3ZYCA

Dynamin 1 gtpase ged fusion dimer complexed with gmppcp
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
347
structure length
330
Chain Sequence
b'SMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVDEMLRMYHALKEALSIIGNINTT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DYNAMIN-1
molecule tags Hydrolase
source organism Homo sapiens
publication title A Pseudoatomic Model of the Dynamin Polymer Identifies a Hydrolysis-Dependent Powerstroke.
pubmed doi rcsb
total genus 103
structure length 330
sequence length 347
chains with identical sequence D
ec nomenclature ec 3.6.5.5: Dynamin GTPase.
pdb deposition date 2011-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00350 Dynamin_N Dynamin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3zycA00
5DIFA 1G21E 1SXJE 1AZSC 2REBA 2BBWA 1G6OA 1A2BA 1UBEA 2JDIA 5CDFA 2WJIA 4URZR 4W5JA 4C30A 4TYWA 2IBMA 2KBEA 2FFHA 3LQRA 4UJ3A 2X1VA 5KUTA 3VU9A 1KDTA 1W47A 3V9PA 2R62A 1YE8A 3DDCA 1E0JA 1I4TD 3GP8A 1RPZA 4JS0A 4P31A 3LV8A 4Z54A 2GF9A 4LV8B 4ZKEA 2WWHA 2RMKA 2OLKA 1W4CA 1LNZA 3AUXA 2QTVB 1XD2A 1DAEA 3EWAA 4A1FA 5JI2E 1PUIA 3DMNA 3QF4B 4MYUA 2ODWA 3GLHB 3W6OA 1SZPA 2VHJA 2XTNA 2V1UA 4MYCA 1SXJB 2P65A 1WA5A 1U9IC 1VYUA 4H1VA 5K8LA 1N6PA 2WJGA 1KKMA 4ESHA 2WKQA 3LW7A 1OHHA 4PAQA 5FPYA 3SEAA 2HUPA 4PPGA 3R9IA 1OYYA 3NH9A 2QT1A 4W5WA 4HLQB 3DVLA 1G3MA 1KKLA 4U00A 2D2FA 2IYTA 1FX0A 3A36A 4PQRA 1XJ0A 4BLPA 1KY3A 4Q5IA 2VQSA 5GADl 2BM1A 5AWFC 2XITA 2MSEB 4JVMA 4C0AC 1TU4A 2Z6VA 4GSYA 3K9GA 4PAMA 421PA 4B6FA 2H5EA 3NBYC 2G1JA 2R6FA 2NZJA 2DWOA 2VTKA 4M1MA 4XWKA 1ZD9A 1RRFA 2NO7A 3DZ8A 1E4YA 2ZJBA 1XXHB 4MRVA 4UXJA 3PEUA 5DHFA 3BXZA 3A4MA 1S96A 1XEXB 2EFGA 2R6AA 2P2LA 2JLUA 2OUKA 3KTAA 4MH0R 4P32A 2WAYA 2AK2A 2ZE5A 3PITA 3RS4A 5L3RA 1E79A 4HLDA 4GT1A 1XEWY 3C5CA 1N2CE 2JLRA 2R44A 3HPRA 4LJ5A 1VYTA 3E1SA 3M0EA 3CRRA 2WHXA 5GJVC 4IHQA 3MSXA 1AS0A 1E1QA 2XB4A 1L8QA 2D2EA 2Y8EA 3KKNA 3SNHA 3MFYA 4TMXA 3KQLA 2CLDX 1U0HC 2DFKB 4Z8XA 2QG6A 2IT1A 1N6RA 1BKDR 1QHYA 1VCIA 3IHWA 5FPKA 3QF7A 4W7SA 1PJRA 3P27A 4LC0A 1ZP6A 1CS4C 5DSZA 4RY2A 3RWMB 3IDQA 1DS6A 1U90A 3PCRB 1MOZA 2G9NA 1CRPA 1CULC 1YZNA 1XCPA 3WXMA 4TQ9A 1WMSA 1NY6A 1UKVY 4QNMA 4W9MC 1PLLA 3EG5A 4Q47A 1KK3A 2PZFA 4A2QA 4LX0A 3THXA 1JPNA 3KXKA 5BYKA 1OF1A 5IK2D 4HAWA 3B85A 4N3NA 4B75A 1EESA 1XXHA 2ZE7A 4CT5A 1QZXA 4CGZA 3R8CA 4DSTA 1M7BA 2HT6A 4OQNA 3W9YA 1OPXA 1MT0A 4XTCS 1UKEA 3U60B 4R7ZA 4WZBE 4L5BA 1D2NA 1Q3TA 1JR3A 5FR2A 3K0CC 4Q4AA 4TLCA 1NKTA 2G88A 4TMKA 4PC6A 4LYJA 1N5LA 4KU4A 3S1AA 2IK8A 4KJZA 2CL0X 4D82A 5KNDA 4IOLA 2ZS7A 1DOAA 3GJ3A 3TQFA 5BW8A 1EFCA 4ZCMA 2DBYA 4TN1A 3K09C 5D3QA 3T34A 4XD7D 4KBGA 4P4UA 5EE1A 3EZ2A 1E2LA 1R4AA 4URYR 2BMEA 4OHXA 2KB0A 3B1YA 3MGCA 1E0KA 2QU8A 2J41A 3RSLA 3TLXA 4C7OB 4LYAA 3CX8A 3QBVA 4I1SA 5B64A 5KOYA 4L9SA 1N0UA 2QMHA 2ONKA 4C4PA 2IEYA 2P3SA 1R6BX 3AP2A 1TMKA 1H8HA 4FIDA 4LY6A 2QRZA 1MKYA 1WE2A 1G9XA 5CB6A 1QBKC 1EFRD 1XPOA 2ZSEA 4Q18A 1AN0A 2OO7A 1OXSC 4B74A 1KDRA 3GMTA 4HB4A 3UIEA 2PX3A 4IVPA 3NEJA 1VHLA 4YQFA 1NVVQ 4GPTA 4P3YA 2C04A 3EPJA 2RGDA 2P5SA 1AZTA 1PUJA 5DH9A 3CNNA 4MA4A 5K8TA 1KI6A 1SHKA 4DDTA 4LWZA 4NL4H 3WNCA 2IYWA 4U02A 4UNPA 3LRPA 5KYKA 2E87A 3Q3JB 1N6HA 4YXWD 5AUOB 1NN0A 4JBYA 1YZKA 1YZQA 3A1WA 3PEYA 2HV8A 3OIUA 3Q5EA 3EZ9A 2IYSA 5LD2B 2ZITA 1TAGA 3TBKA 5KHOC 4D81A 1Z0DA 1P6XA 1KSJA 4HATA 5LB4A 1B0UA 1M74A 3EPHA 1TF2A 5FOVA 5EJEA 2OCBA 2XTMA 1AS3A 2JJ1A 4URUR 4ZIRB 3A4LA 3QJYA 1H8EA 3PR1A 1QF9A 2H1LA 2RGCA 1EFTA 2FSGA 1NMZA 3IGFA 3T61A 2HXYA 4TSFA 1EWRA 2O8FA 2AN9A 1NP6A 1ZNZA 3OZXA 1DG3A 5JEEA 1SQ5A 2VPPA 5M04A 4TTQA 4KYIB 1Y63A 1IN4A 4TZ6A 2X8AA 5CYPA 2CK3D 2YWHA 3VX4A 2QROA 3RS7A 4OQFA 1E32A 3CNOA 1XU4A 1Z07A 1E2HA 1XPUA 4RZXA 1G3RA 1TEXA 3KQKA 3Q8XB 4IKEA 5DI3A 3AUYA 3ONWA 3FHOA 3QKRA 1DAFA 3DKVA 3QKRB 5FI1B 4HEJA 3THYB 1RRGA 1E2QA 2KWIA 1G5TA 1RE0A 2GNOA 3WP0A 5BN5A 3W3AA 5F98A 2WKPA 1OH7A 3QF4A 2GZDA 2GJAA 3AF1A 4QGGA 4WAUA 5J5CA 2VHUA 5HR5A 2QBYA 3ICEA 1JQJC 3EC2A 1U9IA 4B35A 3GFPA 1D6JA 3CONA 1NN5A 2IS2A 1JJVA 1T3SA 1COWD 2EVWX 2CDNA 4F38A 1HEIA 1CF4A 1ZUHA 2OESA 4YMTA 4JZKA 3FDIA 1VHTA 1DAHA 4Q01A 4AG6A 2PLRA 4Q4HB 5FUXA 1KO5A 2ZM5A 5JJIA 3FYHA 4XTRA 2J7PD 2XNDD 1HV8A 1F5NA 4KFUA 2XJ4A 4M2LA 3X1YA 5L3QA 1ZM3A 2O5VA 1FP7A 4ACAA 1P7CA 1ZD8A 4RD6A 4YONB 1DO2A 3Q7PA 3FTQA 3BB4A 3MRSA 4QGHA 5HE8A 1GSIA 3B1XA 1D9ZA 2BBOA 1E2EA 1E94E 4US0R 2AWNA 3KJGA 2VYFA 4M9SA 3Q5DA 2IUSA 3CPEA 1SXJC 4NZYA 4L4UA 1KJYA 2IHYA 1G3IA 1SVMA 1Z06A 2J0QA 2J9RA 2W6IA 1K8RA 2ZRHA 1T5LA 4BEBA 2YNMA 2ZJ5A 2XZOA 3PV0A 4L9WA 4TMWA 4A0HA 1XBTA 2ZS9A 1WQ1R 3SBDA 1P3JA 1Z0IA 4C0JA 4A6XA 4LJ4A 4UXHA 4ASUD 3QY0A 5E95A 1GRQA 2IF0A 3DHWC 5EQTA 1E96A 1ZC4A 2CXXA 3LA6A 1ZM2A 3P4XA 4DLXA 5JWRA 5BWMA 3GLIA 1VYVA 4JVSB 2CEAA 2JIZD 2FSHA 2IL1A 4BFSA 3GLHE 3U5ZB 4JYBA 4HI0E 1SVKA 3KJIA 2JASA 4RD2A 5EE0A 1M1YE 4CVNA 1CBUA 1E98A 3OIVA 1OT3A 4Q4HA 2NO1A 4NYJQ 3T15A 2GJ8A 1XB2A 3UKDA 4DKXA 3OE7A 5JCZA 4DDUA 1UEJA 3T1VA 2WPDD 2H57A 3OAAA 2HEIA 4JLKA 4DDWA 3KQUA 1NNEA 4P33A 5JBQA 3OEHA 4G01B 1TNDA 4RZ2A 1Z0KA 3A1VA 4P4SA 1F2TB 1ZU4A 1W0KD 4NCKA 5HKKA 2E1RA 3B8HA 1IXZA 3K0AA 4DVGA 3PJRA 1CIPA 2NO9A 5JCPA 2B92A 3K0AB 4D25A 4M4SA 5FPSA 1OXXK 5KPDA 3QBTA 2J5XA 2JAQA 3TMKA 1XJCA 1AGPA 2NQ2C 4LC1A 5FTLA 2KI5A 1HUQA 2O52A 3U44A 2PBRA 2ZRAA 4LJ8A 1NIPA 1G291 3GEIA 1QHSA 3ZD6A 1U0LA 1J2JA 4MDEA 2ZETA 1W4RA 1W2GA 4MYTA 4EJSC 2VIIA 2WSMA 4G5RA 3RRZA 3WYFA 4AKHA 2JCSA 2IS1A 2OEPA 3AVTA 1JI0A 1KSFX 1W0KA 1G1MA 3WYAA 2FDCA 3AVOA 4JLVA 3FKSA 4ZDWA 2VO1A 1AGRA 2IHBA 2GAOA 4JL6A 1G8YA 3L2OB 3W34A 3AVYA 1G41A 2VP4A 2ZUCA 3DKPA 4L16A 2ZSFA 3W5JA 2FU5C 3OE7D 1IY2A 3AVWA 1G7TA 2J87A 2VP2A 4G0NA 3SOPA 1EFHA 3K70D 4TZ0A 1II8B 4NPHA 3CRVA 4K81B 3D8BA 5FBLB 3AVUA 1L4UA 2YINC 3BBPA 2ZU0C 2FGJA 4BWYA 2AHOA 1LF5A 2D74A 3ZQJA 1UDWA 2RGAA 3VR4A 1HH4A 4QNRA 3W5IA 4S2EA 5P21A 3LQQA 3ZZUA 4IEEA 5L3SA 4JL5A 1TF7A 2AXPA 4FCTA 3C8UA 3L0PA 5ELXA 5EP1A 3NEYA 2GJKA 1AQUA 2ERXA 3U7EB 5L8VA 1NMXA 2ZE8A 3KB2A 5AR1A 3Q7QA 1Q1QA 1T91A 3DOEA 2LKCA 2CLSA 1R5BA 3A4NA 4A92A 3AKYA 3RSOA 2GCOA 1MABB 2IYYA 3CO5A 1AKYA 4JLDA 2QE7A 3SR0A 1XEWX 5E7MA 2QMUA 2WVJA 1CR0A 1KJWA 3F3YA 2IXGA 2WIAA 1G7SA 2VP9A 4QHYA 1LB1B 2W6ID 4GMXA 1E2MA 4JVLA 3VR2A 4B6EA 3R7WA 4HDQB 1X6VA 3WP1B 2QEQA 4JYCA 4WBSA 4GOXA 4BZPA 2BHRA 5LBIA 3SHWA 1WXQA 4NYJR 4Q9LA 3ZVRA 1M6NA 4QKQA 2ZJ8A 4R9UC 4B43A 2F1RA 1FTSA 1GTVA 4MUAA 1NL3A 3V00A 1T8TA 2QQEA 2TMKA 3JZMA 5GJCA 2DWPA 2XNDA 3C41J 2QORA 3GJ0A 4BFUA 1E2DA 2G1KA 3SJCA 2PJZA 4ZKDA 2JLVA 1VG1A 1FQJA 4QJ4A 1XWIA 3W8NA 1CJKC 1T5IA 3NWJA 2GESA 5D3MA 2ODBA 1COWA 3LBNA 3LW8A 3GLGB 3QNUA 2OLJA 3H1TA 3GLIE 5C18A 2A30A 4ZV4A 3CBQA 3CF0A 1US8B 3ND9A 2P0EA 4GP7A 3ZIAA 3K1JA 2IXEA 1US8A 2BEJA 3ECCA 5KSYA 5E7IA 3HU2A 1DEKA 1V5WA 5K8UA 4IOJA 1QVRA 4US1R 5FTKA 3X1DA 3QXHA 1XNJA 2ZRLA 4JT4A 1GKUB 3T5GA 2O8CA 2N1BA 3VR6A 1P61B 4DCSA 4QFMA 4MQBA 1KI9A 3L0SA 1ZM7A 3U61B 2P6NA 221PA 4HUTA 2IF2A 4Q7KA 1W5TA 3RC3A 3CRQA 1W0JA 1Z29A 1JR3E 5EZ5A 2QTFA 1UPTA 3N5CA 2G83A 4RZUA 2OHFA 4KVGA 3K0FA 1OLOA 1S9DA 1U81A 1QVAA 2QRNA 1FP6A 2AFIE 1B23P 2FPMA 2QMEA 1BMFA 1M34E 2O0JA 4B2PA 2FNAA 1VDZA 5IT5A 4P4TA 4TSFD 3SN6A 3BFXA 1S8FA 3MMPA 2QZ4A 2OBNA 2ZSAA 1P4SA 4G5SA 4QBHA 4B32A 2PT5A 5BXQC 1JJ7A 1N0WA 4JL8A 1H8ED 3PEWA 2ZI6A 2VP6A 2QAJA 3FB4A 4PTLA 4RSGA 1MO3A 2A5DA 4E07A 4Q1CA 2REOA 2FG5A 1LFDB 3GFOA 4ARZB 5UKDA 2JLXA 2AX4A 2QTHA 3SQXA 2J0VA 2RKOA 3E5HA 2ZE6A 4Z51A 1GZSA 1ZM4A 2Q3MA 4NYIQ 4PFSA 4BFZA 1VG8A 1XJQA 4I1UA 3NBXX 5AJYA 1A7JA 1R0ZA 3RABA 2ZROA 1OYWA 3VAAA 3VR1A 4JKYA 5GVRA 4AURA 2WJJA 4YXWA 3IO3A 2YC4C 5CM8B 3EC1A 3MWJA 2MMGA 1EX7A 5EUQB 4JLBA 4EFMA 2QNRA 4OL0A 2C2HA 2WIBA 4DCVA 5JJKA 3FE2A 1GNRA 2IW3A 3REGA 2PLFA 1XD9A 4GBMA 4CT4B 4Q02A 1E2IA 4G5QA 5B30A 2YV5A 1OXUA 2XGJA 2JJ2A 2BKUA 5FUYA 3IEVA 3EW9A 5GJBA 3H2YA 2ZRMA 3PQCA 1H8HD 1I2DA 2I1VB 1RRCA 4V0NA 3CR8A 1JR6A 3SZRA 4A15A 2G0TA 3L0OA 4OJQA 2GXAA 3CR7A 4M1OA 2WOJA 3T1TA 3L8YA 3ZYCA 1OXTA 1GITA 3ICQB 2PZEA 4UNNA 4X8OA 3CX7A 1OSNA 1XX6A 1GKIA 5C4GB 4C0BA 3AVQA 5IF9A 4XD7A 3CW2A 3QQ5A 2JLYA 3G5UA 1ZJ6A 4JLJA 5CLLA 1W5SA 4B3CA 3FMIA 3IKJA 5KTYA 2JJ8A 4Q4JA 2V6IA 4N0EA 3SC3A 3ZVMA 3BB1A 3K9HA 1HQYE 1R7RA 2YWFA 5FBRB 4WZAE 5CB8A 3O8CA 3FOZA 5FTJA 5J4VA 4NONA 4KHZA 1HT1E 1OE0A 2I3BA 2NO6A 4CEJA 2VP5A 4V03A 3R20A 1JR3D 2ZEJA 3TH5A 2FN4A 4OK6A 5SZJA 5FPHA 2NPFA 4QBIA 5CM9C 2XXAB 2B21A 2EWVA 1WCV1 2XX3A 2FH5B 1Q1BA 3T06B 2YOFA 3LFUA 4PSKA 2WJVA 5JRJA 1XRJA 1CJVC 4LYFA 3K70C 2HF8A 1KI4A 4FMCB 2Q6TA 1ESMA 1Z0JA 1Z08A 3KFXA 4BLTA 3CF6R 2IS6A 4B3DA 3HR8A 1KSGA 2X2EA 4KI0A 4POAA 4DWJA 1AS2A 2Z0MA 3GD7A 1VIYA 3N2IA 4B44A 3KKPA 1YZLA 3VU9B 2BVNA 4M9QA 4OHVA 4NH0A 5C4MA 2XOKD 3KUDA 1I4LD 2R65A 3LBIA 4CEIA 1UFQA 5TVKA 2FSIA 4EPYA 1X8KA 721PA 3KUCA 1Z28A 5B58C 1MO4A 2VSFA 2ZJYA 3DOFA 1SKQA 5EUMA 2FWRA 3WRYC 2F1JA 1TQDA 1GL9B 2XZPA 5B2ZA 1JQLB 3K0SA 5E7JA 1VG0B 2A9KA 1Z0AA 4IOKA 3SI7A 2RGBA 4JMPA 1E1QD 1VKJA 4OI4A 1G4UR 4DLYA 3I62A 1E9FA 1KDPA 2CCGA 2WWGA 4LJ9A 2QP9X 3W6PA 4BZQA 3BOSA 4M1SA 3EIEA 2ZVQX 4JT2A 1ESNA 4DSUA 1P75A 4FCWA 1IQPA 4BQSA 3U7GA 2IC5A 1Z6TA 4MKGA 4I1OA 2ZTSA 3X1ZA 3BAFA 4C2TA 2ZVPX 1KK2A 3D6TB 1KI1A 2IYRA 3RANA 4C0QC 1TUEA 1N5IA 4KLNA 1DAKA 1E2JA 5TXGA 1KO1A 3WY9A 2VHCA 3MLEA 4LBVA 1YRAA 3LXXA 3UPUA 1WBBA 2XB2A 2OXRA 3LLUA 1OFTA 2FA9A 3CUEF 4JLOA 1KI7A 3FFBA 1SVOA 5GVSA 3LY5A 1R0YA 1J8MF 1EXMA 4ZDJA 2IEZA 4E09A 3AVPA 4A4DA 1E9SA 2WWIA 1NLZA 1ZC3A 5HE9A 4MYHA 4D80A 2GJ9A 3TAUA 3AKEA 4I81A 1TTTA 5L3QB 1ZNWA 2HLDD 5TV2A 2Q0HA 4YDHB 1WF3A 5G3YA 2ZRGA 2GCPA 3C15C 4HB0A 1W44A 2YOGA 3EA5A 3M1IA 1GL7A 3PUWA 3A8TA 3PUXA 2ATVA 1KNQA 3I73A 3OFNA 5H8WA 4HAUA 4EPTA 2RB4A 1IXRC 2YHSA 3NHAA 1L7VC 2CBZA 1TX4B 1V43A 2ZRBA 1IOZA 2EQBA 3I92A 4XVQA 5SZKB 4M0LA 3ASZA 2FSFA 3MJHA 5EXXA 1LVGA 5FOWA 1O3YA 1QHHA 3IBYA 3VFDA 1DARA 4O2RA 4AYWA 4QJ5A 5SZIA 5EXTA 2H18A 4XJXA 3QPWA 4NYMQ 2ZXUA 1M8PA 1S4QA 2HF9A 4FD2A 6Q21A 3BC1A 2BIFA 1GRRA 4D2IA 3HU1A 4H1UA 2OAP1 3QEJA 4PC3A 2ONJA 3WMFA 3U4QB 3JZAA 4EFNA 3NC1C 2HJGA 4KXFB 3THXB 3A6PC 2GXSA 4MGKR 1E0AA 4MUBA 4XSHA 1R2QA 1P60A 2C8VA 3G82C 4TT3D 2ZPTX 1R0WA 3CB4A 3EZFA 3IBGA 5TDHA 4LV6A 3BERA 2DPXA 4DUGD 5J4LA 1I2MA 5AJXA 1UKZA 4KLZA 3RS2A 3QVUA 3B60A 3NBZC 2CNWD 2V8OA 3AB3A 4OK3A 4Q1DA 4WVFA 4QL3A 2OV2A 5FBVB 1ZM9A 2V7QD 2H7VA 3LX5A 3NG1A 1G8HA 4Z1MA 4AYXA 3U3RA 3K09A 2DR3A 1N3BA 3TGPA 4LHZA 3EARA 4DLVA 3IUYA 3TUJC 4DZZA 1YR8A 4A6PA 5G41A 4IXNA 3AV0B 4LDJA 4C0KA 1SXJD 4BGDA 1DADA 1NN1A 5KDLA 2IWRA 1E9BA 3QPUA 4Q9JA 4DDVA 3EXAA 2FMXA 4A82A 3UXMA 2WWYA 4EDHA 2HYIC 3BH6A 1AM4D 3SFVA 5FL7D 4C7OA 3CWQA 4IDHA 2RHMA 2WM9B 2Q9BA 2L0XA 1T0JB 1OIXA 3EZ6A 4JSTA 4B3BA 2YWEA 4JLNA 4R2HA 1E2KA 2HXSA 2CVFA 3B1ZA 3B9PA 3NDBB 2WICA 3W90A 4LZZA 4NCJA 1VG9B 2P5TB 4BLRA 2IYLD 4CDGA 1E9RA 2A5YB 2AWOA 1NBMA 2VHQA 2X77A 1F3OA 2WJHA 3IHLA 2ZYWX 3BE4A 4C9BA 2GWHA 1Z47A 3D31A 3ZVLA 2AFHE 2ZJAA 2VP0A 2WKRA 2O0HA 1LS1A 1E4VA 4ZI2A 2KBFA 4B3XA 3EZ7A 4D4LA 2CMKA 3HPQA 3UWKA 4KCGA 1NBMD 3EPKA 1KZGB 1IN6A 3L0IB 4KFRA 5EP3A 3THWB 5J4HA 1BYUA 1Z6YA 3X1XA 4F7WA 2GBLA 4B71A 2OCYC 3X2SA 4F92B 2O8BB 2EWWA 4OQLA 2AK3A 2JATA 1TEVA 3ZZTA 3B13B 3ADBA 4DIEA 4JSYA 1IJFA 3VX3A 2BV3A 3KZ1E 1KAOA 3RAPR 2WJYA 4ZIRA 3Q72A 5FI0B 3RRMA 3PXGA 4OJKA 2F43B 1NVUQ 2FZ4A 4CRWB 3GJ5A 4JKIA 4DJTA 1BOFA 2EFEB 2G6BA 2ZSDA 2GETA 2QMOA 3AVXA 4LJYA 4AKGA 5FOXA 3VHLB 4KV9A 4EJSA 4FI3C 2Q3FA 2CE2X 2YZ2A 4G5GA 4NYMR 2GVZC 2R2AA 1R8QA 1UBFA 4LHWA 1OH6A 1RKBA 4K46A 3EIQA 2ZI9A 1II0A 5JS8A 3AM1A 4Q21A 1FNMA 2ZAOA 3I61A 1UKYA 5KSOA 4RD3A 4AIIA 2IUUA 3W6NA 4BRUA 3N70A 4IJMA 4IXMA 4DUGA 3U7FB 1E69A 1P5ZB 2ZYVX 4PXAA 1E2NA 3PVSA 2GK7A 4Q9IA 2QENA 2FFAA 1TADA 3AH8A 2XXAA 4WZ6A 4TT3A 4KAXA 5LD2C 3THWA 2MSDB 2FEMA 3TIFA 2OAQ1 2Q3HA 2RGXA 4LBWA 5TY0A 2F7SA 1ODFA 4I1VA 1FX0B 2VHTA 3VMFA 2CCKA 2ZR0A 4QRHA 1U0JA 3S1AB 2B7BA 4Q00A 1AA9A 4FWTA 1UADA 2GBLC 2HT1A 2LWIA 1NRJB 2QL6A 3QKSB 2C77A 2F43A 4OI2A 3FMFA 3OESA 4YDSA 1Q12A 3IILA 3NBFA 4LHYA 3TR5A 1VCMA 1G3UA 3IPYA 3RHFA 3VNVA 3IQWA 1KAGA 5DHAA 3EX7C 4II7A 2CJWB 2I1QA 2XSZD 5AJVB 5DGXA 2AKYA 3SJAA 2P67A 2CL7X 1CKEA 2ZRDA 4LOAA 3TUZC 1JAHA 4IFEA 3U3KA 3UG6A 3GLGA 1KO4A 3OFND 4EQ6A 2O8CB 2JGNA 3H4MA 4W5HA 3G0HA 5HZHA 2IUTA 3IIKA 2FOLA 4A8JB 2QPAA 5G3ZA 3FGNA 3V4FA 2HLDA 4C0HA 1XD8A 2FE4A 3K0EA 2PCJA 4Q4JB 1W2HA 1YR9A 3I3SR 1KI3A 1OIVA 1S2MA 4LK2A 2JEOA 2A5FA 5KO2A 4YMWA 1G7RA 5A5GA 3O47A 4F93B 4FMDF 2WTUA 1VTKA 4JJZA 3BJIC 3ZD7A 1L2TA 2WV9A 1UBCA 2ZI5A 1OKKA 1T3HA 1XTIA 4LYHA 3O8RA 2PCLA 2UVQA 1HQCA 4YLGA 4PO9A 4Q9HA 2ATXA 1SVSA 4LBYA 1NY5A 2PT7A 3LLMA 5LDDC 2AD1A 4RD1A 3NVAA 3B78A 4M53A 2OILA 1P9NA 1HTWA 4HYYA 4TLBA 2Q9AA 3FWYA 3TW8B 1FL9A 1RVDA 1KIMA 1Q21A 4DCUA 1GOTA 1HE8B 1U2RA 4RKEA 1BYIA 2XEXA 821PA 4PSVA 2BEKA 1CTQA 2HCBA 1ANKA 3AGPA 3TK1A 1YU9A 2IYXA 1RW4A 1G19A 4BFYA 4MGZR 4OBEA 1KI6B 1X3SA 3FVQA 4YC7A 4CYMA 4IW3B 4IEIA 5GJWC 3VHXA 3CX6A 3IIMA 2IA5A 5AJZA 4LI0A 2DFNA 3ZZ0A 1NJGA 4BEJA 3ZQ6A 1W46A 5FOTA 3VKGA 1WRBA 2W2TA 1LY1A 2XOKA 5HTKA 3R9XA 5CYOA 4DLSA 2O0KA 3NIBA 4M1TA 4HUQA 4JIMA 4WOPA 1FNNA 1RYHA 1ZINA 1KJZA 3BORA 3TNFA 4A0GA 3CH5A 2QP4A 4OKSA 4LJ7A 3RS3A 4MKHA 4UNRA 2BJVA 4CZ2A 1TQ2A 2WWWA 2KJQA 3GLFA 2BMFA 3PIRA 2WBLC 2GEDA 1CP2A 1Q3HA 4OK5A 3HR7A 1G7CA 4QC2A 3KL4A 3C16C 4FMDB 4RKFA 3ZJYA 5F3WB 4ON9A 4TTPA 1P9WA 4Y0VA 2BDTA 3SBEA 4IDOA 1EWQA 3TKLA 4GOKA 5KPJA 4N0DA 1NSFA 5CJ2A 1DAIA 4PQYA 3NKVA 1PZNA 4B73A 1W4AA 3SJBA 3SYNA 5DYIA 4DEXA 3H84A 2MMCA 5DYGA 2WWFA 4TL7A 4RFSB 2A78A 3K8YA 1PLJA 2D06A 2FZLA 2J59A 2ZRJA 4AI6A 4RFSA 4LPSA 2GXQA 1G5RA 4O25A 3LVQE 1YZTA 4MGIR 3HJNA 3F0TA 5FOSA 4FN5A 4JLMA 1G8FA 2BOVA 4X8MA 4B34A 2ZS8A 1E9AA 1C4OA 4BFTA 2A5JA 2NPIA 1NSTA 3DZDA 1DBSA 2FGKA 2H92A 4HLCA 3QXCA 4ZPXA 3ZH9B 2QUZA 4TL9A 1JXMA 2J7KA 4OHWA 2CCJA 2OBLA 4NKRA 3ZS9A 5KNCA 1O87A 5E4FA 2ZRIA 4Q7MB 4BLQA 3KXIA 4HAYA 4KFSA 3SQWA 2D3WA 1W36C 4BFVA 5CK4A 4LCBA 5CIQA 2ZYTX 4RD4A 5JSZB 1MV5A 1E9EA 2JJ2D 2C5LA 1DE0A 4G5OA 4OI1A 1SHZA 4D4JA 3FMPB 1QG2A 4GOJA 3ADCA 2OFXA 4HAXA 1XZPA 4Q1EA 1F2UB 1U8AA 1E9DA 5F9FA 1GNPA 4PZYA 4URWR 1IN5A 2DCUA 1X8LA 3GCGA 4IDQA 5J4YA 2GCNA 3B1WA 3AEZA 3OHMA 1FFHA 3JVUA 2QA5A 1UDXA 5DNYB 4PSAA 2OZEA 1PV4A 2QAGB 3H86A 3LDAA 2IYZA 2QAGA 2ZANA 3QE0A 4TYYA 2WWXA 4G3XA 2EW1A 2GCOB 2F6RA 3AKDA 3Q9LA 1W1WA 4PPNA 4TQAA 4KFTA 4ARZA 2FEOA 4B48A 1SULA 1ZCBA 3P1JA 4IVQA 1ZD1A 2VF8A 4H9GA 2OG2A 3VR3A 3ZVNA 4O0MA 2ZI3A 3TVTA 3I5XA 4ZCIA 3ZLJA 1MO6A 2CL6X 2PH1A 4MKIA 1OFIA 3CZQA 4TMZA 2NOAA 1P2TA 2ZJZA 1IAQA 3LXRA 5AJWA 3GPLA 3EPLA 1BMFD 1UM8A 3MJRA 3SFZA 5JI3E 8OHMA 1G17A 2J3EA 4QG7A 3FPAA 1QHHB 5H1YA 3OIYA 2ORVA 1E1RA 1YHNA 4NCNA 2NGRA 3REFA 3C7KA 2C96A 4LJAA 3TAHA 2ZRCA 1ZCAA 1Z83A 1RC8A 3CZPA 1AIPA 2B8TA 2W2VA 1W0JD 1DG1G 3K9NA 4DRZA 1D8TA 3GEHA 5EE9A 4ABYA 4MGYR 5TMPA 2WSSD 1W36D 4MRPA 2QP3A 1H65A 1RJ9A 3BD9A 4M8NE 3RVBA 4DT1B 1XP8A 2Z4SA 1N0VC 2ZU6A 4FXPA 4RFVA 3SJZA 5G53C 1GKYA 5JFGA 1KTVA 4B3FX 3GJ7A 1OB5A 2ANBA 5EE5B 1QHIA 3ZIAD 4KYUA 3T5DA 2JLQA 1G5PA 4BZXA 2GZAA 2Z83A 3U6KA 4B2LA 1W7AA 1DELA 1C1YA 2FPLA 2ODEA 2PEYA 1XTSA 3U3OA 1BIFA 4Q4AB 4US2R 1F6BA 2PEZA 4ACBA 3A1TA 5C1BA 2RH5A 5DE3A 2VRWA 2LCFA 1JAIA 3A1SA 3I32A 3IO5A 3TE6A 1WP9A 1NVXQ 5DI3B 2ECKA 1Z6GA 2BKEA 5JEDA 4TYNA 3LX8A 1CU1A 1GG2A 4XWAA 4BLSA 4D6PA 1KHTA 4ZDIA 4URXR 1X1RA 2CHVA 5EP4A 5AUPB 3QXJA 4R2IA 5FOUA 1IN8A 2YC2C 3CM0A 1GILA 4A36A 3TR0A 3LBHA 4OQXA 1A1VA 3SS8A 2AKAB 3MWKA 3PUZA 4QHSA 5FUWA 3R7WB 3QKUA 3P32A 5FTMA 5FL3A 3RRNA 5JJLA 4DIDA 3DM9B 5E3HA 3AF0A 4NCHA 3VTKA 1U8YA 3KXLA 3SU8A 4EJSB 2GILA 2QE7D 3UMRA 1VIAA 5FTNA 2EFCB 2ZRNA 2OBMA 3RYTC 3GJXC 3WRXC 2ZUBA 4BFXA 1KDOA 2GVDC 2J0UB 5FR1A 1AJEA 5DISB 2XTZA 1R8SA 2OFOA 4QGFA 2C9OA 2NIPA 4PAOA 5C46F 2C78A 2QN6A 1AKEA 4XIGS 2IXFA 3PUYA 4PC1A 2C95A 1ZUNB 3GQBA 1CRQA 1P2VA 3C14C 1Z6XA 1WBDA 1XTJA 4D0NA 4RCZA 4CEIB 3U6BA 2DFLA 3I72A 2P6UA 3MUFA 1XCMA 2VF7A 1MRSA 3O8DA 4A2PA 4EPWA 2VH5R 2G3YA 4QM7A 2EYUA 4V0KA 1DO0A 5JWHA 4DHEA 5JLJA 1P9RA 4OYHA 3WNDA 4M1WA 4RVCA 2V3CC 2D7DA 2GAAA 2QPOA 1Z8FA 1AQYA 4UXIA 2W6JD 3SHFA 4UNQA 3GLHA 2RCNA 2JA1A 1HE1C 1RYFA 2ZUDA 1YZGA 1UAAA 3FKSD 1UEIA 1XZQA 2QQ0A 4RJLA 1R10A 1D2MA 4UNSA 2OT3B 1CEEA 1N5KA 2WMNB 4M1YA 2ZQ5A 4QGAA 1CLUA 1CJUC 3CWZA 4DB4A 2WOOA 3O8BA 3QVVA 4AY2A 2AD5A 4M9ZA 5HZKA 1EX6A 2LKDA 5KU1A 1EG7A 5A0FA 1M2OB 1NI3A 1YKSA 1NLYA 2GA8A 2W58A 2WZQA 2VSOA 3U7HB 1T8UA 2QBYB 5JECA 1ZVQA 4JBXA 2CJWA 3HYRA 1XMIA 4KSBA 1GL6A 2GXUA 2FFQA 1NJFA 2BC9A 2FX3A 2GEUA 2ZRPA 2DB3A 2C99A 4AKEA 1W4BA 1Z2AA 3ASYA 5HKKD 3M4YA 4IRUB 4C2UA 2YVUA 3DMDA 1F2TA 2OXCA 4MRSA 1U8ZA 5FPTA 3OEHD 3WHLA 1E9CA 3EWSA 3VKWA 1KZ7B 3OAAD 2Z5FA 2W6JA 3X1WA 2WPDA 3MWLA 3N2EA 5EP2A 2SHKA 4HLUA 4HB3A 1XMJA 1NMYA 1K5GA 4QBFA 4DBLC 2FPKA 2YOHA 3IEUA 4A0RA 2ZJ2A 3BFVA 4PHGA 4PZLA 5CK5A 3THYA 3K70B 5DLQC 1FZQA 4ITRC 1D2EA 4GFDA 4GMDA 3C4JA 3MD0A 2D62A 1TU3A 2JIZA 1W48A 2ZAMA 2FFBA 4F4JA 3T1OA 2V4ZA 4YMUA 1AK2A 2QAGC 2GKSA 4NBSA 3VQTA 1OJLA 1DVRA 4BRWA 4PC2A 4YMSA 4ASUA 2GEVA 1XTKA 1Q1EA 4QHTA 4URVR 1QHNA 3CLVA 4NP6A 3DM5A 3BIFA 3B1VA 3MCAA 4PO1A 3ZS8A 2FF7A 1X86B 4E5UA 3CNLA 1YQTA 3HDTA 1CJTC 2GZHA 1C9KA 4L8GA 1NVWQ 2Q21A 1DAMA 2W00A 3F8TA 3DPUA 4RZ3A 1R5OA 1EK0A 2H17A 4EIWA 1RFLA 5B57C 5JHGB 1N6NA 1MR3F 1GDDA 2KSQA 1UBGA 4JJKA 3GJ6A 3B2EA 1QG4A 4TL8A 4LBZA 4Q1AA 3ETLA 5HCIA 4PHFA 1XXHE 3BGWA 4DLWA 3U3MA 2YYZA 4CIDA 2F9LA 4BFWA 2O8BA 3CRW1 2J7PA 1NG9A 4WXPA 3BS4A 2R6GA 4DLZA 1ETUA 2A2ZA 4A8JC 5J4KA 3QIAA 4V0LA 1LTQA 1JB1A 3AGQA 1D9XA 1E0SA 2ODNA 2N42A 4QBGB 1FOEB 4MITA 5DI9A 1K6MA 5CITA 4F4CA 4OI0A 2J0SA 2Z4RA 3K0FB 2VBCA 2ZR9A 1HY3A 4PZZA 1KMHA 2J1LA 5J40A 1FMLA 1Q22A 2UZIR 4XH9B 1IHUA 4HSEA 5AK0A 4DLTA 1TL7C 1GIAA 2B8WA 4V0OA 5HPYB 1U94A 3NDPA 2F3RA 4EPRA 4ZCLA 2IYQA 1T0HB 4NDZA 1OW3B 2C9CA 2IYVA 3HU3A 2C9YA 2GHIA 2HYDA 4NE2A 4X8HA 3RWOA 2ZREA 3AF4A 2GDJA 3HP1A 1KO7A 3SYKA 1FW6A 3VNUA 2R8RA 3ADDA 2CE7A 1IONA 1ZNYA 3L43A 4PX9A 3SYLA 3TVDA 2IYUA 3LVRE 2WSSA 3K53A 1KSHA 1HURA 3V4RA 1Q44A 4HAVA 3KQNA 3QOFA 4HB2A 3W8RA 2H16A 5FBQB 5KNBA 4BUJA 2KE5A 4A8JA 2QY9A 2XJ9A 2V1XA 1NG1A 2CK3A 3QXXA 1J90A 1E1RD 4JBWA 3NXSA 4LJ6A 4DT1A 5IHPA 2V9PA 4OHZA 1RIFA 3B82A 4CEHA 4HDOB 3EIHA 4NYIR 3P4YA 1NVVR 3GLFE 4GZMA 1YR6A 2F3TA 4PPQA 4TLAA 2CHGA 4F91B 2REXB 4TLDA 1JEEA 3B7GA 121PA 1PVOA 1YZUA 4EKDA 2JJ1D 4GL2A 4RD0A 5CJPA 3QENA 2WMOB 4HZIA 4NMMA 5A4JA 1CR2A 1A2KC 1JALA 4IDPA 1Z63A 1G16A 1KK0A 2QSZA 3A58B 4IFBA 1F2UA 1YRBA 1J99A 3RS0A 4P0TA 2NG1A 3BH7A 4PANA 4AKIA 3WNBA 2AXNA 3NTUA 4UKDA 2GJSA 5ANRB 2H8KA 1Z3IX 4DLRA 3UATA 1E3MA 4FCVA 2RHDA 3DEFA 4UQOA 4B2IA 2QI9C 3QG1A 2IS4A 1Z6AA 3QKTA 2QM7A 2V54A 2BWJA 1F60A 3FFAA 5G40A 2OFWA 1ZAKA 4PHTA 3LO5A 4Z8YA 2GF0A 3Q85A 2BM0A 2QSYA 3WMEA 2UKDA 2N46A 1QHXA 2EYQA 3SDZA 2ERYA 1RRPA 1S9HA 3B6EA 3CH4B 2HJVA 4GZLA 5KDOA 1T6NA 2RGEA 621PA 3T1QA 1EFRA 2O8EA 3E2IA 3I8XA 1Q1ZA 4LPKA 2YKGA 1DTSA 1LV7A 1T9HA 4CEHB 2F1IA 1GAJA 4Q1BA 4Q19A 2ZYUX 3AF2A 4ILEA 4PPFA 3A1UA 4LHVA 3HWSA 1FPMA 1M7HA 1CR1A 1GP2A 1L4YA 4LUCA 4MRNA 3FHTA 4A9AA 3KFVA 1SVLA 1XEFA 4IDNA 4HZUA 1T4GA 1ZMXA 1G4AE 1BS1A 1N6LA 2ORWA 2UZ3A 4DC9A 1JBKA 1G3QA 3WBKA 2VLIA 1VCOA 3QKSA 4AWXA 4KODA 4WW0A 4C0LA 4KO8A 1N25A 3T35A 3IPXA 3CRMA 3D3QA 5FUVA 5AUNB 4KITB 2PX0A 1E6CA 1KOFA 3CPHA 4M21A 2C98A 2O8DB 2DY1A 4MKFA 2D4HA 3AF3A 2OCPA 4OQMA 521PA 5KSZA 2O8DA 4TMVA 1KNXA 1W36B 4Q1FA 2G77B 3FMOB 4B76A 4BPBA 2R6DA 2W83A 2A3RA 2J46A 1XF9A 4HLUC 1P73A 4GRAA 3F5FA 4TTRA 4XVRA 1OV4A 1U99A 2ZRKA 4D0LB 4DCNA 2DWQA 2RGNA 1RJ9B 4EQ6B 3H0KA 1U98A 3IQXA 1G64A 5KSPA 2XZLA 2HDNB 4Y0AA 4TYPA 1S3GA 1YR7A 3QPVA 1F48A 4X8LA 3DL0A 4BLOA 4XOIA 1M7GA 1IJEA 1Z0FA 1VECA 4KBFA 5FH9A 5IK2A 2GTPA 2F1HA 3ADKA 3BFKA 5JHHB 2QPTA 3RC8A 1HA3A 1QDEA 3UMSA 4M9XA 1OXVA 4HUQB 1EGAA 4A2WA 1KMQA 4LSGA 4ZDKA 1OIWA 3E70C 3GLIB 1FTNA 4O2LA 1TPZA 3TSWA 3IIJA 4LV5B 3GLFB 1T3LA 1XD2B 2GRJA 4R98A 3KB1A 1IY0A 3TW4A 2XAUA 4Q03A 3FKQA 2QM8A 1FMJA 4L15A 1GUAA 1Q20A 1N5JA 4BE7B 4F4IA 4J0QA 2ZR7A 2IWHA 4GDFA 4PR0A 1ELOA 4Q7JB 1P2SA 2BBSA 3L8ZA 5LB2A 2A5GA 3BH0A 1KYIA 2E9SA 2K5UA 1JXOA 2PMDA 4Q4LA 2OE2A 1Q0UA 3U3JA 4Q9KA 2W2XA 1I4DD 3B9QA 4D4KA 1E79D 4TYQA 4FWIB 2ANCA 1TF5A 4TWZA 3AVVA 1HYQA 1ONBA 1IXSB 1OB2A 1WDTA 1XFAA 2OSBA 2XNSA 3CPJB 4NTZA 1KI8A 4U7DA 3ZDQA 1CR4A 5IRCD 1TQ6A 3TJZA 3QEOA 3QG5A 4A0FA 5L3VA 4BASA 1JEDA 3U4QA 1VCNA 3C5HA 2F9MA 4DXAA 1G18A 2P6RA 4QM6A 1OKKD 3EA0A 1KY2A 1ZBDA 3UMFA 4AYTA 5JWOA 1BH2A 3AP1A 1ZU5A 4GI7A 2B6HA 4IVRA 4QXAA 1S1CA 2V6JA 4N1AA 4FW9A 2W0SA 2GK6A 2YJTD 3KJHA 4JLPA 1D5CA 5JS7A 1CXZA 4B33A 1ZIPA 1XEXA 4KSCA 3RDPA 1G8GA 4FMCF 5TARA 1NLFA 4V0ME 4TMTA 1SVIA 2R9VA 4NU0A 4B47A 3WHKA 1YVDA 2HCJB 5EXSA 2NTYC 1MO5A 1N6KA 1YJ5A 3R9WA 3LNCA 1XCGB 2EFDB 1IN7A 3TSZA 1GFIA 5JSZA 4JVNA 2VSXA 1OHHD 1X8JA 5SZHB 1A5TA 1LF0A 2PMKA 4KVAA 3GFTA 3PG5A 3ZGXA 4O3MA 1JNYA 1Z5ZA 3PFIA 4I99A 3BRWD 5F9HA 1XDBA 4DSNA 2BMJA 3RS5A 4ZI3A 3PUVA 2XSZA 3LH5A 1OFUX 4UJ5A 3KKMA 1SVWA 2AL7A 3U2QA 5J47A 1A82A 4HAZA 3NHBA 5IDVA 2YWGA 3J81k 2ZSBA 3UG7A 3LAWA 1J7KA 5FFMA 2VA8A 4FINA 3QSYA 5JMTA 2RGGA 3TUIC 5BQ5A 1N6OA 1P62B 2OM2A 1OFHA 2ZJOA 3AP3A 3ND8A 1OH8A 2JLWA 2O8EB 4P4SB 3I1FA 5BN3A 1UF9A 2ZI4A 3PEVA 2IX3A 5BYJA 4QOSA 5JZVA 1XMVA 2Z43A 2VL7A 3R8FA 2BCJQ 2DYKA 1FUUA 3BWDD 4DLUA 2JDID 4ESVA 3MAAC 3KJEA 4U5XA 1PLKA 2CVHA 2PZGA 1HT2E 3OEEA 1XMSA 4GP6A 2D7CA 4HZUB 3WMGA 4OHYA 2CHQA 3GJ4A 4D0GA 4IOMA 5LPNA 4Q7LA 4NHOA 3VR5A 5DO9A 4M22A 3I5YA 4EPXA 4EUNA 4TLEA 2B7CA 4XWOA 1GWNA 1RZ3A 2ZRFA 1GM5A 4BECA 1NIJA 4EFLA 1G6HA 3CIOA 3KDSE 3QUSA 3UANA 2J0UA 1KK1A 2QGNA 1S0UA 2VEDA 3AKCA 5DN6A 4WIAA 5JRZA 5K8IA 2NMVA 1TQ4A 1ZIOA 1J70A 1XTRA 1JECA 1G20E 1Z22A 3D7MA 4PC7A 2J45A 1II9A 4PO8A 1QHGA 1E2GA 1SGWA 1UJ2A 4WXRA 1LW7A 4DSOA 1R0XA 4S35A 3NH6A 1XPRA 2A7QA 3EAQA 3K9LA 2F55A 2QT0A 5H70A 4V02A 1GVNB 3UWOA 4EAQA 3QXSA 2PJRA 1VPLA 3RLFA 4I4LA 3I4LA 1J8YF 3CKLA 1KO8A 2ASEA 3BB3A 4XSGA 3W3ZB 4K8OA 3KTAB 1W49A 4AG5A 1ZYUA 4D26A 2W0MA 2DFTA 3RNLA 5EE3A 1NF3A 1NKSA 1P72A 2BCGY 3K0CA 3KKOA 4JLAA 2ZI7A 4HDCA 4LHXA 4YMVA 2G0NA 3M6AA 2BBTA 4GNKA 1GRNA 4Q66C 4LRWA 3UK6A 2FJUA 4AD8A 1ZUIA 3MWYW 1G8PA 2OCAA 4DCTA 4D4MA 5KDDA 5TB5A 1KMHB 3RRYA 1LS6A 1IY1A 3TSOA 1SKYB 2ZIAA 1TUIA 3MG9A 3GJ8A 1NN3A 2DHRA 4DEYA 1FUKA 1E2FA 3THOA 2JLSA 1P2UA 4CEJB 1S1MA 1KI2A 3QI2A 4ERNA 3A37A 1MRNA 3CF2A 5AUQA 4E03A 1OH5A 1VMAA 1Z2CA 2PL3A 4NCIA 3SE0A 4AC9A 1BO6A 1JPJA 4MRRA 2V55B 2AR7A 3U44B 3HYTA 3B5JA 4ZO4A 1ZNXA 3AQ4A 5H68A 2JLZA 4R71A 4C0SA 4PQFA 3BK7A 1N6IA 1E99A 1X1SA 1XTQA 3LD9A 3KQHA 4TL6A 4B3GA 1SKYE 1E2PA 3L82B 4PHHA 1DPFA 2R6CA 2X2FA 4CW7A 1ZW6A 4C3ZA 2BMDA 1MH1A 4Q48A 1QRAA 5FL7A 2EFHB 2RGNC 4TQUS 3EASA 3P26A 4LGMA 5D3MB 4EPVA 2QGZA 2I4IA 5F2EA 5FBWB 1KGDA 2EU8A 4DB2A 4E22A 5CDFE 1CJMA 5BN4A 2ORIA 1Y3AA 2O8FB 4QJ3A 3OF5A 1SXJA 4G1UC 2RAPA 1IM2A 1R5NA 3TQCA 1ZRHA 3I8SA 4M1KA 4RCYA 5CIWA 3TRFA 4MDFA 3OIWA 2C03A 3WYGA 2Q9CA 3NC0C 1FQKA 4Z1MD 3P20A 1MABA 3KX2A 2V7QA 3DO6A 3PENA 1DAGA 4AK9A 4WA7A 5C2JB 1K5DA 1S3SA 3LWNA 5DN6D 4FMBB 3WBJA 2CNWA 4CF7A 1EFUA 5HCNA 3GLGE 5CLQA 2CLCX 2NO0A 3KKQA 3T12A 3VKHA 2BJWA 1WB9A 5L3SB 1IBRA 1GNQA 4V0MA 4XVUA 5EZ6B 2NZ8A 2MSCB 1NBME 1Q57A 2X19A 3JVVA 1A4RA 5EXPA 3OEED 1II8A 3FHCB 3GEEA 2WAXA 2FV8A
chains in the Genus database with same CATH superfamily
2REBA 2BBWA 2EV9A 4XVHA 3VZQA 5BXYA 1G6OA 2FWBA 3R77A 2JFQA 5CDFA 4KO2S 4URZR 4W5JA 3UY4A 4TYWA 4A23A 2IBMA 4ZA2A 2FFHA 3LQRA 4H1HA 4UJ3A 2LCQA 5KINB 2GN4A 3LT1A 1Q6YA 3F98A 3O1LA 3Q3IA 3IT0A 1YE8A 3DDCA 3H2JA 4F2HA 4B3SB 3TQRA 4JS0A 4QTUB 4RAQA 3L4SO 3PNKA 1K6EA 2CL5A 2P40A 4RULA 1Z5WA 1UCFA 1HSZA 2GF9A 1XWFA 5JLAA 5DBGA 5AW5A 2AW5A 3ZUGA 3VZRA 3HGMA 3H1EA 3QXGA 3FNFA 1M8GA 1A50B 5CB4A 4TSKA 1X94A 4QD3A 4BX9A 1G0NA 5IZCA 1LXCA 2CUKA 1CVIA 1F0NA 1GJRA 4MYUA 2D5BA 1VIMA 1XZLA 2XTNA 2II6A 3ZKAA 8GPBA 2P65A 3KQQA 1LLDA 4DILA 4L9AA 4X66B 1WB5A 1H5QA 1Y3BE 2EL7A 3D6JA 1YB7A 3A1FA 1TECE 4DR3B 1Z56C 2WJGA 1E3SA 4WZAA 2MSLA 1IM5A 1JYEA 2NVOA 1ZLXA 2C2BA 2ZUWA 3SEAA 1BMDA 2FP4A 4RY8A 4L75A 2WM3A 3DDUA 3KPUA 1TUGA 3NH9A 3TNJA 3R9XB 4HLQB 2HIMA 1AHIA 2D2FA 2IYTA 1FX0A 2JLAA 1O97D 2Q9UA 2QN9A 5KYVA 4WCFA 4AMZA 4I66A 1KMIY 2BM1A 1LPSA 4J0HA 4G23A 2J32A 2WJZB 3QBJA 3C0KA 1WTCA 3QVTA 4MYSA 4PAGA 1RI4A 1KVUA 1LWNA 3F7OA 3O73A 5B37A 4IKPA 4V0QA 5AXAA 4NAUA 3BL5A 1RRFA 1RZVA 3WADA 1E4YA 2ZJBA 2HMYB 1WVIA 1XXHB 1IZYA 1PU2A 1TMOA 1ZW1A 3N86A 1Z8DA 4QLOA 4RHTA 4YJHA 1IWBB 1ZH6A 1IQUA 3BXZA 3FCAA 3FVWA 4Z4EA 1WR8A 2D5CA 3EBLA 3ZXUB 3RT9A 1UXKA 2C58A 4FHCA 2X0DA 3TBHA 1J0CA 1U1CA 2OUKA 4IINA 2COEA 3TOSA 4MB6A 3JWHA 5L3RA 4QOIA 4C4YA 1E79A 2ZIUB 4GT1A 3CX4A 1XEWY 3WWEA 1QB7A 5IC5A 5LA6A 3KHKA 1NATA 3HPRA 5BR7A 4EJ2A 5CPFA 1UJNA 4TV8B 3E1SA 3M0EA 2HSWA 3CRRA 3V8PA 1P7YA 4IHQA 3A9VA 5AH0A 3VVLA 3MSXA 5CVEA 4GLBA 2ZJFA 5JUWA 1QB8A 3HMKA 1E1QA 2Z08A 4KK3A 5ALYA 2XB4A 2BFOA 3VJRA 3MFYA 1XZHA 2CSUA 2FFRA 3SM3A 4RMNA 4EECA 3KQLA 2IT1A 2Q2OA 3VJKA 4BVJA 4TOIA 4W7SA 1PJRA 2ZGVA 1IHPA 3IQHX 3P27A 3TTSA 1ZIDA 2O8NA 4WNYA 1D0VA 3ONFA 1MAUA 2BKXA 2DTDA 4R2MA 5BV1A 5I8WA 1K68A 1ZJJA 3HZOA 2Z3ZA 3HFSA 3SBOA 1DS6A 3LUBA 3WNZA 3PCRB 1VLJA 1FSPA 3DBLB 1CRPA 4JOCA 2UUCB 3ZHXA 4HR7A 1ZX1A 2Y05A 4EF4A 2WD7A 1XCPA 3G8DA 3CC8A 2C7RA 1B8UA 4IGIA 1T5SA 2TMYA 5FQNA 1E6MA 1AUXA 1V3QE 3EBPA 4JP1A 2GPNA 1R18A 1AK1A 3THRA 4PG6A 4XA8A 1JPNA 3EUFA 4M8LA 3PX2A 3FSGD 4J2TA 4HAWA 1XGKA 1P2FA 4B75A 1EESA 3KBOA 1BCRB 5FKJA 3R8CA 1B43A 3ETNA 5BV0A 4DSTA 3T0FA 1YJAA 1RYMA 2EJTA 2HT6A 3W5UA 2X8JB 3W9YA 3CA8A 3D8SA 4H3HB 4O59O 1JF8A 1YDMA 3VR4H 1UKEA 4E5VA 2ZSHA 2Q3BA 4WZBE 3OT4A 4O4IF 1D0SA 1Q3TA 3BK2A 1JR3A 5AHRA 5FR2A 1WMEA 1UH5A 4Q3EA 2GM4A 2WAOA 4DKJA 5DYNA 5E2AA 1XNRB 3RU9A 1OYOA 1I4EB 1N5LA 3FFTA 1CZOA 3N76A 1W73A 2FOXA 3GROA 4D82A 5KNDA 2JL1A 3WLQA 3P2OA 1ZMOA 3GDWA 3PXUA 3TNDA 2AZTA 3GJ3A 3EA4A 3TQFA 4QXPA 1EFCA 1SN7A 3VPFA 2JNWA 5BW8A 3I5UA 2XYRA 3GZTB 1K0UA 3L7JA 4L6IA 2H2GA 4L7VA 3K09C 2QLBA 4ROTA 5CNKA 4DZTA 3X2FA 3KD3A 4M0UA 1DKNA 4AY6A 4Z2AA 3PYXA 2HV9A 4CGYA 2VDPB 5IASA 3PTAA 2I9PA 2R1TB 2ZTLA 4OQ4A 1R4AA 1YK0A 3FAKA 4YRRA 3KHTA 1VHDA 4ZK2A 2C2ZA 1QGUA 2KB0A 5BR1A 1W76A 3L92A 3FNGA 1E0KA 3MGCA 3GRZA 3SZMA 4LF6B 4EYSA 1E3DA 2WKWA 4LYAA 3CX8A 4I1SA 4EG7A 4PEVA 5KOYA 4C7OB 4L9SA 3BMCA 1ZOSA 4KK4A 2PMCA 1D2AA 2O6HA 3IC5A 5IZ4A 3W77A 5FAKA 2CSXA 2QRZA 4D0RA 1G9XA 3LTNC 2V7VA 2AG1A 3L0ZA 4O4IA 4CKEB 1EFRD 3FPLA 5AICA 2WWVD 2ZSEA 4Q18A 2OO7A 1OXSC 3OZVA 3NHWA 4LQCA 1ML4A 1FDIA 2Q5IA 1K6IA 3CZMA 4K5QA 5AM5A 2FI1A 3UUFA 3DTNA 1RXWA 2R5NA 2NYAA 1PFQA 2D2VA 2RGUA 3ZBPA 1AZTA 3OU6A 1A9XB 3OZFA 4RM3A 4B81A 2NU6A 1L1QA 1HFEL 1SHKA 1IHOA 4U02A 4Z4HA 4NU5A 2IHNA 13PKA 4EBFA 4AZ0A 1QVWA 3NHZA 1H23A 2CZCA 3Q3JB 5EIXA 1F6WA 3GLUA 4L2IA 2NN3C 3R75A 2OP0A 4I1YA 3WQQA 3SG0A 1Y98A 3DCJA 4IS2A 1KEKA 2HJSA 4OU4A 2AN4A 4DBVO 4G07A 1IDOA 2INGX 1XFDA 3EZ9A 4PRKA 2ZITA 1ULHA 3TVYA 2PWBA 1OWMA 5I9NA 3DLHA 2X3UA 1JEYA 4HATA 1IVYA 4RDHA 4DV4B 1NE7A 4OAOA 1L4GA 4CG1A 3UMMA 1AKRA 2OCBA 4Q3KA 1H66A 1Q74A 2O9JA 3ZQUA 1S3IA 1Z12A 5LL6P 2O2GA 3M1AA 1H8EA 4AO8A 9ATCA 4KQFA 1QYIA 5KTTA 1EFTA 4FFBB 3QLUC 1E64A 1X7DA 4EFKA 1C9YA 4MQFA 3G9XA 2VTBB 5I7SA 2CV2A 1T8YA 3SQLA 1DNPA 3H7AA 1DG3A 3OZXA 1QRSA 1SQ5A 2CYCA 5THQA 1ZITA 4TTQA 4YCDA 5M04A 4UCXA 4RMGA 1PS8A 4TZ6A 3AFOA 1U3UA 1CS0A 1AXEA 2QTBA 3MINB 5CXSA 1AGXA 2GPSA 5HOQA 4HBGA 4MV3A 2DX7A 3OT1A 2O0MA 1XU4A 3WGZA 1E2HA 4DJFC 1G3RA 3O74A 1PFGA 4Q16A 1J6UA 1IIRA 3U26A 4BKRA 3ONWA 3IURA 1T0IA 1AKNA 3FSEA 1DAFA 3DKVA 1ZKDA 3IALA 5FUMA 4XYEA 3QKRB 4ZV9A 2IE8A 2AC7A 4YUXA 5BMOA 3OZ7A 1RRGA 3DMTA 4W4TA 3THYB 4ECAA 1IK6A 2VRBA 1QWSA 4OXQA 2JJQA 1S8OA 2BGTA 1WY5A 1OH7A 2GZDA 1N7JA 2H5JA 1XK6A 2EAUA 2WTAA 1B41A 3IIIA 5FYDA 2QBYA 1W6RA 1XLTA 4OO3A 3E8XA 1D6JA 2YV1A 3GFPA 4C03A 1CY8A 4YRCA 2X8LA 3N8IA 3G68A 2H06A 3MQ4A 2CDNA 3HI6A 4FFMA 3P2EA 4X41A 4YACA 1ZUHA 2I03A 4RHYA 4DA8A 4E4YA 3LY7A 4JZKA 2Q6OA 5K0FA 4RF2A 1A7UA 4R9NA 4FD3A 2OZPA 2E55A 4AG6A 5JJIA 2QM3A 4ZP1A 1Y34E 4XTRA 2J7PD 3UWDA 2HRQA 2IZ1A 1F5NA 4KFUA 3BCUA 3QWHA 2BEVA 4M2LA 3ZY6A 4A2CA 4YWJA 5L3QA 2XT0A 3GFBA 1FP7A 2YFKA 1P7CA 3BWYA 5DGDA 5DV9A 4ENVA 1T9CA 3K0HA 4AY3A 2P9TA 4UFOA 1TK3A 2HH9A 1GSIA 5EFZA 2G80A 1D9ZA 4US0R 1E2EA 3CEMA 3WLJA 2AFIA 3CN7A 3KJGA 3VDNB 4B82A 5CCEA 4DUZB 1WW8A 5IT0A 3ABZA 1H2YA 3EWIA 2KMLA 1IC6A 5LMUB 3RK4A 1HTBA 1OMOA 1ZZEA 4L4UA 4Y6GB 1KJYA 2ZT8A 1B16A 4FYMA 3QPCA 3NV7A 4EA7A 2J9RA 2W6IA 3EH2A 4Z7QB 1SWVA 2J0QA 4R31A 2ZRHA 4BEBA 5AM3A 3KZCA 3GBPA 2QB5A 3CUUA 3HG7A 1FQOA 4ZT7A 2OMKA 4Q1VA 3W4KA 2J48A 4HS9A 4TVBA 1GCGA 4KRFA 5DYTA 3OHPA 3IODA 3OETA 5K3EA 3ESAA 2H3EA 1JHUA 3FROA 3PGJA 4JJ7A 3ZH2A 5JPDA 1YE3A 3IDZA 3MEQA 4UXHA 3V8RA 4KXMA 3QY0A 4YP6A 1GRQA 4L22A 4DIKA 5FLKA 1J21A 1RACA 3F5DA 1O54A 3MWFA 4RV9A 5A5VA 1FJ2A 3HB0A 2CEAA 2JIZD 4L4XA 2YWBA 4UM9B 3GNSA 4EUSA 3FA2A 1SVKA 5JXHA 2JASA 2VHXA 4YJGB 1Y3HA 1UP4A 1WV0A 4CVNA 1CBUA 1E98A 1QDUA 1UFKA 1XK7A 2NO1A 3ED1A 1RXYA 4YRZA 5A02A 3R6LA 2PKQO 3LSYA 3F1KA 3EY4A 1H69A 1UEJA 3RYHA 3UAWA 5EWLA 4UDNA 1AOXA 3JATB 2GGSA 3FOBA 1LJLA 4UFPA 3AFNA 2BDEA 5AM4A 2FEAA 1E3TA 2DJ5A 1R4NB 2ZBGA 1Y48E 3OEHA 4XQGA 1Z37A 3HVIA 3KVYA 4P4SA 3V8VA 1ZU4A 2WUVA 2GTHA 1U6JA 2BGMA 1EA7A 4RIFA 3TFOA 1L7AA 2TS1A 4UUQA 1LJUA 1VPTA 4F0JA 3PJRA 1GQSA 1JJIA 1CIPA 1M8KA 2HMUA 3A1EA 3EXFA 5JCPA 1QCYA 2BEUB 4GVXA 2E37A 1Q19A 5C5CA 3UMVA 4CDMA 1D1PA 1UFRA 1ZD5A 4G1CA 4NCXA 3RIGA 3TMKA 5TJ9A 2P2SA 4TKVB 2L17A 4F11A 2O52A 4R69A 3U44A 2BH9A 3BKWA 1JFFA 1L1RA 1NIPA 4W1SA 2BUCA 1E3LA 3LC0A 3NBQA 4D1YA 4JSRA 4X0EA 1J2JA 4MDEA 2XGMA 2B2XA 4NK5A 1W4RA 2BM9A 1XN1A 2FMUA 1T3TA 1Y8RA 1DP4A 3ILVA 4WV3A 3WYNA 4KXLA 1IB6A 9ABPA 2HMVA 2VATA 1OGYA 1BDBA 3FUUA 5BV7A 3MT8A 3FTDA 4V1CI 1ZH4A 3AVOA 2FDCA 4OVKA 1X7HA 3FKSA 2C5GA 3WLNA 2IHBA 3DEAA 4JL6A 1BS2A 3KS9A 3L1VA 1GZVA 3D0OA 2W6MA 1AGYA 4BV3A 2AR0A 4DNFA 2HR1A 3EJ6A 4O4HA 3CEJA 3L1HA 4Z86A 3SYMA 2UYCA 5LZ2A 5AKHA 1EFHA 1II8B 4NPHA 4HOYA 1C14A 2FEXA 2YN2A 3FCYA 4FXOA 4RHFA 4JQZA 5LIPA 3AVUA 1V47A 4WKBA 4BWYA 3HYCA 2JLBA 3GNQA 1MA3A 1ZUWA 4YHBA 3V4VB 1UDWA 2RGAA 3CZ9A 1HH4A 3D8TA 4PG4A 1X42A 2PWPA 4Y9SA 5P21A 4IEEA 1YVPA 4KWTA 4B3TB 1RWXA 1TF7A 2AXPA 4UTXA 9MHTA 3CVWA 2ERXA 4YAWA 2CY0A 2B1JA 4AB1A 2GPAA 4HNRA 5KAMA 3W0LB 1ZCFA 1BVRA 2RHLA 4UHKA 4BO2A 1VBFA 2CHFA 3Q7QA 1Q1QA 1T91A 3DOEA 3V7UA 3QEAZ 3HDYA 3K16A 3GPBA 3A4NA 4O8ZA 3IMGA 4G2TA 4EVQA 5DW3A 3IR7A 3AKYA 5E9WA 4YMHA 5EIEA 5LP1A 2BGUA 4GR5A 3DV9A 1CFZA 3B38A 3CO5A 1AKYA 3SR0A 1DEXA 1BEZA 2GWRA 2YNMD 3F3YA 4RANA 2BHLA 2RGRA 3VR2A 1LB1B 5I9TA 3GZ4A 3H19A 5FWYA 1WUYA 5DNAA 2GH1A 1NRWA 3V4SA 2QEQA 2E21A 4P2GA 1G8JA 4GOXA 4BZPA 4YFYA 1IY8A 2EC5A 5I7AA 2O6LA 3HP4A 2E4UA 4OXIA 2A1IA 2SNIE 3R3JA 2J33A 1LLCA 4Q9LA 5EJ9A 2O2EA 3S0JA 1M6NA 3BMCB 4I19A 2ZJ8A 1BKSB 4YO8A 3EF0A 3QP9A 4ICIA 3B53X 4MHOA 1FTSA 1GTVA 3WQRA 1O9HA 3BMQA 5AI6A 4DIMA 1T8TA 2OGSA 2IIPA 2VFAA 5IM4A 5DVZA 4RYDA 4FNGA 3U4AA 3WRXA 4C0WA 2Z3WA 5DM0A 2PJZA 5EJAA 5AO9A 3SJCA 2JLVA 2A86A 3WMRA 3NUQA 2OYRA 1YTUA 1T5DX 3FR7A 1T5IA 5D3MA 2ZIXB 1JDZA 2WPNA 2BTOA 2X5JO 3QNUA 1MZVA 3H1TA 2CNDA 5LP6B 3NM6B 4CLXA 4D9FA 1RBZA 2A30A 4MUKA 3GLIE 3OG9A 4BO5A 5SY6A 2XKBA 3H99A 5EGSA 4E0BA 5A9RA 3WWCA 3ECCA 3KPYA 1CUJA 3C85A 1OAKA 3HU2A 2ZPAA 1THTA 3PFCA 1FPQA 3T52A 5DSXA 3J81A 4IV0A 4V1CB 4MW1A 3QXHA 1XNJA 1M1XB 3T5GA 3UBMA 4DCSA 4QFMA 4F4DA 1WHSA 1QFSA 5IN4A 1QLHA 3O8OA 2JD2A 3QVKA 4P0QB 2WT8A 4WY5A 1HE2A 1ZM7A 3A11A 4OKNA 4REMA 4OIFA 4D9MA 4CIAA 3U61B 1T6BY 3KYBA 3RC3A 4BLUA 5DZSA 5KNBH 1EVLA 4KPUA 1UPFA 3C6BA 4D8VA 2YXPX 1AV7A 3DHYA 1AY0A 1TVEA 1PJ3A 2CXOA 1B73A 2HHJA 2H0RA 1OLOA 3COZA 3GLTA 2I2FA 1U81A 2OBYA 3K0FA 5EPEA 2PUEA 2QRNA 1XKQA 1TO6A 5IP5A 1XP5A 3RYCB 4ZEOA 4Q0MA 3BAZA 2O0JA 4B2PA 5JV5A 4P4TA 4I9GA 4TSFD 2J9ZB 3MMPA 1JW9B 2B8NA 4ILKA 4NBVA 2B99A 4OU5A 1K06A 1GRVA 1WCYA 2DPYA 1A4IA 1OZ0A 2Z57A 2WKSA 4EBBA 2AN3A 3ZCQA 3PEWA 1DDGA 2QAJA 3UT6A 2NVUB 3GT0A 4MVJD 1MO3A 1R9NA 1L8LA 1XRMA 2ISQA 1N3IA 1TRHA 4JJFA 1JYSA 5JYEA 2JIDA 5EJ4A 2FG5A 2XDQB 2ZBPA 3MVEA 3P9QA 1EDEA 5K20A 4TTSA 5F7ZA 5U1PA 3HP7A 4EO4A 2J0VA 2NQ8A 4BX8A 5J1SB 3DOUA 4HEA1 2GTIA 3ANNA 2CNLA 2FW0A 2F8MA 3N07A 3PJGA 4PFSA 1IHXA 5IN5A 1VG8A 5ALVA 5B36A 1C81A 1XJQA 1HNNA 3I8OA 4F46A 1FLVA 4X54A 4Q4DA 3RABA 4X97A 2PGLA 2GUWA 2QX8A 4ZCRA 1NFFA 4IO1A 4BC0A 3IO3A 3WLMA 1IN1A 5F7OA 1QTQA 3L7BA 3L8CA 4J4HA 3U4HA 1IZ8A 2UUPA 4GR9A 1D6MA 3EMDA 1KAEA 4M55A 1CZKA 5EHIA 4MW6A 4Y1GA 4XUGB 5JJKA 3CUYA 4N5LA 3MMNA 1GNRA 1QFMA 3WDSA 3RVLA 1CUUA 4RNCA 3V97A 4NG4A 4WN3A 4DIOA 5FWXB 1EA5A 2OV8A 3OKFA 1KP3A 2O50A 2YL2A 2DTEA 2VCEA 4JB0A 3N8NA 4M6WA 2XGJA 2BKUA 3IPLA 1EZZA 3VSAA 2DUWA 2BL4A 1Q7GA 3O8OB 4JP8A 5FUYA 4C6RA 5JATA 5GJBA 4JUDX 2PRYA 3JSAA 3OICA 3TG8A 3ZU3A 1RRCA 3TN7A 1NBOA 4AECA 3DLTA 5CNIA 3T7TA 4BNVA 2HMTA 4TGLA 4TROA 3L0OA 4MAAA 3SZOA 1X7XB 3AY6A 4TXJA 1UXHA 1KQPA 3AJEA 1BHJA 2L18A 3O9VA 4UBNA 3URKA 3V8NA 2FWNA 3T1TA 2PYIA 3WGNA 3CSUA 4W5OA 4NXMB 4B31A 3ZYCA 1OXTA 1OWPA 2DH5A 4FGKA 4X8OA 3TIXB 1OSNA 1ZPDA 3PP8A 3AVQA 5CXXA 4XD7A 4OHBA 1MAAA 4J7UA 3IMCA 3FGPA 1ZGHA 4XZ3A 1ZJ6A 2K87A 2MHCA 1JU3A 4TWZA 1KH3A 4JLSA 5ENDA 4NXNB 4HGZA 4WCVA 4MEAA 4Q4JA 1N9KA 1YFZA 3DE1X 3R3SA 4FR2A 4HXFB 4J0IA 4X90A 4ZVKA 3SC3A 4I4TF 1HQYE 4BKOA 2P9FA 1OGJA 1SCAA 2JPDA 5CB8A 4HNGA 3DZCA 5ULLA 1VYHA 2GZ2A 3N8HA 4YN3A 2MDTA 4NONA 1HT1E 1OE0A 1P0CA 1F4VA 2KYRA 4HNVA 2NO6A 3BDIA 2EEPA 1A4XA 5C4IA 2NZVG 1ZBQA 4QU8A 2FN4A 3IOYA 5LVAA 2RHOA 3L49A 2B94A 1I14A 3ICOA 4XAQA 5CM9C 4BO7A 2EWVA 3T3HA 2XX3A 2RSLA 3SY8A 4RAOA 3WI7A 2JGFA 3QM1A 4W82A 4YJKA 4EY7A 1XRJA 1DIOB 4JFAA 3PC7A 4FMPA 4HWGA 1OR8A 3K70C 3TZEA 2HF8A 5BT8A 5DEOA 1AQ6A 1U7OA 3UKOA 2Q6TA 2J9FB 3EZXA 4H6XA 1ESMA 2A7XA 2WNSA 3OQ1A 3PXEA 3WV4A 3KFXA 4KNYA 2EZTA 2QV7A 4IPTA 2QRLA 1RWBA 3HR8A 1DRKA 2X2EA 4IGEA 4DWJA 4PRYA 2A58A 1VIYA 3NUGA 1M6HA 4K3UA 4G1MB 4JNCA 4F86A 3H9BA 1KJ9A 2BVNA 4FFVA 1PD0A 4NH0A 1GLNA 3KYDA 2XYQA 4F3KA 1MDBA 3ASUA 1PRYA 1SUWA 1DSSG 4FHDA 5NULA 2JRLA 5TVKA 4BLWA 3KUCA 1MO4A 3I9LA 4LCJA 4U1RA 4NESA 1C7IA 1SKQA 3M3DA 3ZUPA 4KR6A 4J9UE 5HFNA 3ZJUA 1C4KA 1TQDA 2Z8XA 1GL9B 1FP4B 2ZJ3A 2XMRA 5GOZA 5B2ZA 2PO5A 2SKCA 1AK9A 2JHGA 2LD4A 2Q5EA 2A9KA 5E7JA 1VE9A 4CTOA 1RI1A 2BZSA 4IOKA 2NV6A 1WETA 4WK2B 4OI4A 3AI3A 1A2OA 4RH1A 4DLYA 3I62A 1EFLA 3KKEA 4DCJA 5D85A 1PYDA 2Q5FA 1GGNA 1O96B 2WWGA 4LJ9A 2B2CA 3TTXA 2Q5QA 3O3MB 4MP6A 2V6MA 5D87A 4UBMA 1NJ5A 1P75A 4BRSA 3BFPA 4F2GA 1NPYA 3U7GA 2WUGA 3LQ2A 1LI5A 2OO3A 2V3WA 5BNWA 3QSGA 3R0IA 2CKDA 1RBQA 2ZTMA 2OQVA 4C2TA 2ZVPX 1VI2A 3TL6A 5LOVB 3D6TB 1ZGZA 4PO3X 2CV0A 2IYRA 3RANA 4DMMA 4TM8A 2H4JA 2JVKA 3LM8A 4KLNA 3IOBA 1E1YA 4ZXPA 2DFDA 2BYTA 1KO1A 2G1UA 1UWCA 2WT4A 3AR2A 2QTWB 2CV1A 4O4LA 3Q15C 1YRAA 3LXXA 1WB6A 2I4MA 3AM5A 2OXRA 2XI4A 3HYNA 2QVCA 3PFWO 1GGKA 4K6FA 4YDRA 1CRZA 1SVOA 3K1ZA 3PDWA 3LU1A 2ROQA 1J8MF 1EXMA 3U7IA 4FZVA 3JQGB 2IZ0A 3AVPA 4E09A 3F6BX 4D80A 1XQWA 1JMVA 2AEMA 3W7VA 3SF8B 1Z7YA 3HFGA 2I8LA 2XB9A 2GJ9A 5D7NA 1GPMA 1I4OA 4HAOA 5T4HA 3VJLA 3AKEA 1TTTA 3ROPA 3PEFA 1MX9A 1WU7A 1ZNWA 2HLDD 4HWRA 4M54A 4QOJA 5TV2A 4CI9A 3TJRA 3T1HB 4YDHB 2E89A 3LOUA 1WF3A 1AN9A 3FCCA 4N5HX 4DE5A 3OM9A 3WBBA 1Q1GA 1SQSA 1EGHA 3EA5A 3JS5A 3PHIA 4WXMA 1BX1A 1CB7A 1GL7A 2NU7B 4H77A 1NX6A 2WF5A 2PRIA 1HDZA 3PUXA 1KNQA 4C05A 5ERXA 4H15A 2F3PA 2G25A 2PWAA 2RB4A 3EWNA 3JAKA 4GL4A 4INJA 1VMIA 1W85A 4TV8F 1RBMA 1JLKA 3NHAA 4WVLA 1JHYA 1N2CA 3EDQA 1U2ZA 1TX4B 4ZRMA 5D51S 1IBCA 1LX7A 5SZKB 2X2PA 1RLTA 1T0PA 4M0LA 3MWDB 1V4NA 4C21A 2R6JA 1O3YA 1WXEA 1QHHA 4K2AA 2JAHA 1WM1A 1HPLA 2G0AA 5AKZA 4QJ5A 4KQCA 2BGWA 1DC5A 3QMMA 3VU0A 5EXTA 2H18A 3P9XA 3QPWA 1Y5NA 1GA1A 4FILA 3N8DA 2G08A 4JHLA 1ABBA 1SUEA 1T29A 1NQOA 1PK9A 3GD5A 2PUVA 2HF9A 6Q21A 3HBAA 1Y1KE 2E85A 1N5RA 1QX3A 3EVEA 3QEJA 2D1FA 4H1UA 2ONJA 4J3NA 3WMFA 3JZAA 2HJGA 2I34A 1FXWF 1Z6PA 4JH0A 3ZV5A 4X6UA 3THXB 4EUEA 1E0AA 4HNAA 4MUBA 3VMMA 3MIZA 2CNBA 5IEBA 4JDPA 2GVNA 2VJYA 5DULA 1QF7A 1YR1A 1G20A 4HRAA 2V0CA 3HXPA 5TDHA 4LV6A 4FOSA 1AQIA 1PNOA 3FNIA 1WAMA 3NC4A 4P83A 3RS2A 1EUYA 5IWCA 3B60A 3DFUA 3NDRA 4Y1FA 5I47A 3IVGA 4WVFA 1DX9A 3RFCA 3ECSA 2XV1A 3A9WA 2QR2A 2JFWA 2CMHA 1ZM9A 2V7QD 1N7IA 2H7VA 3NAGA 4IEFB 2Q5OA 2MINB 2YJGA 5DGHA 1YU6A 3U3RA 2C2WA 2Z1DA 3DAYA 4DRXA 4RLQA 1WP4A 4LHZA 1XDWA 3Q7TA 4GYJA 2IHTA 4DRXB 4DMFA 1TPYA 1UC4B 2JI7A 2P5YA 4WESB 1Q0ZA 2C5AA 5FUQA 1YR2A 2P2ZA 1DADA 4EYEA 5ERGB 3EH1A 4JODA 4DDVA 4QULA 3IXLA 2YUIA 1JVBA 4ZCTA 2A33A 1NOKA 2BFBA 4LQLA 2WWYA 3PFFA 3H6KA 1G0OA 4I7EA 4EDHA 1Y8ZA 2HYIC 5JJCA 2NT3A 3SFVA 4F9GA 2NV2B 4C7OA 3O9ZA 4IDHA 4RHCA 4PM4A 2FPIA 4NDNE 2L0XA 1OIXA 1P0IA 4JSTA 1W75A 5JRDS 3RBVA 3KXPA 3AHDA 1FFYA 1E2KA 2GBGA 3B9PA 5KX5B 2I54A 2H2WA 2W2LA 3F6PA 4LZZA 4L78A 3WSTA 1N9GA 3M9XA 2BFFB 2WU8A 4BLRA 3NJRA 2AWOA 4QECA 2BRUA 2IUYA 2WJHA 3RVMA 3PCXA 1A0OA 1OWNA 2CEKA 3BE4A 5FV7A 1GT6A 4C9BA 4FM9A 1L5GB 1GARA 5IAAA 1CRWG 2AA3A 3QTBA 5AW0A 3DFFA 2O2SA 3G2HA 1LS1A 3INNA 3DVRX 4FFBA 2PNJA 4RXTA 4JNKA 4JV5B 4B3XA 1PI3A 2RK6A 2Q7OE 3EZ7A 3PGKA 4KQ6A 5ALHA 3SK0A 1U5CA 3HPQA 3LT0A 4AP6A 3P9NA 2VNIA 4KCGA 3ZXXA 2B78A 2WDZA 1RZRD 2B7LA 5EP3A 3WGKA 2V0GA 1I32A 3O2NA 1TAHA 5CLIA 1BYUA 1UK8A 1Z6YA 3X1XA 1P1CA 2FUG6 3EZLA 4N9WA 2OCYC 2UAGA 4WCFC 3X2SA 4F92B 1HNZB 2HLPA 3FB1A 4OJNA 3WZ2A 3RHSA 3ZZTA 2JFZA 2PRZA 2VDLB 1WSDA 3HACA 1MOQA 3H9GA 3MA0A 4NZZA 4DIEA 3S44A 3KZ1E 2LDXA 5CHYA 4PZDA 3WE7A 3AW8A 3AHEA 3Q72A 4JD5A 3X1JA 1BEEA 2CF6A 1ZGJA 5HIKA 3EYAA 5JXIA 1LQ2A 3LUKA 3GJ5A 4JKIA 3HY6A 2G6BA 3H16A 3KSMA 3LGXA 1FFBA 2YV3A 4EL0A 2HIAA 2QMOA 3R7SA 3AVXA 2FSSA 4G5FA 3KYJB 1JIQA 4H31A 1KDVA 1D6SA 2N0SA 1HZJA 2CE2X 4NYMR 1QH9A 4EY3A 1GN9A 2R2AA 4X6LA 1EAMA 3ZE2B 5A06A 4EY6A 4S0ZA 1OAOA 4WX2B 1TEZA 4LXGA 1XU7A 4GMGA 1EIWA 4K46A 3EIQA 2ZI9A 4Q21A 1FNMA 4EG4A 1A9SA 2HO4A 1UKYA 4Z4GA 3VYSB 1GPKA 3CF4G 1C8VB 2JGLA 2PX2A 1WV1A 3IQEA 4BRUA 1VE7A 2IPLA 3NWEA 2ZLBA 3QKWA 3QELB 3JQ8A 4EGFA 3L79A 4TUYF 3DZKA 2B4KA 2R7NA 2X6RA 1TADA 3QVOA 5EKDA 2Q07A 2BP7B 2QI9F 1KQOA 1RLMA 3QLEA 3KKLA 4KAXA 2XXAA 3PXBA 5F7XA 4CBVA 3W5DA 1C7FA 3ZW8A 2P2NA 5CYFA 4NZNA 4YRTA 1PL8A 2Z1NA 5JDCC 3VOTA 1ZSVA 2Q1TA 3EVBA 4WLVA 4EK9A 1KTIA 2D5IA 4MWGA 3WWPA 4RX1A 3GZNA 3KZXA 2C4VA 1JKJB 2AEJA 2F7SA 3BHMA 4TS9A 3N7AA 4W6QA 3D59A 1FX0B 4CLEA 2CCKA 4PSDA 1ZVJA 2HQ1A 3LL4A 4DM4A 4EG1A 2RJ3A 3GAZA 4ALIA 3SSOA 6YASA 4TLMB 4YRLA 3EE6A 4MVJM 3JQDA 3IE2A 3KU1A 3NX4A 4LJLA 2GFQA 3OUZA 3UYLA 5KZMB 5MN5A 1C80A 4XGRA 1G6KA 1K9VF 2H2AA 2V5UA 4OI2A 4NX2A 3TPZA 4HPXB 5FA6A 4ZWNA 1W93A 3HEBA 3IILA 1HEYA 4LTNA 4O4HB 4R1UA 4Y7DA 1E1DA 3EEBA 5HHTA 1GV1A 3K7EA 3RHFA 3G85A 1JG1A 4FUQA 3ZW9A 4GUAA 4CHTA 1YFLA 2Y6UA 4ARSA 1MP0A 4BKQA 3X44A 1DLJA 3QHQA 4RNDB 5AJVB 4MW9A 5HP4A 3QLVA 4BX0A 2P67A 2CL7X 4LOAA 3COPA 3QU2A 3N5KA 2D7JA 3IUQA 4JI6B 2XZTA 3DW1X 5C8YB 4EQ6A 5JAMA 2VXOA 1TZMA 1BXRB 1R8XA 3MMZA 2O8CB 3JQ7A 2JGNA 1UKCA 3DDHA 4RV4A 3JPWA 1MQAA 3G0HA 3JAWB 4CKWA 4EB8A 1MX1A 4LVOA 5HZHA 4JCCA 1PWEA 2XMDA 2FOLA 4DCOA 3HYLA 2ZW9A 1I36A 3FGNA 2YWJA 2HLDA 5BRJA 1XD8A 2FE4A 2CXTA 1KMNA 2GT1A 4JBLA 4MWOA 1U3DA 1HYHA 1W2HA 1UBJS 3LYUA 1S2MA 3MCZA 1J8DA 1UOOA 2JF0A 2GBCA 2JEOA 3D4LA 4Z3OA 5AVOA 2J6CA 4RUKA 4P92A 1U0TA 4MLPA 3TL2A 5KO2A 5H9WA 1XALA 2XGGA 3O47A 4C07A 3RSCA 4RM2A 1P5HA 1VTKA 2AJTA 1E1CB 4FYKA 4RE6A 2QDXA 2IPAB 4ZCSA 1MMFB 4BL5A 2ZI5A 4RVUA 2IELA 3GBSA 1OKKA 4YNBA 1XTIA 4LYHA 4P5PA 3WC4A 4KH0A 3ABSB 3TOZA 5IVIA 3LS2A 2AD1A 4RD1A 4AZVA 2R8EA 2VXBA 3VYUB 3I58A 1XAJA 2RCYA 5C0OE 4HYYA 1W9MA 1D4OA 3OOSA 5DM60 1IUKA 3CEPB 5B7PA 3GDGA 1KIMA 3LVFO 3LYAA 2BONA 5LBUA 1GOTA 4PRLA 1HE8B 4M60A 4RKEA 4JBNA 5CW1A 2UXBB 2R8PA 2XEXA 1QOZA 1IH8A 3P2IA 4JB8A 5I4BA 1EX1A 3N2YA 4PSVA 1P5FA 1CTQA 2W4QA 3KYDB 4FKBA 4L28A 2V7TA 5DM2A 4OP3A 3ZGYA 1ES9A 3IVCA 4WFJA 1BGVA 1VLQA 1YRQA 2WLSA 4MGZR 4M76B 4RACA 4XYMA 1EXNA 1KI6B 3NUZA 4OBEA 4Y2JA 1RIIA 4WJLA 3WGLA 2IFTA 3GCXA 5DPMA 4KR2A 2RE8A 1Y8AA 2IA5A 3EG9B 2AFIB 3FLAA 4LI0A 5CH3A 5AW2A 1IOLA 3LXUX 1JX6A 1YD7A 3VKFA 3ZQ6A 4BJ6A 1ORDA 4BEJA 3MHPA 4H7FA 4D97A 3VKGA 2B5WA 4EENA 1AB5A 2W70A 3R9XA 4GVPA 4YBZA 4EI7A 3NIBA 1Y80A 2KX7A 3IKTA 5HDBB 4M1TA 1ZJ4A 3DV0A 1ZINA 3H1FA 2HF2A 2XCUA 3GAMA 4D5GA 4OQZA 1KPGA 1E1CA 1EEHA 4UULA 4BNWA 1K75A 1I7PA 1T26A 1WL8A 4A0GA 5ICFA 1JHAA 2QP4A 4XLLA 4UNRA 3J80A 1XA3A 2BJVA 5THXA 2BMFA 1TD1A 4JUCA 5K0ZA 2GEDA 1MJHA 1RAIA 1UZLA 3UMCA 3HR7A 1L7QA 1Y3DE 5ABPA 2PZBA 3KL4A 2ZWAA 4RKFA 5GZ1A 3D6NB 1XXLA 3MCUA 4TTPA 4W99A 1H6DA 3AG5A 4E51A 4O4JB 4IDOA 4LYDA 5KPJA 2ECQA 4BY9E 1T24A 4M87A 3B70A 4ML3A 2FPGA 3R7DA 2E1PA 2HIGA 5BNIA 8ADHA 4PQYA 5BN1A 5ECGC 3ZDAA 1GR1A 4JVOA 5C1DA 1AH2A 2VUUA 4YB8A 3LC7O 3LDFA 4PINA 4U0KA 3H84A 5DYGA 3SYNA 3LTEA 4DEXA 3TG2A 2X0FA 4QYSA 1J8QA 3I09A 2J59A 4DLPA 2J07A 4AI6A 3FPSA 4LPSA 1IFXA 4QYTA 1C3OB 3IAFA 4ALNA 1G5RA 1Y4ZA 3LVQE 5BPFA 5E0OA 4O1IA 3UOGA 2PXXA 1POXA 2BOVA 2AE1A 4X8MA 3VDMA 2XQIA 1QP0A 4BFTA 1U0RA 1VSQA 2V74B 3GYBA 2R1UA 5LZ9A 5ALLA 3DZDA 2AX3A 4MRMA 2XQKA 3R5HA 3AQIA 2JFYA 3HJBA 2PPLA 3F67A 1DFHA 4QVGA 4ZPXA 3GAFA 4R2WA 3NT2A 1EU1A 4MWDA 4TYMA 4TL9A 3RREA 4G84A 3WK9A 2XCQA 4R2JA 2J7KA 4Z7OB 4YA6A 3L84A 1DC7A 2VSQA 3KR1A 2OBLA 4PSUA 5DASA 1DBVO 3W8DA 5E4FA 1AQNA 1U3FA 1UUFA <