2VF4X

E. coli glucosamine-6-p synthase
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
359
structure length
359
Chain Sequence
GDKGIYRHYMQKEIYEQPNAIKNTLTGRISHGQVDLSELGPNADELLSKVEHIQILACGTSYNSGMVSRYWFESLAGIPCDVEIASEFRYRKSAVRRNSLMITLSQSGETADTLAGLRLSKELGYLGSLAICNVPGSSLVRESDLALMTNAGTEIGVASTKAFTTQLTVLLMLVAKLSRLKGLDASIEHDIVHGLQALPSRIEQMLSQDKRIEALAEDFSDKHHALFLGRGDQYPIALEGALKLKEISYIHAEAYAAGELKHGPLALIDADMPVIVVAPNNELLEKLKSNIEEVRARGGQLYVFADQDAGFVSSDNMHIIEMPHVEEVIAPIFYTVPLQLLAYHVALIKGTDVDQPRNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUCOSAMINE--FRUCTOSE-6-PHOSPHATE AMINOTRANSFERASE
publication title Ordering of C-Terminal Loop and Glutaminase Domains of Glucosamine-6-Phosphate Synthase Promotes Sugar Ring Opening and Formation of the Ammonia Channel.
pubmed doi rcsb
source organism Escherichia coli
total genus 123
structure length 359
sequence length 359
ec nomenclature ec 2.6.1.16: Glutamine--fructose-6-phosphate transaminase (isomerizing).
pdb deposition date 2007-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01380 SIS SIS domain
X PF13522 GATase_6 Glutamine amidotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 2vf4X01
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 2vf4X02
2PGIA 1JIQA 3CVJA 2XBLA 1T10A 4JI2B 2VF4X 3FXAA 5IT9A 3OOJA 2X3YA 5LMUB 4X62B 1X9HA 4KHPB 3G68A 2WU8A 5A2QA 1NRIA 4YY3B 1G98A 4JI5B 4DUYB 4JI1B 3M5PA 1JEOA 2CXQA 1J5EB 3IFSA 1HNZB 4NXNB 3NBUA 2A3NA 1B0ZA 1X94A 4U6NA 1XNRB 1DQRA 4JYAB 3FJ1A 5I01A 1J5XA 1IBLB 3ETNA 1IBKB 4JI6B 4B3SB 1HM5A 3I0ZA 3J7AC 2Q8NA 4JV5B 2YVAA 4X65B 3UJHA 2ZM6B 2CXNA 3FF1A 5FLXA 4DR4B 3TBFA 1C7QA 3Q7IA 1IATA 2V4MA 2F4VB 2XHZA 2CXUA 3BCHA 1N32B 2CXPA 2ZJ3A 1X9IA 4S12A 2PUWA 1MORA 2UUAB 2O2CA 1I94B 4LF7B 4LF8B 4K0KB 3C3JA 3J81A 4OX9B 2E5FA 2VQFB 2UUBB 4LF9B 1N8TA 1HR0B 1ZZGA 5IWAB 2HHHB 4DV6B 4DV5B 4X64B 4JI8B 4IVNA 2CB0A 1GZVA 3HBAA 2UXCB 3LJKA 1XTBA 2CXTA 1U0GA 5LMNB 1XMOB 1X92A 1N34B 2UUCB 2PUVA 4DUZB 4LF5B 4LFCB 3J80A 1XNQB 4B3MB 1M3SA 1NUHA 1IRIA 3JX9A 4DV1B 4NXMB 2DF8A 4B3TB 3QKIA 4B3RB 3T1HB 1VI6A 1VIVA 4LF4B 3KNZA 4TOIA 2VF5X 1FJGB 2J6HA 5LL6P 3OTOB 1HNWB 3TRJA 1U0EA 2VQEB 4GKJB 1N33B 1HNXB 1U0FA 1IBMB 2CXSA 3ODPA 2UXBB 4YHHB 4S1WA 1MOSA 4LF6B 4AMVA 1HOXA 1MOQA 2POCA 1XMQB 4DR1B 1VIMA 3JAMA 4DV0B 1JXAA 2UXDB 1N36B 2DECA 2I22A 2PUTA 4DR5B 4JI7B 3BJZA 4JI0B 2CXOA 4JI3B 1TZBA 2O2DA 2CXRA 4LZJA 4DV3B 4DV4B 1JLHA 1C7RA 2ZJ4A 3EUAA 1TK9A 4DV2B 3SHOA 1VI5A 3T1YB 4X66B 4DR7B 4DR6B 1GZDA 4LFAB 1TZCA 4DV7B 4DR3B 3PR3A 4LFBB 1WIWA 5BR8B 4AQYB 4GKKB 1KOJA 4EM6A 3FKJA 3HJBA 4DR2B 1Q50A 4M0DA 2I2WA 2E5LB 5BY2A 4JI4B 2UU9B 3Q88A 2AMLA 2CVPA
chains in the Genus database with same CATH superfamily
1IG3A 2I4NA 2H7VA 4ID3A 3MGKA 2XBUA 5JBIA 3O8BA 3EUEA 1IZ0A 5AHKA 1A9YA 4QLAA 2XBMA 1CJKC 4E09A 1JSLA 1ODJA 1JYEA 5I7VA 1QE5A 4EUSA 5I51A 1TAQA 2C9CA 1Y7IA 2DPHA 4MS3B 3CZRA 4TSKA 1IB0A 2OZKA 3CLRD 3Q2OA 1R9JA 2FA9A 2XEDA 1NN0A 3HZOA 5JTUA 3O4FA 1L3IA 3EZ2A 3TW8B 4A8JA 3EDQA 3H1FA 2WVJA 3NIGB 4C5CA 3F5DA 3EXEB 2VUUA 3ZW7A 3BILA 5FBHA 2B25A 2D62A 4PRYA 1T9KA 4II3A 4ZT7A 4X65B 3EOZA 5CA1A 4QBFA 2Q07A 1RQNA 2WOOA 3G59A 4MP6A 5FFFA 3UXEA 4EHDA 1MPTA 1WSDA 1DX9A 1RPNA 2MMGA 3OQ1A 5BSHA 2V8BA 4AX8A 1Z0SA 2JLCA 2C92A 3WQQA 4BE9A 4EUEA 5KDDA 1DQZA 2P3LA 2W2QA 2GVDC 5EWLA 2CXPA 4AT1A 1NM5C 4Q3NA 1F3LA 5K3OA 1IC6A 1ULHA 3GJSA 4JA2A 4UTZA 4DQ0A 3K4QA 3TOVA 4XWTA 4BZXA 1R4MB 4YCMA 3CKMA 3E9MA 4GVPA 3R6WA 5LNK6 1YA4A 3FOFC 4NCKA 3IUPA 1YJCA 1LKZA 4C01A 1T4MA 2ACWA 3JU3A 4KK4A 2V65A 1E9AA 1NVKA 3K9BA 3QBDA 5FP0A 3GLHB 4BVAA 4ALKA 1ZD5A 3E0QA 1AXEA 3UV6A 4BP3A 2BYTA 2ZBUA 4JBWA 1ISSA 5TMDA 3AEXA 1RD4A 5GONF 4DLYA 2P9YA 4A0HA 4XYEA 1DFGA 1Z39A 2WMOB 1REQB 4BX3A 1T5LA 2ZYHA 4Q1EA 1Z08A 3O31A 2M1ZA 2RCNA 3HA2A 4G01B 1KP3A 1QHGA 1KAMA 1Z2CA 3IIMA 3RFUA 3OEEA 2R1ZA 3PGVA 3QXCA 2EEZA 2D5AA 2JFGA 1Q11A 4RQAA 2TRSB 2V1XA 4RELA 4F4JA 1L0BA 1U3FA 2GSDA 4HKTA 1QB8A 2PFSA 3FX2A 3OTQA 5CCEA 1KDTA 3JD3A 1J9EA 4QFMA 1Q95A 2YW9A 5ILGA 3O1JC 4F7DA 4DGQA 5J43A 2XTMA 2O7SA 4YUZA 5EMHA 4N65A 2HWXA 2I8AA 4Y0NA 2GKOA 4LEIA 3V3TA 2QVBA 1TFRA 2DQYA 5A0VA 1NW9B 5LZ7A 3A6JA 4DJJA 2VRCD 2M9MA 2FWPA 4RXTA 5DLQC 3BT7A 4Q4HA 2W2OA 3BWVA 4DMKA 4EO4A 2OCIA 4QJ4A 5JVDB 5ALQA 1YC5A 4RHXA 4B33A 4EGJA 5CB0A 1K7CA 4E5KA 5EUBA 2TMDA 4PFKA 4EG7A 1LC0A 4UNNA 3RYIB 1OFGA 1K3TA 2B34A 2PVPA 3JQBA 5ADHA 5KNCD 1V8DA 2XMBA 3GOHA 5LQRA 1Z8FA 3PYMA 4RL4A 3LT4A 3JR3A 2RHWA 4LRUA 3V1UA 1QP0A 1G19A 3COJA 1AUXA 4CPDA 4GXTA 4D46A 2RHDA 1ARZA 3SJZA 5DV9A 4WT7A 1JT9A 4OGFA 2NTJA 1AOXA 2EF1A 3LCVB 3C4VA 1XEXB 4MS4B 4U2CA 4PXYA 1IEVA 3G89A 2O19A 1JSCA 3O8NA 3TBHA 5C5EA 2C3UA 5ILOA 1IHYA 4KFRA 1UBUS 2ARKA 2HTEA 4HLUA 5ANRB 4CIBA 3GO4A 2Y3IA 1NVXQ 5EVJA 3G9XA 4YUYA 1EUCA 1QFXA 5C4GB 1L7RA 1ZO8A 5H5JA 3IAS6 5AI8A 4E5VA 8ADHA 3RK0A 3SGLA 1EFRA 4BAGA 1LI7A 3TE7A 3KQOA 3V8VA 4KLZA 4EBBA 1C9EA 4LWOA 2OM6A 1V45E 2QRVA 1Y33E 5C31A 1DPFA 5JNRA 3E70C 3L7NA 4P4LA 4PZLA 2DUWA 3IT0A 3RJZA 1U9JA 4K2HA 2JI4A 4MW9A 4XCXA 5EXTA 1QTIA 1LEHA 10MHA 1HURA 4Q7EA 1SRRA 1GPH1 2ZJ2A 2HK6A 4R2JA 3BD9A 1QVAA 3NC0C 3OF5A 1XWFA 1GVHA 1SVNA 1QMPA 2EAUA 5AI0A 4KBYA 3RQIA 2EZUA 1JZSA 2L2QA 4C7OB 1PVDA 3BAFA 3B51X 3KSMA 5CK5A 5SY4A 2IHTA 2HB6A 3RABA 3CR8A 1IK6A 1FSPA 3TCXB 2HNAA 4JSYA 1NYQA 4U39A 4IIDA 1KZGB 1KHHA 1XVAA 4PCAA 3WZ2A 1AHNA 1WF3A 1FXSA 1VPVA 2W6ID 3TK1A 4WEOA 4GKBA 1N3LA 4DMFA 3FFAA 3OLYA 1XDZA 4PZEA 1ZVQA 2VHQA 2FG7C 4LVUA 4LKOA 5DHAA 4AY5A 3JPWA 3GRCA 4FE3A 1RWQA 3JATB 1ANKA 3K15A 2WF9A 2VT6A 2FPWA 3T5GA 4F4FA 3KT6A 1XLTC 2P4UA 4BZWA 4EFNA 2WHQA 3MXOA 4E5NA 1H2HA 1XRSB 3FFTA 3QKRB 4ID9A 3BYZA 4J0FA 4MIEA 1C1YA 4P4SA 4DM4A 2IS6A 2DFPA 2QHXA 1NVBA 1P2BA 2HMSA 2XCIA 2DQZA 5AKYA 3ZUPA 1DKUA 1U3VA 4JP1A 1EFPA 1NF2A 4KDCA 4S2UA 4DPKA 2ZE8A 1PNVA 2FUG1 2OKGA 3AR9A 3NYQA 4JSTA 4RCVA 4Z4EA 4L02A 2E85A 5IS2A 3DBHA 2HF2A 3Q1LA 1LPBB 1W75A 2EW2A 1TTTA 3U0BA 2D59A 4FMBB 5I8WA 2XD9A 5GP1A 3IUJA 2IKSA 2CCGA 1QGAA 2BGJA 2QRHA 1KR2A 2P6PA 3BMQB 3E3OA 3MELA 4PSUA 4O2BF 4YJDA 4D5GA 1XHLA 4YV2A 1T2CA 4TXMA 5E1BA 2VXCA 3NAZA 1W19A 2HSZA 3MRVA 4ZC1A 5ALSA 3U3JA 3PGJA 1QC5B 2I22A 3PV0A 2AF3C 4KP7A 4EFDA 1XTPA 1OXTA 4Q1BA 2CJXA 3F5FA 1NDHA 4ISBA 4DCSA 1NXQA 2JEOA 4HS4A 1KFBB 3N0WA 5BNZA 3EG9A 4IDCA 5TQ0A 4ZK6A 5C80A 2C7PA 2HLNA 3BF7A 5E9JA 1WU8A 3BH0A 4O4IB 5JD3A 2ADFA 5CFLA 2PL1A 1J9GA 2YWDA 2NP6A 2NOAA 1XZDA 1RYDA 3LPLA 4LPKA 3G2PA 1IPFA 2ADOA 4TS9A 4AUKA 1K98A 3EODA 4AUNA 4P86A 1WBDA 3D7MA 3ENVA 1QX3A 2FE1A 1ZI8A 2DHQA 3I6YA 5EZYA 1YHNA 2QUZA 2ZQ5A 4JJKA 5L3ZA 2HV8A 1D3AA 4L0CA 1VRWA 2VJOA 1KY5A 1NLUA 2RHGB 1W85B 4W9NA 1XDSA 1QQTA 2O4CA 2OO5A 2QTNA 2VJCA 1LI4A 3MTQA 4PGFA 3VR6D 5IYZA 5CCBA 1N1DA 2HMAA 1OAOA 4L6CA 3UXHA 3CEHA 2VAPA 3FPHA 4N7JA 4WBNA 1VCMA 4GAEA 4B45A 1YA6A 4YCLA 2FFRA 1PZGA 4PZDA 4CKYA 2ZCVA 4QXPA 3A6ZA 3FPAA 3A7DA 3STWA 3DAOA 5ED4A 4JJEA 5JS7A 2XSZA 3T8YA 5AM5A 4GMGA 1HNZB 1TVEA 4E5YA 3L1IA 3KYDA 1X14A 2JHGA 4EGSA 2OV2A 2XCRB 4XVRA 4L22A 2BI8A 3BWEA 2EYQA 2Y0EA 1II8A 1Z2AA 4JI6B 4EYEA 2JBAA 1A50B 3OETA 4YLEA 1XJ0A 4DLRA 1M74A 3D3WB 1H69A 1AD2A 1RM0A 3KYJB 3T7JA 4A26A 3VNBA 1QIGA 5E95A 3K7EA 4U02A 4J1QA 4PV7A 5AJUA 4TGLA 1ZMTA 3RSQA 3VHLB 2J9RA 2G09A 2PGAA 3EGXA 3IPCA 5KKNB 3WBBA 1QVWA 4LISA 2V7GA 4HVCA 3G82C 1JEDA 1RLMA 2J8ZA 4BIMA 4PG8A 3RAFC 1P17A 2QNRA 4FEAA 4MV9A 1XQWA 5GWXA 1CF2O 5LU9A 4U8HA 1SKYE 5CVUA 1UMCB 2R6JA 2WB2A 3HVJA 3MMNA 4Q1VA 4U6QA 5EJIA 1IQUA 3GJ6A 3R5SA 4D3FA 3F97A 1C2TA 3E7DA 5JRZA 2NSJA 3ZE7A 1RHJA 4L7VA 2AZTA 1W2GA 2Y1LA 2YC2C 4Y8VA 5LPNA 1VTKA 4TQAA 1KO1A 2FP4A 1Q16A 1T3HA 3Q7QA 2A1TR 1ZY2A 1XMOB 4TL6A 4S1NA 4UXIA 3L7IA 3ZI0A 1DC8A 1DBVO 1Y1RA 4QL3A 4UPDA 4RQUA 3WLFA 3HA3A 3IV7A 4C7XA 4L75A 5FBWB 4L8LA 4L16A 1U28C 1U2GA 5JROA 3DMDA 4IIHA 2ZIXB 2O8DA 1U8FO 3CIFA 4NBWA 1SHLA 5D85A 1ZRHA 4BVFA 1A5SB 5DLEA 2CDAA 1I2ZA 2PSHA 3H4MA 2Z5GA 1ZOPA 1Z33A 2FJUA 5DBIA 3COPA 2J7PD 3W2IA 1HF3A 2R6GA 4CM4A 1R4ZA 4YRNA 5DX1A 2IGTA 4P31A 3B9PA 1D6SA 4WLUA 5DFAA 5TE9A 1X8JA 1IWPB 1OXUA 1PJSA 3GLTA 4A6EA 1AN9A 4GPAA 3U0VA 1Y3BE 3L18A 1OXSC 3WB9A 1ZW6A 2HMUA 4R2KA 3S5UA 4DIUA 5FNZA 2O2GA 4PX3A 1NATA 4AYWA 1M1YB 3WL3A 1EFAA 5A5GA 1M75A 3L9XA 5KTOA 2X5NA 1TTQB 1K2VN 1G21E 5EOVA 3PITA 4C22A 3EMDA 4F97A 4RVSA 3VH3A 2R68A 5H83A 3FIJA 2JAXA 3ZQKA 4NYMQ 1O3YA 2Q8QA 3IKMB 8ABPA 2O3SA 4D8VA 3W8RA 4RHEA 3OPVA 4ZP1A 2G82A 1TM5E 4RVGA 1PEYA 5HIIA 1P77A 1SCBA 4TKVA 5JG7A 5AUPB 1ISMA 3MN1A 3C97A 1J7JA 1UR5A 2RH4A 4KWHA 3EBPA 2QTHA 2Z30A 1MO3A 2QTBA 2F4NA 1Y9AA 3OT1B 4HWSA 1WXWA 4EGFA 3DW3X 4LC9A 3VYTB 3HYSA 1PFKA 2JHCA 2PQ2A 4UUQA 1SOMA 3LWBA 3HYRA 3OJLA 3AYZB 3KZXA 2F8MA 4NC9A 3TIXB 3T9BA 5KREA 2RSLA 3HBMA 4MWBA 3K0EA 2R8ZA 2WWGA 3TW6A 4EA8A 2M98A 4UTPA 1KGDA 1TJ5A 2QI9C 3OTWA 4DVJA 5K1ZA 4OHCA 2BF4A 3UBTA 4IO1A 2FQWA 5DLDA 2WIKA 3QOFA 1M6YA 1X1CA 1HE2A 1GPNA 2JVKA 3HMKA 2P9JA 2ZRCA 5FORA 3WGTA 4U3JA 5CA1F 4G25A 4KWIA 3O7WA 4RMIA 1QH8B 5HIJA 1FZQA 1I3MA 1NQTA 3D3JA 1N7HA 4IOMA 2QYHA 4E11A 4NNJA 4Q7KA 1DBWA 1GLNA 2OPBA 5AW3A 4BY9E 5DI3A 4OQNA 2RAUA 2WSLA 2FPIB 1U0NA 1G2PA 4K88A 1UFQA 1VBNA 1IOLA 2OGSA 4YCDA 4BNFA 3TQRA 1QF9A 2GZSA 3GEGA 3C3JA 2VBFA 2ZRBA 4GP6A 4PSAA 4BLVA 5K8VA 2YZMA 5CITA 4NDNE 2RH9B 4LOIA 2V03A 5L7TA 5KYXB 3E22A 1DRKA 2QMUA 3Q9LA 3ZWBA 2ZI5A 2PUDA 1GQ2A 1KPGA 2X1MA 2J0VA 3ZNQA 4XM1A 1LDEA 1DI0A 2HA6A 3ABZA 3AV0B 3MCAA 3MERA 3OWOA 4MR9A 1MHPA 3W3AH 1VSBA 3D1VA 2D1YA 3URKA 2P0AA 3ZJ4A 1NI5A 3C48A 3IO5A 1ZIPA 1LQ2A 1U8ZA 2CF6A 4CEIA 1VL6A 4BL5A 1ZVMA 4EAQA 4FZJA 1Q6YA 3LC1O 4OA5A 1VFPA 1M6HA 2BI4A 2PA3A 4Y6LA 3RT1A 3UWKA 1JTFA 4GPIB 4BNLA 2WRZA 4PYJA 3VX3A 2ZQZA 4YDSA 3OQMA 3SYLA 1T3GA 3ASZA 4QEKA 1NJGA 2ZKLA 3D9QX 5BWNA 4LXUA 2XMPA 3EVNA 2WKSA 4C7BA 3OLVA 3JQ9A 4FJ2A 4QQFA 5GZ6A 3WIOA 2AG6A 4GT1A 4ZOCA 2JCYA 1GITA 3OBBA 4JT9A 2VDJA 3RGGA 5KVSA 3C3BA 3WYGA 4IJKA 1P2VA 4H31A 2K2WA 2YDXA 3C3YA 4OLHA 3HN6A 3L6BA 3U7HB 1N8SA 4YGYA 3BWCA 1N5IA 2YN2A 2AC2A 1TUEA 3IEXA 3NBFA 1EFCA 2BEUA 3PFCA 4Q18A 4IGAA 5FULA 1GNQA 1PI3A 4LY3A 1YGYA 1JPNA 4YRZA 1CJMA 1QR2A 1D2CA 1BRMA 4KXQA 4PEVA 1XCJA 1KMQA 1PDOA 2ENUA 3BB1A 4REQA 4AJIA 3BKWA 4FW8A 1ONNA 3LVBA 2AXNA 3HNRA 3R8XA 3VC1A 1Z4MA 4DCPA 3IKTA 1M34A 1RYEA 1TVMA 4NDZA 4C2BA 1PQYA 4JMPA 3T4EA 3O8CA 4BQIA 1ZD4A 4ZQBA 4R1PA 2I1WA 4KIFA 5EXEA 4JX9A 2HREA 1RYZA 4F1JA 2NPOA 3DQPA 3MJRA 2GUWA 3V1LA 5ITZA 1FK8A 2L82A 3LX6A 2A5YB 3KUUA 4P5PA 4YCNA 2CD7A 1O87A 5LBIA 4G3XA 4OJMX 5JXJA 1TEHA 2Y99A 5EHGA 4FBLA 3QE2A 1KPHA 5HX7A 3P2JA 2ST1A 4UBKA 3WQBA 3N2YA 4JWKA 1WQ1R 4NI5A 3UF0A 2AK3A 2XWQA 2C5FA 2Q29A 3THXA 4AJNA 2O6HA 5ERYA 3HP1A 3K1AA 3WX0A 2IITA 1PFUA 4TZ0A 3T7IA 1W4AA 2PSSA 2ETVA 4FS3A 4GRIA 3NHSA 1VXOA 1NVVQ 1NN3A 3LHIA 4O1HA 4BMDA 1DFIA 4N7MA 5HKBA 1XNGA 1R50A 2A2ZA 3WGUA 1YJBA 5YASA 3AFGA 4C88A 2AXEA 1QCCA 5AXCA 3BHNA 3LOUA 1R74A 4YV0A 4B84A 2C2GA 1B74A 2QPTA 2IIQA 3IB6A 1W36C 3CKKA 1NUSA 2J3HA 5D8DA 5JDCA 5C51B 5D1HA 5BSMA 1UMBA 2DBZA 4GM4A 2QW0X 4DCMA 1PR5A 4ND2A 1RR6A 3QE3A 4XRGA 1E3MA 3EZGA 1OH5A 1I5EA 4DCTA 3QZUA 4J4HA 4G07A 1TK2A 3CZMA 3RLFA 3TIIA 5CYGA 3C1AA 5LCXA 2H4JA 4U5XA 4WCVA 4YUAA 4ZHSA 4D8WA 1OCEA 1NPTO 2OQVA 1IM2A 4C06A 4UD6A 1IZYA 3FYHA 2YWHA 1AUVA 1QV9A 4X5OA 1UDXA 3U61B 4LJRA 3A9RA 3NUGA 3AXSA 3OJFA 3HUTA 2DJIA 1EWVA 1GQQA 1QFMA 2JB9A 2QYSA 4X63A 4MKGA 1Z4JA 5EIBD 1J97A 3H2KA 3O9ZA 3A9WA 4PU0A 1Y42X 2P1DA 2H2HA 3JX9A 4RVCA 4J91A 3PGA1 2JFUA 2XE4A 2HX1A 2VCYA 2C8JA 1MB3A 4YPVA 1IH8A 1V3TA 4NJMB 1YJ5A 2GMWA 5AUQA 2ZRHA 4EELA 5AVQA 1FRNA 4M99A 2GYVA 2WYUA 3B2EA 1U99A 3RVQA 4DIFA 3UCEA 3TWOA 1RXVA 3QHPA 4G9EA 4IG4A 5GJVC 1UODA 3P9QA 3CRQA 3IS3A 4N0DA 4P2GA 4RENA 4DE5A 3UW3A 4IFEA 1UKVY 3G88A 4PYNA 3I5MA 1NUUA 4JB8A 1QG4A 2JF0A 4D8YA 1FYXA 1GM5A 1FSGA 4ZT2A 2VXYA 1CZOA 2VDRB 5G0SA 5T57A 3P9IA 3JAMA 1X1SA 4PGHA 4IIJA 4XQCA 1DTWA 1NBMD 2C4WA 1PWHA 5GZ1A 4N41A 1TI7A 3CUUA 3IOMA 2GESA 2JA1A 2P40A 3LPCA 3KVRA 4XXHA 4BV9A 2IIPA 4K9PA 2JRCA 1ODLA 2VNSA 2EX1A 3WLOA 4CIXA 5BSFA 1QHFA 1UKEA 5T8KC 5C2JB 1L5KA 2QN7A 4UUBA 4BGVA 1F0PA 4JLSA 3CZQA 2PE5A 3I52A 2UZ0A 5HS6A 1QRTA 4OMCA 4JJ6A 5ALKA 3E1GA 4WOJA 2PQ0A 4ER5A 4W7IA 5LZ8A 4UVGA 1WCIB 1YU9A 4JLWA 2PKQO 1C81A 2FLWA 3EY4A 4FZRA 4XOIA 2BJWA 3I4LA 5EZYF 1F8XA 4RTNA 2ZATA 2ANBA 1XD9A 2DPXA 2WSMA 3IODA 4ME6A 1CJSA 1P4HA 1QKIA 5A4IS 3KJQA 4MQBA 1YBFA 2ALJA 3UGTA 2DERA 5IYZF 3KQNA 1U3UA 2Z3ZA 1P9OA 3PJFA 3AHDA 3Q8LA 2O5EA 1YH3A 4A4DA 2HMWA 2KW5A 1FP2A 1U2ZA 1RWVA 3AJ8A 4Y7DA 1S1CA 2H0AA 4NFSA 2X0IA 4E5DA 5BWMA 2VKTA 1BHQ1 1R6DA 3KPJA 2E3JA 2OCPA 1TCUA 4RY2A 3A9SA 5KYWB 1H2FA 1QTRA 1DIAA 1MBZA 1PP4A 2GCOB 3HKEA 4P84A 4U6NA 3SC2A 5TMPA 1Z83A 2WTNA 3FJ1A 3PXDA 5G2OA 4B3DA 2FRXA 2I2DA 4G56A 3N6XA 5A3VA 4B75A 3BFJA 2WAYA 3D6FA 3P45A 4IIFA 7AT1A 3CISA 1SUWA 3I0ZA 1HDIA 1LSOA 3L07A 1P5ZB 2ZAMA 2CT8A 3N7AA 2XZPA 1P39A 3EZXA 4OI2A 5GMOA 1CS4C 4DL9A 2CHGA 3OPYA 4ZU6X 4M36A 3UNXA 1XTIA 4G8JA 1GGJA 3SC4A 2PV0A 3DYBA 2IRWA 3EEOA 1WUJS 2FF7A 5A9TA 4RW0A 3SSNA 1XPUA 5CLIA 1JKIA 5KOHA 1N2BA 4KLAA 4UVDA 3VO8A 5MGBA 1IN7A 3SDSA 1N6IA 5JNVA 1EXVA 3UMJA 5KC8A 3PQCA 1FRVA 1GN8A 1TM3E 5EZ6B 3OM9A 1UC5B 3B7WA 5B3AA 4C0WA 2Z95A 1R27A 1Y7PA 1DWUA 1QCDA 3M33A 3QWFA 4EMUA 4KQGA 3A4TA 5B55A 3U4CA 2CNWD 2COKA 3W5DA 4E94A 3BB3A 4Y1RA 4KK3A 4KE7A 1ZINA 3HZZA 4IDBA 2O5VA 3ND9A 4GWGA 1LDMA 2AJDA 2IYPA 3GCZA 1AUQA 1NXPA 4G1CA 2X5KO 3SVTA 4KLRA 5BWLA 3DEJA 5TIIA 1DJMA 5E1DA 2IW3A 1E0SA 4P58A 2FRDC 2WF5A 3AUTA 5IULC 4TOIA 3ESCA 2ZYSA 2BFEA 5AH0A 1CKEA 2H1RA 4R1LA 3ZYZA 1A4RA 3GZJA 1C3EA 4B1FA 3FTQA 4IKOA 3KFXA 5EQTA 3SR3A 3I9JA 2DFKB 4ZZIA 3MD9A 4KZKA 4S1VA 3W05A 4B2PA 4J76A 1AK2A 4C4TA 2ZAGA 2GN1A 4LYHA 4LF6B 1FZTA 2VYQA 2JJ1A 3EWAA 3QLUA 4B5LA 4BFZA 4CG0A 2GEJA 4RTMA 5IJZA 5ENZA 4YP1A 5EMMA 1G9TA 3A8TA 3LK7A 3I5YA 1VLLA 4ZAFA 4BJ6A 4MYCA 4A0QA 1FSZA 4UQOA 2Y8EA 4UMDA 1ZN8A 1T6NA 3SYNA 4AULA 4BEVA 4C7VA 2X15A 4HVTA 4ZCIA 2OYSA 1SBNE 4DWJA 4XB1A 2OECA 1KMNA 4JODA 5EJ6A 3BB4A 2ZJ0A 3IBCA 4RJJA 4RWEA 5TB5A 1J99A 4GH5A 3H2YA 4UEKA 3DM5A 4D02A 1EFDN 4DOMA 1A9OA 2WJ4A 5G0TA 1PR9A 1QUFA 2FMHA 1TO2E 1JFFA 1V6AA 4AX4A 4B87A 5MHTA 1SR8A 4ICIA 1CRWG 1O0SA 1XJQA 5FRDA 1CW2B 1KK1A 4ZVLA 1THTA 3WYBA 5IJ0A 3TMKA 1KIAA 1OWLA 1T3TA 2DLNA 1Y3AA 4RSHA 2V74B 3STVA 4OTZA 1ML4A 5J58A 2AL7A 3MAAC 3MWFA 1ZMXA 1N5DA 1YZLA 2C29D 1UMDB 3T4UA 2VDLB 4JU8A 3DV0A 2ZIWB 4MKXA 1CZKA 1UAYA 1EGQA 1XZHA 3TQCA 3YASA 4HGRA 1KQ3A 3ID6C 2XCOA 2PR2A 1HO3A 4X6YA 2I4RA 3PA8A 3EPKA 3AVOA 4LZNA 2OGWA 3KUDA 3TG8A 1OYOA 1R9NA 2I1QA 4I8IA 4ND8B 1E8MA 3TG2A 2PZMA 1PUIA 2A92A 2HPVA 1UAAA 1Z22A 3ZZMA 3A2MA 2OV4A 2VYFA 3STHA 3EXFA 3R9KA 2JLVA 1YS4A 3E3NA 1Y3FE 1E5TA 2I66A 2W6JA 3RFFA 4HT3B 1JDJA 3WRYA 1PT9A 4DSOA 3DF9A 1GR0A 1TF2A 4OQYA 1L5HB 4S1PA 2HFKA 3ST7A 4KE8A 3ZEIA 1NOIA 1BX1A 1QV6A 4HYTA 2G8LA 3HKBB 1OFTA 4F6LA 1I80A 4G5RA 2WIJA 2PGLA 2CB9A 4LHSA 4FMCF 4QPPA 3W3AD 2OP1A 3LXRA 3FYUC 2OCYC 3UK1A 1JJAA 2B6NA 2OXRA 1XSEA 1HA3A 3O4RA 4D3XA 4AY4A 2CLSA 2BR3A 5DWDA 3D5EA 3NHRA 3OWHA 4X64B 4Z8YA 4DW8A 2MSKA 2G77B 2ZRAA 5GAJA 1BXKA 4KPFC 1OIVA 1G7CA 4HDKB 3B85A 3NFYA 4IIVA 1C0LA 3THSA 3HHEA 2J4CA 2LCFA 1N5LA 3G13A 2EVWX 3KEOA 3SBXA 2DLDA 4N8SA 2A7XA 2O52A 5LOVA 1JZQA 3WA7A 3BERA 1B1AA 2HBYA 1VIYA 2C2MA 2EXXA 3TM5A 1UCFA 2Q0HA 5KHLB 1OY1A 2QE7D 2WIDA 3NIBA 4DC9A 3M34A 1RJEA 5FUQA 1VIVA 3BEOA 3VTAA 4FYJA 2VF5X 1XDDA 2NU9B 1AS0A 1UC8A 3A7EA 4CIWA 3VHRA 3OKPA 4JFRA 3F5SA 3INYA 2FJ0A 3WNQA 1GU0A 3WIVA 1QFZA 4UPEA 3HZRA 4L5AA 3S1AA 3ED1A 4ARCA 1T36A 3MTJA 4U4AA 2VATA 3EA0A 4FN4A 1LQTA 3F7OA 4CEJA 4C4AA 1HG1A 2Z4SA 4B3BA 2ZR0A 5EJ9A 4ZARA 1GPDG 1YKSA 3O8RA 4PR0A 3OOEA 3TX2A 3UK2A 1A2OA 3ZVMA 2G4LA 4PIVA 4AURA 2X58A 4RCYA 1ADJA 2P2ZA 2ZSHA 1J49A 4HFRA 4RD2A 1SC4A 2ZTMA 2R62A 4ND4A 1T2FA 3ETJA 2EYUA 2CXOA 2IWHA 2PUAA 1L3CA 1RXEA 2O2DA 3QOWA 5K3SA 3GGDA 3UT0A 1MGOA 5KWSA 1I13A 2H5JA 1WZIA 2HF7A 1MVOA 1SNYA 2Q6VA 2P4SA 3CR3C 2PMKA 2IIBA 4P7BA 2SHKA 3WMWA 1K5DA 3PC6A 2O1EA 3IMGA 2UYHA 1C3JA 2XHEA 4JJ8A 4DDUA 2YY6A 1GVNB 1NR1A 2ATEA 2HCTA 2XUZA 4IYRA 4UASA 2FN9A 4D4MA 5F3WB 2ZTLA 1E6WA 1FSSA 1EK2A 2A3RA 1QRSA 4HWGA 2Z2YA 3GLUA 4FYPA 3G2IA 4B6PA 1Z75A 3C1TA 5DLYA 5B3KA 1WB9A 5CLJA 2P6RA 2QTVB 4HY3A 5ITVA 5K99A 3EGDA 1PFQA 3ZCXA 2PWAA 1I6WA 1VIDA 1XYVA 3DOIA 1VJGA 2WYVA 4JVLA 2PV7A 3ZYCA 2DETA 1AGPA 2QVZX 4KHPB 4KNWA 2MTBA 4HBGA 1K27A 3IQWA 5JWHA 3UIEA 3CPEA 4CFYA 1WO8A 1TEVA 1S3SA 5KNCA 3UT6A 2BTQB 3K2EA 3KOZA 4OAPA 1GQFA 2GARA 2WWHA 4YMLA 4ZI7A 2QIOA 3JQQA 1U9CA 5F5LA 1XTUA 3TS1A 1KS9A 3TSWA 4B9EA 1WUKS 5JT1A 2GBLA 3IL2A 4EFKA 3VDXA 1LQUA 2B4YA 2PA0A 4X6XA 3I5UA 1Y5LA 1AF4A 2QN6A 3K2QA 3LKVA 5GJCA 2OGUA 2EC5A 3UH0A 5GVSA 5J3JA 1GNLA 4UC0A 5E3HA 3TSCA 3GR6A 2FUEA 3BMCB 3DAHA 5IJ9B 4CGZA 4Y30A 2W70A 2GPSA 4ZDKA 3ZKWA 1GQRA 3QFSA 1RM3A 1I0IA 3I4CA 1MC5A 4C3OB 2OCXA 1KERA 1JA9A 5KQMA 5FI1B 4II2A 2R87A 3A3YA 4WK6A 1LNZA 1UFOA 2Y27A 4HZGA 5E7QA 1UPXA 3SLKA 3GBVA 1MAVA 3O38A 4NMWA 3MOGA 2V1UA 1AIPA 4U00A 5JAIA 1WXEA 4JC8A 4FGJA 2LW7A 3IDQA 4EUFA 1EM8B 3ZV6A 4BNKA 4YUXA 3S40A 3JWHA 4MUMA 2MSEB 2NU8B 2O8BA 4MVYA 4BLOA 1YB1A 2OK7A 5DYIA 1L4MA 1XZBA 4WOBA 5EE3A 3O3NB 5FBKA 4J0CA 1C9JA 1C3VA 1E1QD 1JN0A 2PWYA 2RGNA 5ALFA 1M1NB 5DRYA 1XDGA 3V97A 2R85A 2XY4A 2BHLA 1NN1A 1ZA2A 1US8A 1KP9A 1HSZA 2YNMC 1I51A 3OESA 3GNTA 4HB4A 3IQEA 4JIGA 4QGSA 2HU7A 3LUAA 2ZE5A 4AN1A 1Z68A 4RAOA 3ODPA 3O03A 1HLDA 1U2TA 4EARA 3CV3A 1Y4AE 4OBBA 4DMRA 1IN5A 2O05A 2BUCA 3QVMA 1KORA 1WHSB 3ZGNA 2B35A 1KEVA 4A8JC 3ITKA 4OHWA 3PVSA 4XPZA 1RRCA 1E1CA 4HYQA 4PLCA 2YV2A 3QLJA 3EGOA 4IIJF 4FZVA 4LS3A 4P4UA 4QDJA 2PUHA 2ZB7A 3CT4A 4JL5A 4TYWA 2XCQA 1E7SA 4JS0A 3FPGA 3OQVA 3PEYA 5KNLA 1D1PA 1TU3A 1VGRA 1I4WA 3HPQA 1TQ6A 3QWIA 4O2AB 3NOVA 4RD4A 3LPAA 3O1IC 2V0GA 2B4QA 4LGYA 4JZKA 4CF4A 1BROA 5EJ5A 1I5OA 1GGFA 4M8KA 4MJLA 2D2EA 3NTUA 2DULA 1Y81A 4PLPA 3DE7X 1YI8A 2OWEA 1R4AA 1U9IA 2O8FA 2I3ZA 4B17A 5AESA 3NKVA 1SFRA 5AJZA 1W88A 2QTWB 2VO1A 1AUOA 2G4CA 2XVAA 3AHHA 3HBLA 3KTAB 4BUCA 1Z2DA 2QL9A 1XR3A 3GPBA 1QIMA 1SULA 2CFOA 3PRHA 4BMOB 2O8EA 5AMXA 4FVTA 5DHSA 3QX3A 1QGYA 2BOVA 3ER6A 4JI4B 4OB8A 4X20A 3KVVA 4A2PA 1RTKA 3LY5A 3ROKA 1T0HB 2G6TA 2W83A 4REOA 3VSDA 4XFDA 3ZDRA 3L2OB 4RVUA 1SBQA 2J07A 1Z8NA 3JSAA 1QZXA 1EFVA 2C2WA 3DEFA 3OX2A 3TLCA 4X8LA 5CXUA 1COZA 1OASA 1O03A 3EVTA 4K6GA 5HBGA 1QMGA 1NVDA 1WY7A 3A6LA 3O5AA 2QS9A 4LMBA 4V0OA 3VPGA 3U26A 2NXNA 5TMBA 2XX3A 4DPMA 4WXEA 4R1MA 1J39A 2HBQA 4EL0A 2Y1DA 3AF3A 4CTJA 4LRTB 1QKKA 2YCLA 5DTMA 1WABA 1DKQA 3KUXA 2CFTA 1DKPA 3FOWA 2D7CA 1N0UA 4KV9A 4YREA 3DVRX 1S2GA 4EUNA 1XUOA 3E23A 1RPTA 4W6QA 2WWTA 3MMZA 1B26A 3ED5A 3X1XA 1HT1E 1I3OA 3QVOA 1NXXA 2G28A 1PWXA 1JV2B 1KZ6A 1RLUA 3GD5A 4MW6A 5LP1A 2IHJA 2P65A 2DR0A 2XPCA 5E3JA 3UKJA 3QPVA 1BZYA 4CLRB 2NO1A 4DTIA 2LNDA 3RTBA 1KTIA 2FZ4A 4EG1A 4KO4S 3PQ5A 2PH1A 3M3PA 4CG3A 1Z5GA 3KP1A 4NG5A 1KDYA 4KIWA 3ZX4A 3KETA 3DBLB 1XAJA 3GCWA 2WJHA 1OC2A 4ZCMA 2EV9A 3OE7D 4L5BA 3HCFA 1RC1A 1Z2PX 4LWQA 5FF9A 3M3DA 4KW7A 2AK2A 4TLEA 2Y1KA 3TLMA 3VPHA 2QJOA 4DT1A 3HSKA 4JSRA 1C4KA 4MWDA 4TVOA 1PIWA 5DCYA 1F6DA 1KAHA 3PUKA 3QU2A 4LJ9A 2GCGA 2X6TA 3VV2A 4BCCA 4UM9B 3RRZA 1XQ1A 2PNFA 2ZRKA 2GZDA 3B6JA 3HCDA 3LBAA 1I5RA 3ONNA 1H2AS 3MGGA 1EVEA 3OOWA 4EYOA 1TAGA 4MDEA 4D25A 2ZE7A 2ZCUA 4HLUC 1BW9B 1P1CA 3JQPA 4RVFA 5I6DA 4GMHA 4PQFA 1Y8RA 4CL8A 2X5OA 3RU3A 1RAHA 5BN4B 2QM3A 2QUHA 2HJWA 3CX7A 1I0LA 2QUBA 4MOWA 1RKBA 2WJ3A 1CP3A 4OYHA 4OHZA 2ISSD 2GF0A 421PA 2NSLA 3K16A 3HEAA 3KIPA 2G36A 5ENDA 1T5OA 3H0KA 2DUJA 1JI0A 5HFJA 1Z34A 4MVJP 4CM8A 4EG4A 4F2PA 5JNTA 3FIUA 3BA6A 3V4PB 1WSBA 2W6QA 3AL2A 3MINA 3H9BA 4RPLA 4I1IA 1A9XA 4GIBA 4UU7A 3RVPA 4WW0A 1QHXA 3UMCA 2C99A 4AXXA 1DEHA 1R6AA 2F00A 4AIIA 3L0ZA 4N4AA 4X7MA 3WDSA 1OFIA 2PUTA 3C5EA 2CZCA 2XUJA 1L1EA 4BJ1A 1NJ8A 4HH0A 3UJ7A 3CM0A 5CFZA 4N0MA 3ZWVA 1FP7A 4TM8A 4DNXA 2BBWA 2O5RA 3LIPA 3B52X 1A7KA 2YY7A 4QEDA 5BXQC 3N74A 4Z8XA 4DRXB 4G0ZA 1X74A 4MVJD 5A4KA 4B3JA 4DN6A 3IVXA 5JRDS 5E38A 3UC9A 3UJDA 3WMEA 1KSFX 2HA0A 1UQRA 4RK0A 4XAQA 3WJ1A 2JKYA 3T1YB 2W6MA 1MIOB 5CU7A 5K03A 3PX2A 3RSCA 4C6HA 2AUNA 3ADDA 3USCS 5HKLA 1KGSA 2D0IA 2WK1A 1ZNQO 3KM0A 3M5DA 1PE0A 1ZM4A 2H9AA 3C41J 2JJMA 1I3NA 4S05A 3HU1A 3TTTA 3X1JA 4R8LA 2E4WA 3S99A 2WT8A 2ZT8A 3AEKA 2GPTA 1WL8A 3EGWA 4J7AA 1G0NA 3HJHA 1E20A 4ZMSA 1Q0QA 2C0CA 1JALA 1B0PA 2ERCA 3U1BA 2XYVA 4MV3A 4HGQA 2Q3LA 5LQUA 1U7PA 3M5PA 4GWLA 3IELA 1AJEA 2XB9A 4WCFC 5EJFA 1CY2A 3G6WA 5HF6A 1IB6A 1R8SA 5DGCA 2DP4E 2R7AA 2YINC 3MGAA 3P1JA 4KKVA 2A1UB 2X5XA 4QAQA 3RS7A 1D6NA 4CKEA 1N0IA 2NAFA 4Y0AA 2WFAA 3HGMA 4F3TA 3W4IA 1TE2A 4OY3A 4EBFA 1A4IA 4NBVA 4JP3A 3DUWA 3AI1A 3MIZA 2YHIB 4CLRA 1UM9A 3FB1A 4DHEA 3NONA 2CL0X 1UQUA 3DNFA 5FIUA 2A9RA 2XLCA 2ZT6A 2PYDA 2WAAA 3B5JA 5IASA 1YJXA 1ECPA 5KCZA 4Q3KA 1UJBA 1V16B 4G23A 3E3LA 4P83A 4Y2TA 4MRVA 4BKQA 1FTWA 1GRQA 3H05A 4KMOA 4KR3A 1ZCAA 5BNWA 1T34A 1L4YA 3BFKA 2CW5A 2B9VA 3UATA 4B7XA 5IDYA 4DLVA 1FW6A 1Y6QA 3QVVA 4MAFA 4BMPB 4E30A 1ZIOA 3PDIA 2PVSA 5LQKA 3I0MA 3ZX5A 4A0RA 2QEQA 3D7LA 4NBLA 1GAQA 2Q3MA 4B40A 4J90A 1JQJC 4MQEA 3UT5B 2FK8A 5LOVF 4R83A 1E9BA 5EN4A 2HKIA 3JZIA 4R5MA 4INPA 3UHFA 1FU4A 2XQKA 3OCJA 4D0RA 4F93B 3CJTA 4UBMA 3VOAA 1Z82A 2C83A 4BN4A 4Z4IA 5JYBA 2PDAA 3R0IA 3PFIA 3AETB 2W2KA 4UJ3A 4FX5A 1NJ5A 1ZUIA 3DAYA 1H2BA 2LUOA 3KKMA 3WMXA 2FMXA 1EK6A 2BP7B 1E2GA 1OAOC 1GRCA 2R5WA 1BE6A 3V7NA 3HRIA 1T13A 2BC9A 3CUWA 3NG1A 4KQKA 5M2QA 1UP6A 3R5JA 4AF6A 1U7TA 5EINA 3OZBA 4R2LA 1GZ4A 1OPXA 1XEWY 1YOVB 1ZJYA 5HQ3B 3HVRA 4AN0A 3K9NA 4JKOA 1Z74A 4Y98A 1J1UA 2WF8A 3F4BA 1DX4A 4TL9A 1I2AA 3GRKA 3GV0A 4UDYX 4I1RA 4RVOA 4OHYA 4C0JA 5CA1B 2V9CA 2ZQYA 1YCGA 3G2MA 4M6WB 5LP6B 4KGVA 5ALLA 1EUCB 3DCNA 2AN3A 1FP6A 1A04A 2X8JA 5TC4A 3Q72A 1R5BA 2DPGA 4IDEA 4M60A 4Z49A 5CG1A 4PAGA 1AHIA 2Q2VA 5KOJB 3IP3A 5L45A 5G0UA 1PU2A 3ISJA 1D9ZA 2QRVB 2NUTA 2PX3A 4BCBA 4EH1A 2G40A 4EPRA 4GNRA 3TSOA 3RBAA 5BOSB 1T4DA 3ZH2A 3KTDA 3N3AC 5K4GA 1A97A 1PNTA 2RBEA 3CH5A 3H1PA 1ZN2A 5BWOA 5M04A 2OY0A 2MSCB 1ISHA 1EVLA 1ODTC 3AEQA 3AP2A 3TQQA 3E5MA 4LX8A 3FWYA 3KHUA 4M0DA 3G0OA 1FDRA 2GJAA 3OP4A 2HF9A 2HY7A 2RBKA 2CXXA 2A86A 1V71A 4LK2A 4Q39A 4X6LA 2P11A 5LBTA 3M6WA 2GSWA 3D6JA 3FCCA 4JEMA 3REFA 4BLQA 4CQLA 5I9NA 1E66A 3GGSA 5CCXA 2C2HA 3QPDA 3AOEC 3LIIA 4D4KA 1R8YA 3EAGA 3PQEA 2HJRA 4ESEA 1BQEA 4EF5A 3FETA 1EA7A 2G0AA 3CZPA 1JI3A 4QM6A 5M29A 1QGZA 3H5OA 1OT5A 4DQVA 5HZMA 5EE9A 4BS9A 3C43A 4FZ3A 2VK4A 5JZ9A 3EVEA 4ZDIA 4ZI7F 4BNDA 2Q1XA 1JG4A 1U2GC 3JCZA 1EUQA 2Z6QA 3ZWOA 3K0HA 4UXHA 5ICFA 5GM2A 3LFHA 1S2NA 3IC5A 5G40A 4D8TA 4DZZA 5A6SA 1WQ3A 5HP4A 2QTLA 2ID9A 3WA6A 5KOYA 2X4LA 3FZGA 3Q7PA 5FLXA 1FQOA 3A4VA 3IESA 3LL7A 4MGIR 3ZBQA 2ZRGA 4D6PA 4N5IX 5HCNA 5G4KA 3R7FA 4YT4A 1GARA 2WFLA 2W2LD 2COUA 2IOYA 1YZVA 3MA0A 3WO0A 2O8VA 4NZPA 1MJGA 1CE8A 3HJTA 3UMGA 4B7CA 3PJRA 3NRBA 2VYCA 1SXPA 3DFIA 3ABQB 3HVHA 2DFLA 1JG7A 3HMQA 2WF7A 4EJ6A 4ER3A 4B7AA 1ECLA 2A0KA 2GWHA 5JD4A 3Q4GA 4LJ7A 5DT2A 1ZXLA 3DT9A 4HO1X 4XQGA 3AR2A 3M82A 2YV3A 1YZHA 4RKQA 2F1KA 1QK3A 3ADCA 3U3RA 1Z7EA 1Q0SA 3RYHA 2CUKA 4G5YA 4QOHA 4A6PA 4V03A 4B4WA 1EFUA 2IPMA 3UAXA 5U4QA 3SEQA 5AI5A 3PX7A 4P1ZA 2QD1A 1J0DA 1Y80A 3GU3A 1IUPA 3PGXA 2J0SA 1U2SA 1IRIA 1G5QA 2OHFA 1SBTA 3X1MA 5IDWA 2YJZA 2XVXA 3P2EA 3LGSA 2F3QA 4EG5A 4EQ6A 4CZ2A 5AQEA 1Q17A 1Y5IA 3H5LA 1QH9A 2BV3A 2HD4A 3WWEA 2Y9PB 2VYNA 3T38A 1QRUA 3TI9A 2WPDD 3EZLA 6ADHA 3BH6A 1Q1BA 3HXTA 3WWZA 1NW6A 4M8NE 1A2BA 1SUDA 3A10A 3VZRA 1HQCA 3I32A 3KSUA 4ZYUA 3UUWA 5I7RA 3TKLA 1H2EA 4X85A 3K2BA 3PP8A 2YJGA 3RG8A 3GH1A 3DL0A 3CRZA 5DNYB 2I3DA 1B6TA 3DAGA 2A33A 2VJDA 1SD5A 4QVIA 1BGVA 4EATA 1IWBB 2PEYA 2QP4A 1CUVA 1RYNA 2N1BA 1Y98A 4KQWA 5EIFA 5KNDH 1QQBA 2IEZA 2FQXA 2WFMA 1P3Y1 2J46A 2V6MA 5KTSA 4WBNB 5FWYB 5DXAA 3ZE6A 4L4UA 2GI4A 2CKMA 2WYIA 1BCRA 3VNRA 4BGDA 2NLOA 4AFNA 1AA6A 1OVMA 1L2TA 4DG9A 2V7EA 2O2EA 4RLSA 2EKZA 2XDAA 4DV2B 1GT91 3LWZA 2V5AA 1SQ0A 4TL8A 4JBGA 4JY7A 4LRWA 5D00A 2J30A 5ARCA 4X7RA 4KSBA 1CB0A 4LSWA 3DAFA 3HNOA 3Q0EA 1Z2NX 1II8B 1YRHA 2W4IA 4IIYA 2NUAB 4RULA 2GK4A 4GXQA 1ZH8A 1QHSA 4C3VA 5JJIA 1QE3A 5CG2A 3INGA 5CUQA 4AO6A 5ILQA 1FP4A 2B2XA 3UA3A 2AWNA 1SRQA 4KXWA 4D9KA 4EKNB 5K0JA 1T2EA 8AT1A 3NHYA 3GGGA 2FR8A 1NLZA 3UHOA 1EINA 2A78A 2VA9A 1IEQA 2QORA 4ZV4A 9LDBA 1H8EA 1OT3A 4UOQA 1HY3A 4CMIA 5CFMA 3FDZA 5DTRA 4BN0A 5LWHA 5FO0A 4IUDS 1L5WA 1IBLB 1YS2X 3WHLA 1NNEA 3OZCA 4KXYA 3JWPA 3Q2IA 2GEBA 1SOVA 2IE0A 5CVCA 2BAGA 3KXLA 3GT7A 1OMOA 5JCPA 4FE7A 3JQ9C 4DR4B 4KMRA 3P2KA 5K0EA 1CUFA 1WHTA 2OVFA 2FV8A 2HJ9A 4GOOD 3I53A 3ZLBA 2DQSA 2HHAA 1WCWA 3FYDA 3NUZA 4GF5A 4C4SA 2RIPA 4ZOLA 5IKEA 3EQ7A 2WJPA 3EVDA 1GPWB 1KL7A 4JYZA 2AJBA 1TKCA 2BHTA 3MUOA 4P34A 1T0IA 3OSUA 5IANA 5F77A 5K2MA 1Q1ZA 2W6OA 1Q57A 2VHZA 2OXFA 3TVTA 3VR2D 4N6OA 3DJFA 3R7LA 2G83A 5JAMA 2FUNB 4ZRDA 3U6KA 5EC8A 1L7NA 3DLCA 4IVNA 4YYZA 5CGZA 2I29A 3EPRA 3U4MA 4D9EA 1R0BA 2XA1A 3QVXA 5H02A 1YRLA 4H7EA 3LVQE 4MS1B 3A1TA 3TIGA 3TW4A 4J16A 4GGOA 1QOZA 4WZBB 3T3PB 2HA4A 3ZWMA 5DM1A 1G3QA 4GL4A 1N3YA 3R5HA 1M67A 4PGGA 3RUDA 3QEKA 3VPBA 3RRXA 3RR2A 3U4QB 2IQIA 1UAGA 2PSFA 4TTQA 4RKEA 2RHJA 2EFJA 4OUDB 2A9KA 2ZU0C 1V5WA 2A59A 1KXZA 1B8PA 3C3EA 3IRVA 4Y9RA 3F90A 4DRYA 2QP9X 4JI2B 4D3YA 5IFKA 1YK1A 4E5UA 2BZ1A 1A8SA 3TOZA 1S02A 2C2XA 2REXB 1UOEA 4BQSA 4YXWD 3R20A 2DB3A 1O89A 2IY9A 2QPOA 5K8UA 1Q0TA 2IQ5A 4G0XA 4BVEA 4OQDA 5KWIA 3FDFA 4OJQA 1B8VA 3L5OA 2C2BA 4Y2VA 5D6NA 3S8MA 4E22A 2G5GX 3U1VA 1Y4ZA 3THOA 4BLPA 1SCAA 4BZPA 1ZOIA 3MWJA 2JGDB 4HXYA 4JYMA 3Q2KA 1JR2A 3IUNA 1XWWA 1DC5A 3ESZA 2O14A 2GZMA 3I1IA 4OLJA 4PYKA 4UZFA 3Q7SA 1ZJ5A 2QLMA 2GCPA 2OT3B 4FDTA 4Q00A 4EVIA 1BMQA 1HDEA 2AZMA 1AZWA 1PS9A 4HS9A 4I50A 4DV3B 1E1KA 2R60A 1XVUA 3LECA 1SIBE 1UK9A 2GAJA 4PHGA 1I24A 1E18A 3RU7A 2W2MA 1KMCA 2W6NA 3GMIA 3VJLA 3C6MA 4UVEA 4AP5A 1NBHA 3RF6A 2PSJA 5JAOA 3ESBA 2ZRIA 4GE3A 1C9DB 2VPTA 4PS1A 4CT0A 3L9WA 4WN9A 2QVGA 1YNSA 2BIFA 3AUJB 1U63A 3CVWA 5IC6A 4EUHA 2Q1TA 1JKJA 2JVIA 4KC0A 3FOEC 3R24A 1V7PC 3PXUA 3DUFA 4LTNA 4DCUA 5BN3B 5AW8A 4RNCA 3CRW1 2XXAA 3SMQA 3WYFA 1R4NA 2VP4A 2TSYB 2CSXA 3U9TA 2AH5A 3MTIA 4IF6A 4KPUB 4LA4A 3T5MA 2VPWA 2II6A 5DBHX 5BUSA 1I0ZA 1JEOA 1T1EA 3SQNA 4JT8A 1SCQA 3ORRA 3E9RA 3R41A 4FFLA 4JLBA 4YCBA 4ZRMA 4A0SA 2CBGA 1LCIA 1GAWA 1RTTA 3L7OA 5ETJA 3E22B 1RXUA 1A9SA 1IHUA 2R86A 2Z4TA 2WSIA 3H2GA 3WGIA 2IVFA 4N40A 2VDUE 3TRIA 2O3RA 3PTLA 3S2FA 2CXNA 3UOWA 1VL2A 4QUAA 3EOBI 3Q7IA 4K9DA 4NZMA 2NQ8A 2X4IA 1GKUB 4I2VA 1G1MA 4MMZB 4Y2XA 5E8JA 4EHLA 4RF5A 4ENQA 2E4YA 3FF4A 4L73A 4S12A 4L78A 2TECE 3CH4B 5IVDA 2PMWB 3W3ZB 3ZI7A 1W4BA 2C9BA 4FBGA 3WWCA 2WAOA 5I4CA 3DTYA 4IQ0A 5BR1A 5KSZA 1I7SB 1E7RA 4TT3A 4EMBA 4DG8A 2IYWA 1HQDA 3HV2A 3L4EA 2PKQP 4PVDA 2Q99A 4JWTA 5DB4A 2WUDA 5IHPA 1RC0A 2V97A 5ALEA 5H68A 3SNKA 4NDAA 4ARSA 1T1RA 4XEHA 3TB4A 1AS3A 4A6DA 1V48A 1YL6A 1G8FA 2W8BA 2Z8XA 1RRKA 3F6YA 1U0GA 2FDXA 3GYGA 3PC7A 4OQMA 4EJSB 3HEBA 1Q3TA 1THMA 2H63A 3DDUA 4I55B 1Y63A 2PUJA 3A4IA 2BT4A 1W2WB 1OROA 4KIJA 2HWUA 3WE7A 4F3CA 3U4HA 2BEUB 1GTSA 2AEEA 3DO8A 1VKRA 1HV8A 2FPMA 4OAQA 1X7WA 3WL8A 1SVOA 5K09A 1W8DA 1NNUA 2I6TA 2VAXA 3JQAD 3QW4B 5CT5A 5E2BA 5EIOA 1RHQA 1EP1B 3W7BA 1KJNA 3RWMB 4MQLA 1YE8A 3ZK8A 3GMSA 2VL7A 3CS3A 1IXYA 3RANA 2PUBA 4OQFA 2WNIA 4I5EA 2R6HA 1RIIA 1T5IA 2B1IA 4QSHA 5JV5A 3VKGA 4F4DA 1MQ9A 4ZA2A 2AJCA 1MPXA 4ZJUA 2GOYA 1V6SA 3WTBA 4EWLA 4YR7A 3ZCVA 3AINA 4BTLA 1K3UB 2AVDA 4GMFA 5ITZB 3JQGB 2IUFA 2XQVA 3EZFA 2HZBA 1WV0A 3KLMX 3OUUA 4I4LA 1E3JA 2ZRQA 5B58C 2AFIB 1Q0RA 1AKMA 2OGTA 4UAVA 1W5AA 3BMOA 2QYOA 3SE7A 3BWMA 3QMPA 5EYPA 4PY2A 3THYB 4R1SA 3IVRA 3OQIA 1GFZA 2WSBA 5CDYA 4BMNA 3MNFA 4Y2HA 5CHEA 3UXMA 4CTMA 1G291 1ZI6A 4IGFA 4X66B 3JD4A 1N2ZA 1M9NA 1YQ9A 2B78A 2QVLA 2RCYA 1A1VA 2V7PA 4C20A 3P20A 2GZRA 1JSZA 3P4YA 3TSAA 3OH8A 1DIHA 2R25B 4MWOA 1O6BA 3HB4X 1T26A 4XARA 1H2ZA 3OZGA 3W8NA 1I10A 4YO8A 4YMSA 3HTXA 1VYTA 4F9EA 1UBHS 3FGPA 4K3VA 2B8EA 5JFOA 2FWNA 2NZXA 4AL4A 5DHTA 3IMCA 3T4PA 2O8CB 1QQAA 4TZKA 1KWKA 3KXDA 1XHFA 2QN8A 5DYWA 3C2QA 4GWKA 5HZGA 2L42A 4R01A 2ZWAA 5EPUA 1G7SA 3L84A 4DUPA 1DEKA 1LW6E 1ZIYA 1XOIA 2ZRFA 3LY8A 5H7XA 3IALA 1NASA 1XEFA 4R1TA 4HDAA 4LDZA 4DLTA 2UUOA 2Y9MB 1ABBA 5F52A 3QV2A 3GBSA 3S70A 5C7OO 3DNMA 2ES4A 3OO0A 3PQ6A 1MH9A 4BAUA 4BGUA 1GDHA 4EJFA 5IMSA 4I6EA 3VBEA 4FLEA 4YJFB 1YRWA 2FX2A 1QO9A 3NVDA 1IDOA 3DZJA 4QUJA 4R98A 2OB2A 4HADA 4TKUA 1VRVA 4MYUA 1A8HA 4AY2A 5FI5A 4ED9A 1YI0A 4OXIA 5DCWA 3BJMA 2AYYA 1JHPA 1K6XA 2GILA 4DJTA 4V1CB 4RUKA 4GQIA 4D43A 1COWD 1MX3A 2GYWA 2PNJA 2J9XB 1TAUA 1RFGE 3ABOB 3D02A 1OAAA 5LLSA 3CN7A 2WWFA 3BTSA 5J2UA 3BDAA 5B4TA 4AP6A 2XV1A 4LJ5A 4G1UC 4R8KA 3ZDFA 2PU5A 4P3KA 4RDIA 5LB2A 2JLRA 3W5JA 4XVUA 5LXTA 1MJGM 4JJ7A 1HFWA 1ETHA 3BA1A 3TSYA 1USWA 2FEKA 2IKQA 1UPTA 3PC8A 2C4NA 3AM5A 3H4TA 2ZJFA 4CKBA 1I1HA 4Q3DA 2OC4A 4J0GA 4EIWA 2Q46A 3HCWA 3OE4A 4IQ8A 3ORHA 4I1VA 5DU2A 4B6SA 1OLUA 2NZJA 3OU2A 1L5OA 1IJKA 5CVDA 2PUVA 1IE3A 5SYNA 4LFCB 1PV1A 3MBKA 3SKVA 1QGUB 3CZAA 4ZU1X 1J0XO 3H11A 3B9BA 1FLDA 3EBOA 3LF2A 1D4FA 4DBLE 3CMCO 4LG1A 3SD7A 5EWMA 1QNLA 3I4FA 3KUCA 1M7GA 1ADBA 2ZSFA 4JVMA 4ZOQI 1ZXXA 3GARA 4GUDA 4TV9B 2IPNA 3H84A 1P2TA 1CZHA 1DBRA 4EITA 3CEMA 3FZYA 4WKBA 5C7YA 4OHXA 1JFLA 5JZOA 5DMHA 1GPLA 2OXTA 4TTJA 1OD6A 3A3NA 1EB8A 2HQSA 3SBOA 4OMDA 4B4OA 4I1PA 2XYHA 3OU7A 5COQA 3N87A 4WK4B 2DRIA 2VDNB 4L95C 2JFOA 2X40A 4E3WA 3LBFA 2DWQA 2H5EA 3QNWA 4G37A 2AF4C 1GQSA 4M37A 3OX4A 4LE2A 2WT4A 3BXXA 3E2PA 4PCVA 2PEZA 5C0OE 3U16A 1SBCA 3H8JA 1UEJA 2H5IA 1LFDB 3P32A 1L8XA 3P9ZA 1OVGA 3CONA 3PIRA 1BO6A 1T1IA 2AMVA 1ZITA 2QMHA 3I9MA 5EUQB 2V0NA 3BHMA 1HKHA 4OQQA 4Q5IA 4DILA 5EIEA 3HP7A 4Y2UA 2C77A 3ZHSA 3PNOA 4MCHA 3DHEA 5IVPA 3AESB 4GDMA 4XTRA 3VM6A 4A7PA 4DWWA 1X39A 4YMTA 2XD4A 2YR0A 1K4YA 1X7YA 2O1SA 3N0TA 5EKDA 1PTKA 3AB8A 3H65A 3TUZC 3INTA 3VPSA 5JY1A 1XNJA 3RS0A 2J5XA 1DKRA 1R1DA 4K03A 3SIXA 1I32A 2HO4A 2VWQA 2I2BA 2DAPA 2QU8A 5CBKA 2ZSJA 5F9HA 5AUOB 2QAGA 4RPKA 4RPGA 2VBCA 3GROA 3K9QO 3OFVA 3UWDA 1C0IA 1KMHB 1GYQA 1MCZA 1S3FA 2XMRA 4LXIA 4BE7B 1T9HA 1EP2B 1UBGA 2Z9CA 2VCEA 2R5FA 3X43A 2AOXA 2UYQA 3KAKA 4XGNA 5F33A 2IHNA 3T95A 5FD8A 1BXRB 4FEEA 4DEYA 2LIVA 4LY0A 5TVKA 1N8KA 4TMWA 2PIAA 1T1SA 4BXOA 1YSCA 3PFFA 3COWA 4KAAA 1T8PA 1WCYA 4ZOLF 2HHLA 4LDQA 3KSAC 1KY2A 1ZD1A 3P97A 4MI1A 3VYSB 3TQHA 1BH2A 2VN8A 2XXJA 4RKRA 4KXLA 2VK8A 1WCXA 2J5RA 4XEUA 1JPJA 5BSKA 4QGAA 1DAEA 3ZQ4A 1LGYA 5D5HA 2J6IA 4G1BA 4NENA 2Z2XA 1XZNA 4G1FA 4DIBA 1EJ6A 1ZI9A 4EDFA 3ET4A 1RXWA 4WNIA 2MYPA 1J5PA 2QVYX 3U7QA 1VB3A 1PZNA 1VDZA 5FDFA 4P33A 5BUQA 4S1OA 2CXTA 3UUGA 1MR3F 4N0EA 3NBXX 3PCTA 3CRVA 2A0YA 4ITRC 3QFFA 4GPBA 3CINA 4QT0A 2F43B 2AWOA 1WLSA 3S7TA 3PNVA 4WMLA 4QXQA 3ESYA 4LMPA 3CNBA 1JDNA 5EP1A 2Y0PA 3CN9A 3A1WA 2FSIA 1RHUA 2SCUA 1RYFA 3E2MA 1BGXT 3EXIB 4KQCA 4BKMA 2FFAA 3LLMA 1LPAB 2P91A 3SEAA 2EGHA 1VBFA 1VJ5A 4E08A 1E4EA 1P4AA 3A6DA 4FIZA 2WZQA 4BBJA 1Z8HA 5J5VA 2Q6KA 3M9XA 1ISGA 1RLIA 4LHXA 1ST2A 4IDHA 5IZ4A 4PN7A 1AUPA 4PPFA 2JK0A 1SVMA 5FJJA 5HF5A 3AUUA 3G9UA 3T1OA 1D1TA 5FWXB 1DDOA 1RZVA 3VJKA 1TIKA 2BFBA 2GBLC 1JHZA 1QF7A 3EZ6A 3GOQA 4PG5A 4UQPA 3WGVA 5L3RA 2PT7A 3X1DA 3OTIA 4HG2A 5AXBA 3VHXA 1EEHA 2VDWA 4OYYA 2G7MC 3LO8A 5KINB 5EGNA 3JD2A 3QBJA 4GZ5A 4I50F 4DV4B 2FSPA 2C7RA 3GLGB 4INOA 1BKDR 1A76A 5ALPA 3DMGA 5T4FA 4LBVA 3PUYA 5BT9A 1YVRA 3TL2A 2H7YA 2ASVA 2Z1MA 3KL2A 2BMEA 1NSYA 3DTVD 4ALLA 1F60A 1WXFA 1S8FA 3LAWA 3NOXA 3FDIA 1P0CA 3EFBA 4WY2A 1XRNA 4ZHQA 2GHTA 5BURA 4KGDA 3F78A 3SC3A 2WWYA 2B1JA 2P2GA 4M0LA 2ZT5A 4LJSA 3I73A 4OUKX 4YS6A 4XM2A 2QROA 1KDVA 1CLUA 3C3KA 4P2BA 4NOKA 3ETHA 4PX9A 4ZQHA 1ZW1A 2E89A 5ES3A 1V2HE 3Q6NA 3SLGA 1TUIA 2RGNC 5C81A 4IEEA 1CR2A 4ZAWA 1E3SA 2VTVA 4WSOA 1SU4A 3AW8A 2PKXA 3CZ5A 4GEKA 3N8IA 3TR6A 3BWDD 4LZPA 4MGHA 4MVJA 3PHIA 1UKAA 4OB7A 5DGDA 1F7VA 1RIFA 1UDWA 2OFWA 2FSSA 3D1LA 4M88A 4PSVA 3WK7A 4FYKA 5JPCA 5KWJA 1ABEA 1FDVA 1M2VA 2XCTB 3QFHA 4U7HA 1C7QA 2Y05A 4H6WA 2D54A 2O57A 3A1VA 4U0JA 3WYNA 2XMQA 1DJQA 1IN4A 4F3KA 3AVTA 4DCJA 3M4JA 4WX2B 2PJUA 4NECA 1MG5A 3FGOA 4O63O 1IDN1 4QHSA 4RADA 1JXQA 4HBZA 1QHEA 3AUAA 5K0BA 3SS7X 4XYGA 3ZG6A 1BDMA 1BDBA 1FC0A 1LPMA 2BHNA 2WG1A 3FMVA 1G3MA 4JOSA 4IZ6A 1N2CA 4NATA 4QOJA 4UNIA 3N07A 1UZNA 2ZWIA 3LQ1A 5CNKA 3P2IA 2YWRA 3IEMA 2BKAA 4DB4A 1RKUA 1TJNA 1VJDA 3FCAA 4IGKA 1T36B 1IAVA 1CNMA 3LT1A 1WXIA 1XTBA 3FA2A 4F85A 4X6UA 1U9IC 1K1EA 1E69A 1R5JA 3V4RA 2J7KA 4S35A 4Y6OA 4BVGA 5BQPA 2O7VA 4IAOA 4BYGA 5C3MA 4S2EA 2X42A 3OFND 4BEBA 5BW5A 2ZBFA 3CLVA 3ONEA 4L28A 3GFGA 3ACCA 1Z6GA 2IX3A 2OLKA 2P75A 1KAQA 1DBIA 1XZMA 3U7IA 4BDSA 1E9SA 4YQZA 2B8TA 1QAMA 3C87A 3GCXA 5IC5A 3OOYA 4EFLA 4WXRA 5F2OA 1B6SA 1OX4B 3M4XA 3R0QA 3RRMA 3T1QA 4EO7A 3RV4A 1L6IA 2ZRPA 2X8BA 2EZ4A 1X7ZA 1NBOA 2EJUA 2Q1UA 4HEA6 3LOQA 1GO2A 4BC0A 5F2NA 5IKXA 3N3BC 2QTFA 3BGOS 4EGCB 1YKGA 3UMBA 4ERXA 4ITUA 4ZRNA 3GAAA 4ZANA 4TSRA 1C7ZA 121PA 2VTBA 3S2EA 2Z8YA 1ZX1A 3T5TA 3R8FA 2GK6A 1G60A 4XX0A 1GCUA 5DGTA 4QT4A 3TQIA 1EX1A 3TTVA 4N9QA 2JIZD 3OA2A 3KL4A 4F7WA 3PE4A 3L0PA 3ZD6A 2EQ5A 1WXQA 1DO2A 1R6UA 4KN9S 1K8QA 5ALIA 4ZMBA 3HFRA 1U7WA 2QN1A 4OL0A 3ZPXA 1UC4B 3IR7A 2XWJI 3PPXA 4PAMA 4ZYXA 1YGPA 2VHJA 3UM9A 1GSHA 1TIBA 4HZUB 1B3RA 5KZMB 4Q6WA 3IQHX 1MFZA 4DDWA 5AVUA 1UBOS 3PKZA 4BASA 4F6RB 1P9LA 1WZNA 1KY3A 2YJTD 3BIOA 1PJ2A 1XK6A 4MHSA 5H70A 2IW1A 4KN8A 2VPZA 3ZQ6A 3DAPA 4E70A 1QHHB 2IPOA 3EX7C 2HIAA 4N6GA 4N3NA 5KSYA 4IDDA 2BFCA 1C1XA 2GVNA 3IUEA 5DK4A 3OZFA 1ZIDA 4NEGA 2QGNA 4DJAA 2GXAA 4I9HA 2WJAA 4MV6A 1QUEA 1CHDA 3WJ2A 5GIPE 3NOQA 4KWEA 3MSCA 3R7NA 2VUTA 4ADSG 2CFRA 1HMPA 3GJ3A 3A6EA 3OIFA 1FS5A 1G3RA 3SF0A 3UFXB 3M81A 2HQOA 4JBYA 1ZGJA 1QDEA 5HOEA 1DBQA 1G8MA 2X7HA 4HN4B 4OATA 5CFPA 1KE2A 1LZLA 1FLAA 4BNIA 2Q8NA 1NMXA 1U4OA 2Q9CA 3FRIA 2PO5A 4Y2JA 5LYJA 2GKSA 1XIVA 3H3JA 1FNBA 4LQCA 4CKCA 4DUGD 1U7ZA 3D0OA 2HEGA 4E14A 3AG6A 3H9GA 3VQTA 1G64A 2PR7A 1DQSA 3IV6A 3P2MA 2QDKA 3CW9A 4WY5A 2RE8A 1QXSA 1E59A 4MLCA 3PXEA 3ZIAA 5J2UF 1GZ6A 1YMUA 2ZIAA 1OZGA 4F2DA 3G2LA 4K0KB 3DE1X 1WV1A 4B82A 1T4CA 4FCCA 2VQFB 3ECSA 4MP8A 4W8OA 5LXTF 1R0LA 2QT9A 3DGEC 3V34A 5JDIA 2NO4A 1QYRA 4ND1A 2CJPA 2C9OA 3DVAB 4RNDB 3CB4A 3N2GB 2JVJA 1JHAA 2XDWA 3KO8A 5HW0A 4HWKA 5G1OA 1CQJB 4Q7QA 4IIBA 3DWIA 1XMSA 1ZUWA 5AM4A 3VXKA 2BKLA 1U2PA 1BEZA 3KKNA 4DUZB 1RWMA 4W5HA 3SIPA 5C7IO 4REMA 1JFTA 4RESA 1BXZA 1P72A 2H5LA 1I01A 3AONB 3AFNA 4JOCA 3BSWA 4HP8A 3G0HA 2A4MA 2W2LA 3LRTA 4QBGB 3RSGA 2FF5A 4B2IA 3OJEA 3SZGA 1M7BA 1QDLB 3NQ41 4E1AA 4BCDA 2H8GA 3OAAA 2O07A 2BM8A 2FR1A 2ZIFA 4HMQA 4LZAA 4W9MC 5TPZA 1WBBA 2XH8A 4R2IA 4M22A 4EQZA 3C5VA 3ZWKA 4GEGA 1EIWA 2GAIA 3IBFA 3L7BA 3B3QA 2QRMA 4D9IA 2G4VA 3U09A 1IHPA 4TWJA 4CKWA 4G1MB 1W88B 1DV1A 3T7EA 4AZSA 4ETWA 1NE2A 3TH5A 4A16A 2JGKA 1ORVA 4DV0B 1P2UA 1CG6A 3FBWA 4TMYA 2W0MA 4HEJA 5JH7B 4GSLA 3AF4A 2NXCA 2PWBA 3ELWA 4GI2A 1YWGO 3BFXA 4PBSA 5AHWA 4FFMA 2SNIE 3AHFA 5LDDC 5K8CA 1DXHA 3D6MA 3ELBA 1VC2A 4Q1FA 5FL7A 3WISA 4BQNA 1XK7A 1KVRA 1RJFA 2YZKA 2J33A 1NVGA 1QV7A 5DJ5A 3EYWA 3OCCA 4M1ZA 5JSQA 5K3CA 2EFDB 3DNPA 3C3PA 4M0PA 3V7FA 1FS4A 3M2PA 3PS9A 4HB2A 4J7CA 4KCGA 5CLGA 3TQOA 3KR2A 3T0GA 4ZJPA 3VYUB 5L40A 5ALYA 1LSSA 2X6RA 1IY1A 2P67A 2WPDA 3AH8A 1WMDA 3DHNA 3EBLA 3GRVA 1WD5A 3I6BA 1UDCA 3JSXA 4OL9A 4URHA 3UBMA 4PSDA 5K3EA 5G41A 1KZ9A 4DQKA 1SUBA 3PNYA 5EJ7A 3QWAA 4ABYA 2X7XA 3R5TA 4U2DA 5T6MA 2IEBA 3ELDA 4G09A 3ZDQA 1H0HA 1UJ6A 3KU1A 2HHCA 1QO0D 3QUAA 3BCSA 4NBKA 2RGCA 4YT8A 1M10A 2YFKA 3JYOA 4M9QA 5AW6A 1NJSA 2GT1A 2DZDA 1E4YA 3M2TA 3E9YA 1OWNA 2G07A 1U1EA 3L8CA 4OV6B 4CQMB 4YAKA 4MW0A 2CJFA 2AZDA 1C9MA 1KAGA 3KHSA 3MJSA 1OI7A 4KVFA 4OQLA 3N28A 3RTCA 5K0ZA 2CE7A 2AJLI 3F9CA 5C7LO 4ZVPA 1YR7A 2IHUA 1BU5A 3QEBZ 1W36D 1M2GA 2VWPA 3WQHA 1SGWA 4K6HA 4YASA 1SU6A 3ONWA 1L4GA 4F9FA 4J2OA 4RD1A 3VOBA 5ELMA 3R44A 3I8SA 5BR4A 2IZ5A 4B6RA 3PGMA 2HLHA 1HYHA 3QIAA 1LS1A 3D54D 2XHZA 4V24A 5AJYA 3ORFA 2WHPB 3HCOA 4MEBA 3UJ8A 1NAIA 5HQTA 1KQFA 2X4GA 4WGFA 1MJNA 4F3YA 2F64A 2X19A 1VPLA 3JVEA 2JLSA 5IMBA 2O8NA 3VH4A 4OK5A 4LWPA 4LF8B 1FU8A 4AIRA 2CCJA 4UBNA 5AXAA 5CBPA 2R84A 3HJAA 3MT7A 2ZW9A 4OXQA 1Y8RB 1B93A 1L4NA 3AR6A 3D8NA 4CI9A 2ZREA 4DV6B 2BGGA 5CT6A 3EPLA 2C95A 1II9A 4WZZA 1UXHA 3T3NA 1G8KA 1E8DA 3DVQX 4MKZA 4E21A 4J1TA 4KO8A 3RS4A 2P6OA 3L93A 2JG3A 3GPCA 3L8FA 4OU5A 1C30A 2I99A 3S2SA 4Q7MB 1WEHA 2PS1A 2UUCB 5BORA 3REOA 4C4OA 2DVMA 4O5AA 4ZT6A 2WZDA 3EVBA 3KEQA 1I7PA 4YNBA 3IAM1 4M76B 4L6IA 1WOMA 3W7AA 4QQKA 5I5EA 2HPHA 3KDSE 5E1MA 4EKYA 4YJHA 1TPYA 3JARA 3ZY2A 1L7VC 1IY0A 2IYVA 4QTZA 5A2GA 5JW6A 1XP5A 3WNZA 2BEVA 4BRSA 1VKZA 1SG0A 2MSLA 5LA6A 3I3OA 3RIHA 1ISJA 1I9CA 3HM2A 1W76A 4L8VA 1K63A 3ENKA 2R6FA 3DP7A 3EDRA 3VAZA 3VR2A 1KFJB 2NUBA 1OHHA 3DOCA 3VDQA 4MR7A 4NARA 3NHWA 3M9WA 4F5EA 2HZ7A 2OCDA 1HZZA 2X6QA 3FCOA 3IE1A 3CVVA 2RC5A 1SCUB 4HHEA 4BBPA 1P91A 1NWHA 1EXDA 4TTRA 1V3VA 4RA6B 3DKIA 5TDHA 3JRWA 3FYSA 1GUAA 1S4MA 5FPHA 4D3ZA 2WQZA 3IOCA 1IM8A 1PJCA 1Y1SA 3KEGA 5TJ9A 2Q49A 4ZQGA 1A95A 1AT1A 1E3DA 1CQXA 2WHXA 2X0KA 3I6QA 2LP4Y 3TDKA 2Z2KA 1U0JA 3T61A 4DJFC 3JALA 4FYIA 3GN1A 2POQX 5C5DA 2HSJA 2QN2A 5A02A 1E6CA 4L50A 2E6KA 2ACKA 2BEKA 1B0AA 2JD2A 2I4LA 4G5HA 3OQ6A 4WQMA 1HT2E 2QN9A 4XGKA 3VC2A 1IQ0A 5A7FA 3EXG2 1FDOA 1U0RA 2HPZA 1XTQA 5JSKA 3K0AB 1AKYA 1H93A 4U6SA 1R0CA 3DC2A 1W87A 3LE8A 3HY4A 3AUKA 3LUBA 5ICCA 1S2MA 3FCUB 4QOSA 4L8YA 4QKQA 4CWAA 2PT9A 3OOHA 4L5YA 5G4LA 4LZWA 4ZHQF 3PTAA 2YHAA 3PGKA 4F11A 4H4CA 2VUHB 3GA7A 1PL7A 1NA5A 3FUCA 4O4HA 2R4QA 3QSYA 1RZRA 1EAYA 2ZYRA 1FMCA 3E7PA 2AQIA 3BCRA 1D5WA 1FYVA 3P9KA 4OQ4A 4XDGA 3K5PA 2ZJ8A 1TKRA 1XB2A 4XIJA 3NHKA 3DHVA 1GGEA 3K6SB 5EKTA 4L0QA 3IP7A 3E2IA 4NZNA 3RVKA 3E4DA 4QARA 1FFCA 4GI3A 4I8DA 1IIRA 1G5RA 4M38A 4MVJF 2OG2A 2R4UA 3PWKA 4JT2A 5HDBB 2VI5A 4MZDA 5JQGB 1Q0PA 2FE4A 2VZ9A 1GUYA 5KYNA 1Z13A 3TXYA 4Y18A 1PZEA 4R40A 5LD2C 1USGA 4GBMA 4FNAA 3JZAA 4M4SA 3FUWA 2JGFA 4PS0A 3RHSA 3TJMA 2PVCA 4MVJM 1XAHA 4WFJA 4ZI3A 1RZUA 5JQWA 3GFRA 2LDBA 2XE8A 3ND6A 1DB3A 2XGOA 4FMDB 4MEJA 5SICE 2P6UA 2KMLA 3G2HA 4JQSA 8MHTA 1P8JA 4TWAA 1UBRS 2VVTA 4PTLA 1Z4QA 2P30A 4K6KA 4ZICA 4OLAA 1I4EB 3JQ8A 4L3OA 1O6FA 4H7JA 1UZUA 1FMJA 1KVQA 2O7NA 1AQUA 1QZZA 4JJIA 2C2ZA 2DHEA 5ABPA 4RTKA 3LX4A 1V41E 1INLA 5CGQB 5J4VA 1E7WA 2OBYA 3DPSA 3G9QA 1M6EX 3KWJA 4TZTA 3BHJA 3BMNA 2FOLA 1GCOA 2MIIA 4IMJB 2H06A 4UVHA 1C1DB 2C5EA 1P4RA 4JLAA 4AMBA 4OHVA 3NHFA 1G38A 3RIXA 1DQNA 1RMYA 3SEFA 1SN7A 2AT1A 4G2NA 2GHIA 3A4LA 1EVZA 2ZB4A 3GEEA 3WMGA 1HYEA 3AVQA 1G5PA 4TS1A 3ZS9A 4DAOA 3N70A 4GLJA 3LMKA 3U44A 4DB2A 2XNHA 3D6VA 1OLSB 2QT0A 2PSDA 5H59A 3HJGA 1JS1X 2QGZA 5BNFA 4CN9A 1KI1A 2YWJA 4A8PA 4JAVC 4F91B 2ZSAA 1FNDA 3EEBA 4BC1A 4CV0A 3CWCA 4D9BA 1ULAA 2ZLBA 1G42A 5D7NA 5CM2Z 3IQZA 3HB5X 1P62B 1UJNA 3BK2A 1PWZA 3DDWA 1RLJA 2QZ4A 1V8FA 4D81A 1NBAA 1GILA 1HDZA 4P9NA 4IHQA 2I78A 1E9EA 3AU9A 3CNQS 3QI7A 1KEWA 4XSHA 1IBRA 4FSDA 3U62A 2OD9A 4HQFA 3HI6A 1S7CA 1T3ZA 2AR7A 3ROXA 3A9CA 1ADCA 2HRZA 1HQYE 2QLTA 2BDUA 1YRQA 1IK4A 4M89A 3Q10A 5FBRB 4V3BA 5K3FB 4IZOA 7GPBA 3W04A 5JFGA 3THWA 3ZHXA 4LMAA 5SYAA 4MVJE 3QW2A 5KQPA 1JPVA 4IQFA 4RKYA 2P0YA 4INAA 1A98A 3HVKA 3QFTA 3MCTA 1W94A 2FPLA 2VOJA 3OCWA 4PG7A 4WOCA 2EW1A 3M6IA 2DT8A 4OI4A 3FDXA 4B83A 5IF9A 4WVFA 3MCVA 3H1EA 3KJIA 4M83A 1ZOLA 1Z15A 4FFVA 4GSKA 2WFLB 1T4GA 4CL2A 2GTHA 4LYGA 2GH1A 3AXTA 2Q2NA 3EH2A 1N2CE 1VGVA 1O08A 2HYDA 5IDXA 3DEHA 3T0FA 5LP6C 2ZI9A 3NIFB 3ENWA 2QRNA 2WD9A 3KE8A 1PQ4A 2FWJA 3L7DA 1TJYA 2Y0CA 2REBA 1K88A 1RJ9A 2F9MA 3WYAA 5LYJF 4YMHA 2FUKA 4NMHA 3ICEA 3WGQA 2UVDA 1EWKA 1UKYA 2CZGA 3AQ4A 3GLQA 4JN6B 4AZ3A 4BNHA 3R3UA 3F9RA 2EWWA 1PZXA 2W5UA 5F5NA 5IW8A 2DUUA 1WSAA 4RLHA 3KR9A 5CLHA 1YMVA 4IH9A 2GD6A 3OKCA 4ZEVA 2E37A 2VP6A 5CVJA 3DULA 3OQBA 2O59A 1NKSA 2OBXA 3BE5A 2HR1A 4D6YA 4H3HB 4HDSB 2J3QA 3PNLA 7YASA 1KMMA 1OBFO 2WUGA 2E5FA 1QANA 1Z4OA 4I4IA 4R8MA 2UZ1A 1RYHA 3HFGA 3WGZA 4URWR 2R6DA 5J1SB 4UHEA 4PQGA 1UDAA 4BUJA 4EABA 2AG5A 1WMBA 3QKSA 1JQ5A 1H9BA 1TKBA 3WV5A 5EZSA 2ZYDA 1GEEA 1CUIA 3LKDA 5AOCA 5GV8A 3R9IA 1NM5A 3WLJA 1YBVA 3A26A 3DM9B 4ABTA 4ZZ0A 1KFCB 1O4VA 4CW7A 1TT5A 1E98A 1V3QE 1Y8QB 3CVXA 1SWWA 1II0A 3CNEA 3L8YA 2J6CA 4ONEA 1BS1A 2ORWA 2DY1A 2OHVA 2EBFX 4MI9A 3AG5A 3KNZA 1NP7A 1EH5A 1OAKA 1T8WA 2JJ2A 2IDZA 3CO5A 4JJAA 3IIKA 4P5EA 5LL6P 4QHYA 3OTOB 1H2RS 3NV7A 3TSZA 2Q3JA 4WOKA 1IBMB 4B85A 4TUYB 1VG9B 4YCCA 1QRAA 1ZC4A 3OBIA 1U1GA 1H0RA 2HAEA 2EJTA 4MUXA 3U4GA 3JQ7B 4MMXB 1I6MA 2MSDB 3K2IA 1TC2A 3RHFA 3PD1A 5I9SA 4EP1A 3SQOA 3FCXA 3H4IA 1I7QB 1ID8A 1KEEA 1UK7A 2OLEA 1K7EB 3H83A 1U2DC 3PC4A 3QM1A 1I3CA 4PGAA 5FTMA 1FP4B 2Q0XA 4MLDA 3R0VA 2QRQA 4QODA 4UHBA 1G5IA 1GSIA 1OU4A 1R37A 3BJRA 3LUDA 4PO9A 2FCRA 3NM4A 5C4MA 5EVCA 3GZTB 2EIXA 2GM3A 3ADBA 5DBFA 3HM9A 1ACMA 1CNFA 1TK9A 5K6TA 2ZJZA 1V26A 2IC5A 3C7AA 3KB2A 5EJ2A 4RSGA 4X3CA 5F7ZA 4NV1A 5C53B 4KDFA 4MW5A 1Z45A 1QU2A 1FXWA 5ALDA 5I4KA 2XAUA 4UD2A 1KO8A 1N9ZA 4US0R 2OG1A 1NR5A 4MV0A 4A15A 1Y5MA 4JD5A 1HH4A 4KXFB 3PFGA 4YGXB 2G9NA 4DMCA 3CT6A 3NDBB 3ZZ0A 1WTAA 3BM5A 2IXGA 3X1ZA 3A1CA 2QX6A 1OFUX 4C78A 1XLVA 2CNKA 4HNAA 4PX5A 1SC3A 5HM8A 2RGXA 1J5EB 2HYIC 2SKEA 3BD6A 3SP1A 2ZVQX 2ZI7A 4R41A 4KPYA 4V39A 3EE6A 1DRUA 1K97A 4HTAA 4I7EA 2DQKA 4NBUA 1NHGA 3BGWA 1AKUA 1LS6A 2R7KA 2W43A 3LV8A 3LXXA 1NY6A 3TZEA 3FVTA 2F48A 4K6CA 3CMMA 2Z58A 4NE9A 3K0BA 5L6LB 3RO7A 1N6LA 3GLFB 3AKCA 1H1DA 5ER9A 3UTCA 3WB2A 1IATA 4BQFA 2DKOA 4G4IA 2IYLD 2B1GA 2ZSKA 5J9FA 4EB0A 4RH0A 1ETUA 3ZGZA 3KHKA 4FYWA 4B2LA 3C39A 4HTFA 1GV1A 2WC1A 4QSMA 2QM7A 1VHTA 1E7YA 1N6NA 1J2JA 5ALHA 3WWYA 1EXNA 3RDPA 1UPUA 2XECA 5DWVA 2J45A 2R1VB 3KCQA 5GY7A 3CUSA 2YTZA 4ND6A 3HR8A 2UUBB 3CSDA 3NEYA 1P1BA 4R6WA 1WB4A 3VOSA 1P73A 3H9EO 2X3UA 4TT8A 4IPTA 2JFFA 3UANA 2CVQA 2QTTA 4FN5A 4FJ0A 5FPQA 1JG2A 3FTNA 4M