2VF4X

E. coli glucosamine-6-p synthase
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
359
structure length
359
Chain Sequence
GDKGIYRHYMQKEIYEQPNAIKNTLTGRISHGQVDLSELGPNADELLSKVEHIQILACGTSYNSGMVSRYWFESLAGIPCDVEIASEFRYRKSAVRRNSLMITLSQSGETADTLAGLRLSKELGYLGSLAICNVPGSSLVRESDLALMTNAGTEIGVASTKAFTTQLTVLLMLVAKLSRLKGLDASIEHDIVHGLQALPSRIEQMLSQDKRIEALAEDFSDKHHALFLGRGDQYPIALEGALKLKEISYIHAEAYAAGELKHGPLALIDADMPVIVVAPNNELLEKLKSNIEEVRARGGQLYVFADQDAGFVSSDNMHIIEMPHVEEVIAPIFYTVPLQLLAYHVALIKGTDVDQPRNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ordering of C-Terminal Loop and Glutaminase Domains of Glucosamine-6-Phosphate Synthase Promotes Sugar Ring Opening and Formation of the Ammonia Channel.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords GLUCOSAMINE--FRUCTOSE-6-PHOSPHATE AMINOTRANSFERASE
total genus 123
structure length 359
sequence length 359
ec nomenclature ec 2.6.1.16: Glutamine--fructose-6-phosphate transaminase (isomerizing).
pdb deposition date 2007-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01380 SIS SIS domain
X PF13522 GATase_6 Glutamine amidotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 2vf4X01
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 2vf4X02
1JXAA 1HNWB 1U0GA 2DECA 4LFAB 4NXMB 1U0EA 3M5PA 2CB0A 3Q7IA 3TBFA 4B3MB 4X65B 2I2WA 1VIMA 2O2CA 1JEOA 3NBUA 1G98A 4M0DA 4S1WA 3J7AC 1HOXA 2PUWA 4LF9B 3FF1A 4JYAB 4DR6B 1JIQA 2CXOA 1HR0B 1FJGB 1T10A 2E5LB 3T1YB 3HJBA 4B3TB 1U0FA 1X94A 2CVPA 2PUTA 4DR3B 2CXPA 2UU9B 1TK9A 2WU8A 3FJ1A 3HBAA 3JX9A 4JI1B 2UUBB 3CVJA 2UXDB 3KNZA 4DUZB 4JI8B 4B3RB 1X9IA 1N32B 3TRJA 2A3NA 4JV5B 1IRIA 3Q88A 4DV1B 4OX9B 4LFCB 5BY2A 2CXNA 2VQEB 4DV0B 2E5FA 2XBLA 4JI6B 1M3SA 3G68A 4DV4B 3T1HB 3JAMA 2PGIA 2UXCB 1C7RA 5LMNB 1I94B 5LMUB 4DR5B 2CXQA 3FKJA 4DV5B 1GZVA 4LF8B 4AMVA 2F4VB 2CXSA 5IWAB 1HNXB 3J80A 3SHOA 1XNRB 4DV7B 3LJKA 3IFSA 1XMQB 1TZBA 3BCHA 5I01A 3J81A 1X92A 3ETNA 2UXBB 1HM5A 3QKIA 1MOSA 3ODPA 4DR7B 1XTBA 3BJZA 2I22A 3OTOB 1JLHA 4DR4B 4GKJB 1IBKB 2Q8NA 5FLXA 2DF8A 1VI6A 1MOQA 4DV3B 4JI4B 4KHPB 3OOJA 2V4MA 2VQFB 4X62B 1N8TA 1B0ZA 1VIVA 2J6HA 1GZDA 2HHHB 1NUHA 1ZZGA 1MORA 3C3JA 2YVAA 1J5EB 4DR1B 1X9HA 2VF4X 4NXNB 2CXTA 1N36B 4DV2B 1IBMB 2POCA 3EUAA 2ZJ4A 4JI2B 4AQYB 1IBLB 4S12A 2UUCB 4JI3B 3UJHA 3FXAA 4LFBB 5IT9A 4X66B 2O2DA 1XNQB 2CXUA 2PUVA 4LF6B 1VI5A 2VF5X 4LF5B 4GKKB 2XHZA 4JI0B 2AMLA 4LF7B 4LF4B 2ZM6B 4IVNA 5BR8B 4B3SB 4X64B 4DV6B 1J5XA 4U6NA 4JI7B 2CXRA 4K0KB 4DUYB 4YHHB 3I0ZA 4TOIA 1WIWA 5LL6P 1N34B 1TZCA 2ZJ3A 4JI5B 1XMOB 1NRIA 2X3YA 1HNZB 5A2QA 1DQRA 1IATA 4LZJA 1KOJA 1C7QA 1Q50A 3PR3A 2UUAB 1N33B 4YY3B 4EM6A 4DR2B
chains in the Genus database with same CATH superfamily
5I7UA 3ZQ6A 3N0RA 1V43A 2JI7A 4ZHQF 1HMPA 1YS1X 1Z28A 4OXIA 4PVDA 2C8LA 3J7AC 3Q7TA 4WACA 5IDQA 1ZS9A 3CVYA 5BWNA 3ZDDA 1U4OA 2JBAA 3KJZA 4EKIA 4PRZA 3R8FA 1RWNA 1W2GA 1PS9A 1ISGA 2HA7A 3K6KA 3QVSA 4HB0A 4N7RA 2HIMA 2H63A 5IMSA 1ONSA 4K9OA 3GU3A 1TJ5A 2IP2A 2D4AA 1T2FA 2DUUA 5EUCA 5HJ7A 2ASVA 1QO9A 3N8NA 4EFDA 3S8EA 2GK4A 2W6MA 2C99A 1KPIA 3K4HA 3KXLA 4BMYA 2NNLD 2BMEA 2IDKA 2FJPA 3I32A 4U7JA 4J3NA 1JG1A 4OTZA 3ZWXA 2HC9A 2Q5EA 4B80A 4IIJB 1RT9A 1P8AA 2CJFA 1XRNA 2EZ8A 5BRNA 1XTSA 3MW8A 3KJIA 4MYTA 3T95A 2PZKA 2W6QA 3W6PA 4N7JA 1Z35A 4BFVA 1NG9A 1UMDA 1OVGA 5EGSA 3ZWQA 4HX2A 2WD7B 1JIXA 3G0GA 4AICA 2HMSA 4FMDB 3JAMA 3LFHA 1WZIA 4U2FA 4ZCMA 1RYEA 4DSNA 5C37A 4AJEA 2JIZA 1N3BA 3NUQA 1J0EA 4HLDA 1FYFA 1F6WA 4HEQA 1TUBA 1W34A 5IAJA 1JFLA 5CBPB 3AVUA 3WGTA 1PVOA 2QN6A 2WYVA 1T2DA 1CY6A 4GVLA 4E32A 1OZHA 1Y3DE 3A6DA 2A59A 1XCLA 1P3Y1 2QUZA 2YVQA 2HPZA 2QLNA 3NYQA 2W5UA 4M21A 4BASA 1H9AA 1QV7A 3UY4A 2QOEA 3BD6A 4B71A 4RNDB 4TVOA 3THXB 2RIPA 1G41A 2YUIA 4BFCA 2AIRA 4MQ5A 1SO8A 4BEBA 5CAEA 5LP1A 4L95C 1M8JA 1XUOA 2NPOA 2YC2C 3PPXA 3TSWA 3TR5A 4FFSA 4RZIA 5BV8A 2PUEA 2DKFA 2IDJA 3IEUA 3GLIA 1U63A 4CGYA 5P8WA 3ZCUA 2ZS7A 2J0VA 3L7MA 5JU6A 1XTZA 1Y1KE 4PAMA 2LCFA 2Q5LA 3UMCA 2IBMA 3UJ9A 3KLPX 3DYIA 3RUDA 3VOSA 3H1TA 5CA0B 3RBVA 3HC7A 2ZJ0A 1TGYA 3CPEA 4OI0A 2JGEA 3B3FA 2PUVA 5EFZA 5IM5A 5IM4A 1UBUS 2G9ZA 4J0GA 4LY0A 5B7QA 1N25A 1D3AA 1T2CA 5CFRA 4HNHA 1GLNA 2HMWA 3HDJA 5E38A 4LF4B 2QE7D 1J56A 1ZJJA 2A9PA 3MN1A 4OXKA 2IU0A 3EQ8A 4CODB 4G24A 2WSBA 4KMRA 1PSWA 1KFKB 5JATA 2HYIC 4ITUA 2Q0HA 4KBGA 2NU6A 3GFOA 3T1QA 1D0SA 5C8YA 1YI8A 2HWKA 4OPMA 1O94D 3K9NA 3ILHA 2JGMA 1ZD1A 4FSDA 4D4HA 1ZVVA 4PZLA 2G9NA 1Y5LA 5EJAA 4DG5A 2QTTA 4YH1A 1SHUX 3NNNA 4WY8A 4JJIA 3PR2B 2NU8B 1WF3A 1FDIA 2RGBA 2W00A 4X45A 3L3BA 4OO3A 1OYOA 3VR3D 4B4WA 5E6RB 2J3LA 2UZ4A 3DZ8A 1SCUB 3RVMA 1SU7A 1ZOSA 2A3RA 4FMDF 1RPJA 3H99A 4MPTA 2OESA 2HFKA 1WPGA 4ALMA 1C41A 3K94A 2B20A 1WD7A 2BR4A 2QE7A 1J8MF 1S2LA 3LP8A 1U65A 4JYCA 3WIEA 1LW6E 1FFWA 4DR3B 4RY2A 1MPXA 1HNNA 4UZEA 3ZH9B 4E2XA 4DBVO 3ONDA 1M2VA 4UE3S 4C4ZA 5GQSA 3C3CA 3CA8A 2EYUA 3T5AA 1Z7EA 5CT8A 1W73A 3C6MA 3M1YA 3FYUB 2D2VA 4GU5A 3VO8A 4DMLA 4ZJPA 3OA2A 4UHJA 2AOTA 4OIFA 5A3JA 5AI9A 5HRAA 1Z4NA 4J4TA 1Z2PX 5AXBA 4BKOA 3QP9A 4IJVA 4QUBA 4N12A 2JFWA 4U7FA 3ZE8A 3U40A 2ZRDA 4P4GA 2XI4A 5GADl 5AK0A 2OCIA 4CM5A 4D6PA 1IN4A 3V6MA 4KQWA 4PZEA 1BDJA 2XMDA 5IUJC 2YC4C 3WIUA 1QHNA 3LUBA 4FZVA 4GXRA 4WV3A 5IJ0A 1WU8A 5A3RA 3FCOA 1UFVA 3KD2A 4KN8A 3QKRA 1O95C 1YR1A 4MW6A 1QAQA 1AKEA 2OPHA 4G07A 4IX1A 3PTZA 5GM1A 1VBNA 1XWWA 4FLFA 4JJ8A 1HNXB 2YWEA 4B2IA 4G1CA 4YQYA 3ETHA 4GR9A 5T8KC 1CWUA 2ZTUA 3PNSA 4ESOA 2NM0A 2ECPA 2XYPA 3I5UA 1XD2A 2C3UA 2YFKA 4MVJG 2EKBA 3BJRA 3F9IA 1U02A 1YQ9A 4YQEA 3IT2A 3LWNA 1O77A 2FQQA 2YS6A 4NG5A 3UJ6A 3H5NA 3MWDA 1CK4A 2ZIGA 2P4SA 1UQUA 2FW9A 3BHMA 3D6FA 4URFA 1VIVA 3S1AB 1I3CA 4I4TA 3LAWA 3N58A 2HA0A 4OYYA 1F4LA 4Q3OA 3FWYA 4R31A 4AF6A 5BSKA 2OB2A 2O1WA 3DT9A 4LKOA 4RVFA 1S7CA 2OCBA 4DA0A 2JFFA 4RORA 1WB5A 1IBSA 1RLIA 1S8NA 3K16A 2Y1WA 1IBLB 4ABYA 1TEZA 2RGNA 4Q19A 1YRAA 1JJIA 1Q6YA 2HPHA 4I1SA 3WLAA 4POOA 4X24A 5EEGA 3P8ZA 3RD5A 1D07A 2AJ8A 1J8YF 3H6HA 4FSXA 3IUNA 1BFKA 1AN0A 4MVJF 2DH6A 5EN4A 2EFGA 5CHYA 4BBZA 3QXHA 2O7VA 1XZDA 1E1RA 3FDFA 1M54A 2JAWA 3CJRA 2HUPA 5LD2B 1IUPA 3NHUA 5A9RA 4MGZR 1TVEA 3H3FA 3MCTA 4A0GA 1OX4B 5AKEA 2I67A 2V59A 1P4HA 5TQ2A 4IIGA 3FVRA 4OFBA 3ZWPA 4BN5A 1OFHA 4MKGA 5G2OA 2IU6A 2JGIA 2IPNA 3A1VA 4I50B 3K73O 4XCQA 1MGOA 2Z6VA 3DF7A 4P93A 3JQAD 4V0RA 4K3UA 1BMFD 2W6ZA 2WC1A 1A9QA 1WZCA 4M9QA 4RSRA 1GZ6A 1M1XB 1OVMA 1H2FA 2OE2A 3GRUA 3GV0A 4ARCA 2I87A 3G02A 1B26A 3UQYS 1Z36A 3AG6A 1WCIA 2JRLA 2GZMA 4UUBA 1XELA 3REOA 5J2TB 1J8DA 1TM4E 3NEJA 1QVWA 3EUFA 5JFGA 4K6GA 5FJIA 3O4HA 1TM1E 4PE5B 1G98A 3ASYA 1L7DA 3MJVA 1N2GA 3QWAA 1GZHB 4LSGA 2GD6A 4KIJA 4B7UA 2C4KA 5D3MA 4S0ZA 3FCSB 3M4NA 3L7KA 3ZHSA 5A71A 5KQLA 3UAOA 1V5FA 3U19A 4OFXA 3HFSA 2YBEA 2CVPA 3DNFA 2BMFA 4KXLA 1QH8B 3SWWA 1JAZA 3I12A 1Q3KA 2QMYA 4DDVA 4CKEB 2NVBA 4HLUC 1SWWA 4C21A 1Y8RB 1YTLA 1ILWA 1CIJA 2RHCA 3HA5A 4NDAA 4PYQA 3JVEA 1T9ZA 1YAHA 4DXDA 1WPRA 3NOVA 1G8SA 2Q3LA 4KVZA 1RPAA 1D09A 2DGDA 2YHSA 3KJQA 4QREA 5A4FS 4MLDA 5DOVA 4HH3C 3UJ8A 1Z5OA 1C2TA 1XZEA 4JI6B 1VP9A 2BWJA 1PJTA 1NG1A 1VGVA 2I34A 5HFJA 4Q3AA 3G9ZA 3GO4A 1CV2A 2AXQA 3ORFA 3U7EB 1VE9A 3EPPA 1K5DA 3HU1A 4LMBA 4MUEA 2A0WA 4TV8F 4UZSA 5AIBA 5IHXA 1AT1A 1JRLA 4BGUA 5E7QA 1NVVQ 4L76A 2ENWA 3P0RA 4F4DA 3UJAA 1TQ4A 1UWLA 2XMGA 3C3EA 5DM4A 3V2GA 3DM9B 7GPBA 4YMWA 1NP3A 1E3JA 1QQTA 2GVNA 2FXIA 4MI1A 4ENQA 1EFRD 1MW8X 4KFUA 2GPJA 2W2OA 3MB5A 1FDSA 1NVAA 4J43A 4OV6B 4ZQFA 3E58A 1KQFA 5KOYA 4YJFB 2NSLA 1RJFA 2DFTA 3PI7A 1O87A 2F1KA 3NHRA 3RLIA 1M0WA 1OLUB 5EMLA 4BX0A 2WAMA 1UBHS 4JU8A 1DBPA 1DXOA 3D0QA 4KVGA 4L50A 3GXOA 2GO1A 4C7OB 1U1GA 3PI6A 2OM2A 3LPNA 3PDIA 2JIMA 3KKEA 2PWZA 3LM8A 5GMOA 3SBOA 3VH4A 4EPYA 3RS7A 3WB1A 2J5QA 4GPBA 3CMMA 4TZKA 4QKQA 5K3FB 3AYXB 3CF2A 4CCYA 5JS7A 2KS6A 1QXSA 1RCFA 3W6OA 5EAIA 3EMKA 1Y7IA 5FWDA 5G4LA 3F5FA 4CG1A 4Q39A 1LV8A 2IFTA 3P2MA 1KOLA 3ZU2A 4CLDA 1G2QA 1LA2A 2XDQB 1S0UA 1H2WA 1PJ8A 1ZU4A 2Z08A 1NN5A 1NRXA 4MWGA 4YJ3F 3S68A 4ND4A 4KITB 4C7KA 4ECEA 5LR6A 3VHXA 3W7VA 3B38A 1Z5PA 5T6MA 1H2HA 3BH6A 2MIIA 3LCCA 4YMSA 1QR2A 3D3EA 4O8CA 1KDPA 3PZBA 4PYRA 2FSHA 5F52A 2F64A 1EDOA 1N2CA 2I8AA 1U7UA 4EJFA 3S1SA 2VWQA 1ODCA 4GO1A 1XYGA 4JXZA 3NH6A 1BVHA 2PVCA 3ZN2A 3RABA 3CUWA 1BQ4A 1J24A 1X1QA 3G7SA 4D0NA 1EWKA 2R87A 4UMFA 5KKCA 5CDTA 1E3MA 5KDDA 4MLZA 2WZQA 2YOGA 3L7NA 2JHPA 4HDRA 2XUAA 1IHDA 1OAAA 1ZCAA 3I58A 2RG7A 3W3AA 4LQCA 4DCTA 4I19A 3TXXA 2ZITA 5F9HA 3INNA 4QL3A 2GETA 4QGFA 1M2FA 3WMXA 1MO3A 3I30X 3WKCA 4NEHB 4HJXA 1CRPA 4JLAA 1JHVA 3HG7A 3H5LA 5LA6F 1DQZA 4JX9A 1AK9A 1U2GA 3D43A 4TKUB 1DXHA 5EPEA 4F3TA 1XP8A 1KY2A 2H29A 5I7RA 1I2AA 1DDGA 2WF6A 3EPRA 4NZPA 5C7IO 2D7CA 1P33A 4IDEA 4OATA 4PONA 5IJXA 2A6PA 4U8GA 2Z4TA 4J90A 3FF1A 4ZCPA 1XMXA 4U02A 1E1QD 4D9BA 1GFSA 3DC2A 3JYLA 4REQA 3BIXA 3CLUD 2EWWA 3ZXIA 4XYGA 2BZSA 1W5AA 2H57A 3DLCA 1EVQA 1NAIA 2PRKA 4I4NA 4LOJA 1ZBDA 4RCVA 4MIEA 1G2PA 2PQ6A 1SWVA 4Y6LA 1JTVA 3RRZA 5WRFA 2LZ0A 5FT9A 4QG7A 4C0JA 5G4KA 3L6EA 3M34A 3A4YA 3W77A 1V1JA 1Z25A 3IMGA 3ZV4A 2F1JA 4JR0A 1RLJA 2C4TA 1ORVA 1JU3A 3CBGA 4P86A 4UDXX 5K3BA 3QJ5A 4YBZA 5J43A 1VCNA 5DHUA 1MNAA 4N65A 4NZMA 2QTBA 3PL5A 3DV0B 1R10A 4U2GA 4GWKA 5C9ZA 2YMPA 2I2BA 4JLPA 5LZ7A 1MR3F 2AFIB 4D45A 3AU9A 3TQTA 1FYXA 4QTXA 1JYEA 2ID9A 2AKEA 2D5LA 1NM5A 3PQ2A 4U7GA 4Z0PA 1CETA 4DLTA 5JBIA 2YRXA 5EXSA 5GONB 5DLYA 4MWDA 2HV8A 2QN2A 4XPIA 2R0QC 2NZJA 4B3IA 2H1HA 3IQHX 3U0VA 1M73E 1Q0QA 3HLTA 3TKYA 3RVPA 3OPVA 2JAUA 1DJLA 1Z62A 1KVTA 2FEAA 4BBPA 1JLMA 1XZ8A 2QV0A 4ND1A 3ZD8A 1IOVA 5CLHA 1FSPA 3RM3A 2QVXX 4OQLA 4DV3B 1LBSA 1QHIA 5F5XA 3DQPA 1ODKA 1FFXA 2HZ7A 4N01A 1PFKA 5K0NA 1Y80A 2H6EA 3KB8A 3GEGA 3WK6A 3H9CA 4JGIA 2YXLA 2C77A 1HDZA 3NS7A 3WQHA 3NVAA 4HGNA 4CYMA 3I6ZA 3GCXA 3RE1A 2X8JB 2BFBA 3IUYA 4LOIA 4DEYA 2ZJ4A 1LVUA 4E11A 2CYAA 1Z2AA 2GTIA 4UUNA 4KJZA 3W6UA 2QP3A 2BH2A 2RAUA 3B1ZA 4JXKA 2X6QA 3E2IA 1DTWA 2CDBA 2R6JA 3LCMA 1E69A 4LVUA 4YMHA 3ONWA 4BBAA 4KXYA 3VOTA 4RE6A 1TF7A 3IH5A 4R05A 3GT3A 1QZUA 1PQ4A 1O9GA 3DAGA 1R1DA 3FMOB 2PLWA 1WUYA 4HDSB 5FH9A 1FW6A 3DE6X 2X0EA 1J49A 3FTFA 3ZBTA 1C1DB 2C1ZA 2CY0A 4O4IB 3PDJA 4B09A 3EVDA 2IZ1A 3K5HA 2TMKA 1UWKA 2NAPA 3TCXB 3LF2A 3CVXA 2NVUB 4PX5A 1C4XA 2Q3MA 3O9VA 5DLPA 1N57A 1NLZA 4DCCA 1XG5A 4Q03A 2GCOA 2O54A 3K2QA 2PCJA 5JSUA 2WJ4A 1HR0B 5B3LA 4OMDA 2NP7A 2GDJA 1ZN8A 2H2GA 2VHQA 2Q6OA 2ZBPA 3FOBA 4QVKA 5TMEA 3ZXSA 4C20A 3O8OB 1JEOA 1XHLA 3S44A 1P62B 2CCGA 2R62A 4JSTA 4YAOA 2YJ4A 4CMBA 3HR4A 5KYVA 3WGJA 1A7JA 3SBEA 3D3KA 3DYBA 3V48A 5F1PA 1ZOPA 1SXJA 3WMFA 2VA9A 1H1TA 3FMVA 2NUPA 4E12A 2FMTA 1GU1A 1LNSA 1LLFA 2P2SA 2UDPA 3VKVA 2LNDA 2B30A 2V96A 1U9YA 3KTDA 4M0EA 4OH7A 4WLOA 5EUMA 3PUZA 4EGSA 1P4JA 3N2GA 4OFZA 1ZISA 4KB5A 1A5BB 1WXXA 3TE7A 2DWCA 4Z8YA 4Q00A 5DW0A 4JIMA 1V0JA 4R6WA 3TZQA 5HQTA 2PUHA 4WX2B 1Z07A 1QTNA 1RMQA 3RG2A 4IEEA 3LY5A 1UPUA 4Y6GB 3EFBA 2SKEA 3E8XA 4UTOA 3BE5A 3H16A 3C8MA 3OQPA 1PLJA 4CT5A 3V4OA 1RC0A 3ACCA 4FMCB 3H3JA 4QASA 4PIPA 3QE2A 1XK6A 5ER9A 3GGJA 3WLTA 1HV8A 4KPUB 3IKVA 3NHYA 1J09A 3IYLW 1KJNA 1V3QE 2IHBA 1WHTA 3LWZA 3TBKA 1ORWA 3O4JA 4A8PA 3RVKA 2G0AA 3FKJA 3R0IA 4GI1A 2IZ6A 4M1KA 4RS3A 4MS3A 1JJ7A 2QLFA 2WHXA 5HA5A 4BQOA 1R3UA 2CKDA 4B46A 3WB0A 3E9RA 4R84A 1K5HA 3KAKA 1MOSA 2OXEA 1R8XA 5DN6A 4E5MA 5FPHA 3I2HA 4K9QA 1SXPA 3UOAB 1ND6A 5DM0A 2G76A 2TRSB 3G5TA 4II3A 4B76A 5C3MA 821PA 3PJRA 1L3BA 1RYFA 3OEHA 3HU5A 3QWHA 1RM4A 3BXPA 2IYRA 3TB4A 2Q3CA 4BQSA 1IHUA 3PE3A 3MWEB 4MYUA 1N0HA 1NI4B 3M6VA 4IVPA 1WKBA 4JKIA 4UVDA 1P0MA 1U81A 2DWUA 3KKMA 3SR0A 2VH2A 3L6OO 1WUIS 2Z9DA 1R0BA 4OJMX 5KO2A 3JRNA 3REGA 1N8KA 5L7YA 3AQIA 1JDPA 1RTTA 1U8UA 4KXVA 3A3YA 3LBIA 3EGDB 4DIMA 5AHXA 4DSTA 3JQFA 2ACVA 5C3UA 1KL7A 5FNZA 3EDRA 3V33A 5BSEA 1KYQA 2HGSA 3BXOA 3L7DA 4R9UC 2PX8A 1CE8A 2BI7A 1FYVA 4QXOA 1NF9A 1SUCA 3O8QA 3CVUA 4ZVLA 3GNSA 5C1DA 3ANLA 4BDSA 5A0TA 3QVGB 3CRNA 2B8JA 3H2YA 4AZ0A 1W0JA 1MX9A 2NZXA 5TS2A 1WY5A 1K63A 4XYLA 1SVLA 4O4LF 4RACA 1Y5MA 4TT3A 3L8DA 2FW7A 4G86A 4MCJA 2IKQA 4RGYA 5DHAA 2CGEA 421PA 1DC8A 4MW1A 4M89A 4ZV7A 1SB9A 3E9ZA 1VSQA 2WFZA 3QXSA 4Y2PA 4XRGA 2QZJA 1DQRA 2QHXA 1KOJA 4U5XA 4YRTA 3JXEA 1G291 2YXEA 2IH5A 2FPLA 2P1RA 2XZDA 1I7SB 2I71A 4Y1EA 2W37A 4M0KA 1EEXB 1TIKA 2G06A 3AW8A 4DPMA 2AN3A 1O1YA 1Y7PA 3PVSA 5JBNA 4RZXA 5AOBA 4M0DA 2E5WA 1X3SA 1I2CA 2BGTA 1QLWA 3QTLA 4XEHA 5BMOA 2VTBB 3AVYA 4F2HA 1BDIA 3KOWA 4INOA 1YRYE 3RK4A 1DWUA 1U28C 1JDZA 4HNGA 4C0AC 4EW2A 1MX5A 2IX3A 1T5LA 5AVTA 3P20A 3GJQA 3RC3A 3R3VA 2O2GA 4HQKA 2AX4A 1K27A 2FSVC 1UPTA 2PSFA 4PFKA 2NAFA 4CF7A 4H3HB 1DX4A 1X2EA 2H2IA 2J3MA 5G0SA 4NVRA 5T8KA 1EFAA 4DBLC 4EUFA 3WB9A 1DC6A 2SCUB 4BE7B 3Q41A 1TYBE 2B83A 4AVYA 4YAGA 3AF1A 4C0BA 3AM1A 4RY8A 4CPDA 1PUIA 4AP9A 5KAMA 2HQ1A 3QEAZ 1CJMA 3KQOA 3G0IA 3ZYCA 3HZZA 2JJ2A 5HR5A 1V26A 1YVEI 5L45A 3GVCA 1ISRA 1VBKA 1WMSA 1JDSA 3IMCA 5TQVA 5JI3E 1OWLA 3W5SA 5A9SB 1RPNA 5CYGA 3DL0A 1F8XA 3FSGA 3GRAA 4DM3A 4DOMA 7YASA 1CEYA 4IYRA 3C3DA 5F5LA 4Q47A 2CHUA 5IJAA 5BN4B 3VZRA 3L4EA 3LO8A 3B52X 3MRVA 4Q24A 3VC2A 1NFQA 3O4RA 5ED4A 2FN3A 2JFHA 4ESVA 1T9GR 5JSFA 2BFEA 3JQPA 5DYYA 2KX7A 1YQWA 2QAIA 1FS4A 3M6FA 4O4JA 1O5TA 5L9AA 1J2UA 3U6BA 2D0DA 2JC3A 4R83A 3W5UA 5JOQA 2OXFA 4R5MA 4FWIB 3K5WA 1LSJA 4W7HA 1O58A 3U3RA 9GPBA 1M6WA 2F3TA 2FSIA 3KKPA 4F1JA 1SUFA 1ZI9A 3CC8A 3PFNA 4YAFA 1DQSA 2WPDD 1CR4A 4LRTB 1RBZA 1T5DX 1YFKA 1U1CA 2QQGA 3OPQA 4LQDA 4Y1RB 1RWWA 1Z0FA 3S99A 3H7IA 4J8PA 2ILTA 1CUEA 1E1NA 2IW3A 1ZM9A 3C48A 1PJCA 1GZDA 4KW7A 5KYWA 2HHHB 1O89A 3II6X 5GP1A 3S4YA 4W5OA 3B6ZA 5A4MS 1OH8A 4UNPA 4EY5A 5JISA 2CJPA 5EY5B 4BFZA 5H1YA 5TPWA 3U7HB 4GXTA 2IH2A 1I0LA 2FMKA 5FBHA 3DFMA 3OU7A 4WOCA 2XUQA 4LE0A 4TYPA 2WTUA 1JUDA 4OQDA 1DV1A 4YRFA 5H3CA 4YCJA 3DDZX 4IDNA 4J6EA 3IVAA 2ZRKA 4OUDB 3NJRA 3HACA 4XVRA 1KSGA 1WLSA 3IO3A 4EMSA 1GGNA 1XRSB 2XNDA 3NCHA 3OOSA 3CWCA 3M49A 4GYWA 3TKLA 5KNBH 3F6PA 3UMJA 4EG8A 2BDTA 4P7FA 1F6DA 4XWTA 4RAQA 4WKBA 1ZO8A 1OC4A 2VP5A 3FNIA 3SBDA 2J7PD 3UOWA 5JQGB 2KSQA 4DB2A 4M0CA 1NMXA 1N6PA 2IE8A 4YMIA 1T36B 2I1VB 2ZFUA 3IUJA 2PJZA 3F90A 1W9HA 3CNNA 4MAAA 1JDTA 1R9JA 1MOZA 1G7RA 2XYQA 5EERA 1SXQA 3VI3B 2WKQA 2C29D 5KYNA 3SQXA 3H1FA 5HS4A 3DO8A 3GLFA 4RKRA 1QMGA 3GFPA 1PGNA 3DMTA 1D2NA 4PWYA 4QBIA 5A4IS 3TM5A 1CQWA 1P6UA 1ULUA 2QXUA 1IFXA 2WJVA 5E4TA 1A3CA 1N2CE 2G40A 1ETUA 2FPIA 2NOAA 2Z0MA 1S4MA 4H59A 3V7UA 1PFQA 3O91A 5IKOA 3O5AA 3TQFA 3IQWA 3GLVA 2BM1A 3SR3A 3B6EA 1VC2A 3CG0A 4DDHA 5AUOB 2OCPA 2XE4A 1H6BA 1V6CA 5GGXA 4J3FA 3PXEA 5BNIA 1U7PA 4MJ3A 1XE3A 3CJTA 2ZJAA 3DG9A 2FG6C 2BTQB 4P5EA 1GAWA 3IVXA 1GQQA 1QB8A 4O29A 3UJDA 2D2XA 4KAJA 3VR6H 4FI3C 5CCXA 3MJSA 1TAGA 1FTQA 1UMCA 5EQJB 2HQOA 4J49A 4EBBA 5JSQA 5KJFA 1ZRMA 1WETA 2XNSA 3MS2A 2P9BA 1G18A 1E3DA 1XIVA 2GZRA 4MQFA 2QL5A 4URUR 4CLOB 5FPTA 3UKJA 1Z15A 2I4IA 4Y2YA 1TLTA 4OLFA 4CI9A 5D86A 2GHTA 1I5OA 1STOA 3EIFA 3B20A 4ZOAA 2AG6A 4RLHA 5F9MA 5ESRA 3IUBA 3W9UA 3J80A 5EMNA 2GRUA 4ILEA 4Q4HA 1B4DA 1KJIA 1DRJA 1YNSA 3HYNA 4Q5IA 4QULA 4A73A 1RI5A 1XRMA 2IQIA 3DJYA 4IQFA 4AYWA 4BCCA 1CERA 1Q1EA 1JILA 1UT5A 4F4FA 2VNIA 3UCFA 1KI6B 2VYVD 3BA6A 4FHZA 1BGVA 2WAOA 3BKWA 4QX6A 5JADA 4YJ2A 2V45A 4UMEA 3CHYA 1J39A 1QFSA 1SZPA 5DP2A 3QQ5A 2FETA 3JALB 4WK2B 1WEKA 4NH4A 3D3QA 4LY3A 2MSCB 4NC9A 4MCIA 4OQQA 4XDHA 3RJTA 4F9GA 2ZRMA 1JQJC 5KWEA 3R3SA 3ZTWA 1JAHA 4BMVA 4BMCA 2Y1CA 5FBWB 3EUAA 4H7JA 3U13A 4E2WA 2LP4Y 1X7YA 3DM5A 1FLAA 3S2YA 3JZMA 4URXR 2V03A 1OXTA 2UZ1B 4GLOA 3IERA 2VT6A 3TLYA 5IULC 3MGBA 2FPPA 1I1HA 1G0OA 4Q9LA 1AHHA 1EBFA 4HNAA 3VHQA 4WINA 3U39A 4LQLA 1ULSA 1RWQA 2BLNA 3TLAA 2J87A 3KK0A 1K9VF 4DSAA 3WGLA 5BXYA 3QE3A 4ESHA 1Q7RA 1SELA 2PO5A 3I37X 2QM0A 4OD0A 1F0KA 4IIBA 4NZNA 2W2MA 5EE9A 4UM5A 5CA1F 1IHXA 2JJ1A 4GRIA 2XF8A 4WHMA 1GLVA 4UU1A 1NXWA 4C0LA 3QTBA 4ZJYA 5DN6D 3WADA 5ICSA 4E70A 4KQIA 2ODBA 2HWUA 3GC6A 3M3DA 1QZXA 4ZYLA 1JKIA 1LTQA 3I73A 3LFTA 2H1OA 2HXSA 1UJ4A 2G67A 5K8TA 2GAAA 3O4IA 3OCXA 2FKAA 1QH1B 4Y2SA 2XUZA 4FP9A 2J0SA 1HT1E 2WT4A 2YTZA 2QMOA 2B2NA 1C30B 2ZSUA 5E2BA 1WLYA 2B9VA 5SYNA 2GKSA 2HGZA 3WLRA 1A1SA 5BV1A 5JJIA 1RWMA 4LDQA 3R3WA 4WT7A 3EUWA 2JARA 1NVBA 3DLHA 4P22A 2DULA 1V9LA 2P9EA 3PJEA 4IEIA 3GLTA 3G2MA 5HIIA 4JBNA 2OORC 5L7TA 2XVZA 2E5LB 1HO3A 1SU4A 4U2KA 3U7QA 5K8VA 1VG8A 4R0NA 1KYXA 4LI3X 1E18A 1K06A 3P2IA 2AXEA 2PXHA 2VBIA 2R751 2CL6X 4RA6B 5DHTA 2NUTA 4XUEA 3VTAA 4AF8A 1EUZA 2KJQA 2GD2A 4W8GA 2ATCA 4G97A 1UM9B 2HDNB 4FFPA 2C5EA 3Q40A 5FYDA 3RVLA 4DMKA 3LQ4A 1I7QB 1DAKA 2VN8A 4BTEA 1VHJA 2QVBA 2VLIA 1GCAA 4K8OA 4M54A 2OZPA 3AHJA 3H5VA 4OMCA 5IBRA 2AQKA 1ZVQA 4C01A 2VQEB 1XZFA 1UKCA 2JFVA 2ZJBA 4LC1A 5MN4A 3ABIA 3DGEC 2J4FA 3KDSE 3QNWA 3X43A 2FOIA 1P2TA 1USVA 1DLJA 2KM1A 4Q37A 2Q5OA 4UDYX 5GIPE 1X80A 2G82A 2OV2A 1Z83A 3EWAA 3CZRA 4M8KA 5ALVA 2QXYA 5REQB 3M82A 1JT9A 4LOHA 2OA0A 1HDGO 1DIOB 1CVLA 3TM4A 4C0QC 2G9RA 4CT0A 3R9WA 1VJGA 1L8QA 2Z30A 3P9NA 3ZV7A 3E9YA 4YVFA 3FHLA 4QQ8A 3SF0A 1ZA1A 3PEFA 2ZQ5A 2A30A 4HRYA 5LLTA 3A9UA 2Y0CA 1Y1LA 4CM9D 3UAGA 2V6IA 2QQ0A 1EVEA 2BP7A 5KWSA 3ZLJA 4NS1A 3P2JA 4NLLA 4YAJA 1GNVA 1KGDA 2ES4A 1UJ5A 4CQMA 1H93A 1OWOA 2MHCA 3B8HA 3OG9A 1U8TA 2FMIA 1E9RA 3G0CA 2XT9A 2PV0A 4B3CA 3FOAA 3HCWA 2RGEA 4Z1MA 3JAWB 3CISA 1KI4A 3E03A 4MI9A 4P7JA 1P31A 4EFNA 2QRKA 2X7JA 1DG3A 1WW8A 4FFLA 4R1OA 2J6HA 5CFLA 1DT3A 1C3OA 3GG9A 1P9NA 3H1BA 1B6GA 1PO7A 4OMUA 3AXSA 4JCOA 4XGKA 1GD1O 3RLFA 1JWBB 3UHFA 1QQ5A 1E60A 2HCJB 1Z6GA 4ZOLF 2A1UA 2PZGA 3OF5A 1UAYA 2R4QA 1VGQA 1NYQA 4S24A 5EE3A 5KU1A 1R0CA 4CDGA 3VYTB 1NR5A 3DBLA 4GQIA 4QWMA 4HMOA 2Y77A 3ABRB 3RRXA 2PS3A 4ENRA 2AL7A 3GBSA 3WSTA 1X7HA 3D0OA 2BFFA 3ZGLA 3ZX5A 4D57A 3P5SA 1CJCA 4TQUS 3GLGE 1BW9A 5K20A 4IXMA 4M88A 1EK2A 1GVNB 3F5DA 1SKUA 4OXQA 5L53A 3QX8A 2QVCA 2FGJA 3LQQA 5CXXA 1DUVG 2JGDA 2ZQYA 3KQLA 1UJNA 3NTXA 4DKXA 1EFDN 4II7A 4M0PA 2MDTA 3E7WA 1EDDA 2Y0DA 3B1JA 1BXKA 1I2MA 3LPMA 5FI5A 1EAYA 3DUWA 2XKJE 4UULA 3DZHA 1FSGA 4WDRA 3HDTA 2C61A 2EF0A 2Y99A 3B2EA 2HIGA 3GHYA 3NX4A 4QRDA 4XUDA 2IV2X 4YYEA 3B53X 1G21E 4TPKA 2Z2YA 2ZIWB 3WXMA 4UU0A 4FCTA 3AUKA 1AGYA 1GGMA 1QVZA 4MDHA 4FFDA 4IZOA 4AKHA 2FW0A 2XEXA 2OY0A 4R4JA 2PL3A 2O2SA 3R7LA 2C5BA 4H17A 3ZU6A 3D7SA 4ER6A 2M1ZA 5TIIA 3DHEA 4KUHA 1FUEA 1XGKA 4OYLA 3I4LA 5EWJB 2EV9A 4ACAA 3HMQA 3P0FA 4EPRA 1BC5A 2E4VA 3AWIA 3BKXA 4N0PA 4Q1EA 4OHZA 1QE0A 2IYUA 4UMVA 4X00A 4CIAA 1YJ5A 3C6XA 1IPFA 3DTNA 3LBAA 2FWJA 3AGPA 1FP7A 2FK8A 2GEDA 2D1FA 2NT3A 3GMDA 4ZVQA 2RGNC 1FMTA 1Q5PA 3GZJA 2B3TA 3W2GA 5AVXA 1KR2A 3E0XA 3PEUA 5LMZA 4OX9B 2BTEA 2LE0A 4BNGA 3ELDA 2DTXA 1GIAA 3GJ0A 3PVZA 2IUUA 3CPSA 4HC4A 2J9ZB 3DCIA 5BSWA 1N0VC 2KBEA 4YUWA 5AM3A 2A86A 1K97A 2PBLA 4IHQA 4AMYA 3DLAA 2GI4A 3Q6IA 4NENA 2Z3WA 5ERXA 1JXMA 1T8WA 2FZCA 4G8BA 3F8TA 1JKFA 1YCHA 3PKIA 4R0VA 3HCDA 3QWFA 5BSGA 2OWEA 4KR7A 3GLHE 1NOJA 4HX9A 4JP1A 2EFCB 1TIBA 2YZMA 1LBHA 4QNRA 2HNKA 4AWAA 3Q72A 2EX1A 4B5LA 4ZZ1A 2PU7A 4ZMSA 1H9CA 3P26A 5AHWA 4M8IA 3CO5A 3SHFA 4R51A 2Z4RA 4P4SB 3WMRA 4US0R 1WR8A 4Y7CA 4DDKA 4BB5A 1D0IA 2VHEA 5EMMA 4Z3DA 2WSSD 2QRHA 1QS0A 2YN0A 3PNOA 3K0FB 4KLCA 4KREA 2O2ZA 5CBKA 4M38A 3TOZA 4AJJA 2CKMA 2XMQA 2VJBA 2YY6A 1A8SA 1I5EA 1W5EA 2WF7A 3LCVB 2QPTA 5FOSA 1WB4A 3P7MA 2RGGA 3UPDA 5AOAA 1I2DA 1JMKC 2XGSA 2J0UB 1SKYB 1R6UA 1X7GA 3LOQA 3ND6A 4FOLA 5CMLA 4EBFA 4NU0A 4ZD6A 3ROPA 2IEIA 1HDIA 2E4ZA 3O47A 4ZIRA 1D2EA 1VB3A 1GRQA 3AC0A 2FKNA 3FYTA 3HYSA 4X97A 1IULA 3HKDA 1M5RA 4KNYA 1RM0A 2K5UA 3NTQA 3R3JA 1Q22A 1GM5A 7REQB 1VZ2A 5IG2A 4HWGA 1FU7A 4QGAA 1PL0A 1WZ2A 1YIOA 4I9NA 4MZXA 2DWOA 1O94C 1GL6A 1FDTA 2O2DA 5DEIA 4OHKA 3LGAA 3W5AA 1X70A 1KZ9A 4GKVA 4GLBA 3SS8A 3HMKA 3IOCA 2PWAA 3STTA 4EH1A 4O0LA 1A8PA 3SZ3A 4LBWA 3PA8A 3RIHA 5K9ZA 2JW5A 3FPAA 1MB0A 3DKRA 4ND5A 4D41A 1MBZA 3SQNA 5K03A 1WSDA 4LOAA 4IRXA 4NNJA 1NKTA 4OHPA 4RX1A 1KKUA 4TV9A 3TZKA 5CDYA 2V4UA 1AQJA 4KQJA 1RZ3A 2QAGB 3V1TC 3UF0A 4KSBA 4E88A 2P2DA 2VJKA 1E5TA 1AM4D 3FNEA 3WB2A 2O19A 2FX5A 3LC1O 4H7KA 4Q9DA 4BRZA 3UGJA 2JHAA 2WZBA 3RFFA 4BLTA 4ZV9A 2R1VA 3OM1A 4YRMA 1E32A 1KWKA 4DR2B 3KFXA 1B76A 2WG0A 4JOSA 4TWJA 4X3CA 3RVOA 4YAIA 2XIJA 4M0MA 2GHIA 2ZR7A 1A9SA 2W22A 1P19A 3BMXA 3HXTA 4L5IA 1I7NA 2PUWA 3QVLA 4M0LA 3GZ4A 2DSTA 3GEIA 5CDSA 2PANA 3OPYI 5BV2P 4EI8A 3G8YA 3VNBA 1VYTA 5CIYA 2AEFA 2FUEA 4DWVA 4P4LA 5AVSA 2WJ3A 4AJIA 4B35A 2Z3VA 1PR2A 4PIVA 4DJEC 3OJFA 3QF4A 4ZQGA 4EHHA 4DV0B 1Z0AA 3KUUA 1ZGCA 1X1TA 1ZUIA 3LY7A 1G5IA 4KLNA 4NBWA 3T9AA 2DPMA 4YLYA 4KE7A 2BISA 2ILVA 4MJXA 1AKTA 1HDCA 1C7JA 1DRUA 1V7CA 4MW0A 4CMIB 4RTQA 3OCYA 4UUAA 1RM3A 4J0JA 2ACKA 2Q21A 2C5GA 2Y4OA 5JMTA 4WKGA 3SG0A 5C51B 1AA9A 4MB0A 3FZQA 4PTYA 2PX6A 2C88A 4C3ZA 3VKUA 4ZVUA 1SK8A 3Q7SA 4B6FA 1D2MA 2OAQ1 3EIXA 4K05A 2F67A 5DIFA 5K7SA 5DOZA 1FMFA 2O6HA 3IBSA 1P0IA 4P3KA 4UNRA 1OIVA 1K8ZB 3G5LA 3AHFA 2QIPA 1CUCA 4F5EA 1JIIA 4ZEMA 1LY1A 3HVIA 1SNYA 3AOGA 2VDKB 5FAKA 3STHA 3ZZUA 1AKNA 4YR9A 5HJ5A 3RASA 2HLDD 2HK8A 3NP7A 2JFGA 4RH1A 5FTMA 4RK4A 1N2ZA 4JVNA 1DQNA 3KE9A 1MIHA 1TD1A 3EXG2 3FYSA 3BRQA 3FNRA 4O3MA 5C46F 3LTNC 4IGFA 3PK0A 5KI6A 3BFXA 3EASA 3GEMA 3OOWA 1KY5A 2WIFA 4PG4A 5BYJA 1Y6FA 4FNGA 4RDIA 3T7KA 2ORWA 2WUDA 2ZRBA 4CQLB 1E92A 2ARKA 2OOKA 5DLEA 4RADA 1AY0A 1T2VA 3WLHA 1RI1A 4D74A 1SHLA 3Q8LA 5EE1A 4ALKA 2RJNA 3F5QA 3LW8A 2HO5A 4TLBA 4FB5A 2O3QA 1TMYA 3QKSA 1VCIA 1FDWA 1JSZA 1N7JA 3CT4A 3U3DA 3WAKA 4EYKA 3IQEA 4OX9Y 3ANYB 2AA3A 1O95A 5FOTA 2RHLA 4NECA 4F56A 5JRJA 2UYCA 1S1CA 3T5PA 3ZCXA 4EYOA 1HTWA 5ALEA 4HL6A 5JANA 2H4HA 3HY3A 3W1EA 4CLEA 3LC7O 1AF7A 1DO0A 3CLVA 1TM2A 1IEVA 2Q5HA 2WK1A 3FTDA 4FOTA 4RK5A 5IJWA 3ZGOA 5JD4A 2IK8A 1EA5A 2YN4A 3BCUA 3DMTC 3QPDA 3ZR4B 4LDZA 2LBPA 1YL6A 5ALWA 1VJDA 2RAVA 3PR1A 1T5OA 2ZIXA 3KJFA 4FGUA 2NTVA 3K9QO 3EGCA 4UNQA 2QV7A 1GPDG 3HY6A 4DV6B 3OKAA 4CKCA 1L3IA 1N7GA 1ENOA 3OCVA 1VQ1A 1EHCA 3ZDBA 1TRHA 2X5OA 2X3UA 1Z6AA 1QYCA 2DY1A 3W5DA 3FR7A 2EP7A 4P3PA 1CYDA 3EJWA 3LUJA 3OETA 3RFXA 3SNHA 5FULA 1QYXA 2O8DB 1B6RA 1CEQA 2Q1UA 4L5YA 3ICVA 4WEOA 5DXJA 3ZGNA 3FPLA 4JBHA 2I55A 4JXJA 3S29A 1BMDA 4DT1A 4ZTZB 2QD4A 3ORSA 3L6BA 1O5IA 4HO1X 3AY0A 1XP5A 3EZLA 1KI9A 3AFGA 3QLEA 3V6LA 3CCFA 2X2FA 5HDBB 1RQ7A 4B3HA 4NU8X 3H83A 2PT7A 4D6XA 2XD4A 5CH5A 3PF9A 4TTIA 3T1YB 1BJKA 2R11A 4KX5A 4QYXA 4U2CA 5IVDA 4RSMA 2IZOA 3HBFA 2PRZA 1A7AA 1DBQA 4M98A 3TSCA 1EFUA 4QA9A 3WNVA 5DLQC 4MQUA 1FDVA 3IB6A 1UKBA 4UPVA 4W63A 4BPRA 1LB1B 3VKHA 5E7IA 1RQLA 2X9LA 3OFND 4IJ5A 2J6BA 3AETB 3B2QA 4PGMA 3ZY5A 3QYAA 4EECA 2B36A 4F97A 4J0IA 3R8XA 3HVUA 2XMCA 2R79A 3RFUA 5JXGA 2XTJA 4YCSA 5IT4A 1ZEJA 2FUCA 1ID1A 2WYUA 3O26A 2E21A 2G6BA 3KOXA 4O59O 5JD5A 2CMGA 2BMWA 5BNZA 3VKGA 1Y5RA 4IMRA 4KV9A 2P7IA 4C4YA 4EMTA 1ISMA 2LKDA 3IJEB 3IOBA 1FIUA 4LZOA 3WZ2A 1TM5E 1R64A 5JZVA 2GPBA 1EUCB 1S8AA 4D8XA 2R6CA 4C5BA 4J0DA 1NN1A 3F4LA 1DARA 1ZVMA 3GQVA 4W4TA 1LH0A 3OZAA 5BSTA 5BVHB 1KZ1A 4HLUA 2JS7A 4CTJA 2EWVA 2CSUA 1U3WA 3K70C 4DCOA 3TFOA 4QYIB 4WJZA 2IHUA 3RU7A 4KXQA 1TGVA 3OZXA 2XUJA 1YC5A 3SC4A 1EFCA 4OI2A 4DRXB 5ITVA 5IYZA 5GVRA 2VAMA 3FCCA 1BS1A 2PX2A 5TEVA 3ZZ1A 2VQFB 1B8OA 1UPFA 1OI4A 1T6YA 3K2BA 3PUVA 5JXJA 5LQJA 2HIAA 2JAXA 4TVSA 1ZAYA 2E2WA 2YDXA 3EZXA 2Q45A 3I9LA 1FP4A 1PNRA 2IBTA 4FWBA 4Q3LA 5ALGA 1OR8A 4NPAA 3I2KA 4URWR 4Z4HA 4YX9A 5MHTA 1DIBA 2LR0A 3CNQS 1A5TA 2NGRA 4RV5A 1UR5A 1Y8QA 4XTCS 5DP1A 3E23A 1G3IA 4S1OA 5I7HA 5EJ9A 3T3OA 4H6VA 2R5FA 3HHPA 2AMYA 2O1SA 3KBOA 5ARDA 4Z0TA 3EOZA 1IEWA 3PD1A 1IB6A 1VIYA 4WZAE 2X76A 1XCGB 2CV0A 3E7PA 3EXHC 1A69A 3FLEA 1DUIA 2BDEA 3PQ8A 4ND8A 4PAQA 1SMKA 1KAEA 4CBVA 5KNCH 2D5BA 1WHSB 3VR6A 2QJWA 3GJSA 1UMBB 1BN6A 2DU8A 2CYBA 3DPIA 1AE1A 1IYZA 2ZCVA 2YYZA 3MFYA 2WA2A 4PG7A 4ZOQI 1UADA 2HX1A 2VHVA 2J09A 5BQPA 3ZWYA 3DE5X 1KY3A 1JYFA 3M1AA 4MQMA 4O1IA 3WFZA 2DX7A 3BE4A 3E35A 4MV3A 4PLYA 3C6ZA 4KE6A 4RAOA 5AK5A 4CU5A 1N9GA 5JWRA 3EIWA 5ALMA 1JLLA 4H1TA 1N5JA 2QS9A 4RHTA 1E2MA 1UPCA 4M1TA 3EA5A 4MWSA 4WTOA 5J40A 3W4KA 4YMTA 1LDEA 2EJWA 1U1IA 1U6KA 2AD1A 2NSHA 1TJ4A 2PH5A 1Q1AA 2WV9A 4PC1A 2AFHB 2QYHA 3HUTA 1J22A 2Q1SA 1N5DA 2QQFA 4GP9A 3LT4A 4ZU1X 1PV4A 5LQCA 2H59A 3CLSD 3NLLA 4IF4A 1X94A 4LNAA 3MCUA 4FT2A 1FFGA 2VUTA 5AXAA 4IINA 5L4NA 3IEMA 4FYPA 3WGMA 4UD2A 1TMOA 1JI0A 3QPWA 4DUZB 3L92A 4U9IS 5JD6A 1QJ4A 1H94A 5LQMA 1SCAA 5E3HA 1H5NA 2PZMA 1BEUB 2EARA 4A2WA 2XRMA 1OB5A 1YI0A 4DG9A 1J42A 2IIQA 4ZC8A 3JYNA 4Y3UA 1XZLA 7ABPA 2C7QA 2ISCA 1LLUA 3PXBA 1C0IA 1ZGAA 2R2AA 4GSYA 1WVGA 1CULC 1O97D 1P45A 2J3QA 3B89A 1KBZA 1GTL1 1Q15A 3AB8A 2XDWA 5CVTA 4AQDA 1FJXA 2PSJA 2WU0A 4BQNA 1EFVA 4L8YA 1PFYA 4YRIA 1NY6A 1J21A 3USZA 2G09A 1OLOA 3TOCA 4NFYA 3HUFA 1S2MA 1V1MB 4JLNA 3TS1A 2O1EA 4BWFB 2EHDA 1A8QA 1U2SA 1NNLA 1OX6A 5LOVB 1ZUD1 3E5MA 1EZ4A 3S2IA 4YDSA 1UXIA 1SVNA 2A4MA 4XX1A 1CR2A 4WOBA 5DBHX 2H0RA 3D3NA 4QSMA 1XLWA 1BHJA 3N0TA 1L5HB 4UM9D 3H5AA 2PL1A 4FIDA 1G5PA 1P5ZB 1QF6A 3RRFA 4P81A 1GV0A 1C8LA 2VVTA 2Q3FA 1PS8A 3I45A 2H8KA 1DEAA 3HDVA 4MKHA 4L16A 1UBLS 3EPKA 4IQGA 5KPJA 4RPJA 4E7PA 4BX9A 1JHQA 3QELA 2VF4X 4QWWA 2ZAIA 3QRWA 2XJ9A 4QAJA 3IBFA 4QTYA 1FP2A 1N5RA 4OSEA 1PTKA 4DA6A 3U61B 5AI8A 2BBSA 1B43A 1N2BA 2FHSA 3CXRA 4RL6A 2JANA 4B73A 1KI2A 2H54A 3SJBA 3AI1A 1LUAA 1THZA 1I8TA 4LTMA 1PJ4A 1VKOA 3KWFA 1DAEA 1E9DA 2AMVA 3F1LA 1O9BA 2OZLB 3H11A 4FQ7A 4QOHA 3QNUA 3WJ1A 4CMJA 3V4FA 4IBOA 3PLRA 3V4SA 1QTQA 4JGBA 2QZ4A 1UWCA 3EXIA 2WJJA 1II9A 1ZX1A 5EIAA 3V4LA 5IJ9B 3H4VA 3JSXA 4NMWA 3LS2A 4YAWA 3S2SA 4TV9F 1I36A 2PGAA 1WMAA 4EENA 4QUGA 1JR6A 2W4MA 5AVVA 3KO8A 4FYKA 2WE8A 2WUEA 4EHKA 1YOVB 3MAJA 5G40A 4BJHB 1QP0A 1KQPA 4DJFC 1WM1A 2QAJA 2XWBF 4WCFA 5A4KA 4PLTA 1CR0A 2ODPA 3HDGA 3OE7D 4Z8XA 3VNSA 2AJBA 1QX4A 2NO0A 3SP1A 1NT4A 4HUQB 4YY3B 3D4NA 2AZXA 4UPDA 5JHGB 4N3BA 4JLBA 4ZVOA 5IANA 3SC3A 2BY4A 4A15A 4NR0A 5JYDA 1RXVA 1BX3A 3E4DA 2COKA 1BROA 1E66A 3T1TA 3MSCA 2ZIUB 3PDHA 1OC2A 4MQLA 2JCYA 3PXXA 5TRTA 4UKDA 3OIGA 3STWA 1B41A 1IY0A 2YV5A 1YONA 3DHYA 3NTOA 1JDBC 1LBTA 5DTMA 3TPZA 2WNHA 4GI7A 1G7TA 2C2XA 1A9PA 4HWKA 2JBHA 2XMBA 5JCZA 3FUUA 3AEUB 1E4OA 3K9WA 2ONZA 2R8PA 3WRXA 1C3VA 3TQOA 5K0ZA 1L5MA 1E6EA 4Y8VA 5FUBA 2OV1A 2ZCUA 3T9BA 3PJGA 1ISIA 3WOHA 4MYHA 3NMUF 4NULA 2IODA 2CFRA 5UKDA 4G09A 4JA2A 1JA1A 2QTVA 3K70D 2HDHA 4I7EA 4ZTUB 1NUAA 1F4VA 2CLCX 1CC1S 3DDWA 2BR3A 4RTRA 4R41A 2OAEA 1QPBA 4UM9B 3ABZA 4XLTA 1JAIA 1WXWA 5E6SB 1TZ2A 3R7NA 2VRCA 2XQIA 4DLKA 3HBNA 2ZU0C 3DBIA 3E3NA 3O74A 3ELUA 4MTLA 2YJNA 4FHCA 2WR8A 4W9RA 1CJBA 4XXHA 3QW4B 3F73A 1NP7A 1R37A 3EXG1 1WTCA 2JFBA 1H2XA 2ZTHA 5ALYA 3HR7A 1JQ3A 1PR9A 4AMVA 2CUZA 5EYPB 3SEAA 3TZBA 5D2CA 4UHDA 1B93A 3WMWA 2O57A 3IQIX 1M76A 2GX6A 3EIHA 4NCIA 2ZJ5A 4P9NA 2NO7A 4PHTA 3DDUA 4PNPA 1Y3AA 2AG0A 4G1BA 3V46A 2IBSA 1ZJ5A 3GLGA 2QD3A 2ZPAA 4W82A 1OH7A 1KJ9A 4BTLA 1J2TA 2OLEA 2VUIB 4JL5A 5CW2A 1QIKA 4OHBA 4V02A 4NDZA 3A6KA 3SZGA 2FUNB 4I5FA 3BREA 4YJ3B 3ZKWB 5BWOA 2QX4A 3FKQA 3Q3CA 4S1TA 2JFUA 1P0PA 3I28A 4QJBA 1F2TB 4BC0A 2GHQA 3M6WA 4ZAXA 5CB4A 1NNI1 1UJ2A 3A1UA 3HB1A 1ID8A 4OXXA 3ZEAA 4TL7A 3RVQA 5JYBA 3H5OA 4ZCIA 2YKGA 4EO7A 2Q7DA 4LRQA 2QUJA 1M5UA 3W05A 4HVCA 2X41A 3UG7A 4YMGA 3IELA 2AR7A 4FOOA 1EJ2A 2Y66A 4AJ2A 3N3BC 5HBRA 1W581 3FNGA 1K4YA 2XE6A 1KP3A 1L4EA 2NSYA 1UFRA 1EUDB 3LUFA 1R00A 1BVUA 1CZOA 2EZ9A 2R7AA 1CUJA 2C1XA 2CVZA 1BVYF 4D3SA 1V8FA 3IV6A 4GZLA 1O2DA 4AKIA 1GL7A 3S6JA 3EXFB 3PWZA 3L06A 4IS3A 4NCBA 2ADMA 1NXXA 3TF5A 2IHYA 1CNMA 3PQDA 1PTJA 1BMFA 2ZJ3A 4EQ6B 3QU5A 1TYAE 2WJ6A 3IVMA 4EAAA 2PGDA 4FYVA 1NNSA 3GFGA 4C1NA 3Q8KA 2VHTA 1RTKA 3TINA 2RGWA 3RC1A 1W35A 2IYQA 2DECA 4FC6A 3WBBA 3HEBA 2DXIA 4IV5A 1E61A 4H4EA 3RVNA 4ALLA 2QRLA 1VMKA 3JASB 3QOXA 4CMCA 4Z7QB 4I3FA 3CB4A 2IJGX 3E22B 3I9V6 2O8CB 16PKA 1Q20A 4YRLA 2H4JA 1LKZA 1M1NB 3FTCA 1MC4A 2P68A 4TZ6A 3QUSA 2XMRA 3Q8MA 4EI9A 1X15A 4I99A 4MV7A 1QHHA 4GPZA 4MQEB 3TZLA 1RSZA 3PC8A 3NRJA 5LDDC 3WAGA 2VUUA 2V7QA 4TKVA 2P35A 1E3SA 4HB3A 2GFQA 4NDNE 3WQSB 5I8WA 4FFOA 5IBQA 2K7FA 3RT9A 3FOCA 3N8KA 2YVUA 4E5VA 2PJRA 2F62A 2I62A 1WXHA 5ALTA 5AQ1A 1CDEA 2WT9A 1ZI6A 4X7RA 3VZSA 2HZBA 3ZGVA 2H00A 3CG4A 4JB8A 2YJZA 3IPYA 4PBRA 1CS0B 1JVSA 2PKEA 3BGDA 2WWHA 1L8OA 1JWAB 5BORA 4KR2A 2FZKA 3OIUA 1F6BA 4E1BA 2CNLA 4Q15A 3SKXA 1XR3A 1C50A 1PG0A 3NDPA 2HJVA 3T6KA 2FZVA 3OTHA 1YZ3A 3L4BA 1R6AA 2P6NA 3QOWA 4KKVA 1Y9JA 2E1PA 3MJCA 1WBJB 1RQRA 2X2PA 4TS3A 4Y67A 3G49A 4WCVA 5DN9A 3WK7A 4PSVA 4PG8A 2PUCA 4BMSA 5JHHB 1Z37A 1ICIA 1US8A 5CYFA 5F7OA 1PIWA 1W1UA 3BMCA 4AX4A 1LDBA 3BCSA 1VXRA 3I4CA 1AO3A 2EFHB 1V8BA 1JLHA 2G63A 4ASUD 5JZSA 2H1CA 2QRMA 3JPYA 1WUJS 3R6GA 4UCQA 4AY3A 4CQNA 1H4TA 5E9WA 3T12A 4LMAA 3MHTA 4NNOA 2E37A 2OENG 3ZDRA 4Z4QA 3DMFA 3UWSA 1REQA 2NN3C 3OQHA 4GR5A 2QSZA 1KYYA 2FMHA 2G83A 1QIGA 1G21B 2OHJA 1U2ZA 2Q6KA 3L7JA 3V8VA 4BJ3A 2YV4A 1BKYA 1W29A 4ER5A 5PGMA 5EJEA 3B82A 1OKKD 5CT4A 3EF0A 1R15A 1QG4A 4U5QA 4KRGA 4PICA 1L1FA 3KSMA 2IEDA 1XWIA 4PLCA 3KOZA 4X3OA 2PO7A 1Q1ZA 2B2CA 2DM6A 1I7LA 4RJ2A 2HA5A 2F8LA 4Q66C 4O4IF 4UARA 1I13A 2FWRA 5LYJF 3IA7A 1QGUA 2WMNB 3ROZA 2RC5A 2CB9A 4EYQA 3WV4A 4V03A 1U4NA 5H3HA 3WSWA 3PUXA 4PO1A 1G8JA 1BE6A 1JBQA 3NIFB 1FDOA 4B75A 3BBPA 2FFHA 2H4XA 1AK1A 1E4YA 1PLLA 4IP0A 4JJ7A 1CQJB 4R1UA 3KB1A 1NVXQ 1X0XA 2G4CA 3DE1X 1U5BA 4AKSA 2RK3A 1I1NA 3RV3A 4WQMA 2Q5IA 4MPDA 1IM8A 1NZDA 4YALA 5DSTA 4JELA 4RLSA 1AV7A 3BWMA 2PQ2A 3PP8A 1V5GA 4KK4A 1Z5WA 4LWPA 5CTAA 3C1AA 1P1JA 2ABWA 1GP2A 4K86A 5A3VA 4HRVA 3IRUA 4ZDWA 5KVSA 2H3EA 4LFAB 2D59A 3NBAA 3THYB 2OFFA 1QBGA 2APJA 2CT8A 1OWNA 2HTFA 4IIYA 3PNMA 5BRJA 4IH9A 4QVGA 4JLSA 1M72A 1CIPA 1UBFA 3H1AA 3Q8WA 3VUEA 1Z4MA 3JPWA 3AUSA 1NJ1A 1IONA 2P11A 4ND7A 4RK0A 3W6NA 4D1YA 4QDTA 4CEIB 1VP3A 4WZAA 2O06A 2V7XA 3A37A 4F8JA 1U8CB 2CXPA 1I5RA 2IS6A 3Q0IA 4NQRA 4I50F 1LC0A 1Q91A 1JHOA 3CWZA 3IKLA 3P0JA 1W9MA 4OXRA 3G85A 3WRWA 3W3AH 4BFUA 3TTYA 3GLFE 3QPCA 4RCYA 3LBNA 4FR5A 2FQXA 2YMMA 5FBKA 1RXYA 3BVPA 3BQNB 1R0YA 3Q5GA 2I80A 1Q74A 5M34A 1W48A 2NUAB 2IP4A 4MV6A 1YDMA 3LCRA 2CK3A 5BURA 2W6ID 1XEWY 3CSDA 3G68A 4R1PA 1JFTA 1RYZA 4RF5A 3OFVA 1K3TA 1TQ8A 4L6IA 3RIGA 1N9ZA 4MCHA 4B17A 1Y5NA 5JY6A 4GZMA 1A4IA 3GQBA 1Y34E 1P4GA 2JLQA 2PFGA 2BL4A 2XUFA 5LQKA 3JQRA 3WG9A 1WOYA 2JAOA 2QEQA 4J16C 2EDAA 2QX8A 4PPYA 1MCZA 2GAFA 4FS3A 4PQFA 1QYIA 4US1R 2C8JA 1BXZA 1L1EA 4RGBA 3UVEA 4ALIA 1U3UA 2Y05A 1I3KA 3ONVA 1CF2O 1ILEA 3LLUA 3JQAB 1QNLA 1PGOA 1TKBA 3CEPB 2AHOA 3ODPA 1U3FA 4RM2A 1HEYA 1DADA 2F9FA 3ICPA 4RFSB 5THKA 3ZI7A 3T15A 2CXHA 4DANA 3U3XA 4ED9A 1Z0DA 2AOUA 4IZIA 3X44A 1D2AA 5ES4B 3QUCA 3LMKA 4AZ3B 4AZVA 1E6CA 2GKOA 3SHWA 5ISMA 4M83A 3MK31 2ECQA 4MARA 5HF5A 6GPBA 1QHFA 3BD9A 3C3JA 4PLGA 2Y1XA 1H2BA 1PK7A 4PZAA 4WDQA 3FOZA 4R40A 1X8XA 1LLQA 4A0QA 1RKUA 3PX7A 4GOLD 3SEFA 1JGTA 5IP5A 1XQVA 3MUEA 1TYEB 1NMEA 1RJWA 2R8RA 4DA8A 1CZNA 3BTOA 4WFKA 3ZY4A 3WLIA 2PLNA 3F67A 1K8RA 5GJCA 4YUAA 1H8HD 4O08A 2P6RA 4OSPA 2ZE6A 1P2BA 1E1YA 1ZW6A 1OA0A 2BKXA 1ECGA 2DQYA 2VYNA 2I6FA 3F46A 3HZHA 4FQ5A 4XIYA 4LDPA 4DXHA 4EKGA 2I7TA 1A27A 4D0GA 1UAGA 5BQOA 1JR3E 1XDSA 3JY6A 5CLGA 1W4ZA 3RUHA 1VDMA 3ZW7A 4EATA 1P6QA 5B58C 5C1PA 2VXYA 1LI7A 1P60A 4ZKDA 2Z6UA 4X1IA 3AERB 4JHLA 1MZPA 3S3TA 4GIBA 3R9XB 1MC1A 3S0JA 3L84A 1GJRA 3BQ9A 2IKSA 2CXRA 1FS6A 2WAAA 1E9EA 2GASA 1MGPA 5FI3A 4DC1A 1WZEA 3ESQA 2C9OA 4JP3A 1YL5A 2EJUA 3WO0A 5F2NA 1TADA 1ZESA 2VPXA 5LDGA 5AI6A 1P2UA 1DXYA 4PZ9A 4HRAA 2ZJ2A 1E8NA 2PKCA 4PHCA 2B8TA 4Y2HA 1A9XB 2QN7A 3H17A 5AESA 1YF3A 1FUYB 3V42A 4NE2A 1SA0A 2WJIA 2CLMB 1W25A 3RB8A 3GFBA 2EP5A 3D59A 4KXNA 5J2UB 1EG2A 3IHWA 4KLZA 1BRTA 1UKEA 3GA5A 4TUYA 5KHOC 2ZROA 5TDHA 4C4PA 3TUZC 1ABFA 4IDGA 4G84A 4PNHA 2BZGA 1L5YA 4J1TC 1XLTA 3R9KA 3NDBB 1MVLA 4YCCA 1MAAA 3FIJA 3TAUA 1L9XA 4IZ6A 1DBRA 3LXMA 1E6MA 4C7JA 3N2YA 5KTMA 3QE9Y 3CF0A 1B23P 3D7LA 4RABA 4W5JA 3AEKB 4BNTA 2W2VA 2ZWIA 3NTUA 4C6TA 4H6PA 1ZD9A 3K0HA 2BGKA 4PX9A 2CMDA 4MW2A 4DVJA 2Y8EA 2EGHA 3F7NA 2YJTD 4QBTA 5F7ZA 3DR3A 4DDWA 1EDBA 3RAJA 5C7YA 3AFHA 4XGNA 1C7IA 1JDNA 1USGA 2ZRCA 1EFPB 1L7VC 3HN2A 4X20B 4ZVPA 4ZK2A 2WQ7A 3HJFA 5ULLA 4GWGA 5DISB 3I2FA 3A05A 4W1SA 5EP1A 3K9CA 1BRMA 3C5HA 5G41A 6REQA 5HZHA 3BJEA 5HM8A 3CUVA 1IM2A 2ZSBA 4BMNA 3NM6B 5HFNA 1IL0A 5I6DA 3JQ9A 4CWAA 4MA0A 4NAUA 1ISJA 3RG8A 2D3TA 4H7HA 2VHUA 3QBDA 5AK6A 4LXYA 4D42A 1MQAA 1MAVA 3GEEA 4W5NA 1N2IA 4EITA 2WSSA 3WGHA 1DNPA 4AIRA 4L73A 3GJYA 4XSVA 2WFMA 3CBQA 5LA6B 3HRIA 4LV6A 1M8GA 2HRRA 2VJAA 3FSGD 5FFFA 5I9SA 1XTQA 3RNOA 1DRWA 2YIVX 5F12A 3KR1A 1NYRA 4MUAA 4D5EA 4JL6A 4YRNA 5J4VA 3WL3A 1M8FA 4BVGA 2NT4A 1YI1A 3P96A 2YX1A 4ROTA 1ZW1A 3D31A 3MUNA 4FW9A 5EIBC 5K3AA 4PN3A 2ZG6A 3FG9A 1U94A 2H18A 3KSBC 1PK9A 1T3SA 1XDZA 2RHDA 1EK6A 3BXEA 1G8MA 2R7MA 1MG5A 1T1JA 3D1LA 5H80A 4TV8B 3FE2A 3NKLA 4AO8A 1FBTA 2VDJA 2QORA 3QVOA 4M1YA 2V3CC 3VU9B 3NTVA 3DA8A 4DL9A 4M6WB 3EFEA 2KW5A 3WNZA 5LUBA 4FS8A 5FF9A 1RU3A 3V97A 1V95A 3D6MA 3KQVA 4EPWA 2PUBA 3SYKA 3W06A 1RABA 1KZYC 1P2VA 1WEHA 2P2YA 4C7XA 1LBIA 2JLCA 5JQGF 2YJ6A 1NVDA 1Z4LA 5CVDA 1XI2A 1TTHA 3VPBA 4PLVA 3M2PA 1BWRA 3RK1A 4L4XA 1SUIA 4D9MA 4RU1A 4L4YA 1F06A 2WIBA 2WYHA 1FRFS 2NPIA 5IC5A 3OY7A 1P9RA 3VO1A 5SY4A 3AYZB 3VZPA 4YRJA 1ML4A 3I9KA 4X95A 1GPLA 1YFZA 1X8KA 1GPNA 2M32A 3LIIA 3R7DA 4XX0B 3WGNA 1ZFNA 2FE4A 4L27A 4HNQA 3KLNA 1VRVA 4CL8A 1JG7A 1NU8A 4LZZA 4Y1GA 2VF2A 4E2FA 5LOVF 1MABA 1KZ7B 4TN5A 3TE6A 1ZD4A 1ZSVA 2JI6A 3GRKA 5I7SA 2WYIA 4PU0A 1RKBA 1SFRA 2AGVA 3EZ9A 4FZJA 4KO2S 2OD7A 1OTXA 4E5SA 1GPMA 2CDNA 2PJDA 1OYYA 3L0ZA 1GTMA 1WVIA 2CXOA 5IJZA 3FOEC 2HRDA 4MHTA 1VKJA 1PU2A 4DQ0A 1T10A 2HIHA 5KNCA 4K9PA 1DEKA 5IAOA 2VTDA 2W8BB 4JUDX 1RJ9B 4QU8A 1P7PA 2O7NA 2VP0A 1DPGA 5JTTA 3VAZA 4QXQA 1XJ0A 1U2EA 4N6NA 3BHNA 5ALZA 3I1JA 4B4KA 2PUAA 4DPLA 4RSGA 3M89A 1JR4A 3HSSA 4N76A 3Q98A 4FZRA 3W8DA 1Z38A 1NLUA 1ZK3A 4PRLA 5INTA 1A9YA 2WHRA 3DE7X 3EGXA 1GGEA 1W4RA 2TS1A 1AHNA 1HRDA 1RHJA 3P9QA 5KVQA 4DLRA 4F3KA 1UJCA 4UAUA 2YW9A 1S2NA 2H5JA 4TWZA 3K2EA 3IUEA 5LMCA 3QFSA 5IS2A 1JHPA 3N53A 3PC7A 1OFUA 1UEIA 4IDDA 5F4BA 3T0FA 2J9GA 4TMTA 3A2KA 1QZ3A 5BOSA 3QE4A 1QDLB 5SYAA 3CQ9A 1VRWA 4K40A 3BJIC 3IKJA 3GL9A 1G64A 3B1VA 2V6GA 1SHJA 3JATA 4PRYA 4RZ2A 1BWPA 1BD4A 4YHBA 3PXCX 5C4GB 4ON9A 4YJHA 2ZWPA 3JS5A 1TT7A 4X6YA 1PVDA 3ECSA 3SHOA 3VZCA 1YZFA 5TGTA 4XYMA 4BVAA 5DTEA 4I9GA 3C97A 4EELA 1QP7A 4MV5A 1X92A 2YDYA 2VDQB 5AIAA 1L6RA 1TCBA 3N74A 1BE1A 3K6JA 4NYMQ 4PG6A 3U4DA 1Q77A 3MTAA 3MLBA 2ZJYA 1Q0PA 3BK2A 4INZA 1JZQA 3IIKA 3R3UA 1JLKA 3JAKB 2Y9PB 3LTEA 1GFIA 2SECE 1I01A 4JJFA 3O3NB 1A1VA 3T7JA 2E6KA 4QLOA 1DAIA 5K45A 2HCFA 3GBPA 3GWGA 3KG2A 1YR9A 4LY6A 4AROA 2QPLA 2ZSDA 3OZCA 4UEOA 3VVLA 3WLEA 1D6MA 3CR3C 2R00A 5IDVA 2XLCA 1LS1A 3TJMA 4HBGA 1O6FA 3T9EA 1LI4A 2WWIA 2WFLB 4U7PB 1XYYA 3UENA 3JQDA 5CLJA 5M04A 4LWZA 4R16A 2O4UX 2AD5A 4OGKA 4XLZA 1AV6A 3PHBE 3BDVA 3M5DA 1JVNA 5TQ0B 4J4HA 4P82A 5JBQA 2B5VA 4HI0E 1Q7TA 2WD7A 3EZYA 5ENVA 1OZAA 3GLSA 2B69A 4QVIA 3ZDZB 3OKPA 4OYHA 1UFOA 2VDRB 2G04A 3H18A 2XH8A 1CUAA 3OJ0A 3U37A 2EKDA 3A26A 3SIRA 1N5KA 1W52X 2XZPA 5IW8A 5HXAA 4LBZA 1OBFO 4QPDA 2Q29A 2GEKA 4MA5A 1I33A 3GUUA 4GXNA 3WWZA 2QLMA 3C14C 2CHGA 3H1EA 4FR0A 1YT5A 3QE0A 1XCOA 1OT3A 2I7DA 4TLMB 1EE9A 3DFUA 1HNZB 4LCEA 1V1RB 2HY7A 2CDAA 4IDFA 1Q7BA 3JZFA 4KV7A 3RSGA 2C3OA 3WYCA 2ZUEA 3LU1A 3G9XA 3BBLA 3UIEA 3SQWA 5C31A 3Q7IA 5CAEB 4B3MB 4A16A 4RHCA 1CUHA 4LHWA 1IWPB 1SG0A 1ZNYA 2CLSA 3DZFA 4OI4A 3T5CA 4N48A 4MQ6A 1U9JA 4ITRC 3GLIB 2QN3A 5FKJA 5HJ2A 2JA2A 1KNQA 3EQ9A 3KX2A 1SURA 5BN1A 3KR9A 1NONA 2E4AA 4ZO6A 2YYYA 4GH5A 1Z33A 4IJ6A 4POAA 4DJDC 1OROA 4TTSA 4Z2AA 4PGHA 2WWVD 1DJPA 1LK5A 3U1VA 3BN3A 3WJAA 5DWQA 2G71A 1NHGA 3QA9A 4B31A 1XXLA 3GA7A 3IRVA 3QXXA 4UQOA 5H9VA 1NI3A 4ETMA 2REQB 4A6EA 4A23A 3T7AA 2EKZA 3SIXA 1IZ8A 2Q5JA 1GA4A 4RA9A 1YMQA 4KP7A 2WJWA 1KR5A 3RFVA 2QMUA 1U2PA 2QUHA 2XT6A 3A1FA 4F46A 1Z3IX 3R3ZA 4LSWA 4TYMA 4PR0A 4ANFA 2ID4A 3T41A 3MM4A 4UHCA 1MTOA 4C3UA 5C5IA 5IASA 3MTDA 5IXYA 4LJ6A 3IAM1 2FU5C 4C4TA 2ZBFA 1ZNZA 2R8ZA 2YW2A 5T3YA 1IY8A 5CT6A 3TG8A 1N8SA 4BP8A 1RAEA 2QTRA 3R6TA 2I7VA 4JUFA 4KXXA 2LCQA 1NWHA 4PLWA 2YHBA 1DIAA 1GUZA 2GB4A 2NVWA 2YCLA 2AYYA 3C43A 1F0YA 2HI0A 3GFRA 2ZAMA 2Q2WA 1XC7A 3IDZA 1SU8A 5EIOA 4ZDKA 2PUDA 2ASEA 5LXTA 3DF9A 2X42A 5HUQA 1WG8A 4FYIA 1A9ZA 4CGZA 2X5NA 1HE3A 2UYOA 5GVSA 5IXSA 4FFWA 1E3EA 3R8CA 4PEVA 3S8YA 5E3IA 3DL2A 4DCNA 1CJTC 4DRYA 5FTLA 3PIRA 3LT1A 3SMVA 2F2TA 1SVMA 5CP8A 2P1DA 1Z7GA 4N0DA 4M7OA 4PLZA 1VM6A 3AB7A 4Q18A 3TCKA 3WKAA 1U8AA 3A9WA 1FUKA 3NIWA 3PFHA 3V2IA 5LNK1 2ZLBA 4NV0A 2Z2IA 4P2GA 4GOKA 2Y1GA 2YWXA 4U2EA 4D98A 2AOTB 2GBFA 5F7JA 1XTTA 3LKBA 4GP7A 5TX7A 3HK2A 3MVEA 5AKIA 4N5NA 2Y93A 4PZZA 2ZB3A 2G07A 4H15A 4X60A 3U5ZB 5DZSA 3EFHA 1EVYA 1YJBA 4R9SA 3ZHCA 4R8LA 2Q9UA 5TF0A 3ESCA 5KDOA 1S2DA 1CEXA 3B1XA 1QV9A 2DEUA 3SAJA 4ENVA 4QJ4A 4MDEA 3ZJTA 3ZVLA 2ZULA 2MSWA 3GRVA 5HKAA 1RWVA 1HZJA 3IALA 3Q8XB 4ZO4A 4CU2A 3IKTA 3HU2A 4EI7A 2JD1A 2BM9A 2XAUA 2UUPA 1ZSNA 3G8DA 4KN5A 2FUG1 3BSSA 5G3YA 1SD2A 5L4SA 1XDBA 2H1WA 3EW7A 1NXTA 1CLUA 1N2HA 2I9PA 1OLXB 2GLTA 3AESB 2OEPA 4XB2A 3TNLA 3UWMA 2J9YB 1XCMA 4LZJA 4QDKA 3CZ4A 3VR0A 1QQ6A 1XDDA 4ZCSA 5FHQA 2PT6A 1T2NA 4F71A 3AVVA 4RUKA 2FMFA 1VSUA 1IXYA 3GIDA 4YUVA 1HNWB 3MWDB 4NBVA 1Y98A 3KALA 2MTBA 1IN7A 1BXRB 1Z17A 5F2EA 3HO1A 2I2WA 3Q3EA 1HOXA 4P5DA 1FJHA 4K28A 2FSPA 3R3XA 2MSKA 3B3JA 3PUYA 3Q11A 3T3EA 1QPZA 3LBYA 1FYEA 4X7BA 1H3EA 1SVIA 1ZPDA 1A7UA 3WK5A 4H7IA 2ODTX 1R2QA 1WABA 4BNXA 5F64A 3FFAA 1XVTA 1K66A 2EJVA 3WRYA 3PXGA 4QPJC 1TT5B 2Z58A 4B6JA 1ZM7A 2P9HA 3HBAA 3QX7A 4K9SA 5EQTA 5KC8A 3TLBA 5B30A 4BYGA 5FPKA 3UB2A 4XWYA 2R7KA 2YQZA 4KIGA 4EAQA 1J9EA 3L1VA 5JJLA 1BCRB 1T25A 4RQBA 2B4YA 3M4XA 4F91B 1YZQA 1IZ0A 3HWWA 4NYIQ 3RVDA 5GPBA 4AS1A 1OX4A 1SIUA 1WNFA 4YJ2F 1LJ8A 2UYYA 3LC2O 1EUQA 3AR3A 2QN8A 2P75A 3FAZA 4P35A 3AR2A 3FTPA 5A7HA 4D9JA 3TBHA 1ATIA 1U3TA 3NCTA 4AJKA 4Z49A 2QBYA 1G42A 4QUDA 1HQDA 4C1BA 1QQAA 1I3LA 3KOOA 1N0IA 1N6LA 3EDYA 4IUBS 3L07A 2X23A 1ZL2A 3C2QA 4GYKA 1DI0A 1ECCA 1WXQA 4ZVVA 3PJDA 3ZHOA 4B79A 2V7UA 3KEMA 5K0JA 1BKDR 3IILA 3IP3A 1L1RA 2VF7A 2CVHA 3B1YA 3LLMA 4TZTA 4HZGA 4JC4A 1P8JA 1RXCA 2JCBA 1C1XB 1JKJB 3EXAA 4RQUA 3NWEA 1C4KA 4RJKA 1PR1A 4ZYUA 4E13A 1DAFA 5KINB 3C7KA 2WM2A 3NBKA 2VAXA 2ZRQA 2VKQA 5DGXA 1P80A 3NNDA 1Q2XA 3HEAA 4JKYA 5D3MB 5F21A 3ACDA 2FPWA 4Q93A 3AVPA 1T6NA 2Z2KA 4BO1A 2OCKA 1G3UA 1YR2A 2ZS9A 2Q5CA 4RQTA 3T06B 4FONA 3NOQA 2GO7A 4BVEA 4PYKA 4A2PA 5J5AA 2FNAA 3OZWA 3ANXA 3GFSA 4C5AA 4EG3A 1YS6A 3W8EA 4MS4A 1ZM3A 1Y8RA 1N7IA 3FYCA 2AWOA 1M34E 1R8JA 4I8XA 3K2IA 5AWFC 2POCA 4G01B 3VRHA 5KNDA 3IA2A 3ZNPA 1UAAA 1R4AA 2NSDA 2Y2VA 2I4RA 1QWSA 2MWMA 4B3FX 3SD7A 2C5LA 2GPSA 3C39A 3C3BA 3TI9A 5JZOA 3KAPA 1C29B 1FFSA 4KU4A 4W9NC 4WGFA 1HQYE 1Y6GA 4J2OA 5KTRA 1ZA2A 2VF5X 2Y4NA 2ZTLA 4CM8B 3UK7A 1JA0A 2B25A 3W0LB 4WOKA 1YB5A 1UT6A 2QMZA 1ZRSA 4WXEA 5DNDA 4ITVA 5CNJA 4YP5A 3RCBA 4UCXA 3B7PA 1UWVA 1THTA 4KVFA 1ZR2A 1Y8CA 4LJSA 1KFEB 5I4CA 2JH8A 1X7XA 3GAFA 3UN1A 2XKKA 4JR1A 4BO2A 5H4GA 4FHFA 3GK3A 2H07A 5IK2A 3EFOB 4N4AA 4BFWA 4KAFA 3ZC3A 4N9WA 3OJEA 1WW3A 4MHSA 5LIPA 3O92A 4C7OA 4ARVA 4CNQA 1JEDA 5IRCD 1D9XA 1QAMA 1ZCZA 3KYIB 4JY7A 4TKMA 2VP2A 1P91A 3SVLA 3FDIA 1JN0A 5LYJA 1TRKA 1TUGA 3FWKA 5BQ3A 3I61A 1SPBS 1MVNA 3ZHVA 4BMPB 1AF4A 1X6VA 4UTPA 3P2YA 2Q0SA 3WKDA 1H1LA 4WNCA 2HMTA 3KLBA 2EZ4A 3OFNA 1FQKA 1RHKA 2O0HA 3GT7A 2AG8A 4WPGA 4NFLA 5KEIA 3TLGB 1GKKA 1FPMA 1Y4UA 2OCAA 2PS1A 3CGGA 3PQ7A 4LYYA 5KYUB 4C87A 3EZ7A 2J8ZA 2P7HA 1CUUA 1RZVA 2DUWA 1KJYA 4QAQA 3LK6A 5HCNA 4DA4A 3MINA 4OJYA 4YP0A 4GBED 2QX7A 4UUMA 3KTAA 1SUAA 5L3SB 3VU0A 5KX5A 3JQQA 3QITA 5ECDA 5JAQA 1EFHA 1P7WA 2JGRA 1RRGA 1Q0HA 3GZNB 1TJNA 3IUQA 4YP6A 1T34A 3NJ8A 3DZJA 1PV1A 3L0PA 3KYCA 3B7WA 1B3RA 2WF9A 4OHCA 1FDUA 1YDEA 1ADFA 5FNVF 1XJQA 2PS0A 2RHRA 3PGLA 3UEOA 1HOTA 5LP6C 1Y9DA 3RYFB 3EK2A 3AUYA 3K8QA 3MNFA 3ANTA 4TL6A 1TZKA 2UYHA 1KOFA 8MHTA 1Z4OA 2IEBA 3P4YA 3CS3A 2MINA 2JEZA 1XMQB 5FOQA 2VAPA 3RH0A 3OX1A 3IB3A 4Q7QA 2R8YA 3TL2A 3UUWA 5LWQA 4KQFA 2YS7A 1QH0A 2PD6A 4CM4A 3LXRA 1W5SA 3PNVA 4IDPA 3N6VA 3MRXA 1PYGA 2HAEA 4REQB 5K3EA 1V45E 2BRUC 2OHOA 3VPAA 5DBFA 3CY6A 4QEDA 3UWDA 5HPYB 2YR0A 4CM1A 4QM7A 1BA2A 3I5XA 4K8RB 3OQBA 4YAKA 2DBVO 3EW9A 3UOGA 3LQFA 4Z9YA 5HTKA 4WRRA 2DCMA 4DMRA 2NZUG 3UWKA 3TTWA 4EY7A 4Z5XA 5D01A 5JNSA 4E1VA 2PYZA 5CVCA 4UNIA 2LKCA 2PPLA 1JG3A 3VGPA 2QR2A 1KVRA 2YASA 1G3QA 2C5AA 3QMWA 4DLXA 3HP4A 2O8BA 2R2GA 3I1FA 2XQJA 3ROEA 2NVOA 1MP0A 2IYPA 1A76A 2REOA 4I4IA 5DV9A 5JCJD 2FLKA 2XQFA 5M7EA 1UMKA 1JPUA 4I36A 5AW9A 2B8EA 1JQBA 4FCCA 4RLQA 4E31A 4D3YA 2GRJA 1VE7A 1TCUA 2VQ6A 1SXGA 3CMCO 1IOWA 4OA8A 1SIOA 1AD2A 3AL2A 3U3KA 1GU0A 5ICCA 2AFIA 2FH5B 1P1HA 1SXJC 3OU6A 2ZE7A 4JR2A 1GTG1 5LVAA 4JC8A 2Y1EA 3BWYA 4EHFA 5LQSA 1W2HA 4PAGA 2O8NA 2QXTA 2HJSA 1C80A 2FSUA 3C7CB 3CSSA 1UKYA 2W98A 3L7BA 4QOEA 4WBSA 3L46A 4XIIA 5FUQA 1RXEA 4LI0A 4G4GA 4XDYA 3ADCA 4BMDA 1UC8A 2QL6A 3DYVA 1QCYA 4AECA 4E7OA 3R4VA 2ZVPX 4ZQCB 1ZK2A 5TPZD 3WFIA 1G6Q1 2W6PA 3DO5A 3DV9A 2UVPB 3HKCB 3OCZA 3S1LA 4MR8B 4JFAA 1PBTA 2JRCA 1Y3HA 4TMWA 4L15A 1VIMA 1DBIA 1JPVA 1KS2A 2QB5A 4A0HA 3KQKA 3KWMA 3GFFA 3OD5A 1S2IA 3IT1A 4ARSA 5IF3A 4E07A 3AL0C 2QQEA 2ECOA 1QQ7A 2X8JA 3ZE2B 4R01A 1I7PA 1U5AA 2CCJA 4KR3A 3PF8A 2F1HA 3OQIB 4AKTA 2IHTA 1KDRA 5FBQB 3A2MA 3PQ5A 5LP6F 10MHA 3EQ2A 2ORIA 4L08A 3TW6A 5ADVA 1V3VA 4H3KB 1Q6ZA 1U2RA 4JLKA 4JX8A 3JQEA 3RJMA 1JMVA 4PN7A 2HBYA 1FFAA 1ML3A 1FVHA 3TRIA 2F43B 3PGA1 5BN3B 4UBLA 4X92A 1O8BA 1KE1A 5LUAA 2NSJA 1FX0B 3RFCA 4JV5B 3CWQA 3ESBA 1DJMA 2H17A 3GY0A 3FWZA 1T1RA 1WMBA 4G5RA 2IGBA 2GEVA 3EYWA 2PQMA 4TRNA 3TQHA 5FADA 4HGZA 2XBLA 2QZPA 2HD4A 1XK7A 3AOEA 3HI6A 3IUMA 4H4DA 4QECA 4UM8B 5SYMA 5JCXA 3Q9UA 2DFNA 3DHWC 1VOTA 4P3NA 2XVAA 4QYMA 1A5SB 2O9JA 3DL7A 3K9HA 3PICA 3P71T 3FMGA 4ALJA 4CTNA 1VPDA 3UT5A 1SEPA 3OP4A 5KKNB 3GA0A 4P83A 3PRKE 1TW2A 4LJ7A 4LK2A 4ZANA 3AWDA 1LS6A 3IPLA 3X2FA