2VF4X

E. coli glucosamine-6-p synthase
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
359
structure length
359
Chain Sequence
GDKGIYRHYMQKEIYEQPNAIKNTLTGRISHGQVDLSELGPNADELLSKVEHIQILACGTSYNSGMVSRYWFESLAGIPCDVEIASEFRYRKSAVRRNSLMITLSQSGETADTLAGLRLSKELGYLGSLAICNVPGSSLVRESDLALMTNAGTEIGVASTKAFTTQLTVLLMLVAKLSRLKGLDASIEHDIVHGLQALPSRIEQMLSQDKRIEALAEDFSDKHHALFLGRGDQYPIALEGALKLKEISYIHAEAYAAGELKHGPLALIDADMPVIVVAPNNELLEKLKSNIEEVRARGGQLYVFADQDAGFVSSDNMHIIEMPHVEEVIAPIFYTVPLQLLAYHVALIKGTDVDQPRNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSAMINE--FRUCTOSE-6-PHOSPHATE AMINOTRANSFERASE
publication title Ordering of C-Terminal Loop and Glutaminase Domains of Glucosamine-6-Phosphate Synthase Promotes Sugar Ring Opening and Formation of the Ammonia Channel.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 123
structure length 359
sequence length 359
ec nomenclature ec 2.6.1.16: Glutamine--fructose-6-phosphate transaminase (isomerizing).
pdb deposition date 2007-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01380 SIS SIS domain
X PF13522 GATase_6 Glutamine amidotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 2vf4X01
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 2vf4X02
2Q8NA 2HHHB 4JI0B 4JI7B 4DV3B 4X65B 2YVAA 2UXCB 3FF1A 3HBAA 4U6NA 2A3NA 3UJHA 1XNRB 1X9IA 1T10A 2XHZA 4X62B 4DR7B 3PR3A 3ODPA 4OX9B 1HNWB 4DV1B 3QKIA 4B3TB 2PUTA 4JV5B 4DV5B 4B3MB 4LFAB 1XTBA 2CXQA 1VI6A 2ZJ4A 1JXAA 4AMVA 4LZJA 1MORA 4S12A 1JLHA 1J5XA 4LF7B 4GKJB 5LMUB 1KOJA 4GKKB 2I22A 4LF8B 1N33B 1G98A 1M3SA 3FJ1A 1JIQA 3IFSA 1C7RA 1X92A 2PUWA 4DR3B 4JI8B 4TOIA 4JI4B 4AQYB 2CXOA 1MOQA 1WIWA 1U0GA 1XNQB 4K0KB 4DUYB 1N34B 4DV2B 1GZDA 3TBFA 1J5EB 1IBKB 1IBLB 3HJBA 1I94B 4JI5B 4NXNB 1HNXB 2UXDB 1NRIA 2O2DA 1VIVA 4X66B 4JI2B 4DV7B 3JX9A 2UUCB 2UUBB 1ZZGA 2POCA 4LFBB 1XMOB 1HOXA 1N8TA 2X3YA 3Q7IA 3JAMA 3FKJA 2E5FA 3CVJA 1B0ZA 2I2WA 1TK9A 2PUVA 2CXPA 5BY2A 1N36B 3TRJA 1HNZB 5I01A 4LFCB 1HR0B 2WU8A 2CXTA 2UXBB 4X64B 2O2CA 1XMQB 1IRIA 3C3JA 5IT9A 3OOJA 1U0EA 2CVPA 4DR2B 1FJGB 4B3SB 4DV6B 4JYAB 2F4VB 3Q88A 5FLXA 4KHPB 2CXUA 1HM5A 4M0DA 1TZBA 3T1HB 5LL6P 4DR1B 4IVNA 1IBMB 2V4MA 4JI3B 3SHOA 2DF8A 4YHHB 3KNZA 1X94A 5BR8B 4JI1B 4JI6B 4NXMB 3M5PA 2VF5X 2CXRA 3FXAA 1C7QA 2CXNA 4EM6A 5A2QA 2VQEB 4DV0B 1VIMA 2CB0A 2UUAB 2DECA 2E5LB 2UU9B 4DR4B 1VI5A 3J7AC 3G68A 4LF9B 2VQFB 4DR6B 3NBUA 3I0ZA 1X9HA 2ZJ3A 5IWAB 2VF4X 4DUZB 1JEOA 3LJKA 3OTOB 3T1YB 2ZM6B 4LF5B 1GZVA 3BCHA 5LMNB 2XBLA 3BJZA 2CXSA 2J6HA 2AMLA 1NUHA 1U0FA 4DV4B 4B3RB 3J80A 1N32B 1DQRA 2PGIA 4LF6B 1TZCA 3ETNA 1Q50A 3J81A 4YY3B 3EUAA 1IATA 4DR5B 1MOSA 4LF4B 4S1WA
chains in the Genus database with same CATH superfamily
1L8LA 2FZKA 3EG9B 3EXG2 2JLYA 1HRDA 4RX1A 2B8TA 2W6CX 2HJRA 3DBIA 3QPAA 2C96A 2WZCA 3RUPA 1GUZA 3TZLA 3MJVA 3BH0A 4ECAA 1VRCA 2H1HA 3KQWA 3L1JA 3PK0A 4Y9TA 5SYMA 3UANA 3QP9A 4IJUA 3ZD6A 3QE4A 2WHRA 3I9NA 4UMEA 1J8YF 1XL0A 3TEMA 3E5NA 4BDSA 1NJ2A 2G70A 1L8OA 3L07A 2WFLA 4JLUA 5HF9A 1ZOLA 1TK3A 1AK2A 2ZANA 2GJ8A 5AFSA 4BPBA 1D2RA 1BJTA 1NXQA 2AH5A 5IU6A 3TXXA 1YRLA 3CFYA 1RYHA 3QXGA 2PZFA 2R4QA 3S7TA 5BXYA 4BCDA 4QYIB 2CWDA 4R98A 1L4HA 2BGMA 3REGA 1TYZA 5BSWA 1MBZA 2NQ8A 1XFDA 2CL7X 1E1KA 2WPDD 3GRVA 1I3NA 4PCUA 2DUNA 5AOBA 4YECA 2BGUA 3CX4A 1OROA 3CLUC 4IWXA 4WY5A 3KWFA 3PQ2A 3SR3A 2A6PA 2ES4A 3V9PA 3UYLA 5B1SA 4RTLA 1E1RA 2BJVA 2Q4OA 4M99A 2O57A 2X9QA 1XRMA 5GV8A 2UYQA 4DDUA 5HQJA 1NC1A 4M1SA 1LQTA 1V1RB 2XTAA 5BSMA 3VNSA 3LY7A 2P9CA 1KJYA 4J9UE 1YCHA 4RH1A 2H4YA 4B82A 2MT9A 4HAVA 3DC7A 3BWXA 1H9BA 3UO8B 2QY9A 4L22A 1Z45A 2X3YA 4Z86A 2ZJ2A 2RKOA 4L9SA 5EZQA 3WHIA 1ESNA 1CXZA 1R6DA 4OK6A 4TSFD 3V4VB 1E2PA 2CHQA 4Y1RA 3R74A 5KSOA 1CR6A 1R6VA 2B1JA 3SDSA 4ENRA 5J4KA 3I30X 2XMPA 3CVOA 3NHLA 2BMDA 2RCNA 2QN8A 2FP4A 4QYSA 4CEHB 3G17A 4CTNA 2ATIA 4V0QA 1MAVA 4QGAA 5F4ZA 5D3ZA 3ZV6A 2YBDA 3RYCA 1CG6A 2HJSA 2O48X 4B4VA 3EWNA 2L18A 3V7WA 2Y66A 4GQIA 4LI0A 4FHEA 4P2BA 4JBLA 5AKXA 4AJIA 1OYYA 2B4AA 2H4FA 3I0NA 4CZ2A 3LX8A 1RFGE 3LVBA 4D9CA 2FJUA 3I9V1 1E2NA 3A4YA 3MGKA 4RVGA 3DM9B 1I24A 5CGZA 4NV0A 1LFAA 3ZQUA 1CQJA 3DV0B 4K81B 3ROQA 3VKHA 3TWOA 1RYZA 1AA9A 1P6XA 2UKDA 3IPRA 3C39A 4R8RA 2XXBA 4J0QA 2VYCA 3CRZA 4ZPJA 4F72A 3H5AA 4KIUA 1EWKA 3FMVA 5KOYA 4LCBA 4IZHA 4MI1A 2PLRA 2PUGA 1G7CA 1ZK1A 1WEKA 3NLLA 1RC8A 1BCSA 3RFXA 1E1YA 3UW3A 4REQA 5KYUB 3WL6A 2W11A 3GPCA 4PAQA 1ZUIA 3O8QB 4EG4A 5FTMA 4URXR 5EWJA 3HKBA 5IKOA 1XZHA 2DPXA 4ZK6A 1A1SA 1IZ8A 3H0EA 4FHDA 2VO1A 1N8KA 2IU4A 1O95A 4RHUA 4BVKA 4JY7A 1GXSB 4MULA 3DTVB 4FWBA 1NRJB 3NAMA 4FR2A 3FJOA 5JAHA 4U02A 2H2HA 4KXYA 3BMCB 3ZW7A 5EWLA 5EKUA 2QMHA 2O54A 1L8QA 2AXEA 1ONOA 3M5WA 3J81A 2AMVA 4O6VA 5DHUA 2FLWA 3T3NA 5F9FA 3PG5A 4JB3A 3JYLA 5DIFA 4ZXPA 2OESA 1R74A 3G02A 3JWIA 1UMDB 4RFSB 1PVVA 4KOAA 4XZ3A 4EM6A 1G19A 2O2SA 4GG1A 1E61A 1H1TA 3CB4A 3PPXA 4NK5A 4X92A 1TEZA 4G0QA 4XCQA 5DK6A 3NKVA 1ORTA 4JB0A 4NBVA 3SQLA 1KEVA 4Q9KA 3BTSA 4JLBA 5LA6B 1JEQA 2C3UA 5JFTA 3DAHA 4TSFA 1TAUA 2VPYA 1PJTA 2IYFA 1F60A 2BL4A 4LFAB 1BS2A 1YO6A 3EF1A 4K9OA 1A2QA 4YP0A 2FZCA 4ZCMA 4ZT6A 2O8VA 5GIPE 3SLKA 1QH1A 3RU2A 4EJSB 3U2QA 2G4CA 5JXGA 1ZI8A 5DHRA 1VBFA 5AESA 2R48A 3GIWA 1A7AA 2VJQA 2VA8A 1W4BA 4Q1BA 1E1DA 4J1QA 3ZE0B 1HEUA 3S28A 2ISCA 3WMRA 3PITA 3ZEIA 3MRXA 5DBGA 2DQSA 2JH3A 1R2QA 3QPCA 4HLUA 3AI1A 4G0YA 4MXDA 4FS8A 3THSA 1X7WA 1H1LB 4BFYA 5C2JB 2JVKA 5C8XA 2FGJA 4JLMA 1LPPA 2XB4A 3GJ7A 1U4NA 1DLJA 2Q5HA 4MEAA 1NBAA 2FP3A 1MP0A 4RV5A 2QQ5A 4JI5B 3X3HA 3QLEA 4BLTA 2B7LA 2QX4A 3ADPA 3ICVA 3L7OA 4IIJF 2AZXA 3EEFA 4H08A 4C0KA 4YBRA 4S1PA 2UZ1A 2Y67A 3C7DB 4Y9UA 4WPGA 5E38A 3V9AA 3A4NA 2F9LA 4YO7A 3RRZA 2R47A 4ABYA 1RVV1 4C43A 4O2BA 1GHTA 4OB6A 5GGXA 3KQKA 1YOVA 1U8TA 3NT4A 1IY0A 3H2IA 1AC5A 3O7WA 2CVQA 4TRMA 5IG2A 1XZDA 1VSTA 2OCXA 3C7KA 3BGWA 1TF5A 3FNQA 4ECEA 3ZE7A 1MNAA 4AWXA 4E33A 5MFPA 3C3JA 4MGYR 3BBPA 2ZRCA 3PP8A 4KE8A 4JGIA 4NS1A 3ZKWB 1KI2A 1N1MA 2AKYA 3ZNOA 1HORA 2ANBA 2P7IA 1M2NA 3KLMX 1C1DB 3PWZA 3JQAD 3MFQA 4WRRA 3RARA 2JLRA 5A4DA 1TEXA 4RY2A 4ROSA 1Y5LA 3D3QA 5DOZA 3SZOA 3ICEA 2E1RA 2GJ4A 1ENOA 1TEVA 4X91A 1RWMA 1PR2A 4NBNA 1UPAA 3W8EA 5AUPB 1UBRS 2Y1CA 3K9LA 1GGJA 3P0JA 1WNFA 4NCXA 1FNMA 2IIBA 2X5XA 3L41A 3V2HA 3VVCA 3FPFA 2AOWA 2EFHB 6ABPA 5E9JA 1Z16A 4AMGA 4ZO7A 2IRWA 2GCIA 2REBA 4BFCA 1PFKA 4YMLA 1L5ZA 1ULUA 4FMPA 4LHXA 4R51A 1LF0A 4XB6B 4EVRA 2A84A 4UULA 1EJBA 2JDID 4D8XA 2LP4Y 1CW2B 3I53A 2WJWA 4H6PA 4I9NA 3AEUA 3KSBC 1G21B 2HPAA 3RAEC 4C21A 4O25A 3AHFA 2HNAA 3R7SA 3TZKA 3BCHA 1WB5A 3M34A 4GOKA 1HQYE 4YREA 3MIIA 1RXWA 1XCJA 4L0QA 4BO4A 4L2IB 1H9AA 3ICWA 2WSMA 3IR7A 4C0SA 2P9ZA 3GCGA 4ESOA 2EOAA 3AK4A 1OH8A 1EX1A 2GPSA 3BK1A 2GCEA 1MXFA 1L7RA 4M8NE 3BBLA 2ZT5A 4UW9A 3FDFA 3L84A 3L5KA 4CKCA 4NCIA 4CQLB 3VKFA 4R83A 1JKJA 4JASB 3FETA 2NUTA 1Z38A 3L8FA 4EW1A 5EKTA 4RPLA 3L0DA 3NTQA 3HI6A 5C3MA 1GADO 2G4LA 1VSUA 3PDWA 3TZHA 1TJYA 1YFJA 4PHTA 2K7ZA 5HEKA 4NYJR 3PR3A 1E9AA 3ODPA 4KLRA 1YA6A 5T64A 1NQUA 3HP7A 4D9FA 1GSHA 1RC0A 2P9BA 3JD1A 3QPBA 4EG1A 4XYLA 3PFIA 2Y3IA 3CZ9A 1IVSA 1I2ZA 2J3HA 2C9CA 4BVJA 4RY9A 1HNNA 1DJNA 4K1XA 2GDZA 3MAGA 4FFWA 5J2UB 3JVEA 1SEPA 4IFTA 2FFJA 5C51B 3ONEA 1JVSA 3K09A 5JPIA 2QXYA 2IA5A 1QB7A 1D0IA 3DMDA 4ISBA 1GL3A 5KMGB 2YHBA 3AHCA 4I8XA 5H70A 4C7OA 3FMFA 1I7QB 2VOJA 3MUFA 3PNKA 2O8BA 2O2YA 4Y6GB 1A98A 2H7YA 3SCZA 1MHTA 2YTZA 5E7MA 3EWIA 3DE7X 1WXEA 4PRZA 1F1JA 2ZYTX 5B1DA 1A8IA 2P9FA 2C2KA 2DPMA 4DHEA 5K9ZA 2QIPA 1V95A 5ALJA 5LQMA 4OBBA 4MOWA 2CNWD 4O4LA 3E0QA 4EKEA 1ISIA 1XMOB 4OX9Y 4RTPA 1SXQA 4WFKA 2R8RA 2OCPA 3LVFO 1L5GB 5L45A 2NU6B 2CUNA 2JDIA 4HQRA 2FR8A 2GYWA 3IKMB 4HZGA 4WGGA 2JKYA 2P4SA 2HT6A 2PWAA 4BNMA 1KQGA 1T1EA 4MPTA 4UFOA 4EG7A 4BY9E 2FE4A 2J8ZA 4L6AA 1LBEA 1DX6A 4GYWA 2IK8A 5AKGA 5DXFA 4IIXA 1Y7HA 4D4IA 4BV3A 4EJSC 4ZAYA 1ZKMA 1IN6A 3R41A 4IG9A 4NYMQ 1F0NA 4ADSG 4NVRA 2CF5A 3NATA 3P2JA 3KZ1E 4PYIA 1XHLA 1PJ2A 1SHTX 4LYGA 1JSRA 2R6DA 3A6DA 3NM6B 4PLPA 5EFZA 3OU2A 3RAPR 4B46A 5B7QA 5IYZB 1VB3A 5ADVA 1G7RA 1UBOS 3R23A 3R3JA 5E2BA 4K9SA 1UEIA 1Z3IX 4L4XA 3WSTA 4CM4B 2WE8A 3GBVA 4JC5A 2KLBA 3EZFA 1YASA 4HAXA 3SVTA 1JHUA 1UT6A 2QSJA 2F8MA 2I34A 4GPEA 4GXRA 4ZQIA 5K51A 3UUFA 5HGXA 4MLCA 3O83A 4M21A 4ZARA 3S2IA 3PEFA 5K3FB 2B2NA 3R6DA 4J0EA 4PFJA 1PUJA 2AWOA 3L7JA 1TM4E 5KNCH 3I76A 2VDQB 4AU1A 5CDTA 4AY2A 4YCJA 3ZLBA 3ANTA 4E13A 1EFRD 3ITKA 1DWPA 5HQ3B 4YAEA 1FXWF 2DSTA 4LTMA 4HGPA 1JA1A 2NGRA 3N70A 4EA7A 4WADA 4DUZB 2GEDA 3FM9A 4D9HA 1I7DA 2Z3WA 4HUQB 1E3IA 2QPAA 2H8KA 2YY6A 5M34A 2P2DA 3AHIA 4IWYA 5HPYB 2V3CC 2G07A 1M5TA 2C0CA 4FONA 1V96A 1FX0B 4CF3A 2FETA 2JGIA 2C4UA 4IIEA 2HRQA 4ZOLB 1B0PA 1ILEA 3K70B 2XDYA 2KBEA 2Q3HA 4IFIA 4C2BA 1ZVVA 4F4DA 3GLIE 3DPIA 2HMAA 4L7VA 2H2IA 2O8EA 4NAVA 3LSYA 4CDMA 1K5HA 2W2MA 3AESA 4R7TA 1P31A 4XGKA 3OZVA 2VHVA 4FK8A 3GLIB 2GM3A 3LHSA 4M8SA 5HJ5A 1U3UA 2O07A 1E62A 1ZXLA 4POAA 5GVRA 5KREA 3NIBA 3MGCA 1GQFA 3KB2A 2BRUA 2PS9A 1VG0B 2OZPA 4EVSA 4Z7OB 4MW9A 3HXOA 5CHEA 2OO5A 1XYVA 2WMDA 3FYUB 4FYXA 1NW8A 2XTZA 2RE8A 2UYYA 5C4MA 2ZBVA 3MCWA 1T1IA 3L7IA 5EHXA 3EZLA 3QVGA 3DXZA 2IU3A 4K6KA 2ZREA 4GRDA 4KV7A 1TECE 3BTOA 5EQTA 4BWVA 4C5CA 3L92A 2AHRA 3EOZA 1X92A 1KQFA 3U5ZB 4F4FA 1OILA 2M1XA 2OBNA 1K98A 2I2XB 3HB7A 4O59O 5CFLA 3QE9Y 5KOIA 4TYYA 3CLSC 5EZYB 1B41A 5GOTA 3RQSA 2WPNA 1VCNA 1NVGA 4FZRA 4TLMB 3OQ6A 2AFVA 1QS0B 2EFGA 4MV4A 2R11A 3EY9A 1F6DA 4I9GA 4B0OA 2EP7A 1RT9A 1VSQA 1C4XA 4CW7A 2IXFA 1G2IA 3AFGA 3DVRX 1H9CA 3I6IA 2QUZA 2I7XA 2AR0A 2I6QA 2IP1A 3CV3A 3LUBA 3D3EA 3LZDA 2Q50A 2IT1A 1DAFA 2JL1A 4I8IA 3HZZA 2PUVA 1PG2A 1YHYA 3NX4A 3M4JA 4G07A 4YIKA 4ZQFA 1AT1A 2GK3A 3R3ZA 4Q12A 5DBEX 3RC7A 2D0PB 3T5CA 2AJLI 3M8KA 5JY1A 4UBLA 1PV1A 3KOWA 3WZLA 1KYXA 1AHIA 1VYUA 2E6UX 4IDQA 3VAYA 4F4UA 3LX4A 4F3YA 4C2AA 1ZQ9A 2F1JA 1SUWA 4FYWA 1BEEA 3MD0A 4U4AA 4E1VA 3JRWA 3EX7C 1I7LA 1N92A 2GI4A 3THOA 1C0KA 2G63A 2ZGVA 3HB5X 4KEAA 4HDOB 2QD3A 4EUKA 2YQ4A 1UFRA 3FAZA 5D51S 5E4TA 2WJ6A 2V7XA 4RKYA 1ZA2A 2R751 3BQMB 1DC3A 1ES9A 3NP9A 2AFIE 4GM1A 3BK2A 1KAHA 4I5EA 4IW3B 4NFSA 1YUBA 4RMJA 4U7WA 2OGZA 4QGBA 5IVIA 4ALMA 1Z0KA 4AVYA 4NEGA 4ML3A 3SM3A 1M34E 3NRCA 2EJBA 3O6VA 3INRA 5IJ0A 1FSPA 5DN9A 3RC9A 2FG7C 2AFIB 1DO0A 2DECA 4CR8A 3AM1A 1QG0A 4LDNA 3M6LA 4AURA 4A9AA 2NTNA 1KMCA 2VWPA 4O2AB 1DWOA 1P0PA 2HIGA 2LNDA 2Z30A 3QWBA 3RUIA 3T06B 1U5AA 4EHAA 5F7XA 1V6CA 1UKAA 2IE8A 3LJKA 3PT9A 4YASA 2QMEA 2NVUB 1LBHA 5ILGA 2ZUWA 3BJZA 3IEKA 4RE6A 3TL6A 4AECA 5KYWB 1RPZA 5LXTA 1SOWA 1LQUA 3RH0A 3OJ0A 4O2LA 3BILA 5CT9A 5EIFA 1N32B 1IWPB 2Z2XA 5DM2A 1TZJA 3BXOA 3FRJA 4K40A 1RQXA 3RVLA 1FP7A 3TOCA 4YCSA 1PJ4A 1X3SA 5IH3A 3UA4A 1YVUA 3IHTA 3TBHA 3ZIDA 1S9HA 1X2BA 3V32A 1SU8A 2ERXA 3A06A 5FWYA 1E8NA 1GL7A 1NAHA 1H2HA 1DRUA 3DT8A 1DEOA 3GYBA 5JLJA 2AFHE 5K03A 2BFEB 1GQ2A 2RCYA 3R7BA 1E1LA 1YUMA 3FBTA 2XMZA 2CYAA 5HZKA 2FB9A 2RSLA 3INGA 1SVNA 2AFRA 4KQEA 1IN5A 1TM7E 3S27A 1IUPA 5AO9A 2AFHB 2QMZA 4XJSA 1B00A 4HAYA 1YU6A 2JRCA 2V8BA 3DP7A 5GONB 4TKMA 1YBMA 1E3SA 1GV1A 1RAGA 1S6YA 1GT6A 2ONZA 2P9JA 3DO5A 3GLVA 4MYCA 3WMWA 1EGQA 3WK7A 4YXWD 5CEEA 3B1XA 3W6PA 2C20A 2GBLA 4LXQA 1Y6QA 5EE9A 2A59A 3SC6A 1VP3A 3NBKA 5FBZA 3ORSA 2XOKD 1M3SA 4I4NA 3GD5A 4N6NA 4JDPA 2BR5A 2OV3A 2ZPAA 4PZZA 4PZ0A 5BSFA 2VP0A 4LYJA 4UMFA 5I7UA 1DC4A 1ZUNA 5BT9A 2OZLB 5I7WA 3LY9A 5FNVF 2SECE 1D5CA 3O8DA 4YAWA 5KTOA 4TX1A 3GD7A 2EQAA 1LB1B 4RACA 4G3XA 1KVSA 4XD2A 1W1IA 4YNBA 4KPFC 1OLXA 1HE2A 2JASA 1FXSA 1X87A 2RI6A 3KEMA 2Q6KA 3P19A 4F86A 1ML4A 1FFAA 1VQ1A 1W6RA 2DHQA 2I7TA 4MQLA 3CLRD 4AROA 1TADA 1ZHHA 1RADA 1YDGA 3N5KA 4IIYA 4C0XA 3V4RA 2D7CA 3B3QA 1N6KA 3MLEA 1LI5A 9ATCA 3FHTA 5DI3B 1GEEA 3VO2A 2O8FB 2YICA 1X42A 1EDZA 1UBEA 2VF7A 1DAEA 2HRBA 1ZUHA 2WP8J 1IK6A 4JJ6A 4DYVA 4GBMA 3JVIA 3SQMA 13PKA 1B6TA 1YH3A 3SM9A 4B3JA 5C8YF 5CBPA 4GGOA 1U0RA 4U5XA 1AE1A 2G5GX 1QF7A 4FJ0A 4JR0A 5E95A 3RLFA 3PWKA 3GB9A 3PDIB 3C98A 1VPDA 1XCPA 5FPHA 4JODA 2W4IA 2B3TA 4M0DA 4DC1A 1CP3A 4FOTA 1ENZA 5FBWB 4CKEB 2FQYA 2C4HA 4FNMA 2QTVB 5JVDB 1P3Y1 1OBHA 1R4NA 1AGRA 1U04A 4M87A 4R8MA 4KIJA 3BKWA 2GESA 2RGEA 3MWEB 2CXRA 4FXPA 3C1TA 4AJ2A 4I36A 4PPQA 3ZHRA 1PJZA 3IKVA 3ROPA 1T2CA 3TQQA 1S3IA 3OE5A 3L9WA 3Q10A 3EYAA 3WJ1A 5EAIA 3IKTA 3PGMA 3EZ7A 5KJ6A 3A9RA 1M2HA 4PANA 1PGQA 3T9BA 5TEWA 3HBLA 4YXWA 1ULTA 1QCDA 2ZJFA 1SVLA 2IYOA 4FIDA 6CHYA 3KSMA 2Z5LA 2RBEA 2G8NA 4HYYA 4LVOA 4WLNA 5DX0A 3BFPA 4H77A 3RFFA 3C8ZA 4A8JA 2VFAA 3FFWA 2ZU0C 4HQKA 5GP1A 3ZNQA 3O3OB 5C5EA 3WWDA 1N1DA 1NDHA 1U2RA 1Z4JA 4OQEA 3KELA 3F8SA 1N2GA 3GEPA 7YASA 1M6EX 4CMGA 3SYLA 4W5NA 4IHKA 3VO1A 1AY0A 3ONNA 4ITUA 5JAOA 3HRHA 1U81A 2AF4C 4LF4B 2ZRNA 3W2IA 3W9UA 4K9RA 3GT0A 3JQ9C 5EFOA 3TLCA 3AVYA 2AQHA 3OKCA 3H1PA 4Q00A 3VDXA 3RS5A 1C14A 1E1QD 4DILA 4N0QA 1YJCA 3GBPA 2B7CA 3B2QA 4UVDA 1GZ7A 1H8HD 4Q9IA 5AVJA 4X6XA 3ZWPA 1W9HA 2VS1A 3FUVA 4PR0A 2XCTB 4L15A 3DEFA 2SBTA 4YYZA 2DPYA 4DLXA 1DBSA 4RCYA 4F3KA 4X71A 2ZOSA 4KXWA 4X84A 4F5YA 3ISVA 4WHMA 2JVJA 3NYQA 5KWJA 4JCOA 1XVIA 3L6BA 3JYOA 1K5PA 4UCQA 4AJPA 1G8JA 1THTA 2VNSA 3HA2A 3ZWMA 4ZYVA 5F1YA 2PLAA 4ZGWA 3QHAA 1YONA 2RC5A 5A4KA 5BW5A 2JJ1D 9LDTA 1GAEO 2VH2A 3A3OA 5TDHA 1AUQA 3KQYA 4TMZA 4I3HA 4JFRA 2P5YA 1V9CA 1ZM7A 5FOUA 2K5UA 3S2YA 3D6UA 4A4DA 3SYMA 4ESVA 3P9ZA 3WWZA 4G8BA 4WLUA 2GJKA 2VHWA 3OQ1A 1E2FA 4BGEA 4G84A 4RMIA 3G1TA 2V5AA 3DLBA 1NNSA 4IIDA 2EX4A 2GHTA 2TRSB 1CPYA 1EFPB 5C4IA 1XAHA 5BOSA 4XQEA 2CLHB 4CL0A 4LJSA 4YUAA 4N5DA 4E12A 1DV2A 4ZVKA 2B37A 1ZIDA 1RLJA 3GNSA 2RH8A 3NC0C 2GAAA 5FHRA 2JIPA 3W8RA 3THXB 1Z29A 5I4CA 2FEPA 2OC4A 3MJDA 4EYSA 3CF4A 3WGIA 5CLIA 1ADJA 2FCRA 4WZAA 4BZZA 5IBRA 1YBAA 3D54D 4IYJA 4DZZA 5CA0F 1I7NA 3GZNA 5G0TA 1CNFA 2FMTA 5AJYA 5KSPA 4B0PA 1HFKA 3L01A 1P9LA 1NVUQ 3OIVA 4RXUA 1G1MA 3GJSA 3QOWA 4PQEA 3T4PA 2DFNA 4GXTA 3OMXA 1XYYA 1ZD5A 3NIFB 4Z9YA 2A5JA 1IHOA 2JGRA 2RIPA 5FCDA 3I52A 3SIWA 1X77A 1YQEA 3JPWA 4XVQA 4JSYA 4AB1A 1B43A 2Q8QA 3KT8A 5KJ1A 1HM5A 1HDRA 4DLSA 3VOTA 3THWB 3TUJC 2FN3A 1L7QA 1BG6A 4ZDKA 1O0SA 1OXUA 1E3EA 3DTNA 1KJNA 1GPJA 2OSVA 3BKXA 4GPBA 4L02A 2YVKA 5FQNA 4AKIA 4RKRA 5KC8A 2WV9A 1NPTO 4BB5A 3E53A 4BFUA 4U2EA 2Y1DA 3VC2A 1DBQA 1UPUA 2VJYA 3OM8A 2VPQA 3BIJA 1HURA 2FMHA 1USWA 3H8SA 2JGKA 1XB2A 4HEJA 3V00A 2VNHA 1QONA 4LOAA 4XCVA 4DABA 4M0UA 4MWSA 5JRDS 2PCJA 1EP9A 4EKDA 3D8UA 1PR0A 4EPRA 5A1JA 3C5VA 5FA6A 5KO2A 1SFRA 1RRCA 4YRFA 2Q5CA 4MI6A 2JJ1A 2UZ4A 1W29A 1SN7A 4PTZA 4DDWA 2CXSA 2YW9A 4ZVTA 2JFNA 1CQIA 1RBZA 1U7PA 3KOZA 2BGNA 3NTXA 3RC8A 1NNEA 1F5NA 3G0BA 3BB3A 3ZDAA 1YFLA 1XP8A 3DZBA 4GUDA 4BEJA 1VL0A 1TEHA 4NMHA 1XXHA 3QNUA 4LJ8A 4FDUA 1KEWA 3I9V6 4EECA 5LQKA 3C3BA 1C3OB 1Z2AA 3K6KA 1WP4A 621PA 5ITZA 4RUKA 4LYFA 2DBRA 4I55A 4CMAA 2OB2A 2QUHA 3PF9A 4GI1A 4IZOA 5EGSA 1YE8A 5DT2A 2DB3A 3DMTA 3B2EA 4Q7EA 3KJIA 5DX1A 4CKZA 2AEMA 4MIOA 3GGPA 2FFRA 2XVYA 4BP1A 3G0IA 4U2GA 5HRAA 4KX3A 1QZXA 3NDIA 1QPBA 1YQ9A 1CNMA 2DLNA 1U0TA 3IUYA 3Q3VA 2Q6VA 3HUTA 2IV7A 3S4YA 2OD2A 2NZ8A 1CUDA 1AKRA 4IFEA 3IGFA 3C85A 3INNA 3RK4A 1YIOA 2BBTA 2B4RO 3WNQA 4YQFA 1PFWA 1L7AA 4U6QA 1B8NA 3T9DA 1QTQA 2DTXA 4YROA 5H0IA 2P1RA 4EYEA 3SHQA 2QUKA 1W34A 2QX7A 1L7VC 3UQYS 5JNSA 2YW2A 2Q99A 3U7HB 2YJGA 3HQ4O 1JSZA 1N6IA 2IDJA 4RM2A 3TQHA 3RSZA 1Z7EA 4K28A 3L7YA 2XXAB 2D1TA 2OEPA 4NZPA 4MQBA 3U62A 3RS7A 1DEAA 3SF8A 4UBMA 1SCBA 2ID9A 5DJ5A 3C3KA 4NABA 1TMOA 4FLMA 3FUUA 3K8YA 1QFYA 4X94A 5JDIC 2BGGA 1QFMA 1OY1A 2ZIEA 2AEFA 1W93A 1HDZA 1MB0A 3EZ2A 2DR0A 1H23A 1VXOA 3ZJVA 4O4LF 2VKQA 4CL8A 4D98A 5SZKB 5LP6F 2K7FA 1O6CA 2VP4A 2A7QA 4Y30A 4US0R 4XDZA 1FP2A 4BNHA 2C9ZA 4CEIB 5FLKA 3QVWA 1KE2A 4R2HA 3IE2A 5HE8A 4Z0HO 1OFGA 3QEKA 2HCTA 4KI7A 5DSXA 3UJ3X 1ONNA 1LLUA 1HT3A 1IU9A 2ETXA 2C9DA 4HLDA 5JYCA 3GZJA 3DDSA 3VV2A 4A6EA 3C7AA 3ETGA 4FYMA 1E94E 4GC9A 4PHFA 5EQDA 1SEVA 3VHXB 1OLSB 1ABEA 4NYJQ 1NUPA 2GEKA 2DQ4A 3K0CA 1L1RA 3K9QO 2G9RA 3A26A 4QUJA 4R68A 4UUPA 2EJCA 4I1SA 4E5YA 3I6YA 2EW2A 2FG5A 5DGIA 1T91A 4GI7A 4N3AA 2PNFA 4FYVA 5F12A 4OQNA 3R9KA 3GJ6A 4UARA 4CQMB 1AK1A 1Q1ZA 2QVLA 4KVGA 1F6BA 1E6CA 4YGYA 1JQKA 1TCBA 3H5WA 1UCFA 5JQGF 4F5DA 1PDVA 2CB0A 4NBLA 2BEUB 3I1IA 9GPBA 5BYJA 5BV2P 3AFNA 3V4SA 1GCUA 5D1HA 3PXEA 3AKEA 2EERA 5CXUA 3DQQA 4TS1A 4C88A 1HDEA 3AJ8A 3M9XA 1PSZA 2P4UA 4WD3A 1ND5A 3ZWAA 4UKDA 3H0KA 3EQ9A 4Z1MA 1HRKA 3QLJA 1NBMD 3ZGNA 2ZUCA 5B1YA 1FMFA 3Q6MA 5K01A 1A3CA 3MTGA 4E5DA 1BU5A 4M98A 4TM8A 4KR9A 3ZY2A 3JZDA 3D0OA 1ARZA 4GOMD 3N87A 2IJGX 3C7CB 3DBRA 2KJQA 3AUXA 4HUJA 5CNKA 4ZANA 5ULLA 3ZDYB 5LQAA 3CXUA 4L8WB 2ZR0A 1BO6A 1PWZA 2A9VA 2BY4A 2F62A 2C3OA 4H3HB 2VRWA 4BFZA 1H4SA 2R5NA 5DIZA 3ZDBA 2FPPA 5AI0A 4NBTA 3HJGA 3HXTA 1F2TB 1KSFX 2HYDA 1B6GA 1WABA 2PLNA 1VJ5A 3NR2A 1UMKA 1JTEA 4XFJA 5FFNA 1MB9A 3D02A 1P6UA 2BMFA 4DQVA 3CVXA 4KLCA 2VEDA 2BHNA 1SH7A 4N4AA 5FTJA 5I7RA 3OQNA 3ZIAD 1R6XA 4IRXA 2WIFA 3WZ2A 3X1XA 4XXHA 3AL0C 1IJEA 1PJSA 1UKBA 1WXDA 2GM9A 2TSYB 5B3LA 1YD7A 3A4LA 3NHFA 2G9NA 1Z37A 3E7DA 4OJQA 4XIFA 3MUOA 2IXGA 3OZXA 3ZGOA 2GPNA 3RB8A 4CFZA 3NTVA 1YJXA 2QQEA 2GZRA 4LE0A 3DB1A 1Z22A 4G4IA 2G9VA 4PPYA 1SAYA 3AMVA 3EXIA 1XZIA 3IXLA 2QXTA 4A8JC 2DUJA 4JWKA 3ANMA 2WKRA 3L5OA 3ORFA 2VUHB 2HHAA 4PCVA 5JMTA 1OMOA 4BEWA 1FDRA 3NWEA 1IJKA 2FMIA 1YDFA 1E9CA 4BO3A 5H3LA 4DNOA 5FBVB 3A36A 5HTOA 1BDBA 2ZFUA 3PQ7A 3SC4A 3ZDZB 2GCOA 2XCSB 3KOOA 3CF4G 4FKZA 4FS3A 4J6EA 4NG4A 5CH5A 2ZXEA 8GPBA 2G9UA 2HREA 4MA5A 4PE5B 4X3PA 3KV1A 2CXPA 3NYRA 3SAJA 4BCCA 2G40A 5IM4A 4UUBA 3BAFA 3H2YA 4JSTA 2QLNA 2CXTA 2P62A 1F38A 4WIAA 3DKRA 2H07A 3IQEA 4PBTA 2B6NA 3CLRC 2B1QA 5BNWA 1P3JA 4LNUB 4JUFA 1WHTA 3G2PA 2ZIAA 3O3MB 4F96A 1NBMA 3AEQA 1Z6XA 3T95A 2KYRA 2QN3A 1E4OA 4QSMA 1SXJD 5JMPA 4BMXA 4U3JB 3GEMA 1AV7A 4I5IA 4TS3A 5JXJA 4ZA2A 3VC7A 2OAQ1 4LWPA 5TMPA 1REQB 1TTTA 2I9KA 3BAZA 4OLFA 3GFOA 1II8B 4NJEA 1EX7A 1ZD3A 3UH0A 4DXDA 4PAOA 4BLVA 4TXMA 3BE8A 1OOEA 5HFNA 3PXGA 2JJ8A 4Y18A 5CVUA 1CZHA 5DNAA 3ZLTA 5BMVF 5JAIA 2O8DB 3QIVA 1DELA 1VGVA 2OZVA 3C8HA 2N0SA 4RETA 2PT6A 1M8KA 3FXAA 4ZU6X 4QVIA 1Y3BE 2QENA 1CJUC 3HWRA 3W3AH 2B1RA 3HCAA 1QB8A 4BP3A 1DZ3A 3QYFA 4N03A 3J7AC 1FCJA 3O31A 1WSDA 4JXJA 1KOGA 2Z09A 5EQJB 5CLFA 1Y8RB 5EJ7A 4MW0A 5DBFA 1WAMA 3F6EX 1OX5A 3FFAA 4RNDB 1PT5A 4EG6A 1JT9A 3Q5GA 2PJRA 1ZISA 4FB5A 2O5VA 5AW1A 3LF2A 1Z6YA 4FYJA 1KSGA 4J0DA 5JO9A 4Q47A 1JIXA 1BW9B 2M6KA 1AUPA 3P0IA 2YH2A 2BBSA 1J4AA 1WXWA 2RKBA 2PMBA 2IY8A 4FFPA 1FNBA 5JHGB 5TPWB 2AN3A 2DCMA 2B0JA 2ZYSA 6AT1A 4TV9F 1W52X 1MTOA 2MSKA 4KXFB 1ZXBA 4Z0TA 3H9GA 4YMUA 3DMNA 1VTKA 1DDOA 2VI5A 3KQTA 3P7MA 1UADA 2PX4A 2Q4TA 4J2TA 1EYZA 4AUEA 4BHTA 4F6RB 1MAUA 2HTEA 3I23A 1GQSA 1H0KA 4HLQB 2PUTA 4O33A 1K3TA 1RFLA 4RTRA 1NYQA 3BJIC 4Q1CA 1T5DX 3EUEA 5FPPA 3OVMA 1ZGBA 1TQHA 4YJ2F 3O4IA 4YI3A 3FSGD 4QOJA 3UWSA 1PLJA 1UDWA 2JFWA 3IKLA 4UOQA 3R9IA 1FYFA 2G36A 4GMGA 3QYPA 4GSKA 2VRCA 1B73A 1PQ4A 2HRZA 3RUHA 3L8ZA 1KI4A 1NJ1A 3RFVA 3TJRA 1VL6A 1JDUA 3DFMA 2ECPA 4H4DA 4H3SA 4YH1A 1RQ2A 4QUEA 1E98A 5JUWA 2KI5A 4DA7A 2MINA 4MJ7A 1SOAA 3R3VA 4FN4A 2V7GA 4J0CA 3UFXB 3OZGA 5AHOA 1JHXA 3ROFA 1KZYC 3AQIA 3WGKA 2BFOA 2ZAMA 3ZHTA 1C8VB 2PKEA 4S2UA 3IQXA 3IVGA 2IVZA 2CHEA 1VSVA 2QP9X 2XCUA 2ZR8A 2ZSKA 4MVJI 4NZZA 1OH6A 3AUKA 1NULA 2GWRA 3IEPA 3NEPX 3G79A 3MILA 1RXIA 4NC9A 2Q4EA 2RDMA 3OCVA 1ZRSA 3F3YA 4HMOA 2RHRA 4EHNA 4F2WA 1G3QA 3BSYA 4QLOA 5TVKA 1KK2A 5H5JA 4AKTA 1Q20A 3VSDA 4FFDA 5KYYA 4KXLA 3PQ4A 1GAJA 3KYDA 4Y2JA 1KEUA 1Q77A 2Q6LA 1GNRA 3FLAA 1ECCA 4FOLA 2XYHA 3S2SA 1V4VA 3A8TA 3BRWD 1I4OA 1FTGA 2A8YA 3O03A 1TZBA 4MB0A 2WDZA 1A5BB 3LUJA 4RPCA 1P2BA 1TA9A 3O1IC 5DCLA 4CTMA 3U56A 4XWAA 4HN4B 1Z7BA 2D2VA 3K0AA 5IVHA 4RJTA 1ADGA 4HZUB 4L78A 2DKFA 5EP2A 5HIJA 4MV8A 5CEJA 5JASA 3TM5A 4E70A 1XHFA 1RWOA 3MS4A 1GRVA 4XWGA 5K3DA 3GLFA 2PAFA 5LU9A 3QKSA 2GXSA 2C2GA 3MELA 3DQZA 1T15A 2FFQA 5ECDA 5FOQA 3TTVA 1ADCA 2F9MA 1RZRA 3FSGA 5E6RB 1IM8A 4HQNA 1NVTA 1XMJA 4ZICA 1MA0A 3NCTA 4F3CA 3P2YA 1SHJA 1DAOA 2AMLA 5FFMA 5CG2A 4N5LA 3QYJA 1K89A 2RD2A 1RKUA 1Z4LA 3U3RA 4F3TA 4Z2AA 5L4SA 3JAKA 3AI7A 4L4ZA 4JHXA 4LZLA 4RPHA 4XEHA 3ZXXA 4A0HA 1KZGB 5KJCA 3L46A 2OOKA 1LPAB 3H42B 1JE1A 4IKEA 5DBHX 5FF9A 1PCXA 3W3ZB 1N0IA 4LBZA 4OF4A 4AIRA 1CC1S 3F9RA 2PBZA 1N4DA 2FA9A 4N0MA 1AUXA 4Y67A 2GJAA 3U4GA 2NSYA 2AN9A 4YV0A 2IYNA 4UNQA 3AWDA 3T1NA 3VA7A 2QYOA 2WAOA 3JRNA 4M89A 1BXRA 4NARA 3HVUA 3ZZMA 2VPWA 3CKMA 4NU6A 3E5HA 4JUAA 3E22A 2CC2A 4X1KB 4OU4A 1QMGA 3H5VA 2RHHA 4G1MB 3IESA 3KZNA 4L3WA 4NHOA 5C18A 1YTUA 5JSYA 3UMFA 2GLTA 4DBLE 3Q8KA 2J3EA 1PYDA 3BHIA 2X8AA 1ZSVA 4BKPA 4KSBA 1EGMB 1JLHA 1UXOA 4D56A 3H5IA 2DUMA 4GQBA 5B6PA 1KJJA 4B7CA 1YIDA 2LIVA 2F8SA 1TYBE 1B93A 2R7NA 4KP7A 4OD0A 3CEAA 3HCWA 3Q2OA 1N2CE 1RWXA 2SCUB 2JIOA 3E82A 1D04A 3BHNA 1IN1A 3BRWA 3OJOA 3M4XA 5HS6A 3RG2A 1AGXA 1ST3A 2G3YA 2I6SA 3ER8A 5FO1A 3AVUA 1LLQA 3O26A 3KJQA 3V7YA 3G9TA 2OMKA 1JHAA 4A92A 2B6HA 2XNSA 1WHSB 3CPHA 2A5FA 1EM8B 4C5AA 5JD4A 4OHMA 1R0RE 1KORA 4A23A 2CNOA 2ZRFA 1LPMA 3E5MA 3UT5A 5CFRA 3ENKA 1LBIA 2HDOA 3D8NA 4CIYA 2HU7A 5CDHA 1LV8A 2WF8A 2YJ4A 3UHFA 1ZW1A 2V9PA 1PT6A 1QVVA 3HDVA 5BY2A 3I9LA 2UVPB 4FMDF 1C2TA 2QJWA 3EC2A 2D5AA 3LE8A 3OF2A 1DG3A 2J6IA 1U2DC 5D01A 3O4GA 3ZV3A 1YBFA 5A6SB 1TM2A 4NESA 1I6LA 2FSHA 1FRQA 1O97D 3AOEA 3AFOA 5BSKA 3K0EA 1U7ZA 5JAMA 4FQ7A 2CWWA 1Y4ZA 4CIXA 3EGOA 3PGXA 3ZCXA 4FQ8A 2ZDHA 1YMVA 3VVMA 4FOSA 3BA1A 2NV0A 4UHFA 1M7BA 1ZC4A 4J0JA 1LWNA 4Q3OA 2AB0A 2PKWA 3C5EA 3FNGA 3VOAA 3LPDA 1P5JA 2C78A 1OAAA 1IAQA 4UTXA 1QX3A 3PUIA 1M5UA 4XUDA 4MW4A 5K99A 4Q6BA 3UJ8A 3BMOB 1QDLB 3KKPA 1SKMA 4NH4A 2BEVA 3GA0A 3TX6A 3P27A 3PFBA 5F4BA 1GFIA 4TV8F 4G5XA 1GNQA 1R5BA 3WNVA 4YCNA 1D0VA 2PXXA 1B15A 3GJ8A 1NBIA 3NIDB 3TEJA 3WBKA 3DL2A 4HGRA 5HYVA 4O8ZA 4ZFNA 3L06A 1FYWA 3A9UA 4PVCA 1UXGA 2B2XA 1WPQA 1Z73A 5TJHA 4CHTA 1JQJC 3C5CA 5THXA 4GX1A 4PN7A 4IQ4A 2Q3MA 1Q3KA 1QTRA 3FOWA 3L43A 1J42A 3G5LA 3L8DA 5G3ZA 1VPLA 1QHHB 3DWIA 4HYQA 2R4TA 4Y6SA 2M9MA 1FTWA 3EGEA 2X86A 3RF7A 1UFOA 1QQTA 2CCJA 1PZNA 4G4SO 4YONB 4FMCF 1KR5A 4JBWA 2ORYA 3BN3A 1XRJA 2VCHA 3A10A 3PQ3A 3AIIA 3R40A 4UEOA 4G0VA 2G80A 3A1WA 4LMRA 4QDZA 4RY8A 4YUXA 1ISGA 1L5LA 1Y7LA 3PC8A 1CY0A 4NPCA 5CVTA 1CQPA 1N7HA 2J5XA 5CLGA 4PYOA 4BXOB 3CUEF 1ONPA 2IYXA 3FWYA 3KZMA 4D6YA 1Z5GA 3Q3GE 2IPOA 4YRRA 5D3MB 5H3CA 3WQHA 2CV0A 1YT5A 3E48A 3DE2X 1O96B 1GU7A 4LGYA 1P0MA 1C9JA 2H63A 3CCBA 3C6ZA 1ZQ1A 4F5EA 4Q4AB 4GQAA 3QVTA 3G2MA 3BXZA 3FJ1A 2GZDA 1U0NA 1VLZA 5DNWA 3TG2A 2FHPA 3BMNB 4KPYA 1I3KA 4ZDWA 2XYRA 1E32A 1NQVA 2O3QA 4PGHA 1U8CB 4I66A 4ICIA 2QLMA 3JQ8B 1TGYA 5IBCA 4JJAA 1QV6A 4D1YA 4BLQA 1F4LA 1SCAA 3DJFA 3H2BA 1Z47A 3V6LA 4XYGA 5TB5A 4RA6A 3DBLB 4CKWA 1TUBA 1QIMA 1X8LA 2FUCA 2XY4A 1V45E 3NM4A 3JVDA 2GVNA 3IQHX 1UUFA 2NT3A 5EE3A 5ILOA 3DKVA 4JZKA 2UUBB 1E59A 1WUIS 4ZKDA 5KBYA 4K8OA 1HSZA 4Q15A 3TDNA 1OBCA 1VL5A 2YWHA 2ZYDA 1HGXA 4UJ3A 1AB6A 2CJWA 4XIYA 4C20A 5DXJA 5AW4A 2BCEA 4UDYX 4DJ5X 5B7PA 3UF0A 4LDJA 1NC3A 5EE5B 1TAQA 4H59A 1SUSA 4HNHA 3HBNA 1NNI1 3QLVA 1OFUA 3DD5A 4ER0A 1DPFA 4KBFA 4CKWB 1QFXA 4DNXA 2ZJ5A 4LHEA 4PLCA 5DNDA 1P4GA 1YA4A 1W8DA 2P9EA 1LEHA 2HO4A 3AINA 1J2TA 4HF7A 4G41A 4Y2SA 5I7HA 3CEHA 4JJ4A 5DI9A 5KSWB 5A5GA 3M3DA 3YASA 4N12A 1GV0A 2P3OA 4JYAB 2OV1A 1Z7WA 2PZMA 5B4VA 2QGNA 2WTBA 1FP6A 3ZE6A 3OM0A 1OAOC 3CNBA 2Q3FA 4V3CA 3VR4H 5BUZA 5E8JA 1SXJC 1YJQA 2ZVQX 3FB4A 1WDKA 1YQWA 1FYVA 3LUKA 4DLRA 5CFPA 4JC8A 1V43A 4MAAA 3V4LA 4X1IA 2X8JA 2BF7A 1IZ7A 2PBFA 2OLEA 4LE1A 3QWHA 4Q5IA 4JI6B 4UM9B 1BWSA 2WU4A 1X1QA 4JR2A 3RT7A 4OHKA 2GWHA 3HJNA 3HNOA 3EARA 3P9YA 3RBXA 3NOQA 4A2QA 2C99A 3SU8A 2ZCUA 3PC7A 4FBGA 4ID9A 8OHMA 1KXJA 1X8KA 3SJAA 2ZIUB 2EDAA 4V0NA 1BE0A 1VRWA 5JWHA 1J7KA 3OEHD 1Z35A 2VQ3A 1D4FA 2P9GA 4DYHA 2OENG 2PYZA 4GR5A 1M2WA 4PIMA 5IXSA 4DN6A 4Z99A 5JJLA 3K9CA 4HDSB 2CK3A 2D5LA 3JYPA 3L4EA 1J20A 3VDNB 4HB0A 4JB2A 3A2MA 4QX6A 4B3HA 4A1OA 2QL9A 2WM2A 2QXUA 1KQOA 4KNVA 5LQDA 1ECGA 2JVIA 2YHIA 1K7FB 2P69A 2QTHA 1KO5A 2VT6A 5K0GA 4O4IA 1QFZA 2VOEA 3UZUA 1HZZC 4N0PA 1YNOA 2IZ6A 1IOZA 1N9GB 3IQZA 4LY9A 3B9QA 3ND5A 1CUZA 1Q1QA 2J45A 3CLKA 4K6CA 4W5HA 4MVJH 5DMXA 2P68A 3RYHA 2D74A 2UXCB 1KPIA 3AF6A 1RIFA 3K9FC 2XMCA 3HB4X 3HXLA 2D0OB 1SHUX 1XJQA 4Q05A 3BRQA 4A7PA 5B4TA 4QXOA 3C3WA 1KE1A 1TUEA 2PZAA 1RQRA 4ZVVA 4CG2A 5BN3B 4U7FA 1SKYE 4BFLA 2HFJA 1DLIA 3V80A 3INYA 3TS1A 4R1LA 1L7NA 1W85A 5LD2B 3KKKA 4ZJPA 3EEOA 4YJDA 3AT1A 2OP0A 2I1WA 1XE3A 1OLUB 3FHOA 3QFFA 1CBUA 3OZBA 2GPJA 4XX0A 3L8EA 4TYNA 1CYEA 2A9FA 2QTWB 2WD9A 4QAQA 2NT4A 1NX6A 4FGLA 4U9UA 1TX4B 3HEAA 4RVUA 3C3XA 3T3PB 5JATA 4TOIA 1GU1A 3I73A 4UE6A 1AZLA 1PJRA 1QYXA 1DUSA 4IHJF 5DLYA 4P7JA 3EULA 1PQPA 2PK3A 1TD1A 4B71A 2IF2A 3ANNA 3TBFA 4EQ6A 1AHHA 2P30A 3BEOA 4Q66C 4EB6B 1DU4A 1P8AA 1SKBA 1EVLA 2DYKA 4LMAA 2W90A 4PW0A 1F7VA 3EA0A 4DGSA 2YIVX 3FGNA 3H3FA 3KJZA 3IIMA 3A9VA 3M6AA 4B81A 1CETA 4L57A 1OTHA 2O5CA 2NU8B 1N5KA 2IFTA 3MT8A 3PCXA 2MSWA 1RHRA 2VTKA 5TMBA 3QPDA 3H9CA 4CMEA 2B82A 2WFZA 4PHGA 1J6UA 3DVLA 4DS3A 1DOAA 3L4BA 4B6SA 1NG9A 4YV2A 2O7SA 3L3BA 2FG6C 4RQAA 5DGXA 3DWGA 2B7BA 2FWJA 4BIMA 1K06A 3GJ5A 3HY6A 4D4MA 1T0UA 5BQ5A 3DCYA 3KHSA 3QH4A 2WJZB 3Q7QA 4P33A 5CB4A 1M9NA 3LBNA 1X7DA 3FOCA 3GRKA 4K2HA 4NONA 5D8DA 2IS2A 4LJAA 4BVEA 2DBVO 4A0RA 2PCLA 4PFKA 3N0TA 4R8LA 1MO2A 1NGSA 2H4ZA 1DAPA 3LA6A 3W2TA 3EVFA 2Q0XA 3O8RA 3O4FA 4R2LA 4D9EA 1E96A 2AD1A 4NZ9A 2IXEA 2RGNC 3AERB 3RWMB 1XZPA 5MN4A 3KCQA 5AP9A 3LI2A 3WO0A 3BX1A 2WFLB 3ON5A 3CBQA 5BSGA 2W9XA 2XTNA 2CGEA 2JNWA 5JZBA 4DV0B 2YR0A 4ZXFA 5HIIA 3DJYA 2A9OA 3D6AA 4RQBA 4TMTA 5IAAA 1EFHA 1FY2A 3COVA 3OOYA 4BWFB 3IO3A 4C7VA 4BIIA 4DCGA 5HUHA 2VQFB 4YPFA 3TQSA 4JLVA 4Y9DA 4BMVA 2OYSA 3UY4A 2E82A 3NRJA 1PZGA 4E3WA 4EGSA 3OTOB 1X2EA 4L0CA 1Z13A 2C5EA 3CSDA 3UV6A 4EYKA 5FNVB 2LDXA 4V39A 1QC5A 4IGFA 4WKNA 3NDBB 3DDCA 3FDIA 2WSSD 1TE2A 3FOZA 3SVZA 1TB4A 3OEWA 5F5XA 5NLLA 3PEYA 4IY1A 2OFOA 1GKIA 2FJ0A 3NWBA 3CH7A 5F3WB 1GTG1 4C2TA 4G5OA 2HR1A 3HKDA 1EI9A 3H2SA 4MWZA 1JG2A 2Q07A 1E1CA 4NATA 1E20A 4OMFG 2FW0A 3C8UA 3PXAA 4ZWNA 4Y1RB 3T7DA 3WLEA 5B3AA 4A2CA 4DQKA 5F7OA 1VHTA 5ADWA 1EESA 1KFJB 1WMFA 3L4JA 1J00A 1QR6A 3WGOA 3AVWA 4JBHA 2FR1A 1XQ6A 3PFCA 3PHJA 2VA9A 2FP4B 2HKIA 4MJXA 1Y3DE 4DDMA 5C8YB 3UWDA 3GRPA 1WR8A 4NEHB 4XLTA 5TMEA 3HJAA 4YRCA 1GRRA 1KRXA 4BKOA 1T3SA 3PRKE 2REXB 4Y8VA 3RYCB 4H15A 4DMLA 4Z6KA 3W0LB 4EW6A 5B1EA 4AKGA 3QGMA 1Q17A 4NPAA 4DLZA 4URWR 4KRYA 1DIAA 3ZD9A 5EXSA 5IARA 2FDCA 4MRVA 4ONEA 3GJTA 3EBOA 1PGPA 3CNQS 1R12A 1YACA 4HFNA 1OR8A 1CQJB 2XR1A 2EWMA 2PUWA 3K4HA 4IZ6A 4XYBA 2NX2A 5FD8A 1SO8A 4F4CA 1I14A 5M7EA 3I37X 4YP9A 2EHJA 5T4EA 2F3QA 2J0EA 3V1LA 2YWEA 4I5DA 3O93A 1KYZA 4RQTA 2J33A 2Z9BA 3NTUA 4QLAA 4UXHA 4DUYB 3IJRA 1D9ZA 3QUTA 4G5FA 1PGOA 3LA8A 2HF9A 1AKEA 1SJ9A 1YMQA 1W46A 1EHIA 1DARA 1DXOA 4L8VA 4REQB 5BVGA 2JJQA 1ZVQA 1XEAA 1KMQA 2FH5B 3HL4A 4DHWA 2OORA 3HGTA 3IP3A 4GMXA 3FNIA 4P3YA 2YV3A 3HKBB 1VE6A 3G8YA 4MMZB 4LFBB 5B3JC 5A9TA 3HXMA 4R81A 1TLFA 3R6WA 3MMSA 2HCFA 2E5FA 4ASUD 4CCYA 4LDQA 3BC1A 1V39A 4HRYA 1CIJA 2DFDA 2CBGA 5FOVA 5K6AC 2Q5IA 1V11B 1IBMB 1FU7A 2VDWA 5KWVA 3H19A 3LLVA 4U0KA 2QRPA 1PR6A 2IHBA 1KZ7B 1C9DB 1QBKC 1DTEA 3DS8A 3L8YA 3HB1A 3RO7A 5LD2C 1HFJA 4BE9A 3R7FA 2CFSA 5HBRA 1JAXA 3KJHA 5IC5A 1JFSA 1X80A 1HTTA 3NG1A 3AIMA 3OF5A 3G6KA 4CR6A 3EVCA 2X0IA 3CF6R 2JLVA 1FJGB 1WXFA 2F00A 2V7UA 1HFWA 1O97C 3OZTA 4ZC1A 2WINI 4HGYA 2IBSA 1JEQB 2YZ2A 2BFNA 2KS6A 3BQ9A 1CB0A 1ULZA 3F6PA 2EIXA 2V7BA 3R3YA 4KGZA 2XCOA 4Q19A 4KQWA 3VZPA 5IKXA 2O6LA 2B61A 3L1KA 4KK3A 2W22A 4J91A 4RPGA 3KAJA 1XPUA 1LVHA 1NLZA 3FTDA 1I4TD 4PX2A 5KCMA 3TZ6A 2VSXA 1EUCA 4NENA 3ZZUA 1KP2A 3QPWA 2FZVA 1PD1A 3I28A 2VTBB 4NG5A 4IUDS 1M1XB 4R9NA 3O7MA 1NRWA 1QUFA 1DCKA 3MCVA 3ZTTA 3NV9A 2J08A 4L72A 4DWJA 4PG7A 3S1AA 3KZCA 3OURA 1X7WB 4J7UA 4UHBA 1U5BA 3BE6A 2FJPA 2D00A 2QTMA 4NYIR 2ZBGA 4IBOA 1Z34A 3VBEA 3D4BA 3MJSA 1GZ4A 4F92B 1DDGA 1Y3CE 2A88A 2UZ1B 1M75A 2GBGA 3AR6A 3OZ7A 4KFRA 4RF4A 3BJMA 5IK2D 1WF3A 4TMXA 3ANSA 4O2BB 3CISA 1JR4A 3VISA 4RYDA 3WLMA 4OB7A 1AGPA 1YOVB 2JIMA 1QOPB 3RYFB 1R0ZA 4YHBA 2OQRA 1ZRMA 3ZVKA 1V8FA 2CZCA 3OQIA 1AQJA 4AY3A 3LC2O 3QJYA 3WL7A 1OXMA 1VYVA 4ASUA 1IIRA 5TVGA 3SHTA 4KITB 5CNMA 5HMMA 1UK8A 5T67A 1NR5A 3SP1A 3DE1X 4MA4A 1YS4A 3HYLA 4KKXB 5AKEA 5GV7A 3W9BA 2RGCA 1BDIA 5TQ2A 2DG2A 1W87A 4ZIRA 1QKJA 2P1DA 3O3NB 4CM7A 1AIPA 5ALEA 3K71B 1FDSA 5HKLA 1Q0RA 3B85A 2VN8A 3NPMA 3A6FA 1GRNA 1JU9A 5K2MA 5LOVA 2ZB8A 3ANYB 3PJFA 1KERA 1LD3A 3I9KA 4LY6A 4C07A 2JFVA 4AS1A 2YV1A 4PAMA 4MQ5A 2JFXA 3LPLA 4P83A 5J2TF 4EMBA 2PS0A 2JA1A 2QD2A 1XVVA 3P2EA 4MI3A 3CW8X 1BA2A 1XXLA 2GCNA 3AHDA 3PKJA 1L6RA 1I94B 2OY0A 1XG5A 2B99A 2QLBA 5EJIA 1UIRA 2JFQA 1WMSA 1Y8CA 4G9BA 4JZYA 4RDCA 4YDSA 2CDRA 4EJ0A 2PNJA 5FUVA 4EY6A 4QUIA 4GPTA 3ZX4A 4BO7A 1J22A 4RZQA 5BURA 2HGSA 3Q7IA 1EIZA 1M2VA 1GR0A 3I64A 5EXTA 3TK1A 2ZIWB 3QXHA 4NFLA 3O4HA 5C34B 2GAJA 3TSOA 3WLOA 2PU7A 3E9YA 5JTTA 1H4VB 1VJCA 3EASA 3L8CA 4FWIB 4KR7A 1H6DA 4KGDA 3W5AA 1UC9A 1GUBA 5KNCD 3EOBI 4LVUA 1NW7A 1YS6A 1WVMA 4CKCB 3OOWA 4HMQA 4JAVC 4R9UC 1P2GA 3O1HB 4UBIA 3WLPA 3Q87B 1UC5B 3ZWXA 4ENWA 1JKJB 4WERA 2CVPA 5AKZA 1VM6A 3BD9A 2VSFA 2GN8A 2VDOB 2XT0A 3KQMA 3OIWA 2X15A 3WGZA 5IK2A 4EGCB 4F9GA 4B87A 1XO1A 2GD1O 1CUHA 2PMDA 1FS6A 4UNSA 1IOVA 1C7IA 3QMWA 3U7GA 1PNTA 1WCYA 3QG1A 3LHKA 4D9NA 2CLEB 1MAHA 1L5SA 2VXYA 3QF7A 1YDEA 2W98A 4MKHA 5EVCA 4YRGA 1Y63A 3AY6A 3G9UA 2XPCA 4OP1A 4RE5A 5DFAA 4AJJA 5JYBA 3MT0A 2EZ4A 3A28A 4IXTA 1XQ9A 4FE7A 2XZTA 5CVCA 3VHQA 4WV3A 1V3TA 1HE8B 4PZCA 4WZBB 5B58T 3K6JA 3ER6A 1SC3A 2WJ4A 4RSRA 2WA2A 4MV6A 3EW9A 4P4SB 4MGEA 2O8BB 3W1VA 1YC5A 1ZJ4A 4J2OA 1JJ7A 3SX4A 5DTEA 4CR7A 4CGZA 3CTPA 1T9BA 3WGQA 4KKVA 5AOVA 4KIGA 5KWEA 2WT8A 3PQDA 3DOOA 1W0JD 2NO6A 4RD0A 1Q6ZA 1ZD9A 1TT5A 3DXFA 4IGEA 2GT1A 2Q6IA 1A9TA 4O4LB 1GD1O 3CNLA 3URKA 3VX4A 5DGDA 3H8VA 2I8CA 4A0QA 2FX5A 2WYOA 1PX2A 4HWPA 4ZJZA 3GN1A 2APJA 3NHRA 3A6ZA 2Y92A 4WKPA 5K8VA 2VYND 1G17A 3PNQA 3WGLA 3O9VA 3OCZA 3SEFA 2O3TA 3OHSX 4MVJM 1XZBA 5A4IS 1H6BA 1O03A 2WTUA 2HA5A 2JFHA 5F9HA 4QOHA 1DXQA 5IKPA 2BR4A 3GH3A 1FP4A 2BFWA 4Z5XA 5KNCA 4YAFA 5HF8A 1WDTA 4DCUA 1CEEA 1J5XA 3LBHA 4CTJA 3AYZB 3HS3A 4BV8A 4EARA 2XODA 4LSWA 4ZVRA 2W0SA 5H9VA 5ICMA 4E2FA 3CF0A 2V6GA 5LWHA 2AJDA 1C9KA 3FH0A 5ALNA 1H66A 1VLHA 3N1UA 4NFHA 2ALJA 3A7EA 3WDLA 2JFZA 2YIDA 2ILTA 4JEMA 5JQGB 2Q3JA 2R2GA 2ZJ6A 2ZITA 1AA6A 4N48A 1XGKA 4M37A 5JEEA 1ZN9A 5JDCC 3N74A 1XT6A 2C0QA 2FMFA 4F1KA 4BFSA 2AW3A 3UV7A 4DYDA 4UU7A 4WXMA 3I8OA 2IODA 3LUGA 4H2DA 4DLYA 4IVQA 2Z9CA 2IUEA 4II3A 5D86A 4AUMA 1W36B 3OY7A 4HGZA 2IYVA 5CLQA 4AX8A 4ME6A 5FTNA 5KVCA 1BVHA 3SQXA 2OILA 1XEWY 2I7DA 4PO9A 1MVLA 3MK31 1ZGCA 4ISCA 4WJKB 3U39A 4ACAA 3CUSA 2X9VA 1RYEA 2J5QA 4F2GA 3Q3HA 1Z5PA 3WX0A 1A4IA 1XTQA 1ZXXA 3DUWA 2QAGA 4UE3S 4KXVA 3HBJA 2CXXA 4ALJA 2O8EB 3NBAA 3MB8A 2UVDA 3ETDA 3AESB 4AWBA 3VKVA 4RD3A 4Y0NA 2J09A 1PV4A 5FBLB 1CF4A 1A04A 3EZXA 2R44A 2VRBA 1J9EA 3CE6A 1UBHS 2WVGA 1YR9A 3K31A 2AZDA 2JGJA 2K4MA 1H2WA 2VAXA 1HC7A 2CL5A 3ZD8A 1KI3A 4HAZA 3T1TA 1U7DA 4QM7A 4HFRA 4BVFA 3I32A 2VYNA 4LWQA 4EPWA 5CFZA 4KR2A 2D06A 2R7AA 1QRTA 3MLAA 5EXEA 5EUBA 4QECA 4P7FA 3DLIA 1ZCAA 1P4AA 1Z06A 1EFDN 1R88A 1H42A 2KHZA 3NHZA 4DDHA 2IS4A 2WJ3A 1RDFA 1BMFD 4FILA 3HCBA 4KUHA 3LHIA 4RLQA 3TDMA 4UPVA 1NN5A 5CPBA 6PFKA 2H4HA 3BGDA 4QDKA 3ELBA 2GMWA 2Z5GA 4EEKA 1I1NA 1I2MA 4CV2A 1GGHA 4P0PB 4RD1A 5KWIA 4B3RB 4D9BA 2GO7A 5FI0B 2C9OA 4J94A 3TOSA 3QMPA 5JS6A 4C0AC 3LCMA 4GLJA 4YMHA 5K7SA 3EDMA 1P5RA 1DS6A 2D5IA 3MJTA 1Q7GA 1KOFA 4GIBA 1CDOA 2Z56A 3FI9A 3G2OA 4UVHA 5HBGA 3WV4A 4EG3A 1D7OA 4OXNA 2P6PA 1R3UA 2RB4A 3F2VA 3M9LA 1J0AA 2H1SA 4HAOA 5KX5A 1G5HA 1V1MA 1ZK4A 5J58A 5F35A 2JLQA 5TQ0B 3U17A 1KH1A 4ZO6A 5I9MA 2H4XA 5JMWA 3L7LA 2OXFA 4TT8A 2ZI4A 5CM2Z 2WSYB 4IV0A 2C77A 2R9VA 3JQQA 1CFJA 3ZHVA 2PXAA 4HWRA 2HHCA 2ON6A 4TWJA 3WK5A 4H7DA 1PLLA 3WL5A 4IDNA 3AJ9A 3PFFA 3BVPA 1OGYA 4UUOA 4CDNA 3WDKA 3SE0A 5F2NA 2Q0QA 4ATNA 1F1BA 4JVLA 2GN4A 3LPMA 4HS4A 4R3WA 3IH5A 3W1EA 1J97A 4ZV7A 3U61B 1XVLA 5CLHA 4YI5A 1ORHA 4G0UA 1MVNA 3GAMA 1NL3A 5LFAA 2OV4A 1VE1A 4Q4JB 2YNMC 4EELA 4Z4GA 1XTSA 4YN3A 4XWKA 1IBCA 1KNXA 1M1NA 2ZIGA 4KQIA 4TS4A 1UM9A 2VHZA 4ZOQI 3WK6A 5IJ0B 4AY6A 4GP6A 2F48A 1VXRA 3KT3A 3NKFA 3Q8MA 1QQAA 1OA1A 3EMDA 2JAPA 3HKCA 2QM3A 5DYWA 2REQA 2TMYA 3BDAA 3QBTA 2FDRA 5LP6C 4MYDA 1HNXB 2WV7A 5C37A 1ITZA 4PZ9A 3ZKAA 5CA1A 2YJ5A 4JI2B 1LX6A 4E94A 3FCEA 4CM9D 3I5XA 1SHZA 1Z33A 4AJ1A 2J0VA 1HI9A 1IHXA 2QLFA 2DFVA 4HYTA 4RXMA 4L8LA 4U7TB 3ILYA 4HDRA 4HB3A 3SMQA 2FZLA 2RHOA 3R0ZA 4PZDA 3UEOA 3KZOA 3P0EA 4WTOA 5KHLB 2BTQB 3AFHA 4JITA 1IQPA 1BMFA 3RASA 4CF5A 4P8RA 5EXDA 4C3ZA 1UKCA 1T34A 2X58A 3IAUA 4WINA 5ADUS 3OWXA 3ORQA 1XD9A 3GP8A 5GVSA 1ZL2A 1KYIA 3A9SA 1FLAA 1OIXA 1KOLA 4TV9B 5CDGA 3G8CA 1SKAA 4AKSA 1QDEA 1UZMA 2PZLA 3LGSA 3GI1A 4NCJA 3HDHA 4Y2XA 4KFSA 4P4LA 2EV9A 3S3TA 1J90A 1LC3A 2PJZA 4UDNA 5A3VA 4BQNA 4DSOA 1Z2DA 3LW7A 2I2DA 5EIBD 4ENQA 2W6IA 4TL6A 3ZDEA 1ZUD1 4JBIA 4IO0A 3GP5A 5CDYA 4EB0A 3ESBA 3QZUA 3SR0A 4IJQA 5DYIA 4C7XA 5I5GA 5E0KB 3ZVNA 5AI9A 1FMTA 3DNPA 4D0RA 2J67A 4ROTA 1EDDA 1FSSA 3I6ZA 4B8WA 2H9AA 1UP7A 3NNSA 1ZJWA 1H3EA 2JLWA 3UC9A 1KJIA 2WT9A 3D2LA 2O14A 5GM2A 3UMRA 3V4OA 3W77A 3OEEA 1A9ZA 3ERCA 1SOMA 5A7FA 1W36C 1D2MA 5IAOA 2P67A 3N6RA 3NTLA 5DK4A 5TMDA 3LSTA 5A4AA 1HNWB 2R2AA 3QMVA 4QULA 4F1JA 1ZUNB 3L4KA 2XNKA 2SNIE 4B31A 1XRRA 4PSVA 1Z6TA 3E3NA 1I7PA 1U0FA 1MV5A 2C83A 2IYUA 1J33A 4LQLA 4FYIA 1NDUA 1L5YA 4RPIA 2NVWA 2G1JA 2WHEA 4KREA 5TS3A 1TPYA 4L8GA 2X42A 3GFSA 1UBSB 4LIPD 3IBCA 3SSNA 1H2RS 2PIDA 1MIOA 3HBFA 1DJQA 4HAWA 4HSGA 3HUUA 4HOYA 5JADA 3FFXA 3MWFA 4KQ6A 5KQSA 4II2A 5KU7A 2WVAA 4OBXA 2WUVA 3WOHA 2IDZA 4J16A 1LSOA 5DULA 4P92A 4UDXX 1CJBA 4MARA 1GA6A 3CM0A 3ABIA 3KQQA 4K6FA 4WLVA 5JIBA 2H31A 1TA0A 1QLHA 1L7XA 1E64A 5CBPB 5CB0A 3Q8XB 3LBIA 4YCDA 4B4WA 2Z1MA 3MQ4A 4CFSA 2FRDC 2OCAA 2YJNA 4KXNA 5ILQA 4G63A 3W4JA 1M76A 2W2LA 3HDTA 2INGX 4I1YA 2PXCA 2P6UA 5J4VA 4N7RA 4DMKA 3GGGA 3D4NA 3NANA 1OZFA 1P1HA 4L3VA 4V2IA 4GKKB 4FDAA 1B0AA 1HEYA 1I13A 1U3TA 2C59A 2XJ4A 1JDJA 1MQAA 1IMOA 2YV5A 4R2MA 1RYBA 1OX6A 3C7TA 2O4UX 2HA3A 4HSEA 1R4NB 4W82A 5C7LO 5KKNB 3NHBA 1R6UA 4PC3A 3IB3A 4X9XA 5IAKA 3S8MA 4RZXA 3GLUA 4M0EA 4MS3A 1OBFO 1OJLA 2VBFA 1MX3A 4GBJA 4UU0A 3C1UA 4YAJA 1C3LA 3DM5A 1HYQA 3PXDA 4AK9A 4G1EB 5JH7F 4BJ5A 2RGBA 3ISTA 1KZ4A 4C29A 1CDZA 2R8OA 3FA2A 2ZKIA 1JEYB 1YBVA 1UKZA 2XUHA 5ES3A 2TECE 2XX3A 1FTQA 4WCFB 1D8TA 2IZ7A 2Y27A 3RHFA 1G16A 3UK7A 3WYDA 1OWPA 2O7VA 2DHDA 5ALYA 5AW0A 2O0LA 4ZAZA 3H3JA 5F7JA 2CSXA 1JLSA 1WLSA 1IVYA 1GQOA 2D5BA 3LUAA 3C3EA 4H0CA 2QR2A 2GCGA 4LSMA 3ACCA 2QPLA 1IN4A 1LW6E 5I4KA 2F3UA 4TQ9A 3QA9A 5CRIA 1E5VA 1LGYA 3P4YA 3RUCA 5T41A 2CDNA 5B36A 2QZSA 4KQFA 4PNEA 1KEEA 2YS7A 3H1FA 4ZI7B 3DZKA 4U6SA 1QAQA 2FWIA 4FYKA 4S04A 2ODNA 4MMYB 1AOXA 5ELLA 1JS1X 4RTSA 1ZNXA 2NAFA 3TVYA 4YRBA 4YRKA 5IUJC 1KEPA 3T9FA 4BKQA 2JGMA 2K87A 2OR3A 3REQA 2JEOA 4FHGA 4I6JA 1VJTA 4DC0A 2VLBA 3N28A 3FYHA 4PWYA 1N0UA 1QIGA 4GL4A 5DZSA 3SYNA 4CV1A 4UTPA 1H0RA 4M86A 3SXUA 4FX2A 1CUBA 1YA8A 4XIGS 4ZHQA 4PY2A 3QU9A 1FFXA 1U7HA 3H8WA 2DPLA 4I4LA 4RGVA 5EOVA 4RPJA 3V7FA 4BNJA 1CTQA 3ME5A 1B7GO 3G8DA 2PUBA 1TGVA 3ZDXB 4LJYA 2MDTA 4BNUA 3HXQA 5DDIP 5DHSA 2XUIA 1FFEA 4M1YA 4BJHB 3H65A 5C8DA 3KUUA 3U3ZA 4DM7A 3I5MA 2GF9A 1J2JA 2E4XA 1MKYA 4BV2A 2N75A 4HVLA 1XQWA 3WK9A 4CODB 4JP3A 2XRMA 5HXAA 4TWIA 3DOFA 4TKUB 4D92A 3DEIA 4DMFA 2HPVA 3UMYA 2OG1A 1M6VA 4LZZA 4WZAE 3ZZ0A 2B36A 2E18A 2X5OA 2IQIA 4CEJB 3NHKA 2X0DA 4OK3A 5GIOE 3UMSA 2QTLA 4M3NA 4JOBA 2ENWA 5LN1A 1CUCA 4B4KA 2WWWA 1DMSA 3HFJA 4DLLA 4KWIA 3NBXX 4GSYA 2O52A 3IIJA 4YJ3F 3RJMA 4BFWA 1GCIA 3F1KA 4LHWA 1DJOA 4NECA 1EUDB 3QK7A 4KFTA 4RY0A 3U0BA 5HUQA 3UWMA 3JD3A 3L02A 3UJNA 4YX9A 2XYVA 4V02A 3VDRA 1AKMA 4FCWA 4CM1A 4JEIA 1PVOA 1XTBA 1A7KA 2Q2NA 4JNCA 3IL2A 4QJIA 4KPEC 2GFQA 4UPEA 2A1UB 4L6CA 1D5WA 1ZGZA 1F8XA 1WD5A 2VCEA 2VJMA 3QKTA 5BSHA 3BSFA 2P40A 3E9DA 3W6OA 2I78A 2PA3A 3FTQA 3SEAA 1P1IA 1GG8A 5AVVA 4BNZA 5LYJA 2WQ6A 3C3DA 3D0RA 2KLHA 2GZ3A 4I5GA 4M1WA 3TRKA 1RCUA 4RH0A 2M98A 4ER7A 3CQ9A 4U8HA 4DT1A 3Q8LA 1ZD2P 1KAQA 4CT0A 3TAXA 4RA9A 4TMYA 1OZGA 1XLWA 5F23A 1N34B 3IP8A 4QO7A 2PT7A 2ZVJA 2EKDA 1SKQA 5BPHA 2FWRA 4O0MA 2FZ5A 4WA8A 4KZKA 4BQIA 2OA0A 3K4PA 1VFNA 1KMHA 121PA 3M5CA 5SYNA 4ETWA 2OXTA 5LDDC 1ZZGA 2HCBA 2A9JA 3PHBE 4MWCA 5CIWA 4NYIQ 4A0FA 4OXYA 2QMYA 1XXHE 3ACDA 1K7EB 3OFKA 4FD3A 4MWBA 1VYHA 4XVCA 4GLFA 1I1QB 1KXZA 3P4UA 5GZ3A 2CLMB 5J4LA 5L3RA 2ZI3A 1NJ8A 2A2ZA 2CBXA 3TH5A 2DXIA 1M2EA 4ZOCA 4R1SA 1DSSG 4FNAA 3DNFA 4Q9LA 3E6AA 1IG3A 2FEMA 4FZ5A 4I55B 3T12A 4A8PA 4C5BA 5FJJA 5KHAA 2OFWA 1N1EA 5HF5A 2V4ZA 3M6VA 2WJGA 3JALA 1QWSA 4RVNA 4WNAA 2BH2A 2V7QA 2Z98A 5T8KA 5TNXA 2LTAA 1W0KD 5CK5A 3CH5A 3MINB 2E4ZA 3SSAA 5LSAA 3LX6A 4JK3A 5IT0A 3C6MA 1YHNA 3PF8A 3MOIA 4KYUA 4B2LA 1OF1A 2X5KO 3CN9A 1KR2A 3CKLA 4N7JA 3ZK8A 2C42A 2VAWA 2IYTA 2RONA 2VQEB 3T3OA 3HMKA 4H1TA 2AG1A 2DE0X 4MWTA 3DCIA 4TLAA 4D97A 1T1GA 1ZKDA 4BB6A 8ATCA 3D8HA 2RJ3A 4EKGA 1LDMA 4A2WA 5FDFA 4QHYA 5AW2A 1SZPA 2YVLA 3GPIA 3ICOA 3MJFA 2VF4X 2ZSEA 1FU4A 1SA0B 3RIHA 3WP0A 2NLOA 4HO1X 2G0TA 3CUYA 5C5IA 2WNIA 5ERXA 1LTQA 3WLKX 3DHYA 2XWBF 4RHFA 3ZWKA 4BNIA 5LYYA 3SF8B 4J7XA 2JAWA 3EODA 3O73A 2ZTHA 3GLHB 4TLBA 2J9FA 3ACBA 4HVAA 5CDFA 3MCUA 5TGZA 5KS2A 4MP8A 3ROZA 2XE4A 2R7KA 4FYYA 3TE7A 4H16A 1TM1E 4LZPA 1AD2A 1OC2A 3GVPA 1YB1A 1UBMS 5A7HA 2IZ0A 3EGDA 1D9XA 5BV0A 1BMDA 2HHHB 2HMYB 5ICEA 3GARA 5EHNA 4ES6A 6REQA 1Y1TA 3QVOA 1TVKA 1XK6A 4IDPA 4M83A 2FW1A 3EMVA 1Y9DA 2ECQA 3ILVA 4FR5A 5T3UA 5G0VA 4YRMA 2C4VA 2IXTA 2J4DA 3QEJA 4V0KA 5GMOA 3SYTA 2G28A 2XYQA 4X7PA 2B94A 3CGWA 1MTZA 5KYXB 2NU7B 2Z95A 3BORA 1X13A 2FHSA 3IJ5A 4PRLA 3ZXUB 4HDMA 3DDOA 2VZ0A 3ZU4A 1KBZA 2GVDC 2IZ1A 1U90A 3KSUA 1U1CA 5DKFA 4BO9A 3K0HA 1KO7A 1T8UA 2ZDGA 5L7TA 3ZE9A 3Q9UA 3REOA 4M8LA 5BV8A 1GKYA 1CZLA 2G0AA 3QE2A 2QRHA 3ADCA 1AQIA 4E4YA 1NPYA 1PF7E 2JI9A 5J4HA 1E9BA 1MOQA 1S8AA 2ZS9A 3QTBA 4K0KB 4ZGBA 2WG0A 1A9XA 1W0KA 1ZW6A 1JKMA 1JQBA 1ANKA 2Q9AA 2I4MA 3S2EA 1NRIA 3OT1A 4GPIB 4LW8A 1U98A 2RK4A 1AJEA 2V9ZA 2NSHA 3H5RA 3V8VA 2POCA 2BHRA 1XMSA 1L1QA 3DOEA 3WLFA 3PZRA 2ZCJA 5KOJA 2P8JA 2R8XA 2FCAA 5FTWA 3I6QA 3H9EO 1KI9A 3F7TA 1WKBA 5BSUA 3A1NA 3WMGA 5TLSA 1FUYB 1YI1A 2J87A 1VHDA 3HY3A 5JOQA 4HY3A 1RWKA 1COZA 1QX4A 1JHQA 1XLVA 1VKRA 2H00A 2ISSD 2OWDA 3NJ4A 1JYFA 2Z9DA 3HR7A 4JFAA 5EZ5A 3RPEA 1EBFA 1MQSA 3PI6A 5JV5A 1XOIA 5HIKA 2I55A 2FPPB 4HTFA 4BLRA 4F4JA 5JSUA 2IY7A 4ZVMA 3DAGA 2J41A 5HKOA 3AFIA 1K97A 3H04A 3W5SA 5ENZA 5TJ9A 4Z49A 3TB6A 5BNIA 3FOFC 3E8MA 4BFTA 3CONA 3PKIA 4M6WA 4YAGA 3I3OA 5ICSA 1TM3E 2QLJA 3OM9A 3EZ6A 4DRXB 4C78A 1U0JA 4DOMA 1LF5A 4LV6A 3QOXA 2F3TA 2GA9A 1SZDA 4G36A 2FK7A 4UJ5A 2Y2UA 4QNNA 2QVBA 3EEBA 3KJGA 4YTEA 4ZU1X 1M6WA 5IFLA 2I3BA 3ESZA 5AJUA 5CW1A 2PMKA 2CD9A 3I9JA 2IIPA 4B6QA 3KT6A 1JKFA 2H17A 1YJ8A 3VPCA 1IIBA 3HG7A 3EMKA 3IP6A 3ZHYA 5CITA 3IA2A 1YJ5A 3COYA 4LC9A 2VKTA 3EXIB 3Q98A 4N01A 4QXRA 3ST7A 4E88A 2ZM6B 4PXAA 4CMIA 2Q1WA 2GBPA 4GHWA 1MJNA 1SCUA 5HILA 1T9DA 4Y2HA 4AG6A 1SB9A 2Z2KA 3JW8A 1WBDA 3K0FB 4EL5A 1A9PA 4RH3A 4JEHA 4WN9A 5FI3A 3U4DA 1GITA 2GCOB 3QHPA 1Q2XA 2B4TO 2RH4A 4V1CI 2WKWA 2QJTA 2C07A 4EMSA 1V5EA 2PL5A 2QRUA 1IATA 5LKRA 3OQHA 1T5SA 2PA0A 3WYAA 1Z07A 4FJ2A 3FVWA 4L5YA 4DA0A 5B2ZA 4YMGA 3E2MA 5BUCA 4MGZR 1R6TA 5HGJA 4NDNE 1UPXA 1M0EA 1BWQA 3I6BA 4PXYA 4BL5A 2W7TA 1NBME 2AZTA 2RHMA 4JU8A 4HH4A 1JX6A 2D1YA 4BUCA 1ZJ5A 4FC6A 3UK2A 4B4UA 4MUHA 4YRJA 5K0ZA 4MCJA 3PBKA 1QRDA 5FWXA 4HWOA 4QTZA 1GKUB 2ASVA 2RI1A 3IMFA 4JJ8A 1L4MA 3D43A 3G0GA 3H13A 4AJHA 3AEQB 4Y3UA 3MJEA 1N0HA 3KPYA 2CB9A 3UATA 3NMUF 3JASB 2CXQA 3MG9A 3KVRA 2IHZA 2ZYAA 3PVZA 3W3AA 4L8YA 2ZJ4A 1JQ5A 3JYNA 5FORA 4KQKA 4YJHA 3TKAA 5A9SA 4NF2A 2DFTA 3FTNA 2VSOA 3IT3A 4UEKA 5HF6A 2XMSA 5J23A 1Y98A 1Y8QB 3G2QA 4OSOA 4NJEB 4XGQA 3QPUA 1AMNA 3DEZA 4YRNA 3OESA 3DSRA 4DCOA 5BRNA 3LRXA 1X9GA 2GGSA 5FXMA 4JYCA 1TC1A 2OC9A 1TI7A 3G9ZA 1WDWB 3OE7A 5BSEA 3ZPXA 3L6OO 3AGQA 4KAXA 2BHLA 1QHGA 4DZTA 2DHCA 1K8QA 2QTGA 3E84A 4I5FA 4ZP1A 3SQWA 2RK6A 3VKGA 4CDRA 1XRSB 1TJNA 1VIVA 2BW0A 3HDYA 1BXZA 2LR0A 4RHYA 4GMDA 4EUNA 1LRJA 3NWPA 2PUFA 3L6CA 1LQ2A 2PZGA 4LTDA 3OMLA 5KHOC 1L6IA 4AJ4A 3IOEA 1YQXA 3ND9A 4PYNA 3WXMA 2C2BA 3EXFA 5B58C 1CRPA 4RYLA 2EHDA 2B4YA 5CTJA 4JJFA 2BEKA 1PN3A 2NTVA 2ZJ7A 4OXIA 1B76A 5I3CA 1IH8A 2X3UA 3OJWA 3HBMA 4YRQA 1KAEA 4KAJA 4BKMA 3SQOA 1NTOA 4IV5A 4PYQA 3S81A 1IZYA 1O57A 4OMDA 3LIIA 1T4MA 4DNFA 1RTTA 5A5EA 3H2KA 2IS1A 4F2PA 3A6KA 2FPMA 3KWLA 3LLSA 4FBLA 5BVHA 4J3FA 3HWX1 2XDQA 4YRPA 5LUBA 2QBYA 3IQWA 1NN3A 1JHMA 4Y0VA 4E4TA 1E79D 3E3AA 3BXPA 2X1VA 2DH6A 3BS4A 1P4HA 3M4ZA 4IWNA 3V4PB 4B83A 5EEGA 1Z0FA 5PGMA 1NUTA 3TINA 4EGQA 2DEUA 1QV7A 3MPUA 3RRXA 4IDOA 4B3FX 1UXJA 2J46A 1GG2A 4HEHA 2I7VA 4Q3KA 1U1GA 4QQFA 3DE3X 5E1DA 1CZRA 3EC1A 4B6GA 4K1LA 1MJ5A 5JWRA 3NC1C 4MAMA 3UPDA 1C0LA 1EAMA 3NWJA 3IV9A 3HNPA 1LDNA 1KYVA 5GZ6A 2J0SA 3FKSD 3MTEA 3B5JA 2IU0A 4GX5A 1W19A 1ZH0A 2V97A 4RIFA 4ZZ2A 4Z9BA 1NVWQ 5IM5A 3V33A 2WIJA 2FZWA 3OPMA 3LC0A 5GPBA 1JIKA 2ZI7A 4W7SA 4KOEC 4ZHSA 2VNJA 4PHHA 3IB6A 2I54A 4RVSA 1IEXA 3B7WA 3AF0A 1YB7A 4MO9A 4LF6B 4RZ3A 2FSVC 3TR5A 2AWNA 1VLJA 3JWJA 4L74A 3OTIA 4G89A 3Q1LA 4JLOA 5FI1B 3IHWA 1W59A 4OHRA 4C7JA 1ICIA 4YB8A 4LZOA 8ABPA 4S1WA 3SNHA 1K68A 4MHTA 4MR9A 2ACKA 1P2UA 3DD1A 3DQPA 4M49A 3A14A 2HLDA 3IODA 2FGKA 4C6TA 5KQGA 2EKBA 2BFPA 3PICA 4BU1A 2W6PA 4BLWA 1OW3B 5DWDA 5G0WA 4PZAA 2OYCA 4E1AA 4QHSA 2Q7XA 3U13A 1O5TA 3PIDA 4OATA 4WNIA 1NHWA 2NZJA 5KYYB 3ECCA 3KYDB 5KJFA 2AKEA 4WNCA 5M04A 3IR6A 2WAAA 2Q3DA 1S2NA 3D59A 4QWWA 3WTBA 3EXHA 4E22A 4ENTA 1RQ7A 3HCRA 4FCCA 4KWHA 4LE2A 1DUIA 4DDTA 3QVUA 2Z8YM 5LMUB 3SX2A 2A0XA 4I50F 4ND4A 1XKTA 3ED1A 4RCVA 1ZYUA 4KPUB 1GCOA 1PJ8A 4JXKA 1DBWA