3ZYCA

Dynamin 1 gtpase ged fusion dimer complexed with gmppcp
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
347
structure length
330
Chain Sequence
b'SMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVDEMLRMYHALKEALSIIGNINTT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DYNAMIN-1
publication title A Pseudoatomic Model of the Dynamin Polymer Identifies a Hydrolysis-Dependent Powerstroke.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 103
structure length 330
sequence length 347
chains with identical sequence D
ec nomenclature ec 3.6.5.5: Dynamin GTPase.
pdb deposition date 2011-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00350 Dynamin_N Dynamin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3zycA00
1Z29A 2OE2A 3H1TA 4KBGA 1YR9A 2V9PA 2X2FA 4LHVA 5CK5A 2ZYVX 1X3SA 4FINA 2JIZA 5EXPA 3QPWA 4GMDA 5P21A 1IJFA 2J0SA 1VCNA 4CT4B 4TWZA 3GJ3A 4L9SA 5AJWA 3EC1A 3G5UA 3VX3A 5L3QB 2JLWA 1PLLA 4DCUA 3WMFA 3EIHA 1GNPA 1GP2A 3I1FA 4HAYA 3VR6A 4A0HA 3K8YA 3OAAD 4B3GA 5FPKA 3NBZC 1KO1A 3TH5A 4YMVA 3EX7C 4OJQA 1VG8A 3JZMA 3KTAA 5DNYB 1LS6A 5LB4A 3RDPA 5HZHA 4JLPA 2GJKA 3AV0B 2C5LA 1I4LD 1TADA 2DWOA 2GTPA 3ONWA 4P3YA 3LBHA 4NL4H 4B71A 3B85A 4BLPA 4A1FA 3RHFA 1EFUA 1J2JA 3SJCA 4EPYA 1T3LA 2GCNA 2IL1A 1Z0IA 4DZZA 1D2NA 1MABB 1IN6A 2WVJA 1GRNA 1R0ZA 3ZLJA 4V0ME 5JWHA 5LD2B 2GBLC 3DPUA 3LA6A 1T9HA 3OIUA 3ASYA 4UJ5A 1V43A 1XMIA 4FW9A 1TQ6A 4JJZA 2XTNA 4KCGA 3NEYA 2CL6X 4HUQB 1T5LA 1DVRA 3TVDA 2ZYWX 2OHFA 1ESNA 3EC2A 3HPRA 2GESA 3IDQA 4PC6A 5CJ2A 4DCNA 3AVTA 4K46A 3OAAA 1D9ZA 1LY1A 3PG5A 5FUVA 1IN8A 1S9DA 4NP6A 2G83A 2V1XA 4IHQA 4DHEA 2WAYA 3E5HA 5DISB 5IHPA 2J59A 2NPIA 1E1RD 4KXFB 5FOWA 3WXMA 4URWR 3ZYCA 4A6PA 3T15A 5J4YA 1K5GA 1F48A 2ZSEA 4L9WA 2ZAOA 4MGKR 3SN6A 2A5DA 1J8YF 1EGAA 2HLDD 3TVTA 1AGRA 4ON9A 4RFVA 1CR1A 1XBTA 4BRWA 4D80A 5JEEA 4C2UA 3AKCA 1NMXA 2BBTA 5G40A 4CIDA 5FR2A 1AKEA 2DB3A 4MKHA 4E03A 4NU0A 3QENA 4Q01A 2RKOA 3ICQB 4DRZA 2PLFA 5LPNA 5SZIA 4DLYA 4JLAA 1HT1E 3L82B 3FE2A 1S0UA 1CJUC 4EPXA 3GLFE 3V4FA 3LX5A 2ZS8A 2ZJ2A 4Q03A 3TKLA 1NN3A 3PR1A 2O8FA 1DAKA 2G77B 1W46A 2WZQA 3NDPA 3QKRA 1R8SA 1TQ4A 1COWD 3CF6R 2NO0A 2ODWA 3CR7A 3H0KA 2REOA 4MRPA 5JWOA 3IBGA 4NMMA 5K8UA 5DGXA 4BLQA 1XEFA 4TYNA 4D6PA 1HTWA 1P9WA 2DR3A 2P3SA 1E2PA 4JLBA 1E1RA 1GL6A 4OK5A 1L4UA 1XD2A 2CEAA 2HF8A 1L7VC 3QG5A 3AVYA 5FTKA 3IEVA 4G0NA 4JS0A 5AWFC 1QZXA 2IYYA 3ZIAD 4PSVA 5L3RA 2DYKA 1CR4A 2KSQA 4MKGA 3AP1A 4MUBA 4Q4HA 2GAAA 3QE0A 1XTRA 2FFHA 5F9FA 3SC3A 1IAQA 1OHHD 2GA8A 2JGNA 1WBDA 4D4JA 3F3YA 2OBLA 3QUSA 4PSAA 4C4PA 1JECA 5EP2A 3AGQA 3C8UA 1S8FA 1ZMXA 2XB2A 4C30A 4OHYA 2GJ9A 3K0CA 4P33A 4Q4JB 2JASA 4MRVA 2VEDA 2BHRA 3AUYA 2DWQA 4E07A 3CX6A 3EPKA 4OJKA 4TQAA 4HLCA 3K70C 2PJZA 4IDOA 3VU9B 1COWA 3BXZA 5CYPA 5BN5A 1TEXA 3GLHE 1PLKA 3S1AB 2GXAA 1W4BA 4Q1AA 5KPDA 4LK2A 3KJHA 1FQJA 1PJRA 1Z0KA 2J7KA 2MSCB 3AKYA 4C0JA 2P6RA 2O8EA 1EX7A 1Q44A 2ZE6A 4DCVA 1XF9A 5EXSA 2D2FA 1ZNWA 2PL3A 1U0JA 4UKDA 3LXXA 4FMDB 4AI6A 5JSZA 1ZM2A 3BC1A 4HB4A 2V7QD 2F1RA 1CRPA 3ZIAA 2FMXA 3FMIA 3W9YA 1G5TA 1H8EA 8OHMA 3QKUA 5TDHA 4G1UC 2ZRJA 1SXJB 1R8QA 1EFTA 2CCKA 3DMNA 1Z6XA 5JZVA 4B3FX 1JXMA 2KE5A 3VTKA 1TMKA 3D7MA 3QKSA 3WBJA 1S9HA 4BQSA 1KI8A 2J5XA 1TX4B 5E95A 1AQUA 4C0SA 1R0WA 1G7TA 2BBWA 3BH0A 5KSZA 3ZD7A 3P4YA 2P6NA 2EFGA 4C0KA 3SBDA 2QPAA 1W5SA 3OFNA 3IUYA 4OHVA 1OLOA 4U5XA 4IVQA 5J4KA 2ZRCA 1G8YA 3K9NA 3B13B 2QL6A 3O8RA 1YRBA 2GF9A 4YMUA 2A5JA 1E0SA 3FMFA 2QRZA 4IOLA 4W5HA 3VR3A 3WHLA 2YC4C 4Z1MD 2EYUA 2GZHA 4Q00A 5H68A 3N2EA 5BYKA 4CYMA 2VSFA 4RD0A 5K8IA 1OV4A 3T35A 1IXRC 2H57A 4IEIA 1E94E 1Z0AA 3CRVA 1OH6A 4IDHA 4DBLC 1CP2A 2J46A 3AVXA 4KITB 2XZLA 1LNZA 1ZNXA 4JSTA 4JLJA 2OCBA 4DLTA 2OUKA 1T3SA 2BMEA 3FDIA 3O8DA 2I1QA 3BBPA 1U90A 2PLRA 4PX9A 4Q1DA 1Z0DA 5JI3E 2XTZA 2ASEA 5LDDC 3NHAA 2Z6VA 4ZDKA 3RWMB 1NN0A 1Q21A 4PTLA 2HT6A 5KUTA 4GDFA 2FPKA 1R4AA 5FOTA 3IO3A 1AKYA 1XWIA 1KK0A 1F6BA 3FPAA 5DN6D 1T5IA 3CWZA 1RW4A 2G3YA 3IKJA 2VHUA 4NTZA 1JR6A 2RMKA 1FOEB 2GZDA 3Q5DA 4CGZA 1S1MA 3VHLB 2IUUA 3VX4A 1Y3AA 1H65A 3TMKA 2ZU6A 4Z1MA 2ERYA 3PEVA 2F55A 4RFSA 5C2JB 1OH7A 1M7GA 4Q9KA 3LRPA 1VG0B 3LQQA 4DDTA 4M1YA 2GHIA 5JS8A 2PH1A 1KIMA 4JMPA 5CM8B 2QUZA 2ZRIA 4NCNA 3B78A 5BQ5A 3BE4A 2KB0A 5GVRA 5EUMA 2OCAA 4S2EA 1YE8A 3DVLA 1YKSA 4Z51A 5AJVB 2QEQA 2A2ZA 2AL7A 4NYMQ 1E2MA 4KLZA 4NE2A 3L2OB 4KVGA 1A2BA 2WWFA 4D81A 2FSHA 1LV7A 4FD2A 4LX0A 4FMBB 3U7HB 4RCYA 4LJ6A 2SHKA 5FBQB 1N0VC 4DSNA 2YWGA 3K09C 1MV5A 4B73A 4DEYA 3LW8A 5FI1B 4BFXA 5D3MB 4AC9A 5DN6A 5FOUA 3K70D 3QVVA 521PA 5GADl 4Q1EA 1PV4A 4CVNA 3GLGA 3I8XA 1ZUIA 1OJLA 1ZC3A 4KFUA 3CNOA 2OAQ1 5C1BA 4LPKA 3LV8A 5HCNA 4MGIR 2D74A 4ESVA 2R6DA 4DB2A 1WE2A 4IKEA 2FV8A 3NBYC 2ONKA 1W0JD 2Q3HA 1M2OB 4QGGA 2OFOA 4PQYA 4NDZA 1QHYA 2W6JD 5BN3A 1KO4A 1BMFD 1JJVA 2XB4A 4A8JC 1UDWA 2BV3A 2OAP1 3ICEA 4TLDA 1R5BA 3B1VA 4LV5B 2JLYA 5FTLA 2NOAA 1NKSA 4NCHA 3RRYA 4B74A 1KI1A 821PA 3EPJA 3UATA 4JKYA 1X8LA 3ZGXA 3LLMA 2QAJA 5IDVA 3THYB 2VHTA 4YLGA 4ZDWA 4YMTA 1TF2A 1ZU4A 2ZUCA 2DPXA 3WY9A 3PIRA 4F91B 5KTYA 1XP8A 2RHMA 1IBRA 2Z4SA 2RGBA 4M9SA 4V0NA 3U2QA 1W7AA 1KJYA 1RIFA 4CT5A 5EE3A 1CTQA 1G1MA 3K0AA 1JR3D 3WNDA 1CRQA 1HA3A 1S96A 2VP2A 2OM2A 3ND9A 2IT1A 4B2IA 4POAA 2VP4A 5EP4A 4DWJA 2C96A 4PAQA 4LHZA 5EXTA 3BERA 3ADDA 5L3SA 3AVWA 4KAXA 1F3OA 4DLVA 1W0JA 3B9QA 1UBEA 4KODA 5G41A 4KJZA 1KZGB 2OBMA 5E3HA 4LJ4A 2BM1A 1RJ9B 1XCGB 3F5FA 4LCBA 2W6JA 2RAPA 1BMFA 1SVIA 3Q72A 2IA5A 3SQWA 1WB9A 5AR1A 2BMDA 2RGGA 2YOFA 4Y0VA 3BB3A 4Q9HA 2B7BA 1E96A 2NZJA 4PPFA 3LVQE 1Q3HA 3KFVA 2ZIAA 4PC7A 1KAGA 2CDNA 1Q3TA 3A8TA 1P60A 2BKUA 4OHWA 5J40A 3ZJYA 1TPZA 2ZRFA 1KNQA 1G291 2Z0MA 4HYYA 2R6GA 4Q7JB 2EQBA 1P72A 4MUAA 4BGDA 5FFMA 3DHWC 2ZVPX 3CO5A 1UKVY 3QBVA 4WXPA 1JR3A 1F2UB 4Q9JA 4JZKA 2ZJZA 4ITRC 4MQBA 4HZUA 2RH5A 3CH5A 2BIFA 3U6BA 1XZQA 2OFWA 3ZVRA 2FU5C 3L0IB 1Z2CA 2QU8A 4DJTA 1D2EA 1GZSA 2E87A 1N6HA 3L0SA 4URXR 2ZRHA 1C1YA 1JALA 5HZKA 4JKIA 2VLIA 4DLUA 2ORVA 2QMOA 2ZE5A 4URYR 2YWHA 5FUWA 1XDBA 2AN9A 4P4SA 3VR4A 1R5NA 4TTRA 4BPBA 3AVUA 1Q57A 4D0NA 3HWSA 1T6NA 1I4TD 1E2JA 1ZW6A 2XAUA 3C5CA 1AS0A 4JBWA 4NH0A 4N0EA 4DEXA 2JJ8A 2ZRDA 1WA5A 2XNSA 3CZPA 3C15C 4A4DA 1N6LA 5L3QA 1WCV1 5J4VA 4Q1CA 1XX6A 1KI7A 2OT3B 2R9VA 2ZUBA 4B75A 4CEJB 3RRMA 3CF2A 2ZANA 1OYYA 3LFUA 3PENA 4OK3A 3LY5A 4GPTA 1EK0A 1KMHB 3MJHA 2ZRKA 3KQLA 2CE7A 1P3JA 2QRNA 2WJJA 3RAPR 2O8BA 2ZREA 1ZNYA 2N42A 3BD9A 2RGAA 3A4LA 2C2HA 2I3BA 5FBRB 4FN5A 2X77A 2QQ0A 4PPQA 4TYWA 1G41A 5FI0B 4M1WA 1DELA 1QHGA 3KKMA 1KDPA 1N3BA 1IN4A 2H5EA 1OF1A 2BBOA 1G6OA 1IN7A 2VIIA 3AKEA 3EZ7A 2AK2A 1GRQA 4P32A 4EFNA 3BB4A 1RZ3A 1MABA 2IYSA 2AKYA 3FYHA 2CHQA 5M04A 1RKBA 1GDDA 1TF5A 2C04A 4O2LA 2QE7A 2BJVA 4G5SA 1E6CA 2YNMA 4MYUA 5IT5A 2RCNA 1N6IA 5KPJA 4US2R 2OCYC 1UJ2A 1AS3A 3PEUA 2D3WA 1BYUA 4HUQA 1NG9A 1TL7C 1E2IA 2WSSA 3A37A 4PPNA 2BCJQ 3EIEA 3FMPB 1CJMA 1XCPA 3H84A 4DIDA 4MH0R 4C0LA 2FSIA 1XEXB 2WOJA 3X1ZA 3DZ8A 1EG7A 4MYHA 3KDSE 3A1SA 2ZXUA 1G4AE 2F1IA 2IF2A 3HYRA 4LC1A 1UAAA 3IIKA 4DLRA 4XVUA 1TNDA 4XH9B 3SJAA 2ZE8A 3C4JA 1JEDA 3BIFA 4LBYA 5CLLA 4B2PA 3R7WA 1IY0A 3DKPA 5FL7A 5F3WB 4D2IA 4QM7A 4C2TA 3TGPA 3WBKA 5IRCD 2WPDA 1VHTA 4PC3A 3VKGA 1OPXA 1KK1A 4A8JA 5EQTA 2ZJ5A 4OHZA 1G8PA 4QKQA 1Z0JA 3GEHA 4PHFA 4DXAA 1DO0A 4OQXA 1KOFA 2ZRAA 3CPJB 4UNQA 1GL9B 1GKUB 1NI3A 1MO5A 1PUIA 2GEUA 3RWOA 1KZ7B 1N5IA 5GJVC 1FNNA 3CRMA 3OZXA 4KSBA 1ZM9A 4QHYA 3TSWA 4DSOA 3T12A 1DEKA 4WZ6A 4V0LA 3WYAA 3F0TA 3BOSA 3MSXA 3Q7QA 1CU1A 3K9LA 1PLJA 2BMJA 5B2ZA 4G01B 3WYFA 1ZJ6A 3KJEA 2ZS7A 1XEWX 2F6RA 5L3VA 4MA4A 2BWJA 3VHXA 2CK3A 1Z3IX 3RC8A 5EE5B 1T0HB 1FFHA 4URVR 1P2VA 2IXEA 2DCUA 4I1SA 4HATA 2O0JA 3MAAC 3D8BA 3U3MA 1XXHB 4P4UA 1SXJD 2UVQA 3BORA 3RANA 3W5IA 4C0HA 1E2EA 2GAOA 4Q66C 3FOZA 1TEVA 2HEIA 2ZI5A 1G7CA 3LXRA 3RS0A 5H1YA 2ANBA 2ZSBA 3RSOA 1RRPA 3K0CC 3UXMA 2RGEA 1J7KA 3D6TB 1ZIPA 4BZPA 3TR0A 1YRAA 1X86B 4KI0A 2UKDA 4RKFA 3W3AA 3THOA 2G1KA 3UWOA 3J81k 2AKAB 5KSYA 4A36A 3Q3JB 2I1VB 4YXWD 1SQ5A 1EFCA 1OE0A 1XTIA 2WMOB 3I32A 3BAFA 1SXJE 2OLJA 2WWWA 5CK4A 1Z2AA 1FUUA 2XNDD 3S1AA 4E22A 1E4VA 3Q7PA 4AG6A 3M4YA 1KSGA 1G8GA 2XXAB 4AY2A 4GNKA 4GT1A 3V4RA 1ZINA 1TAGA 2PZGA 4PZZA 4PAOA 4GP6A 2ZSFA 4R98A 1RRGA 1E2FA 2VP9A 3AB3A 2BEJA 5CDFE 2H92A 3CNLA 2KBFA 2OILA 1Q1ZA 3U6KA 4AWXA 2QM7A 2QSZA 3P4XA 1ZYUA 3CX8A 4PHTA 4FIDA 2Q6TA 1YZNA 4LWZA 3CKLA 5B30A 4KFRA 1T91A 1OB2A 1TU3A 3LW7A 1OXSC 5TMPA 1W4AA 5KU1A 2JLQA 1U99A 2RGXA 3UPUA 3LO5A 4RD6A 1K5DA 2ZRPA 3MGCA 2QPTA 3Q5EA 2GCOB 1UEJA 3QXHA 1RC8A 3B8HA 4XSHA 2C95A 4J0QA 3IHLA 1QBKC 1C4OA 3QKTA 1R7RA 4A2WA 4DSUA 3ZVNA 5DO9A 5CDFA 3CRW1 2G0TA 1RPZA 3CONA 1VKJA 4Q9LA 1OXXK 2AX4A 1NMYA 4WZBE 4QGAA 4YXWA 3IGFA 1XB2A 2UZIR 1D6JA 2WKRA 2ZJ8A 1U2RA 4P0TA 2G6BA 3W6OA 3GFOA 1OIVA 5AJZA 3LNCA 4RD4A 4F38A 1G64A 2XNDA 2Q9AA 4B2LA 4BASA 2JDID 4QBHA 4I4LA 2J0VA 5DIFA 4YMWA 4QHSA 5HE8A 3FHCB 4ARZB 4MRSA 4GFDA 5JFGA 1P2SA 5JEDA 2NO7A 1JXOA 4CDGA 4Q4AB 1U9IC 3EZ9A 2OFXA 3NIBA 2V3CC 4CEIB 3GJ0A 3NKVA 3GJ5A 4M2LA 1ANKA 1DG1G 1MKYA 2B8TA 2OLKA 1G16A 2A7QA 2ZJBA 3AVQA 4QBGB 5CM9C 4OI1A 2R6AA 2Y8EA 3DKVA 2WHXA 3P26A 4Q02A 2A3RA 1A5TA 2QT0A 4TZ6A 5EUQB 1II8B 3Q85A 1GNRA 2PT5A 2I4IA 3UMRA 2Q0HA 3KKNA 2F9LA 4JBYA 3GFPA 1RRCA 4WAUA 3WMGA 3OE7D 3AEZA 3ZZ0A 4LJAA 5FL3A 1M1YE 2HDNB 4L8GA 4TL7A 3SYLA 3VFDA 3CR8A 4BE7B 1NVUQ 3THXB 4V0MA 1SHZA 3U3OA 3GPLA 4K81B 4UJ3A 2J41A 1U98A 2O5VA 3ZQ6A 2ODBA 3C16C 1NL3A 3FHTA 1E2QA 4KV9A 5CIWA 1P61B 2GETA 2PX0A 3CUEF 2PCLA 4OQNA 4TMZA 2JDIA 5KNBA 5FBWB 3MJRA 4TYYA 2QAGB 3A1WA 1FQKA 4NHOA 4F4CA 3NHBA 2G1JA 1J99A 2VSOA 1W2HA 3U61B 2D7DA 1A2KC 4AYWA 3IPXA 2QM8A 3EPHA 3K1JA 3KJIA 3QF4A 4NCKA 1I2DA 5JWRA 4H1UA 4JT2A 4Q1FA 3B2EA 1FP7A 2CL7X 2WJGA 4GZLA 4JL8A 2QMUA 3T5GA 4TT3D 2RB4A 1HUQA 2CNWD 2WIAA 3TW4A 4JSYA 4EDHA 1NY5A 4JLKA 3MFYA 3HU1A 2IYTA 3OE7A 2QENA 3PUWA 5D3MA 3T5DA 4M9XA 2FE4A 1UBGA 1G6HA 1M6NA 2AD1A 2HV8A 2ZR9A 4JVNA 5AJXA 2ZETA 3SEAA 5DYGA 3TW8B 1SULA 4GOXA 1G17A 2OBNA 4G5GA 1YZKA 4B44A 3U4QB 3O8CA 1KI6B 3RNLA 1UPTA 3GLFA 1F2TB 2EVWX 2W2TA 4KYIB 4X8HA 3UKDA 4DLZA 4DT1B 4YMSA 4ZCMA 1I2MA 3K0SA 2HLDA 3SU8A 1HQCA 2Z83A 4U7DA 4IFEA 4R9UC 2VO1A 4IFBA 2GEVA 5E7IA 4BLOA 4A15A 2ORWA 5G3YA 3MWYW 2VYFA 3BFKA 4GRAA 2NIPA 4BECA 3EA0A 2BDTA 3EAQA 1MRNA 2AHOA 1BIFA 1N0WA 1HY3A 3BWDD 4V0KA 5JRJA 2AWNA 1XTQA 3CRQA 1P5ZB 3UANA 2QTVB 5A5GA 3B1WA 1TUIA 3TK1A 3KB1A 5HPYB 3FTQA 4U02A 4TT3A 1ZIOA 1KK3A 2ERXA 4JJKA 5FR1A 1JEEA 2FSGA 2A5FA 1JI0A 1CJVC 4JLDA 4EPVA 3FB4A 3KQNA 3FHOA 1UFQA 4Q21A 5FH9A 1VG9B 3H86A 5FOVA 4F7WA 4L15A 2HJVA 4TMXA 3GFTA 2CJWB 2QBYB 1W36B 3FWYA 1R5OA 1AA9A 2MMGA 1YR8A 1HEIA 1Q12A 3QQ5A 4AKHA 4JLOA 3GJ8A 2WV9A 3OHMA 3E2IA 1V5WA 2F43B 2Z5FA 4IVRA 1RJ9A 4PAMA 4HB0A 2VHCA 1ELOA 1FMJA 4QJ4A 1P75A 3GLHA 1HYQA 4FCVA 4QJ5A 2P5SA 2IHYA 3WP0A 4EJSC 4UNPA 4DKXA 1OHHA 1QHXA 1Y63A 5EXXA 1MO3A 4B34A 2J0UB 5HKKD 1DAIA 2CMKA 1AZSC 1RE0A 1JB1A 4R7ZA 4RVCA 2J3EA 4II7A 2C9YA 4IOKA 1VHLA 2QGZA 4NBSA 3W5JA 4ASUD 2IYWA 4W9MC 4NYMR 221PA 4AKEA 1G3IA 4P31A 3KXKA 4BLRA 4BFWA 1S3GA 4DIEA 2CBZA 3LD9A 4LJ9A 2V1UA 2DFKB 2X8AA 4AG5A 3U60B 1G3QA 2HXSA 3NVAA 5JCZA 2QZ4A 3R8CA 1QVRA 1ZD9A 3VKHA 1CIPA 3TUIC 1G3MA 2OO7A 4I1VA 1YZQA 5F2EA 2IXFA 5HR5A 1NVXQ 3CBQA 3X1DA 4XVRA 5KO2A 2PZFA 3AF0A 3D3QA 4E09A 1SVMA 1NBME 1P2TA 2XOKD 3SI7A 2GXSA 3E1SA 3QBTA 1DARA 4B43A 2V7QA 4B6EA 2FEMA 3SDZA 4ZO4A 1U9IA 4KHZA 2GJAA 2IYUA 1N2CE 2NO1A 3KTAB 2R8RA 1UKYA 1GL7A 1X1SA 3L8YA 2ECKA 4KFSA 2JJ2D 3C14C 4DVGA 1ZUHA 4EQ6B 2O8CB 1JQJC 3GEEA 2EWWA 5FBLB 2W6ID 1SGWA 2IK8A 2G9NA 3LH5A 4TLEA 4B3DA 4ZIRB 4RZ2A 3B82A 1P9RA 5TXGA 2F1JA 4Q48A 1A7JA 1BOFA 3MD0A 4CEJA 5AUNB 4BFZA 2CVHA 4QXAA 1HE8B 3PUXA 3T06B 1NNEA 2ODEA 1H8HD 2BJWA 4ASUA 1GKIA 1G8FA 2P2LA 3EASA 4Q9IA 3HU2A 3KL4A 1ESMA 4HAVA 5IK2D 4LJ8A 4E5UA 4BFUA 2IC5A 2HYIC 2EYQA 3ZQJA 2CHVA 2CLSA 1E9CA 5EE9A 1HE1C 2GZAA 1I4DD 1BH2A 4ERNA 3U3KA 5LD2C 3OEED 2F1HA 1LTQA 2QP9X 3BB1A 4B35A 2XOKA 5FOSA 2BM0A 1W2GA 2JLXA 2OV2A 3EA5A 4Q7MB 3U7FB 1II0A 5TY0A 2GEDA 3T1OA 3P32A 3IBYA 2NQ2C 1YVDA 3TSOA 1OW3B 1MRSA 1CR0A 4MGYR 1YR7A 5ANRB 2W6IA 1OSNA 1AGPA 2YVUA 5H70A 4RY2A 4WBSA 2F3TA 2XGJA 1E2DA 1M34E 4HAUA 1GSIA 5C18A 4M9ZA 4WW0A 1XEXA 5KDOA 5KDLA 2NPFA 1E79D 4M1OA 3T61A 1VIAA 4LV6A 2ANCA 1XFAA 4Q4LA 2JEOA 2GILA 2QAGC 5IK2A 1VYVA 4I99A 3PXGA 3EZFA 2BMFA 1WBBA 1T8TA 3I4LA 3QPVA 3PUZA 1DS6A 5DI9A 4XOIA 3CH4B 1WP9A 2O8FB 1Z6AA 4L16A 3VMFA 3QKRB 2R44A 1HQYE 4BZXA 2C9OA 4CEHB 3JVVA 1P4SA 2BKEA 2IWHA 1MO4A 1N5KA 1DE0A 3WYGA 3A1TA 1KO7A 5FOXA 1XD2B 4IXMA 1XPRA 1K8RA 2ZJAA 2LKCA 4BEBA 3B1XA 4M53A 5D3QA 4FWIB 2OZEA 3RS3A 2C8VA 5CB8A 1XXHE 5JRZA 3AP2A 2FSFA 3UG6A 4XTRA 3AVOA 1KI9A 1TQDA 2ZI3A 1P9NA 1ZD1A 3M6AA 4TYPA 4DCSA 2O52A 2IYZA 2ZTSA 1XMSA 2AXNA 4R71A 3WRYC 1E79A 5A0FA 4PQRA 2JLRA 2LKDA 1VIYA 5FTNA 1XJCA 5LBIA 1KI4A 3WHKA 4YONB 3WNBA 4PSKA 1XJQA 4UNSA 5TV2A 2FWRA 3D31A 1QHHA 2DHRA 2R65A 3BS4A 1YZLA 4FCTA 1IN5A 2W0MA 4LC0A 4M1KA 4EAQA 3QEJA 3L0OA 2RGDA 3UMSA 4WVFA 2VP5A 5DI3B 3SYNA 2AK3A 4EJSA 2VTKA 4UXIA 2KBEA 2LWIA 3ETLA 2GRJA 3C41J 4IOMA 1QG2A 2QY9A 4LZZA 5DLQC 4Z8YA 4EFMA 1CR2A 3HJNA 3CIOA 1FUKA 2VPPA 3IIJA 3UIEA 1XPOA 4URUR 2HCBA 1RYFA 2ZI7A 4UQOA 1NJGA 1W44A 4LYJA 3A4MA 2XXAA 4EFLA 1YZTA 3I5XA 2QGNA 3TAUA 3TBKA 4LYAA 3HU3A 4JLMA 3OEHD 3VQTA 4ZI2A 2IEYA 5JCPA 4KU4A 2Q3FA 2YWFA 3GJ6A 4US1R 1SXJC 2VL7A 2YJTD 1DAGA 1FW6A 1B0UA 4XTCS 1GFIA 3I72A 2RHDA 2XEXA 4LJYA 3X1WA 3LAWA 3TNFA 5JHHB 4TYQA 2HJGA 1QDEA 4O3MA 2FDCA 4WIAA 1OIXA 1CBUA 2GCOA 2DFLA 3T1QA 5JLJA 4OQFA 5A4JA 5CB6A 1D8TA 1XU4A 1YU9A 1HV8A 1FNMA 4JBXA 4RZXA 1ZP6A 2ZRBA 5HE9A 2QA5A 1G8HA 1AM4D 3I92A 2YYZA 1YHNA 4Q19A 1G3RA 4D82A 2PJRA 2TMKA 1XTJA 1UEIA 3HR7A 5AJYA 1E2GA 3AM1A 1OT3A 2WAXA 4O2RA 3P27A 5EE1A 1VCMA 1JPNA 5FTMA 1UKEA 4DLWA 5K8LA 1F5NA 4UNNA 4NKRA 4CF7A 3EG5A 1Z06A 3LLUA 2EW1A 2WKQA 1VCIA 3V9PA 1RYHA 2VF7A 1MOZA 1W5TA 2BEKA 4Q4AA 2VP6A 3RS2A 4QM6A 4CEIA 3DZDA 1IJEA 3PVSA 4O0MA 4G5OA 3VKWA 4ABYA 5CITA 1Q22A 3GQBA 3OF5A 1IOZA 4GBMA 4RCZA 3RYTC 3T34A 1NRJB 3O47A 4TLAA 2JLZA 4KSCA 3U44B 4QG7A 1C9KA 2MSEB 5EP1A 1AK2A 1E99A 3QEOA 3ZVMA 2JLVA 3UG7A 5J4HA 1KNXA 2AR7A 3B1YA 2QMEA 4TTQA 1NG1A 2H7VA 5JJIA 2CL0X 3DMDA 2E1RA 1E2LA 5FTJA 2BOVA 4PC2A 2V4ZA 3THXA 1AJEA 4A2PA 5DHAA 4LBVA 1R0YA 1NLFA 1S2MA 3AF3A 1GITA 1E32A 2ZPTX 2HF9A 1DADA 3BK7A 3QPUA 4Q7KA 1KI3A 4ZDIA 3KB2A 1M7HA 1S1CA 2FJUA 1ETUA 4XVQA 1ZUNB 1OFUX 1Z22A 1E2KA 2QAGA 2FF7A 2B92A 3REFA 2QN6A 3I8SA 4MDFA 3MWLA 2GK7A 4M1MA 2LCFA 5CJPA 4HLQB 3IQWA 3KZ1E 4KBFA 5DE3A 1NVWQ 3V00A 5J47A 2EWVA 3PV0A 4JT4A 1OFTA 4NYJR 1SVSA 2OG2A 3PQCA 4OI0A 3NDBB 2ZE7A 2VP0A 1N25A 3KXLA 3GLGB 2FH5B 2W00A 2REXB 4U00A 1YR6A 3EIQA 4C3ZA 3KQUA 1D9XA 2YHSA 2A30A 3W34A 1IY2A 4TMKA 1NVVQ 2QQEA 5UKDA 1NP6A 3U5ZB 4ZCIA 3M0EA 1G5RA 621PA 1QHSA 2N46A 2WMNB 2P6UA 4NYIQ 1X1RA 3G82C 2A78A 3A58B 1U8YA 2ZROA 4KO8A 3DO6A 4MRNA 4BZQA 3TIFA 4NZYA 1W36D 4M4SA 1Z28A 4ESHA 1KI6A 2QMHA 2WWGA 1OH8A 3BGWA 1NY6A 3LQRA 2IHBA 4A0RA 1WF3A 4B33A 5KSOA 1AQYA 3KFXA 4D26A 4DUGD 1KO5A 1NSFA 4US0R 5BYJA 1P73A 1Q1EA 1VG1A 5BN4A 3K70B 1KDOA 3K0FB 3QJYA 4PFSA 3RRZA 5FPHA 4QBFA 1R10A 3VNUA 3NBXX 1T0JB 3B5JA 1U94A 3SQXA 1UF9A 4OHXA 1CEEA 4Q4JA 3FMOB 4JL5A 3WNCA 2ZITA 2CHGA 3IIMA 1IY1A 1YQTA 3CWQA 4FMCF 3EZ2A 4IRUB 1EX6A 4DC9A 4LJ7A 2W0SA 2WJHA 3VU9A 5DHFA 1FX0B 3A4NA 2DY1A 3ECCA 1KO8A 4M9QA 4QHTA 3AP3A 3NEJA 4XSGA 5HTKA 2F9MA 1E2NA 2CJWA 3MG9A 1Q20A 3GLIB 4B3CA 4DCTA 4QL3A 1ZD8A 3VR2A 3OIWA 4B48A 4CZ2A 5C46F 4PPGA 1A82A 2GF0A 2AWOA 2ODNA 1XMVA 2GJ8A 4MITA 2CLDX 4PHGA 3IILA 5ELXA 2X1VA 2GXQA 3IEUA 3U3RA 3SJZA 3N70A 4F4IA 2PZEA 1SXJA 4C7OB 1DAFA 4AURA 2AFHE 2ZR7A 3EXAA 1J70A 3EW9A 3FGNA 4EUNA 4AIIA 5SZJA 2K5UA 4B3BA 1KJWA 4D0LB 5HCIA 3U7EB 1J8MF 1T8UA 4PR0A 2YOGA 4IEEA 1SKYB 2IYQA 1DG3A 5GJWC 2CCGA 3ZZUA 4LHWA 4B76A 1TF7A 2D06A 3AF4A 1XEWY 1JAIA 2D7CA 3KKOA 3LBIA 3DOEA 4XWKA 1FPMA 3P20A 6Q21A 3VAAA 3EPLA 1P6XA 4TLBA 1VTKA 3NC1C 4C9BA 4RZ3A 3NH9A 4P4SB 4RSGA 4M0LA 3SNHA 5IF9A 5LB2A 3THWB 1HH4A 2E9SA 1ZCBA 2IS6A 3VR5A 1SVOA 3BFXA 2BBSA 4LOAA 2HUPA 4QC2A 3JVUA 3P1JA 3MWJA 3VNVA 2VA8A 2MMCA 2IX3A 4IXNA 2Q9BA 4LBWA 3LX8A 2UZ3A 4AKIA 1Z47A 2AXPA 2C98A 3C5HA 3U7GA 4R2IA 2FOLA 2WSMA 4BLTA 1VYTA 2WBLC 1XRJA 4H9GA 4LY6A 1N5LA 3SFVA 2CE2X 3TSZA 4RZUA 5AUOB 2O8BB 2KJQA 2WOOA 2ZRLA 4EQ6A 2WKPA 1NIJA 2X19A 2ZRNA 2O8CA 2W2VA 1NN5A 4N3NA 4ZIRA 2FEOA 4DDVA 1LF0A 1US8B 1GRRA 3CPHA 1ZU5A 2QORA 4PXAA 5E7JA 4ACAA 4GL2A 1HURA 3ADKA 2GKSA 3WP1B 2WWHA 1TU4A 4TSFD 3SHWA 1EFHA 2FFAA 2JA1A 4JLNA 1JJ7A 2P65A 1SHKA 4CW7A 4FCWA 2D62A 2RGNC 4DDWA 4FWTA 1B23P 4G5QA 5K8TA 1XTKA 5SZKB 4W5WA 1KDRA 5BXQC 1KKLA 2WIBA 1NLYA 2H8KA 1JAHA 1BKDR 1O3YA 2C9CA 1QRAA 2YOHA 3DL0A 2WM9B 3AVVA 3K9HA 1MO6A 3QOFA 3L8ZA 4D0GA 1OXVA 2W2XA 4X8LA 1CS4C 2IS4A 1IXZA 2QTHA 2QP4A 2A5GA 5EJEA 1UM8A 4MKFA 3RABA 4O25A 3B60A 3TQCA 3X1YA 1G7RA 4KVAA 2GNOA 4WXRA 5H8WA 5KNCA 3B6EA 1E0KA 1VMAA 3I73A 1E9RA 2J9RA 1OYWA 2O8DB 4HEJA 4I81A 4IDPA 2JATA 3PUVA 2XX3A 5JJLA 5B58C 2NO6A 2GK6A 2ONJA 5EE0A 3TAHA 5E4FA 1G9XA 3IO5A 1XD9A 4V0OA 4IJMA 4LSGA 2VSXA 4N0DA 1G4UR 4H1VA 3QXCA 2JLSA 1CXZA 3R7WB 4A6XA 3AF2A 1QHIA 2XTMA 1O87A 4TSFA 3REGA 3JZAA 4OBEA 5AK0A 3PCRB 4QGHA 1U8AA 2G88A 4OKSA 5SZHB 4A8JB 1UBCA 5F98A 5TVKA 2GWHA 3RRNA 3PUYA 4RD3A 2DFNA 1GTVA 3W6PA 3L43A 3Q9LA 5DSZA 2IWRA 5B57C 4HLDA 2EFDB 1J90A 1GILA 2PMKA 1LF5A 1NJFA 4LUCA 2ZI9A 3NC0C 1KY3A 1Q1BA 4JIMA 3PEWA 2JJ1D 4Q18A 4L5BA 4CEHA 4HDOB 5FPYA 1TUEA 4EPWA 3HDTA 2ZYTX 1SVKA 1DO2A 2OXCA 4ZKEA 2AFIE 3ZZTA 5F9HA 3MWKA 1EFRD 2ZSDA 2FPMA 5EP3A 3PEYA 5E7MA 4BFTA 2ZU0C 3QSYA 4M21A 4C0QC 2IW3A 4LDJA 2KWIA 3THYA 2C78A 1SVWA 2QTFA 1SZPA 1M74A 1IONA 4OL0A 1MR3F 3AF1A 4TL8A 1NKTA 4HI0E 4OK6A 3ZS8A 3FKQA 1JNYA 3F8TA 2CNWA 1CF4A 2ZM5A 1H8ED 1G21E 1W47A 2OESA 3O8BA 4Q5IA 1KSHA 3SHFA 3TR5A 4M1TA 1E0AA 4AYXA 3NWJA 2ATVA 2XZPA 3R20A 4UXJA 1XZPA 2IYVA 3BH6A 3MCAA 4BFSA 3GMTA 2CXXA 1N6NA 3W8NA 3FFAA 3OFND 3CRRA 2IEZA 3GJXC 5KHOC 2Z4RA 3KX2A 3SOPA 1Q1QA 4HDCA 3BFVA 3R9XA 4M22A 5KDDA 2JJ1A 4IDQA 5G53C 3FVQA 3NBFA 4BWYA 2AD5A 1QF9A 4TMWA 2ORIA 3T1TA 5GVSA 1CKEA 4JL6A 3UMFA 4D25A 2FPLA 1EFRA 5AUQA 4DLXA 4F93B 3RS5A 1LW7A 5DI3A 4OQMA 2YV5A 4RKEA 2IYXA 1E0JA 2FGJA 5AUPB 2GJSA 4WOPA 1NBMD 3A1VA 3R9IA 1SVLA 3ZS9A 1UADA 1KSFX 2GCPA 3H4MA 2VHQA 3RSLA 1IQPA 3TJZA 1ZC4A 2WWIA 4C0AC 2Q21A 2IF0A 3ZD6A 1PZNA 2GVDC 2FGKA 3QIAA 4ILEA 4F4JA 5KYKA 2V8OA 1F2UA 4HLUC 1KKMA 4OI4A 1T3HA 4BUJA 2ZRMA 3GP8A 4LBZA 4TQUS 4YDHB 4MKIA 4URZR 3SZRA 5BW8A 3A1UA 2FA9A 3GJ7A 1OXTA 3CW2A 4HDQB 1ODFA 1X8KA 1T4GA 3BJIC 4LRWA 3RC3A 1ZM7A 1OH5A 1XD8A 3QI2A 1ZM3A 1ZCAA 1N5JA 1CLUA 3PITA 1W4RA 1P2UA 2REBA 4DB4A 4YQFA 2DFTA 2N1BA 2W58A 4MRRA 3SFZA 2X2EA 4A92A 3OIYA 4BLSA 1DPFA 2NGRA 4LI0A 4WA7A 5TARA 3OESA 5HKKA 1F60A 1KY2A 1VECA 4EKDA 2ZVQX 1AS2A 3A36A 4F92B 1NBMA 2P0EA 4A0GA 1VYUA 1KMHA 3QXSA 4YDSA 3CPEA 5FPTA 4G3XA 1NF3A 2RGNA 1HT2E 4GMXA 2V6JA 2GBLA 1E4YA 4X8MA 2OSBA 3EWSA 4LHYA 5C4GB 5L8VA 4JYCA 4PC1A 5JHGB 2WWXA 2VRWA 1U0HC 4MYTA 4Y0AA 2EFEB 5FUYA 1G3UA 2O0HA 4HB3A 3NH6A 1OXUA 4QRHA 1KHTA 3ZVLA 3RVBA 2HT1A 1KTVA 3W6NA 4GOKA 2C99A 4C0BA 4EIWA 2OEPA 1FZQA 3ND8A 1FP6A 4QJ3A 1NLZA 2JJ2A 2VQSA 3U44A 4LJ5A 1ZRHA 4XWOA 2B6HA 3LDAA 1NSTA 2NZ8A 2PBRA 2Q9CA 5CYOA 2ZUDA 3BRWD 2ZJYA 3QY0A 4EPTA 4GZMA 5BWMA 1KK2A 4FMDF 2V6IA 3QNUA 1QHNA 2EU8A 5CIQA 2WJIA 4KYUA 3SE0A 1E9FA 5EZ5A 1QVAA 3Q8XB 5JI2E 2J87A 5JECA 3GLGE 4V03A 1H8HA 3I3SR 1FL9A 3QF4B 4PO9A 1U0LA 1GOTA 1D2MA 1Z0FA 4JYBA 1GKYA 2NTYC 2ZJOA 1JBKA 1E9BA 4FI3C 1DAEA 2VH5R 1PVOA 3B1ZA 3QVUA 2QSYA 2YZ2A 3K53A 4ZPXA 1L8QA 3W3ZB 1TTTA 4ZI3A 3EZ6A 3DDCA 3K9GA 3OEEA 1OB5A 5J4LA 4LYHA 1X6VA 3L0PA 2H17A 1DAHA 1ZBDA 4PHHA 3CB4A 4BEJA 1GWNA 2P67A 4JLVA 2Q3MA 3ASZA 3CX7A 2YINC 1XTSA 2J7PD 3GLFB 3GEIA 3CNNA 2XJ9A 2ZAMA 1AIPA 3FKSD 1NMZA 2WWYA 3I62A 1KAOA 1W49A 1BO6A 4UXHA 1OFIA 4HAXA 1XMJA 1PUJA 4QFMA 5JMTA 4TL6A 2A9KA 2QG6A 2BC9A 3CM0A 2G0NA 3K0EA 4AD8A 1Z83A 2WJYA 3HR8A 4Q4HB 3VR1A 1RVDA 2J1LA 2ZYUX 3AUXA 1GG2A 4G5RA 1K6MA 2C77A 4HSEA 1MH1A 3WRXC 1ZNZA 3TUZC 4RD2A 4I1UA 2GDJA 1AZTA 1L4YA 3X2SA 2C03A 2B7CA 1E9DA 2XSZD 3DEFA 4TLCA 3G0HA 1XXHA 2HCJB 3SYKA 2ZI4A 1A4RA 3T1VA 2P5TB 2NMVA 4PZLA 2EFHB 4B47A 2R6CA 1ZAKA 2XZOA 3TQFA 3LBNA 3ZH9B 3GLIE 3K0FA 4QNRA 3RS4A 2O8EB 4JVLA 1KJZA 2FN4A 1JPJA 1N6RA 4NCJA 1GIAA 3MRSA 1D5CA 1U81A 4QOSA 5JSZB 2V54A 1ONBA 3MUFA 4L4UA 2J7PA 1N6OA 3B7GA 1E9AA 3FKSA 4ZKDA 4AYTA 5DYIA 1JQLB 1XJ0A 2H16A 4TMVA 1LB1B 4QNMA 1FX0A 1UKZA 2QP3A 1Z6TA 4A0FA 5JJKA 1JR3E 3EARA 3GLHB 1W36C 4I1OA 5TB5A 2MSDB 3QKSB 1W4CA 4M8NE 3PFIA 3GLIA 1WXQA 2J0QA 1R2QA 1GUAA 1SKYE 2QPOA 4HLUA 2V55B 1DAMA 4PZYA 2R2AA 4PANA 3NXSA 1M7BA 2NO9A 1GAJA 3QXXA 1KMQA 4MGZR 2IUSA 3KJGA 2XSZA 1L2TA 3AKDA 4GSYA 1WRBA 3SBEA 2YWEA 1E98A 4C7OA 4IOJA 1AN0A 1IXSB 1N0UA 1EWRA 4FXPA 4M1SA 4Q47A 3UK6A 3OIVA 4OI2A 4GP7A 1E1QD 2DBYA 3UWKA 1OKKD 3KUCA 2F7SA 1OFHA 1E3MA 1RRFA 2PCJA 2WICA 2F3RA 2JCSA 3KUDA 2QE7D 2FX3A 4IDNA 4B6FA 1LVGA 1P62B 1S4QA 4TL9A 721PA 3THWA 2FZLA 1MT0A 1ZM4A 4JVMA 1CJTC 1Z5ZA 4PQFA 2NG1A 1TQ2A 3KXIA 2XITA 1Z07A 3LWNA 1NVVR 2FFQA 4Q1BA 4MDEA 3DOFA 4NPHA 1OIWA 2WSSD 4GI7A 4ARZA 3W8RA 3OEHA 1WDTA 2OCPA 1U8ZA 1YJ5A 4Z8XA 3ADCA 3C7KA 1EXMA 4N1AA 4MYCA 4NYIR 1BS1A 2PEYA 2PMDA 3CZQA 3PJRA 1W48A 3KKQA 2YKGA 3RS7A 2VBCA 2IS1A 1IHUA 1FTSA 3SS8A 2FG5A 4A9AA 1Z63A 1P7CA 4A82A 2PEZA 5JS7A 4TQ9A 1II8A 3W90A 1GNQA 4RFSB 1US8A 1YZGA 4FMCB 5JBQA 4TN1A 3ZDQA 1E1QA 5GJBA 2ATXA 1KGDA 1OKKA 2B21A 3AQ4A 5FL7D 4NONA 1XNJA 1Z8FA 5G3ZA 4TZ0A 5FUXA 2WPDD 2CLCX 4Q7LA 4TTPA 3I61A 4WZAE 4S35A 4CRWB 4TMTA 1R0XA 3IHWA 1IM2A 1XPUA 1XCMA 3TE6A 1Z6GA 3BH7A 1N6KA 1Z08A 3IQXA 4DSTA 5KNDA 2Z43A 4K8OA 4QBIA 4LV8B 3WMEA 4ZDJA 1KDTA 2JLUA 4D4KA 421PA 1DTSA 1CULC 1VCOA 3AVPA 5EZ6B 4ACBA 2IBMA 3FFBA 2R62A 2RGCA 1Z6YA 2CVFA 4HAWA 3K09A 2O8DA 3QF7A 4PO1A 2QT1A 4HZIA 5FPSA 3TLXA 4ZCLA 4LYFA 3E70C 2HYDA 3ADBA 2JAQA 4DDUA 2VHJA 5CLQA 2CK3D 4EPRA 1GM5A 1FMLA 1KYIA 3CLVA 2ZSAA 3GJ4A 3IPYA 1VDZA 2QROA 3U3JA 4UNRA 1EESA 1M8PA 1S3SA 1LFDB 3H2YA 1NN1A 4IVPA 4HAZA 4Z54A 2W83A 3MLEA 1N6PA 2L0XA 1W0KD 4BFVA 3TUJC 1II9A 3KKPA 5DH9A 1DOAA 3AGPA 3NTUA 3X1XA 3DM5A 2O0KA 4AK9A 2H18A 4LPSA 4GOJA 4LGMA 4XJXA 4BFYA 4DLSA 3U4QA 1E2HA 3GCGA 2OXRA 1BYIA 2ZR0A 3HYTA 3N2IA 4YC7A 4A2QA 1F2TA 2A5YB 2R6FA 4DT1A 1G20E 1E69A 3RLFA 2DWPA 2YC2C 5KOYA 4LHXA 1DBSA 2B8WA 4OQLA 2FFBA 1FTNA 3DM9B 3QG1A 3R9WA 3B9PA 5GJCA 3K0AB 4V02A 2D2EA 3EWAA 3NG1A 1Q0UA 2QNRA 1A1VA 4HB2A 2H1LA 3KQHA 1NIPA 2IS2A 4B32A 2D4HA 2IUTA 1YZUA 4JVSB 5L3SB 2FZ4A 3CF0A 1G18A 1E9EA 1E9SA 2XJ4A 2ZS9A 4P4TA 4W5JA 3KQKA 2J45A 3GD7A 4XD7D 4XIGS 3QXJA 3TRFA 4BRUA 1G5PA 2IYLD 1SKQA 1G7SA 1GVNB 5KSPA 2CCJA 1QHHB 4X8OA 2JIZD 2PT7A 4KLNA 5B64A 4AKGA 1W0KA 4R2HA 1X8JA 3HPQA 4IW3B 1CJKC 2QBYA 2ZRGA 2WJVA 2VF8A 2BVNA 4HUTA 2ZEJA 5FBVB 4EJSB 2QI9C 4QGFA 3SR0A 1RFLA 2IXGA 121PA 2IYRA 4PO8A 5J5CA 1G19A 4ZV4A 3I5YA 2F43A 1QG4A 1R6BX 1EWQA 3AH8A 1LS1A 4D4LA 2HXYA 5C4MA 3N5CA 3SJBA 3MMPA 4RJLA 1KI2A 4XWAA 2GVZC 2KI5A 4DUGA 2PX3A 4NYJQ 1W1WA 2ZQ5A 2ZI6A 3M1IA 1UDXA 4HZUB 3LVRE 1ZVQA 1UBFA 1WQ1R 2FNAA 2J0UA 4RD1A 2GXUA 1KSJA 2EFCB 4NCIA 3R8FA 4OYHA 4W7SA 3A6PC 2BCGY 4KFTA 1VPLA 4D4MA 4XD7A 3HP1A 2WTUA 1WMSA 4B3XA
chains in the Genus database with same CATH superfamily
1BQEA 2Q50A 3KPWA 5K0GA 1JH8A 1IHPA 1E6WA 1RYMA 1A9YA 2OE2A 4KBGA 4TX1A 4ND4A 5FULA 4UM9B 2X2FA 2OSVA 1H4SA 2XCUA 1X3SA 1C5KA 3H2SA 2YJNA 4JAVC 2KS6A 3IT3A 1EHCA 3QPWA 4J1SA 5EJ2A 1XRQA 5P21A 1IJFA 3VR4H 2LTAA 2JGMA 4UTOA 2BFCA 3DD5A 4WCFB 2J0SA 4L9SA 2XUDA 3D02A 2PYDA 2YHIA 3EC1A 1U5AA 1X7WB 3HABA 4QFBA 2C7QA 5L3QB 1WCXA 2Y05A 3HO6A 2JLWA 3TG2A 3DCNA 5DCUA 4C4AA 2WQ7A 3EIHA 1BKYA 1GP2A 2CUTA 3I1FA 3ISTA 3OAAD 2DBZA 4ZT3A 4ND3A 5FPKA 1IXKA 3NBZC 1KO1A 1GKLA 3X2FA 4HEA1 4MVXA 4DQXA 4B0PA 5DLDA 2C5SA 3JD2A 4EHKA 1GG8A 3JZMA 1XMPA 4G07A 2ODAA 1FF9A 1K5HA 4RF3A 4YECA 4KR3A 1LS6A 1FP4B 5LB4A 1YB2A 4U2KA 3RV3A 1O77A 1UJ6A 2VHEA 3CW8X 4UPDA 3SZGA 3SC6A 1EFPB 3GV0A 3LBHA 1IPEA 4YBRA 2XMDA 2GR9A 5AHOA 2QJTA 5DT9A 1TRKA 3LZ6A 1IB6A 1N57A 3EFHA 2GCNA 2JFBA 2IL1A 2J33A 4FHDA 1VFPA 4HNQA 4JP2A 1WU8A 4ALNA 1YB1A 3V8RA 5DLPA 4PBTA 2PKQP 4RYLA 1QZ3A 5LD2B 1I24A 2KPOA 3ZHBA 1NVMB 3LUPA 1UBTS 4RF5A 2PZKA 4LF6B 3OIUA 2FDXA 1VLVA 1WY7A 4FW9A 1O4WA 3FBWA 1VPWA 3F78A 2YZMA 1TQ6A 3OBIA 4JJZA 3NEYA 4CGYA 1KGSA 4P7BA 1KHHA 4EHAA 2OA0A 4GLOA 4C89A 2VNKA 1DVRA 4AZTA 1VJ1A 2ZYWX 3BGOS 4QYTA 1D8AA 3RTGA 3Q7EA 4NENB 2OHFA 3DKKA 3EC2A 3AU9A 4IXTA 2AEEA 3MGBA 4DCNA 4K46A 3OAAA 4M83A 2I1WA 2NTVA 1X2EA 3PG5A 5FUVA 3R5KA 1EA7A 4F45A 2ZYHA 1MN6A 2WAYA 1YO6A 5DISB 1PZXA 2Q1YA 3ZNNA 4A6PA 4URWR 2B99A 1J97A 2ETXA 1ISSA 1I6LA 5EQDA 1FLNA 4ZYYA 3JYPA 3DLTA 4RVHA 4PLPA 4QUHA 2ZAOA 4MGKR 1U3VA 2A5DA 2DZDA 3DYBA 3K4QA 4IIJA 1MX1A 1EEHA 5T8KA 3TVTA 1VCHA 1PBNA 3BQMB 1JKJA 4D80A 1YMVA 5JG7A 5CLFA 5CIYA 1MNAA 1JSZA 2DG2A 3BF8A 5I9BA 1UWCA 3AKCA 3A7EA 1XC7A 5G40A 5FR2A 4HVAA 2DB3A 1E7YA 4MKHA 4Y6GB 4KAAA 2C4HA 2GYYA 1UC4B 4V1CA 3DCJA 1L7DA 4WACA 4TGLA 3HVRA 2PLFA 3ZDDA 4RU1A 1S0UA 2DKFA 1ZY2A 2PFKA 3I5UA 4IX9A 4M9RA 4OYLA 2PRZA 1NF9A 3V4FA 2EV9A 1SBQA 4S1VA 4Q03A 3HSYA 4TTTS 1QPZA 3H9UA 4MPTA 3SYRA 1XTBA 3PR1A 4HL6A 4Y2QA 4CLOB 4G0UA 2O8FA 2H1RA 3NDPA 1S01A 4YN3A 4LVOA 1COWD 1Q0PA 4F6RB 3UWDA 4URFA 3WGQA 1A97A 2REOA 4MRPA 5K3FB 4RUKA 1ES9A 5DGXA 4BLQA 4TYNA 1O0SA 2HA2A 3O26A 1P9WA 3QXGA 2WFAA 1BFDA 3QW4B 1GL6A 2CEAA 2FW9A 1L7VC 2BCEA 3QG5A 3O1HB 5FTKA 2VTBA 3FOEC 3VHXB 1E3WB 3EFEA 3RARA 3UJ6A 5AK5A 2VR1A 2IV7A 3TQQA 1RCUA 3ZIAD 3UW1A 3DAGA 1G8AA 4XWTA 4DJAA 1YNSA 2Y4NA 3G6WA 3CUSA 3HJHA 3P7MA 1XL1A 5KTPA 1TQHA 2AMFA 5KTOA 2EBFX 4Q4HA 4QGBA 2EJWA 4YNBA 1XTRA 1YR1A 1ZVMA 5C8ZA 5EJ5A 1TT5A 3R6TA 1OHHD 3P2YA 4HYTA 4ZVLA 4A8TA 1WW2A 1P29A 3PFGA 2OBLA 4WNAB 4MI6A 1SCIA 3E2PA 2HMWA 1KTIA 4C30A 2XB2A 2MHCA 2AJDA 4RYDA 3TLJA 1LFAA 3SVZA 2VEDA 2J5KA 4XQ0A 1UQRA 3AUYA 3OLWA 4E07A 1TDJA 2OV3A 3HXPA 3LT0A 3VZRA 3H5TA 3W3AH 5JZSA 1HFKA 3K70C 2PJZA 1P4JA 1COWA 2PRIA 3PFWO 3BXZA 4V0QA 5CYPA 1TEXA 3GLHE 1NUQA 1V4VA 2J4DA 1SIUA 2XD9A 1YZYA 4UUMA 3MNFA 4C0JA 5IEJA 3S2YA 2P6RA 2DECA 2PWAA 1JVNA 2O8EA 4HNRA 2Q4RA 3ETEA 3AT1A 5FI3A 2DBVO 5L4NA 3CUUA 3LXXA 4EKEA 4AI6A 1Z88A 1EVJA 1ITZA 3GVHA 4AVYA 1U11A 5K3DA 5JSZA 5KOHB 2I03A 3BC1A 5B7PA 2JNWA 3ZJ4A 3ZW9A 2WM3A 2I9KA 3PEFA 2JBAA 4N6OA 5FWDA 3TJRA 3ZIAA 4CNBA 1U2DA 3AR7A 1G5TA 4YFYA 1PJCA 2OK7A 2GSWA 4RO0A 1AB6A 3NXKA 4Y6PA 1WSAA 2AMVA 2YZKA 4XM2A 2UUBB 3IHTA 5JZVA 4MICA 2KE5A 2XV1A 1TMKA 3D7MA 1NE7A 3GAMA 3FDZB 1F8FA 3C3BA 4JFAA 4TS4A 2J5XA 1FFYA 4UDXX 1JX6A 4DV4B 1CUVA 1NZFA 4C0SA 3V48A 2O2YA 4OMUA 4CUJA 5BVGB 1OBOA 2JPDA 1HKHA 3LX6A 1TEHA 4QSHA 1UFRA 3WWOA 4EENA 3HCWA 3SBDA 1GPBA 2QPAA 1W5SA 4QYWA 3F4LA 3OFNA 3PDWA 4HRVA 4BTEA 1JHQA 4BMCA 3ID6C 1DU4A 3FUWA 3BN3A 5FD8A 2CLMB 3MMSA 5CPBA 2ZRCA 4YRLA 1KP2A 1G8YA 1FFBA 3B13B 3H9JA 4IXDA 2EKPA 2VBFA 2D8AA 1YRBA 2K2WA 2VZ9A 4Q12A 2E1PA 1DGQA 3HKEA 1E0SA 2AQHA 4IOLA 4J8PA 4W5HA 3UBTA 3WHLA 2YC4C 4XB6B 4ZANA 3ILVA 1GNTA 4G5FA 5H68A 3N2EA 5JSHA 4HQOA 2VSFA 3LCMA 1G66A 3M2PA 1M6VB 4RD0A 4RJIA 1U0SY 2ZUFA 5BW4A 4XUGB 1E94E 1LBHA 2B1IA 3UGQA 4IDFA 4P5PA 3WGKA 3WWEA 5LL6P 2QVZX 4NQRA 4DBLC 1GLVA 4E94A 2J46A 3W2HA 5FDFA 2P35A 2H9AA 3T1NA 1CJBA 2H4FA 2WJZB 3BAZA 1ZNXA 3IOEA 4N5MA 1QAMA 2IEBA 2O7NA 2XB9A 4XFDA 4ZOLA 5TPWA 1OZAA 2CDCA 2OUKA 3AERB 2V7TA 4NY1A 4D42A 1WDLA 5JI3E 2DAPA 2PLRA 4H35A 3R7FA 4IIXA 4PZDA 3QWIA 2ASEA 3L7BA 3NHAA 5CVCA 3ITKA 3KVNA 4ZDKA 1W6UA 3C3CA 1Q21A 1Z4MA 1MOSA 2FPKA 1GGFA 3H8JA 3QJ5A 1KP9A 5BV2P 3ON5A 3FDXA 2Q3BA 1T5IA 1ODSA 1ORTA 1RW4A 2G17A 2G3YA 2V74B 3IJ5A 1W85B 2GPTA 3C3DA 2A88A 1G6KA 4HDSB 4I36A 1S1MA 4WN9A 3VSCA 2CEKA 4YPVA 1BWSA 2QRJA 1HOXA 3R0JA 4FEEA 2IUUA 1U2SA 1PJBA 1Y3AA 2X5KO 1H65A 3M7IA 2BFDB 2I6GA 5AXBA 3UA4A 3PEVA 2EP8A 3JQEA 4F2HA 4QT0A 5H02A 2UVPA 1M7GA 4RGQA 4Q9KA 3VYSB 4EAAA 2PUDA 2HW8A 1H5NA 3UT6A 4DDTA 3SKXA 4E5VA 4BVAA 5JS8A 2H4JA 2PH1A 2VQDA 3OCYA 1EWYA 1P1BA 3AHCA 1NV9A 3JVDA 4NCNA 5KNBH 4JA2A 4MVJD 5LKRA 1IVYA 2OY0A 4PLFA 2PXHA 3BE4A 4Y1FA 1WHTA 5EUMA 3QOXA 5DWVA 2ZIVB 1YKSA 5AJVB 4B7AA 2XZDA 3P0RA 4O8ZA 2AL7A 2GHTA 1E2MA 5PNTA 4NE2A 4K7JA 1PNOA 4QE3A 3AWDA 1A2BA 1KZYC 5IS2A 3PUHA 4D8YA 4D81A 1U0TA 2HMYB 2QZJA 2SHKA 4NFYA 3KO8A 2YWGA 3AZPA 2RC5A 3DOHA 3BG5A 2KM1A 2UDPA 4RIEA 1MB3A 3VPFA 2AR0A 2C7RA 1E7SA 1Y9DA 4UHFA 1YF3A 1IPHA 4BFXA 5D3MB 3A27A 4AC9A 1M1ZA 4WEQA 5JDCC 4GR4A 2FP4A 3F96A 3HR4A 521PA 1LBIA 1ML4A 1A2QA 5TF0A 3U40A 3ZEIA 2ZIWB 4CVNA 3GLGA 1OJLA 4BVJA 1L9XA 3PNMA 3CNOA 4KFUA 3TIXB 4LPKA 2Q3EA 3FUTA 3LV8A 2HU2A 3H19A 1KJJA 1KPGA 2Q5EA 4MCAA 3P9IA 1VGQA 4UBJA 3G6KA 1NJSA 5DJ5A 3RUCA 4DB2A 3ADPA 1RIIA 3ZCSA 2Q3HA 4DDHA 3D64A 1M2OB 3BULA 5LP6C 1M2FA 2YQ4A 5DHQA 4PBSA 4KX5A 2OOKA 4RAOA 5DKFA 4U7GA 1L7BA 4NDZA 5I7AA 2W6JD 5ITSA 2XB4A 3WFIA 5BUZA 4MVJA 1XTUA 2GYWA 4KMOA 4LDZA 4TLDA 1GPH1 2ZIFA 2NOAA 2JFFA 4XR9A 2NNWB 5AVXA 2I99A 5LXTA 1KI1A 2SBTA 2PWBA 2WYWA 1UWLA 2X9NA 3S0JA 5K8JB 4JKYA 3LF1A 2CXRA 1A27A 4K26A 1N7HA 4ZT2A 1T9BA 1DPGA 3AR9A 4YLGA 4YMTA 1QZUA 1TF2A 1RLMA 1K88A 1LQTA 3C7TA 3CUYA 1RJGA 3HKBB 4MS1B 4BNVA 4F2GA 3LY7A 4F91B 1M8FA 1XP8A 2A4MA 3U2QA 3ZVKA 4WEOA 3O8NA 1JWLA 1IQ0A 2X5NA 1KOLA 1Q3KA 4UBLA 3S8YA 3ONEA 2VCEA 1PU2A 1G1MA 4GBGA 2EBHX 4ZFNA 1N8SA 4RKRA 3GRAA 3AR8A 4R1SA 1SUEA 4M1EA 2OM2A 1CETA 4Q3NA 1QMGA 3OHPA 4JJ7A 5EP4A 3LUFA 3VHQA 2PUCA 4DWJA 3SG0A 2GEFA 3H1BA 3EVAA 4LHZA 1T5HX 1JQKA 3FTDA 3JQ6A 4PAQA 3QUTA 5JCOA 3LOPA 1RLOA 3BERA 3RF6A 1H1DA 2ATIA 4M0EA 4XE5A 5L3SA 4AT1A 2E5LB 2GAJA 3FPLA 3C8HA 2W2OA 1REQA 2IXAA 4QBKA 1LZKA 2XCIA 4HBZA 4KAXA 1XAIA 3B9QA 4KODA 4LXQA 2VSYA 2O2JA 5BPFA 3TCXB 4LWPA 3VTAA 2IOFK 2ZUTA 2O2DA 4KI7A 2BM1A 5CFLA 4LCBA 2W6JA 2RAPA 2PTHA 4H0FA 1C9MA 2JGRA 1YDHA 2CV0A 1VBFA 2R00C 1BVRA 2RGGA 1JIUA 1T2AA 2B7BA 2ZSIA 4WHMA 1E96A 2NZJA 1THTA 3BMOB 1R9GA 4MVYA 3ZEAA 3BICA 4CKZA 1Q3HA 3GAAA 4ARIA 1PQPA 1X7GA 3E7FA 4IH4A 4UCXA 3GJZA 1RJFA 2OHGA 4GPBA 4MQFB 5EMMA 2NQ8A 4ZV7A 5J40A 3ESXA 3RC9A 3WKBA 1Z45A 3B20A 4JX8A 2HO5A 3I9KA 3KLOA 3S29A 3TLZA 4UUBA 1GZ4A 2BFMA 1C1XB 1AHHA 2EQBA 1P72A 2QRGA 4MUAA 3RG2A 4YRRA 2I54A 3AIMA 1P1JA 3DHWC 3V1LA 2I33A 4UVGA 3QBVA 5BV8A 2A5LA 2FVYA 1F2UB 4DRYA 5I4KA 1YVPA 4BIIA 3JQAB 2HHHB 3IPRA 4F6RA 2QS9A 4IZOA 4TVSA 3U6BA 2M98A 4CXMA 1RTTA 5CFQA 3OE4A 2PZLA 3LTEA 1O94D 3U31A 5A03A 2GLTA 3WK4A 4TV9B 2UUAB 1N6HA 3AUTA 2ZRHA 3B51X 4TRJA 1JBQA 1EHIA 3ZUPA 3T7JA 1ENZA 5KSWB 3KIPA 2ZE5A 3HP4A 5FUWA 2AN9A 2HMAA 1UAYA 4RTJA 4BPBA 1OXKB 3SXJA 4H1WA 4QUBA 4GKKB 1I4TD 4JBWA 4AJIA 3ZIUA 4LDNA 1AS0A 4WESB 3RF7A 1Y1QA 2XNSA 3I01A 4YA6A 4A4DA 1N6LA 1ZLXA 4OSEA 2PQ6A 2H8GA 3WIVA 1XX6A 4JKOA 2HD4A 2OT3B 2R9VA 4PGAA 1WHSB 1NQ5A 2B34A 4V2IA 3RRMA 4PZPA 5KX5F 2HIMA 1CB7A 3FLMA 5U4QA 3FI0A 3WMRA 4GPTA 5IYZB 1E5XA 3MJHA 3L04A 3BK1A 2RAVA 4UDOA 2VPQA 1VZ3A 5H16A 5LQSA 1UP6A 3A6HA 4D6XA 3LK7A 4GDMA 5AHKA 1NW5A 3IAM6 1DFIA 4FN5A 4CJXA 5BNZA 2W2KA 1G41A 1EGQA 1XELA 2VFAA 3BXOA 2I91A 1MX5A 2H5EA 1BG6A 4O4JF 3H13A 3L6BA 4G8CA 4E5PA 4N39A 4ZT7A 1SUDA 2BBOA 2CMGA 1IN7A 1X39A 3AMVA 5TMEA 2QG4A 2RKWA 4J29A 2PJDA 5JAHA 3BB4A 2LE0A 1VJ0A 3A3NA 3VSBA 5JATA 3D81A 3O4JA 5CA0A 3LUKA 3D2CA 3OOWA 1L5NA 2CXUA 5KVAA 3NB0A 1U6IA 4KN8A 2GN4A 3NP9A 4BZZA 2OV1A 2TRSB 4I1YA 1E6CA 1KH1A 3V33A 2YV4A 3UK7A 1DBQA 5IT5A 4HPXB 1JHPA 4JYPA 1F20A 5FNVB 3HHPA 4UUQA 1AS3A 2FRDC 1Q5PA 2D3WA 4M9CA 1KQPA 4HUQA 2I8CA 4WMLA 4ZEWA 2ZP1A 2W2NA 2GBCA 3WBFA 4N3BA 1USGA 1QV7A 2PUTA 5CTAA 2NVUB 5BR8B 5EJMA 4H77A 1SCAA 4PZEA 1N92A 4U6NA 1CJMA 4GG1A 2GASA 3BZWA 4Z9XA 5KYGA 3E5RA 3H16A 3AUSA 3HI4A 4MH0R 4C0LA 5D85A 5F3DA 4I55F 2ZB8A 1TIKA 4L95C 4HWPA 3KLNA 4GPAA 3DZ8A 3DL4A 4BV8A 1U8CB 4NQZA 4OHMA 2D1SA 2B94A 2R7NA 1GZ7A 5KYYB 1SB8A 5BQPA 4OHUA 2F1IA 4JJ8A 1K0FA 3QX8A 4JUDX 3IIKA 4DLRA 1C9NA 3TMYA 2B69A 3L9WA 3DOJA 1K7SN 4U4AA 1JEDA 1FNCA 4LBYA 4MEAA 5CLLA 3MINA 4N8DA 2HWWA 3DKPA 1QONA 4FJ2A 2C1XA 4Y3UA 5JPDA 4ZZ3A 1K8ZB 3L8DA 1RBQA 4D2IA 4ZVMA 3SXUA 3MD9A 4BO1A 1KORA 2ZYGA 1C0LA 1N7GA 1VHTA 2PX2A 2QN2A 2Z98A 3F67A 4PC3A 4TV8F 1JS1X 1PWYE 2XE7A 4KNVA 5EQTA 5F4BA 1L1FA 4OPMA 1G8PA 1Z0JA 4OXRA 3GEHA 1T1EA 9ABPA 2GFHA 4PHFA 5KCZA 1XKLA 1A9QA 3V1MA 1JWAB 3H1PA 4WJZA 5CNMA 5ISMA 1XMQB 3T0FA 1HWYA 2JLCA 1Q6ZA 3EEOA 3TR6A 3I2GA 3SMVA 1JA1A 3OWXA 1N5IA 5GJVC 5KI6A 2SCUB 3Q3IA 1QZTA 4KYTA 3T12A 4QDKA 3QPDA 3OT5A 4FZ5A 1E7MA 2IODA 1I2AA 2EZUA 3HN2A 3Q9SA 4X41A 3MSXA 3TXYA 4FDMA 3TPCA 4Y7DA 2IHZA 4IHJA 3K9LA 4J94A 3HB1A 4LMAA 4BBJA 1FS6A 4F60A 2E3JA 3WYFA 4BLUA 2I4OA 3OJWA 4X93A 3BX1A 4ENRA 4AICA 1GDTA 2DUMA 2ACKA 5EE5B 1T0HB 4NJMB 4URVR 1P2VA 3E1GA 4C76A 3WTCA 1JIQA 4HATA 2O0JA 1XXHB 5FEUA 1SXJD 2UVQA 4OXNA 4GO1A 4C0HA 4MUKA 4QYSA 2PUHA 1Y1TA 1XAGA 1NI4A 3RLIA 5EWJB 4F84A 4Q66C 4YUAA 1TEVA 3QHAA 4Z7JA 1ACMA 2AUMA 2HEIA 3D7NA 1G7CA 2EJBA 3JALA 4RIIA 2BR5A 3LXRA 4AL4A 1GNSA 2HOQA 2GK3A 2HF7A 2C0CA 5H1YA 5AW9A 1GG5A 1ZHOA 2P78A 1I4WA 3MS2A 3K0CC 5HQJA 4BWGA 2RGEA 1DRUA 2PQ2A 3BXPA 4JB3A 4DWOA 1ZIPA 2O06A 3HM9A 1A8UA 2AFVA 3I9LA 4AF8A 1TMYA 4KI0A 3QVWA 4A36A 2AKAB 1FNDA 3Q3JB 1IUOA 1UXKA 3RREA 2I1VB 3ELWA 4YXWD 4AX8A 2IFTA 4UZSA 4MR9B 5IJZA 3NVMB 5DEOA 2WMOB 3WQHA 2O7QA 3C1TA 1OMOA 1A5ZA 5CK4A 1SCNE 2OAEA 5KVVA 2JAUA 1O6GA 2SKCA 3GCDA 3F9IA 2IU4A 2HTFA 2IHUA 1P1FA 2PSFA 1K2WA 2I4RA 3WGLA 4CLOA 1U7PA 3V4RA 3D8HA 4PZZA 3D2AA 5HILA 2J9YB 1GAWA 3SSNA 4BKRA 5AM3A 5HVNA 4ARBA 1BFKA 1WXFA 3ZOKA 5DNCA 4BUZA 1PFUA 2PGDA 1EBBA 4JUCA 2BEJA 4R5HA 4ZAFA 2PPVA 2C82A 1LI7A 2KBFA 2OILA 3HRIA 2FWNA 1VLHA 3H2KA 1WVMA 2QM7A 4AWXA 1HYHA 3ZCPA 2BKLA 4N7JA 2CVPA 2Q6TA 4ID9A 1ORRA 4LWZA 1OB2A 1MVLA 4KFRA 1KYYA 1Z4QA 1H5UA 1TU3A 2E4WA 2QZSA 4MVJM 2DFDA 4G0OA 3FTFA 5AHWA 2Q1SA 3NGLA 4OU4A 3QKIA 1JHUA 2AV6A 5LU8A 1OGIA 3I8OA 3UPUA 1RZUA 2X23A 1K5DA 3LO5A 3GRVA 3MGCA 3NGMA 4WSOA 3JASB 1C9DB 4RV4A 3QXHA 1HSOA 2VUIB 4NDNE 3L7LA 4XSHA 2C95A 2HDHA 3IHLA 3ZVNA 1R7RA 2AX3A 1X7ZB 5DCWA 1RWPA 5GGXA 3RU9A 3QX9A 3FZNA 1Y9JA 1RI3A 2OBBA 3PF9A 4IDAA 2AI1A 2VA9A 4Q9LA 4UTZA 3K31A 1N5OX 1UDBA 1XB2A 1V11A 2ZCUA 4YXWA 3GFVA 4BMZA 4DQVA 2UZIR 4QQ8A 4KXYA 3STXA 1L8AA 4Y6RA 1V2GA 1Z3CA 5G0TA 4C1BA 2DM6A 3OKPA 2V65A 4P08A 1V7CA 4EA6A 2Z6UA 1OZHA 2WHRA 1G64A 2H63A 2A4KA 3CN7A 4U7JA 4JELA 1YXMA 2Q9AA 2VH2A 4R83A 4RK5A 3I30X 4BASA 4D9NA 4EJFA 4QBHA 3H7AA 1OWNA 4I3HA 3HXLA 1A8SA 4HMQA 2IPAB 1VKOA 3Q10A 1EUCA 4YMWA 5TT0A 4QHSA 4ZVQA 1K8XB 1OA0A 4MQEA 1FYXA 1XVIA 3UCXA 1OX6A 4TROA 1QYCA 3LHDA 2NO7A 5JXHA 1AY0A 1OJ7A 1EWVA 2IYNA 2QUIA 1JIKA 3EZ9A 2OFXA 4ISBA 4Q4AB 4Z49A 6LDHA 1YOVA 2V3CC 2A57A 4R5MA 1T2EA 3ZWAA 3GJ5A 4AJ1A 1DG1G 2AFRA 4R7TA 4NEGA 2QRVB 4D3DA 5ER6A 1MGPA 2Y8EA 4C7MA 1SCUB 3V7NA 3IP7A 1SCJA 1TZBA 3FETA 4DV2B 1T9AA 1II8B 3Q85A 1GNRA 1BEEA 3E2MA 3KKNA 1ZCFA 4LF9B 1LX7A 4FKBA 4ZZ2A 1RRCA 3INYA 2ZZNA 1P7ZA 2W6PA 3A70A 1N77A 1J9ZA 4LJAA 4NU8X 1PWZA 1VSUA 1JIVA 4L8GA 1ADFA 3S2UA 1KMNA 3CR8A 3ESBA 1GYQA 2QL9A 4QA9A 5AM2A 2CXHA 4CDMA 5ALXA 3LF2A 3NS7A 1X74A 3ONDA 1PR5A 5JJCA 1Q7RA 3LUDA 1UDCA 3GPLA 1GQSA 2AS0A 5FP0A 3WIBA 3I0ZA 2FN9A 2P1ZA 1HPLA 1U98A 4X6UA 5JMOA 1C4KA 3AOEC 4L07A 4OY3A 5EJGA 2PSJA 3C16C 3GP5A 2I6QA 4F4UA 2PE5A 3G8YA 4X54A 4J49A 1T34A 1X2BA 4LSZA 3PA6A 4C08A 4D4GA 1JHXA 3QVTA 5FBWB 5C7LO 4V24A 4L2IA 1ICIA 4B7CA 2BF4A 3OZAA 1YL7A 4NHOA 4F4CA 3G3EA 4NOMA 1J99A 2AC4A 3U61B 1UBJS 2HQSA 2IYEA 3DTYA 3K1TA 5JTUA 1DJMA 3RTEA 1YULA 1Z34A 2K4MA 3IPXA 3AHIA 5LQJA 3UAZA 2YL2A 4MUMA 3MCWA 3WIEA 3BHJA 1MEOA 1UJ4A 4Q39A 5B36A 5TQJA 2BGMA 3MILA 1NBOA 2Q2WA 1Z2DA 4V3BA 4MJ3A 4X0EA 3B2EA 3PHJA 4XQ9A 4FHFA 1T6XA 1LDNA 4OP3A 5KINB 2RB4A 4KR2A 3I01M 4MSUA 4D02A 4C07A 2WIAA 4NHEA 3CZCA 4B81A 1BA3A 1PJZA 1FB5A 2IYTA 2RHWA 1OGJA 1EBFA 2X4IA 3CHYA 4FQ5A 2EBUA 4GLJA 1LX6A 2O2EA 1Q83A 2XMZA 1RMTA 3FGZA 1ABFA 3EUAA 1IDOA 2HV8A 3CQ9A 1M6NA 3SEAA 2ZR9A 2HF2A 5FYDA 3GFBA 4ARSA 3TW8B 2FMIA 5TMBA 4CQNA 1XOIA 3JQRA 1T4CA 4GOXA 4PGMA 3ZY2A 2OBNA 3M9WA 1JNXX 3IAUA 1Z8NA 1YZKA 3LUGA 1W73A 3U4QB 5JXGA 2FRXA 4BMYA 4FYPA 5CDTA 3BTUA 1UPTA 1XZNA 3Q7RA 3GLFA 3E22B 3WSVA 3KTDA 4PG8A 2ZYSA 1ZKMA 1WEKA 1HQCA 3IMCA 4NABA 4BMNA 1U2QA 5IKEA 4U7DA 3AVXA 4ITVA 4QU8A 3TTYA 3FYTA 2EZ8A 2XI4A 3PEEA 4OB6A 3GFQA 3G8AA 5COAA 3FKJA 1RYBA 1TZKA 4L22A 4GRAA 5AVVA 1MVNA 2O2HA 5DIZA 2NIPA 3EAQA 3OJXA 5JD5A 5KHLB 1K98A 1FPQA 1HY3A 2RK3A 1FS4A 4M60A 4O29A 1TVKB 1XTQA 3CRQA 3PCXA 5A5GA 4CODB 1TUIA 3TK1A 4CF4A 1BEZA 2C7BA 3DC2A 1EDDA 1UC9A 1ZIOA 4HEHA 5IW8A 1KK3A 1ZVVA 3PHLA 4D9CA 2R5WA 1QH9A 1JEEA 4I6JA 1JT2A 1JJFA 4ZOQI 4EPVA 1BXRA 4PTZA 4Q21A 4ESOA 5E2AA 3UY4A 4KRGA 5FOVA 3B48A 1Q17A 2QN3A 3C1UA 4ZVTA 4F7WA 2HJVA 4LXTA 1KAMA 3ACCA 3LFHA 4PS1A 4TS1A 1RQPA 1U5BA 4FSDA 5LLDA 4J2HA 2F4VB 3CVOA 2ISCA 4B7UA 3L7NA 4C5AA 1YRHA 2O5EA 1X1QA 1QHFA 1VMEA 4U9IS 1E92A 4NVRA 4AJ2A 1CIJA 1L4MA 3BWYA 3OQMA 3GJ8A 1V3VA 3OHMA 3E2IA 1V5WA 3C70A 2Z5FA 4QODA 5HFAA 4U6SA 5TE9A 4BAZA 4EGQA 2H5IA 1H3EA 1T2DA 3D8TA 3RSGA 1NJ8A 5CPFA 1NRIA 1P75A 1HYQA 4E5SA 3EHEA 1OZGA 5DBEX 4QJ5A 2IHYA 4ZO9A 1NR7A 5JQGB 4QLOA 2I1LA 4ZREA 4CI9A 2Z58A 1MO3A 5KVCA 5MGNA 2J0UB 1RE1A 2RAFA 1ETHA 2YFKA 1XQVA 3BL5A 4WFKA 1WX1A 4Z4FA 4Z86A 4L6AA 4ETNA 4Z9FA 4II7A 2C9YA 1HLFA 1IUNA 2G9VA 2QGZA 3PYMA 3BEOA 4J0JA 1PK9A 5LN1A 2JI7A 2DGDA 3PPIA 2Q4DA 2DKOA 4UCWA 5IKPA 1QMPA 1G3IA 3EOAI 3PX7A 1OTHA 4DABA 1C4XA 1GYPA 1YFKA 5LP6F 1QRUA 2CBZA 3RYHB 3LD9A 4PTYA 2DFKB 3UB3A 3KM0A 4RS3A 3E23A 4UDNA 3NVAA 1HT0A 1E6KA 5EHXA 3R8CA 5JCZA 2NZYA 1QVRA 3K7EA 5DGIA 2R97A 4GKJB 2P77A 4B17A 1G3MA 2OO7A 4I1VA 1YZQA 3WBBA 3UQZA 4WKCA 2CN1A 1NVXQ 1BMTA 1QORA 1P2TA 2XOKD 4DW8A 1I94B 1DCFA 3E1SA 4ADSG 1DARA 2V7QA 3CMMA 4B6EA 1I32A 2FEMA 4Y6LA 3WS7A 3ZV5A 4EM6A 4MCHA 2J9FA 1FP1D 4JNCA 2B30A 2GJAA 4U39A 2R8RA 1X1SA 4TVOA 3EEBA 3UXYA 3V1TC 2YDXA 1FYFA 2D7JA 3BHMA 4EITA 1D7OA 4MTLA 1CQIA 1U8XX 2Q3JA 5DHPA 3GEEA 4RPLA 4Q6BA 4TLEA 2QSUA 3IYLW 1Q0RA 4DV0B 3RT9A 2YUIA 4W9NC 2WEKA 4X65B 1SCBA 4F97A 2D2XA 3OM8A 5C7YA 1P9RA 3HLYA 4Q48A 5L3ZA 1A7JA 3GVPA 5DP1A 5IAOA 4IGEA 3UAWA 5AUNB 4EATA 1X0VA 2H48A 4E2WA 1CEXA 3H9BA 1N2XA 5EJ9A 1JHRA 1G8SA 1TYZA 1Q95A 3LP8A 4FGUA 3QOYA 2QTZA 1G0OA 1YB6A 1GR1A 4Q9IA 3HU2A 3FHLA 3KPUA 3LC2O 1E4EB 1JQ5A 3C3AA 5ARDA 3KUXA 4MHTA 3TKAA 4AJJA 3GG9A 3CUVA 4EUSA 1OOEA 5HCUA 4DV1B 2HYIC 1VPTA 2EYQA 4AS3A 2CLSA 4PXYA 2O48X 2PD4A 3DWIA 2GZAA 4HN4B 4WFQA 4J1NA 1D1PA 2QL7A 3GGDA 4BNYA 1JKIA 1OX4B 3C6XA 3UC5A 1YV9A 1O97D 3AHFA 2Y76A 2XOKA 4OMDA 5FOSA 3ZD9A 2FOIA 1W2GA 2H4HA 3RYFA 2OV2A 1NMEA 1KFBB 3T7TA 1KEEA 3ND5A 5J23A 3FWHA 3JW8A 2WHPA 2GEDA 3T1OA 1L7QA 3P32A 1AC5A 5KQGA 3IBYA 7ADHA 3HBAA 1JFFB 3NTXA 1OW3B 6ADHA 2B0JA 1YR7A 1Q7EA 1TT7A 4MUGA 3U4AA 3ANXA 2CFSA 5CDGA 1I33A 1OSNA 3PDIA 4IF6A 4KZKA 2YVUA 4CMCA 4EH1A 1JKJB 1O95A 2CMHA 2FQ1A 3G5AA 4WBSA 5EIOA 3T7CA 3ZR4B 4B6OA 1M34E 1ZMOA 2ZPAA 4FEYA 3UN1A 1GSIA 5C18A 2NXWA 4G1MB 5KQSA 1Q1GA 4M9ZA 4YMIA 4I1PA 3FAKA 5KDOA 4BNMA 3Q0IA 5ALQA 3AEYA 3L7IA 3NHUA 4V1CB 4A2CA 5FLEX 2NPFA 2IHNA 2E4UA 2WD7A 3HJRA 4REMA 3QPAA 2GDZA 4D97A 4S0ZA 3GELA 1JB9A 1VYVA 5K6AC 2OUIA 1A3CA 5JUWA 1WBBA 1T8TA 4MLDA 4BRZA 2G5CA 3DZIA 4TS9A 4KO4S 4Y9SA 1XUOA 1I6WA 2O8FB 1Z6AA 1QUEA 3O7MA 2YWDA 2R44A 2C9OA 2K87A 1UR5A 3A9RA 3JVVA 3NHRA 3R5TA 2VDKB 4S24A 2RARA 3UHFA 2PY6A 1MO4A 2IPXA 2Z8YM 1DE0A 3CS3A 1PFWA 1SHLA 2BGRA 3GUCA 1ZIDA 3IESA 5EGNA 5J59A 5K4GA 2PUBA 1KO7A 3KOMA 4G26A 4XW2A 4EB0A 4TXJA 2WJWA 3PNQA 1K8RA 4MR8B 2PQ0A 5JWOA 2V0GA 2D5IA 3H8SA 5KMGA 5DX1A 1JAZA 1G6Q1 4WK6A 5GY7A 1HNZB 2X58A 3HO1A 4ZODA 1JHZA 4KXMA 4MROA 1BW9A 4B2YA 2QRKA 2FHPA 1N0HA 1XXHE 2HU5A 3I9JA 3ZG6A 2FSFA 4AS1A 4XTRA 5T67A 2C5HA 3N6VA 4G24A 2GKOA 2AYZA 2NXJA 1LXCA 1RYNA 2Q41A 3GROA 2BFEA 2PT9A 2B8JA 4J0HA 2HREA 4DCSA 1ATIA 1NJ5A 2DR2A 1TT5B 4YJGB 7MHTA 1T9CA 4CQJA 4BZWA 5D84A 4YO7A 3N87A 4DZRA 1GU1A 2XDWA 2GCGA 1CZRA 1XGKA 1KI4A 3C5EA 3NOXA 4ZZ0A 3G79A 4RK7A 2O2XA 3QV1A 2B5WA 4HN2A 4WUTA 5TV2A 2BT4A 4J7CA 2C5FA 4MX8A 3D31A 1GT6A 4QXPA 3LXMA 2CD9A 3BS4A 2PHZA 2B3TA 1GFZA 3A4TA 5EVCA 3MTIA 3OT4A 4IIVA 5HDBB 2NP7A 4H27A 1E59A 2RGDA 5D7BA 1EVQA 3BCUA 1N4AA 4JMLA 1DX9A 4QDUA 2IQIA 4EFDA 2YJ4A 4ER5A 5ILOA 2VTKA 2JIOA 4Z4HA 5A06A 2DSNA 2AC7A 3NTOA 3PLRA 4GXTA 2BTQB 4NV1A 3C41J 3RUHA 3ZQ4A 2YCLA 1HTBA 2FZWA 3ZK8A 3KLBA 1XG5A 1QG2A 3D0QA 3K8ZA 3RBZA 3ZU6A 4LZZA 3WKEA 1JKFA 3GLTA 3A6EA 5M29A 2YFQA 5CFPA 1SKBA 3ER6A 1B3RA 2R1VB 2VPPA 3MM4A 5T4HA 1XPOA 4URUR 1KYQA 2HCBA 1L5GB 5B1EA 4JBNA 5KTMA 5LQDA 3TPFA 2NUBA 4B7XA 4FZVA 1RFGE 3PPYA 4ZQCB 3FWKA 1YZTA 3KNZA 5CLIA 5AKHA 4JI5B 3N1UA 4RKYA 3TAUA 3WNQA 4JGGA 4A26A 4EVSA 1WIWA 2OFPA 1HLDA 3VZBA 1TMOA 1M1UA 4HMPA 2OZKA 4PYNA 3GLUA 2Q3FA 2AZTA 3RODA 3D6VA 4K28A 2VL7A 2YJTD 1K4MA 3D3KA 3NOOA 1BWQA 3IP9A 3K0KA 2QLNA 4OD0A 2FR8A 3SZUA 4HVCA 4RPHA 2ZCVA 4PINA 1CRLA 3EVZA 4O2AA 3X1WA 3LAWA 4E31A 1CUIA 5ADVA 3MTQA 2ZSKA 4LOIA 3V8NA 3ER9A 1K7YA 1QDEA 4O3MA 2JW5A 5JH7A 3S3TA 2FDCA 1OIXA 3SXPA 2YVLA 3FRJA 1RXUA 2B5OA 1VLJA 2DFLA 2WTMA 2O57A 4NZMA 2DQYA 5KTTA 2P9TA 1FRFS 5A4JA 5CB6A 1D8TA 3P9KA 1XU4A 2POQX 3ZDYB 3FG9A 2BMWA 5CT5A 1FNMA 2TYSB 5J2TB 3CNQS 3IUPA 5HE9A 2YHUA 3S68A 4M38A 2BEVA 3O6VA 4Z4IA 5B2EA 4H4CA 3I92A 2WYHA 2YYZA 1YHNA 3EOBI 4B6RA 1NNI1 1Z74A 2YYAA 5H3LA 3T3EA <