOA 1N2JA 3BL6A 1ZOIA 1GQYA 3A2NA 3WLEA 3DV0B 3K16A 3O8BA 4PSUA 1M2JA 5K0GA 2VDWB 3WQHA 5EMNA 2OZLB 3CN7A 5C3MA 3CKYA 3RE1A 1MW8X 1E59A 5KCMA 3UK6A 3DVAB 4HLQB 3GD5A 3AI7A 1ZHHA 1DGQA 4LZNA 3D4LA 4C1NA 1LPOA 3HWX1 3EPLA 4FWTA 3FYSA 3TJZA 1MQSA 2HDNB 5EWJB 3EIWA 1AV6A 4WY2A 4AZ0B 3OPQA 3T7SA 1KI4A 2BJHA 3UAOA 4PWYA 2QNRA 4KIJA 3QVWA 3X1YA 1Q19A 2M2IA 3CEMA 3FNEA 3L7CA 4EB0A 1HTWA 2HEIA 2RFLA 4YRRA 4ENUA 3KT6A 5H5JA 5FJJA 3N2GB 2AUTA 3WYCA 1T8WA 2WZBA 3ECAA 4W1SA 3GH1A 3SJUA 1PE0A 2AR9A 2RK4A 2YMMA 1UK6A 3N0VA 3P9ZA 1RQPA 2EIHA 4EABA 4YFVA 1PDVA 2NV0A 1Q7BA 2WM8A 1X7XB 2XCIA 2J41A 1FVFA 4KQIA 4Q9IA 1E77A 1V0JA 1Y8ZA 4GC9A 1EWQA 4D9BA 4JJFA 1ZC3A 3IPXA 3O3OB 3RS9A 1Z38A 1FA9A 2NYRA 2P1RA 4FZ5A 1YA8A 2LBPA 4IFEA 3OIVA 4DIBA 1Z06A 2PAAA 3BXXA 4ENPA 4X1IB 5C7LO 1GFZA 3GLGA 1ZG3A 2JI8A 5DLYA 1KI6B 2DHEA 4HK4A 1SC4A 5HM6A 3T12A 3DDHA 4AX8A 4BNUA 2JIZD 5FI0B 1K5PA 5GONF 2BSAA 2IZ6A 1WXWA 4B80A 4X62B 4FFMA 2VRWA 2OBNA 3AW9A 3T4UA 1YDHA 1IJEA 3F6RA 3FGOA 2R3SA 1CR0A 3VFDA 1WEKA 1FDVA 4NBNA 4TS3A 4R2MA 3UUFA 1U9IA 4P7JA 3I92A 1VPTA 4FUTA 1RPZA 2R1UA 5DX1A 4PLFA 3PQ2A 1U8ZA 1C1YA 3H2YA 1NVFA 2J4DA 2JFPA 2ERYA 5EPEA 1NJ8A 2ZDGA 5LQUA 3VJRA 1HE3A 3ND5A 2I1LA 3HMQA 5CB8A 4EF6A 3W6UA 1JQJC 5K09A 5CLIA 4KQKA 3ETNA 3DPIA 3TMYA 4FI3C 4EDFA 1ZIDA 4G67A 3PBKA 2IU4A 4COOA 3HXQA 4Q4AB 1O2DA 5CM8B 5COBA 4MQ4A 3BB4A 3EGOA 5KX5F 3BE8A 4IHJA 4PSCA 3C1OA 4MRMB 3AUKA 2YHIA 1XVIA 3DTVA 3L43A 4H4CA 4HWOA 5DYTA 1XWFA 1DLJA 5DK4A 1TKBA 1ZVVA 3DBIA 2NU9B 1PR3A 2OQRA 1CUBA 2FRXA 4ZDWA 1G6HA 4D46A 1UDRA 2WY2D 3WDSA 1FLAA 5LL6P 3R7BA 4EUFA 1GPYA 4W9MC 4FOOA 2B82A 3QVGB 4QBKA 4B4DA 4UMDA 1E2QA 5SICE 5I7EA 4FNGA 1HLFA 3V34A 4Q34A 1ZM2A 3C8HA 4RZUA 1Z13A 3S55A 1FFYA 4OK3A 2FXIA 3JVVA 4FZVA 1YZTA 1KE2A 1H85A 3VPCA 3MAAC 1AURA 5CX1A 3N0TA 2KHZA 2OYRA 2V6JA 1H8HA 1XKQA 1XUOA 2ZJ4A 3BZUA 3S6JA 4OLAA 2UZ3A 1USGA 2QVYX 3VTZA 4XOIA 4V0NA 3UWPA 4O4HB 2WZQA 5K3SA 4CDMA 4W8OA 4HZUB 3V33A 3GEBA 4DKXA 3EWSA 3LWNA 3H2HA 3P19A 2LCIA 4S05A 1C0LA 3HU1A 1P91A 2Q3HA 1IRXA 3PQ3A 5DBFA 4GLLA 3GP8A 1Z6AA 3HXLA 2C7QA 2GZSA 3HNPA 3TL2A 2CL6X 3IA7A 4IDHA 1U7ZA 3D7MA 2DXIA 1LFDB 2PPVA 4MS3B 2X2FA 3H86A 2Y9PB 5EL0A 4EQZA 3A70A 3EIFA 4KR9A 5B5SA 5TQ0A 3KHKA 1JHPA 1GPUA 1UQUA 2H1WA 1QNFA 3NIDB 4YV2A 5BNIA 3KQYA 3SXJA 3BUSA 5BR7A 1SUDA 5LUBA 1WZ2A 1I9CA 1IYZA 2ZBPA 1FUYB 2ZSKA 4BYGA 1J8VA 3H42B 1OB2A 2WNIA 1JXQA 3VAZA 4H7JA 4YPOA 4XIYA 2WPNA 1JP7A 2HCTA 2QENA 4PAGA 1OBHA 4LXXA 4TN1A 3VX3A 1SU6A 1B15A 2DUWA 2FZVA 1KP3A 2ZPAA 3OC6A 4ZHQF 4ZYLA 1UBTS 3NBFA 2F3TA 4FFWA 5A0FA 4I1VA 1RE1A 1QVZA 1BIFA 2MYNA 2XB9A 1WDLA 4C0LA 4AKIA 4KBYA 4B3TB 3NDIA 3IEIA 3TSYA 2R85A 2P9GA 2QK4A 1OXVA 1Y8CA 4JS0A 5D1NA 3W3AD 3GAFA 2K2WA 4IPTA 5FAXA 2IOYA 2PSEA 3JALA 4JNCA 2P7IA 4DM4A 1GNSA 3CZ4A 2FPIA 1DHTA 3RWBA 4S0XA 4BEWA 2VJBA 4FLMA 1I6LA 4RNDB 1LY1A 3NNNA 4CF7A 3K1JA 4KE8A 1IHXA 5AW1A 3JWGA 2IS4A 5DYNA 5IN4A 1KY5A 2EZ4A 3EMKA 2DEUA 3DFKA 1U8CB 3I9JA 5JY6A 1PGOA 4J49A 1RNLA 4ZRDA 3GUCA 1IUKA 5KQPA 5J4LA 3G8CA 1JIUA 1B76A 4BJ6A 2IHBA 2TMYA 2OHIA 4TYNA 1SQ5A 1ULSA 3I2FA 4I1SA 4DLVA 4BPBA 1FW8A 2FCAA 2XMGA 2DBQA 1Z7EA 2W83A 4M9ZA 4TLCA 2A84A 2QGZA 3BDAA 1RQGA 2X9LA 4KJXA 3C87A 2C54A 3KJEA 1UOQA 3LBFA 4MCJA 4YDSA 3ZWAA 7REQA 1P8JA 1SXIA 2VK8A 4HVAA 3GRFA 3T9DA 1WQ1R 4NBWA 3PYLA 4ZYZA 3DHVA 1ONBA 2DSTA 2QM0A 1EM6A 3PQ4A 4IR7A 1M1NA 4JQOA 2ZRLA 2VATA 1BE6A 4EY7A 4ZCIA 1TAUA 4PIMA 3MWFA 4NEHB 2C9DA 3D1JA 3QW4B 1NL3A 5HG0A 1WHTB 4Y9RA 3WDKA 4AWAA 4WBNF 4EHJA 3COVA 1JYSA 1SKYE 1C9DB 4PRLA 2ZSUA 2DWCA 2WT8A 3IILA 3B12A 2C3MA 3ITEA 3HLYA 3SLKA 3WISA 1FXWA 3ZWWA 1CQIA 1NVGA 2YV2A 3DG9A 3FRHA 4ROTA 5JZ9A 1JV2B 4Q00A 5TLSA 3LDGA 1Y1SA 2Z9CA 3NTVA 2DGDA 4M7OA 2BHSA 2Q3BA 4QXOA 4ZU3A 3FPSA 5HGJA 1OA0A 2X8WA 6AT1A 1A8IA 3R7AA 4E88A 2FG7C 4ID3A 1KZ7B 3TNFA 4V3CA 3JR3A 1L7QA 2IY8A 2Q9UA 3KOUA 1O5TA 4IRXA 4E31A 2B8NA 3PUVA 5BMVA 4MEAA 3KEFA 4ZEVA 1IJKA 4X92A 2YYSA 3GVCA 5DNEA 4JI2B 2AD1A 2MWMA 3WKDA 2J9YB 4ZT7A 4CLXA 4X1OA 1KZ4A 1A5ZA 4JP5A 4V0LA 3C3BA 4BMDA 1ZH4A 2I2CA 3LZCA 1M2VB 1J0BA 3UO8B 4G0VA 1RXSA 2F1OA 4RPHA 3QVXA 5ELXA 1WSWA 3B1YA 1LW6E 3AVYA 4AZSA 1A8UA 2PK3A 1QK5A 3A1SA 2JIRA 3HPRA 1EBFA 5FI5A 4B3IA 1WZEA 4HR7A 4BFVA 2RI0A 3FB4A 3FCSB 2SBTA 5DYGA 4QQFA 5FI3A 1NBAA 4ETMA 1M1ZA 1V43A 3JZFA 3QVTA 4L28A 3V1UA 2CXHA 2HSJA 4X7MA 4JJ8A 4F4UA 1XVUA 4XASA 1H2RS 4TRMA 4JGGA 4Q19A 1OTXA 1Q44A 1F1BA 1WEHA 2PRKA 2O7VA 3TF5A 2YN4A 2YY6A 4G8CA 3U3XA 3DMFA 5BNFA 1JG7A 3K8YA 2C9BA 3H1AA 4CMJA 1JZTA 3KQVA 3W2FA 3WIOA 1NQAO 3SHFA 5D8DA 5B3KA 3B6KA 1UBMS 4LY0A 4Q01A 1ZLYA 2FK7A 2ZWIA 4Q7MB 4GG1A 3AHDA 1D1SA 1CUVA 2P9BA 2Y92A 3LQ2A 3MNFA 3UV6A 1MRNA 1RYFA 3HJBA 3S2YA 1YRHA 3ABRB 1JNXX 3PWSA 2AFHE 4TKMA 1GYPA 1THZA 2ID7A 4JL5A 4NS4A 4R9NA 4WV3A 4PNHA 1BG6A 5T57A 4I2NA 4XWYA 2MR6A 1X87A 2GCOB 1YQGA 4R8VA 1N36B 1VA4A 4GPEA 1E3QA 4RCVA 1IVYA 4C5BA 4F6LA 3TRKA 4B3DA 1GTJ1 2O19A 3RUPA 3OP1A 4U00A 3SGLA 1L5YA 4RTJA 1AKMA 1UEXC 4PNPA 1VPLA 1X8KA 3T3IA 1J8QA 2QEQA 1ISJA 3FBGA 3P9KA 2X9VA 1O5OA 2D00A 3BWDD 2PIDA 2F00A 2IHTA 3LUDA 3FNBA 4HDOB 3ST7A 5L4SA 3HK2A 3GJYA 3SQXA 1EB9A 4PFSA 2ROQA 1JH9A 3K1ZA 3LKZA 3MUOA 5I7WA 1QV7A 2JJMA 3OQBA 1GN9A 2XDYA 2JH3A 7MHTA 4LWOA 4DE5A 3K09A 4MP3A 4QRDA 3ESAA 1BXGB 1EINA 4RE5A 1U0BB 3HDYA 2ZJZA 1EKXA 3A6FA 5IVKA 2XRZA 4HPWA 5EJ2A 2OYCA 4TKVB 4M0LA 1FIUA 1EA5A 2BFMA 4O3FA 2V4MA 1CDDA 5A0TA 3CIOA 2ZWOA 1JW9B 3DE6X 4G09A 4YPFA 3KPYA 4DIUA 1AHPA 1FNBA 3WKCA 1Q83A 4AY2A 2O8NA 1EVJA 2OB1A 2V96A 4JLMA 4BWYA 1WIWA 2HTEA 2QWXA 2ZYVX 1U0LA 3U7QA 1PCXA 3BIOA 3MFYA 4B7XA 3D6JA 2F1HA 2VDQB 1TADA 3L92A 3FW1A 2W43A 3C14C 3GYBA 1G2OA 3QBEA 3V6LA 4K7JA 3D9QX 3K9CA 4Z3KA 2IYPA 5B4UA 3OFNA 3RCBA 4OM7A 4BDSA 2WMNB 3GD7A 1UPAA 1YVDA 4ARZA 2VYND 4Z4HA 1GZHB 3SM9A 3S8YA 2WJ6A 2IZ0A 3BC1A 2OZEA 4P9NA 5ICMA 1ZD2P 1BH2A 1QX4A 3E58A 4XARA 4ZQFA 5KWSA 1QVVA 3KD3A 3N58A 2P9ZA 1Y1TA 1Y3AA 3DCIA 2LGJA 1XJQA 5FQOA 1D3AA 3NMUF 1TZCA 5F23A 1SRRA 1B4DA 4H6WA 4AAYA 3D2AA 1GSIA 4AJ2A 3UV3A 1MOQA 1YIDA 1RDFA 4Q93A 2IZZA 1KWGA 3I2GA 3TL3A 1EYZA 1GGKA 1H65A 2ZROA 3TW8A 4LHXA 4ZWNA 1YUNA 1QZTA 4XGNA 4DA6A 5ITVA 3MW8A 3R0JA 4TTRA 1MTZA 1W73A 4LGCA 1SHJA 2CLLB 2A9RA 1XTJA 3BHMA 3QU5A 3UQYS 4K9SA 3VH4A 1R6BX 3CH4B 2YW2A 1KYQA 4BWGA 3D8HA 1HX7A 2GN9A 3SX0A 2HWYA 3E7XA 2IWRA 4F93B 1IOVA 1PEYA 1IY8A 2H08A 4NBKA 4TVKA 3TO5A 2B36A 1K5DA 1SOVA 4Z7QB 2D3TA 2YR0A 1L1QA 1U9YA 4I0WB 4R0NA 4L72A 4IJVA 1O6ZA 3NTOA 4XDYA 4UPVA 1AT1A 1OBCA 2OBFA 4DIKA 1X94A 1GZ7A 1UXJA 1YFLA 1Z6XA 1YA4A 4KK4A 4DUYB 3C1TA 4PO8A 4P5EA 4B3MB 3H2SA 1E3IA 4QHSA 3LZDA 4EHNA 4PXYA 1YHYA 4J9VA 3VDQA 4AXXA 4IFIA 3WLKX 4JA2A 2D4HA 1R2QA 1XIVA 2GXQA 2Y0DA 3T0FA 1QF7A 3V8EA 2JJ1A 1E7RA 4PS1A 4S24A 1Z4JA 2P6UA 2CJYA 1NHGA 4JI0B 1EX9A 3DJYA 4CM8B 3SYRA 3QI7A 2VBFA 1B74A 3AIKA 4WDRA 1UBHS 2I0FA 4B6FA 5G0WA 1A9OA 1R9JA 2X9GA 5A9TA 5JSQA 1G5RA 1JT9A 3G6KA 3ESBA 1BA2A 2VOEA 3FN4A 3IR6A 4DQXA 4XAQA 5I45A 1HORA 1QC5B 1Z2EA 5EIBC 1U8UA 4BLUA 4E03A 3CM0A 4EB6A 3W9YA 2QJWA 2FSHA 2RD2A 4NMLA 2Y4NA 4GIBA 3E35A 3K0CA 4MW1A 3K2QA 4AY4A 3FPCA 3LQKA 1VZ2A 3OZEA 2WD9A 2YXNA 3EQ7A 3LKDA 4WXEA 4Y6LA 3WO0A 3PIDA 4UFPA 4Z1OA 2ZE6A 1KKUA 2IKQA 4OMFG 3D3NA 3DQPA 3NASA 4H60A 2AVNA 3ZDEA 1D2RA 3C3XA 3TSWA 2PUHA 3TRJA 1WQ4A 1V6CA 1CFZA 1UF9A 4LJKA 1SUSA 2IOFK 2WF7A 1PQ4A 3HH8A 1P2GA 1M6WA 5LA6A 3BEOA 4D92A 5HKOA 4N5LA 5HJ7A 2Y71A 2JCGA 4YMVA 4JUBA 2CJFA 1RHQA 2VTKA 2Y3IA 3O3CA 3DMTC 4ZPXA 5GONB 5K1ZA 5JSUA 1VMEA 4LYHA 5MFPA 3U60B 2C97A 1C1XA 2M6KA 3PQ6A 3HUUA 4L08A 1FLVA 5GZ1A 3UMMA 2YUIA 3OWXA 3HR4A 5AK0A 3MTAA 1JVSA 5DNUA 3SBOA 2VXYA 4OFBA 4WZZA 3Q0TA 2HLDA 4G81A 2FZLA 2GPNA 4UJ5A 3LW7A 4R8KA 4ENTA 5CFQA 1Q0ZA 2ZIVB 1GAEO 1WMFA 3PE3A 2HSZA 2H0AA 2ZB2A 1R4NA 4PINA 4KGDA 4DV3B 4FYMA 3V1TC 1NA5A 4GR5A 1E0JA 3ORRA 3OD1A 4NK5A 2FG5A 1M1YB 4WKBA 4WVLA 5FL3A 2W6JA 3HWSA 4MDYA 4O0LA 1HSOA 3KSMA 1BKYA 4MR7B 1FL9A 1LF5A 1RHRA 4Q3OA 5B7NA 2YHAA 1ESCA 3TWOA 2WLTA 4JWKA 3K3PA 2QZSA 4K40A 4KO2S 4ZZ2A 4Q3CA 4ZOCA 1XZEA 1C80A 2QAGB 4RBNA 1JEYB 1NXXA 3R2JA 4UU0A 4RJIA 2QOEA 4YJ3A 3OAAD 3QELB 4WESB 4LJ4A 1G16A 4PN7A 3HRHA 1ZUHA 1ZC4A 1EXWA 2GLTA 1T36B 2HJVA 3B5EA 3QFTA 3A2LA 3GUZA 4ANFA 4DXAA 3PSHA 1Y6QA 5J2TB 3NC4A 2PLFA 2W8BA 3G88A 1LPMA 1JF8A 1Y7HA 1NSYA 1ZK4A 2Q99A 3DF7A 3CF4A 4JLNA 4EW2A 1M5TA 1A9PA 2I71A 1PFYA 2JIDA 1EAMA 1QH1A 5DNDA 3WMEA 1A5AB 4RD1A 1JHMA 1WBJB 3C6QA 4R2KA 3GDOA 2IXDA 1SQ0A 2Q3EA 3A4NA 5FWAA 4WOPA 1ATIA 5IJ0B 2E6UX 2J4FA 3EBLA 2OLKA 4GBGA 4XM0A 3PC8A 1SXJB 4M88A 5ALNA 4Q7JB 4P3PA 4ZV7A 3ZR4B 3NWJA 2I9PA 2QR5A 1QS0B 2YWHA 4UAGA 1I0IA 2UZ1A 1AB5A 2JVIA 1MQ9A 2ZSDA 1LA2A 2IYQA 4PCUA 1PG2A 1TE2A 3CN9A 2PGJA 1YBMA 3CJTA 3CCCA 3HWWA 4PBTA 3VZQA 4BEBA 3ESYA 4IP0A 1KEWA 1Z4MA 1EFVA 2F17A 2HJWA 1CUSA 2XT6A 1V26A 3MAJA 4M37A 4YJHA 3RH0A 4AIRA 4E4TA 4ZDKA 1E4YA 3QEMA 5FOXA 3D54D 4XSHA 4AVYA 4ZT4A 5ALHA 4AG6A 1XVTA 3VKWA 1SXJD 4LYJA 2ZJBA 3D31A 4G3XA 1DAHA 1U1EA 4I50A 3HY6A 3L1HA 5BW6B 3TD9A 3GJ5A 2X3UA 3MOSA 1MPTA 3N8HA 2WVJA 2G06A 2JFQA 4A0GA 3FPLA 2YJ6A 5HE8A 3GRVA 5ITZA 3RWOA 3OI7A 3TJRA 4F45A 2PUBA 3ZDYB 1V47A 5LQMA 1XKLA 4R54A 3KAQA 1OPXA 4OGWA 4JL8A 1S2NA 1YB6A 5DI3A 4C89A 4QXQA 2VAVA 4EFNA 1K7SN 2G1JA 3Q9SA 4CG1A 4UE3S 4RTQA 2ZTUA 1U2SA 4YAIA 1Q0HA 1K3FA 1YS7A 2EW8A 3T7TA 3H2GA 1PT9A 3V9AA 2A1IA 4D1YA 2VQ3A 3IOEA 4JUDX 1USVA 2WILA 2YN2A 3ROEA 1C7IA 2FR0A 4XD7A 3PICA 5FL7D 2WM3A 1K5GA 1XQ9A 2J5BA 1DE0A 3L82B 2SCUA 4MJ7A 2LCQA 1EE2A 5BR4A 3GX1A 5KTNA 4AQ7A 9ATCA 4IGEA 1F8YA 1XA0A 3K8ZA 1BTOA 3AY7A 4X1YB 5COQA 1BQ4A 1GJRA 1N8KA 2I6SA 1UP6A 3NTQA 4XR4A 4C03A 4MWEA 2XWQA 3HP7A 4P34A 1UM9B 2DRIA 2FQWA 3BF7A 3A2KA 3WB2A 3ZGZA 3ASVA 3LYHA 2VRCA 1JHQA 1A77A 2V6BA 3N07A 1U7OA 4OHRA 4PR3A 4P4SA 3C3KA 4AYXA 1YONA 3FNRA 3FR7A 4BO9A 2AIRA 5JCJD 2W6ID 4CV0A 4JI1B 5AHXA 4TYYA 4IZIA 3BQ9A 4UD6A 2FUG1 3DOOA 1V5EA 4XUGB 4R3NA 5HA5A 1L7DA 3P2EA 4L50A 4TSKA 1LS6A 5JV5A 3OZXA 3BA6A 4BNTA 4BFYA 2V3WA 4BO3A 2CVQA 2CFRA 5K8LA 2BC9A 5IMSA 1KERA 5JCZA 3VI4B 3ISTA 2B5WA 2Q7XA 1W4RA 2W5UA 3CZ5A 3EVGA 3GRRA 4PAWA 2H3HA 2QAGC 2D2FA 1TFUA 2QXUA 3DZJA 5BSFA 4HFRA 4DWJA 4DCPA 3ED1A 4A15A 4MHOA 3VPHA 4UAVA 3K2EA 3KDAA 2JGDA 1AGNA 1D6SA 1MRSA 3RARA 1WABA 2BKUA 1L5KA 4M21A 4BC0A 1QHXA 1L6RA 1GVNB 2XVMA 3UAXA 2P2CA 4EMTA 1T3SA 4GMXA 3R9KA 4EGQA 5BT8A 4BEVA 5IHXA 4MVJP 1H2FA 1RHJA 3GGSA 5KCZA 5CMLA 1W6UA 2I4NA 5D3KA 4I1PA 3RNLA 1RPNA 1YZFA 1E2IA 2I6UA 1DQRA 3VH3A 3WKBA 5JD6A 2LRHA 3BE5A 3D0OA 3O1JC 2WF5A 5FNZA 1B7GO 3ROQA 1VBFA 2VJQA 3K6RA 4IIJF 4DUZB 4ARVA 4BZQA 4ZI7F 3KP1A 4M46A 1SXJC 3CH5A 4OKIA 1T4CA 2BEWA 5TS3A 3SBDA 4DS3A 1PWXA 5BW4A 1Z2DA 4GX1A 1YNSA 2VVTA 1UK7A 4IIYA 1UJMA 5T64A 4UNQA 3LNTA 4YQFA 2NQ8A 2HSWA 3IUPA 5IVPA 4HDKB 3KQKA 1ZK1A 3E22A 5ARBA 4GPIB 3HM9A 1I5RA 1ILWA 1LPAB 2Q9BA 3C48A 3ZZNA 1V4VA 2ST1A 3HJTA 4OA8A 2I9KA 3K20A 2VP4A 2XNSA 2IPAB 3VU9A 5DM60 5GINE 2Z4RA 2Y0PA 5DBIA 1OXMA 2VDWA 2LV8A 3DJFA 3NCTA 4AL4A 3QYAA 4YBRA 5CXXA 3KV1A 2X0FA 2XMPA 3FAKA 1WXGA 3NOXA 4PSAA 3RK4A 2JAPA 3WA6A 1GRCA 1KSHA 1RJFA 1TXGA 2FYTA 2XUHA 3M4ZA 2FZWA 4HDSB 5DPMA 3JYHA 4K2HA 5DX8A 4GU5A 4BMOB 2JATA 1VLMA 3DNPA 3PXDA 4MLZA 1KQNA 2GAAA 1TD1A 3MB8A 1IVSA 1G66A 1GITA 3EOZA 2EKZA 3U39A 3OSUA 2R6AA 5AQ1A 2XVAA 1YQWA 4ND6A 4MQ6A 4I8XA 3DWFA 4QG3A 4D0RA 2WD8A 2D7CA 1UDXA 3ZE9A 2O14A 3C6XA 1LI5A 3DDWA 1LV8A 1RRPA 5DRYA 2QL9A 4JQCA 2BMJA 2DPGA 2IS6A 1C14A 1KZ9A 2PUVA 1BKDR 2JIZA 3KALA 2ISQA 4TV9A 1U65A 2XOXA 3QJGA 4HXFB 4G0UA 2PT5A 3JQBC 3NCHA 5DTRA 4BE7B 3O1LA 2ZRHA 2R6JA 4O4LA 1KPIA 3EAGA 1SH7A 4DLAA 3H2BA 2FN7A 3LF1A 4TLLB 4FDAA 1F2TA 4BNKA 3R09A 2C88A 4GZ6A 2GZHA 3C7CB 4ZHSA 4Z4QA 1AQLA 2W0SA 1KI1A 2WJYA 4OK5A 5JS8A 1P9LA 1MCZA 2F59A 1GA1A 5AM5A 4LJ6A 2H0QA 2VDNB 4IKEA 3E7FA 4DCMA 2ACKA 1P1JA 4M89A 3GLGE 1L4GA 3GGJA 2NXWA 3I09A 3OZBA 1E7MA 2EKLA 4EMSA 4B3GA 1U0RA 2ZU6A 2QRJA 2NUTA 2G72A 2YXLA 3DXZA 4PAMA 1MBZA 3HA5A 1H93A 4KV7A 2IS2A 2FUG6 2IH2A 4KK3A 1WCIB 1YS9A 4MWDA 4YRAA 2GK3A 3JD1A 3V7FA 3HP1A 2NQ2C 3C45A 2OESA 4I1IA 5ERXA 2F3SA 2BFPA 1Q0PA 3LUAA 2HK9A 2YS7A 4RETA 1QDLB 5CLHA 4X93A 4B2IA 1T8SA 3DZFA 3CZPA 1GGNA 1BOOA 5E2BA 2EL9A 2O1SA 5DHAA 4MR8A 4R5MA 4P7GA 1T1IA 5IT5A 4E5PA 2E49A 3CZCA 2A4KA 3E9EA 4OJMX 1Y82A 1GHTA 2C2YA 3BQMB 3D7RA 3GFRA 4BO8A 4PSVA 1L7OA 4HBZA 5G1OA 4RHFA 1TJNA 4YJGB 2R0QC 4Q4AA 2XB6A 3LL7A 4M1SA 3L1UA 3H1FA 2DBRA 2YQ4A 4NENB 2W22A 5MFZA 2YC2C 4EVRA 4BCCA 3L7DA 4P4TA 5IKXA 2RGDA 1N3BA 1WKVA 2N46A 4O6VA 3T7IA 5JAMA 2BEJA 1RYMA 1K75A 1N8NA 4OMCA 3H9EO 4PZYA 1IXRC 1TIPA 2IVFA 2VTBA 4PYRA 1T5DX 1KFEB 5DSXA 3LDAA 1DV1A 4QU5A 4DDHA 4REQB 1RC1A 2VTVA 3CRW1 2X41A 3E4DA 1SZDA 3T7RA 3UJ8A 4FFVA 1NJ1A 2J5RA 1P19A 5C4GB 1WZUA 1M6YA 4GKAA 3IIJA 1Z7BA 2RGNC 3KB6A 5E4YA 4B6QA 2QX8A 1VFNA 5SY9A 2C82A 1NVKA 2YRFA 4HFNA 3EPPA 3NWPA 3L9XA 4N6OA 4ER7A 3KFLA 4QXPA 4M54A 1DWPA 1NXPA 1QIGA 1RWKA 5JD5A 4A0FA 1OWLA 1S2OA 2BGGA 2IOHA 3NJ4A 4XE5A 1OH8A 1WHSA 2R86A 3PC4A 4OL9A 3K6SA 4MUMA 2P11A 4GICA 3RT1A 2B98A 1UC9A 1IM8A 3QIAA 5D3MB 4I9HA 3ZDAA 2R8ZA 4GR4A 4PX2A 1UDAA 4LN1A 2JFWA 2FW0A 3OU6A 4QO7A 1K7YA 4DMUB 1Z63A 2Q1SA 1A9SA 3F5DA 1WXEA 4QUDA 2C4NA 2C5BA 2WWIA 1Z83A 3AH8A 1N5RA 2QL5A 3T35A 3W7BA 2HO5A 1V39A 3KE9A 1E1NA 2BMAA 4RFSB 1N0UA 2QRMA 2HFKA 2FPUA 3QWFA 5CX1B 4XUEA 1UBFA 1LLFA 3RG8A 1YU6A 2JBAB 2JPDA 5EJFA 2QTBA 5KEIA 1MEOA 4G1VA 2ZREA 4DLWA 2RHGB 1JU9A 4AKEA 5HIAA 2RHLA 3LCVB 3OE7D 3WS7A 2CCGA 3C15C 3PA6A 1G8SA 4PF1A 1N1DA 3ZVLA 4D9GA 4DLSA 5JAPA 2YZNA 4DNFA 1KDRA 1TAHA 3IV9A 4O4JA 4I8DA 2E18A 3C6ZA 4ZTUB 2WKRA 4L15A 2IUTA 4KLNA 3ESDA 3S68A 1XN1A 4ZAWA 1MPXA 1ZN9A 2X2PA 3GPCA 2AXQA 4FQ8A 5CHYA 5CT9A 5IJXA 2XB8A 1QHSA 2CKMA 3B3QA 2UVQA 3F73A 1VPDA 4MJ3A 1FS4A 1XTSA 1P0FA 1YRYE 5EOVA 2F8TA 3DL4A 2Z1MA 4M6WA 2NUAB 5K20A 1BCSA 3W8FA 4LWZA 3DBOB 3BF8A 3CUUA 3NTUA 5MGNA 1XF1A 2A30A 5CRIA 1GSOA 3HBLA 4CRWB 4CKBA 2ZUVA 3ETDA 2OV8A 4O02B 2LDBA 1BE1A 1ST2A 3TLAA 2W48A 1J0AA 4YLGA 3REOA 1TPZA 3ZBQA 3P0EA 3FSJX 2I1QA 3AKCA 3BGOS 2OAEA 2RGWA 4NBRA 4BTEA 3N1UA 5CNJA 4A8JB 2W2KA 1W4BA 3H5RA 4P08A 5BQOA 1Q0TA 3LOUA 3TKAA 1PIWA 3U6KA 5K0JA 2VPQA 3G0IA 4LVCA 2V8BA 3BZWA 4Y67A 2P8SA 4J1NA 5DM1A 5K4AA 3SXPA 2BAGA 1XAIA 1XZLA 2VYQA 3KCQA 4OHWA 3OZCA 3JQDA 4I55B 5E6SA 3DHNA 3I42A 1GQFA 1H22A 3NM6B 1PLKA 1YTLA 2GM5A 3FR8A 3PENA 4X8LA 1E6UA 2Z8YM 5I9MA 4AP6A 5L9AA 5LMCA 1XPOA 2OAQ1 2OHJA 4NKRA 4OHPA 3LKBA 1NKSA 2IU6A 5IBPA 3ZWCA 1KZ6A 1PT7A 3HN7A 4ZO8A 3K9QO 3DZGA 1NQ5A 2YVUA 3OKPA 1V8OA 2HZBA 4MLPA 2WWFA 4HGOA 3D6TB 1XYVA 2GZ1A 1RBMA 2CHVA 1C0PA 5DE3A 3WOVA 4EA8A 4Q3AA 3TQQA 3L04A 1GTRA 1FZTA 4HH4A 4X1KA 1T1GA 4HPJB 3RT9A 3LX5A 4KQGA 3RTCA 2OCAA 4ZEOA 1BOFA 2JFYA 2DHQA 4QTUB 3AL3A 1ZK2A 1NVEA 3A4VA 3FIUA 1XTQA 3G8DA 1QZ3A 4UUBA 1Z74A 3F5MA 4BNNA 1LK5A 4DVGA 2PWBA 1JPVA 5C7OO 4RPGA 1TYEB 3L6DA 1ULZA 4M38A 4DLRA 4OBWA 2JLZA 3UH1A 1QQTA 5TVGA 1QF9A 1I01A 2VXOA 1MAAA 3GG2A 3NO4A 3VRHA 2EDAA 3UJNA 3I5MA 4FFOA 4FSDA 2VSQA 3LUGA 4OYYA 4YEDA 3RIXA 3SR3A 3RSQA 4JROA 4Z9FA 1OYOA 1ZIXA 1G7CA 2IGBA 3PPIA 4EY4A 3AVVA 5IKMA 5KVVA 1LBTA 3KR2A 4UU1A 1UOPA 5DSTA 1IN6A 1TI7A 2O23A 4R2HA 2AI3A 3UWMA 3WLHA 2YHBA 1WUJS 3CY6A 2VF5X 1OWNA 3A3OA 4YP1A 3GO4A 4KACA 5AOAA 2BI7A 5AUOB 2GZRA 4BVFA 5TE9A 1FBTA 1N1EA 2RHMA 2EL7A 1HDEA 3L0BA 3PU6A 5L7WA 2QRKA 1J0CA 2E1RA 2GT1A 1QHIA 5JJ5A 1LF0A 1IB6A 3MINA 4UM9B 3V7UA 1W87A 4C2TA 4HUQB 2AL7A 1SU8A 3SNKA 3Q5EA 2QR2A 3MJSA 3IB3A 3BGWA 3I4FA 5JW6A 1UMDA 3PFKA 4K8OA 1P5RA 4UE6A 1FDIA 4F4FA 3SYKA 1NN3A 4FGWA 4ERNA 3G0DA 3WRYC 2G70A 1NDUA 1AUXA 3E05A 4YVFA 5K0LA 3UJDA 5JT1A 2CMHA 4IS2A 1QNLA 5DB4A 4QT0A 4Z49A 4PYKA 5AI8A 5LP6A 4EO9A 4QTZA 1G8HA 2UXDB 2O8CA 2UYHA 1BC5A 1WUIS 1VYUA 4PQEA 3NRCA 4DAEA 1VSVA 2WSMA 1SM4A 1LB1B 1C1DB 1Z08A 3O21A 5MN5A 3IULA 1US8A 4HUJA 1CEQA 2YASA 4DR5B 3JASB 2EFYA 3PXXA 4ZC1A 3V8MA 3WGMA 1ML3A 2CV2A 3UCXA 4QO8A 3ZXXA 2HRQA 4CLRA 1QZXA 1M2GA 3I3SR 3HVIA 2H4XA 1AQYA 1JILA 4JFAA 4K26A 4UVEA 2PAFA 3VZPA 2ZRBA 4D8VA 1JTVA 4EK9A 1GZ3A 1I14A 3IAM1 1Y34E 3M3DA 3GLHB 3E3MA 1V8PA 2ZQYA 3O92A 3QUBA 4QELA 3ZNNA 3X1KA 3EIHA 4A8JC 2VSXA 2GTIA 4Q9NA 5AM2A 4N5NA 2IPNA 1Z0IA 3AM5A 3WGKA 4L8YA 2ZRQA 3C7AA 3GP3A 1Y4ZA 1MO3A 1Y5NA 2V7UA 3U2QA 2QLBA 3NHKA 2Q8PA 1O89A 4HH1A 3AUTA 4Y8VA 3T5MA 1DRKA 1VSBA 1JHRA 2O20A 4N18A 3WK5A 3MG9A 5CFPA 1QOZA 5EHXA 2H57A 3S81A 2OFOA 3KTAB 4DW8A 5H70A 1QO9A 3OKAA 4J8PA 4ZVQA 1BN7A 1E8NA 1QANA 3SX4A 4C29A 3W78A 5FDFA 5B1HA 1OASA 3BKXA 1W1WA 2IYOA 1BVYF 3KLOA 5G3ZA 1Z0UA 5JQGB 3WQBA 3SQMA 1W0KD 3B8EA 2ZRPA 1NVAA 3M89A 5EFZA 4WECA 1K8QA 1O96A 3CJQA 3IDZA 2G63A 3Q3GE 4CETA 3THYA 1KYYA 1OJLA 5CT5A 3B9BA 4IQ0A 5L4LA 3NB0A 3QE4A 4H0FA 3JWPA 4LOAA 5AQEA 4JYMA 2VYNA 1NDQA 3C6YA 4S2UA 1R6UA 3B8HA 5H0IA 2D54A 3ZY4A 3FVTA 2LCFA 5CYFA 3BMCB 4ZYVA 3GMTA 4NABA 4OOEA 3RUCA 2ZSIA 2QJTA 3ZQKA 3HGTA 4V0RA 2CB0A 3T7KA 2BKVA 2WWRA 3CWQA 3VSDA 1W19A 5BQXA 3KHTA 3RSGA 4D99A 1OD6A 2XZOA 1HPLA 1SD2A 2X0IA 4QG7A 4RX1A 1C0KA 2B5VA 1WXHA 1ZCFA 3WB1A 4A8TA 5CCBA 1PYOA 3TAXA 4OP1A 3FF4A 3C3MA 4D9EA 3CRVA 3DMTA 1KYTA 3M3PA 1SBCA 4KW7A 1ZU5A 4Y2QA 4OQQA 3AINA 4PE5B 2WYIA 2C78A 3AP2A 1T6YA 2OCKA 5G1NA 1EHCA 5KYWA 3LK6A 4NH0A 2E6KA 1NG9A 2RCYA 4RGBA 1ZD1A 2HF2A 2VNJA 1U7TA 1GDHA 1KF0A 5H9WA 4BZWA 3ZOKA 3SJAA 3HDGA 1TMGE 4XB1A 2B1GA 4QDXA 3UGJA 3KQHA 3HN2A 3KV3O 4FBLA 2JH8A 4MQFA 1FEZA 2GJ4A 2NZJA 4WH0A 1ONSA 2ZUTA 3TZEA 2NMVA 1HKHA 2C2ZA 2ZJ5A 2G83A 1MT0A 2OGSA 2VAPA 3G1UA 1LPNA 2KW5A 2PRYA 3R6TA 3A1WA 4HLDA 4U2DA 3G2LA 4UTOA 1EUZA 1Q12A 2AEFA 1C4OA 4O8CA 5EA2A 1L5NA 3OCWA 5CB4B 3SVLA 3KZNA 1ISHA 1ELOA 4EL0A 4RANA 2ZJ8A 3L0YA 1WA5A 1Q91A 4FOSA 4WXHA 1LFAA 1DC8A 5JY1A 2ZJ3A 1AMUA 2GYWA 3DD1A 3TIIA 5ADHA 3U7GA 4FS8A 1HTBA 1EUDB 3MMXA 4N3CA 5TPWB 3GG9A 1GPDG 1VHLA 2CUZA 2GEBA 4RKEA 5DGXA 5FPPA 4C7VA 4YUZA 2EZTA 4ARSA 1PL6A 1N9KA 1U99A 3LWBA 3P26A 4FFSA 4LKOA 2F90A 4K6HA 5KYGA 2OKGA 3CRNA 2JLVA 4FFLA 2JGIA 4YB8A 2LP4Y 2OGTA 2AX3A 3JQFC 1ISPA 1IN4A 3L7NA 1VJ1A 2YJ5A 3IAM6 4GPD1 1UFRA 1C30B 4B3BA 3U09A 5J4YA 1ZIOA 1F0PA 4YRCA 5TNXA 3WAKA 2RAFA 4PX3A 1Y7LA 3HSSA 2VA8A 3OCUA 2XXAB 1IFXA 1NT4A 4DRYA 4EO7A 5LWQA 1Z4OA 3UWKA 1I3KA 1RYDA 3UKJA 4A16A 1SZJG 2BKXA 4KWHA 5BOSA 2GYUA 3OJ0A 1I8TA 2XKAA 1OLOA 2FPOA 3A10A 3MBIA 3A8TA 4QWWA 3FM9A 4RUKA 5EKUA 5CDGA 1LC0A 3WLQA 2VBGA 2CXTA 3I6MA 4GD3Q 4RF2A 4Z0PA 3MS7A 3NWBA 4O1IA 1GLNA 1OREA 1T0IA 1R0BA 1OR8A 1P7PA 1I2DA 1QCCA 1V8DA 1NJSA 2I78A 3AHJA 3I4CA 2O1EA 2CF6A 3PFCA 4G5RA 4I19A 4RADA 5BW8A 1ZOOA 4ACBA 2H31A 3WZMA 5FF9A 4DWOA 1VRVA 1PLLA 3AHFA 3OFVA 1BXRA 3VR0A 3AEKB 4E51A 1YBHA 3RUFA 3LO8A 4OTZA 2UUPA 1JEQA 2WTMA 4X95A 4MH0R 4IWYA 1KYZA 2QN9A 1WQ3A 1OI7A 1C3OB 4ZYWA 1TU3A 3VR6D 2RIRA 3GUVA 3SZUA 4CV3A 5KNCH 2IKSA 1QUFA 2E1PA 2C4UA 3IUMA 1JQLB 3FCYA 4WLVA 2BE7A 4H7DA 4QJBA 2NP6A 1DUSA 2CCKA 2J8ZA 3TQRA 4C4TA 4CEIB 4JQYA 3O4JA 2COKA 4XEHA 1Z6QA 1EWTA 2V4UA 4FC6A 3LXUX 4TRRA 3U3MA 4R69A 3X1JA 2AXEA 3BCUA 1BDHA 3MYYA 2IHNA 4H1WA 5AIBA 3PZRA 1Z0FA 5DTIA 4S04A 3BIFA 2BFCB 3QVOA 3EK2A 1X8LA 1JA1A 4WI1A 4C3ZA 5GONA 4ZCRA 1LSUA 4LXTA 4MUBA 4BGVA 4GYJA 4KMMA 3KYIB 2I2BA 2QE6A 3THXB 1TYDE 2OXTA 5HQ3B 1B6RA 3QF4A 5DTMA 1II0A 1ZISA 4UM8B 5JFGA 5ED0A 1D2EA 4XVQA 2JI9A 3ZHZA 2QMUA 3MUEA 1BE8A 1CP3A 3MJCA 2QTGA 3HNRA 2FZ5A 2JCBA 1UDCA 3JZMA 3EXG1 5I9SA 2WTXA 1RPAA 3OAAA 5HIJA 4WN3A 3VNUA 4BNWA 4GRIA 2BH2A 3INGA 1ZCZA 1QONA 1ZUWA 4GW3A 3W2TA 3HYRA 3UA4A 2PA0A 4DA0A 3TBHA 4QUIA 3L8HA 3O31A 4KWCA 2HJSA 1FQKA 2PQ2A 2B37A 4ICIA 3I28A 1M2WA 5KX5A 2JFNA 3FGNA 1IN1A 3MTJA 1T91A 1ZY2A 4D80A 5C8DA 4LXQA 2WU4A 3D0RA 3KXPA 3OETA 4LTDA 1E58A 4ZVLA 4L7VA 4BWVA 1GADO 5D87A 4NU8X 3OTQA 2QW0X 5AFSA 2UZIR 3RJTA 2MYTA 1YE5A 4EEKA 3GRYA 2XTZA 3ZU5A 1Z6TA 4ER0A 4MJXA 1YHNA 4NBLA 4EL5A 2XHEA 1EIZA 1BVUA 4Y6OA 3P9SA 4KO3S 4GR9A 5AO9A 3D4OA 4JX9A 5CVEA 3DUWA 3KEGA 3LBIA 2XRMA 2CKDA 3K5IA 4RKFA 4UC0A 3U3ZA 8OHMA 3T7CA 1CF2O 1VDMA 3DGFC 1K66A 2Z2XA 1DDOA 2OBYA 2V7GA 3M7IA 4NYMQ 3LIPA 3ILYA 2QD2A 4KQ1A 1UBKS 1XMIA 1SXJA 4EEZA 3I23A 3PNSA 1FYXA 2Q4BA 3WJ1A 4PLVA 4RXUA 4W8HA 3OA0A 1VBNA 5JWHA 2B61A 4K1XA 2XE4A 4K6GA 4RWEA 3ZLJA 4BZPA 1X7YA 4JLVA 4U7GA 2XKKA 1XQWA 3DLIA 3LSTA 4DV5B 1Z34A 4O2BB 4MQUA 4G5XA 4P92A 1T6ZA 4EF4A 3M2TA 3LFTA 1HFEL 4TUYF 1FX0A 2I7VA 3F1KA 5DLEA 2JGNA 5JSFA 3CE6A 1IXKA 2V9CA 2ZTHA 3PXCX 2W4MA 2NTYC 1YQ9A 3QM1A 1MIOB 4CMIA 1LKZA 1JHXA 1MX1A 1N1MA 3DYVA 4YROA 5FL7A 5LYYA 3H97A 4X61A 4LFCB 3UFBA 3H04A 5E1DA 3QRWA 4C6TB 5JS1A 2XA1A 3CX3A 2J3DA 3E82A 3RFVA 2CLFB 3TQSA 1WAMA 5JJCA 4G56A 3JAWA 5H9VA 2FN8A 3AR5A 1K3TA 5AOCA 4ZHQA 2ADFA 3RGGA 3UMFA 3AFGA 3LWZA 3T34A 1VBMA 3KFVA 3K9FC 2VAMA 1U2RA 2VDUE 1SVOA 3A6HA 2XNKA 3QKSB 1GZVA 2BMDA 2JFXA 1WDWB 2C4VA 5D6NA 1CSEE 5JCJA 3WP1B 2BT4A 4DIOA 4S3MA 1H2YA 1N5KA 4QHYA 4RMIA 4E2ZA 3LA8A 1NU6A 1RRFA 2AJBA 3CGGA 1XQ6A 2ATIA 3OQ1A 1GPKA 1XXHB 3D2CA 4FX2A 4S1WA 4BB6A 4QRIA 3HFGA 4K9QA 1KMIY 2C29D 1D09A 4BXOB 4QDTA 2YXBA 2H2AA 3R5KA 1ZIYA 1KSJA 3BWXA 4IIFA 5HS6A 3BMQB 3GRUA 4ZCTA 2QHXA 3AGPA 3LVFO 3TXXA 5AW7A 2EF0A 3FOAA 2W6NA 5LNK1 1PW7A 2D2EA 2IDKA 3NP9A 4K9LA 1NM5C 2F43B 1JDUA 2FX5A 2VDVE 2WHPB 3QHQA 4IL5A 3LVRE 4G4IA 4G36A 1EIWA 3QX9A 5DEOA 5EKXA 4K3UA 1B8UA 5FTWA 4PX5A 4RVFA 3OTHA 5GJWC 3U80A 1M9NA 3TQFA 3KR1A 4MLCA 3A3YA 1R5OA 4JUCA 5FKJA 5D1HA 2E89A 3WYDA 1YVEI 1SQFA 1YU9A 3R7FA 3DLTA 4JKYA 2WD7A 2B7BA 3N7UA 4C4XA 4DZZA 1X80B 4PCVA 3I05A 1J24A 3NGXA 1ZN7A 1G7SA 4P3XA 4Z9YA 2D0IA 3BWBA 1N6PA 3HI6A 1JHAA 4WDQA 2N3ZA 1L9XA 4MYSA 1RFLA 3CZQA 2CDRA 1W49A 4IZHA 4QDZA 2F9MA 5JR3A 1N32B 2FRDC 4KYUA 4QUBA 5AD1A 4G1UC 2WU0A 2PBFA 4RM3A 1W44A 5FORA 4EG0A 4IGFA 3R0VA 4OM8A 1DG3A 1XF9A 4TSRA 4LCBA 5HILA 1SA0A 2WE8A 5F5NA 4GFDA 4PX9A 4UNSA 4WBNA 3EPJA 4K6OA 3B9PA 1E2HA 4LBZA 4BKRA 4ZI5A 2ON6A 2WC1A 2WDZA 4LNAA 1RRCA 3MTDA 1P5HA 3OLZA 2HQRA 4KQ2A 3WI7A 3FVWA 4CUJA 5AKLA 1KK3A 3UB2A 2JHFA 4B43A 4WCVA 1SZCA 2FP3A 4TQGA 1PT5A 5AJTA 4MV3A 2O2XA 4BFXA 3G49A 2G4LA 3N2KA 2VT3A 2YZ7A 3PIRA 4J0DA 3RC2A 3P0RA 1SXPA 1NI4B 4RWZA 1OT3A 2ONJA 3RTDA 4IH4A 1E0KA 3QOWA 4NOKA 3CLTD 4GQIA 4PW0A 1USUA 3REFA 3KEMA 4DLXA 4ESHA 3F98A 3OOJA 3DC2A 5F1YA 5K2MA 4M0UA 3T5BA 4E0BA 2KS6A 1OAOA 2YICA 1B73A 4OLBA 1PKXA 3DBHB 2H29A 2ZLBA 1TM3E 3QLTA 4HQ0A 1M5UA 5FEUA 1CUWA 4U4AA 1CLUA 4B7ZA 4XQ9A 3DKKA 3IA2A 3P0FA 4IMJB 3QPUA 4MTLA 4R3WA 1D5WA 1I6KA 2YN0A 3DCNA 3OCVA 4WERA 1U2GA 3M6LA 3EULA 1I0ZA 2WICA 4HDSA 2MTBA 3N8GA 2EZ8A 4I5EA 5E7QA 3VGJA 1PGJA 5IAOA 5M04A 1CF9A 2O2GA 2P2NA 2Z1NA 2ZITA 4JNKA 2X7HA 1K92A 2XRFA 1LU9A 3NDJA 4YJ2B 4XVRA 4JBIA 4K6MA 3MD0A 4RY8A 4BS9A 3OPXA 1SB9A 5HZKA 4JKIA 4KXLA 4M1ZA 621PA 3V8VA 3WNBA 1TEXA 2IHYA 4XGRA 4CWAA 2JAQA 1Q1QA 2QTTA 4AF8A 3CPJB 3IEVA 3I01A 3DXYA 3AZPA 5A6SA 2G9QA 4EY8A 2ZUWA 4FR2A 4KUGA 1K68A 4PCAA 5IABA 3MRTA 5KS2A 4WXPA 3BBLA 1AMNA 3K9GA 3W05A 4ZP1A 2FPGB 3GN2A 1M5RA 2EBWA 1XEWX 1RYYA 4OP2A 3USCS 2BHNA 4I9UA 4ND1A 4QM7A 1EDEA 5CX4A 2ZWPA 1MJNA 2B0CA 4GSKA 4TRNA 3K1AB 5LNK6 3IIIA 4GI5A 2XBLA 3QU2A 4N3GA 5J5CA 1XDZA 3N2NA 4DLKA 1DAMA 1V9CA 4HNAA 3WLLA 4IGAA 4O4IF 3L0PA 4NCXA 3RROA 3SIPA 3AVQA 3HVUA 4HQOA 2H6EA 3KOZA 1TIKA 1U7XA 1W88B 2G17A 2ORWA 2B83A 4B4KA 4MXDA 4R7TA 3F4KA 4BUCA 2OB2A 1PR9A 3EPRA 5L3SB 1XZCA 4ZVTA 2OA0A 1KJ9A 2KBFA 3DLAA 3EGWA 4UE2A 3FCUB 3CR3C 3PNPA 3HYTA 3O73A 2ASVA 2C83A 1PZMA 1J70A 3DEZA 4GLJA 4Q6BA 4TT8A 3UOGA 3ZBUA 1HETA 3ZH9B 3ZI0A 1NPYA 4V1CA 3ICWA 3HV2A 1P0IA 5EMKA 5BWOA 2EDCA 2PQ0A 2H2FA 5EIAA 1S3SA 3R7LA 4MYHA 2FR1A 3COPA 4E5UA 2GCPA 5EGSA 1TT5A 4OBXA 3LC2O 2EJUA 3HZRA 1FP6A 1B3RA 3KDSE 4V0KA 3N39C 3F97A 1DX4A 2RBEA 1I3CA 3RRJA 3CLTC 4NENA 4X6YA 3KYCB 1XMPA 3JQ9A 1VKZA 4TYPA 3ZTYA 3V1LA 4BO0A 3OZDA 4NOJA 1FRVA 2IU0A 3GMDA 3EEYA 5CUQA 3VU3A 2PZGA 4REQA 1KQ3A 3RIGA 1H3NA 4BY9E 1DIGA 1XZAA 3R7WB 2CWWA 2JD2A 4TL8A 1LLUA 3SQDA 1KEEA 2JC3A 4GX0A 1BH6A 4RHYA 4ZVVA 3FPAA 5CVUA 1ZGBA 1W93A 2L69A 2NIPA 5GZ6A 3ZZ0A 3LUPA 4FGSA 3HXPA 4G1BA 5I7FA 2QV0A 1T1SA 2D2VA 3B1WA 3EG9B 1BHQ1 2QTZA 3QY9A 2A9FA 2Y77A 5AP9A 5T6MA 3GQVA 5A3JA 3EGVA 4YJDA 3GWZA 3IXQA 1D2GA 2QM3A 1ACLA 4KWEA 3HYLA 4DLBA 4I7EA 2CB9A 4TQUS 4E5YA 5HJEA 3INRA 4IO0A 1OTHA 3SF8A 3BMNB 4MV4A 3WK4A 4F9GA 4FIZA 3USZA 2A7XA 3E2PA 3UW1A 1D9XA 1EM8A 1LXCA 3PCXA 3QBVA 2BTOA 4RE6A 5F3RA 3TUIC 2FX2A 1VCOA 1CNFA 2MINB 3N70A 4FGKA 3AR7A 1T15A 2BY4A 1AKNA 2QD1A 4QUAA 3L8CA 4DMMA 3H4MA 1KMHB 1Z0DA 2Y1WA 3OZIA 4EHKA 2JW5A 1SVUA 3BRQA 2ZYIA 1P1BA 1JJAA 1GRQA 1O97C 2EBHX 3WO1A 3V2UA 1YB2A 2QVXX 1IWPB 3KPVA 1MX9A 3L4SO 3LY8A 5D5HA 4DCGA 2GPBA 2IUFA 3TKLA 1Q6YA 1YMVA 2EERA 5FPYA 1OUMA 1FDWA 1FSSA 3FCAA 4MR9B 2G7ZA 4M22A 3ZK7A 3H0CA 1IXSB 3ADCA 1A27A 3EGIA 1NG1A 3WLSA 3GU3A 2BUBA 5IMBA 3ZJ5A 3J81k 3CU5A 3PJGA 4MOWA 1U8FO 4BQOA 2GEVA 2CWDA 3DD5A 4G26A 2IYNA 2IZ1A 5K8CA 1EVLA 1XNHA 2GFIA 2ZRFA 3RVJA 2IYRA 4CM4A 2QW8A 5TIIA 3VM6A 4UJ3A 1GZ6A 5ESRA 3KIPA 2WUGA 1LJUA 4CF5A 4HLCA 3H83A 4EI8A 4YBZA 1MB9A 3C7DB 4QD3A 2HTFA 2FKAA 2QXTA 3EOAI 4H1HA 2WZDA 3FLMA 1DJOA 2QMQA 1MFPA 4Y2GA 1IE3A 3C3PA 2JA2A 4OQYA 4D6PA 1YZVA 4OQZA 5YASA 4EZBA 4RD0A 2C7GA 3UPUA 1SFRA 1T3HA 4IFBA 3ESZA 1Q20A 3EZ2A 2OLJA 1EUYA 1NJGA 1UANA 4EI9A 4BVBA 3T9CA 4O0MA 4MKHA 3R41A 2IS1A 4CXMA 2PKCA 1ZD8A 3L0ZA 3OCYA 1V9SA 5ICGA 2E4WA 3I37X 4NEQA 4CKCA 5CAEA 3HUEA 2MDTA 4XQ0A 2HK7A 1CEXA 1VOTA 1NVBA 4ALJA 4D4LA 1FRFS 3HCEA 3WLOA 3WLPA 4Q1CA 3OCCA 3T9FA 1CZLA 3EIQA 3QEJA 1BROA 2VP0A 4KE6A 1QH0A 4ESOA 1Y5RA 2FQXA 3ZNOA 1SUCA 1YFKA 2ORIA 1NBIA 5CJ2A 4PYMA 5F77A 1OA1A 2B78A 3A14A 1PVDA 3ZBPA 1YR3A 3M6FA 1K89A 1WKBA 1HZZA 2YZ2A 3MHPA 3SFZA 4H59A 4Y2YA 2JASA 3HB0A 4EARA 2H1FA 5DLQC 1IZ7A 3O1HB 3TW6A 4U2BA 4B0OA 1E6WA 2VWHA 3F0TA 3SZLA 3GV0A 1ILEA 1UH5A 1OLXA 1WF6A 3LE8A 3LY7A 4GUAA 1MA0A 2FCRA 3S8MA 4X9XA 2O5CA 3AEUA 2NUPA 3P94A 4BO5A 1EMDA 4TVBA 2Y1XA 4DYDA 1TD9A 5CEJA 2Z6QA 1OU4A 4FMBB 3CNNA 2IYTA 3Q4GA 1N6IA 1S89A 2QRZA 3QJ5A 4H3HB 3JQQA 5ECGC 1XRPA 4H17A 3VC2A 4CMEA 4EG1A 1DG9A 3T5AA 2LPMA 4GZMA 2DFKB 2XTMA 4F04A 1E6EA 4GVLA 2PNFA 2MMCA 2OAP1 3N0XA 4K9NA 5DHFA 2ZSHA 5FBWB 2ZRCA 5I9BA 2VQFB 2F9FA 2ACEA 4DYVA 1FVHA 2QIOA 4A4DA 5DU2A 1M8GA 4G9BA 1IEWA 3K96A 1UKAA 4PPYA 3EEOA 3RRFA 3WFIA 1LDMA 2XWJI 1IM2A 1K97A 3STHA 2H9YA 3AUYA 3FKQA 1VCMA 4WUVA 4EPVA 1SURA 3SNHA 1EDDA 4B75A 4II2A 1KJ8A 2HWXA 3RUAA 3TZLA 1G1MA 3D6VA 1JTEA 3MWEA 3QU7A 5GV8A 1A3CA 1T9CA 3PGVA 1DEOA 2XNCA 1I0LA 1EGHA 1PGQA 1NIPA 1L2TA 4UDYX 3KPWA 2YY7A 3W6NA 3JQ7A 1GPLA 1T5OA 3MWYW 1M6NA 3W4IA 1I1NA 4EG3A 1IONA 4Y2TA 3AKYA 5K0TA 1ZCBA 4W63A 5C1IA 5ADWA 3RS8A 1VPEA 2ASEA 5C1OA 5CDUA 5IX8A 1W1UA 2C3OA 4V02A 4TVOA 5L45A 1HQDA 1V35A 3I1YA 4DWWA 4N3AA 1ZHFA 3UPDA 3UHOA 5BXQC 3W1WA 2GJSA 4PSDA 5KOHA 3UK7A 2R8RA 1CUYA 5EY5B 3DP7A 3I53A 1FLDA 4XCQA 3EZGA 1GKYA 3HKDA 3TSOA 4H6PA 1N3IA 4D9NA 4BO1A 1XJCA 4I1YA 3PDUA 3RVDA 3EUFA 4B6PA 1HEIA 1B0UA 3WWYA 3RYCA 2JLBA 4EHFA 1F4PA 2ZYSA 3B2NA 3SHWA 1T6NA 5ITSA 4LHYA 1EXNA 1EVKA 4LFAB 5BSWA 2HWWA 3WGTA 4AURA 4EY3A 2BZ0A 4JCCA 2A3NA 2VK1A 5D00A 3V5NA 4BKMA 1I94B 1XTRA 3N8NA 4C2AA 2OGWA 4FNMA 2WUEA 3R9WA 1FFXA 3UYKA 2NSYA 1WULS 4DR3B 2LKDA 2O3SA 3QFRA 1W4ZA 2HB6A 3OJEA 3EZ6A 2QN1A 3TQTA 4TUYB 3LQ4A 4X65B 1C7ZA 1ISSA 2A92A 3QWHA 5JC8A 1A2QA 2FK8A 4X66B 2I7TA 5J4KA 1GCGA 2GAIA 2WUDA 2PIAA 4ZGWA 1V48A 1W0KA 3S40A 2PXHA 4MRRA 3AKEA 5T5QA 1CDOA 4AXBA 3EFBA 2PUAA 1YSCA 4M0DA 1CPYA 5AKYA 1FDUA 3WKEA 1H94A 4B3XA 2DG2A 3FVQA 1ZJYA 2O0HA 1K8ZB 1YB1A 4PZUA 5FTLA 2PMWB 4D8WA 1L3CA 1N2ZA 2HDHA 3ONFA 4PO1A 2XECA 1UC8A 3IURA 1NW4A 3B9QA 4MICA 4HYTA 3IPCA 4TX1A 5LBTA 3IHLA 2CSXA 3K53A 1NYRA 3DOJA 4X71A 4CHTA 3U19A 1YR7A 4WZAA 1MJGM 2E4UA 2FWJA 2NO4A 3ESQA 2NYVA 1I2MA 5TQVA 3WGHA 3WXBA 3ZLUA 5K0CA 4FB4A 3TG8A 2H7VA 2VT6A 1KU0A 4JC4A 4IJMA 3KVVA 4OREX 1OYWA 3R3JA 4UNRA 3CC8A 3V48A 1JUDA 4RSHA 6YASA 2RC5A 5L6LB 2IPXA 2O2DA 3ZGXA 4R41A 4AUKA 5TMEA 1T25A 2GPWA 3NAMA 3KUXA 2RJ3A 3O2QB 4TWIA 3VH2A 4TS1A 4FEEA 2QY6A 3EEBA 3IKJA 4TMYA 3EZFA 5CH3A 3PFWO 3TBKA 1HUQA 3OC0A 4LS3A 4JGBA 5CVJA 3W3AA 1GGMA 1MC1A 1MQ8B 3M49A 4FFRA 1E4EB 4RZQA 1Z39A 4IDPA 5ALRA 5TF0A 2J9FA 4FE3A 5GP1A 3EFOB 3OJFA 3FUVA 3N87A 4MYDA 4C6HA 1MB2A 2B4YA 1FRQA 3GPBA 1I3OA 4L5CA 4NX2A 4AZWA 2WHQA 1C7JA 1DIOB 1O54A 2YYAA 3FY4A 2R60A 2YDXA 4QOJA 2N1BA 4NHEA 3ZZUA 5LMNB 4BNIA 1YOVA 1YRLA 2FWBA 2ZBGA 3KEQA 3L84A 3BJIC 3M6VA 3EXHB 3O4FA 1K6EA 4JVLA 3U4QB 1DO8A 1GSAA 1WLSA 2JARA 2XAUA 4KN6A 4WN9A 3HYNA 5F7OA 4QOEA 5BN4A 3T0GA 1HWYA 1WUKS 2J5XA 5DSZA 3K94A 1SIOA 1XN4A 2C9MA 2Q6TA 1N4DA 3D8SA 3M9LA 3OVMA 4KWIA 4YLEA 4RK7A 3WWDA 3ZW9A 4RTMA 4TZTA 1KJWA 3EWIA 4HO1X 2Y99A 4JIGA 3WBFA 5BR8B 3R74A 3AGQA 1MTOA 3KLPX 5CIWA 1Y3FE 2P77A 3NUQA 4IVQA 4CFYA 3KB1A 2XMBA 3PRHA 3ZU6A 2PPLA 3OPYA 4X20B 3HB9A 4WY8A 1MJ5A 3BCRA 3IO3A 3HO6A 3LA6A 4DCOA 5JVDF 2WW8A 1HGXA 2A6PA 1YDMA 3BCSA 1UIRA 1Q7EA 2BI4A 2WIJA 3H18A 4FXPA 5EN4A 5FYQA 1UBSB 1OLSB 1P60A 2F3PA 1GQSA 1E1CA 1P7YA 2I29A 1O6CA 1GTG1 1QYWA 3C3EA 4FHCA 2D62A 4HGNA 4IIJA 4K87A 4KN8A 4Y7CA 5TARA 3REQB 4ZI7A 3N2YA 3T5CA 1GYRA 4J2OA 1ND5A 3BMXA 4C0HA 1JBQA 1GQQA 1ISGA 1GPWB 5JE8A 3G0CA 1YMUA 3L01A 2HMWA 2CLKB 2JRLA 2X9QA 1QP4A 1IPEA 4MKGA 5GMOA 3ZV7A 4Z86A 5M29A 3PB3A 1YS4A 3ZDCA 4BMZA 1C29B 1OOEA 4DCTA 3U0VA 2BF4A 3ACBA 3KQOA 2E4YA 1DO2A 2FVYA 4Z6KA 1AA6A 4G0WA 1OX4B 3RFCA 1RCUA 4RORA 4BJHB 1Q0QA 5EUBA 5HQTA 2B8EA 2GK6A 1G7RA 1P5JA 5AJXA 1XHFA 2X40A 4YJFB 1G8PA 3IBFA 4V3BA 1O0SA 5M7EA 4P82A 5F7XA 3DTYA 3KQQA 4HDNA 4MITA 1U1IA 5ANRB 4L7QA 4A0HA 1K9VF 3U7EB 4EECA 1OE0A 1YJCA 5LWHA 2PVPA 4PG5A 2ET6A 4QJ4A 2PZKA 2WM2A 4GX5A 3HR7A 1MH1A 3K8QA 5ALFA 3TM5A 5BSEA 4QU0A 3MAGA 2H7CA 2X3FA 4RK4A 1EZ1A 3M6MD 2BKLA 2C00A 3LPNA 1L5LA 1VJDA 3SKVA 3IBSA 5EKTA 4FFBB 4MWSA 4RTKA 3VZBA 3VKVA 4I4LA 3MWDA 4D56A 1RQ7A 5JZOA 2XDWA 2OP0A 2Y1EA 4N12A 5BPHA 1SUIA 3PR1A 4L3VA 2PUFA 2WZCA 3UAYA 5J3JA 4DV4B 3KETA 2XCSB 5KNDD 1REQB 3PGKA 2YJ3A 5FT9A 3RYHB 3EE6A 3WE7A 4X0EA 4CN9A 1GZ5A 4C0BA 1XHLA 2V5VA 4Z3OA 4OYRA 1AE1A 2BFDA 1B00A 4M8IA 3S0JA 4DG8A 1NUTA 1ZGAA 4JEMA 5EYPB 2VC2B 4AULA 2PE5A 1GN8A 4UAJA 2PJZA 4IDGA 5J5AA 4RK5A 4IX9A 4YAKA 5CDTA 4NR0A 1V3UA 4GYYA 3RFTA 1Z5GA 1TTQB 3F3SA 1SBYA 2O0LA 1YDGA 2VP9A 2GPTA 3IHWA 5EIWA 5CDSA 4TZ6A 5JYBA 1GRRA 4RXMA 4EVQA 4AFNA 4RJ2A 1AGPA 3NKLA 4AY5A 2P41A 5HQ3A 2H59A 2PX3A 3PDWA 1P4GA 1YR9A 2QUKA 3PWKA 3UAZA 2VPPA 3EXHC 4QTYA 2XZLA 4R9SA 1EFKA 1YL7A 3COZA 4IO1A 4J1TA 2OV6A 3UGQA 3WAGA 2Y68A 3C3WA 1JFRA 5AHWA 1LTHR 1OFUA 1N57A 1G8MA 1UXHA 2BIFA 4NESA 1M6HA 2QVLA 2YWDA 3RU9A 3THOA 5JALA 5L3VA 3ISVA 2RGBA 1Q0SA 3VZCA 3KWJA 3K4PA 4F46A 3GLVA 5D6OA 1COZA 1TGYA 2QN2A 1Y8QA 1LS1A 3RVLA 1CQJB 4HVTA 3QYJA 1OQAA 1U6JA 5K8IA 1VHWA 3GOQA 2CUTA 2BPOA 2WQZA 2G5PA 3C4JA 5EWLB 2HRZA 3EYWA 5TMDA 3NNSA 4JGIA 2O3RA 2EEPA 5CPFA 3C24A 1KXJA 2UZ4A 1G20B 3Q9NA 4G1EB 4L8GA 1DEAA 5AM1A 2P6OA 4MB6A 4L85A 4L1KA 121PA 5REQB 3AIOA 4YACA 1L5MA 3N8DA 1NMEA 4JI6B 3AVTA 9GPBA 1UZMA 3VU0A 1U3GA 1NX6A 1NZJA 1C7RA 2IRWA 4KSCA 2IXGA 4LV8B 4KAFA 4UFOA 4RELA 1FNMA 3KK0A 1XTVA 1IEXA 4KMOA 1JAZA 3T5PA 2A1UA 1DJMA 5LLTA 1JL3A 1VLHA 1QK4A 5AVXA 5SV2A 1NDHA 2AOUA 4BFCA 5E3IA 3MJEA 4BFUA 4EKIA 3KSZO 5IYZB 1IOWA 2AOTB 2G9RA 3AVXA 4JZKA 3PFBA 2QRHA 3ILHA 4LJ7A 1E61A 1SXJE 3HDVA 4HS4A 3ZDRA 3OQJA 2AEMA 3TD2A 1NFQA 5IVHA 2I2DA 1NMSA 3NJRA 4D9MA 1M66A 3D7SA 4V24A 1ND6A 4ER3A 3R3YA 3V55A 2AUMA 4I3HA 3CZAA 1P44A 3ZCVA 3ASZA 3AVUA 3P4UA 3RLIA 4DILA 1N2CB 1Q1AA 2IXEA 2R96A 1JQDA 1H6CA 1HT0A 3RHSA 1PT6A 2GK7A 5A4FS 5EPOA 1K3UB 4O2AF 1T4GA 3AC0A 4JJIA 1JG2A 2Q6VA 3AHEA 4G9EA 3W5JA 5AI4A 3GJ0A 3JYLA 4C6TA 1EFTA 4EQ6A 2HGSA 3TQIA 2H51A 1YJXA 3LG2A 3Q3CA 2HA5A 1DLIA 4RA6B 1BGXT 4IIDA 4WXYB 3NI2A 2HOQA 2XGSA 2PGOA 1MB0A 2H7XA 2ZCVA 3IVRA 4K3VA 4B32A 3K05A 4B5LA 1RD4A 2C2MA 2F6RA 1YULA 2VUHB 4PO9A 5E3JA 5JAZA 4UAUA 4W4TA 5JH7F 3IC5A 3D59A 2QTLA 1IG3A 5FV7A 5SY4A 2FGJA 4DR4B 1EFPB 2Q2NA 2R00C 1FVXA 4GZLA 4RA9B 3RGWS 2OKCA 2PT6A 4NK4A 1QIMA 5FQNA 2IYAA 3SQOA 4UMVA 4NLLA 1QRTA 2A0YA 3GARA 1XXHA 2Q5LA 1T4MA 4JQZA 3WNZA 3W3AH 4C0XA 4Q12A 4XD2A 2V7WA 4KFCA 1EK1A 4BAZA 3EQ6A 3HA2A 2YL2A 5CFMA 1NKTA 1QPBA 1X1BA 4Y2PA 4RIHA 4CM5A 5AVUA 2W6PA 3COWA 1XFAA 2QE7A 3NC0C 2ZCJA 4JK3A 1GKLA 3MQ2A 2R97A 1QE5A 4F56A 2A67A 3ENVA 3OURA 1LVUA 3GFPA 2ZRIA 4AJ1A 5JD4A 1OGJA 2J3JA 1XEXA 2ZPTX 1O1YA 1ZBDA 4XDGA 5EQFA 3CJRA 5BORA 4HVLA 4ZXPA 4KZKA 4L02A 4ZANA 3OIDA 5C32A 1B0AA 4YRNA 2A1TR 1QX3A 3GQBA 1TNDA 1VE9A 2IP2A 1X80A 1NRWA 1SCKA 221PA 4WRRA 3WLNA 2C7RA 2YWJA 1Z4PX 3F4LA 4FCTA 1XTTA 2KWIA 2QVZX 4Q1EA 5BSTA 4FYKA 3IR7A 1FXSA 2HJHA 3KVYA 4KTVE 1PK8A 3MF4A 1Z2OX 1Z6YA 2VSOA 1HE4A 4U5QA 3CR8A 1A9RA 3ENZA 1MG0A 2H1SA 1I3MA 2QP4A 5K2OA 3QLVA 5KC9A 4MVJG 3H6GA 4EGJA 1T26A 1CNMA 1VIDA 5FBLB 1P6UA 4NZNA 4C4RA 1M6VB 1Z47A 2WU8A 4J1SA 2X0RA 1D2MA 4BP3A 2C7BA 2ONCA 3PTLA 5JAQA 1M6EX 1IEQA 2BTEA 5K45A 2WPDA 3A6GA 1CR4A 3S2GA 2Q2WA 5JIBA 3DZIA 4FKBA 1VXOA 4ZVKA 2MR5A 1W5EA 2CD7A 1T2VA 2GNAA 2J9ZB 4OF4A 5TC4A 1T8PA 2Z95A 1P33A 3AL2A 5I8WA 5TXGA 3OFSA 2P35A 4LV5B 4Q1VA 5CXSA 1H2WA 1Z0AA 1UBEA 1UCFA 1WDTA 1Y7PA 4QPCA 4ZAXA 1PTJC 3T7EA 1C8KA 3UJ3X 4EUKA 5BRJA 1PWHA 4U6NA 1C4KA 2PG3A 2WAMA 3CNBA 3D4PA 4TVSA 2R25B 4WAUA 1CUJA 4EHHA 3SK0A 5G3YA 1IMJA 2EU8A 1YQQA 3CNQS 4JEHA 2WFLA 5TF4A 4L57A 4DSOA 1XL0A 3R3VA 4MUHA 2C9ZA 2GILA 3UMJA 4W9NC 2DWOA 1FMCA 1CLEA 2W2XA 3SEQA 3FDIA 2GVZC 1J7JA 2O3TA 1V37A 3A0UA 1IXYA 3H0KA 1Y1KE 1ZXXA 3E4CA 2Y76A 4LRTB 2H8KA 3CIFA 2R7NA 5EP1A 3KYBA 1N7IA 3MWKA 4AP9A 2C4TA 2YVAA 3HEMA 1KEPA 3K2IA 4V0OA 3SXUB 2DBVO 3Q15C 1R10A 3FWKA 3KFXA 4RHXA 4GXRA 2RB4A 4MDHA 5KOJB 2GBLA 3KJGA 2ORED 2CVHA 4O63O 3W8NA 3BULA 1NBEA 2WIGA 4QDOA 3HSKA 5K3DA 3B82A 1JU4A 3JSAA 4IF4A 4WT7A 4Q7KA 3LYUA 2BCEA 3FX2A 2IF2A 1K5HA 2AFIA 3DAFA 3PQEA 4C7JA 1QQBA 3KKLA 1YD7A 1DHRA 3IGFA 4QPNA 4K6CA 4NBSA 3R40A 5CCXA 2O3JA 4BEJA 5C1DA 4O3MA 3VDRA 1JPUA 3CKMA 2FSPA 3IUSA 3Q85A 1E5TA 1SB8A 2DYKA 3ORYA 4TXNA 4PGMA 1NRXA 1P0PA 3UOWA 1AG9A 3CMCO 3DZCA 3LHIA 3NBQA 4D97A 4RDXA 2C2BA 3UK0A 1QFSA 3MOGA 2OE2A 1XLTA 4FHFA 4LC9A 3TRIA 4LMBA 3KQLA 2XGGA 3K1AA 5CM2Z 3F6CA 4QJIA 2AJDA 4AYTA 2AYYA 2AC2A