2VF4X

E. coli glucosamine-6-p synthase
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
359
structure length
359
Chain Sequence
b'GDKGIYRHYMQKEIYEQPNAIKNTLTGRISHGQVDLSELGPNADELLSKVEHIQILACGTSYNSGMVSRYWFESLAGIPCDVEIASEFRYRKSAVRRNSLMITLSQSGETADTLAGLRLSKELGYLGSLAICNVPGSSLVRESDLALMTNAGTEIGVASTKAFTTQLTVLLMLVAKLSRLKGLDASIEHDIVHGLQALPSRIEQMLSQDKRIEALAEDFSDKHHALFLGRGDQYPIALEGALKLKEISYIHAEAYAAGELKHGPLALIDADMPVIVVAPNNELLEKLKSNIEEVRARGGQLYVFADQDAGFVSSDNMHIIEMPHVEEVIAPIFYTVPLQLLAYHVALIKGTDVDQPRNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSAMINE--FRUCTOSE-6-PHOSPHATE AMINOTRANSFERASE
publication title Ordering of C-Terminal Loop and Glutaminase Domains of Glucosamine-6-Phosphate Synthase Promotes Sugar Ring Opening and Formation of the Ammonia Channel.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 123
structure length 359
sequence length 359
ec nomenclature ec 2.6.1.16: Glutamine--fructose-6-phosphate transaminase (isomerizing).
pdb deposition date 2007-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01380 SIS SIS domain
X PF13522 GATase_6 Glutamine amidotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 2vf4X01
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 2vf4X02
2O2DA 3G68A 4DR6B 4DV1B 1HNWB 2VQEB 2X3YA 5BR8B 3IFSA 2PUVA 2CXTA 1XTBA 3J80A 4LFBB 2CXNA 3KNZA 2CXUA 4AQYB 4S1WA 3LJKA 1C7QA 1N33B 3FKJA 2DECA 4AMVA 4LF9B 4B3TB 2UU9B 4JI4B 1J5XA 2UUBB 3JAMA 1XMQB 4LF6B 2XHZA 3I0ZA 4DV7B 4DR1B 3T1HB 2ZM6B 4LZJA 3M5PA 1N34B 5IWAB 3C3JA 2UUCB 1HNZB 4NXMB 2J6HA 1HOXA 2UXBB 1C7RA 2CXSA 1IBKB 1U0FA 1U0EA 4GKJB 1G98A 2DF8A 3JX9A 3BJZA 4DV0B 5I01A 4JV5B 4TOIA 1TK9A 2E5LB 2PGIA 1JIQA 4LF4B 4LF7B 2O2CA 3CVJA 1M3SA 1J5EB 4DUYB 3NBUA 4S12A 1MOQA 3FF1A 4JI3B 2VF5X 4JI5B 1NUHA 1JEOA 2CXPA 3ETNA 1VIVA 4YHHB 1B0ZA 3BCHA 4DV2B 1JLHA 1Q50A 2Q8NA 1T10A 4X65B 5FLXA 5LMUB 1IATA 1MOSA 2CXQA 3HBAA 3OOJA 2CVPA 3UJHA 3FXAA 5LMNB 3SHOA 4DV6B 4YY3B 3T1YB 1VI5A 4X62B 5BY2A 1N32B 2V4MA 4EM6A 1X9IA 2POCA 1TZBA 2XBLA 4DR4B 1IRIA 1ZZGA 1XNQB 2PUTA 4JYAB 1X92A 4K0KB 2UXCB 2UXDB 2E5FA 1XMOB 3TBFA 3Q7IA 4DV4B 1VI6A 4DUZB 1HR0B 4JI7B 2WU8A 3TRJA 3EUAA 1IBLB 1VIMA 1XNRB 2I22A 1DQRA 2CXRA 3OTOB 2VQFB 4DR2B 4JI0B 2AMLA 3Q88A 4DR5B 2CXOA 4JI8B 4LF8B 4B3RB 2ZJ4A 2CB0A 4B3SB 4JI2B 4DR7B 4OX9B 1FJGB 1N8TA 2VF4X 4NXNB 2HHHB 2PUWA 4X64B 3ODPA 1GZVA 4IVNA 4U6NA 1X9HA 5IT9A 2A3NA 1KOJA 4M0DA 4JI6B 3PR3A 1HNXB 3FJ1A 2UUAB 1TZCA 1NRIA 5A2QA 4LFAB 1I94B 1IBMB 1GZDA 4DV5B 4B3MB 4KHPB 4GKKB 4JI1B 4DV3B 1HM5A 3J7AC 1JXAA 2I2WA 3HJBA 3J81A 4LF5B 1U0GA 2F4VB 4X66B 4DR3B 1WIWA 1MORA 2YVAA 1N36B 1X94A 2ZJ3A 5LL6P 4LFCB 3QKIA
chains in the Genus database with same CATH superfamily
2PSDA 3PXXA 2VQ6A 1HUQA 4GM1A 3NH9A 2WA1A 2CXXA 1SEPA 4FFDA 3F78A 5EGNA 2Y71A 3S27A 2AR9A 3EQ2A 3U7IA 1CETA 3MFQA 2Q1WA 4YCBA 4EY7A 1ZGGA 4WKNA 5G53C 1ND6A 4Z3OA 4BN4A 2Q3FA 1LPNA 4BU1A 1IN7A 2Q21A 3B1YA 1E2MA 1OI4A 3LBNA 4GMXA 2AL7A 3MWEA 2D74A 3FWKA 4WA7A 1SUIA 5KWEA 2PZMA 1EHYA 5DHTA 5AVUA 1CR6A 5HIKA 1XTPA 3KUKA 1N2HA 3DFMA 1FJHA 2HWYA 2I5PO 5C46F 5ADHA 2CYAA 3UA4A 2B30A 3L8EA 2C3UA 5TRTA 3RFCA 3GUVA 4DA4A 3RS5A 4TV9B 2AI1A 2V98A 3NIDB 4RK1A 5I7RA 4J0GA 5FPQA 4B5LA 3HPRA 3A6JA 1B0PA 2JHGA 5DBOA 4NICA 1I36A 2OKCA 1REQB 3G8YA 1Z6GA 2P91A 5FQNA 3WJAA 3KM0A 3PXCX 4O5AA 2QVGA 3RC9A 1G98A 4QKQA 4DV0B 1VL6A 4LXQA 4E31A 3U3ZA 1NR1A 3VH2A 1B43A 3L6DA 4ZYYA 5MDHA 4QXAA 2J85A 4Q9LA 4YAEA 3HYCA 3ON5A 3OZTA 4EF5A 1TZKA 3QENA 3SEQA 4KWIA 1N9ZA 3I73A 3IJPA 1P6UA 3ND9A 2ASVA 4YAJA 4YUZA 1SO8A 5EZSA 4DNPA 1M7HA 1NI5A 1SY7A 2I71A 3GJSA 2YV3A 5BUCA 1P6XA 2CCKA 3EF3A 3X3HA 1EUQA 4IINA 1YFZA 5FNVA 2PWYA 4AMYA 5JNUA 3GT4A 4HNAB 1ZO8A 3CZCA 1GU0A 5D7NA 1QC5A 4OHOA 4UARA 3TE6A 3K96A 2XBLA 4LX0A 1ZIDA 3HY6A 3M49A 3UAGA 2VTBA 1IXKA 5CHYA 1ID1A 3AVVA 1Q11A 1C3VA 5FPKA 2HMUA 2R85A 2W8BA 3QYJA 2I2XB 1QOZA 2Y1GA 3E1GA 4V03A 1XN4A 2AMFA 2H2WA 2XSZD 3STWA 3TAXA 1J8FA 5EGSA 2JI4A 2O2XA 2VP3A 1YI1A 1FFCA 3GNSA 3K8QA 1PLJA 4NFSA 5F5XA 3B5IA 4UBLA 2EFHB 1GAWA 2Q27A 1G38A 1W2WB 3WY9A 4MV6A 2ZVPX 2Z3VA 5AR1A 2Q50A 4U02A 3PQ2A 4QC2A 3A1CA 3RF7A 2QI9F 3AVOA 1FFAA 4EJSB 2VJQA 2XB8A 1OWPA 4Z0PA 2IWHA 3BMOA 1MTZA 5HS4A 4X63A 1B0AA 1P5HA 1VKNA 2JLQA 1QCCA 3FYUB 3KYJB 4J7XA 4B47A 2H0RA 4JS0A 2IUTA 1L5HB 3MS4A 1SVWA 2XH8A 5DNDA 1FP1D 1DIRA 2C3OA 5EJGA 4XM0A 2HF2A 5DNAA 1AO3A 3G0HA 3J7AC 1QLHA 2A0YA 4P32A 2PZ8A 1WDWB 3N2NA 4GMDA 2F1KA 3S1AA 2GXSA 4E6EA 3J81A 1IFXA 4BQIA 3JQPA 2XNDD 4ZXPA 5IUJC 2O8EA 4D8WA 2IH4A 1X1TA 2KQUA 4R2HA 2PZBA 5TQJA 3F7MA 3GLFE 2YMQA 4MRSA 3BTSA 3OTIA 4KR3A 3KETA 1ECGA 2OEPA 1V8BA 1C8KA 2VDQB 4OBEA 2BH2A 4FEYA 5FHQA 2HZBA 3HKBA 1N5MA 2ZWIA 2R8XA 5JHGB 2HFKA 1B74A 2QJWA 3PXGA 1BMTA 3OQIA 5JTTA 1T6ZA 5BV0A 2NQ8A 3QBVA 4UNRA 4C4OA 2D6FA 4DQUA 2HF7A 2YIJA 1SC3A 1G4HA 5BOVA 3CSSA 1IB0A 4XA8A 2UU9B 2HXGA 1R0LA 3AINA 2RHGB 1JSLA 4X1KA 2CLDX 3P4YA 5KOJA 3OQOA 1SXJD 1F0YA 2DR2A 4BQFA 4IGAA 3ZNQA 2HQBA 5HQ3B 1QP4A 3C3JA 1HETA 1JE1A 1SHKA 2IP4A 2PGXA 4HAVA 1CZKA 1E2KA 4R81A 2BEJA 3GAZA 2QM8A 3A2LA 1AZTA 3ZU5A 5AKEA 5BN3A 5BO5A 4Z51A 1EGMB 2M2IA 1JHYA 1WCIA 1Q3HA 2NTVA 3DAHA 1JJVA 1LK5A 2OBLA 2RAUA 3KJGA 5T3YA 2A0UA 4DC0A 2GPBA 1XKQA 3K94A 3OF5A 5HWSA 5I5EA 1QGZA 5H4HA 1FVHA 3COYA 2E89A 1IDOA 3HYRA 1N5RA 3QVMA 3EXHB 2CHVA 4UHCA 5JFOA 1KEEB 2WJ6A 5JJLA 1JDTA 2TYSB 4D4JA 2Z1MA 3FHJA 5CFPA 2OORC 4HDQB 1KY5A 1G55A 1PJSA 1SHTX 4ETWA 5M29A 1YA4A 4CNQA 4EYOA 1C9YA 4CV1A 1RRPA 1P77A 1E99A 3VNUA 2RGUA 2YZ2A 2TMKA 5BRJA 4CMCA 2B8NA 4RANA 1PO7A 2PZEA 4EJMA 3TLGA 2JGRA 2PUTA 3BHNA 4LDAA 1P1FA 1W5TA 1E9EA 3C3KA 1TCVA 2E5FA 3IR6A 3NBFA 4LZLA 4O29A 1F14A 5TF4A 3SX0A 2W6NA 2BWJA 1KRWA 4BX0A 3O75A 1R4ZA 3BH7A 1THGA 4RA9B 4XD7D 3SJAA 4NOMA 2WTXA 4YWJA 4I9HA 5E95A 3GUHA 5AHXA 5FD8A 4ETIA 3UXHA 2X2OA 4UTNA 3AU9A 4M3NA 3VSAA 2R6ZA 2WVAA 3WFIA 3PVSA 1X87A 4LGMA 5K3FA 3ZHBA 1YJAA 2I1WA 3C4QA 2HGSA 2E7ZA 2MT9A 3K0AA 1GEEA 1O58A 5GM1A 2HEIA 5DM4A 3E4CA 2QG4A 1FJXA 2PAAA 1VP3A 1AT1A 2HK7A 5DWDA 4IZ6A 4DDUA 3H04A 4D3FA 4CLOB 2CHFA 1NMYA 3SJCA 1EESA 3GL9A 4AZTA 1RJEA 1MAAA 3PIIA 1YBVA 1UXKA 1OCEA 4N54A 3QTTA 1C1HA 2B6NA 2QU7A 1FFXB 1M66A 1GL3A 1R8XA 3LK7A 1M75A 3H1EA 4WLUA 1EJBA 1JWAB 5K0FA 2M6SA 3URMA 5LZ9A 1U0LA 4Y1RA 3TW6A 4QOJA 3WAGA 4HB0A 3FFXA 2EEPA 4IOJA 1L4MA 3OPVA 4Y2VA 3EN0A 3RV3A 2VEOA 4HX2A 2G8NA 3IP7A 3VGPA 2IXAA 3PIRA 4B09A 4D1YA 4ZHQA 1TZ2A 1L8XA 1JU3A 2IF2A 1FFDA 1WZ2A 3M6MD 1IE3A 4RETA 3HPQA 1UXGA 3LC0A 2JS7A 4XWOA 2V8BA 3F7OA 4A6DA 2Z6QA 4K26A 1O8BA 4HGQA 4QAJA 1C0LA 2O2IA 1ZH2A 4ND8B 1Y4AE 3SXJA 2B3TA 5HVNA 3KHUA 1C1XA 3B7PA 1GNQA 2H8GA 3M3PA 3RVJA 4P3PA 1M2FA 1ZI6A 3PCTA 5LDDC 2GAFA 4OEHA 4OQPA 3DDCA 1EVEA 1AF7A 3H11A 4MS1B 3JQGB 1B6GA 2YS6A 5ALRA 3BRCA 3TG8A 1FSPA 1ZUD1 4IJVA 4TXMA 2DM6A 3NU1A 1SVKA 1WU8A 1X80B 1UPTA 2WJHA 4KH1A 1BD4A 2BMFA 4UVGA 4Y6SA 4WOJA 4XPIB 2LIPA 1ZW6A 2RB5A 3DVRX 3HXOA 3HZZA 2I2DA 1N77A 2W83A 4KJXA 1DKPA 4QXRA 3WJ1A 3FTFA 2O5EA 3U26A 3OQNA 3OX4A 3USZA 3WDKA 4LI0A 5EJIA 2DSTA 2ONYA 4EARA 4XJXA 2VBFA 1Y4UA 4W6QA 4ESOA 4PC2A 3CWZA 2XWJI 1DAFA 2OENG 3SKVA 4B8ZA 4ZO6A 4YAKA 4KFCA 2R8OA 4ZTUB 5EMMA 1VGVA 1WY7A 2XGOA 2XUHA 3ZIDA 4B6EA 4RF3A 5CX1A 4D3SA 4KXQA 1N3YA 2CDRA 3SVLA 3LCVB 4RK5A 5F7ZA 3R4CA 1MDFA 5C7LO 3U44A 2IJGX 1NZJA 3ZCQA 3AEQB 2D2IA 1B26A 1MJ5A 5ENDA 1PSWA 3NAZA 1JXQA 1SQFA 3IQDB 2F1JA 3QNMA 1IRXA 5ALFA 3SQOA 821PA 1OYWA 3A1UA 1LDEA 5DU2A 3HU3A 4IUBS 2FCRA 3U3KA 1GYPA 3SBDA 4MQUA 4GOJA 2V6BA 3KDAA 1E7SA 3KPYA 4Q05A 3UMVA 3F5DA 2OD2A 2YVKA 4P3XA 1ADGA 1GGNA 3GP3A 2Q1TA 4Q4AB 2H16A 1T34A 4TSFD 5A3SA 3AM1A 4US2R 4CFSA 1H9CA 1NKVA 3OG9A 1UBHS 3H0CA 1UFKA 4DM3A 2JJQA 4YAUA 1TVEA 2NU8A 5GPBA 3SMQA 5A6VA 4K3UA 4CR6A 4DT1B 2Z3WA 5J47A 2O54A 3OZIA 1J8VA 1VJGA 2PWBA 4RY9A 3L93A 3LT1A 3GFSA 1ZR2A 3ZJVA 1ZN7A 2ETVA 4CJXA 1DRUA 3RFUA 2EW8A 2QX8A 1SU4A 2HO4A 3LUHA 3TSCA 3PFFA 3ZYCA 2YC4C 4ZJZA 2BBSA 3K4QA 2PUHA 2UVPA 3D6HA 1XPUA 1UWVA 3EXFA 1E3QA 4A0RA 3AESB 4CN8A 1FPMA 3OPYB 3Q10A 1IH8A 1U1DA 1SNYA 3RAGA 5ADWA 4L8GA 4RTKA 1KMMA 1UMCA 4ZZIA 1HFEL 3JTEA 3GDGA 2W2KA 1KJZA 2MINA 4BNKA 3JAKA 4E5DA 3X1WA 3EC7A 3W6PA 5DX0A 1L4KA 5F7JA 3Q2OA 2O2YA 4NBSA 2WOOA 2VBCA 4N6GA 1JJFA 4ND6A 2XUQA 4AXBA 1KAOA 4DV3B 3DOHA 1EI9A 2WIJA 5DGXA 3SHQA 1X8XA 4MCJA 3ADKA 5JCOC 4IW3B 1IXSB 1ES9A 3FROA 1JHVA 1V41E 3TBKA 1CHNA 4Q7EA 1RBZA 4EUHA 3AEZA 2ZXFA 6AT1A 4KL8S 4U6SA 1FDUA 4ZOEA 1EBBA 4F11A 1DCFA 1YDEA 2CJFA 3C2QA 2FSUA 1K2WA 3W5HA 4F1WA 5IANA 5HK8A 1PAUA 1G8FA 1FPQA 2G9ZA 1GPYA 4DLLA 3BXPA 2H5LA 4WLEA 3ZQ6A 2D00A 3TSOA 1CE8B 1GVNB 3ZR4B 4TZKA 4AD8A 4ZCMA 2Y1OA 4OLBA 1JBEA 2H65A 2K2QB 4ZVQA 1W36B 3H05A 2IZ1A 3E9YA 2RJNA 3FF4A 5I6DA 1Y8RB 5JS2A 5B6IA 1GSHA 1DP4A 4GLJA 4DNXA 1ZIYA 3R7SA 1FMFA 2IH5A 5KIAA 3NBZC 4KLCA 3MIZA 3PYLA 4C0KA 3R5TA 2P90A 2VPIA 2JFOA 1IEWA 4BZXA 3W4JA 2HJWA 3K70B 4FCTA 2HK9A 3JX9A 4LJKA 4G6ZA 1T3TA 3CLSD 1OT5A 4FFLA 4R7TA 3D31A 3BA6A 4L4XA 4OQXA 4UXIA 1M2GA 1BKDR 2GYYA 2WSSD 9MHTA 4EPXA 5I8ZA 3KPJA 5DLYA 2G09A 1OX5A 2OZVA 1AN0A 1EWKA 5INTA 3HBNA 2OAP1 2D1RA 5BN5B 1E1QA 3K9CA 4FT2A 2FZVA 1V5IA 3C48A 2WB4A 4B40A 3ZNPA 1E2BA 4X95A 3GGJA 4XKJA 2NO1A 1E2QA 2W00A 5PNTA 3FGNA 2NQTA 5A4JA 4Q1EA 2WWXA 4F38A 2VDWA 3CZPA 4E7PA 4F4FA 1Z7BA 1XCJA 3CWCA 3P2YA 3WX0A 2ZUFA 1NBIA 3ML1A 5EP4A 2GXUA 4E1BA 3EGOA 1DHTA 1NJ8A 3EVTA 3TLZA 5CEJA 3JQ8A 5KNCD 2FPIB 4EPRA 4CIDA 5IN5A 3U6BA 3HJRA 3I8XA 3PE6A 3KAPA 3A28A 5AW2A 5E6UB 1KKLA 4JUAA 3TZCA 2QN1A 3MNFA 3VM6A 4F71A 3LUFA 2RHTA 1VZ2A 4HBZA 2C4WA 4LYFA 1J1UA 3OIWA 2JFPA 3OT4A 3GJRA 3K9BA 3ICQB 3DE5X 3JSAA 4QBFA 4L16A 1G59A 2CXOA 5C52B 1MX5A 3F5QA 4YREA 5C7YA 3JRXA 2P62A 4QHTA 1FP2A 1P7ZA 2WNHA 3SQMA 4LKOA 3BQ9A 4MUKA 4WESA 3C5EA 4P7FA 1IJKA 1ADFA 3LA6A 2DFNA 3DO8A 4F7WA 2WFLA 1FLVA 2H2DA 4HWKA 2XMSA 3BJMA 1KMNA 1ZWKA 4IV8A 4NBNA 3ZK9A 5DULA 2A9QA 3EY9A 1YULA 1O03A 2WTBA 4MHSA 4TTAA 1NN3A 3EAQA 5JZBA 2Q5IA 4M22A 5IAAA 4OKSA 1VA5A 4HVAA 1CS0B 1O94D 1W5AA 2H2FA 3TAHA 1SCJA 4J0FA 4LISA 1KNQA 3ND6A 4NMXB 3B1WA 3IUYA 3ZJTA 1CVLA 2D1FA 2XXAA 1XVAA 2HHCA 3C3DA 4N82A 4HMQA 2GTIA 3FNGA 2EP8A 1V1MA 4JEUA 1EFKA 2R1ZA 4QO8A 2HL6A 3UAVA 1A5SB 3WKEA 5ICEA 1CQJB 3PTAA 1G1MA 5CM2Z 2OZPA 1QIKA 1ZKDA 5EZ6B 1C8LA 1PGJA 4RPHA 3G8AA 1Z2NX 2P0YA 5F2KA 5GZ1A 2OCPA 4XEHA 5AVQA 3K0KA 3LLCA 4PXYA 2RAPA 3ZLBA 4POOA 1AGYA 2GKGA 1JAYA 3MMSA 3OZAA 4L76A 4NU8X 3SS9X 4WFKA 2HBQA 2Z58A 2BIFA 3GEPA 1OBCA 1XYYA 4QDTA 1HYGA 1CR4A 4D2IA 5D1HA 3T3OA 2ZJ7A 2ZUEA 3JU3A 4M8IA 3LXUX 2F9FA 4A03A 1SXHA 2JZCA 5E4TA 2ZBRA 2OM2A 3A9VA 3JXEA 3A6KA 4MMZB 1YONA 1RFLA 3LQ2A 3RC8A 3DHNA 1WV0A 1T4MA 3JSXA 2GD2A 4U5XA 4GECA 4M1TA 2X1MA 4BLTA 5CBKA 4ZHSA 2ZATA 3QBTA 1DBVO 3UZUA 6REQA 1A88A 2A1UB 3D7KA 4C05A 1KWKA 3MJSA 3ABZA 4MRVA 2ZSDA 1SKYB 2JCYA 4EJSC 5BN4A 3EIOA 5EVCA 1ZOPA 2DPHA 5MF6A 2QRGA 1T8SA 3HJGA 1RLJA 4LTDA 1KAHA 2RDMA 4Y2UA 2ZJAA 3KUUA 5FQOA 4BXOA 3ED5A 3FYUC 3RS0A 1ZNWA 5HZKA 3DLCA 3PEVA 4TL9A 5CH5A 4B79A 2B4QA 2C4NA 1SBQA 3EMVA 4B1FA 1BDBA 2BKUA 3NG1A 4GX1A 5FTLA 2R65A 2XTMA 4KGXA 3CUWA 4DBLE 2AUNA 5HK9A 2CMDA 6YASA 4BRSA 2DPMA 4OX9Y 1T43A 4EY6A 4IUCS 4URXR 1RYZA 5IEBA 1C1DA 2NSDA 1QO0D 2YN0A 3DW1X 3IKLA 3R5KA 1JEJA 5JEDA 3KR2A 1FP6A 4RHCA 3M4JA 4OQYA 3IQFA 1Q14A 3U4GA 3F7NA 3O03A 2QP3A 4FFMA 5DHRA 5C53B 3QQPA 5K6RA 1IVSA 4F4HA 1XRNA 1JJBA 1E5QA 2Z08A 1GPAA 2YS7A 3A3PA 1EFDN 1DJPA 4E33A 1PYOA 4IWYA 2BEVA 1PF7E 5DW3A 4KXWA 4CODB 1ODCA 4JI8B 4LF8B 3W1EA 4QPZA 2D5CA 5F33A 4HADA 1IWBB 2QUKA 1KVTA 2WHPB 4Y1FA 5H3HA 1C8VB 3QEBZ 1D1PA 1UODA 4UM9B 4CLRA 2FPSA 4N39A 1XFDA 3A9WA 4HEQA 3D8SA 3DE3X 1TA4A 1XCPA 4QUBA 2YIVX 1NZDA 2LD4A 2OESA 5HZMA 2SBTA 3CM0A 2NNWB 1T2DA 4BUZA 4Z0TA 3RIMA 2WFZA 2Q3CA 2B5WA 4AW9A 1A3CA 4BLUA 5AUNB 4PO1A 5AM2A 2ICAA 4W6ZA 4C6RA 1DX4A 3PDCA 5JAIA 4V2UA 5LBIA 2IZZA 3HU5A 3NGLA 1IBMB 2C2BA 1II0A 3SFTA 1PK7A 1P2DA 4CW7A 4FWBA 1O5IA 5B58T 4DG9A 4Q9NA 2QD1A 2BBWA 1UXOA 2I2WA 3OZXA 4MV9A 4O4LF 5ECYA 5K3DA 5HOEA 3KQNA 4HDMA 3EXEA 4B35A 4OFWA 3GMIA 4MUMA 4DA7A 3FE2A 2A5DA 3TIGA 4UUMA 1R0CA 3DV0B 1CR1A 1ICIA 1U5CA 1MVOA 2J6CA 3IERA 3M6UA 3N8IA 1IVYA 4RVOA 4RU1A 1X19A 1U8EA 4AUEA 4A8PA 4XQCA 1SWVA 3RPEA 5C5CA 4AZ0B 2JAPA 1I2DA 1GPJA 2AHRA 1OI7A 4IRMA 3QNUA 4NZ9A 4AQYB 1Z6AA 3DVLA 4FYVA 4QUGA 3SZ3A 4Z7QB 1VDMA 3GD7A 1H4QA 2VUIB 1G5IA 5T64A 4F06A 1NU8A 3FR8A 4ENPA 1MA0A 4H4EA 1OOEA 2H8KA 3L8ZA 1Y6FA 1Y1SA 4GQBA 5JIBA 2HPHA 1OFHA 1VGQA 1IQRA 1TIBA 2WKPA 3IUNA 3E2PA 4FYWA 4QU8A 4BBAA 1ECJA 2O2EA 4BLOA 3PXAA 3D8UA 3THYB 4NKRA 4IIUA 5JPIA 2FMKA 3HCRA 5CT9A 1E3LA 2QMEA 2UUPA 3JD1A 3PJGA 1QGUB 5BOSA 1Z26A 2FDXA 4KRFA 3S2IA 1GPBA 4IH1A 4WKBA 3L0PA 1RXSA 4TOIA 1VI2A 4PG4A 3O6VA 4BFVA 1KEZA 3SIXA 4YAIA 5LZ2A 3BF8A 1NDHA 1ZD2P 3OHMA 1NSTA 2FHPA 4MVXA 1TW3A 1MNQA 3UGJA 4INJA 3JR7A 1OI3A 2O50A 4MV3A 1UBSB 4G1VA 3AHDA 7ADHA 5TARA 5THQA 3VR2D 1AURA 2VP0A 1FP4B 1P7VA 3FPBA 3N7TA 4WZBB 3T3NA 2DH5A 4PO3X 1UOOA 1KI9A 1M1UA 2Y68A 2P2GA 3E27A 2R6CA 5JAMA 3OA0A 1RJ9A 2I9PA 2GN2A 4LWPA 3S29A 1XKXA 5JRDS 2EJTA 4X7BA 3RS8A 5G0VA 3SQNA 5LNK6 3NWBA 1DAEA 1E3IA 2JLRA 3BERA 1HC7A 2ILVA 3BMNB 1V25A 5F3DA 1HFWA 2IXTA 5JADA 5JNVA 4DXDA 3B7GA 4MA4A 1W9HA 5HF5A 5TPZD 1R3DA 3PHLA 1NYRA 4CMBA 3EHEA 2XT9A 3L02A 1RXEA 2BZGA 5FWNA 1FEZA 1YVDA 5EZYB 4DR2B 3NDJA 3QOWA 3DC2A 4BFCA 1NUUA 1B15A 4U3JA 3QKTA 1NKSA 3LO5A 3EW9A 3MQ2A 2VRBA 4NBUA 1RBMA 4UW9A 3T9DA 3ZZUA 4AJ2A 2BBOA 2WZCA 5DHUA 1L9XA 3KQQA 3TOZA 5CLGA 5JMWA 1RDFA 2ZULA 3C6MA 2HA7A 4HX5A 4ZI7B 1CJVC 1NUSA 1ONOA 1Z6ZA 2V8OA 3ANYB 3DB1A 4MV8A 4X1YB 1YT5A 1DMSA 4JELA 5A9SA 5HPYB 1LWOA 4WNAB 2QVCA 3ER6A 3JQ6A 2C9CA 3CLUD 3QLVC 3R7BA 1W59A 3W05A 4E3WA 1ZHHA 1MMFB 1CZHA 3WYBA 1U3UA 4YR7A 1KPHA 4JMLA 4DREA 2C9ZA 1X39A 3GX1A 4GX5A 2M1ZA 5HKLA 3TDNA 4A1FA 4W9MC 2HW8A 4AKHA 3SS8A 2QGFA 4BGIA 3J81k 1CSEE 1QKJA 3K1YA 1Q0TA 2DUUA 5KQMA 3JALB 4ZK2A 2HU5A 3GV0A 4R40A 5B3AA 2GFQA 1IEVA 1W75A 4FGWA 4QEZA 5IAJA 3R4VA 3AI3A 4OFXA 3TCXB 3N2EA 1SA0B 4PU0A 2B8JA 4IX9A 3UG7A 1NP3A 3LV8A 1XLTC 3G2JA 2AF4C 4GNRA 3FNQA 3SBXA 5BR8B 2R2AA 2YW2A 3HUDA 1ZBQA 3F6BX 2YR0A 1Y7HA 2KB0A 4IVRA 4FMCF 3AKYA 1QGDA 1DC4A 2QRMA 3MRVA 3O1IC 1QZZA 1XVLA 2B61A 2DP4E 2WJPA 3F3KA 2HCRA 3FIUA 3GXOA 3MERA 1FRNA 3ACDA 4HWSA 2HV9A 4KQEA 4RTNA 1LF0A 2C8VA 5E7QA 5G0SA 3EODA 2E3JA 2P2YA 3IP9A 3K5WA 4AN4A 4CM4A 3HBFA 2QRLA 4F3KA 4MAAA 1EFTA 4KVZA 4DS3A 3D3EA 2DFLA 3I64A 1MAVA 5BYBA 1CFZA 3EXG1 3SU8A 3BKXA 4ML3A 2BFEB 3O74A 1Y6GA 2KSQA 3NFYA 3W2FA 1E96A 2BF4A 2RGCA 4CQNA 1HOXA 1NL3A 3AERA 2I67A 1KETA 4LSWA 3LLMA 4KVAA 3WGLA 4ZDJA 3CU5A 1KQ3A 1U2PA 3QVWA 5EKUA 5KKNB 4LHEA 3T3HA 2C5LA 4RQUA 3ZCUA 1BEZA 1Z4NA 1GCAA 4Q4CA 1X38A 3JQDA 3BMCB 2QN7A 2EC5A 2CNLA 3LZCA 3S44A 3W0LB 1PTKA 4EP1A 1UOQA 3FF1A 5C3MA 4YI5A 2Z9DA 1P75A 2BC9A 4C7OA 1Q1NA 1ZA1A 4X7PA 3K8YA 5EP1A 3IEUA 4UD6A 1KDVA 1JEYA 1E2EA 1HA3A 1EH5A 2MJLA 3KZXA 2RH5A 3GNLA 5FUBA 5K0LA 1BFUA 2ARKA 3OCJA 1UJ6A 4ATNA 4F72A 1QVAA 3RCBA 1HZJA 1NW3A 5BT9A 4EB6B 2CVPA 2HQOA 3SYNA 3GARA 2AG6A 4H6VA 5ELMA 2BGLA 3BWVA 3RGWS 3LP6A 1PNVA 2OORA 4WCFB 3AUAA 2VSYA 3QKWA 5ALXA 3GPDG 4KG7A 1QP7A 2C8JA 3QE3A 4M9XA 3T1OA 4LC1A 2CZCA 2H17A 2HSWA 2JASA 1WKVA 3DDUA 1WEKA 5K0JA 3OC6A 1PKEA 1P74A 4Q1FA 3THWA 3QE2A 4OGWA 1Y3IA 1Q7RA 3CZAA 3ONNA 5LZ8A 3H4MA 4HKTA 5DHFA 1TVKB 1GFZA 4C30A 4LE2A 1I7SB 2C9BA 2P8JA 3DPUA 4FS3A 2NVOA 4EKNB 5JATA 1K9VF 3IMKA 3LHSA 4FX5A 4LMAA 5IT4A 1Y89A 5GGXA 5JZMA 3UJ6A 1XYVA 2H1OA 1QYXA 2W2LA 4Z3DA 3T5CA 3CMCO 2O0MA 4JLWA 4EG4A 4UBMA 4R9VA 1LQUA 4IJWA 2DUWA 1CK4A 3E70C 1ZOOA 3O3MB 1LLFA 2VXCA 4JJ6A 3NRBA 3RJ5A 2X3FA 3KTAB 2ISSD 3FPCA 4NK5A 3EZ7A 2AFRA 1CRQA 4QAQA 3S28A 5AXDA 2VP9A 1WXDA 4V0MA 3M6LA 1KJIA 1QF9A 3AEUB 3KVOA 4FSHA 2AW3A 3STUA 1JPVA 3T5TA 1BN7A 1U9JA 1WCWA 2C8LA 4RYLA 1LI7A 3RTCA 4CKBA 4HQNA 2XNSA 5B5SA 3FDIA 1VPWA 3I2FA 5A4MS 5K20A 3USCS 3DLBA 3IQEA 1SG0A 3M0EA 4IIFA 2FH5B 4PCVA 5TF0A 4B7AA 4F5DA 4ZEMA 1KVRA 3ASYA 1MXFA 4O8ZA 3FJOA 1RLTA 1XCOA 2CW5A 1BQ4A 2FWAA 1F0KA 3CF4A 3OJLA 4MA5A 2XZOA 1IEQA 3HY3A 2G82A 3LYAA 4AFNA 1EUDA 1S3FA 2WR8A 1T8TA 2H2IA 2ZWPA 2X6TA 3H9GA 3NM4A 4TWRA 3L01A 5FP0A 1G6HA 3RI3A 3V6LA 1XCLA 3I8SA 5FWYA 4LS3A 3GB9A 4AG5A 1NRXA 5FWDA 1GL9B 2NXJA 5LD2B 1ZGCA 4FSXA 4FR2A 3L6EA 1U7PA 5BQXA 4QFCA 2DECA 4U9UA 1GTG1 4RNDB 3GNQA 3F4KA 1X14A 3LOPA 4J6FA 4LZOA 3QWHA 2XTJA 2M1XA 5FT9A 3SP1A 1NLUA 2YDXA 4E5VA 3AF2A 2QK4A 3C7CB 1QFYA 2QP4A 3H17A 3RGGA 2IDKA 2IUSA 2NTJA 4X90A 5CU7A 1YL6A 2INGX 4ZOLA 5H68A 3RRZA 3O31A 1E98A 5AJYA 3PNKA 1HORA 1OV4A 1WHTA 3HB7A 4J07A 5EWLB 4C06A 4DEVA 4O1MA 1FXSA 1ULZA 3DCNA 4RPIA 4ZO9A 5IVPA 4M46A 1ZCAA 3IXQA 5C5DA 2IY8A 1ULSA 3HZRA 2ZI3A 5A5VA 3I4CA 3ZVRA 3GJ8A 4IYRA 2W90A 2DQYA 4ZAWA 3WK5A 2Z5GA 4IDGA 5L3QB 2HH9A 2JW5A 4QDZA 2VHZA 2BMDA 1HEYA 2C0CA 2KHZA 2VPWA 4BCCA 3D7RA 1NJFA 1VMAA 1I5RA 3E2IA 3PD7A 4BJ5A 4KITB 5AOBA 1GR0A 3H7AA 2C61A 1IM8A 2RGNA 3WNCA 4DV2B 3N6XA 3T9CA 2PZFA 4EHDA 1GRVA 1OTXA 1TMOA 4MVWA 3IBSA 3KE9A 4CQLA 1EJ6A 3GA0A 3NZEA 3X1XA 4WLOA 3UANA 1NAIA 1QQAA 2GCEA 2O57A 1TMYA 2O0KA 3NI2A 4B7ZA 3RSLA 3P94A 3HP4A 4NV0A 1NQOA 1RJFA 2JI9A 3HA2A 2HRCA 2PKYX 3WE7A 3CIOA 4LPSA 2OHXA 4LOLA 5IABA 3CUUA 2JGJA 2BR3A 2OHOA 4LMPA 4TKVB 3GK3A 4LOHA 2H0AA 4U0JA 5JJKA 4NJMA 2YYYA 2AN4A 2PRIA 4Q19A 1SZCA 3DZ8A 1FOEB 2VC2B 1FY2A 4M87A 1BXZA 2HKIA 4RMNA 5EE1A 1GRCA 3P32A 4DCNA 1HYHA 2F1RA 3SJUA 4U6QA 2VLBA 1OBVA 2PLFA 3HEMA 4U8GA 5KPJA 2LWIA 2P9FA 3B8HA 4I2NA 2QTLA 4N8EA 4ER0A 1FDOA 4HXGA 1U0OC 1AKTA 3QVTA 4UFOA 1Y9EA 1ECLA 2RJ3A 3S8MA 1JH9A 2NUBA 1XF1A 5IFLA 5L3SB 1NUTA 2M6LA 5L9AA 3L4EA 1GXSA 4MWOA 4RQBA 1XZDA 2RHMA 1S8OA 1U8CB 3DOFA 1Z3CA 3SR3A 4IWNA 1N6RA 3ZDEA 5LQKA 4PQFA 3SOZA 3CNHA 2DU8A 1CY6A 4KBFA 1SCBA 3UHAA 5LFAA 1TL7C 1V95A 1TE2A 2X1VA 1CY2A 1MDBA 3IVMA 2GN0A 1AD2A 4ZALA 1EWVA 1Z7EA 3QQ5A 4LSZA 4KRYA 4LQLA 1E0JA 1W35A 4EI8A 1EGQA 3OETA 1VPDA 3L9XA 4L5AA 3FUWA 4OIFA 5LA6B 2WDPA 2GEJA 3PHBE 1KTIA 2VNHA 4FFNA 4QNRA 3A4VA 3QXJA 4JWKA 1WF6A 3GUUA 3A6PC 4JSYA 5U4QA 2H59A 1XMVA 3GLUA 4GWGA 5CA0F 4RF4A 1FRFS 1H0SA 2VPZA 3ZU4A 5DCUA 3RTGA 5JCOA 4YRIA 4WOCA 1XK7A 3MS7A 4RZ3A 3U81A 1VL2A 4H0CA 2R6JA 3EDMA 4ZP1A 4N0DA 3AP1A 3WLLA 3KNZA 3L05A 3OOEA 2CBGA 3HDVA 2YX1A 2GPSA 3KHTA 4YMWA 4Q1CA 2HQSA 3AIMA 3KEQA 4GOLD 4AO8A 2AR0A 1UMDA 1P0PA 2I6GA 3HDHA 4LYHA 1ISRA 4C03A 3LLVA 3MTJA 4W5JA 4XWGA 5D6OA 1QIEA 4OP2A 2ZB7A 2ZKIA 3RU7A 1FMCA 4BQPA 2P30A 2R60A 2KS6A 1GSOA 4ES6A 4E1AA 3AVYA 3GEHA 1WMSA 2PBLA 3JYHA 4F46A 1SVMA 2XF2A 1JYFA 1YHYA 2ZYWX 4I8DA 2XCIA 3GFBA 4RSMA 4TLAA 1NXTA 1NUAA 3FKQA 3NNNA 2OAQ1 4JDUA 3RT9A 5K6TA 5EJMA 2H2AA 2I78A 3WB0A 4IV5A 3HYSA 1WF3A 1XGKA 1MB4A 1PJAA 2ABWA 2JCXA 1ORRA 1W88A 5IJ0A 3DHEA 4S12A 5ALLA 1KSJA 3VPGA 1AMOA 4MQLA 4XYGA 3IE2A 2JJ2A 3CUSA 4ZOLF 3MPUA 1X70A 2ZYUX 3DTVD 3Q1LA 4ZVNA 1TO6A 2G5GX 1YZLA 2FEPA 2B98A 2QGNA 3PI6A 1MJGA 4PX9A 5E6SB 3NWOA 2G6TA 4EGJA 4NBLA 1RRKA 3B6MA 2V58A 3MQFA 1VIYA 4A92A 1E79D 2XRMA 3QHAA 4NDAA 5DCWA 2O8FA 4RTLA 1ESMA 1HTBA 3MT8A 2XIJA 1XWIA 4BGDA 5BQOA 2BHLA 2WW8A 3VPDA 4AROA 3WYDA 4WBSA 2ZIXB 5CFNA 3KQWA 3NUQA 1UH5A 2H4HA 5JQGA 5K8VA 2CXHA 2NZ8A 4GZ3A 4ZOBA 4QG7A 4RDHA 3TM4A 3QNWA 3Q9SA 4AKIA 3TXYA 1MU0A 4BWGA 3ROKA 3PB3A 2WF5A 1HYQA 1WETA 3PPWA 3GEDA 2XCRB 4DR7B 2BHSA 2F90A 3GRAA 2YY7A 3FM9A 4JJ8A 4FEAA 3H4TA 1JHUA 1GA1A 3WIEA 4GOKA 4JQCA 3IKJA 3P9XA 4Y18A 1UBCA 2NP7A 5BMVB 5A3JA 1HSZA 2J3DA 3VVCA 2VYQA 4X3OA 3BXHA 3U56A 2CSUA 2NO4A 4E3ZA 3EPRA 4R2IA 3UG6A 1CQIA 2QPOA 4DKJA 1AC5A 4XOUA 4GO1A 4TV9A 1NBOA 4YK7A 2VJMA 3GRZA 4TKLA 1N9GB 1PL0A 1TM5E 3R44A 3FAZA 4NLLA 3TGWA 1K7CA 2A7XA 2BJVA 4ZJYA 2ZM5A 2X0EA 1I7DA 2HT1A 5ADVA 1Q0RA 2QN3A 2VF7A 1NM5A 4BNXA 4AG6A 1QIGA 4L27A 1R0BA 2AG1A 3RASA 4GH5A 3CJTA 3V9PA 5AKGA 5C1OA 4X44A 8MHTA 1OWMA 1GDDA 3TTXA 2BTOA 1G3RA 3BHMA 4HT3B 1EBUA 5IKMA 4V02A 2GTPA 1W8IA 5JCPA 2XHEA 1EK2A 3DD5A 4ZVMA 3BIJA 4DPKA 2D2VA 4I1OA 4DJTA 3FNHA 3HO6A 3WG9A 4EHLA 1YBFA 3TFOA 4I55F 3SQDA 2E4XA 2VJBA 4MKRA 1V9SA 1M2KA 1T0HB 2DOKA 3R5FA 4AKTA 4BFYA 4LBYA 1FNSA 1MENA 4U2EA 3SYKA 2J3HA 4PZAA 1UQRA 1KGSA 4ZEOA 1H6DA 1EE2A 1XXHB 3K73O 3DNMA 3FZYA 1G6KA 1DXHA 1P2BA 3GLIB 1BDIA 2PGJA 3M70A 1LJUA 2ZGVA 1X2EA 1UADA 2XDWA 1E3WB 2XE4A 3FMFA 2O5RA 2W6CX 3KC2A 2YJNA 4G4JA 4JFAA 1IIRA 4RPGA 1FCJA 2R47A 5JAPA 1NSYA 4L8YA 4OXNA 1C7RA 3BB3A 2YJTD 4GICA 5TPWB 3SS7X 1AUXA 4JQOA 4HTAA 1WBJB 4C88A 1APBA 4TLCA 3NVAA 4ZMBA 2UAGA 1F4PA 3W8DA 1ESEA 4HZIA 5C8YA 2E87A 5IMSA 1E1CA 2E2WA 2IHYA 3G88A 4EUKA 3QG1A 4E2ZA 4P4LA 3B78A 2F43B 1X7HA 2JFXA 1EDBA 2PD6A 4LRQA 5CFRA 4MULA 1SK9A 4H4CA 3QUAA 4H0FA 3TCKA 2V7XA 3HN6A 4EJSA 2C7VA 5HCNA 5KWSA 3NUZA 4E12A 4PC7A 3BFJA 2B4TO 2OGUA 1EDEA 3ELUA 3FYUA 2B7BA 1GKIA 3MG9A 4L9SA 4V0LA 3ZGVA 2HPAA 4E88A 3LBFA 4WWHA 3K5IA 4XIYA 3SE7A 6NULA 9ABPA 1TMKA 1ZZGA 2B2XA 4QYIB 2OXIA 4RO0A 1OIWA 4UPEA 3UJPA 3N3BC 4XUGB 5JW6A 3ZWVA 4MGKR 5JD5A 4Z7OB 3CVYA 4MP3A 3ZNOA 4KO3S 3AKCA 5LMZA 3ESXA 4Q9DA 3FWPA 2H57A 2BFPA 2IOQA 4MWDA 4Q66C 4X85A 3UFXB 4AVYA 4MUJA 4YRNA 1WULS 4YRFA 4DQDA 4WCVA 1YKFA 4IMJB 2IYTA 1R66A 4RSHA 3KKZA 5DW0A 3HJNA 3L18A 4FHZA 1NC3A 4WFIA 4B45A 4AN1A 1TTPB 2P27A 3VKWA 5JECA 2FSVC 4OX9B 3ZJUA 3DGFC 1Y34E 3LDUA 5K2MA 3IP8A 3VSEA 4BNYA 1SC4A 3TZBA 3GWZA 2QW8A 4G63A 4DF3A 2PSHA 1E2IA 3CH6A 1KZ9A 2DG2A 4OG2A 5EJ5A 3FFTA 4S24A 4DL9A 3R77A 3B9BA 1ODJA 4LFAB 4P82A 2WIBA 3IAS1 2R44A 2JRCA 5BNWA 1SRQA 5C1IA 5FUMA 3TPFA 2Q3EA 3K20A 1E2UA 2X5NA 3M1YA 3IUSA 5EHIA 3ULKA 3IHTA 1CW2B 2DFPA 3IDSA 3O94A 1JAZA 4I4TA 4LWZA 4Y9DA 4CKCB 3GT0A 3L92A 4IG4A 2C7PA 5E4YA 5F52A 2RH4A 2I4LA 1RYBA 3KEMA 4J6EA 3IDOA 3T41A 2BR4A 4TZ0A 2D62A 1HNWB 3KVNA 4Q02A 2RCYA 2CMGA 1Q17A 4TV9F 2GPNA 2HBYA 3KTOA 3OFVA 4CYMA 3NT2A 2Q99A 5KJ6A 1KEEA 3CMMA 5JNWA 5KYKA 2BFBB 2VJYA 5B1YA 4W9RA 4GVXA 1ZJYA 2BVNA 4C0JA 5CA1B 1XOIA 3CE9A 4WCFC 5IJ9B 5B55A 4B4WA 3JD2A 1DADA 3EA0A 2FWIA 4QECA 1QRTA 3A9SA 2HWXA 5BYAA 4CLDA 1H66A 2I6QA 4KAAA 1SURA 1P31A 3HR8A 4Q7QA 1COZA 1LY1A 5E7IA 2RE8A 1ZNXA 1T1RA 1JA0A 3Q9LA 5B7NA 1HE8B 2D8MA 4H1TA 4NECA 4B46A 2CNOA 1GQRA 3CUTA 5F73A 3KOMA 4N18A 4Q7JB 1WBBA 3C1TA 2LKCA 1W30A 3PCXA 4QPDA 5DNUA 1NJ2A 2TMYA 4YP6A 3S81A 3RSHA 4Q4LA 4KI0A 4QU0A 4KXMA 3OESA 3PQDA 3Q6MA 4Y7CA 1Z0DA 3T1TA 3RH0A 3ROMA 1ZVVA 2AGVA 1JPNA 1E2PA 3V2UA 4BZWA 4C6TB 5KTOA 3NETA 2EKLA 4N5NA 4J03A 3ZHUA 4N48A 3LGSA 2O3SA 3JVDA 3AP3A 2RIPA 2P3OA 2C7BA 1PT6A 2ZQZA 2JZOA 3BEOA 1LFDB 3P4UA 4KSYA 3UWKA 4HAWA 2DX7A 3G0IA 3LNCA 1WQ3A 4HUJA 4JLSA 2ID9A 2EATA 2Q7OE 1UC4B 1ACMA 1B0ZA 1BMQA 1CQWA 1O97C 1LFAA 2G1JA 2QR2A 3O3OB 4NPCA 5CW2A 4EO9A 2JCVA 1R6VA 3H1BA 1WO8A 4YT5A 4GZMA 4IXMA 4LXGA 4Q34A 5D7BA 5KVAA 4HGRA 2AG5A 4RZQA 1SELA 4HLQB 2X4IA 1JT9A 1KH2A 5F4BA 2GD6A 1ZI9A 6GPBA 2OQIA 3RUIA 4TTVA 3KZVA 4XD2A 2AFIA 2IEZA 1A8IA 2FFJA 2A1TR 2XWQA 2Y0DA 4YP1A 3AFOA 3BL8A 3QUBA 1UEJA 1H0RA 1SHLA 3HBMA 3WL3A 4EITA 3QPBA 5LZ5A 4ZK6A 2REOA 2XW6A 4M60A 2AYYA 2C57A 3LPAA 5H4GA 1H5NA 1ZK4A 4QBIA 3KUDA 2KW5A 5HG0A 5KDDA 1UWLA 2FWBA 3VV2A 1P9OA 1QXSA 5KTPA 2DMRA 2QR3A 2WKRA 1HDRA 4X84A 2B37A 3NANA 5H1YA 5I3ZA 4NMHA 2VH1A 3L6UA 4LXXA 3BH6A 4QUDA 3EVFA 3VSBA 2XYVA 4JC8A 1KI6B 4BO2A 2WB2A 4YXWD 3F0TA 2QENA 2H1CA 1IZ7A 2JFNA 5E7MA 4J7CA 1AKRA 2Y66A 4MS1A 5HZGA 1GUYA 2Y0CA 2VFAA 1J4AA 2JDIA 4GBMA 4B6RA 3JQGA 4X60A 3WLEA 1F2UB 1YC5A 3DE1X 2X0KA 4KVGA 1LNZA 1II9A 1XRQA 2UZAA 4OATA 4OGKA 1RQGA 5JXJA 4B85A 1JG3A 1GAJA 3AUKA 5DE3A 2H9IA 5AKIA 2DFVA 2JIPA 4RCVA 2IV3A 1LD3A 1J8DA 1SU7A 4IQ4A 3NTVA 4NMMA 4DV5B 5FBWB 2HWKA 1NJ6A 4UMFA 4GXQA 2AX4A 2JRLA 3QLVA 2QVBA 1W4RA 2A0XA 4ND1A 5GWXA 2B20A 3ZWKA 3IOBA 5FDFA 2FF5A 1TU3A 1VDZA 3GR6A 4PZLA 2PDAA 2ID7A 1PSDA 4ZT4A 1DEKA 4IL5A 3WNZA 2XUPA 2DCMA 4P7GA 3EYWA 5EJFA 2EP7A 3PNLA 1KEPA 2E6KA 3NHKA 4K6OA 5T41A 1PQYA 1QK3A 2A5LA 2UDPA 3EVZA 3LZDA 1NBHA 4LFBB 3UKDA 3UXMA 1ZVMA 5LKAA 3JQEA 2XYHA 4I4TF 1T5HX 13PKA 1YC2A 4KZKA 5CP8A 5AFSA 2LTAA 5LSAA 3GGPA 2BEWB 5KTSA 3OCVA 2ZPUA 4YLYA 5P21A 1WKCA 1F1BA 2VBIA 2ZZMA 3ZEIA 1ZJZA 4CPDA 4JHXA 3LXMA 3VHRA 3OFKA 4LJ7A 4UVEA 4I5IA 4XASA 3TJMA 4Q4AA 3ERCA 1S0UA 4KZPA 2GFHA 3AZOA 1GPWB 4LECA 1KZHA 1G17A 2BFFB 2OAEA 3C7AA 5CDTA 4KB5A 4PZ9A 1TF2A 2DWCA 3QPAA 4RM2A 1Z5GA 4B9AA 2YWBA 1U0EA 1JMVA 1ONNA 4FNOA 4QOHA 2BHRA 4QBHA 3ZJYA 1RP1A 2EGGA 4DANA 4ARBA 1VPTA 1GQYA 1XBTA 2YJ3A 2QD4A 2Z56A 3MTEA 5EUCA 4JIGA 5ERXA 3ZDRA 1TQ4A 1U63A 1EZ1A 2XA2A 2FK7A 3ZCSA 4K86A 3I2GA 1FRQA 3AB3A 3LQRA 1RPAA 2VL7A 3MJVA 5TVKA 4PCLA 2CFSA 3MMXA 3L41A 1N7IA 3OPYA 4LXUA 5ENZA 3NHUA 4G5QA 2I1VB 1A0OA 2Q5FA 3IT0A 4OLFA 4PNPA 2A94A 4PZ0A 3G7NA 2ES4A 2PJDA 5ICFA 3WLOA 3DP7A 4PE5B 1JUDA 3DV2A 2VQSA 4PYIA 3OM9A 4OV6B 5TDHA 4MGYR 3U1VA 3UWSA 4BBPA 4BFXA 4C2AA 3HXQA 2H48A 3B6EA 1J1ZA 3LT4A 1OA0A 4DM7A 1LPSA 1SCAA 1GTZA 3HEBA 4GI2A 4EM6A 4JGBA 4EW1A 4AT1A 5AXBA 2QJFA 1Z7YA 3L7YA 3MFYA 4N3AA 3HCNA 4LKRA 1U94A 3RROA 5BV8A 5T8KA 3TBFA 3ANMA 1DI0A 3D6NB 1ZL2A 4LVOA 4LQCA 1NXXA 2PXXA 3B3GA 2E9SA 1V4BA 2PMDA 1PT5A 3MXTA 4H6XA 1PI3A 1WA5A 3U7JA 1Y4ZA 3B1XA 2ZBPA 4JLNA 1L4HA 1IBCA 4OAQA 4B3FX 2V9CA 2BPOA 4XVCA 2VXOA 3B2NA 3I1IA 4GLBA 2HGZA 1J56A 4D79A 1K7EB 5KAMA 3I01M 1QQBA 1U2DC 4R8KA 3GLKA 1Z7WA 1P9NA 4YRDA 4Q1BA 1CE8A 1X7YB 4EH1A 2QR5A 1G5HA 3QRWA 1U6KA 1KYTA 2CZQA 2OD9A 1HDZA 2B0CA 1ZM4A 3SHTA 3SICE 2Z2JA 2XCQA 4MEAA 1SKUA 3ZWBA 1V5WA 4Y2PA 1Z4MA 4PSAA 1A8PA 4E0BA 3E9NA 3STTA 1RM3A 5AI8A 1GUFA 3S0JA 2BGNA 5E3HA 2VJAA 1PR0A 4OHUA 2D1SA 4YB8A 4DJEC 1FS6A 1W9MA 2WSYB 2D3TA 5EEGA 4QDJA 5BSFA 4U2BA 3N0RA 1L4GA 2J9ZB 2EWMA 2ZJZA 1N2SA 1P0IA 2V7WA 4QASA 5FAXA 4IQ0A 1PJ2A 4REOA 1CX9B 3KYDB 4ITRC 5M5BA 2GQ0A 1ODTC 2A86A 4KXXA 1Y3AA 2EBHX 4K9OA 3HSYA 3YASA 5E1OA 2W0MA 3O2SB 4Q9IA 5IF3A 3R6TA 5EYPB 1K68A 2I29A 2GPYA 2V54A 3G59A 4IFIA 5G1OA 5T67A 4OQLA 4O2RA 5F76A 1LC0A 1E3SA 3D9QX 1MA3A 2PT6A 4QQFA 1NYQA 5B4VA 1MH1A 1ULBA 4TV8A 3A3NA 3ENVA 5M3BA 1EP1B 1UZNA 1SULA 3O4RA 2VNKA 3KVYA 5JS8A 4FINA 4MINA 2Y2VA 2Y67A 4HK4A 5IMBA 3R3JA 4FIZA 2Z09A 5DGHA 3VZQA 4C20A 4AX8A 3RYTC 2FX3A 5CT5A 1M8FA 1PR5A 5EG5A 2P1RA 4WNCA 1J9GA 1ONSA 3W5CA 3A04A 4WSOA 2FPIA 3GUCA 3NEJA 3DVSX 2ZKLA 4HRXA 3FZEA 2F1OA 5G4LA 5IASA 5TMPA 1E69A 1WY5A 4ILEA 4IOMA 4R8LA 5EMKA 1WNTA 2BE7A 3A3YA 1H8HA 3SZRA 3TQTA 3TQIA 4UM5A 5TSDA 4KO8A 1DOHA 3ZD8A 5I8WA 5D87A 4OQMA 1AQ6A 4BO9A 5L6MB 5IAGA 3ZCPA 2GBFA 5EZ5A 4LYAA 4ENTA 5C5IA 5TIIA 2QOEA 3V8MA 5PGMA 1WSWA 4IAOA 3LMKA 1HZZC 1X1CA 2CK3D 1MOZA 4JB0A 4L2IB 2IE0A 1PCXA 4S1OA 4QEDA 2H31A 1DEHA 5EXPA 4ABTA 2ATXA 1VTKA 4S2UA 3TOVA 3KELA 3EOAI 1DJMA 1SRRA 4OMDA 2MU1A 3PHGA 4R1OA 5EHXA 1F0PA 3BE8A 1K8QA 3W34A 1L7MA 4DVGA 4NY1A 4PEVA 2HCFA 4FFBA 5CK4A 3GPIA 3KL4A 4JROA 5F9MA 4H7IA 4A7PA 2CT8A 1UJ5A 3H2KA 1DDOA 2H08A 4I5DA 3ZI0A 3ZDDA 3LHDA 1VLQA 2A9OA 1HY3A 3HA3A 1MXHA 3BSWA 3DHVA 4RHYA 4UCXA 3DQZA 1CUFA 2LKDA 2IXGA 4U4AA 2C2WA 4Z3KA 3COZA 3OQHA 1W5SA 2EFDB 1CS0A 5EJ7A 1UFVA 3BN3A 4FKZA 4GT1A 3F9RA 3DMYA 3PRHA 4V0ME 1E9RA 1YUMA 1H0HA 1L7PA 1PN3A 1S2GA 2DWPA 3BMXA 2MYTA 4HQLA 4ALMA 1NXSA 5KX5F 2O3UA 4WKCA 4KLZA 4I19A 2ZT7A 3NHZA 4IHQA 1WP9A 3DH0A 2ZRHA 3ZX5A 1MCZA 2PS3A 3FJYA 3N7AA 1LW7A 3OF3A 1GUAA 1V4NA 1W96A 4IJQA 1M6EX 2QTBA 3I30X 2FW8A 1N8TA 3ZWPA 1L7BA 4Y6RA 5J4HA 4DCSA 2AS0A 4IF6A 4QT0A 2NU7B 2C0QA 1BW9A 1P7WA 1TYDE 2P11A 1X9HA 3F6EX 4O6VA 2FWJA 2P68A 4B33A 1SWWA 1GSIA 2J4DA 1DKRA 3JZMA 3NCTA 3ENQA 4UEQA 4XCQA 5K0ZA 1RR6A 4G0OA 1XROA 2BCGY 1SC9A 3LWNA 3ABQB 2ZUUA 4LVCA 1Q6ZA 5JRJA 2QEQA 3AFNA 3HR7A 3ZZNA 1ODSA 1T2NA 2Y9MB 2AW5A 4R6WA 3VR5D 1S7CA 3GVCA 2VP6A 3EQZA 3FSRA 3H5IA 4C87A 1YH3A 4COOA 1XP5A 2WIDA 5EWJA 1M5UA 1XAIA 2G77B 2Q3HA 3NOOA 4UQPA 2RHDA 4BKOA 2KM1A 2C59A 4TKUB 2A1UA 3MWKA 4ZQCB 1ZK2A 2XT0A 4LXIA 2PUGA 2JI8A 3LC1O 2O2DA 2OD7A 2WHXA 4J76A 3ZQUA 3G82C 1D0IA 1MT3A 5BXQC 4Y30A 5DWQA 3F5FA 1E2NA 4GLFA 1CUXA 2WHYA 3C8ZA 5CHEA 2IOFK 2CXNA 1EQAA 1PHPA 1EZZA 3V1MA 4R71A 3Q40A 1C7QA 1TKBA 2NT4A 4FI3C 5JS7A 4ESVA 4EZEA 3Q0TA 3FCYA 3HZHA 2N1BA 4MQFB 3R7DA 1JS1X 3I8OA 5GADl 4RHFA 1RI5A 3CO5A 4MB2A 3SVTA 1PJCA 2BI8A 5L3RA 4DAEA 4FM9A 2ECQA 4LCBA 3IEMA 4KN8A 1T9BA 3NTQA 4BIIA 2PO7A 3L46A 1ISFA 2VWHA 3RC2A 1NXPA 3UFBA 1G20E 1U99A 5EESA 1Q84A 4B8WA 2CMHA 1I14A 5KMGB 4TV8F 1P1HA 1ZVQA 2NPOA 5F7XA 3TX2A 1EXVA 2C84A 3AO0B 4NZYA 3LIPA 1T5BA 4AS3A 1UOEA 1XEWX 2GN9A 4INAA 3HV0A 3QF7A 4WE3A 1TK9A 4WOKA 4BX3A 4KQHA 2M6KA 3FPEA 2K7FA 4YRCA 1JG6A 1K06A 5HYVA 3IPRA 2ECPA 2WHPA 3WHLA 1F8XA 1U2QA 3ZV7A 5KYWA 4OO3A 4FJ2A 5EJEA 2QZPA 3WADA 2J3QA 3O8OA 3PSHA 4TN5A 1OPRA 1SPXA 4URZR 1YK0A 1VE1A 2GESA 1DAOA 2C5SA 2OT3B 1G19A 1LI5A 1I6MA 1BFKA 3W5SA 4PW0A 4RVDA 4C2BA 1RXYA 2C2OA 3DMTC 2ZQYA 1E1YA 1T4CB 4PX2A 3LK6A 1YQUA 1E2FA 4DR4B 2QDKA 5SICE 3WLHA 2GKSA 1WUIS 3COVA 3TUJC 2ODPA 1X15A 1N6NA 3CZQA 4RVNA 5CT8A 3COPA 4YJHB 2X0IA 2AUMA 3U3XA 4UM7A 2O3RA 4F7DA 1B8UA 1FUEA 3DZGA 4JJKA 3UXYA 4BLWA 4BC1A 4XFDA 4FMDB 4AM8A 1DTWB 4RACA 4RV9A 5KHAA 4JK3A 3WR5A 4CQMA 4UCFA 5IHPA 5EKDA 4C5CA 4AZ0A 1NMSA 2B1RA 4I14A 3S99A 1L4EA 4J1NA 1CZUA 1FL9A 4OJQA 2YV4A 3OPMA 3PKZA 2Z8YM 2HLDA 3ZXXA 4WD3A 1RZRD 4GKAA 3R6DA 4WK4B 5JMTA 3PGMA 2HO5A 1T1EA 2B69A 3QKUA 1WABA 1KEWA 5D8DA 4MI3A 4UUAA 1RYHA 4BNVA 3B12A 3WLJA 1EUYA 1J24A 3VR1A 3BREA 4M0UA 1YCHA 1FS5A 2P0AA 1AM4D 1JT2A 3NM5A 3NXKA 4GGPA 4NS1A 1K6EA 4BMSA 1Q1ZA 4F5ZA 3I3SR 3PEEA 1E1DA 4G36A 2D13A 1GG2A 4CKXA 3BSYA 5U1PA 2RHCA 1J7KA 3IULA 4DQ0A 1SXJB 1V11B 3SNHA 4M8LA 4ZEVA 2X9QA 3SQLA 1BCRA 1VLMA 3LW7A 1C0KA 1L5KA 3BXFA 4EKYA 4M1SA 1W52X 2EFGA 1QGUA 2R6HA 5KDOA 1KOFA 5JG7A 1CCWA 2HJ9A 4LMRA 2HWWA 1VMEA 5L7YA 3D5TA 1LDNA 1GLVA 1ZD8A 3LGXA 4TWJA 1WDTA 5E4FA 2JEZA 2V6IA 3EBLA 4NZMA 2XMCA 3JV7A 3OFND 4QQRA 1ISIA 1GM5A 221PA 2ODBA 5IDWA 1E3TA 3NV9A 3UF0A 4Y0VA 4HNUA 2ZJOA 2ZRBA 2ZJ5A 2DUNA 4OXXA 1S02A 1NP6A 3G1WA 1U7DA 1IZ0A 4Y6GB 2HRZA 2Z0MA 4ECAA 3H9JA 4YPOA 4FXOA 1JFRA 3TG2A 2X13A 3L1VA 4DEXA 3KSRA 1D5WA 1JMYA 1X7DA 3CINA 3GZNA 2ZS8A 3C45A 3QPWA 2DHQA 3K9WA 4FJ0A 3KV3O 1FTNA 2YYZA 2HXYA 2QNIA 2UVQA 3DV9A 4QTTB 3MIIA 4LV8B 4PWYA 1GGVA 2QUIA 2YXEA 1OLSB 2ZYAA 3LKVA 1I3LA 1KI7A 2CXSA 2Z8XA 1SK8A 4RKWA 5FLYA 5IDYA 2QE6A 1FTGA 1B73A 3WDLA 2WUDA 4MUIA 4Z1MD 2Q1UA 1U4NA 5EZYA 4G0UA 4KMRA 3NXSA 4RCZA 2W48A 3QA9A 1AQNA 1EM6A 1XD2B 3LPDA 3CCCA 1BWQA 4IFTA 1SXPA 1XHEA 5DBHX 4YUWA 1GFIA 4ZI7A 1ZHOA 1EMDA 4B6GA 4GLOA 4D5GA 1JR3D 4DMCA 1CULC 3E7XA 2XCLA 1NT2A 3CRW1 2X7JA 3H8JA 3OTGA 4MUYA 4UMVA 4WNIA 3AONB 4WNAA 2FWNA 4BE9A 4CIWA 5JBIA 3VPSA 2HIAA 1LBTA 5IXJA 3JASA 3WO1A 5LMNB 3SHOA 4BO3A 3LQYA 2JJ1D 3MHPA 5K45A 4GW3A 3RUEA 3BCSA 3DDOA 3LOQA 4IJ5A 4K9RA 4KI7A 4Y2XA 1AF4A 1WZUA 3DUFB 3FSGD 1OZAA 3KKQA 3N7UA 1P18A 1KU0A 3PR2B 4L50A 1DG1G 3R0XA 4Y9RA 3WGZA 1T5LA 2FE4A 4JOQA 1ZUNA 2G1PA 2LR0A 3D4BA 1G8AA 1C3OA 2ECOA 4HSEA 3RUPA 5U9CA 2AZ4A 5IPFA 3EPJA 1EX9A 4JGGA 1E4OA 5DRTA 1OAAA 4R1SA 2N42A 3ILYA 5ALTA 3U3RA 1SA0A 2NNLD 3KOZA 5CJPA 4J0KA 1XTRA 3NHYA 1BE0A 1NJSA 2O1WA 1DQPA 3OQVA 3A26A 3NGXA 1XA0A 2WFMA 4EJ6A 4EG5A 4UFNA 1AOXA 4H3SA 4NNPA 1OIVA 5IC5A 3SFVA 1L5QA 3EIFA 4KGDA 4CHTA 2O59A 1U3GA 3ZE2B 1BTOA 2IU4A 4CKWA 2PXAA 3R3HA 4OY3A 3LKDA 4ZICA 1HQDA 4GVLA 1VXRA 3Q2IA 5LJLA 1RJGA 2X22A 4EGSA 3IP6A 2FSVA 5AJHA 3UY4A 4NENB 4ETMA 4B2LA 4K87A 4DMKA 3I9NA 2C5EA 2BE9A 2FPKA 2BFEA 3OHPA 3QLUC 1R0YA 2AOTB 2J32A 4UEOA 4CKWB 2VK8A 3PFKA 2CUNA 2P4EA 1TUEA 2Z1NA 1SUPA 1MB2A 3OIGA 1DBIA 2HSGA 5JI2E 4D4KA 5A0TA 1Q1QA 1A5BB 3JRWA 1JIVA 3PXBA 1DELA 2N9UA 3PUJA 5L51A 1OWNA 3QYAA 3BMCA 1E9CA 4PHGA 1XZ8A 3LPLA 3RSOA 4WZAB 4HWGA 4RXMA 4ENUA 4I50B 4MRPA 5JAQA 1FYDA 1W581 1WKBA 2X2EA 1LRKA 3D4NA 3PC2A 1W0KD 1JLLB 2BZ1A 2E37A 2PG3A 3CRZA 1I13A 4KFSA 3M89A 4ZCQA 4BMVA 4DUGA 3N07A 1UM9B 5EINA 3LTNC 3DMNA 3FKJA 2Z6AA 5BR7A 4K9QA 3IQXA 4XCXA 3GEEA 3RU3A 1E92A 4AIRA 1C80A 1T6YA 1ZICA 4FWIB 3E03A 1VLVA 3KKKA 4L57A 4RELA 3VHXB 3GLGB 2HMSA 4BX8A 5G0WA 1F4LA 1HTTA 3A1DA 1ORVA 3CJQA 5EIOA 1ELOA 1OXVA 4Y2YA 2PJZA 5CVDA 3CHYA 3WRYC 3X43A 1J07A 3SZGA 4F3YA 3BCUA 3K4HA 2O4UX 1U2ZA 3E3NA 3M2PA 3MHTA 1JG2A 3EQ7A 1V0JA 2G70A 1TAQA 2K2WA 1GGFA 1VKOA 3WL8A 2WZBA 1AB6A 4K9LA 4ZOQI 2WJZB 4P93A 4AO6A 5D85A 4YAGA 1JLMA 4PIVA 4XARA 1YMUA 1GZSA 1I4OA 4ZYVA 2J0VA 1N0WA 1TVKA 4G67A 4LY3A 3P27A 4NHOA 3KTFA 3JQFA 2R6FA 4Z4QA 1DDIA 4TYNA 1M3SA 1Z83A 1R00A 1N6HA 1T9DA 1X13A 4R54A 5JZOA 2P2NA 2C31A 2VF5X 2AXPA 2EJWA 3G6KA 3DTYA 3KOUA 3MJCA 5SY4A 5C32A 3SYRA 3L49A 1T2UA 3HQ4O 3OKAA 5CXXA 3L77A 1LI4A 1R6UA 2FPXA 1M1YB 2ZT5A 1R5JA 4RIEA 3V1YA 4FOLA 4EEXA 4P2GA 3OFJA 4BV3A 1ZCBA 1F7VA 4MHTA 1JA1A 2ODEA 5EZYF 5K0TA 1V2GA 1IULA 3FXAA 3TIFA 1IONA 3AEUA 1TQHA 3JYNA 5CPFA 2AG8A 3B3AA 3I3OA 1M6HA 1OWLA 4RK0A 4NG4A 3TL3A 3IYLW 3G7UA 2YYAA 2C88A 3JWIA 1S4MA 3TIVA 4ZI7F 3Q3JB 4EENA 2IUEA 3KQLA 3QFTA 2I9KA 4OXIA 3HB0A 3T12A 3W8EA 5LMCA 4G4IA 4Q9JA 2WD7A 5I9BA 2L18A 1L5RA 2RAFA 3OQBA 4EUNA 3P0FA 1KP3A 2VHXA 1IC6A 3R5JA 5CMLA 3DS8A 1WXHA 2W22A 4N03A 3AM5A 1JQAA 1YB5A 3K3PA 3I6ZA 2IBMA 5KKAA 3ZW7A 4AF7A 3OPYI 3RSQA 1BVHA 4NPHA 3SBOA 1IQ0A 3KYBA 1HDCA 2ZJ0A 3LGAA 2G28A 2P2CA 5TGDA 4NXNB 5TV2A 1BNCA 2HEGA 3CZMA 3P4XA 1U3TA 3IIEA 1TTHA 1F48A 3L5KA 5JCJA 4D74A 1EFVB 3DFKA 4G07A 4BO6A 4MV4A 4O59O 4RMHA 1PD0A 3ITKA 2VSXA 4QLAA 1QYVA 3COWA 1QAMA 2FJPA 1IYZA 5D3MB 1A9RA 3O0TA 4V0RA 1JYEA 3DWEX 5TGTA 5K5EA 3Q0IA 5AK3A 3ER8A 2V6FA 1CV2A 3C3CA 3RIEA 3QV1A 1GPKA 4Q4HB 1RI3A 5EZQA 3T94A 2HU8A 1KR2A 3UIEA 4X66B 4AP5A 3CTPA 1DRKA 4WINA 2EGHA 3B6ZA 4KEAA 1YQWA 4GZLA 3D54D 1GPLA 4GKBA 5EIFA 4ZT7A 4CTOA 1NJGA 5TE9A 4JLMA 2GYVA 5KNBD 2UXDB 5JU6A 3I34X 1TM2A 1FJ2A 1E4VA 1A8SA 2VKTA 4QSMA 3VOAA 3ZIAA 3C8HA 1D8AA 2NT3A 1L4BA 4M7RA 3NLLA 2WLSA 1V8DA 3B6IA 3PYXA 2A9PA 2H11A 1ZGBA 4PX3A 2PFKA 4O4IA 4ZWNA 3VZRA 4ASUA 5CB4B 1HLGA 3N8DA 2X23A 1S3GA 2VXBA 1LX6A 2PX2A 2ZR8A 1AG9A 3K0BA 3KP1A 5EKTA 1B14A 1KMIY 4A91A 3SYTA 4F85A 5AVYA 3PGJA 2R3SA 1P80A 2MDTA 5KYYA 1GGEA 5REQB 3DE0X 3AKDA 4OHMA 1UP6A 2C29D 3TTWA 5JAHA 2RH8A 1G5PA 2PYIA 5EKSA 3GN2A 1N2BA 4FLMA 4MH0R 3SOPA 4E5UA 1GKKA 3RYCB 4B87A 2PX6A 4GI7A 4K1XA 2SHKA 3L0OA 1E5TA 3O82A 1EE9A 4UAJA 1PVOA 4LYYA 1XLUA 1FW8A 4L4YA 1HT1E 1XA4A 1Q83A 5AIAA 1BYIA 3H0KA 4KIJA 1J0DA 4CMEA 1KTVA 4F5EA 2PIDA 3DBIA 2A0WA 5TT1A 2P6OA 3SM3A 5BN1A 1PJQA 4JLDA 1KY4A 5FORA 1ZAKA 4B3CA 2IEDA 2A4KA 4G2NA 4EOGA 3BX1A 1PLKA 4I1UA 3O9MA 4PO9A 5FBHA 1C0EA 2FPOA 3BXXA 5L3SA 3C3XA 1QCYA 3ZY3A 4KTTE 2BP7B 2OBMA 2Q2NA 5IAKA 4UBOA 5NLLA 3ROFA 5K9ZA 2V3CC 2LXNA 1T91A 4HPWA 1OLUB 3HVIA 3UAXA 3RAPR 1KNXA 3PPXA 2ESRA 3HDTA 4WXMA 5HJ7A 4W5NA 4PHTA 4U63A 1R9JA 1VSUA 4UBKA 5ALPA 4BY9E 1TZBA 4LOIA 4GP9A 1KKUA 1HYBA 4EX7A 1NQVA 2V6MA 1L1QA 2P3LA 1QVZA 2IGBA 3DWGA 1MP0A 1Y3DE 2WABA 3BFKA 3RFFA 1EYZA 5LA6A 2DBYA 2H4ZA 3WFZA 3U09A 1EB8A 3AFGA 1SZJG 3GGCA 4R41A 1PJZA 2VRNA 3AUTA 4QBKA 4UMDA 3AVTA 4BMYA 3MTQA 1S8AA 2W6JA 3V32A 2YHUA 3KK0A 2G1AA 4J0EA 4DADA 3SBEA 4M8KA 5CDGA 2G71A 2Q41A 1H6AA 3KUXA 4HNQA 4LCJA 5G4KA 5GM2A 1JXOA 4KR6A 2VEDA 1HMYA 4M55A 4QULA 3JWEA 4YRSA 1M5RA 4UAVA 4JLVA 4D3DA 3KUCA 3G9ZA 1ZJWA 1SGWA 4O2AB 3WYEA 1ECPA 5MN6A 3N0XA 4RJTA 3B3QA 1TZCA 1NF9A 1USUA 2P4QA 3CBGA 3QFHA 1U2DA 4DLSA 5DT9A 1IEXA 1XZBA 2JKYA 1GZ3A 4I1SA 2OHHA 4JUBA 1CEXA 3T52A 3S2GA 3I39X 4L6CA 1XTVA 4GKKB 1YCDA 4EFDA 1VA4A 1NX6A 3DEJA 1ISPA 1Q1AA 2V9ZA 2A5YB 1U0GA 2VYCA 3HNOA 4GZ5A 3UN1A 3HXLA 3LS2A 3RBZA 1VJ0A 1A7UA 2WVJA 4A2QA 1PZHA 5BYKA 4LHZA 4HWTA 1T8UA 2XT6A 1JPJA 1U4SA 4DYDA 1Y8AA 1ULAA 5D51S 4B80A 2IIBA 3E22A 3NDPA 2IITA 3HGTA 4Q03A 4DLPA 1NBWB 4KFRA 1OFGA 4KOAA 4UCQA 1V3UA 3AHGA 1F6BA 1YOVA 4X6XA 5IX8A 2Z30A 2VT3A 1P9LA 1UWKA 3A0UA 4FQ7A 1HE4A 1UPCA 4YHBA 4L5CA 4A0GA 3UUGA 3NYQA 2OAGA 1SUDA 1S5PA 5ICCA 1AZWA 2IE8A 2VHJA 3CRMA 4CFYA 3EF1A 4MLDA 4WOBA 3WK6A 4N6NA 2EW1A 4TVOA 4B5KA 5K2OA 3W5BA 3KZKA 4P58A 1R4MA 5DGDA 10MHA 2B4KA 4NIMA 1XP8A 2FOLA 1JEEA 2GBCA 2PH3A 3I9FA 1N2CA 1IHYA 1W0JD 3LDHA 4J49A 3V8EA 4EY3A 5JYDA 1W36D 4LGCA 4ZT2A 1KXJA 3PUYA 1G0NA 2DKFA 2I6XA 3CONA 4UNIA 1NX9A 3OM8A 2QX7A 1OB2A 5EAIA 3KB2A 2KYRA 4ERXA 1JKIA 4WN9A 2BFWA 4O4IF 2JIMA 4UDYX 4BMDA 1Z75A 3WZMA 3NYWA 2RBKA 4W7SA 2UXBB 1IG3A 4D6YA 2FZCA 1TECE 3OE7A 4H0NA 4TYMA 3WYFA 3A2MA 1DFHA 4NK4A 2FR8C 1C4OA 4RAOA 2PMWB 3KJZA 3K70D 1J2UA 1O5OA 4JV5B 1A71A 2F55A 3B8EA 4G5HA 1UZUA 1R6TA 1LWNA 4P5DA 1Q20A 2PGLA 4O2LA 4EY5A 1UDAA 3PRJA 1X6VA 5J4KA 3FYSA 1DT3A 2X4DA 2PMCA 1TYEB 4G65A 3U2QA 2P78A 3C14C 3DE2X 3EEBA 3HCOA 1XNJA 5KYNA 4YT8A 2YKGA 4HXFB 3RS3A 1ETHA 1A04A 3C70A 4BVHA 4PZEA 4O8CA 2ID8A 4G4GA 2HDWA 3QF4A 3X44A 1USWA 1SXJC 1BDHA 4XWKA 1TU0A 5BMVA 1NE7A 4P4UA 4BB5A 2PTHA 3KDPA 4Y3UA 5FV4A 3SMVA 3QELB 2ATIA 2YJ6A 3IUPA 2VT6A 2E4AA 3NQ41 1NFFA 5I9NA 3QKRA 2G3YA 4PYRA 1CWUA 4YRTA 4DWJA 1YVRA 1F06A 2GUGA 2ZETA 3INNA 2F62A 2MMGA 4OTZA 4P6VF 4Q7KA 3SSNA 2I65A 2Z98A 3HWSA 3WDSA 1QG2A 1M0EA 2UXCB 2AXNA 2YW9A 2H4JA 4HN4B 5KOYA 4OQEA 4F4CA 1I1QB 4Y2JA 1KO4A 3PHJA 3OEED 3E8SA 2Y1WA 4CGZA 2PS1A 2QTHA 1JN0A 3RVOA 5CBPA 5IDXA 2HOQA 1CJCA 2QL6A 3AY7A 3SZLA 3ORQA 1U31A 1JAHA 4WEQA 4A5SA 4MKZA 2NZVG 1G5QA 1YQTA 3WBJA 2GA8A 4B3XA 3GYBA 5JNLA 1IHDA 1JVNA 1RI1A 4QBGB 2EWWA 1VHJA 3QMVA 3RSGA 2ZR7A 3EVDA 4TSKA 2DUMA 2X7XA 3EVAA 3QTLA 1YRWA 3F67A 3L3BA 5H80A 1E5LA 1TKRA 2XGMA 1Y5RA 4TMZA 4CUJA 4FMPA 1FSGA 2XZPA 5LA6F 4E08A 1O0BA 2V4ZA 1SUBA 3FCEA 2RKBA 4X7RA 3IX7A 3KDSE 3LC7O 5LBUA 1GYRA 2DSNA 4X1OA 2JFGA 1K6MA 4I1YA 3DL0A 1FQOA 4Z0NA 5LPNA 2G4LA 5KTRA 4NSNA 3BJIC 1IZ9A 1HPLA 1U8XX 1GGHA 1ULUA 2GN1A 2JAXA 2RK4A 3IEKA 4R2MA 3KOWA 1NIPA 3VU0A 3PITA 4DRZA 1VKJA 2QL9A 3KQPA 1YJXA 2Y1CA 4R68A 3D43A 3NR2A 5TPWA 3GRKA 3RS7A 2OBBA 4A73A 5LQJA 3IA2A 4NEHB 3LBYA 4C3OB 2FTKE 5IS2A 4H08A 1KI1A 3NMUF 3JQ7A 1YGPA 5J63A 2ZDGA 1PK8A 1A2KC 5A03A 2VRCA 3EAGA 1D2AA 5F2NA 1W44A 4KWHA 2AZDA 2QAGC 4NOLA 3C0KA 1Z6PA 2YZ7A 3DMDA 4F3RA 2OVFA 1K6XA 4TUYA 4UPVA 1JI0A 2B7CA 2EJCA 3CR3C 2HA5A 2BSAA 4W1SA 3RYIA 5B6JA 2C92A 4XUDA 2IHTA 4LWQA 4P31A 4F9EA 4TT8A 1E9BA 1D2RA 3U9SA 3V8QA 4K2AA 4AJJA 3DO5A 5BSVA 1NBAA 4XDYA 2P41A 5A7FA 1M1NB 3GNTA 1VPLA 2QS9A 5HTKA 5I4KA 2NUPA 2C54A 4X8MA 4QOFA 3BL6A 2YWEA 3TECE 3EZXA 1BOOA 1QRDA 4DDHA 7MDHA 3PX7A 2VG8A 2ZXEA 2BKLA 4LDNA 5KI6A 5JANA 3IAEA 4N5HX 2NV0A 3UFXA 1E6KA 4M0PA 1UAAA 3OURA 5TX7A 5D86A 9LDTA 2F9MA 5ERGB 1T0IA 5C4IA 4ARAA 2K7ZA 2OV4A 5C34B 5GIOE 1LA2A 2OSVA 2OXEA 1OXXK 1ODKA 2HRRA 2WUFA 1U2RA 1FLAA 2NXCA 2Q8NA 2Z83A 5BVGA 1T15A 2OLJA 2Q29A 3KEGA 1Y6ZA 1HE3A 1UEXC 1YVEI 1Z47A 2Z6VA 3OTWA 4UVDA 1PFYA 4F8YA 5JLJA 3PEWA 3A6HA 3H5LA 1AKEA 1KAMA 4YY3B 2AZTA 2OB2A 1NZFA 1VCIA 1XEFA 2P9EA 4TMYA 2H29A 3RC1A 2EKQA 4FHFA 1OPXA 1UDWA 3NPAA 2HC9A 1YD7A 1RNLA 1YDGA 4J0DA 5DHAA 2ZZKA 1PR9A 3UJ8A 1VL1A 1I3NA 3VU8A 2J09A 3ZKWB 4CKCA 1CDOA 5ILQA 5BMVF 2FV8A 3EUAA 5IDQA 2XQKA 3T7DA 1W87A 1YK1A 2JJYA 3I37X 5E6RA 3E61A 3H2HA 3V55A 3Q3IA 2I62A 1BVUA 3TVYA 4G37A 5WRFA 2WEKA 2XQJA 4MKGA 2NUTB 4GPAA 4UUNA 1V3TA 3BTVA 1SKYE 1M6VB 4R69A 1EDOA 2BFBA 3CT4A 3T54A 4NOKA 4R16A 3CX8A 2IKSA 4UM9D 1VPVA 3P45A 1H65A 2FSGA 2F1HA 3W2EA 2PMFA 4COKA 5CDFE 3QBDA 4YQFA 5IJ9A 2GYWA 1QO7A 4UHHA 1HE2A 4YASA 1LBQA 5FI3A 2QU8A 3CRRA 1UBRS 3HN7A 1H8EA 3IP5A 4K5QA 4D9MA 3RU2A 5T6BA 3UNXA 3F9CA 3M4ZA 2GM4A 2SKEA 1E5VA 1M54A 2MMCA 1RRVA 3RTAA 2AMVA 3G2NA 4B7XA 4S04A 3RS2A 1CRZA 3A9TA 5JSYA 3T5BA 4MR9A 1UZLA 1SM4A 2YWCA 2QE7D 4U7WA 1PR1A 4HDSB 4ZCIA 4DR6B 4C6TA 5DN6D 1S9HA 1DWPA 5HIIA 1OJ7A 1XWWA 3HM9A 1ODLA 3L1JA 1Q0PA 2R5WA 4HNTA 4C7JA 5KOHB 4EHJA 2PUCA 3MJTA 1SVUA 1A2BA 3TLEA 5CVVA 2GNOA 2W37A 1KZ7B 5AI9A 4DLRA 4ENQA 1N33B 2WHEA 1YJ5A 5JISA 5KYUB 1B7GO 1RXUA 2JFYA 5A9TA 3QEMB 5AJXA 1VL0A 1XTZA 2DJIA 2OILA 4XDGA 1K1EA 1H1LA 3K2BA 2DWQA 1VKRA 4JVOA 4RQTA 4B4DA 4L3VA 1SD5A 3AWIA 4IGFA 5BSTA 4RVHA 3SSAA 1LSOA 4EHFA 3FB1A 2OOSA 1BRMA 2IP1A 1VYTA 2EXXA 4FHGA 3LLSA 4KQ2A 4WLVA 5J5VA 3VKVA 4D4GA 2DAPA 2ZPTX 2YUIA 2ZAMA 1W1WA 3DYBA 2TMGA 4PFQA 1MPTA 3C98A 3RVRA 3NORA 4PPFA 2ZBEA 3DBHA 4G24A 2I0FA 2G4VA 4QWMA 4XE5A 3WKCA 2XOEA 5GVSA 4P3OA 1G9SA 3O7WA 5JT1A 2BHNA 4CM9D 4KYTA 3AF4A 4JC4A 4XWTA 5LP6A 4FI3F 1O96A 2JIZA 3HXMA 3QH4A 4PLGA 4FBMA 2QT1A 1ZMXA 2RI0A 2W6MA 1U0SY 5EIHA 1KI6A 2ZBQA 4EWLA 1NVVQ 3T4XA 2GM5A 2VPPA 2VTKA 4KUEA 4PHCA 5HW0A 4EF4A 2NO0A 2VZ0A 1BFDA 3D8HA 4S35A 4TSRA 4IG9A 1F2UA 2ZS9A 3R7LA 3VO1A 3A6LA 3KYCB 1I3MA 4DLYA 1G6OA 4ZZ3A 4FGLA 1XU9A 5AVTA 2W6ZA 3I53A 1NA5A 4PZZA 2ZSJA 4QGHA 4JJGA 4ZAYA 2POCA 4ALKA 3LI2A 3TQHA 3WA7A 2P2DA 4D8VA 3UPTA 5FFFA 4K6CA 3CLSC 5F3WB 2C4UA 1MC1A 3X0DA 3TKLA 4EW3A 4WQMA 4MLZA 3OIUA 3WYGA 5KNLA 5KSWB 2WAYA 1E0AA 4YPFA 5DK4A 1QBGA 3W3AA 3KXDA 1LK7A 1QPZA 4MUFA 4QQNA 4PSKA 4BRUA 4CKZA 4MPTA 2BGIA 1O6BA 1OY1A 4LVUA 2A5FA 1GQFA 1NY6A 5TMBA 3WWCA 4CMIB 4A15A 1PWYE 1Q1BA 3C85A 4RPLA 4F2WA 2NSJA 2UYCA 5AKXA 4JY7A 3FBGA 2WKQA 4XDZA 3I0NA 4RORA 1FFBA 4DUPA 3ZXUB 3QPCA 4FUTA 3SHFA 1ZHFA 1I5OA 3SEZA 4DLBA 5SV2A 2WF6A 4D44A 2R8PA 3N2GA 4L07A 3GFPA 2NTEA 4WZBE 3VV3A 4JLPA 4E13A 8OHMA 5AW0A 1N6LA 1BGXT 1AZSC 5JEEA 3K9FC 1XIVA 3V34A 4EHBA 2V65A 5AW9A 2IF0A 2J45A 3O4FA 2XE6A 5AM3A 2BFFA 4BQRA 4JBWA 4LYJA 4DJDC 2C3MA 5AKHA 2KWIA 3ROGA 3V42A 3V4OA 3AR5A 1HXHA 4N0MA 2OXCA 3NHMA 1U5BA 3AY6A 1M2OB 2CVFA 2WJJA 2FG6C 3JYQA 5B37A 4KIUA 3BXOA 1CDZA 3RKUA 3UKJA 2Y1XA 3OCUA 4Q47A 3A2KA 3NHJA 3DW3X 4PR3A 4YFVA 2WUEA 1DS6A 3K92A 2WE8A 2ZBGA 2DVMA 4GSKA 2PSEA 1O95D 3LZ6A 3VU3A 2FGJA 3H16A 3CRNA 1Z0IA 4H1HA 1F2TA 2PMEA 3OBBA 2OA0A 1JL3A 1X86B 1XPJA 1G63A 3TZKA 4JAVC 4MARA 3FY4A 2HU2A 3ZWQA 3UC5A 1O94C 4CM3A 5BV1A 3OTHA 3CLTD 1NVDA 3PEUA 1KU6A 1WXFA 1EZ4A 3G9XA 1GA4A 2BELA 4JR0A 4XM2A 1QV9A 4KR2A 2IYEA 3E0XA 3HR4A 4NP6A 4NV1A 2GEVA 3Q85A 4MUXA 3H4VA 1Z88A 2XLBA 2ZUSA 1L1FA 1TC1A 4JA2A 3WRYA 3UK0A 4WMLA 3TS1A 3ZGNA 1EVQA 1RWKA 3ACCA 1XN1A 3HB1A 3OAAA 4DBLC 3ZZ1A 2YWJA 2JGLA 2BRUC 1VFPA 1CJMA 3BE4A 1NT4A 3OX1A 3ETHA 3SM9A 1A27A 1OE0A 1YR1A 3N86A 5BORA 4H7FA 2IYXA 3WP1B 3SR0A 4C01A 1OVM