3ZYCA

Dynamin 1 gtpase ged fusion dimer complexed with gmppcp
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
347
structure length
330
Chain Sequence
SMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVDEMLRMYHALKEALSIIGNINTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Pseudoatomic Model of the Dynamin Polymer Identifies a Hydrolysis-Dependent Powerstroke.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords DYNAMIN-1
total genus 103
structure length 330
sequence length 347
chains with identical sequence D
ec nomenclature ec 3.6.5.5: Dynamin GTPase.
pdb deposition date 2011-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00350 Dynamin_N Dynamin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3zycA00
4KYIB 5JI2E 5EXSA 2CK3D 4GP6A 5FFMA 2V6JA 5GVSA 5JHHB 2IYUA 2JLZA 1KSHA 4PC2A 1HT1E 2AK3A 1GFIA 4DC9A 1UBEA 4OI0A 3AKEA 1E9FA 5AUQA 4Q7LA 1U0HC 3K0FA 4Q00A 1KJYA 1OXXK 2GEUA 4IFBA 5DHAA 1OXSC 4WXPA 3FOZA 1T3LA 5B2ZA 1U94A 4NYJR 3GD7A 1XU4A 4LJ5A 4A2WA 3RRMA 3C15C 3TGPA 4TL9A 1JBKA 4KLNA 2ZRPA 1JNYA 1M7GA 1XMVA 2OT3B 2WSSD 2IEYA 4A92A 3B85A 2FSIA 5C18A 4AKGA 3B9PA 3BORA 2FZLA 3ZJYA 3OFNA 3AUXA 1G17A 4LYAA 4M9ZA 4DKXA 1G4UR 2BMFA 5G41A 4MRNA 1XTJA 3CBQA 1H65A 1RVDA 1WQ1R 4JLMA 2VEDA 5JEDA 2IYVA 1E2EA 3SQXA 3TJZA 4DB2A 4PTLA 3IQWA 5EE3A 1W0KA 4PPFA 2WV9A 3THWA 4ILEA 4B3XA 1A5TA 2GESA 3CH4B 2G83A 1B0UA 1DELA 2OUKA 1Q3TA 2E9SA 3NEJA 1E2MA 2ASEA 3NH6A 3KXLA 2YKGA 1AN0A 1XEWX 2HYDA 3QIAA 4XH9B 3ZGXA 1SVWA 2QMUA 1OH5A 2AL7A 3TVDA 1XJCA 2RHMA 1KHTA 1KSFX 2Q9AA 4Q1DA 3THOA 1ZNYA 3GLHB 3TSWA 4NU0A 1Z07A 2UKDA 3GMTA 1SVMA 1YRBA 3CO5A 1M7BA 1C1YA 3RANA 3IO5A 4XWOA 2ZSEA 3VR3A 3CH5A 3FMOB 4BQSA 4L16A 5BYJA 1KDTA 5EJEA 3B1ZA 1NN1A 1RRPA 2KWIA 3EG5A 4US0R 4A8JA 4GNKA 3O8CA 1EESA 5KO2A 4C7OA 4UNNA 3PITA 1AGPA 5G3YA 4C2TA 1EWRA 3NBZC 4PAOA 4PSAA 2WVJA 1QHIA 2O8EA 2MMGA 2HF9A 3CZQA 2ZS8A 4N3NA 5FBQB 4TSFA 2QN6A 1NVXQ 1GM5A 3V9PA 2YWHA 1E2LA 4OKSA 2W6ID 1OFUX 4LHYA 2Q0HA 3IEVA 3QEJA 2XTNA 3Q5EA 1TUEA 5L3RA 3QI2A 1TEXA 2WBLC 4UNRA 4I1OA 2H7VA 3BFKA 2H1LA 5FTKA 4Z1MD 2F43A 2OILA 4PC7A 4ABYA 4MKIA 1XEFA 2GILA 4YDSA 2QP9X 4QRHA 1KZGB 2ZJOA 1RKBA 2FPMA 5B64A 2P6RA 4XOIA 2DHRA 2VHCA 3JVUA 2G1JA 2ZROA 4OHZA 3BERA 3RRNA 4KHZA 4NP6A 4KFRA 2QTVB 4RKFA 2EWVA 2HJGA 4B3FX 2RHDA 4MYHA 2H17A 4LJ8A 1XEXA 1P62B 5AJWA 2FV8A 2OBMA 1FX0B 3CX6A 4LJ6A 3WHKA 1XMSA 2FG5A 4GOXA 1CRPA 4WW0A 1E79D 3SBEA 2CNWD 3VKWA 2OAP1 4L8GA 1RYHA 2XZOA 4XVUA 2VHJA 3EW9A 1II8A 5FUWA 1R0XA 1G7TA 5KU1A 4JSTA 5JSZA 3QQ5A 1A1VA 2ZSFA 3B5JA 1A4RA 3LX5A 1N5IA 5GVRA 4C0JA 4DCVA 3VHLB 4KBFA 2PMKA 3W90A 3BOSA 4JVSB 4GSYA 3SBDA 1JQJC 4MKGA 1KDOA 5E3HA 2NTYC 4NYJQ 2ERYA 3OAAD 2NO7A 3IHLA 2AWNA 3R7WA 4LC0A 5JRZA 2NO6A 1G3UA 4M1WA 2ONJA 3VR1A 3ZD7A 1ESNA 3IHWA 5KNBA 1XCPA 4AI6A 2JJ2A 1E9CA 2OESA 1I2DA 1F2UB 2R6CA 3G5UA 4TLBA 5LPNA 3X2SA 5A4JA 3ND9A 3QXXA 1P61B 2VTKA 3A4LA 4F92B 4BEJA 2NO0A 2QTFA 1CKEA 2ZVPX 4NYMQ 3VU9B 2X2FA 2QSZA 5FR2A 1Z6GA 3U3RA 3WRYC 2GXUA 1HURA 3C4JA 2WKQA 1DTSA 2ANBA 1MO3A 3WNCA 1JR3A 3R20A 3DM9B 1VYUA 4CW7A 1EFRD 4G3XA 1COWD 3WMGA 3L8YA 1FW6A 5CDFA 3NHBA 4H1UA 1PLJA 4LZZA 2WWHA 5ANRB 5KYKA 4NL4H 2XITA 2DPXA 3DM5A 5J4KA 4AKHA 1DBSA 2NZJA 4G5GA 5JS7A 2X8AA 2FA9A 2ZUCA 4MDEA 3LLMA 2QE7A 2H8KA 4TN1A 3RDPA 1YZTA 4C0HA 2QPAA 4ZDJA 3BGWA 2EW1A 1DO2A 2H5EA 2W6JA 4HB3A 1D2EA 2WICA 2QROA 2GNOA 4O2LA 2EWWA 4R2HA 2GXAA 3TNFA 3W3ZB 5FTJA 5CITA 3QJYA 1VYVA 4HDQB 3RRYA 5JRJA 4Z51A 2FNAA 2HJVA 1QDEA 5CK5A 5CM8B 2ZAMA 4OQLA 3SYKA 3IIJA 4P4SB 3WBJA 4ASUA 1E3MA 1TAGA 2UZ3A 1KYIA 3RVBA 1XP8A 5EE0A 2CLSA 2ZXUA 4PO9A 4ACAA 1XCGB 1OT3A 4HAUA 1QHYA 1NN5A 1DAKA 1GKIA 2JJ2D 2D06A 3HWSA 4HAYA 1UAAA 1IBRA 3MJRA 3CZPA 1LW7A 5E7JA 3F8TA 1W36D 1ELOA 3BWDD 2ZJBA 1G7CA 3SJCA 1MRSA 5C4GB 4A6XA 1RJ9A 3W8RA 4ZDIA 1GAJA 4MYTA 2EU8A 4D2IA 3FB4A 3T5DA 2V1XA 5L3QA 3U3KA 4I1SA 2GCNA 4JLVA 4BRWA 1G5TA 1E98A 2YWFA 2QGZA 2E1RA 2NG1A 3LRPA 5G3ZA 2NZ8A 4X8MA 5JFGA 4TZ0A 4KAXA 4IXNA 1G6HA 3SOPA 1QHGA 1KO8A 4I99A 1DOAA 5FPTA 5F98A 1XTQA 5AUOB 5JJLA 4OK5A 1UKYA 4IVRA 4EJSC 2RGNC 1EX6A 2B7BA 2F3RA 1AS0A 3VX4A 5TDHA 4BGDA 1G4AE 1DE0A 1MKYA 1VCIA 1QHXA 4OK6A 3QKSA 2JLWA 2GWHA 4D6PA 2NMVA 2ZI9A 2J0SA 3DKVA 3K09C 2R44A 2V6IA 1U8YA 1P60A 2ZJAA 2JAQA 1A2KC 4C0SA 1P6XA 5EXXA 1AK2A 2KBEA 2JLQA 1JXOA 3OE7A 4IEIA 2C98A 4MUAA 4TZ6A 1KO7A 2WIAA 4L4UA 3X1WA 3AQ4A 4MKHA 2GF0A 1XD2A 3A1VA 2XTMA 4M8NE 3FGNA 2FPLA 3R7WB 4QKQA 1R5NA 2AD5A 3VQTA 3L8ZA 1WB9A 4JLNA 1DG1G 5FPKA 5CYOA 3L0OA 3IILA 3T61A 1FMLA 2WOOA 3LA6A 2QGNA 1N5JA 5KUTA 2QT0A 1GIAA 4D4JA 2CL7X 1IN4A 2BBWA 2DBYA 4ZDWA 1VG8A 3QXJA 4LHXA 2FN4A 4G0NA 1CJTC 2FSHA 4A2QA 4DUGD 2PX3A 3HR8A 5CB6A 3B1VA 1CXZA 4WBSA 4FW9A 2X19A 1GUAA 3A4MA 4GT1A 1KI2A 1XB2A 5AJZA 3DZDA 3I92A 4TYNA 1E0KA 3B2EA 4M21A 2FMXA 3F0TA 4DCUA 3LFUA 4D4MA 2ZE6A 2BBTA 2WAXA 2QI9C 1IJEA 1E6CA 3GEIA 2WMNB 3K0AB 1FQJA 3QE0A 1KDRA 4QGAA 1TTTA 2BCJQ 4I4LA 2BJVA 3AVXA 2ZITA 5GJWC 3CR8A 2DY1A 5FUVA 1J2JA 1DAEA 1LF5A 5JZVA 2Q3FA 3EPJA 4GFDA 2P5TB 3A1WA 4KCGA 1L8QA 2QORA 2QMOA 2GK7A 2QPTA 3LBIA 1JR3D 1NLFA 2JLVA 3JZMA 4DSOA 1TQ2A 8OHMA 1ZU4A 4RZXA 1TQDA 2WJYA 4IDOA 2BWJA 2IXFA 2GCOB 1NIJA 1Z2AA 4KSCA 4TWZA 3X1DA 3NDBB 2CMKA 3EC2A 4AK9A 4DZZA 2JJ1A 4FWTA 1CULC 1Z8FA 1TQ4A 1JAIA 3P4YA 1ZM7A 3AEZA 4A1FA 2AK2A 2YOGA 5EUMA 3AGPA 1EX7A 4PC3A 4Q01A 1QVAA 3C16C 1R6BX 2A2ZA 4W5HA 4EPWA 5TXGA 1AKYA 4OQXA 4Q9HA 5DSZA 3TH5A 1TMKA 3NHAA 4D0GA 1T0HB 2DR3A 2CHVA 3GLFB 3RC8A 2ZU0C 1YR8A 3QXHA 2B8WA 3Q7QA 4L5BA 3ZYCA 2B8TA 4UNSA 1J8MF 2F6RA 4EJSB 1K6MA 4TMZA 1XF9A 3T34A 2JIZD 1KI8A 2QY9A 4RZUA 3OESA 1HE1C 1E2IA 4HAVA 3U4QA 3BBPA 5SZIA 2G88A 4G5RA 2ZREA 1NN3A 2ZRHA 5HR5A 4F93B 4UJ5A 5FOUA 5EE9A 1IAQA 4YMSA 1ANKA 3H1TA 4TLCA 3FMIA 3NBXX 1ZM9A 5FH9A 3Q3JB 5AWFC 4AWXA 5EP2A 4WZBE 2D2FA 2VHUA 1ODFA 2WZQA 4H1VA 4DIDA 3RS7A 4OBEA 3TAUA 1DAFA 3KTAB 2GA8A 1R4AA 1Z47A 3KQNA 4BLPA 3VAAA 1ZINA 4GDFA 3HP1A 3PEWA 1WE2A 2DFKB 4CF7A 2D3WA 2OE2A 2QAGA 2ZEJA 2AKAB 3BK7A 3QOFA 4MGZR 4V0LA 1Q44A 3RABA 5JWRA 1IN6A 1IY0A 2IUUA 4ZI3A 2PJRA 4PXAA 4DLVA 3K9NA 3O47A 1XTRA 1KZ7B 4HDCA 5DI3A 3VNUA 2WWFA 4YQFA 4PHTA 3CRQA 4M1MA 3G0HA 1R10A 4DSUA 2C8VA 4HLCA 2XGJA 2GZAA 3THYA 4C0KA 1D9ZA 2PX0A 3ND8A 5FPHA 2R65A 1N6PA 3VR2A 3ZS8A 4QHSA 2DFTA 4R7ZA 2IHYA 1UBCA 5K8TA 2VP2A 3U44A 4NE2A 2J41A 3CF6R 3TUIC 3UWOA 4XSHA 4ZCIA 1S1MA 2F55A 1P4SA 3SC3A 4F4CA 3C8UA 3I32A 4IEEA 1RJ9B 3DL0A 2QT1A 2RGAA 3QKUA 1WMSA 3OEEA 3ZD6A 1E0AA 2ZYTX 2ZRDA 1CIPA 5SZJA 3AH8A 3ZQ6A 1LB1B 221PA 3LH5A 1SVKA 4URVR 4KXFB 1ZM2A 4DLYA 4TTPA 3EPKA 5EUQB 4ARZB 2H18A 4A2PA 5IT5A 1KI3A 3U7FB 5GJCA 1YZQA 2O0KA 1GSIA 1BYIA 1WXQA 1VCMA 1XTKA 1N5KA 1XJ0A 4P32A 2O8BA 4Q03A 2WSMA 2Q9CA 3EZ6A 3REFA 5GADl 2YV5A 1ZP6A 4JS0A 4JYCA 1CLUA 1X1SA 3IPXA 4WIAA 2C2HA 1W47A 3EA0A 1BOFA 2UZIR 2WJIA 1KOFA 4Q18A 3EIHA 3A4NA 4QJ5A 4YC7A 3UKDA 3BE4A 4B2PA 2ZQ5A 5FL7A 4MITA 4PQYA 4JJKA 1E9RA 1T8TA 2GVDC 4Q19A 1SXJD 3ZIAD 2OBNA 4X8HA 3WRXC 4ASUD 2A5GA 2IK8A 2WMOB 4U7DA 1KO5A 1E2FA 2A3RA 4WZAE 3PUVA 4LPSA 4RD0A 1KK1A 4O2RA 4JL5A 3AF3A 2VP0A 2W0SA 3Q9LA 3CONA 1N5LA 3KXIA 2WSSA 3C5CA 3TR5A 1E9DA 2CJWA 1MV5A 1US8A 3D8BA 4RKEA 3LVRE 3S1AB 5P21A 2I4IA 3K0SA 2GJAA 3D6TB 1N0WA 2JGNA 4MGKR 4XWKA 1PJRA 4EUNA 3V4RA 5DLQC 4CEJB 1NY6A 1LS1A 1P2SA 4NCIA 1WCV1 4XVQA 5CDFE 3U44B 4Q9JA 4V0MA 3K0EA 4HEJA 5C46F 3B78A 1Z29A 3LX8A 1ZNZA 3GEEA 2PEZA 2PCJA 4A36A 2ZJYA 5TMPA 4WAUA 3GJ7A 2OFXA 1ZJ6A 3KDSE 4OK3A 1XJQA 2ODEA 4QBIA 2JLRA 2VSXA 2YJTD 3QKRB 2W6JD 1ZD8A 1NSFA 1W5SA 1Z5ZA 3NXSA 4FMCB 3I72A 1YZGA 1KNQA 2NOAA 3FKQA 3ZZUA 1G7SA 1BIFA 2FH5B 4JLOA 3SFVA 3GPLA 2F9MA 1LVGA 4PC1A 4EPTA 5IK2D 4OI4A 2VRWA 1JEDA 1HQCA 2L0XA 2IF2A 2H16A 5SZHB 3TW4A 4B48A 1DEKA 2XNSA 3RS3A 3THYB 4OYHA 1N0VC 3BS4A 2BOVA 1FNNA 2AD1A 4BPBA 1XZQA 4NYMR 4DBLC 5JI3E 1RFLA 2PZEA 3DMNA 4LHZA 2WHXA 4E09A 6Q21A 3KQLA 5BYKA 1Q20A 4AURA 3NBFA 4JJZA 1ZC3A 2VBCA 4LOAA 3UIEA 3EWAA 4M1SA 2ZUBA 1PV4A 2ODNA 2PZFA 5HE9A 4U00A 3OEED 2P2LA 4MH0R 2WIBA 3AVUA 4HLQB 1KGDA 4RJLA 4C3ZA 1CRQA 1J8YF 5FOTA 4HDOB 4Q02A 2XJ4A 3KTAA 4TYQA 1SKQA 1XXHA 4C0BA 3BC1A 1U99A 1CJKC 2ONKA 4RD2A 1T4GA 4ZIRB 4OHWA 4RZ2A 3ADCA 1KI7A 3GQBA 4OHXA 3EPLA 1WDTA 2QENA 5FI1B 2ZRGA 2HLDA 2OEPA 3OIYA 1CJUC 1H8HD 1TL7C 2GZHA 4A0RA 4QM7A 2ERXA 2GDJA 2JDIA 2ZSBA 5B57C 1XCMA 3CUEF 4LV6A 4POAA 1ZBDA 4QHTA 2WWYA 1Z3IX 5LD2B 2N46A 4FD2A 3KKMA 3FYHA 4D81A 3QKTA 1E2GA 1OXTA 4Q1CA 4DLZA 4ACBA 4QBHA 1W46A 4MGYR 4NZYA 1S96A 3T15A 3QSYA 3F5FA 4Q4AA 2ZUDA 3BIFA 3THWB 4IOKA 1YU9A 2NGRA 4LHWA 4NMMA 3UMRA 3TUZC 4Z8YA 2IW3A 3BJIC 5JLJA 3L0SA 1QHHB 1NVVQ 1FP6A 5AUPB 1OFIA 3LBNA 3PENA 4KO8A 1GKUB 2V9PA 3KFVA 2GEDA 3AF2A 4RZ3A 2OCBA 1NRJB 2P6NA 4D0LB 2CDNA 3A8TA 3PUWA 1KAGA 3CNOA 3EAQA 1YZNA 1NMZA 3QPUA 3KL4A 1GTVA 2GBLA 2QM8A 1KJZA 4ZKEA 4CEIA 3IBYA 5G53C 5KNCA 4XD7A 2HT6A 4WVFA 1SKYB 4B35A 2JLUA 3B82A 1XZPA 3DDCA 1RZ3A 2XB2A 1UF9A 1T5IA 1OSNA 1M1YE 4QBGB 4Q9LA 2F7SA 3E2IA 3I8XA 2CVHA 4HUTA 1WBDA 1JAHA 4Q5IA 2CBZA 5FBVB 3FMFA 1U8AA 4A0GA 1LF0A 2GRJA 2CL0X 4BE7B 1Z08A 1D2MA 2GEVA 2J3EA 2ZJ8A 3W8NA 3MUFA 2ZS7A 1YZLA 4M22A 4DLRA 4D26A 1G8GA 1U81A 3ZQJA 1ZCBA 4W9MC 2AFIE 4M4SA 3K53A 4AG6A 3VR6A 4E03A 2ZJZA 2BC9A 2Q21A 2ODBA 2FJUA 1U90A 3ONWA 1Z6XA 2XB4A 4LBYA 2XTZA 3RS2A 1G8PA 2FF7A 3B8HA 3M6AA 1KAOA 2F1HA 1AIPA 4EFLA 2XZLA 3UWKA 5HKKD 2AXNA 3R9XA 1FTNA 2CEAA 3Q72A 5FL3A 3K0CA 1LY1A 1P75A 5KOYA 4A9AA 2NO1A 4QXAA 1OIXA 3ETLA 4LYJA 5EXTA 4V0NA 3GLIE 3K09A 3Q7PA 1D2NA 2C9OA 4UXHA 3SYLA 2QAGC 1YKSA 2IL1A 4AYWA 3AF0A 3RSLA 1Q1ZA 4CGZA 4MRRA 3FWYA 4Q7JB 1ZIPA 3NTUA 3QBTA 4HI0E 4DCSA 1SXJE 1FZQA 4PO8A 1QBKC 3ADBA 1D5CA 5FOXA 4ESVA 2PLRA 2AWOA 2FFHA 2HXYA 1DAMA 3QPVA 5FTNA 1NG9A 1UADA 4B3CA 4HZUB 2ZJ5A 2FU5C 1MO6A 3K70C 2DB3A 2WKPA 1GNRA 2HF8A 1OH8A 3SNHA 5TV2A 1XX6A 5L3SA 1JB1A 1IHUA 2JATA 4RVCA 5AR1A 2ZYWX 2VL7A 1P9WA 2EFDB 1F2TB 4P4UA 2BKEA 4MYUA 4RD3A 1CS4C 4QJ4A 5EE5B 3L0IB 4JIMA 2YVUA 1GL9B 1JI0A 4V0KA 2IBMA 3MD0A 2I1QA 2RKOA 2J0VA 4P33A 1ZIOA 1CR0A 4BEBA 2J46A 2D7DA 1CR1A 1QG2A 1VIAA 3A37A 4PANA 3EIQA 4Q4JA 5FOWA 2R8RA 2Q9BA 1OKKD 2Q3HA 3DEFA 4C0QC 3RC3A 4LBZA 2VYFA 4WXRA 3GLFE 2Z83A 5CIWA 3IIMA 2HXSA 1I2MA 1NVUQ 2D2EA 3EC1A 1VCOA 3LQQA 2C9YA 1V43A 2ZI6A 3OF5A 1N3BA 2GJKA 4HB0A 4NCHA 5JBQA 1RRFA 1G6OA 4TLDA 1JALA 1P2VA 1Q21A 2AFHE 1JPJA 2OHFA 1JJVA 1G8HA 1Z06A 4BFWA 4DHEA 1QVRA 1U8ZA 1IOZA 2DWPA 4NCKA 3R8CA 2EFGA 3RHFA 3I5XA 2W6IA 1VECA 1Y63A 1KNXA 1ZNXA 2A7QA 1E0JA 1M2OB 2A78A 3AGQA 3MSXA 4LI0A 4QG7A 1FPMA 4PPNA 3SQWA 4B43A 5E95A 3DHWC 1IY1A 1TQ6A 3C41J 4EKDA 3CWZA 1LNZA 1FP7A 4BFSA 1G5RA 2WWWA 4JSYA 2HT1A 1RW4A 2ORIA 4IXMA 3VR5A 1ZNWA 1E2JA 4LJ4A 3SE0A 4AG5A 1TU3A 2FWRA 2VQSA 3AF4A 1SHZA 2FSGA 5CLQA 4EPVA 1KSGA 1XPOA 3DO6A 1J90A 3EZ9A 1KI6A 2AX4A 1T5LA 5KPJA 1XEXB 5DO9A 4DWJA 2PCLA 1N6HA 4TMWA 3QG5A 3I62A 4BRUA 1Z0DA 1A7JA 3K70B 1PLKA 2MSEB 1W36C 2LWIA 4V02A 4ON9A 3K9HA 2ZS9A 4V0ME 1WP9A 1VYTA 4OHVA 4IVPA 3THXB 2X77A 2J0UA 2QMEA 1XD8A 4URUR 2ZYVX 3N2EA 1TF2A 3P1JA 5DNYB 3QF7A 3TSOA 5EE1A 2IS2A 5JSZB 3FTQA 121PA 3GFTA 1IN7A 1Q1BA 5BN4A 1Q22A 5KHOC 3UPUA 1E9BA 5EP3A 1VKJA 2PH1A 4AYXA 3C5HA 2NO9A 4Q1AA 2W2VA 3KKQA 3WP0A 4MRVA 1R0ZA 5K8UA 3BAFA 3HR7A 4UNPA 3AKCA 1II0A 3U7EB 2AXPA 4XTRA 5J4HA 2O0JA 4TQUS 3ZS9A 4JVMA 2WOJA 2P3SA 4C7OB 3ZLJA 3HJNA 4KJZA 4AY2A 1E4VA 1E1RA 4GBMA 3FHOA 2ZRBA 5KTYA 4F38A 3KB2A 2F43B 4II7A 2IYQA 2BEKA 1II8B 4HZIA 4TQAA 3GLIB 3DKPA 4PO1A 4GRAA 4CEIB 3CPJB 1XPUA 2QP4A 4ZO4A 3ZVRA 4A8JC 3B13B 621PA 1JR3E 3U7GA 2D4HA 2BMDA 2ORVA 1L4YA 1E2NA 2FFAA 3WNBA 5DISB 3X1ZA 3BB3A 4YMUA 4DB4A 4A6PA 3DVLA 3M0EA 1CEEA 3FKSA 1UEIA 2QRZA 4HSEA 5E4FA 1SZPA 2PL3A 3QENA 3UG7A 1HE8B 2XEXA 4Y0VA 3PVSA 4BFZA 3FVQA 4DJTA 4TYPA 3ADKA 4TQ9A 3TIFA 4C9BA 1TX4B 3UATA 1ZD9A 4LV8B 2XX3A 4XTCS 5H8WA 1S1CA 1OYYA 4LWZA 3GLGE 1P9RA 5HCNA 2QE7D 4MDFA 5BWMA 1SXJB 2XJ9A 1NIPA 3B6EA 2BEJA 1ZUIA 2ZR7A 1VHLA 2PT5A 3OAAA 2RGNA 4MKFA 2CK3A 4B3BA 2CNWA 2NPIA 3LNCA 4MGIR 4RD1A 1KJWA 3DOEA 2O8EB 2IF0A 3IBGA 3OEHD 5GJBA 2N42A 4YMVA 3SJAA 5CJ2A 2JJ1D 4IKEA 5F9HA 3IUYA 4LYFA 4A8JB 4BFVA 2OBLA 3AKDA 5J40A 1DAIA 1BKDR 2H57A 1XXHB 4KFSA 4Q9KA 4A4DA 3AKYA 3TQCA 2FGKA 2ZETA 5LBIA 1UBGA 1OW3B 2D7CA 4M53A 1N6NA 4FXPA 1SVLA 2V54A 2IYYA 1OIVA 3S1AA 2AHOA 5IF9A 3K8YA 3U61B 4K46A 5J47A 1OB2A 2QL6A 3IGFA 4IVQA 4EFNA 5FUYA 1X8KA 4LJAA 3SN6A 2A5YB 4NPHA 1J99A 1KK0A 5CIQA 2C99A 1Y3AA 1G41A 1KY2A 4URWR 1GRRA 5E7MA 4Z1MA 2PEYA 3AVOA 3GLHE 3CW2A 1MO4A 1TU4A 721PA 2OCYC 1KSJA 3LWNA 4TMKA 4TT3D 4AYTA 2VP6A 2MSDB 3TK1A 5HCIA 3EXAA 4LCBA 1S2MA 2GXSA 4JT4A 4RY2A 4TYWA 1VDZA 4KVAA 1W0JA 3OIWA 3OHMA 4YDHB 3RLFA 4E22A 2FGJA 1H8HA 1R0YA 5C1BA 1PUJA 4QJ3A 3I4LA 2B6HA 2ZRCA 3QXCA 2CE2X 3LDAA 3K9GA 5BN5A 1FOEB 4IJMA 1C4OA 1BMFA 2J5XA 3PR1A 2A5FA 2O8DB 1EXMA 1UKVY 4LBVA 5BQ5A 2RGGA 1GNQA 3GJ4A 1Z0AA 4F4IA 4KFUA 4NHOA 4PHHA 3W9YA 4Q4HA 3LO5A 2AKYA 2F1RA 3ZIAA 2QNRA 3LXRA 4HAZA 5A0FA 1IN5A 4FIDA 2YZ2A 3A6PC 5C4MA 3AV0B 2C96A 2CHGA 2Q6TA 1Q1EA 3X1XA 3TQFA 2ZRAA 3ZDQA 3WMFA 4K81B 2ZRJA 5DIFA 1OPXA 1NLZA 2SHKA 4LSGA 2R9VA 5JWOA 2OFWA 2VP5A 4JBWA 4B74A 1UBFA 4KSBA 4TL6A 1NKSA 4DEXA 2BM0A 4XWAA 3AVWA 5HPYB 1E9SA 2OM2A 3NEYA 4N1AA 1NVVR 2WJHA 1AQUA 1TPZA 3QNUA 4LDJA 3SI7A 2KBFA 4BZPA 2RGXA 2ANCA 1GWNA 5JEEA 3FFAA 3RYTC 4OI1A 3GP8A 1N6LA 4HAXA 3FKSD 3L82B 2KE5A 2J7KA 2BCGY 3TRFA 4PAMA 4ZKDA 1Z0JA 2WWXA 2YHSA 1OJLA 5KPDA 4QHYA 1E9AA 4ZV4A 4E07A 5LDDC 2BMEA 1JXMA 1X1RA 4L9WA 5CLLA 2R6FA 3SU8A 3GCGA 1SVSA 2ODWA 2ZIAA 5E7IA 5AUNB 3TW8B 1FQKA 5IDVA 3BFVA 4EDHA 1XPRA 4B33A 4L9SA 4FI3C 3U3OA 3AVQA 1NY5A 3G82C 1NLYA 3LLUA 5H68A 4FMDB 4PSVA 2V1UA 3F3YA 2XSZA 2DWOA 1F6BA 2DWQA 4BASA 5EXPA 3W5JA 4D25A 3MG9A 4A0HA 4BLOA 3KJEA 4R9UC 4P3YA 3H84A 4Q7MB 3NKVA 4DUGA 4PPQA 5JMTA 1W4CA 3P20A 2RAPA 1NBMA 2YNMA 5FOVA 4JMPA 3EX7C 1MH1A 1T6NA 3VMFA 1M34E 3EARA 3TBKA 2DCUA 1R7RA 2C03A 3CPHA 1YR9A 1O87A 1E1QD 4DLTA 5DI3B 1AA9A 1MABA 4IDNA 1PLLA 4HUQB 1GITA 3PFIA 3QPWA 1EFUA 4IRUB 3BRWD 2ZRKA 1NL3A 4EJSA 2R6GA 2C77A 2ZRFA 5DI9A 1GRNA 2QAGB 3T1OA 821PA 2YWEA 2ZYUX 1NVWQ 1A82A 1F3OA 1RRGA 1X8LA 1XTSA 1IY2A 2Z43A 3KJGA 3LBHA 4JLKA 3OIVA 1CTQA 3T12A 3U7HB 1BS1A 2WWGA 5EQTA 4JVLA 2YYZA 5D3MB 3DOFA 3H2YA 3GLFA 1ONBA 3KQHA 5IHPA 1K5GA 2RMKA 4URZR 2FFQA 3B7GA 2LKDA 3ZVLA 1JR6A 3DZ8A 3FHCB 1E2DA 3LVQE 2RGDA 1XRJA 5L3VA 2GETA 3ZH9B 3OIUA 2IXEA 4BLSA 2QA5A 2V4ZA 2WM9B 4TTQA 1P5ZB 1XEWY 3L2OB 1CR2A 2GCOA 4N0EA 3KXKA 1XXHE 4URYR 1RC8A 4DRZA 2O8FB 3PEVA 3VKGA 3C14C 4A0FA 3UMSA 4ZCMA 3PUXA 1II9A 3LY5A 2C9CA 4KVGA 2A30A 2ZI3A 2A9KA 3M1IA 3TLXA 4G01B 1GKYA 2IXGA 3AB3A 3GEHA 3SHWA 3SYNA 5KSYA 1N6KA 5CB8A 2V7QA 3CKLA 5F3WB 4BFTA 4DT1B 4AKIA 2UVQA 4LPKA 3VFDA 3GLGB 4LJ9A 1J7KA 3SR0A 4Q21A 3CNNA 5DN6A 1W49A 3FE2A 4M1TA 521PA 4AD8A 2O8CB 4JLAA 1IJFA 1KI6B 2AN9A 5HTKA 1F5NA 4CT5A 5G40A 2O8FA 1AS2A 4D80A 1ZCAA 2W2XA 1E4YA 2G6BA 1S3SA 1VIYA 1IXSB 2EFCB 1QF9A 3FHTA 3WHLA 3WMEA 1Z22A 1Z6TA 2I3BA 1HT2E 3IO3A 2PT7A 4BZQA 2GBLC 1DO0A 4LGMA 3N2IA 3NIBA 4MRSA 4DT1A 1ZRHA 1G1MA 5FI0B 2XXAB 5KNDA 4LV5B 5DE3A 1CBUA 1G3QA 5JJKA 3ZVNA 1OHHD 2CLDX 4BLQA 4DEYA 5AK0A 1VCNA 4Z8XA 2VO1A 4EQ6B 2DFLA 2QSYA 1EG7A 2IT1A 2GK6A 3L43A 4OQFA 1Z6YA 4RFSA 5GJVC 2QU8A 2JA1A 4M0LA 2IC5A 2P0EA 4EPRA 3QKSB 3FFBA 1ZM3A 4DCTA 1G21E 3KUDA 3B1YA 2QRNA 5UKDA 1G9XA 3RRZA 1FMJA 4RD6A 3KQUA 2ZE8A 1CJVC 3QKRA 4H9GA 3I8SA 2YOFA 5TB5A 3K0AA 4JLDA 4NONA 4Q4LA 5D3QA 1P9NA 4DSNA 1EFTA 1OFHA 1Q12A 2JLSA 1Z0FA 3R8FA 1JPNA 2FOLA 4KBGA 2HEIA 2HYIC 1YJ5A 3I3SR 3E5HA 3JZAA 1W48A 2REXB 5LB4A 4B73A 4PHGA 1OF1A 2OG2A 3EASA 4A15A 3AUYA 3FDIA 4KV9A 5L3SB 4IDHA 2VF7A 4TTRA 3ICEA 1G64A 1S9HA 1KIMA 3D7MA 1DADA 1FNMA 1GVNB 2IS6A 2P65A 1HH4A 1XNJA 2QPOA 1QG4A 3DMDA 4CT4B 3U2QA 2CL6X 4GMXA 2ZANA 1NMXA 1E94E 1Z28A 2HLDD 1OYWA 3K70D 4TYYA 2I1VB 3D3QA 4JT2A 4F91B 1AZTA 4LK2A 3UMFA 3W6PA 1GDDA 2Z0MA 3SDZA 1IXZA 3WBKA 3B1XA 4TL7A 1KI1A 5KSOA 3O8DA 2IYRA 1UFQA 1E99A 1MT0A 1SKYE 3LW7A 2CXXA 3ZVMA 4PX9A 1VPLA 4Q1FA 2WPDD 4D0NA 2FPKA 3ADDA 4HLUC 4X8OA 3REGA 1W4RA 2YOHA 3KUCA 2KSQA 3GFOA 4TMVA 4TL8A 2HUPA 4B75A 4U5XA 4DLXA 5L8VA 3UK6A 3VU9A 2QTHA 2FZ4A 2VHTA 1OFTA 1SHKA 1GL6A 2JDID 1LFDB 4JLPA 4Q1BA 5JWHA 5JJIA 2CCKA 4HZUA 3T5GA 2JJ8A 3UXMA 1VHTA 4CYMA 3HU2A 1E0SA 5FTLA 1XDBA 2JCSA 4CRWB 1QHNA 2C5LA 4R98A 2KB0A 5AJYA 1HY3A 4B6EA 1K5DA 4WZ6A 3PEUA 3VHXA 1Q57A 1Z63A 1UJ2A 3U3MA 1UM8A 2RB4A 3PQCA 4TLAA 2XSZD 5FR1A 4O0MA 2YINC 3C7KA 4AIIA 4F7WA 4US2R 4FCTA 4RSGA 3O8BA 4L15A 3RNLA 4M1OA 3NBYC 3R9IA 2J87A 3MCAA 1ZUNB 2RGEA 1EFHA 3MAAC 3T1VA 1XD9A 5DHFA 2IA5A 4Q48A 3W5IA 421PA 4LJYA 4QGGA 1P2UA 1S4QA 2QQ0A 4UXIA 1JQLB 2QQEA 1E1RD 1QHSA 1JJ7A 2V8OA 2ATVA 2MMCA 3BB1A 3AVYA 1X8JA 2DYKA 4P0TA 2QBYB 2W00A 4PHFA 4QNMA 4GPTA 4DDVA 2F9LA 2QZ4A 1ZD1A 2J7PD 4JBXA 2J7PA 4OQMA 3UANA 2F3TA 2ZI5A 3WXMA 1QHHA 2GTPA 4UJ3A 1U0JA 5FBLB 5J4VA 1S8FA 1M74A 2NQ2C 3K0CC 1S9DA 2OXRA 1I4DD 2XNDA 2ZAOA 2QP3A 3AVTA 1IONA 3PXGA 1E32A 3HU1A 2BV3A 2P6UA 4FMDF 3N70A 4HLDA 2GKSA 1OH6A 3IEUA 4RFSB 3SZRA 4OI2A 3QF4A 2OZEA 3CLVA 1E2QA 1OKKA 2IS1A 5KDDA 1DAHA 4BLTA 3SJZA 3WP1B 1R8QA 2CVFA 2C04A 1L4UA 2OLJA 1FX0A 3CRW1 1E2KA 4MQBA 2Y8EA 3CRVA 5H70A 2ECKA 4RCZA 1F48A 4DXAA 5HE8A 4B71A 2W83A 4JBYA 4WA7A 3N5CA 2W2TA 2BJWA 2EYUA 1SULA 4DSTA 1FUKA 1K8RA 4P31A 2Z5FA 3P27A 1EGAA 2WAYA 5FPSA 1OE0A 3GJ0A 1ZMXA 5HZHA 5M04A 3PIRA 3CX8A 4I1VA 1Q1QA 5DYIA 4Q66C 3IPYA 2OAQ1 1N6IA 4ZPXA 3BD9A 3HYRA 3U4QB 1C9KA 1P2TA 2IYLD 4TMTA 3TAHA 2IYWA 2XOKD 2Z4SA 3HPRA 2BM1A 2IYSA 4GOJA 2VP9A 2IWRA 1F2UA 3HDTA 1COWA 4HLUA 1E9EA 2JASA 2RH5A 3PG5A 3AP1A 4GOKA 4N0DA 2BDTA 1N0UA 1YZUA 4OJQA 4W5WA 1RIFA 1UEJA 2IUTA 3NWJA 5J4LA 2J45A 1E2HA 1W4BA 5AJXA 2ZSAA 4MA4A 2J59A 4TT3A 3TVTA 1G7RA 2OSBA 3KJHA 4ZIRA 3E1SA 4NBSA 5LD2C 4HYYA 2GXQA 1M8PA 1E79A 2FE4A 1HQYE 4XIGS 3W3AA 4FCVA 1GRQA 1OB5A 2QMHA 2VPPA 4D4LA 2TMKA 2ZJ2A 3GJ8A 3NG1A 1LS6A 2R6AA 5HZKA 1B23P 5J4YA 4BFUA 3NVAA 2B92A 2VP4A 2IUSA 1GG2A 5JS8A 3ASYA 5FPYA 4IW3B 2ZI4A 4UQOA 5FL7D 5HKKA 1FL9A 2HCJB 3MMPA 4QNRA 3AVPA 1IXRC 1TNDA 2Q3MA 1PVOA 1NSTA 1R8SA 3RSOA 3B1WA 4PZLA 4EAQA 3LXXA 4M9XA 3RS0A 3NC1C 3ZZTA 3LD9A 4B6FA 4IHQA 1BMFD 1P72A 2EVWX 3HPQA 4DLSA 4PPGA 1GILA 3EWSA 1UKEA 4Q4AB 2ZRMA 2J1LA 4CIDA 4DLWA 4KFTA 3CR7A 2A5DA 2EQBA 1E69A 3RWMB 4V0OA 5EZ5A 5DN6D 2ZPTX 3IIKA 1KO1A 3LQRA 3QF4B 4JZKA 4F4JA 5H1YA 4IOLA 4LUCA 3GLIA 3K1JA 1HYQA 4LBWA 2BMJA 4QBFA 4D82A 4JKYA 3MRSA 1H8EA 1AZSC 1Z6AA 4M9SA 1W5TA 3Q5DA 1ZYUA 3HU3A 1OLOA 4Q4JB 1S3GA 1BO6A 3KKOA 1ZAKA 3OFND 1P3JA 4B2IA 2ZU6A 5A5GA 3W6NA 4LRWA 1GNPA 2G1KA 3W34A 2OCPA 1I4TD 2V3CC 4BFXA 2D74A 2WPDA 1G20E 3ZZ0A 1G3MA 4BUJA 4HATA 1XD2B 1LTQA 3IKJA 5FTMA 4OQNA 1DG3A 2X2EA 2FSFA 2WJJA 4OJKA 4RFVA 1XWIA 4S35A 1RYFA 1YE8A 4FMCF 2IX3A 1QZXA 3H0KA 1VG9B 4KYUA 3IQXA 1Z2CA 2WKRA 3GLHA 4QFMA 3VTKA 4ZI2A 3J81k 3NC0C 5AJVB 3T1TA 3SS8A 2EYQA 1WA5A 3VNVA 3CRRA 1YR7A 4JL8A 1PUIA 1M6NA 3A58B 2GJ9A 1US8B 3SEAA 4DDTA 4UNQA 3GJ6A 5CM9C 1G3IA 1OXVA 3WYFA 5FBRB 2FFBA 4EIWA 3QEOA 4KITB 4RD4A 4EPYA 1G5PA 1Z0IA 2ZR9A 2E87A 4BZXA 4WOPA 3B60A 4M1YA 3AM1A 4QM6A 1PZNA 3GJ3A 1SVOA 1TEVA 3GJ5A 4CEHA 4PSKA 3KQKA 1T8UA 4BWYA 4GZMA 4C30A 5EZ6B 1O3YA 3L0PA 2PJZA 3QVUA 2VIIA 2QBYA 5FUXA 4NDZA 4C2UA 1ESMA 2GJ8A 4IOJA 1SVIA 1A2BA 2CCJA 2ZVQX 4TMXA 5TARA 3BFXA 1LV7A 4DDWA 1NKTA 2ZE7A 4O3MA 4P4TA 3PV0A 4Q1EA 5J5CA 5L3QB 1U9IC 1WBBA 1YZKA 2K5UA 3VX3A 4NCJA 2QEQA 3T35A 1W7AA 4V03A 2R62A 3U5ZB 3KFXA 2N1BA 5TY0A 3ICQB 1AGRA 5BW8A 4YMWA 2O8BB 4XD7D 2REOA 1E2PA 1HV8A 4NTZA 5LB2A 3U3JA 4BECA 3K0FB 1W1WA 1FUUA 2G9NA 5CK4A 3TKLA 3CIOA 4LX0A 3CB4A 3QBVA 2R6DA 4FN5A 3V00A 2BIFA 1ZUHA 4YLGA 4K8OA 4NYIR 3EZ2A 5CYPA 1GL7A 3R9WA 1NF3A 1YRAA 3A36A 3KKPA 3CWQA 4OL0A 1CP2A 4Q47A 3NDPA 4X8LA 1MRNA 1N6RA 2OV2A 2J0QA 2NIPA 3CRMA 4B2LA 1F2TA 1DARA 1HEIA 2BVNA 1EFRA 1I4LD 4B3GA 3PEYA 2VLIA 3WYGA 4C4PA 3U60B 2QG6A 3IDQA 2GAAA 1RPZA 3ECCA 4GP7A 5IK2A 2ATXA 3EA5A 4TLEA 3PCRB 5F2EA 4JLJA 4O25A 1E96A 2MSCB 5ELXA 1NMYA 2CJWB 4Z54A 1VTKA 3TUJC 1W2HA 1KI4A 1DVRA 2HCBA 1OIWA 1KMHB 1KMQA 1U0LA 1TF7A 5FBWB 1SXJC 1RE0A 2VF8A 2C95A 2BKUA 5SZKB 1T0JB 3EIEA 4ERNA 3KB1A 4NKRA 4CVNA 1F60A 3WNDA 4KU4A 1EK0A 4JVNA 3H4MA 3U6BA 1G16A 2JIZA 2EFHB 3I61A 4AKEA 1ZW6A 2RGBA 4UKDA 2V55B 1IQPA 2V7QD 4KODA 3P26A 2BBOA 4EPXA 2B21A 2ZSDA 5TVKA 2G77B 1P7CA 4GI7A 2P67A 2Z4RA 3BH0A 4EQ6A 1U2RA 1XMJA 2RGCA 4ITRC 5F9FA 1X86B 2Z6VA 1G3RA 3GFPA 2O8CA 1D9XA 1ZM4A 2GJSA 4IDPA 1MR3F 2FDCA 2O52A 3MWYW 4LC1A 1R5OA 1HUQA 4Q7KA 2XXAA 1NN0A 1YVDA 4DCNA 1BH2A 4ARZA 3GLGA 2GF9A 1U9IA 4JKIA 1G8YA 3I5YA 1Z0KA 2BHRA 2H92A 4OHYA 2YC4C 1IM2A 3I1FA 3RS4A 1CU1A 3CF2A 1D8TA 1RRCA 4JYBA 2CLCX 1T3HA 4JLBA 4DIEA 4U02A 4B32A 3GJXC 3A1SA 2OLKA 4US1R 5DGXA 3E70C 4QGHA 1G18A 3T1QA 2GCPA 2GVZC 4EFMA 1YQTA 2GZDA 2B7CA 1VG0B 4MUBA 2XNDD 2IS4A 4NCNA 2D62A 5BN3A 2VHQA 5IRCD 1W44A 4IDQA 4IOMA 4E5UA 1NBMD 3EZFA 1T91A 4B3DA 4KLZA 4PC6A 3V4FA 4UXJA 3CF0A 3H86A 2JLXA 1P73A 1DS6A 1MO5A 3TR0A 1KK2A 1XMIA 4ZDKA 4GL2A 3CX7A 1KDPA 2ZI7A 2OXCA 3B9QA 4YMTA 3AVVA 1V5WA 4AC9A 4FWIB 2VSOA 2G0TA 3M4YA 4G5OA 3O8RA 3TE6A 2ZR0A 3HYTA 3KX2A 1KI9A 1T9HA 4CZ2A 2CE7A 1ZVQA 4ESHA 3BH7A 3PUZA 4W5JA 1W36B 2W58A 4QGFA 1G291 2O0HA 5JCZA 2R2AA 2XZPA 4NYIQ 4HUQA 3TSZA 1MABB 2OFOA 3QUSA 1OV4A 4R2IA 4YONB 4M1KA 4XJXA 4B76A 4GZLA 5CJPA 4C0LA 1TADA 3QY0A 4NH0A 5DYGA 2PMDA 3ASZA 3VKHA 4Y0AA 1FTSA 1QRAA 1KTVA 3UG6A 2ZRLA 3WY9A 1CJMA 5K8IA 1G8FA 5KDLA 1U98A 2WTUA 4ZCLA 1W0KD 4W7SA 5DH9A 3MWLA 3WYAA 1GZSA 1SQ5A 1UDXA 4BFYA 2AR7A 4JL6A 3SJBA 4URXR 2RCNA 3RAPR 2FEMA 2IHBA 1M7HA 1NJGA 3W6OA 4PZZA 2A5JA 1R2QA 3D31A 3Q8XB 4LY6A 1UPTA 5EP4A 2X1VA 4FCWA 1ZC4A 2ZE5A 1OXUA 1CR4A 1N2CE 2YC2C 2QUZA 2ZRNA 3DPUA 2O5VA 4PAQA 2J0UB 3THXA 1DPFA 3CPEA 1Q0UA 2P5SA 1EWQA 4G5QA 1YR6A 3A1UA 5JCPA 1XTIA 3U6KA 4QL3A 3LAWA 3JVVA 1E1QA 3FMPB 1GOTA 3I73A 3X1YA 2JEOA 4M9QA 1NP6A 1XBTA 2PLFA 4B34A 1TUIA 2GAOA 3KKNA 3KJIA 5JHGB 2OO7A 1OH7A 3QVVA 1ETUA 2LCFA 1TF5A 1AQYA 4PQFA 3QG1A 4LHVA 1CF4A 3RWOA 1H8ED 2DFNA 1KK3A 2YWGA 1NI3A 3BH6A 4G1UC 1GP2A 3MGCA 3RS5A 1XFAA 4HAWA 2VH5R 1NG1A 2G3YA 1KO4A 2OCAA 1X6VA 4MRPA 5FOSA 4XVRA 1FFHA 3KZ1E 1R0WA 3BXZA 3EZ7A 2REBA 4C0AC 3AF1A 1AJEA 2WWIA 1W0JD 1X3SA 2FX3A 4QOSA 2LKCA 1AM4D 3SHFA 2CHQA 2HDNB 1KMHA 4IFEA 2ORWA 5D3MA 4P4SA 3NH9A 1SGWA 1HTWA 1D6JA 1J70A 2BBSA 4I1UA 4DDUA 5JECA 1HA3A 2F1JA 1DAGA 1W4AA 2XAUA 2C78A 4DLUA 4HB2A 2IYTA 1L7VC 2IYZA 4LYHA 3PUYA 4YXWD 1OHHA 3A1TA 2ZM5A 3P32A 5KSPA 3TMKA 1KKLA 2G0NA 4B47A 4FINA 1IN8A 3OZXA 3T06B 3MFYA 3CM0A 1G19A 3OE7D 4RCYA 1YHNA 2J9RA 4M2LA 3PJRA 4CEHB 3OEHA 1MOZA 1NJFA 1EFCA 1WRBA 1JEEA 3Q85A 2JLYA 5KDOA 1NNEA 2IWHA 1JECA 2KJQA 2KI5A 3P4XA 4BLRA 3EPHA 2PZGA 4D4KA 5K8LA 2O8DA 3CNLA 3MJHA 2CCGA 2XOKA 1AS3A 1Z83A 4CEJA 1R5BA 3VR4A 1T3SA 4TSFD 1N25A 1UKZA 1VMAA 2W0MA 4I81A 4R71A 1NBME 4S2EA 1UDWA 3LV8A 4G5SA 3MLEA 2GHIA 2HV8A 4DVGA 2IYXA 3AP3A 3MWKA 3QXSA 3SFZA 5B30A 5C2JB 4GMDA 4Q9IA 1KKMA 4YXWA 2ZTSA 1VG1A 5BXQC 3AP2A 3LW8A 1AKEA 1Q3HA 2VSFA 2WJVA 3MWJA 4PZYA 4MYCA 2FEOA 1N6OA 5KSZA 4Q4HB 3K9LA 2EFEB 4PFSA 2NPFA 5B58C 4FMBB 2ZRIA 2PBRA 1KY3A 4LJ7A 4A82A 4PQRA 1ZU5A 4CDGA 4PR0A 2F1IA 4B44A 3BB4A 2WJGA 1WF3A 4KI0A 4J0QA 4XSGA 2IEZA 2QAJA 2QM7A 1S0UA 2VA8A 1BYUA 1SXJA 4HB4A 3FPAA 5EP1A 1L2TA 1W2GA 4QC2A
chains in the Genus database with same CATH superfamily
1I2BA 4LFBB 3WSTA 2ZG6A 4K1LA 2YV1A 1P0FA 4GP6A 4L6IA 5GVSA 5JHHB 1KSHA 1NFQA 1HT1E 4ZHQF 4JXKA 2AK3A 2O3QA 4M49A 3DCIA 3VR4D 1PU2A 4NZ9A 1WLYA 2IYAA 5IH7A 1CVIA 4DC9A 1X1DA 3JPWA 1UBTS 3DBLA 1D8AA 3WGKA 4D3YA 4OI0A 4IDCA 1E9FA 4Q7LA 1KZHA 3PQ2A 1DC6A 1MW9X 1U0HC 3IV9A 3K0FA 4S12A 4CM9D 5AVRA 2DLNA 1KJYA 2W6CX 3H5VA 1R3DA 2WJAA 4FZ5A 4BNGA 1HDXA 3B3GA 4HPXB 1S7CA 4O4HF 5F3RA 1T3LA 5CT9A 3REQA 1U94A 3ICPA 4NYJR 2HK8A 4LJ5A 4LX8A 2BKAA 3DOHA 2R79A 2GUWA 3KPUA 5AH0A 1TA0A 2GLTA 1BWRA 1CE8A 1IBCA 3ML1A 3P96A 4MUYA 3T6KA 3PWKA 3VUEA 1GCGA 4UUBA 2X8BA 1MU0A 4W1RA 2Z6QA 4A92A 3U9SA 5C18A 1T5SA 2X40A 1YI0A 3GA7A 3I3OA 3ZJYA 5EOVA 3IESA 3AUXA 4M7RA 4KR6A 3OQBA 5LN1A 1GO2A 4M9ZA 3TJRA 1Z0SA 3TRJA 4DKXA 1CYDA 1G4UR 3VZBA 2Q3EA 3Q0TA 4FC7A 4MRNA 3H9UA 4KIWA 5T4FA 2AF3C 2BGRA 2ES4A 2VEDA 2VJQA 1VI2A 3G3EA 1J5EB 1UMBB 3IHTA 2X3YA 4PTLA 4YYEA 4M0CA 1A8QA 1CY7A 2M2IA 3THWA 4JXZA 1UAGA 2IY8A 1A5TA 2C2MA 4FYJA 3UMYA 2GESA 3N2KB 3QYAA 3O4VA 1LK0A 3PU6A 4QUJA 2ASEA 4C6TB 1NLMA 3UMGA 3O9MA 2YKGA 3W2IA 3ZGXA 4XH9B 3QIAA 1VE1A 4M0FA 5B3JC 2QMUA 5BUCA 2AL7A 4FDVA 5BSWA 2RHMA 4I08A 1U8XX 2Q9AA 1Y8QA 4WRRA 5CYGA 4WJLA 1J33A 1U1DA 1YRBA 3CO5A 3WKAA 1Y4DE 3HE3A 5B4UA 4AY5A 2ZSEA 1UFOA 4BTEA 3MK31 4INOA 5TQVA 3CIFA 5THQA 5LJLA 4TKVA 1DXYA 2M1XA 1EDOA 3N6XA 4DIUA 1NN1A 3BAZA 1RRPA 1SA0A 1RI3A 3MBIA 4MUJA 3ZHTA 5K8CA 4US0R 5IASA 3KKLA 4G5HA 1CS0B 5KO2A 4L5AA 2H7XA 3KQOA 2XOEA 3F49S 3M7IA 3PITA 4UHHA 4B79A 5G3YA 5J23A 1VJ1A 3SXPA 3KAJA 3NBZC 4PSAA 1QYVA 4UOQA 5EGNA 1QHIA 5LIRA 2I1WA 5BPHA 2UYQA 4O2BF 2OSVA 1NUQA 2ACVA 4HEQA 2QN6A 3MB8A 4KLCA 1JGTA 2E4XA 2AZXA 2AG1A 2H4YA 2W6ID 2Q5EA 1QO9A 3IEVA 4EUSA 5AM5A 2YXDA 1UPFA 2HSGA 2LP4Y 3IAXA 3Q5EA 2C4HA 4BQPA 4P1ZA 4YNBA 2AMVA 5BV8A 2WBLC 4I1OA 3OX4A 2H7VA 4AMBA 3G5LA 5FTKA 2JFZA 5G1PA 1VP3A 4ABYA 1I5EA 4MKIA 2Q4OA 5F77A 1XEFA 3FNIA 4FFPA 4L51A 4M88A 2ZJOA 3FX2A 3LK6A 3NDRA 5JDCC 4ZYYA 2VHCA 2VHVA 1X1CA 2PZMA 1O8BA 3RRNA 4KHZA 3W2HA 3ZHXA 4RKFA 3AFMA 2EQ5A 3HFGA 4KNWA 4MYHA 2VVTA 3AM3A 4N01A 3TECE 1Q7EA 3PX3A 3P7MA 1RXUA 3AJAA 2FEAA 2Y1WA 4AP5A 2IZZA 1YIAA 2VZEA 5IC6A 3ZR4B 2FWJA 3RVMA 1M6YA 2CNWD 5FPPA 4L4YA 4Q9DA 2PUEA 4L8GA 2EGUA 3DLCA 4XVUA 4AO8A 3ZV3A 3IP3A 3W4IA 3SSOA 4P5EA 2XMSA 1BVRA 1IIRA 3B5JA 1A4RA 2OB2A 5JH7B 4G8CA 3SHTA 3VHLB 2PMKA 4PGMA 2X7XA 2ET6A 3W90A 4AZTA 4D45A 2IXDA 5KU7A 4JVSB 3H04A 2Q0QA 1VOTA 4GSYA 2R751 5E3HA 4KVZA 3FN4A 4NYJQ 3EXIB 1JG3A 5J59A 4KEAA 5EWLB 1TK9A 1Q0QA 2NO7A 3FYDA 3DH0A 1WXIA 3IHLA 3IP9A 4OSPA 2JIDA 1HLDA 1RADA 5BYAA 1G3UA 1OX4B 4I6JA 1XO1A 3BTUA 4FE3A 1J8VA 3L1JA 3VR1A 4AI6A 5B1HA 3VSAA 2B1RA 3JYLA 2EGGA 2OESA 5AW1A 5IKOA 1DKMA 1RM5A 2BR3A 2IU0A 3X2SA 5IM4F 5A4JA 1QQ7A 1QONA 1N7GA 2C92A 3A4LA 1QCCA 2QTFA 4WD3A 4X3CA 2ZVPX 3O3MB 4KWCA 1T13A 3CC8A 3PF9A 5JUWA 3IXMA 3SZOA 4M8IA 3IQEA 4U63A 3VI3B 4X3PA 2QSZA 3LQ2A 5JZOA 3VH3A 1A4UA 4X7MA 1NMQA 2EJBA 1P4RA 1G5FA 2J9GA 1OLSB 1MPXA 2GXUA 2VHZA 1X70A 2XUKA 3LA8A 4DV0B 1HNZB 5SY9A 1MO3A 3HKCB 4K88A 2QRGA 2OOSA 3AHJA 4BKUA 2CVOA 4O59O 5M7EA 4UU7A 1EFRD 2O2YA 3FR7A 4CW7A 4G3XA 1COWD 1IWBB 3R5XA 1JILA 1E3WA 5ANRB 2WWHA 5ESRA 4OHMA 3OFSA 3HJGA 3Q1KA 2Z1MA 1DBSA 3G2KA 4G5GA 1JMVA 2CNOA 3PJEA 2X8AA 4MI6A 2FA9A 4BXOA 1H9AA 1LI5A 4JLSA 2SBTA 4BP3A 4GW3A 4MDEA 2KLHA 2FSPA 4HWSA 1IJKA 3PQ7A 3DZKA 5T6BA 1YZTA 1DHTA 3R9XB 1JLSA 4BBJA 3JQFC 2H5EA 2WILA 4HB3A 4CMJA 6ABPA 3VISA 3K9CA 1T36A 4R2HA 4C7JA 2PRSA 4M38A 4DPMA 3T0IA 3OD1A 2FZCA 5FTJA 5CITA 4YP0A 3QJYA 3ZEAA 1QDEA 3B12A 4BQEA 2OHGA 2ZAMA 1HDIA 5HDQA 4LXYA 4IH9A 3TQQA 1HLFA 3JQGA 1JKJB 3PI6A 2GRUA 4XXHA 4TXMA 2P4HX 3WBJA 1UWKA 2F4NA 1WZIA 2FR1A 2C59A 3L46A 4LISA 5AHRA 2CLSA 3AHIA 5AVVA 3IL2A 2B69A 3PFFA 1SU7A 4OD0A 2EKDA 1NN5A 1D1TA 2PFKA 4LJRA 3HWSA 4HFNA 1IBRA 4IUCS 5KWVA 2XUJA 1CV2A 4R84A 3T5PA 3ZNPA 3L7DA 1B14A 2BEUB 4IUDS 2IEAA 4KR7A 3T94A 5AVOA 2Q5CA 4ZDIA 3I9JA 1GAJA 3DL4A 2EU8A 4MYTA 5KTOA 1AGXA 4E7OA 2GUGA 2AXQA 2R47A 2VRNA 1XAIA 4EO9A 4BRWA 4JLVA 4CLXA 2XY4A 2YWFA 3VPGA 4W7HA 2YXNA 4HEA6 2BEUA 5G3ZA 2NZ8A 4X8MA 4K6HA 3WQQA 1RQLA 1G6HA 2Z5VA 3SOPA 3WMRA 3ZY2A 1DKOA 2QN1A 4L0DA 1L3BA 2BDEA 3R40A 1DOAA 5KKNB 4MIKA 1XTQA 2V6BA 3OA0A 3DQPA 1EE1A 3URMA 2CF6A 2Z8ZA 4CM7A 2QRPA 5ICCA 1UKYA 3V3TA 1BAPA 1PDWA 3FRIA 4EI2A 1H6BA 1NVDA 2P69A 3LPNA 1XQ9A 1JLLB 3C3AA 2A9JA 2P4QA 4PN7A 2BE7A 2JBHA 1DE0A 3ZDYB 1TYZA 1QHXA 4OK6A 4N6NA 1OAOA 3F5MA 4QOIA 1PVDA 5AXDA 2VNHA 3RV3A 3ZJ5A 3COZA 3MTJA 4XZ3A 4X71A 2J0SA 3PDUA 2V6IA 3KWJA 5K0GA 1H0HA 1P60A 2ZJAA 2XW6A 3AUAA 3MTQA 4CKBB 1A2KC 1Z12A 5F5LA 2ZGVA 1MIHA 1A9ZA 2VZ0A 2JLQA 5CCEA 2VSNA 1A9SA 5A3JA 2C2ZA 1W5BA 4MKHA 5BORA 1RRMA 1YDEA 2GF0A 1CUXA 2J5BA 3A1VA 3W8DA 5JNLA 1R0LA 2FN7A 2FPLA 3FGNA 3R24A 4M8NE 3VQTA 1GU7A 2JBAB 4Y2GA 3SR4A 4L6CA 4TZKA 4F6LA 2AJ8A 1BHQ1 2WOOA 4AQDA 2V7BA 2QGNA 5C51B 5HRCA 1O0BA 2X22A 4WT7A 3LHFA 1N5JA 2Q1UA 3DGFC 3AIOA 1DG9A 4W4TA 1PNTA 4D4JA 4HDKB 2DBYA 5HIMA 3LY7A 5ETJA 2YIVX 4PYIA 4JJAA 2WSYB 3N76A 4KDCA 1EE9A 3ODPA 4TWJA 4BIIA 3F6EX 5LKAA 4UDNA 2PX3A 2PGJA 3PNYA 2WFLB 4YJ2F 4OJMX 3WL8A 1B0AA 3GJQA 3L7KA 1G20B 2D5BA 3BMCA 2BFEB 3TQRA 2P2CA 1KI2A 5AJZA 1SUPA 4XWGA 4ND8B 1YHZA 1OYOA 4TYNA 1PL0A 3GMSA 3CTMA 3HZHA 4LF8B 4GI3A 4RK0A 4WHMA 2DBVO 2I4LA 2I4MA 2X8LA 4RH3A 4DCUA 3LFUA 5A1JA 1JZTA 2J9YB 3BF7A 4HTFA 1I7LA 1MTZA 2DUNA 3O2JA 4NQZA 5AI9A 2UUOA 4JX9A 3EVDA 4C2BA 4HNHA 4OMFG 4CT0A 2WMNB 1JQEA 2SCUB 3K0AB 4P7FA 3QE0A 1GG8A 6REQA 1X3LA 3AVXA 1UPCA 3CZCA 3CR8A 1RJWA 2DY1A 3KV1A 2R48A 3D6JA 3P71T 5JZVA 3NCTA 5IT0A 1OUMA 1JQBA 4KCGA 3RC9A 4AULA 1BX3A 4YB8A 1VKOA 2GK7A 3LBIA 5DW0A 4EM6A 1NLFA 5DSXA 1TQ2A 1V5IA 2RK6A 1XEAA 1ZU4A 1RCUA 4RZXA 1WCIA 4BNIA 3T54A 1Z5GA 5IN4A 3C6QA 3N1UA 1NIJA 3KCQA 4YRLA 2CMKA 3HA3A 3SZGA 3SQMA 3TLGA 4MVJE 1YJBA 3AT1A 2X0NA 3WLRA 4ARAA 4FM9A 5IYZF 3A4VA 4FWTA 3FMVA 3WTCA 2JLBA 4DJAA 1KYXA 1JAIA 1TQ4A 1PKXA 1U7PA 3KKKA 1ZM7A 3AEZA 3P4YA 1YIDA 3NVKI 1TMGE 1GZHB 1WM1A 2AK2A 3I9MA 1VPTA 1GQOA 1HDRA 3AGPA 3IV6A 3L6EA 4PC3A 5ALKA 1DO8A 1NC1A 1MJNA 2A35A 3ISJA 4LGYA 1DEAA 4WK4B 3RBXA 4OQXA 2JIQA 4Q9HA 4EPWA 1TMKA 5LLDA 1USKA 4RSRA 3QEAZ 3U4AA 1PK8A 1M2WA 1EI9A 2C9DA 2P0YA 3E82A 3K6KA 4QPCA 5EIWA 3OG9A 1BDMA 3KZVA 3QXHA 3N87A 5A06A 2B8WA 4HADA 3PICA 2DWUA 2Q6VA 1U6KA 2Y1CA 3Q7QA 4KH1A 4JJ6A 1J8MF 1LSUA 1YFZA 4BNHA 4KC0A 3BMCB 2WM2A 1WSDA 1DIHA 4EB6A 3LUJA 5AW7A 3PTZA 1K6MA 1O0CA 1GTJ1 2GBFA 2JIZD 2YHBA 2IH4A 2QY9A 3DDSA 3WB2A 6GPBA 3K8QA 1QK3A 1E2IA 1Y7PA 1TCUA 2G88A 3H7IA 4H7DA 4RANA 2G9RA 1NN3A 1U6IA 2WG1A 3QHAA 5JPDA 4WBNB 1OFUA 5FOUA 5EE9A 2F3QA 3NJ4A 1ANKA 1DOZA 3H1TA 5LUAA 1ZITA 1WNFA 2QL9A 4E70A 3HO1A 1PP4A 2XE6A 3NBXX 3Q3JB 2GFHA 5CTJA 2X76A 4L74A 4WZBE 2VDOB 3F47A 2LD4A 1I2ZA 1JSXA 1U9CA 4FFMA 3EIWA 3MOGA 3M4XA 4OIFA 3RS7A 2YWRA 4C88A 4Y2QA 3TAUA 2VSQA 5CA1F 3EHEA 5CB4B 4BO5A 1IK4A 4YJ3F 1TZMA 1VMKA 2O6HA 5EVCA 2YZMA 1P44A 3B3AA 3HP1A 2PR7A 1B8VA 1Q2UA 3P0EA 3O4FA 2OE2A 4MGZR 1M0SA 5IDYA 1GGEA 3JYPA 4EW1A 5C8YF 2WUWE 1KU0A 5JWRA 5A4IS 3K35A 3DMRA 3K9NA 3IE0A 4WKNA 4CNQA 4MRMB 3FA2A 4GPAA 5K0JA 1A72A 1EEHA 3TW8A 3UFXA 3ENQA 1KBQA 5CDTA 3PT5A 5LOVB 1U2DC 3LCUA 3JD0A 4PHTA 4LDNA 2FZEA 3ZXSA 4COKA 2G08A 2V5AA 3RAEC 4G0UA 1A9QA 2XD4A 2C8VA 1TM1E 3V1TC 5JNWA 2IHUA 1PEYA 3DV0B 3T41A 3X1KA 3RADC 4B9EA 1TJYA 3ND8A 1Z6ZA 5K0FA 3GN1A 4RADA 3ZS8A 4A8HA 4GOOD 1IM5A 2DFTA 5B37A 3EZYA 4PLGA 3BBLA 2YUTA 1PR9A 3FPLA 1HL7A 1YZ3A 3L5OA 4QASA 2PD3A 3U44A 2EBUA 2IXBA 1NW5A 1HRKA 3DVQX 3H2JA 3L7OA 4HDNB 5DF1A 5BN5B 4AZWA 1FDIA 2ENUA 2CUNA 3TUIC 1YQEA 3VO9A 2BGMA 4M0DA 3I32A 2B20A 5TMDA 5C5IA 2EKQA 5DEOA 3DL0A 3ROZA 2RGAA 1MIOB 1WMSA 2H4FA 3OEEA 4MR7A 4ZVOA 4BMZA 4EFKA 4RHYA 4KQHA 3PHLA 2H00A 4F45A 3GCDA 3AH8A 4DA4A 1LB1B 1SNYA 221PA 4WNAA 2AEMA 3WC4A 2DHQA 3AB8A 3ICVA 1MCZA 4NECA 4GR5A 1OWLA 1E3LA 5F1PA 3EPKA 4FFOA 3BXOA 3UMJA 1E7RA 4RKQA 2H18A 3U7FB 5GGYA 4X90A 2JK0A 3PKIA 4K40A 1IZ0A 4HDRA 2R8EA 2O0KA 1GSIA 5DWQA 1WXQA 4NBWA 3EUEA 2Q6OA 3F6SA 2O8BA 1T8SA 1CNFA 3GVXA 3U4GA 5K03A 3G0IA 3IOMA 4JUBA 3EZ6A 1N75A 1S8OA 4JYCA 4WIAA 1M6VB 2GT1A 3EA0A 1UMDB 4MPTA 1XHEA 2WJIA 3EIHA 3BE4A 3A26A 3NTLA 4J0CA 1P45A 3G59A 3P97A 4AZVA 1OA0A 5LYJF 3DQQA 2RE8A 2X9QA 1E9RA 1C7RA 3AUTA 3NLLA 4OHUA 4C4AA 4Q19A 4M36A 1SXJD 3JRXA 4RABA 1EZ4A 3OMWA 2RHHA 3ZIAD 2OBNA 5BVHA 4TXLA 3KLBA 3F1KA 3IT3A 1N2EA 4ASUD 5K09A 1ND5A 5FUQA 1XMPA 4I2VA 5DM2A 4IIDA 1KO5A 1E2FA 3HN7A 4ZREA 4NU5A 4LPSA 4RD0A 4JYMA 5TSDA 4YXFA 2D54A 2VP0A 2W0SA 1PX0A 4WY8A 1N5LA 3LX6A 1UFRA 5JISA 3I4CA 1H9BA 2YS7A 1M34B 4EHBA 3X2FA 5CAEA 4N12A 4PGHA 4X6UA 1ODSA 2W6MA 4CNBA 4G36A 3S1AB 1Q7CA 4FE4A 1NOJA 3T99A 1HMYA 3SEQA 2SICE 3COVA 3E7DA 3K0SA 1DLIA 2GJAA 2QD5A 2EFYA 4Y2PA 1T9BA 4XW2A 1GZ5A 5C3UA 2HR1A 1PJRA 2C5EA 1MF7A 1G21B 3K1YA 2R4TA 5TJ9A 3X1JA 4ERXA 5DLQC 5CBPB 1NY6A 3UJCA 1M6EX 1KR2A 1V4NA 4XVQA 5AVUA 5CB4A 4Q9JA 4V0MA 2VT2A 1XU7A 3L9WA 1RS0A 3LX8A 4BWFB 4J2OA 4ND4A 1ZNZA 2Q2VA 2PEZA 1W581 2WMDA 3B1FA 5KCMA 3TINA 5C1PA 3RFXA 2F00A 4A36A 4K86A 5I6DA 5EXEA 3C3XA 5TMPA 4KIUA 1GNTA 3GJ7A 1V6SA 4KAJA 4P98A 3A27A 2OFXA 4RK6A 4E21A 2ODEA 1O96B 3MRVA 1JHZA 1T2AA 2QDKA 2WIKA 2YJTD 2FLVA 3FPGA 3J80A 2PSFA 2W6JD 4MR8B 1ZD8A 1NSFA 1L1FA 2BKXA 1CQXA 1Z5ZA 3B52X 4FMCB 4U0KA 2H2DA 3PFHA 5F23A 3ZLUA 1Q1GA 2J08A 2NOAA 2OMEA 5CW1A 2JIRA 3RT9A 3U49A 1L4NA 5JD4A 2JZNA 4WGFA 4NNOA 1QF6A 5K3SA 1RFGE 3MTDA 2FH5B 3FTFA 3SFVA 3GPLA 4PRYA 3KRTA 4IVNA 3LLCA 4QWWA 4AF7A 1I4EB 1UKBA 3KG2A 1Q92A 2JGDB 2IPOA 1JEDA 4NJOA 1Z4OA 3E9ZA 4FYPA 3S2UA 4HJRA 1HQCA 4G67A 5SZHB 1IUOA 2VHWA 4LRXA 3TW4A 3UTDA 5CD9A 1J20A 4RA6B 2XNSA 4OYHA 1P81A 1N0VC 1U2ZA 3FFWA 3O21A 2UZ1A 3PHJA 4IWXA 4WERA 4FEAA 4BPBA 1XZQA 4MUHA 4RMHA 4DBLC 1X2BA 4Y6LA 5AVXA 1UC5B 4JT9A 3B48A 3QU5A 2PZEA 4F9EA 4CIVA 3NATA 2PSDA 6Q21A 3AOGA 3RARA 4RBNA 3P2OA 4I55B 3KQLA 1T9ZA 4AURA 1SQSA 1V7PC 3NBFA 1ZC3A 1XKLA 1CUZA 1LSOA 2VBCA 3EWAA 3OQPA 2W2NA 4LOAA 1A95A 2ZUBA 3GRYA 1IPFA 4G8JA 4YGXB 1L5MA 1MNAA 5LUBA 3TM5A 4U00A 3L7AA 4DBVO 2P2LA 4EUKA 3N0WA 5HFAA 3AVUA 3IMKA 2WQ7A 3B9RA 3HZOA 1CRQA 1UOQA 4R3WA 3RLIA 2XUFA 2XMBA 4Q02A 1IQRA 2XJ4A 1N4DA 3C8MA 3KTAA 3UHOA 3ZTTA 4Q3LA 2XRFA 2DU8A 3FLBA 2I99A 1DDOA 1D07A 2JFUA 4OHXA 1DXHA 4J16C 4YQZA 1B74A 2V65A 2YN2A 1JBQA 3AMVA 1HBJA 3OCUA 1OZGA 1V16B 3OOYA 5ILGA 3VZCA 3NJ8A 2QNIA 3H11A 4D3FA 1CJUC 1H8HD 2Y0PA 4GSKA 2JDIA 1Q0PA 3HLYA 3QLVA 1MVOA 4HX5A 4MEBA 2A0UA 2VUIB 1NNI1 3E05A 1ZBDA 3HVJA 1RLJA 4LV6A 1ZNQO 2YWCA 3KZKA 4HX2A 2N46A 2O8VA 3ETNA 3F98A 3KKMA 4I4TA 4YR9A 4UPVA 3QKTA 1E2GA 1F8UA 3SQNA 5I7RA 1ZVKA 2HU7A 1Y9JA 4MV8A 3QU4A 3C70A 4CMHA 3D6VA 3UWMA 4QBHA 1U5BA 4RLQA 1FP2A 1JIJA 2QRJA 1S96A 3ND5A 3I2HA 3MT0A 2IBTA 1SUEA 2ZUDA 3Q0EA 2YQ4A 3FHLA 5EHXA 4Q0MA 1CNEA 3CT4A 4XWYA 1IVYA 2AA3A 1Y5IA 2NGRA 3L18A 4KPUA 4LHWA 5C31A 3UMRA 4QTTB 3ZWYA 3TFOA 3TUZC 2Q7OE 3BJIC 4JEUA 1PFWA 3L0SA 3DD5A 4HQ6A 3DXYA 4RE6A 2AF4C 3GI1A 4I5FA 2D4AA 1FP6A 1ZKMA 3A2MA 2Y0DA 1OFIA 3CZAA 1KKUA 4KO8A 4R54A 1GHTA 2V9PA 4XR9A 4N8EA 3AF2A 2ISSD 4PFKA 2VPQA 3GWZA 2H5LA 3OLVA 3WLAA 3PUWA 1ZR4A 3L0ZA 3P4UA 1T2UA 4N7JA 5CXSA 5EGSA 1TGYA 2P9QA 5ILQA 4Z3DA 2DKFA 2GK4A 4YUZA 5JQGB 1BDIA 3C4VA 4NC9A 3T52A 1KWGA 1A98A 1J07A 1ZH2A 3MQFA 4Q3KA 4RM2A 1KJZA 1FSSA 4FX5A 4HXFB 4O4HA 4ZKEA 5KNCA 1SKYB 4B35A 3IOEA 1UAYA 1GZUA 2QR5A 4O4IB 1RZ3A 2XB2A 1OSNA 3O0TA 2B61A 4YRQA 3D8HA 4X54A 3LGAA 4YP9A 4E5VA 2CVHA 3KOUA 2QUJA 3RVJA 2ZSJA 4E51A 1JVBA 3MBKA 3WGHA 1U8AA 1W5FA 4A0GA 1UK8A 3TYXA 5HWSA 2CL0X 1Z08A 4OXKA 4PNPA 3MS2A 1A5AB 2ZJ8A 1DBRA 1G8AA 4ZV7A 5E1OA 1QU3A 4RDIA 3MUFA 4YGYA 1YZLA 3EJ6A 3EXG1 5EMHA 4D26A 1G8GA 1ZCBA 1K4YA 3COYA 3VO1A 4WI1A 3VR6A 4RIHA 3VKUA 5HEKA 2ODBA 2FJUA 1DIOB 3EMKA 1U90A 2BFEA 3FSEA 1B26A 1W8IA 2XTZA 3QGMA 4OLHA 2FF7A 2GOYA 4MS4A 3R0XA 1Y82A 4XB1A 1BVUA 2C84A 1G8MA 5KWSA 5CUQA 3PXUA 3KE8A 5KQPA 3KEFA 1CZRA 1EIWA 4DM7A 4GQAA 4L3OA 2XH8A 5GP1A 1OTXA 3TIXB 4J90A 3N58A 1FTNA 2BR4A 2CEAA 3P2JA 3K0CA 1SIOA 5CXUA 1MAAA 4A9AA 4LEIA 4QXAA 1Z4LA 2H4ZA 3LUHA 4E15A 2QYOA 5IJAA 1ILEA 4UFNA 1QX3A 4Q93A 5DWVA 1B1AA 4FBMA 3HCCA 4ITVA 2NXEA 1TC1A 2RAUA 4UXHA 2X0EA 4AYWA 1F6WA 4HNQA 4P6VF 3M9XA 2OBBA 3O9VA 4EW2A 3NTUA 1QR6A 3CUWA 2ECPA 2E4WA 2PWZA 4F86A 2FPGA 1EE2A 2PLRA 2BSAA 4AB1A 4MJXA 1Y5RA 1KXZA 2FFHA 3WAKA 2JJQA 1B8NA 2J30A 5FTNA 4OFXA 3R4CA 1Q6ZA 3DW3X 5EZSA 3HYLA 1A76A 1JH9A 1H85A 1TMOA 4OMCA 1CQIA 3SNHA 5TV2A 4UE2A 4FR5A 4B6RA 5BR7A 5MF6A 5JMPA 5AR1A 4ZMSA 2ZYWX 3NAZA 1ORIA 2OGWA 3WGYA 1P9WA 2AMLA 2GFQA 1L5VA 1F2TB 2FWBA 2BKEA 2ZBVA 4RD3A 1MT3A 3QMMA 4QJ4A 1DBIA 3PHBE 4Y8VA 2FJ0A 4ZI5A 2NTEA 3A11A 1J8FA 3DWGA 1LI4A 1SFRA 2QJFA 4WNCA 5TPWB 3SD7A 4D8WA 4FPXA 4XDYA 2I1QA 4DRXB 5L4NA 3CURA 1VBNA 4P83A 1ZIOA 1CR0A 1T0IA 2GCGA 4BEBA 2XRMA 3FMGA 8ATCA 4G25A 4CJXA 2D7DA 1PDOA 3A37A 3R1IA 4Q4JA 3WOVA 4IICA 2R8RA 3AESB 4C0QC 3Q3EA 5KCZA 4LBZA 1N8TA 4O1MA 4ZK6A 2QM3A 2VYFA 4RSHA 4JEMA 1G38A 1LPMA 2PGIA 2EARA 4WXRA 5CFMA 2Z83A 1N9GA 3VGPA 3E4CA 3EC1A 2WA2A 3TQHA 3LQQA 4EA9A 3BM5A 3L7YA 3HJRA 5F7XA 1ZUNA 4L3VA 5D1NA 5JQGF 3OF5A 2GJKA 1YBFA 1H2EA 4NCHA 5JBQA 1G6OA 1PGNA 4TLDA 1JALA 2AFHE 3GDOA 2PQMA 4NAVA 3KQMA 1VL6A 3ETDA 5FNZA 1X15A 2KPOA 2TS1A 1IOZA 5EJ6A 4P3PA 5GPBA 1ILWA 4E08A 3CLSD 4PBTA 3WZMA 1Y63A 1KNXA 1T43A 2A7QA 2A78A 1ZESA 2HB6A 4FGZA 4O2AA 5BNIA 3NFRA 1C8BA 1T4CB 4PPNA 4ZD6A 4DRXA 5I7UA 3CXRA 3DHWC 2QVYX 1TQ6A 1RVV1 1V35A 2W4IA 1LNZA 2YNMD 4WLOA 5FLEX 4ENTA 4RY8A 3E58A 4YCCA 4JSYA 1N57A 3T7AA 4W9RA 1ECPA 4XFDA 5GMOA 3VSBA 1A97A 2QQGA 3VR5A 1NVMB 1Y4ZA 1BQ3A 1ZNWA 3OCCA 3F6YA 4GQBA 1U2GA 4BZZA 1XV5A 4AG5A 5G0SA 2ZIVB 4RYLA 1Y7TA 3HDGA 1WL8A 1BX0A 1T8YA 2FSGA 4FGJA 5CLQA 4UTVA 3EZ9A 4E2XA 1B3BA 1EWTA 1NU8A 4G07A 4ZHQB 3F90A 3O1JC 1XEXB 3MT8A 4LMBA 4MTCA 5COBA 4OLFA 1ESDA 3NHRA 4N03A 1N6HA 4RTQA 5IDWA 4PLVA 3R3HA 4HNTA 3J81A 1Q7BA 2JAWA 1EXNA 5DHTA 1A7JA 4Z53A 1KFEB 1V9CA 1VJCA 1L7PA 4V02A 1W36C 3HCOA 4V0ME 1G9TA 1XROA 2Y1EA 4EENA 3ZDBA 2JHFA 1IC6A 4B3SB 4YR7A 3EPPA 1WP9A 2Y1GA 4LN1A 2H08A 4R9NA 4WMLA 3RTBA 3THXB 4HPWA 4A03A 2QMEA 1ECGA 3L07A 4URUR 2DHCA 2ZJ4A 1XA4A 1E7MA 3SC2A 3CKYA 3FLMA 3FTQA 121PA 2CSUA 2IS2A 1H1TA 1IN7A 1KEVA 1Q1AA 1VJ0A 1QTRA 2Y67A 4G0ZA 4NZMA 3VOAA 4BNUA 5KHOC 1D1PA 1S2DA 1SCDA 2PH1A 4FN4A 4TTJA 3LECA 5KTSA 4TXJA 1YWGO 3JAMA 2NO9A 1SIWA 2X6QA 3PL5A 5MFPA 4B4OA 3JQQA 4RLSA 4UZEA 2GFIA 3IT2A 4KLAA 4UNPA 1MB9A 1II0A 3AKCA 2AXPA 2VPTA 2GEFA 4RPHA 4XTRA 3NI2A 1EP9A 2ZPUA 3CV3A 3H87A 4IY1A 4TQUS 4WKCA 4WCVA 2YY5A 2WOJA 1RPTA 2P3SA 3FF1A 4JVMA 3U4CA 1ABBA 5B7GA 4ER0A 2Q27A 4F46A 1RQ7A 3PD1A 3PIIA 2QZ9A 3HJNA 3OBBA 4KJZA 1ULAA 2VRCD 3RE1A 1OI7A 2Q0XA 4I1RA 3SC6A 1XYGA 1Y5LA 4YJGA 1C4WA 4QBKA 1ML4A 2EC5A 2PKQO 3F7OA 4ZOLF 3S3TA 2BEKA 4FGSA 1DCTA 4JA0A 3ZU4A 3STTA 4LF4B 2QLMA 4RIIA 2CYBA 4DUYB 1WKBA 4DY4A 2QP4A 4BBAA 2Y76A 3U7GA 2X0IA 4RL4A 3HCRA 4BO4A 4UCWA 2BMDA 1L4YA 3CMCO 4IJ6A 4QOFA 4BUCA 5FDFA 1TO6A 2PWYA 1F6DA 1XQXA 1BH6A 2ZBPA 1RAAA 3CSDA 4PYLA 4BRSA 3PNKA 4G85A 5FD8A 3L6UA 3TLJA 4B7XA 2EERA 1ZPDA 1RI5A 1RMQA 2VDVE 4LNUB 4BB9A 4KR3A 4ZALA 1CEEA 3FKSA 4INPA 1T0BA 5GINE 5E4FA 1JIKA 4GKJB 3UG7A 2BI7A 3QJ5A 2OL4A 5E2AA 3OQNA 2ON6A 3IDAA 4TKUB 1ACJA 4DJTA 3UBTA 3C74A 3K5WA 4X1OA 1QGAA 2BRUA 3CZ5A 3JYOA 5F12A 4EHKA 2PKXA 3UATA 2CUKA 1IUPA 2QMYA 2ZSKA 1G8KA 1H0KA 1OVGA 1OYYA 4TN5A 3JRNA 3JU3A 4BPRA 2G72A 3HUTA 3L7MA 2FR8A 1N4AA 1N1EA 4JOCA 4MDFA 5BWMA 2XJ9A 2ZUEA 3NUZA 2BEJA 4D8UA 2QI9F 1YB7A 1JEQA 1XCOA 2PLAA 1F3LA 1QZTA 2QXTA 3K1TA 4P36A 4X65B 2CK3A 1IOVA 2NPIA 1CZOA 3A6HA 1J0BA 1M2EA 1ZGAA 3I45A 4K87A 2IF0A 1ZRMA 3OEHD 1V9LA 3H11B 3SJAA 3TTVA 5C35A 2QVCA 1PRYA 3BA1A 5IW8A 2JJ1D 2D13A 2G5GX 4J7AA 5B3JA 5F9HA 1CS0A 1PGQA 2J6IA 2ZCVA 2JFNA 4LYFA 5AFSA 3DBLB 2OBLA 3DEKA 3AKDA 2O23A 2LBPA 5JCOA 4BFVA 3BA6A 2G70A 3ZHBA 2H57A 3MMNA 5DXAA 2Y4OA 4L7QA 2NVUB 3WWOA 1NDQA 1PYOA 1K3TA 4RPKA 1EBBA 4A4DA 1H22A 3VAYA 3ZK8A 4G9GA 5DKFA 1AB5A 4UVDA 3V34A 3GBSA 1U63A 3BCHA 1DX6A 4HWGA 4M53A 1N6NA 4TLLB 2BMVA 1SVLA 3CVOA 3R5KA 2IUEA 3INTA 4BX2A 4D0SA 4IO1A 4DZTA 1E89A 4NEGA 3S1AA 4W6ZA 3L0CA 3K8YA 3TNDA 4K46A 3RYHA 1IHOA 7YASA 2CL5A 3AEKA 4NICA 1ISHA 1J5XA 4ONEA 5BSFA 5IUNC 2AV6A 1PG5A 1L7EA 2A5YB 3M1AA 3VJLA 1THGA 1KK0A 2BHLA 5CIQA 6AT1A 2C99A 5E7MA 3D1VA 1Z15A 3M4ZA 4XSVA 3W7BA 3GLHE 1LJ8A 3CW2A 2PV7A 2ICAA 1U0FA 2FRDA 4JBNA 3GH3A 3CSSA 5KZMB 1KSJA 1IQUA 3LWNA 4GYWA 2P4EA 4MB2A 2MSDB 2D1FA 2XUOA 3NHSA 3UJAA 2O05A 4LCBA 4E5PA 4EGJA 2GXSA 1QANA 1VDZA 1TAHA 2DBRA 2Z1DA 1BCSB 1W0JA 3G17A 3OHMA 4FP9A 4J4HA 4YPOA 3A7DA 3GUZA 1BS2A 1TJ5A 1JR4A 2H2FA 4FOLA 4IYRA 4U8GA 4WEQA 1CE8B 1H8HA 1R0YA 4MWGA 4R6XA 4WZBA 5GV7A 2R2GA 1Y3DE 1V39A 3KWLA 3QXCA 4QPDA 4ZZ2A 2CE2X 3W2EA 3RRXA 3LDAA 1G0NA 4Q3AA 3K9GA 3V9AA 5CLIA 3RVDA 3WWCA 4EF4A 1BMFA 2AOVA 4OA8A 4KQ9A 4QX6A 1Y4UA 2A0XA 2H4HA 1UKVY 1W5AA 3B6ZA 3Q88A 3P9QA 1OX5A 4LBVA 4C1NA 4YJ3A 1HYHA 1MXHA 1N0HA 1Z0AA 2JCYA 4YRBA 1ZD4A 4HF7A 3BIXA 4KQGA 2C54A 2AKYA 2C4WA 3LXRA 1K63A 1HK7A 1T0UA 1YTUA 1VYHA 1VHDA 2Q45A 3EMBA 4FIDA 5HFNA 3A6PC 2Q1SA 3AV3A 4DHWA 4CTMA 1GUFA 1Q1EA 2C07A 2XVYA 1EK5A 1OR8A 1YHYA 2IIVA 3EN0A 2ZRAA 3PXDA 4QDJA 2IP2A 4ZOBA 5IVDA 3TQFA 2WY2D 3VVCA 1SQ0A 4K81B 1FU7A 5DIFA 2I0FA 4CM8A 1HT0A 3WB9A 2AR9A 2SHKA 2OV3A 3F74A 1ZONA 4PY2A 3UCEA 2ACWA 5AHOA 1KE2A 3OZAA 3OHSX 1HFKA 1ZISA 2BM0A 4E13A 3AVWA 2CXPA 3UJ7A 2X9NA 3KJZA 4KE9A 5HPYB 4EYGA 5LLTA 5JXIA 2JGRA 2KBFA 4K9KA 1IOWA 4RVUA 5ALEA 1SB9A 1P5FA 2IP4A 4OI1A 3GP8A 3L82B 3CPSA 1NU6A 1YQXA 2I6TA 3PWSA 3WS7A 4EGAA 1HTBA 2IDMA 3OCZA 5MN6A 5ALSA 1B6SA 4PAMA 4I9HA 2WWXA 4FC6A 3BIOA 2YHSA 5IF3A 3KZCA 4M86A 4MW4A 3SX2A 2JVKA 4F3TA 5KPDA 1GZVA 1E9AA 4EABA 4E07A 5LDDC 1I3NA 3OFVA 1JXMA 2ZP1A 1QOZA 1X1RA 5CLLA 2R6FA 3SU8A 2UYHA 1SVSA 1Z6QA 2ZIAA 3L93A 4AKTA 5AUNB 1J9ZA 3BXPA 3NUQA 1A9OA 2VQDA 4Y6PA 2NP6A 2GSWA 5J1TB 1BVYF 2ZBEA 3BFVA 5CA1B 5CDUA 4DV4B 4N76A 1RTKA 1V6AA 4L9SA 2C4KA 3BWXA 4OATA 1TKAA 2BFNA 4R1NA 1NLYA 3PGXA 5H68A