3ZYCA

Dynamin 1 gtpase ged fusion dimer complexed with gmppcp
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
347
structure length
330
Chain Sequence
SMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVDEMLRMYHALKEALSIIGNINTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DYNAMIN-1
publication title A Pseudoatomic Model of the Dynamin Polymer Identifies a Hydrolysis-Dependent Powerstroke.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 103
structure length 330
sequence length 347
chains with identical sequence D
ec nomenclature ec 3.6.5.5: Dynamin GTPase.
pdb deposition date 2011-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00350 Dynamin_N Dynamin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3zycA00
2R6CA 3TVDA 1OXXK 3NHAA 4OI1A 3VAAA 5EZ5A 2XSZD 2JLSA 2H17A 3UATA 2CLDX 3FMFA 1JXMA 3TBKA 3WYAA 2OLKA 1KSHA 1S2MA 3PUXA 1VDZA 4EPWA 1R0XA 4NHOA 1Z2CA 5L8VA 5KDLA 1XD9A 2YV5A 2IWHA 4IDNA 4P33A 3IQXA 2FA9A 2R62A 2R2AA 4TL8A 4JLDA 2F1IA 4DDWA 2QMUA 5B58C 4Q47A 2H57A 1ZCBA 2ZJZA 2FZ4A 2UZ3A 1KDRA 4KCGA 1CXZA 1EFUA 3FGNA 2CCKA 2NPIA 4EFNA 1B0UA 2VTKA 5HR5A 5DNYB 5IT5A 5H8WA 1ANKA 4FCWA 2ZITA 2C78A 4YMUA 5FPHA 1GSIA 5A0FA 2ORIA 3SYLA 2R6FA 1N6OA 4IHQA 3BJIC 2GXSA 3KX2A 3WMFA 2I1VB 3WNBA 2EQBA 3ND9A 5BW8A 1BYUA 1G3RA 2IW3A 1Z2AA 1E9EA 4MH0R 5JCZA 4IDPA 3IKJA 4D2IA 4UJ5A 1HV8A 2DR3A 5AJWA 2W2TA 2ZSBA 4WBSA 3VMFA 2CL0X 3UWOA 3KXLA 5CYPA 3RS5A 1YZKA 1KJYA 3OAAA 1Z83A 2AD5A 4LHVA 3K70D 4WVFA 1O3YA 1EXMA 5BYJA 1XTKA 4JL6A 4BFZA 1FNMA 1SGWA 4IFBA 2OXCA 5EP3A 4WZAE 3GLFA 3KKNA 3VNVA 2EFHB 3TAUA 3K1JA 2KJQA 4MYUA 3SQWA 4Z1MA 1JXOA 2ZSEA 3LO5A 1F2UB 4JIMA 4WZBE 1R2QA 4LJ7A 4OHZA 3ZVRA 2ZRGA 4RKFA 1LF5A 3AF4A 4M21A 4D4JA 1BMFA 2IYVA 3WP0A 1NVXQ 2QROA 1YZQA 3SYNA 3THWA 5J4KA 4RCZA 1CJUC 3QKRB 1IN6A 3WNDA 2V7QD 1W0JA 3VX4A 2V6IA 3SFZA 1T3SA 1KK3A 4JLVA 2ZE6A 4MITA 3EPHA 3AVTA 4F4IA 3LWNA 3QF7A 1OHHD 1VTKA 3TIFA 5LD2C 1OKKD 3A8TA 2ZJ2A 1GKIA 4M8NE 3C8UA 1N3BA 2A7QA 2IC5A 5DSZA 4AC9A 3ZZ0A 4QGFA 2H92A 4LJ4A 4A2QA 1QHHB 2C9CA 1N5KA 2IYZA 3AH8A 3IHWA 1E9BA 1LVGA 3QEOA 3SFVA 1OE0A 2KI5A 4QC2A 3PEWA 1KMQA 2ECKA 2F1HA 2A5FA 2PMKA 3TUIC 1Z47A 3I72A 2VBCA 4KO8A 1LV7A 4H1VA 2O52A 2QPOA 1IN4A 5AJXA 3ASYA 2GCOA 2ZUCA 1E9CA 2QE7A 4QOSA 5TY0A 4DLTA 4D25A 2QTVB 1OPXA 4KYIB 3I62A 2WWYA 1CBUA 3M4YA 2O5VA 4Q4JA 3H86A 1XFAA 1OB2A 4YXWD 1UAAA 2ODWA 4EAQA 1M2OB 4L9SA 5TVKA 4E5UA 2XGJA 2EYUA 2PX3A 4M1SA 3U7EB 2JLZA 3FMIA 3BFKA 3IBYA 2RHMA 2G0NA 2ZVPX 1G8PA 1MRNA 2QUZA 4NBSA 3I8XA 2DB3A 3P27A 4LBZA 4ZDIA 4TQ9A 4BWYA 4XD7D 3NTUA 4Q21A 1OXUA 3Q5DA 1XPOA 5EE5B 5FUXA 5E7MA 3LXRA 1MOZA 1HUQA 3K53A 1GL9B 1EFRA 5DHAA 2WJHA 1PLJA 2ZJAA 3LH5A 1RJ9B 3T1TA 3L8ZA 521PA 5GJBA 2WTUA 1L2TA 3A1WA 2ZS9A 2FFAA 1KKLA 2XTNA 4GZMA 4BFTA 5CM9C 5JWRA 1P75A 2J0UA 1CRQA 3HR7A 3GLGA 2ZJ5A 2B92A 3AM1A 5F98A 2QP4A 2ANCA 2NQ2C 2ZRFA 2HF9A 5K8LA 3THYA 2AKAB 3AKDA 1RPZA 4KHZA 1PVOA 4LZZA 3CX6A 4BLRA 3GLHB 1FX0A 3LNCA 2IYUA 2OE2A 1KI8A 4WAUA 5CB8A 421PA 2EFCB 1CJKC 2J45A 4IVQA 1ZUNB 2CLSA 3RS2A 4QNRA 1EFTA 1J70A 1VCNA 4M1KA 3ADCA 4GMXA 5JWHA 4M1TA 5DI3B 3KJEA 1YR6A 2RB4A 3CO5A 5CITA 1JEDA 4BPBA 3IIMA 4ACBA 1W4RA 3A37A 4U5XA 5AR1A 2X1VA 3UG7A 1ZCAA 3U3RA 5L3SA 4MRPA 5SZIA 1VCMA 1W36B 4HAYA 2VP9A 4CZ2A 3AEZA 4RCYA 3KUDA 1SXJC 4TLCA 5E7IA 5J4LA 2ZTSA 3AVQA 2ZAMA 4CEIB 5JJKA 4II7A 5DE3A 2AN9A 3NC1C 1JB1A 1LNZA 3U3JA 2VP6A 3QF4A 4PPFA 2VH5R 1DEKA 1II9A 3RANA 1XEWX 3L0OA 5GVSA 2IBMA 4Q9IA 4JVSB 2ANBA 1KI7A 1SHKA 3LA6A 1Z0KA 3FOZA 5JLJA 1FUUA 5KTYA 3H1TA 3ZH9B 1SZPA 1CULC 2OLJA 5CDFA 1P5ZB 1UBGA 2ZSAA 1FW6A 1ZJ6A 2WWXA 1IY1A 3MG9A 3OAAD 3RS3A 1RYFA 4C0HA 1ZRHA 3SN6A 1NJGA 2FSIA 4HAXA 1GL7A 3G82C 2QGNA 3PUWA 1E9RA 1G7SA 1OXTA 5IK2D 3S1AB 4FINA 4PTLA 1J2JA 1SVIA 4NCJA 2KB0A 5FUVA 2IHBA 1KO4A 4Z1MD 3E5HA 2QT1A 1NN3A 2OV2A 1VG9B 2DWQA 1RIFA 2GEDA 4TLBA 4JVMA 1BMFD 3DMNA 3TK1A 2DHRA 1E2FA 3KTAA 1R4AA 4F4JA 1UKVY 3OEHD 3GFPA 1JJVA 2JJ8A 2AWNA 5DHFA 2WJIA 5C18A 4BEJA 3GCGA 4DEYA 3EIEA 1G20E 1UADA 2GK6A 3AP3A 4OK3A 4ZCMA 2BM0A 3U4QB 2HYIC 4BFUA 1FMJA 1HA3A 2ZR7A 3K9NA 2VSFA 2GBLC 5E7JA 4CF7A 4A0HA 4V03A 5HTKA 1CJVC 4DCVA 3THXB 4MRSA 1M74A 3LLMA 1GP2A 4QGHA 3DM9B 2C9YA 4N3NA 1GG2A 2BC9A 3K0AA 3EPKA 1AS3A 1IN8A 4CIDA 1AKYA 1LTQA 5JEDA 1D2MA 4OQNA 4JS0A 2JJ1A 3LW8A 1GTVA 2FFBA 5KYKA 2Z6VA 2I3BA 1XXHB 3MWKA 5DH9A 1QDEA 1T0JB 3EZFA 3K09C 4MKIA 2KE5A 1QZXA 5B30A 3SYKA 4B33A 2BIFA 3GLIB 4A9AA 3CF2A 2JIZA 3I92A 5HPYB 1QBKC 2DFKB 4HLQB 1E0JA 2BJWA 1YKSA 2AD1A 4Q1FA 2QPAA 5EE9A 1P4SA 2FNAA 5FR1A 1HT1E 4EQ6B 2NTYC 3M6AA 4ITRC 3LX8A 4C0JA 1XCGB 4EJSB 3B1XA 4IDHA 2QGZA 5GADl 4UNSA 4G5RA 1OF1A 4URUR 4PQFA 1D6JA 3TQFA 3AB3A 1S3SA 2ZQ5A 2A78A 3PV0A 3ZZUA 3VKGA 1EFRD 4Y0VA 5BN4A 2N42A 2VHTA 3B5JA 2NGRA 4A0RA 1MKYA 1T5IA 1XBTA 1UJ2A 4L15A 5H68A 4KSBA 2YJTD 4QHSA 121PA 3QNUA 1UF9A 2DCUA 2OBLA 2PEYA 4NYJQ 4ERNA 3TLXA 4E03A 4XWKA 4PZYA 2ZJ8A 5DYGA 1Z0AA 1HH4A 2ZRPA 4QM6A 4FMCF 4UNNA 2VYFA 5GJCA 4IFEA 4JL5A 1N6RA 1T0HB 3TQCA 1Z63A 1CF4A 2ZI5A 4DHEA 1OIWA 3KJIA 5IHPA 1QHSA 2B6HA 5C4GB 3OIWA 4B76A 3AVXA 2BEJA 1RKBA 4DIDA 1E4VA 4JKYA 4IKEA 1AJEA 1SKYE 4ARZB 5F9HA 3BORA 4OJKA 2A5YB 1ZUIA 1AQUA 3CUEF 4QJ4A 3EPJA 1E0SA 1TQ2A 2HYDA 1QRAA 4Q02A 4B71A 1D2NA 1NKSA 1FP7A 4Q4HA 3SBDA 1IM2A 1GFIA 4D0NA 2OILA 4CGZA 3DDCA 3DKVA 2FG5A 5CK4A 2GTPA 5C2JB 3QUSA 4TZ6A 4EDHA 3A1VA 5ELXA 4J0QA 1H8HD 1VCOA 2Y8EA 1YRBA 1EWRA 4ZIRA 4ILEA 5KPJA 4BFVA 1JECA 1GKYA 2QTHA 1AN0A 1EG7A 1S0UA 1G8YA 2XNDA 1HT2E 1UDXA 1G5TA 2RHDA 1N5LA 1ZM7A 2JATA 2WWGA 4PQYA 4QJ3A 2HCJB 4XSHA 4OYHA 4I1OA 4E22A 1KI9A 4PO9A 1T91A 1NVVR 1S96A 4MKFA 3WHKA 2GEVA 3FPAA 2V8OA 1K5DA 4M9SA 3SS8A 1ESNA 2JDIA 2VP4A 2CXXA 2ZI9A 3ZS8A 3ICEA 2ATXA 3EIQA 4TWZA 3WMGA 4F93B 3CRW1 8OHMA 3O47A 4Q4AA 3LFUA 2WKPA 4XWAA 4TZ0A 1E2MA 1GRQA 2IXFA 4K46A 2VSOA 5CLQA 1X8KA 4DCNA 1IJFA 3EZ7A 5HCNA 3QXXA 1X3SA 1AM4D 2VEDA 1M8PA 3B78A 4U00A 4PAMA 2QL6A 3V00A 2RCNA 2YVUA 3FTQA 5FTJA 3IBGA 2R9VA 3RC3A 1G3QA 2JLUA 5AUPB 2VHCA 1M7GA 3KFXA 1XTSA 4BRWA 3EG5A 3CPJB 1TQ4A 1TTTA 2J87A 2NO7A 1XWIA 3ZGXA 2A2ZA 3BRWD 1XMVA 2RGGA 1FP6A 1ZAKA 4O0MA 5FTMA 4A82A 3H84A 1JQJC 2BV3A 4ZO4A 4CEHB 5KSOA 3B1ZA 1DAEA 4BASA 3D31A 3K0FA 1F2TA 2ZJYA 2OBNA 1ZM2A 2D74A 4HI0E 1U8AA 3SZRA 5B57C 4X8OA 4ZI3A 2ZRLA 3X1XA 4MKGA 4RJLA 5TDHA 3DPUA 4KI0A 3WXMA 5FOSA 4EIWA 4JVNA 1IY2A 3SDZA 2DFTA 1N6NA 4KBFA 2R8RA 3U3OA 2IS2A 2X19A 2PZEA 4POAA 1CKEA 3TKLA 2WPDA 1SVOA 4KITB 3RDPA 2QU8A 4JBYA 2NZ8A 3FHTA 1IQPA 1N2CE 3NDPA 1VMAA 4G5OA 2AX4A 5AUQA 4ZKDA 2Q0HA 2QAGB 4CRWB 1E9SA 2ZYUX 4PPQA 3VQTA 1ZNXA 3H0KA 5TARA 3BK7A 2JIZD 3QJYA 4NH0A 1J90A 2PCLA 3RSLA 3AVWA 1I4TD 1TQDA 2PLFA 3ADBA 4MQBA 5FI0B 4XJXA 1JJ7A 2V4ZA 3WRYC 1JAHA 1YZLA 2H16A 2OXRA 1SXJA 2X8AA 3AGPA 4HDQB 4IEEA 3PXGA 4C0KA 4XVUA 5JSZA 3C16C 1GUAA 1DBSA 3HPRA 1OH6A 1JR3E 2VHJA 2GVDC 4QL3A 1OXVA 5KPDA 3CNOA 2IYXA 4NYMR 2CHQA 3H4MA 4DLRA 5JS8A 3EPLA 4NU0A 3K70B 2P3SA 3ND8A 1P2TA 3L43A 4HSEA 5AK0A 2IYYA 2H5EA 2J7KA 2YHSA 3ZD7A 3NC0C 3B2EA 3R9XA 4W9MC 1LB1B 3SJZA 1VCIA 4PO8A 4DB2A 1N0VC 4C2UA 4R2IA 2O8FA 2FWRA 4L16A 4ZI2A 3R9WA 1WRBA 4XSGA 4G5SA 1Q44A 4NCKA 4E07A 2P6NA 2FPLA 2BM1A 5CJ2A 1Z06A 2QM7A 4LPKA 2X2EA 3LDAA 2RH5A 4V0NA 1Z8FA 4P32A 2WBLC 821PA 1ZVQA 3PUZA 4EPYA 3PQCA 3KKMA 2DPXA 4LC0A 4QBFA 1S9DA 1Z0FA 1PLLA 1VYUA 2FGJA 1OIVA 2XTMA 4KSCA 3A58B 2F9LA 3GFOA 4TYQA 2IT1A 2ZREA 3R7WA 1EESA 4JJKA 3LW7A 1KAGA 1G1MA 2VL7A 1KI1A 3EC1A 2WOOA 3NBXX 5L3RA 1E2HA 3D7MA 5CIQA 2JJ2A 2QBYA 1GZSA 1G17A 2D4HA 4KAXA 1OFTA 4PSKA 1WMSA 3IPYA 3FFAA 1HY3A 3LQQA 1U90A 5FL7A 3EX7C 2C03A 4OHYA 3C7KA 1COWD 1C4OA 3QI2A 4Q9HA 2O8CB 1QHXA 4MDFA 4HAVA 5EE0A 1V43A 2J1LA 3CH5A 5EXTA 3FMPB 1ONBA 3B1WA 5HZKA 5FPTA 1NVVQ 3K9GA 4D26A 4MGZR 2HJGA 2O8BB 1S4QA 2W83A 2XNDD 3GLIE 4O25A 3B8HA 1VIYA 4A36A 4GOJA 4A0FA 1WBBA 1D5CA 4XVQA 1MRSA 2AL7A 3B9PA 4DBLC 1N6IA 1XEWY 4NE2A 3VR1A 5FBVB 3IEVA 2JGNA 4WA7A 2QNRA 4BLOA 4AWXA 1QHNA 3L0IB 1NLZA 1U0HC 4UNQA 3DZDA 3KKPA 4CEJA 3U3MA 4TYYA 5KOYA 2G83A 2J9RA 1NG1A 2G9NA 1PZNA 2EWVA 3TVTA 1P2VA 2E87A 3KQHA 5GJWC 1ESMA 3M1IA 4JJZA 2H1LA 2AHOA 2J7PA 5KO2A 3RWMB 4CYMA 4W5WA 1EFHA 2CNWD 1P9RA 1A7JA 1GVNB 3CLVA 3HR8A 2OM2A 4C0BA 1QVRA 4Q48A 2OFXA 2WZQA 4KV9A 1W1WA 3Q8XB 1H65A 1UKYA 4LY6A 5DN6A 1CJMA 3A1UA 4UXHA 3QBTA 1Z6TA 5P21A 1E96A 4LJAA 4RSGA 1KO7A 1A82A 2W0SA 4KXFB 3FKQA 4M9QA 2RGEA 3IEUA 4K81B 5EUQB 2LWIA 2DFNA 1OH5A 1P73A 2AR7A 1MO3A 2W2VA 5FPKA 4MDEA 5JHHB 5JBQA 1NJFA 2FOLA 1TNDA 1YVDA 4QBHA 3O8CA 1Q1BA 2BBTA 1YE8A 1N6HA 4LBWA 3ZIAA 2ZRMA 5IDVA 3SHWA 2EYQA 4CT5A 3GJ8A 1TL7C 1AGRA 5CJPA 3CNNA 3EZ6A 1W0KD 3F0TA 4TL6A 2NMVA 2ZVQX 2GXUA 3F5FA 5JFGA 2OESA 4JBWA 2CLCX 3HU2A 1C1YA 2WIBA 2ZI7A 4HAWA 5KSZA 3WMEA 1SQ5A 1N6PA 1Q20A 1D9ZA 2WPDD 2IUUA 1ZNWA 4FMCB 5KNCA 4M4SA 4TN1A 2WAYA 3X1YA 2C77A 4B3CA 4LYHA 1E32A 5JHGB 1GM5A 1E4YA 3I4LA 2IXGA 1IONA 1S3GA 1UBCA 4I99A 2BBOA 2OHFA 1F2UA 3UMFA 5FPSA 5AWFC 3T1QA 3DOFA 1EX6A 2XAUA 1XEFA 1J8YF 1R5BA 1XF9A 2P6UA 1X8LA 4UNRA 2FF7A 1E69A 1ZIOA 2D62A 1UBEA 4NYMQ 4IXNA 5UKDA 1N0UA 1QHIA 1NBME 2JASA 3AF1A 4GFDA 1SXJD 4V0LA 3WYFA 4QXAA 1GNRA 3CWQA 5J4YA 4A8JB 2CK3A 1KK1A 2OT3B 3O8BA 4AY2A 4GSYA 3LXXA 4YMWA 2AFIE 2WIAA 1SKYB 3KFVA 3JZAA 3RRZA 1DARA 4PHFA 3TR0A 2QT0A 1XMSA 1JI0A 3AUYA 1W4CA 3B82A 3MSXA 4FD2A 3RRYA 1NY5A 3SJBA 3ZVLA 3C4JA 3O8DA 1QHHA 3RNLA 1G6HA 4PHTA 3QXCA 1UM8A 1DG3A 2P65A 3CH4B 4NZYA 2ONKA 5TMPA 2QQEA 2P67A 2ZE8A 3OE7A 1ZD9A 4R7ZA 2Q3HA 5FBRB 3KB1A 1OB5A 4TQUS 2Z0MA 3HWSA 1G4AE 4TMWA 2FV8A 1NVWQ 4LHWA 1G291 1NKTA 4BFXA 5EXXA 2XTZA 2ZYWX 3C5HA 2QAJA 2OAQ1 2YWGA 2CDNA 3UIEA 4A1FA 4W5JA 3RWOA 2ZSFA 1ODFA 2J46A 2WKQA 3ZS9A 4DT1B 4NYIQ 4F92B 4JMPA 3BAFA 3BIFA 4YMSA 4JVLA 1OFIA 4P4SB 2JJ2D 3HYTA 4OQLA 4MGKR 1BOFA 1ZUHA 2IEZA 5EE1A 2GXQA 2OBMA 5GVRA 3WBKA 2XOKA 1F60A 5E95A 2BMFA 1XEXB 2O0KA 3SEAA 4LJYA 4I1VA 3AGQA 3VNUA 4DLUA 2QZ4A 3B13B 4TTPA 5EXPA 2JAQA 3U2QA 1G9XA 1SVWA 3A1TA 4IOLA 1RJ9A 1E98A 1Q1ZA 2V1UA 2ZRIA 2OFOA 3AP2A 1KAOA 1YZTA 2F1RA 3PEVA 2GCOB 3ZYCA 1ELOA 2W0MA 4TTRA 2J0SA 1F3OA 1DAKA 4LHYA 2AK3A 1G3IA 3VKHA 4TLAA 1IJEA 2GF9A 2REOA 1E2LA 2G77B 2GVZC 4Q4JB 3B7GA 2DY1A 1NY6A 4MYHA 4AG5A 2D2FA 1R0WA 2OCBA 1Z6AA 4Y0AA 2WJGA 4C0QC 1AK2A 1QHGA 3P26A 4M1WA 3EZ9A 1ZP6A 4TLDA 3FWYA 1ZMXA 2IYWA 3GLHA 5CB6A 1NLFA 1W49A 1F6BA 2F43B 1HQCA 4HAZA 3K0SA 4G5GA 2HF8A 3CIOA 2FSFA 4MYTA 4L9WA 2IYTA 2CMKA 1RC8A 4JLAA 1I4LD 3E1SA 3K0EA 2JLVA 4RFSA 1NSTA 1QHYA 1A1VA 5DI3A 1KOFA 2IF0A 5DN6D 1P2UA 1RRGA 4B6FA 1EFCA 4LJ9A 1FTNA 4TMXA 5ANRB 3TSWA 1YQTA 1WXQA 2EU8A 3GEIA 3U60B 1UFQA 3KJHA 4I4LA 3SC3A 4GOKA 3T12A 3U7GA 5D3MB 4WZ6A 4LV5B 1XDBA 3E2IA 1TU4A 4HAUA 3K8YA 4D4MA 5K8TA 1FUKA 4CEIA 1KZ7B 3DVLA 4IOMA 4OQXA 3PFIA 1Q0UA 1FX0B 4ZV4A 3MAAC 2MSCB 1A2KC 1GAJA 2LCFA 2VF8A 3CPEA 3ZIAD 4C7OB 2IYQA 2WWFA 4Q9JA 3HPQA 2Q9CA 4FWTA 3I8SA 2O8DB 4HLUA 3EIHA 4KU4A 3M0EA 3P20A 4LYFA 2Z83A 3PENA 4QRHA 4QBIA 4CVNA 3VR3A 3ZQ6A 1M7HA 1BO6A 4IVRA 1Z5ZA 3F3YA 4XOIA 2MMCA 4D81A 3KXIA 1MABB 1WCV1 5SZKB 2IYLD 1HTWA 4NTZA 1OFHA 3U3KA 4R9UC 1GIAA 4BLSA 4URXR 5SZJA 1Z08A 3CRMA 1Q57A 1CR2A 1NRJB 4H1UA 3S1AA 2IS6A 2GAOA 2A5DA 2C96A 4M1MA 1KTVA 3REGA 4KJZA 2ZROA 4PR0A 5AJYA 3REFA 4IOKA 3RC8A 2PJRA 4FCVA 1CTQA 3CONA 5HE8A 2C9OA 2P5SA 4RZXA 1TAGA 5D3QA 1XD8A 1S8FA 4YONB 1NMXA 2GNOA 1L4YA 3GJ6A 3EWAA 2Q9AA 3T35A 4DEXA 3MMPA 1T3LA 4OBEA 2CK3D 4HLDA 5FTNA 2ZUBA 2FSHA 1YR7A 2ZRKA 2XZLA 3AVYA 2FSGA 2G0TA 5KNDA 2F7SA 1W0JD 2HXYA 5EP4A 2O8EB 1KZGB 5JRJA 1A4RA 1GNQA 1U98A 3GJ4A 5KSPA 4DSTA 1FL9A 1KYIA 3PEYA 4IRUB 2D2EA 1FZQA 2YYZA 4EKDA 5BN5A 1W47A 3NXSA 5L3VA 4EPTA 2CCGA 4X8LA 1W7AA 1R5OA 3NBFA 2C95A 2NZJA 1XXHA 3BS4A 4PANA 1YU9A 1XTIA 1XCPA 2AKYA 5TXGA 5JCPA 3QPUA 5FTKA 2ZR0A 3OE7D 1XD2B 3OEEA 4M9XA 3EA5A 1E9DA 3DL0A 3GLIA 4JYBA 5SZHB 1RRCA 3TSOA 3QKSA 1DE0A 1L8QA 4DIEA 2IA5A 2X2FA 4JLBA 1YZUA 2F3TA 1U8ZA 2CL7X 3HU1A 2BDTA 4B2PA 4XVRA 1F48A 2IEYA 2FDCA 5J5CA 4RZ2A 3KQKA 1W2GA 2YWFA 4EQ6A 1KI6B 2QE7D 4EUNA 4D82A 2WMOB 3QXHA 1MO5A 1M1YE 5FL3A 2XZOA 2MSDB 4BGDA 4AG6A 1LS1A 2OSBA 1Z07A 2WM9B 2YWEA 4UXIA 1E79A 4EJSA 4RD1A 2WJJA 5JEEA 3U44B 4HUQB 5E3HA 1W5SA 2DWOA 5L3QB 4LHXA 1G3UA 1KNQA 3RS4A 3NDBB 2BCGY 3UKDA 1NN0A 1TADA 4NCIA 1GKUB 5AUOB 3CKLA 3IDQA 1OFUX 2BEKA 1E9AA 4DDUA 1U81A 4U02A 1UEIA 1LF0A 4LHZA 4YDSA 4DZZA 4CT4B 3NWJA 1LFDB 4Q5IA 1F5NA 3U6BA 1ZM4A 4X8HA 3QVUA 2HDNB 2JLYA 3L2OB 1XJCA 1O87A 2DFLA 3THOA 5FOUA 2GHIA 4M53A 2OEPA 3GQBA 1XP8A 4B73A 1VKJA 5BWMA 4P4TA 3LRPA 1H8EA 3KKQA 4MRNA 3Q7PA 1MO6A 4AI6A 4GZLA 4LUCA 3MWLA 2E1RA 1S1CA 2Q3FA 3DHWC 3ZJYA 5JI3E 1NL3A 1SKQA 4ARZA 3QXSA 4RD0A 1XZQA 2FU5C 3WRXC 4BFYA 3KL4A 4JLJA 5B64A 1M7BA 1I2MA 1IOZA 1JPJA 5FI1B 2GEUA 2J0QA 1KJWA 2GZDA 1AKEA 1X8JA 1DO2A 1G41A 3RS0A 4URVR 2V3CC 5JJLA 3GLFE 2FE4A 3SE0A 4C3ZA 2XJ4A 1GRNA 3VR5A 2ONJA 1KO1A 1KMHB 1PUIA 2LKDA 2YC2C 4JT4A 4WOPA 5KHOC 1HEIA 3HP1A 3MJHA 1J99A 2DBYA 3UMRA 3AVVA 4N1AA 4U7DA 1ZU5A 3UG6A 4TL9A 3RHFA 1Z22A 1KDPA 1N5JA 4JZKA 2BVNA 4RZ3A 4HDOB 2RGNA 4CDGA 1NBMA 1E2NA 2O0JA 2RGBA 1HE1C 4JL8A 4DKXA 3BBPA 2W58A 1NSFA 4IW3B 2ZRHA 1OH7A 4GNKA 1KK0A 2CE7A 3B1YA 2FH5B 5IRCD 1FPMA 4B34A 4Q7KA 1CRPA 1AZTA 4Q4HB 1TF7A 4BUJA 4LYJA 1XX6A 4G1UC 1XU4A 3RVBA 3W9YA 2Z5FA 3TAHA 4DDVA 2MMGA 1JPNA 1YR9A 2ZANA 3BFXA 3FHOA 4ABYA 5JWOA 5K8UA 2CL6X 4BQSA 4KODA 3SJAA 3LQRA 2B7BA 4N0EA 3QQ5A 1M6NA 2BBSA 5K8IA 4BFWA 1G8FA 2W6IA 3A4NA 4AURA 2JLQA 1TX4B 1ZD1A 2A3RA 4HB4A 4MRRA 3V4RA 3U7FB 1T4GA 3LBNA 2W6JA 1TUIA 5JMTA 1SVSA 3MRSA 4Q7LA 5TB5A 1R8SA 1N6LA 1KDTA 2BKEA 1NMYA 4F91B 3SJCA 4M0LA 2KBFA 4LPSA 1Z0DA 4CEHA 2OCAA 1JEEA 4PHHA 4V02A 4NKRA 3RRNA 4B2LA 5JJIA 2QTFA 4KYUA 4AYXA 3CRQA 1UKEA 1YZNA 5F9FA 2CJWB 2RAPA 2ATVA 1DELA 4TYPA 4OI0A 3VR6A 4NL4H 3NIBA 2ZI4A 4DLWA 2IHYA 3W90A 2GWHA 5FOTA 4B3FX 1ZM3A 2YC4C 2PX0A 1L4UA 5A5GA 4EPRA 2OG2A 4GBMA 4Q18A 4YMTA 3TNFA 1IN7A 2VPPA 4RFVA 5HKKA 1EWQA 4KLNA 3B60A 2BMDA 3Q72A 1XPUA 2JJ1D 2D06A 4YC7A 3B6EA 3K0CA 3OEED 1R8QA 2PT5A 3GMTA 2GRJA 4GI7A 2R6GA 2VO1A 1XTJA 1Q1EA 4RVCA 2IS4A 1E94E 2E9SA 2PH1A 4QG7A 3GLGE 1K6MA 1G7CA 3FE2A 2A5GA 4OHWA 3CR8A 3VU9B 1WP9A 3NBZC 1US8A 5JRZA 2VA8A 3TRFA 2QY9A 4PX9A 1ZINA 3QKTA 2PT7A 1JBKA 2NG1A 3BOSA 2DYKA 2G1JA 1ZW6A 1Z6GA 5J4VA 3HDTA 4GOXA 1N6KA 4FN5A 4JLNA 1E79D 3MFYA 3CW2A 4DLSA 1DAFA 3KQNA 3W3AA 4PC7A 1OT3A 1Q22A 3T61A 4ESHA 2BOVA 3MLEA 4QGAA 4EFLA 1SHZA 4EPVA 5KDOA 3A4MA 3DKPA 2BMEA 3KQUA 4URWR 3GJ5A 2EFDB 2GJ9A 5KNBA 5KU1A 3A36A 5FOVA 4S2EA 3X1DA 4PHGA 2X77A 4PSAA 4GP7A 5EP2A 2GJSA 1W36C 1N0WA 4KFSA 4MGYR 5LPNA 3WYGA 4FMDF 4H9GA 3UANA 5J4HA 1G18A 2AK2A 2ZRNA 3D8BA 4US0R 2QQ0A 1KGDA 2PMDA 2G1KA 2AFHE 2REXB 1X1RA 1H8ED 4LX0A 4QHYA 1VYTA 3MJRA 2ZI3A 4US2R 2JLXA 4HUTA 2KSQA 2XXAB 2C2HA 4W7SA 4C9BA 3AVOA 3VR2A 5C1BA 2CVFA 4HLUC 3VFDA 5G3ZA 5CDFE 1W46A 4JSTA 3JZMA 1NIJA 3BWDD 1NF3A 1S1MA 4PO1A 4M22A 4MUBA 3TJZA 5DO9A 1OXSC 2ZU6A 2D7DA 4M9ZA 2ZE7A 3BGWA 3EC2A 3R9IA 4G01B 1II8B 1Q1QA 1J7KA 1VYVA 2ERXA 2O8CA 2QG6A 1UPTA 2ZAOA 1DAIA 1JAIA 4B48A 1MH1A 1CJTC 2AXPA 1E1QA 3OZXA 1ZNYA 1G7RA 3AVPA 3FB4A 2ZRAA 2QPTA 2AXNA 2D3WA 4XH9B 5EP1A 3LV8A 2FJUA 3KJGA 3QOFA 3D3QA 4XIGS 4DC9A 2ODBA 2BJVA 3BE4A 4M2LA 3X1ZA 4TYNA 4DSOA 1IAQA 2WJYA 3KXKA 4B75A 1OIXA 1WDTA 1ZNZA 1PLKA 1JALA 3VKWA 1X1SA 1XCMA 1E2QA 5C46F 5BQ5A 4PXAA 2QM8A 3LBHA 4O2LA 3SR0A 1BS1A 2JDID 1KIMA 4V0ME 4AYWA 3MWJA 1P6XA 4I1SA 4LDJA 5FBQB 4OK6A 4LC1A 4R2HA 1Z0JA 3DOEA 4ZKEA 1P3JA 4HZUB 1K8RA 3KB2A 2ZPTX 2YNMA 3A4LA 1G4UR 4MGIR 4Z51A 2V6JA 3ZD6A 4AKGA 2OZEA 4GDFA 4YLGA 3EW9A 4IVPA 4EFMA 3PG5A 4Z54A 4X8MA 3ECCA 1E0KA 1FTSA 2W6JD 4IDQA 4NPHA 1KSJA 4TL7A 3T5GA 2CVHA 3SHFA 4B32A 3QG1A 4RY2A 4YQFA 5FPYA 3RRMA 3HU3A 2PBRA 1T8UA 2HJVA 5DISB 5FBLB 1OLOA 1IBRA 2VHUA 3AP1A 2ZS7A 2CHGA 1P72A 4LOAA 4OI4A 2OUKA 5FUWA 1IN5A 1VECA 4EJSC 1A5TA 1IXRC 1CIPA 2CEAA 3DMDA 4A2WA 1SVMA 1VG0B 1G64A 5HZHA 3UK6A 2ZIAA 3E70C 2L0XA 4HLCA 2PJZA 1CEEA 1G8HA 3L0SA 2ZYTX 1TU3A 5FTLA 2ZEJA 4DJTA 4JKIA 2ODNA 1W48A 4D0GA 5HKKD 4E09A 4LI0A 2B8TA 2GJKA 2RGCA 1BH2A 2SHKA 1BIFA 4C0SA 2J5XA 4OQMA 1GNPA 1XNJA 5JS7A 4LBYA 5GJVC 1UKZA 1E0AA 2WKRA 4OJQA 4IOJA 1ZIPA 5JZVA 3H2YA 3EZ2A 1EGAA 3GD7A 1P62B 1ZD8A 4Q7JB 5HE9A 3OF5A 3SOPA 3V9PA 1JQLB 5JI2E 1XJ0A 1LY1A 3SBEA 2OAP1 4G5QA 4NCHA 3W6OA 1DVRA 4DSUA 5G41A 4A8JA 2RMKA 3ICQB 2B8WA 2PCJA 5CK5A 3TGPA 2YWHA 4KVGA 4B2IA 2IK8A 1AIPA 2FEOA 3QKRA 4LBVA 4D6PA 3R20A 4GP6A 2P5TB 2FX3A 3Q3JB 3F8TA 2Q21A 4I81A 5A4JA 4PQRA 1OH8A 1MO4A 2HV8A 3ETLA 4JT2A 221PA 3VX3A 5EXSA 1FNNA 2ZJOA 5IK2A 2IS1A 5G3YA 1GDDA 4B3GA 1KI4A 1U0JA 1ZM9A 3GLFB 1K5GA 1RZ3A 1KJZA 1RFLA 1VIAA 1FFHA 1WBDA 4Q9KA 1OV4A 2V54A 5M04A 2WSMA 4QBGB 2GCPA 2JA1A 1Q3HA 5DI9A 4BECA 1RW4A 2RGNC 1E1RA 1U8YA 1U2RA 1JR6A 3OEHA 1B23P 2R6AA 4M1OA 2ZR9A 2G88A 1G5PA 3QVVA 1XJQA 2WICA 3W8RA 2FPMA 3QG5A 3WY9A 3UWKA 2QORA 3THWB 2ZYVX 1DADA 3QEJA 3C5CA 4JSYA 2A9KA 3KDSE 4DXAA 4HATA 1SULA 2HT6A 2VSXA 4DT1A 4OL0A 4GRAA 4LJ6A 4P4SA 1E3MA 3AKEA 5IF9A 4NDZA 4KFUA 1DG1G 2RGXA 4RKEA 5CM8B 4B3DA 1XEXA 5G53C 3QKUA 3ZVMA 1FOEB 4RD2A 5FL7D 2EFGA 1E1QD 1UEJA 4L8GA 3FMOB 4NONA 1TF2A 3BB3A 3WP1B 4ZDJA 2NPFA 2V1XA 4G3XA 4B43A 2BCJQ 1DTSA 2A30A 3IIJA 4RD6A 3T1VA 2OO7A 2C5LA 3GJXC 4DVGA 2IYSA 5LBIA 4PC2A 3LVQE 2GF0A 2HLDA 2YOFA 1XPRA 4Q03A 3LBIA 1KHTA 1U9IA 3EARA 4P0TA 6Q21A 2F43A 3AVUA 1E2GA 4A15A 4Q19A 4KFTA 2QEQA 2ZRCA 3N2EA 3FYHA 2VP2A 3W5JA 2GETA 4LWZA 2WHXA 2IX3A 2J7PD 4IXMA 4D80A 1VG1A 1UDWA 3FKSA 3J81k 3P4YA 3THXA 1CP2A 3R8FA 1Z3IX 1CR0A 2KBEA 2UZIR 4XWOA 3N5CA 3UMSA 3K0CC 4LV8B 2QAGC 3CPHA 4IDOA 1G16A 1D9XA 1IXZA 1WE2A 1CLUA 4WIAA 2J41A 1DPFA 4G0NA 1KSGA 2JCSA 4XTCS 5BN3A 2ZRJA 2ERYA 2VQSA 4B35A 1Q12A 2IUSA 5D3MA 3ADDA 1XMJA 1IHUA 4NYJR 1G7TA 1KK2A 3T34A 4LJ5A 4AKEA 2J0UB 2WVJA 5CYOA 3GLGB 1SXJE 4HEJA 1CR1A 3P1JA 1VHTA 4C7OA 3THYB 2PZFA 4A92A 5JECA 2ZE5A 1UBFA 1NN1A 3V4FA 4AK9A 2HXSA 2BBWA 1GOTA 1M34E 4OHXA 1E99A 4A4DA 2O8DA 1FQKA 2JEOA 2Q6TA 4RFSB 4TMZA 4V0OA 5FH9A 2GZAA 3K70C 4GL2A 1QG4A 1W4BA 1JR3A 3CWZA 1GILA 2QN6A 1SVLA 3CRVA 3I5XA 2GA8A 4FMDB 3EXAA 2H7VA 1MABA 1G3MA 2QI9C 5KUTA 3PITA 5F3WB 3LVRE 3IGFA 2KWIA 4JLPA 3LX5A 4PC1A 1N5IA 1YZGA 1H8HA 4PC6A 1Q21A 1U0LA 3L0PA 1AS0A 2XB4A 3QE0A 5FOXA 3ZZTA 3RYTC 2C04A 4HDCA 5H70A 5L3SB 2I1QA 4BZPA 1D2EA 2W00A 4PAQA 1S9HA 3L82B 4C30A 3JVUA 4ASUA 2P2LA 3Q7QA 3UXMA 1TEXA 4Q1EA 1KO5A 4A0GA 4B74A 2JLWA 3U61B 1W4AA 2HUPA 3VHLB 3EA0A 3I73A 2Z4RA 3QF4B 2B21A 2FGKA 4DSNA 3Q5EA 1II0A 1W44A 1R6BX 1WA5A 1OJLA 4ACAA 2XJ9A 2O8EA 3U4QA 5KDDA 4LK2A 3UPUA 3CM0A 4MRVA 1HQYE 4KLZA 2A5JA 4HYYA 4QKQA 2GDJA 3CX8A 3IPXA 1T8TA 4HB2A 3Q85A 1DS6A 2O0HA 2VHQA 3AF0A 3SI7A 4BE7B 1D8TA 4D0LB 2ZRBA 1GL6A 1W5TA 2IL1A 4LSGA 3GP8A 3TW4A 2D7CA 4M1YA 4XTRA 2IF2A 3FHCB 4Q7MB 3OIVA 1DAGA 4PPGA 3IO5A 1RE0A 4B6EA 2H18A 4LV6A 1NLYA 2R44A 1XD2A 3C14C 1E1RD 2WOJA 3KKOA 4RD3A 1W2HA 3PUYA 3NH9A 2GKSA 2WWHA 1HYQA 2FFQA 3KTAB 1DAMA 5BXQC 3A1SA 1U94A 1XMIA 3PCRB 4ESVA 3MGCA 5FFMA 4HZIA 1KI6A 1LW7A 2ZI6A 1R7RA 3NG1A 4K8OA 4Z8XA 2PZGA 3BFVA 4W5HA 1ETUA 4JLKA 4UKDA 2I4IA 3QSYA 2GCNA 3W6NA 3W8NA 1PJRA 4IEIA 2V9PA 5EZ6B 4V0MA 4D4KA 3U44A 4HUQA 4TMKA 2N1BA 4B3BA 2WJVA 3K0AB 3B85A 5L3QA 1L7VC 3IQWA 5EQTA 2GJ8A 2V55B 2XOKD 2GAAA 4O2RA 2WV9A 4TSFA 2GJAA 2Z43A 1DAHA 2HEIA 2F9MA 2ODEA 3HJNA 4BLTA 2XX3A 2YOGA 3K9HA 4QM7A 4RD4A 4DB4A 3MD0A 3QKSB 2PL3A 3K9LA 3BXZA 2F1JA 4A6PA 3SU8A 721PA 4UJ3A 4F7WA 1G8GA 4ZDKA 3SQXA 2YINC 1XRJA 3TR5A 5FBWB 2XZPA 2C98A 3PVSA 3WHLA 1BYIA 5CIWA 4Q66C 2XNSA 3GJ7A 4URYR 2HLDD 1AS2A 3P32A 5AUNB 5LB2A 2EVWX 2P6RA 1Z28A 1OW3B 3B9QA 1A2BA 2VLIA 4C4PA 4PPNA 1FMLA 1ZBDA 3NH6A 4BRUA 4FW9A 3T5DA 5TV2A 3RAPR 4DLZA 3ZVNA 1KO8A 1DOAA 2ZUDA 4OQFA 2QMHA 3TSZA 2QSYA 2WSSA 1OYWA 1E2DA 1R0YA 4A6XA 4L5BA 4HB0A 2ZRDA 2FFHA 2FN4A 1QF9A 3FKSD 2ZU0C 4N0DA 2YOHA 4NP6A 3TMKA 3IHLA 3U6KA 4Q00A 4IJMA 3VR4A 1AZSC 2FMXA 2IWRA 4P31A 3U5ZB 2F55A 2REBA 2QRZA 2NIPA 5F2EA 4DUGA 1KMHA 2QSZA 3WBJA 4AKHA 4LRWA 4DLXA 2IYRA 3W6PA 2ASEA 1LS6A 3OESA 2J59A 3AF3A 1RVDA 1NN5A 4OKSA 5E4FA 5B2ZA 5AJZA 2GXAA 4OK5A 1W36D 4LCBA 4MYCA 2GESA 1DO0A 3LAWA 3VHXA 2GK7A 1QVAA 4TT3A 4C2TA 1NMZA 1Z0IA 5FOWA 4A8JC 4WXRA 4B3XA 3GPLA 1G21E 2H8KA 2F3RA 1ZYUA 1T6NA 1PV4A 1WF3A 3PIRA 2WMNB 4TMTA 2EWWA 1P61B 2RKOA 3TE6A 3OHMA 3ADKA 1JR3D 3BC1A 4BZXA 1YJ5A 3IILA 4BZQA 4DLVA 3ZDQA 1E2KA 2CBZA 3PR1A 5HCIA 4TYWA 4Q1BA 1COWA 3TUZC 1G19A 3OFNA 2UKDA 4FI3C 2NO1A 3IIKA 3QIAA 1XTQA 1R10A 621PA 3NBYC 3VTKA 4ON9A 2QMEA 2ZETA 3GFTA 5LD2B 3A6PC 5LB4A 1ZU4A 4PFSA 4RZUA 4Q9LA 3X1WA 3MWYW 4AD8A 1E2JA 1TF5A 1Z6YA 4LGMA 4QJ5A 4UNPA 4ZIRB 2XEXA 1ZC4A 3N2IA 2BWJA 4PAOA 1AQYA 4ASUD 4O3MA 1NI3A 1KI2A 3KZ1E 3EWSA 1Z6XA 2ORVA 2TMKA 2IXEA 4US1R 1EX7A 1PUJA 2OFWA 4P3YA 2AWOA 4UXJA 4L4UA 3ZLJA 3NVAA 1OYYA 4DWJA 1Q3TA 3CRRA 1MR3F 4PC3A 3C15C 3AUXA 2CJWA 3FDIA 1Y63A 5DLQC 5J47A 2VP5A 3AKYA 3JVVA 3QPWA 4Q1DA 5C4MA 4Q4AB 2CNWA 3FFBA 1IXSB 4R71A 5EUMA 2VF7A 3BH6A 4I1UA 1IY0A 5BYKA 3LD9A 5FR2A 4JLMA 3OIYA 1YRAA 2XSZA 1NG9A 3W3ZB 4WW0A 4PZZA 3PEUA 1P60A 4KFRA 3I61A 3DM5A 3QBVA 4WXPA 2RGAA 1X86B 3W5IA 2C99A 4D4LA 1CR4A 1V5WA 2LKCA 4P4UA 4PZLA 3NEYA 4LJ8A 1P9NA 5FUYA 1XB2A 4HB3A 3CX7A 4F4CA 1E9FA 1YHNA 1E2PA 3IUYA 3AQ4A 1NP6A 2N46A 5H1YA 2QAGA 2Q9BA 3ONWA 3FVQA 3QPVA 3VU9A 3ZQJA 1T9HA 2ZS8A 3CZPA 3GEHA 3MCAA 3EAQA 1SVKA 1NNEA 2UVQA 4R98A 3GLHE 2NO6A 1U9IC 3I1FA 4A2PA 3L8YA 1RYHA 3I3SR 2ZM5A 4DRZA 1RRPA 4QGGA 4OI2A 3G0HA 2G3YA 3K0FB 1F2TB 1P9WA 1W0KA 2OCYC 2P0EA 2ZJBA 3DO6A 2C8VA 4B44A 4Q01A 4TLEA 3DZ8A 4DCUA 4V0KA 2WWWA 2GZHA 5EE3A 4ZCIA 4FMBB 1WQ1R 1C9KA 1E2IA 2NOAA 3BH0A 3RLFA 3ASZA 4TSFD 4C0LA 3MUFA 4B47A 1N25A 2ZSDA 1GRRA 3PJRA 1AGPA 2QP3A 4Q1AA 4BEBA 2FPKA 1NIPA 3TH5A 3GJ0A 4YMVA 1R0ZA 3IO3A 1JNYA 2EFEB 4F38A 2VP0A 4BLPA 4DCTA 1OSNA 3P4XA 4BFSA 1YR8A 3C41J 1US8B 2FEMA 2Q3MA 3EASA 2GILA 3I32A 3B1VA 1KKMA 4GT1A 4DLYA 1KY2A 4ZDWA 3CR7A 3RABA 3GEEA 2EW1A 3T06B 3QENA 2HT1A 3TUJC 1GITA 3D6TB 2FZLA 2XXAA 3HYRA 5CLLA 1SXJB 2JLRA 2ZXUA 5JSZB 2V7QA 4OHVA 1P2SA 4TMVA 3X2SA 2J3EA 3TW8B 2W2XA 2WSSD 5LDDC 2QMOA 4ZPXA 3LLUA 1TPZA 2BKUA 1U99A 4JYCA 4BLQA 1QG2A 2IUTA 3RSOA 3PUVA 4Q4LA 1OHHA 3CF0A 2QENA 1OKKA 2WWIA 1R5NA 1II8A 4TQAA 4URZR 4DUGD 2YZ2A 5DGXA 3I5YA 4EPXA 2K5UA 4ZCLA 1J8MF 1XZPA 4Q1CA 3RS7A 4MUAA 2RGDA 1G5RA 3T1OA 3NKVA 2O8FB 3G5UA 3CNLA 1CS4C 4GMDA 1EK0A 4TTQA 2ORWA 1CU1A 2PEZA 1KY3A 1MT0A 3AV0B 4JLOA 5DIFA 3R8CA 1GWNA 4LYAA 4PSVA 2O8BA 3NHBA 2G6BA 4TT3D 2R6DA 5AJVB 2QRNA 1MV5A 1VG8A 4AKIA 2NO9A 4KVAA 4YDHB 1TMKA 3BB1A 5DYIA 4QFMA 2XB2A 1ZC3A 4AYTA 1NBMD 3KQLA 3LY5A 3R7WB 4CW7A 4FIDA 4UQOA 3BB4A 3DEFA 2R65A 4FWIB 4MKHA 4YXWA 4QHTA 3O8RA 3CBQA 3WNCA 4Z8YA 5KSYA 1I2DA 2YKGA 2GBLA 4FXPA 4DCSA 1TEVA 2QBYB 1KSFX 3BH7A 4NYIR 3BD9A 4NCNA 2HCBA 3OFND 4QNMA 1AA9A 1T5LA 4FCTA 1Z29A 1XTRA 1XXHE 4XD7A 4HZUA 3CZQA 1KDOA 3N70A 1FQJA 2XITA 2J0VA 3CF6R 3BERA 3GJ3A 2VRWA 1KNXA 1TQ6A 2MSEB 2PLRA 1RRFA 1VHLA 2Z4SA 3AF2A 4NMMA 2VIIA 5G40A 1TUEA 3QXJA 4KBGA 4C0AC 1P7CA 4DDTA 2F6RA 2W6ID 3K09A 2OCPA 1X6VA 2WAXA 4GPTA 1I4DD 1BKDR 5EJEA 3Q9LA 3KUCA 3QY0A 1T3HA 2NO0A 4MA4A 3W34A 1NVUQ 1KI3A 2B7CA 3OIUA 1Y3AA 5J40A 3U7HB 1WB9A 4S35A 3SNHA 1G6OA 3T15A 4CEJB 2QP9X 1VPLA 2CCJA 1E2EA 2DWPA 1HE8B 2BMJA 3CB4A 1E6CA 4JBXA 4AIIA 1HURA 2QA5A 2BHRA 2CHVA 3AKCA 3NEJA 2CE2X
chains in the Genus database with same CATH superfamily
1EM8A 3TVDA 4OI1A 4X20A 2XSZD 5F4ZA 2JLSA 2H17A 3UATA 3N3BC 1EVLA 3H17A 3FZQA 2QLNA 1PSZA 4WKOA 2VDRB 1MQAA 3TBKA 2VRCD 3AW9A 3BTSA 1W87A 3OZRA 4Q6BA 5D3KA 1Q74A 1CUFA 5CT5A 4LZPA 2NZYA 2GHQA 5BXYA 4IGFA 4YUZA 5L8VA 4GMGA 2E21A 2JFBA 2SNIE 4P4GA 3ZGOA 4MWDA 1NW4A 4ENRA 3UJPA 3RADC 4P33A 2O3SA 3MYRA 5BQPA 2FW9A 4Q47A 2O8VA 2W4QA 4RYDA 4WY2A 5DSTA 1KJNA 1KDRA 2C92A 2AFRA 3PNKA 1WOMA 1KH1A 4KCGA 4AWAA 3ZDXB 3BKWA 4JUIA 1L5MA 3K9CA 4KQMA 3CW8X 4X44A 2C2KA 1CFZA 2BSXA 3ON5A 3FGNA 5GZ6A 1X9IA 1C7FA 4DAEA 4DWWA 4NDNE 2P11A 2XMGA 3WL4A 2J4DA 4BX0A 1UQTA 2NPIA 1G55A 2Q07A 1B0UA 5F23A 1G8JA 3A6ZA 1REQA 3A28A 1S2IA 4FCWA 2C78A 3VTZA 1SOWA 4ISBA 3HC7A 5E95A 1Z4KA 4B6QA 2J9XB 2I22A 2ORIA 2PSEA 2R6FA 4IHQA 3BJIC 3WLIA 4A1OA 5ETJA 5LN1A 3WNBA 3ZKWB 2YBDA 2P3LA 2IW3A 1QCCA 1S02A 1Z2AA 4PS1A 4RE6A 3IKJA 4D2IA 1NFQA 1N78A 5AJWA 4PZPA 3AIMA 5JJBA 3L7IA 2PX5A 3KXLA 3RS5A 3ZD8A 2E5FA 2PGLA 4LHVA 2AW5A 1QIJA 3HRKA 1FS6A 4GYKA 4EOGA 1JHOA 3DC7A 1SGWA 2WQZA 1PFGA 5HDBB 4AUKA 3U31A 4R41A 1FP4A 4IH9A 5EP3A 3GLFA 1AB6A 1Z2OX 10MHA 4RC9A 3KIPA 2KJQA 1MP0A 4J94A 4KKXB 4MYUA 4P35A 2DPHA 3C3KA 5GAJA 4AZTA 3SQWA 4IH4A 5D00A 3LO5A 1R4MB 1F2UB 3D3KA 4JIMA 2HK7A 4WZBE 1ADGA 4RKFA 1YQWA 4M21A 4UUOA 4H59A 3DLIA 4Q7QA 5AKJA 3WP0A 1FVFA 3M6FA 1G98A 2QROA 4BX2A 2PZMA 4MIYA 4WCFA 4BRSA 5F51A 3THWA 1SXQA 5J4KA 4L85A 3QKRB 3P52A 4OO3A 1HDXA 2FZKA 1KBQA 3IAUA 1UMBB 3VX4A 2AQ8A 1GXSB 2GPSA 1BA3A 2H31A 1JU4A 1XQWA 1T3SA 3GI1A 4JB8A 3SFZA 3VR2D 1HFWA 3G1UA 5JAZA 2YCLA 4DBLC 1MQ8B 4IMRA 3LWNA 1RWPA 5LD2C 1QKJA 1UMCB 4ZAFA 4IQ0A 2Q3CA 3FOWA 2IC5A 3M5WA 4CKYA 4PV7A 5JDIA 3I4CA 4PGHA 3GRVA 1LDYA 3VXKA 5DBEX 3G17A 3R7DA 2IYZA 2O23A 1DXHA 3WL8A 5K0CA 1E9BA 5JZ9A 2C7PA 2FN3A 1G2PA 3GCDA 3TFWA 2ZYAA 4RTNA 1JHUA 4BJ3A 3BDVA 4RLFA 1M2WA 2PMKA 3TUIC 1XMOB 5KKNB 5FFFA 5EJ8A 1FLDA 4FE4A 2Q2OA 5DCWA 1LV7A 4H1VA 4YHHB 2O52A 1YDGA 2QPOA 3ED5A 4YY3B 2VAPA 5AJXA 1RYDA 3ASYA 2GCOA 2C9ZA 3ND6A 5JALA 1CBUA 4KBYA 2VPQA 1V45E 3H86A 1XALA 3TLGA 2QN7A 3W5BA 5HUJA 4HFMA 1JFVA 2XGJA 2BEWA 1J06A 2JLZA 4IIJA 1KP2A 1VPDA 4BVGA 3BFKA 4LNUB 1QGAA 2G0NA 2WYOA 2OB1A 2ZVPX 2CB0A 3L7KA 3FTNA 1JZSA 2QUZA 3NATA 3RBZA 2DB3A 4DNXA 3CB2A 1BMQA 4YDRA 4TQ9A 3GBPA 4B7XA 2YV1A 1CWUA 4HJRA 1WPQA 1PE0A 1OXUA 3NTUA 3Q5DA 3UXYA 4FFOA 3ZE6A 4WJLA 3DEKA 2ZSIA 5FUXA 3S8MA 3ERCA 1MOZA 1JQAA 1HUQA 3K53A 3WDLA 1GL9B 4KC0A 3P8ZA 4UMEA 1IBCA 1USWA 3LH5A 1RJ9B 2NU8B 3R5FA 1GPMA 2WTXA 1FRZA 4X92A 1L2TA 5FQNA 1L5NA 1W59A 2ODAA 2C7BA 4CIWA 2X8LA 4WECA 4KO3S 3W5CA 2QTAA 1DRWA 2HPHA 1V48A 2PGDA 1KKLA 1C1DB 2CHFA 4GZMA 2QD3A 1A27A 1PT9A 2GCGA 2QD2A 3IDSA 4ZZIA 5HIAA 5JWRA 2WNSA 1Y1QA 3ITDA 4NEHB 2X40A 2QP4A 2JS7A 2ANCA 2NQ2C 2XUGA 2YVAA 1E92A 9LDTA 4L27A 4J0DA 2JG3A 4P38A 3AKDA 1ONSA 2OV3A 3WRYA 3GLHB 1FX0A 5CT4A 2INGX 1PF7E 2PT6A 3L5OA 4HNSA 4ME6A 4BNWA 3ICPA 4WN9A 4B46A 1C0PA 4K6KA 1WKBA 4QQRA 1D3AA 2GUGA 4IVQA 3TSCA 1D5WA 2CLSA 3ZKAA 3JTMA 1SBNE 2HCRA 2XBMA 2ID9A 3ZCPA 3Q7EA 4TKMA 4M1KA 3ADCA 4CKBB 3TVYA 2A1UA 4M1TA 3MBOA 3KJEA 2QYTA 3BVPA 1NLUA 2RB4A 1O77A 1BN7A 5ES4B 5ICCA 4KQ9A 1GRCA 1IWPB 4U5XA 3E9QA 2X1VA 2I2AA 4L4YA 4BWGA 1Q11A 4MRPA 5SZIA 4UHEA 3PU6A 1XL1A 2IJGX 2WIDA 3RGGA 3HKEB 4FYJA 4RCYA 1OQAA 1SXJC 1E8NA 4JSRA 4C6SA 1R50A 1KMMA 3DOHA 4LWQA 5KKAA 3DKKA 4CEIB 3LUPA 4PYKA 2J9YB 4EY8A 1CVIA 2AN9A 2QUIA 1JB1A 3NC1C 3EBOA 2Y1DA 4P7KA 5DE3A 3ZDBA 1LNZA 1HSOA 3U3JA 2VP6A 3QF4A 2FE1A 3Q11A 4PPFA 3O95A 1XKTA 1O9GA 1QBGA 2IBMA 4JVSB 3AKZA 1KI7A 3FR7A 1ZQ1A 4OFWA 3RUEA 1Z0KA 1ZQ9A 2QVBA 3M33A 3H1TA 4R84A 3ZH9B 1X7ZB 4TT8A 4AB1A 4FZRA 4TWJA 4C22A 3ES9A 3ER6A 3HADA 3RS3A 3MG9A 3R23A 4S1VA 1N2EA 3G7UA 3F90A 1AUPA 1R0BA 4NR0A 1J56A 3N5KA 2Z3ZA 1JHPA 1KZ1A 2FSIA 2VBIA 4QPDA 1TZ2A 1YZVA 2BE7A 2PLAA 4BQRA 3CINA 3G5LA 1OZFA 3I1YA 1OXTA 5JE8A 3S1AB 4FINA 1LQTA 1J2JA 1O9BA 3PHIA 4UD2A 2KB0A 2XMDA 3I2FA 4CFYA 4XIFA 4BUCA 4BO2A 3FHLA 1GU1A 3H05A 1VG9B 4JVMA 1Y9DA 3KEGA 1BMFD 3DMNA 2V74B 3TK1A 1X7YA 5DTIA 1ZBQA 3II6X 4FEEA 1E2FA 1NW9B 4R8RA 4F4JA 3ZJ4A 1KFCB 3OEHD 4K2HA 4O2BA 1JJVA 4RLQA 4CG3A 4UNIA 5G1NA 3VOBA 5ITZB 1A5AB 1V5IA 2E6KA 2GA9A 2WJIA 4EG4A 3O3NB 3FYUB 1G20E 3AP3A 1V4BA 1L0BA 4JROA 4AP6A 4ZCMA 2HYIC 4EF5A 4AWBA 4QATA 4A0HA 3AM4A 3HMQA 4XFDA 1D2HA 3E18A 4UZSA 2Y6UA 3THXB 3OJCA 4BNFA 1M74A 3RAEC 2PANA 3KYCB 3EF0A 4N3NA 1DI0A 4EG6A 2BC9A 2YFHA 4JB2A 4UCWA 1AS3A 1ECFA 1I1OA 2EF0A 4GZ6A 4CMEC 1YZYA 2CJXA 1XDDA 2D1QA 2QIPA 3BXEA 3N7UA 4JS0A 4UM7A 1TD9A 3ZXSA 7GPBA 2V59A 3LW8A 3PI6A 4AJOA 1A0OA 3QSGA 2WJ4A 4JI1B 4B84A 4CTMA 2Z2KA 2DQKA 4ZVKA 4EP1A 2I3BA 4KACA 3MWKA 2Q3DA 2HLPA 2GO1A 3ZHXA 1EUDA 1EEHA 1UFOA 3K5WA 3EMVA 3LE8A 3LY9A 5FLEX 2KE5A 3V7YA 1QZXA 5B30A 3GLIB 3HLYA 3H1FA 5KSWB 1IU9A 4ZZ1A 3BF8A 5LUBA 1M75A 2VAWA 3I92A 4MA5A 4B4UA 4QUEA 4MVJF 2ZYGA 2BJWA 4UHJA 4Q1FA 3GN2A 5DCUA 1KDZA 5J43A 1QZTA 3OCJA 1P4SA 2FNAA 1RZVA 4M89A 1E7SA 3OZIA 1HT1E 4EQ6B 2IGBA 3M6AA 2YJ5A 3CLRD 4GOLD 2BHNA 4MHSA 1W76A 3ETHA 2CNNA 4HAOA 3TG8A 4EY4A 4XARA 4O1MA 2I8CA 3EYAA 4YRAA 1W73A 1XCGB 3AHDA 5EA2A 1PGQA 2V45A 3SKXA 4IDHA 1OLSA 1I3CA 3TZKA 2QTWB 2HTFA 3QKWA 4FJ1A 1R74A 2C58A 3INRA 1OF1A 1Z7WA 3AB3A 4MEBA 3DBIA 1S3SA 3SEQA 4RSHA 2OENG 1KZ4A 5IH3A 3A25A 5LQRA 1TGVA 3VKGA 1EFRD 1ILEA 1A8SA 3L8HA 2DTDA 5A03A 2VHTA 1ZHOA 1GKKA 3ZU6A 1KXJA 1XQ1A 3FLAA 5JZBA 5B1DA 3V3TA 4L15A 2FEXA 4TV9F 5H68A 5EWMA 2IZOA 1U7UA 2X1MA 4KSBA 3RO7A 3QNUA 3HJGA 1ZDMA 5FBHA 1ST3A 3PQ4A 1EDEA 3TLXA 1VKOA 4DMRA 4B3MB 2CLOB 3DMGA 3PC8C 3VDNB 5IAAA 4XWKA 1O94A 5DYGA 2UZAA 5CD9A 4BNVA 4FMCF 1B6SA 4FKZA 5DLDA 1JUDA 3GV0A 1T0HB 3IE0A 4MIEA 1SIBE 2FCRA 3TQCA 5JQGA 2OD7A 5FNVF 2PX4A 8AT1A 4YCLA 4DHEA 2JCBA 2VZ0A 4MK4A 1PVDA 3KJIA 2HBZA 1QHSA 1RYEA 2B6HA 3HCDA 4WBNA 3KUXA 4RPHA 2BEJA 2DH6A 3D2LA 4ZXPA 4JKYA 5TVGA 2C97A 5GV7A 1VMKA 3NAQA 3TTVA 4ND3A 3TLBA 2JKVA 3PFNA 4ARZB 5F9HA 1XU7A 2DR0A 3KUUA 3ROMA 4EKNB 3EPJA 3E9ZA 1TQ2A 2HYDA 5BWCA 3LZ6A 1AQNA 3WIVA 5AM3A 3GEPA 2FY8A 5ENVA 3UB4A 3O73A 3VV3A 1WNFA 1K86A 1M73E 5GONA 4CGZA 4FTWA 2R48A 3K6SB 3ADOA 2GTPA 4YCJA 5JOQA 4YO7A 1RAGA 3NNDA 1ECBA 4N48A 5B6JA 1I51A 4AZ3A 1Y7HA 2WJWA 5HJ2A 4MQFA 3JQFC 1ZFNA 2G09A 2Y8EA 1G8AA 4MUMA 4RQUA 1CQIA 1EWRA 1Q3KA 2O20A 4ZIRA 3QP9A 4HNVA 5KPJA 3ESDA 4BFVA 2WIKA 1ZVMA 1P4RA 2VTBB 2RJNA 1QOZA 1HT2E 2C3OA 3BXHA 4QJ3A 1HFKA 1ZM7A 5ECYA 4HGYA 2QSJA 4E3ZA 3AFHA 4CPDA 1YJBA 2MDTA 4XSHA 5FQOA 1ZCZA 1KI9A 3WS7A 3OCYA 1T91A 1S96A 2BEVB 2R7KA 4MKFA 1EHIA 3CF4G 2CXNA 5CP8A 5BNIA 3RQSA 4QD3A 3FPGA 1TM5E 5H80A 3HK2A 3EVGA 1RBZA 3SS8A 4GKJB 1ESNA 3SVLA 2VP4A 2ZI9A 1IIBA 2YQ4A 2ATXA 4RWZA 5TJHA 3OA2A 3WMGA 3R44A 4H4EA 4HNQA 4Q4AA 2RG1A 1D6MA 1T6BY 4IDBA 4XWAA 5EJIA 4TZ0A 4FEYA 2IXFA 5JDIC 1AXEA 1FQOA 4YJ2B 5KX5F 1HEYA 1L7MA 1C9YA 2QV7A 1E2BA 2TMYA 5IM4F 4Q82A 3SLGA 1MOQA 5B4VA 2QL6A 1T9GS 1MIOA 2RCNA 2XZTA 3FTQA 1GV1A 3EGXA 2DKNA 4YJFB 1AO0A 1TC1A 3OPNA 1NJ8A 4F85A 2IPOA 4LRUA 3KT3A 4ZOQI 2AOTB 1PEDA 2Q5HA 2VNHA 3EG5A 1OX4A 4UDXX 4QOFA 3ZI0A 2YWDA 2RDMA 2DT5A 1XWIA 3BRWD 4IMPA 1I3OA 2H1HA 4YUVA 1ODSA 1NWHA 1XMVA 1ZAKA 4UZFA 3OZGA 4EY5A 1JJAA 3NANA 4A82A 4Z5XA 1JQJC 4JI6B 4ZO4A 1Y7PA 3IS3A 4OGFA 5CX1B 2ZCUA 1F1JA 4DRXB 4HCJA 2QY6A 3D31A 2ZJYA 1CB7A 5A0TA 3W4JA 2OBNA 1QC5A 3F9CA 5IHXA 3N2YA 3FNBA 4DSAA 4ZEOA 5KPDA 4F1KA 2EKZA 3WDMA 4QFCA 4PO3X 3DBHA 4PG6A 1P91A 1E3JA 2ZBUA 2ZRLA 3GH3A 3OBBA 1O0CA 3DPUA 1H93A 4XX0B 5FOSA 3EIOA 5HRAA 1BE8A 1HMYA 3JQ9A 4CTJA 2R8RA 4YCCA 3NV7A 1MG0A 3S7ZA 5IDWA 4AJLA 1K2WA 4QOGA 3CGWA 3G0BA 4EEZA 3PQ3A 3O84A 3Q9NA 3QE4A 5F12A 4E70A 3ECSA 1IQPA 1U2DA 1UPUA 2Q0HA 2QAGB 4H60A 4CRWB 2P9EA 4UDYX 4PPQA 1OGYA 5EJAA 1ZNXA 3H0KA 4RK1A 2XDWA 1ESZA 2XDAA 3IQHX 3QJYA 4H1TA 4YRSA 4WXEA 2B2NA 2ORYA 4P3NA 5DBFA 1Y6FA 4M7PA 4QFDA 4XJXA 5AHXA 3CKKA 3UB3A 3WRYC 3AIOA 4EA6A 4JUDX 4YJGA 1N32B 3O82A 2OXRA 4TGLA 3AGPA 1V16A 2R47A 3OJXA 2M1ZA 1PEKE 4GZ5A 1JR3E 3TW8A 3FUWA 4QL3A 1OXVA 1BEZA 3DDHA 1PR2A 3G5MA 1IUKA 2PJDA 3CNOA 4HDSB 2I2WA 4LI3X 1L5FA 4FMPA 4Q4CA 1P2FA 2F2TA 3QPDA 4CLRA 3CVVA 3EPLA 2C5SA 2X15A 2HSWA 1Z4OA 2IHUA 3DA8A 2CBGA 2VYQA 3IP5A 3ND8A 4NU0A 3VV2A 5A05A 1P2TA 2B35A 1ZR4A 2Q99A 3STWA 4HSEA 1FNCA 5HVNA 2H5EA 1MX5A 3NC0C 1UJ6A 3CXUA 5ENZA 3RU7A 2XUDA 1WDWB 3WJ2A 5BN1A 2N1MA 4B83A 3R9XA 2V6FA 5JXHA 3R7SA 1N0VC 1N8NA 2GASA 5DZSA 2IZ1A 2FWRA 3NHJA 1CD5A 3BA6A 4ZI2A 1S89A 4F45A 1WRBA 4PLHA 1HT0A 1TEHA 3L0YA 4WJZA 5GM1A 3ZWVA 2BM1A 3HXQA 3ZDRA 1SQFA 4KQEA 2J5KA 1PJ8A 2N9UA 1JMKC 2IKSA 2XWPA 3JXEA 3KC2A 4V0NA 1Z8FA 3AO0B 4P32A 5I7FA 3N7AA 4F12A 3PQCA 3KKMA 4C14A 2JVIA 4EI9A 1T5HX 4LC0A 4QBFA 1S9DA 1LTHR 1YR2A 3EGCA 1NJ6A 1DFGA 1FYEA 2IT1A 4KMMA 4JJKA 2VZ9A 2OQ2A 1F1BA 2NX2A 1G1MA 2HRCA 1U3VA 3JAWA 1B1AA 1DT5A 1KI1A 2WOOA 1ZOLA 3EC1A 1E2HA 2XBUA 3JWHA 4J1NA 4WKGA 4KXMA 1DKQA 1LJUA 2JJ2A 2HL6A 3CZ5A 1WMSA 2Y0CA 3OFJA 3Q8KA 1HY3A 3RAJA 4PAWA 3UJ9A 1JV2B 3B3AA 3L0BA 4LVCA 4TKVB 4X62B 4OHYA 3LQ1A 5KYXB 4AN0A 1C4OA 4Q9HA 3HNRA 2XR1A 2GMWA 1QHXA 3OOYA 3QVOA 5EE0A 4D3DA 1XRNA 2A4KA 2WW8A 3WQQA 3CH5A 5A06A 3FMPB 1ONBA 1T2DA 3B1WA 4OYLA 1WDMA 1YDFA 3WLAA 1NZFA 4D26A 5ALIA 4FFBA 1DIAA 2HK6A 5EZYA 3USZA 3MW8A 3GDFA 3B8HA 1CB0A 3IRVA 3UT5B 3QJ5A 4A0FA 3N74A 2PPVA 2CT8A 5L3ZA 4KH1A 1XEWY 1KOJA 2JGNA 5CBPA 2QNRA 2WUDA 3GT3A 5JCJA 2YN0A 1WQ4A 2O6HA 4JUCA 2OXIA 3U4MA 2JD2A 3KKPA 4JI2B 2ZKLA 2WQ6A 4NZNA 2PE5A 2G83A 1BWPA 3TVTA 5A9TA 4J0JA 2O4CA 3G2LA 1XZLA 1I5OA 3OI7A 4PIPA 3KQHA 1S7CA 3H6HA 1GU7A 5FIUA 3RK1A 1DJQA 1G20B 1OREA 3BMOB 3M1IA 4PLWA 3EQ7A 2XUJA 5LYYA 4W7HA 2AYZA 5DHQA 1KPIA 5KO2A 4XCXA 1RZRD 3E2PA 1U8CB 5HW0A 2X41A 6LDHA 1VIVA 1JEQB 4AL4A 2E4ZA 1Z39A 2HF7A 1P9RA 2FX2A 3HR8A 5GZ3A 5J2UA 1OCEA 3EMBA 3O8LA 2BP7B 4H3VA 3WYCA 4AKSA 4C0BA 4GKBA 2IU0A 2PNJA 2HOQA 4CDMA 1SBCA 5IVHA 1ECCA 2VJKA 4KYTA 5DN6A 2F67A 3FCSB 5CGQB 4J3JA 1Z6TA 3K92A 5GP1A 2H4JA 1PD1A 3MILA 4U2KA 1Z25A 1Z4MA 2HMSA 1GZVA 3PX7A 1DEXA 1A82A 3HA5A 4K0KB 1BJTA 2DBVO 3T4PA 3PUIA 4IJ6A 1EUCA 3BE6A 4C2AA 3VZRA 4DADA 2YY5A 2LWIA 1OH5A 3PQ7A 1P73A 2G4VA 2M6SA 3WV4A 2Y1XA 3W2TA 3WZ2A 5FPKA 2J08A 2YHIB 4PBRA 5JBQA 4YAUA 5C52B 1T8YA 2GSDA 5EERA 1YE8A 2NXCA 3TGLA 5IDVA 4F46A 1CDZA 3KWLA 1I2BA 3FNEA 4YP0A 1KZHA 3UAWA 4OQQA 3RVMA 1NV8A 1XZJA 2J6BA 4BN0A 4KWCA 1JHRA 2JK0A 2QQGA 4W9NC 5PNTA 4TTSA 4GKAA 1RWQA 2OESA 4IX1A 3HDGA 2CLCX 5KHLB 3AONB 3X1XA 5JSHA 1C1YA 1ZXBA 1QP7A 1RKUA 1GQ2A 1N6PA 4Y30A 5HGJA 2QN2A 3DDSA 1XWFA 2WPDD 3IPRA 4P4NA 3SOZA 5MN6A 4M4SA 3KLPX 2VK2A 5JAMA 2NP7A 1YJ8A 2WAYA 3GEGA 2C77A 2XWBF 3RU3A 1DU4A 1E4YA 1O94C 3TWOA 4TKUA 3WAJA 2XNCA 1GAXA 1UBCA 1B3RA 3IVAA 4XGQA 4YEDA 1YDMA 3UMFA 3D81A 3N59A 3T1QA 5CVTA 3NONA 1XEFA 1J8YF 3QVLA 3TCXB 1XF9A 4UNRA 4YAGA 3W7VA 1ZIOA 1AHHA 2HNKA 2A1IA 4DR4B 1UBEA 1T5OA 1N0UA 1WPRA 4H7JA 1NBME 1AX9A 4GSKA 4GFDA 1SXJD 4RHCA 1F7VA 2IP4A 4BNIA 3A11A 4LQLA 3CWQA 4YAIA 2CK3A 1KYQA 3W79A 1G21A 3O8BA 1Q17A 2Z2JA 2FX5A 3HBLA 5CURA 3S70A 1IG0A 3DAYA 4YMWA 1L4BA 2B8JA 3KFVA 1YA8A 3JZAA 1DARA 4UEQA 3TR0A 5LOVF 1IZ8A 3PJDA 1JI0A 2CF6A 3VO9A 1AKQA 3B82A 1D09A 1HQKA 3BMQA 2AJTA 2YQ5A 1Q2XA 3A9VA 4FD2A 1NY5A 1PK8A 4YAWA 5MGBA 2CC2A 1QHHA 2FPGA 5B2EA 3KAQA 2D1FA 3QXCA 5AK6A 1HE4A 1L8LA 5BOSA 5K0EA 1T24A 2X3FA 3K16A 4YT2A 4ND2A 1WMDA 5DF1A 1EEXB 3R3ZA 4INZA 1ST2A 5TMPA 1UWCA 2F3QA 3SVZA 4OBXA 4D9IA 1P1BA 5AVKA 5CXQA 1OB5A 2C82A 1X1QA 2FRVA 1M2FA 4O4LF 1IOVA 4L3WA 4ZN6A 4S3MA 2JFWA 2CNBA 3K9QO 4P34A 1T9AA 4PYIA 4X1YA 5DK6A 1PFWA 5LM3A 1NKTA 2B6NA 3UAOA 1CX9B 1XMPA 3H75A 4FVTA 2YWGA 3LS2A 4W5JA 3RWOA 3HBAA 2EDCA 2XXJA 3ZS9A 2ZIVB 4DN6A 1M2OA 4C04A 3D8RA 4HMQA 3V48A 1BXRB 4P4SB 1OFIA 1QH9A 2AJLI 3QLTA 1UOPA 4LSWA 4YJ3A 5D1NA 2XDQA 4OQLA 4R9SA 4ZQFA 4E3WA 1TZBA 4HH0A 1IB6A 1YRYE 3QLVA 5IDQA 3ICOA 1YONA 2QF7A 3BIJA 1XE3A 2VVTA 3EIFA 3G0GA 1RHRA 2BMFA 2QVGA 2O0KA 4ZO8A 4HNHA 4LJYA 1LZKA 1R0SA 2GS9A 3R8XA 3LQYA 2A3NA 3AGQA 2UYHA 3VNUA 1CEYA 3TS1A 3TEFA 1GR1A 4YLEA 3RU2A 5EXPA 3IQZA 2ZUEA 4IOLA 3KZXA 2F8SA 3HUFA 2D1RA 2I4TA 1GUFA 2WJ6A 4JI3B 4YCNA 2XTAA 1FSFA 1KAOA 1YZTA 3PEVA 4UW9A 2GCOB 4R1LA 3A6DA 4XQGA 5KMGA 2XA1A 4LHYA 1JSCA 2ZSJA 1E62A 2CFSA 1IJEA 2REOA 4UHKA 2DRIA 2MINA 3I9FA 3B7GA 4XYEA 1NY6A 4J2TA 2J8ZA 1R0WA 4AY5A 2AEFA 2X7JA 3H9QA 1S2LA 4QSHA 1KRXA 1MAUA 1QHGA 2E5LB 4MQMA 4YRTA 1ZN7A 4BX8A 1N5DA 4Z3KA 5CB6A 3FB1A 4NRDA 1E3QA 4Q1VA 4Y6LA 3QEKA 4ENSA 3VYVA 2QUBA 3KV1A 4MYTA 3RUHA 1SIUA 3JQ9C 3QI7A 4DMKA 1RC8A 1GG5A 2V0GA 3K0EA 5CH5A 4RFSA 1N36B 1H3FA 2O7VA 3UFXA 2VAMA 1GG9A 2AXEA 2XCLA 5F33A 4YR9A 1IVSA 1KOFA 1LDGA 3GO4A 5FRDA 1A1VA 2IF0A 2J9ZB 5CEEA 1ZSYA 1ZVJA 1U2DC 2YMQA 3OQIB 3WMRA 3K5PA 1DRVA 1Q95A 1N2CA 1Z4NA 3NHLA 2NYAA 5KYWA 1WXQA 4RTKA 4JYZA 5FF9A 4O4IA 3RUAA 2E85A 1OBFO 2W6NA 3U60B 2ZTVA 1C7JA 4I4LA 5ECWA 2I3DA 4GOKA 3T3HA 4BMDA 4QGSA 1E8MA 4J03A 5C5DA 1GG8A 4CM4A 5HCUA 3E2IA 4HAUA 3C6MA 3K8YA 2C4UA 2GN0A 5EJGA 4HC4A 1ZH8A 4JASB 3OLCX 1KZ7B 1QPZA 1GLVA 1PL7A 1I7DA 3PFIA 4OLFA 1FX0B 3ZU2A 2WF6A 5CHEA 4ZYTA 2DLDA 2O0MA 3ZIAD 4JU8A 3WISA 4E6PA 4Q9JA 1EK1A 4BQOA 2QG4A 5CBKA 3G88A 4FYWA 4A6DA 3ZHSA 4NBNA 4HLUA 3EIHA 1XOIA 4KU4A 3D5QA 3GAMA 3AEKA 3P20A 2Z83A 1Y8QB 2B5VA 3PENA 4DQKA 5DKFA 2JI8A 3OX2A 3S8EA 1OOEA 2E4XA 5IUJC 4XB1A 3NGLA 3TTTA 3C70A 4IHJF 5C5CA 4XOIA 4ARAA 4M7RA 1MABB 4MV9A 2IZ0A 3PL1A 4J9VA 4NTZA 3Q15C 4BLSA 4URXR 5EUCA 3EXHA 5SZJA 3FX2A 3HQ4O 1JFRA 1CR2A 4E31A 1QOQB 3REGA 2A5DA 2C96A 4MI3A 2G70A 3RARA 2OO3A 3DYVA 4KJZA 2P79A 3O7MA 1IUOA 3REFA 4AQDA 3RC8A 4ALKA 4CR6A 1C0LA 5BR8B 4CLOB 4CQMD 3EY4A 2PIDA 2C9OA 2P5SA 2H06A 4U3JB 5CMLA 5G0UA 5HE8A 5J3JA 4JV5B 5J2TA 4RDCA 4MINA 3WYNA 1Q2UA 3OQHA 1NZDA 2ID8A 1XVVA 3P0JA 4P5PA 2IBTA 2WP0A 1T9KA 3E8SA 2XCQA 4GPD1 3GJ6A 3MT8A 4Q3BA 4AW9A 2HH9A 3JVDA 4OBEA 3RI3A 4ZEMA 5A6VA 2JLBA 2P6PA 5FTNA 3T9AA 4KR7A 2FMIA 2XZLA 2EP5A 1PAUA 1V47A 2X9LA 4S1WA 5HJ7A 2F7SA 5BSWA 1JFFA 3VHRA 1WCIA 2NSDA 5EP4A 3CEPB 1Z37A 1MORA 3ZYZA 4HMOA 5JRJA 1LTKA 5FEMA 5KSPA 2GD1O 2XEDA 3CH6A 3HBJA 4JB3A 1P5HA 1C7RA 3PEYA 3ABZA 3MMXA 2PUWA 3ANYB 3IT0A 3NBAA 4P84A 1GNVA 4YYZA 3A06A 3DVQX 3KV3O 3DVAA 3YASA 4MB2A 4EPTA 4RVUA 1OV6A 3DLPX 3GB9A 3GUCA 2R00A 2QJRA 4OXNA 1SZCA 5DWQA 5B36A 3U16A 1R5OA 5I8PA 1GZ5A 1Z6PA 2C95A 2NZJA 2DFDA 5LU9A 1EIWA 1YU9A 3CEMA 4URFA 5CVCA 5KQRA 5HTOA 2VUUA 3KBBA 3N9IA 3QPUA 3JVEA 4XZ3A 1X7YB 4ED9A 2H2AA 2Q2WA 3OEEA 4M9XA 1HR0B 1JHZA 2Z8YA 3KOMA 4F04A 1RRCA 1O54A 3QKSA 1DE0A 3B2QA 5JCOC 2GRUA 4EYOA 2AH5A 2IA5A 4AMZA 1SO8A 4JLBA 3QFFA 2VK1A 4KGXA 3HU1A 2BDTA 3SSNA 1Z6QA 3C87A 2FDCA 4NENB 4RVNA 4PE5B 4BO8A 4RHEA 1LBHA 3DEIA 3H2JA 4PZ9A 1Y1LA 3WHIA 1U9YA 4J1QA 2JLCA 3SR3A 5KNDH 2DZDA 3QYPA 1YWGO 3I62A 1M1YE 3WV5A 3LF2A 5JMWA 2NUAA 5KWEA 2OSBA 2YWEA 3DFMA 3U4GA 4J0EA 1E79A 1RI2A 2O50A 4EJSA 1EXDA 3KHKA 1SOUA 4IF6A 3R7AA 3WGKA 4HUQB 3JASB 4JEIA 2B37A 3R6GA 3GFBA 5IAOA 1PR0A 3DDOA 4L6AA 1JGTA 2LE0A 1RADA 5LZ9A 1LC3A 1P77A 1NN0A 2BCGY 3UKDA 3U39A 2EGHA 3ISTA 2TYSB 4JJ4A 2BMVA 2YZKA 3IDQA 4OQDA 3UCEA 2BEKA 5AUOB 5JASA 5KVAA 3OQOA 1GQYA 5DT9A 3WLRA 2OKGA 3SEZA 2ZJ1A 3ESBA 4TLMB 4AMUA 3A2LA 1NF9A 1U81A 4P3KA 2WJ3A 4L4XA 4ZQEA 3ZJUA 4Y2XA 1LF0A 3QFCA 3D7SA 3I1IA 4G9EA 1JHDA 4DZZA 1UANA 4HZGA 4KQJA 3NWJA 1YTUA 1OMOA 4X8HA 1EE1A 5A6SA 1L3IA 2NACA 3PXCX 1P6QA 3MWEB 1M2GA 1O87A 2DFLA 3RPEA 2G63A 4EECA 5FOUA 2V7GA 1X74A 2OEPA 2ZTLA 1XP8A 3EVDA 4B73A 3AFGA 3K15A 4FHCA 2CL5A 2R8YA 4LOKA 3K05A 3SXUB 3V4ZA 3UOAB 4OXYA 3PHCA 1P44A 2GBPA 1ITZA 1TVCA 2QRPA 4TRNA 4WV3A 5HIIA 5K2MA 4C4ZA 4ER7A 3RUCA 5NLLA 3OQJA 2Q3FA 5K99A 2GN6A 1NL3A 1MVOA 4I2NA 3VSAA 1QP4A 3QXSA 4MV6A 5DW3A 2JFVA 1WX1A 3L92A 4JLJA 4ZAYA 3E53A 4RTPA 2DHCA 4A10A 4FC7A 3F1KA 4KN9S 5F77A 1USGA 2VAVA 2FSUA 1AKEA 1X8JA 2P5UA 2QRJA 3UWMA 4URVR 5DNWA 1DOHA 5JJCA 5HUQA 2N0SA 3AFNA 1E77A 3KSMA 5A9RA 4LOIA 1P1IA 4LZJA 3SIWA 1YIDA 3IOCA 1E5LA 5FO1A 4BUZA 4NS1A 4R54A 4DM3A 3OKFA 1GRNA 2PZKA 3VR5A 1VZ2A 1MB3A 2LKDA 2YC2C 5KHOC 1ESCA 3A3KA 1HEIA 2I3GA 3DE7X 3KQQA 2OD2A 4DV3B 2H59A 3EVNA 4WZAA 5DCLA 1UAGA 2OOKA 2QN9A 3EW7A 4U7DA 1ZU5A 1YL5A 3UG6A 4P92A 2WFLB 3OA0A 1KDPA 1VPTA 4JZKA 2XQGA 4MCHA 2BVNA 4RNDB 4HDOB 4RZ3A 3L4JA 2DQ4A 2OBBA 2GLUA 3VJLA 3A2KA 1R8YA 3AL2A 3LDUA 1FA9A 3EGIA 1BRTA 4IEFB 4E4YA 3T5MA 1D4ZA 1E2NA 4HNAB 5JXJA 5LWHA 1POXA 4QVIA 4JL8A 3S2GA 3HXTA 3PEFA 1NSFA 5ARCA 4IW3B 3TPFA 2F3SA 4CM9A 3HKBB 2WB4A 4GVLA 3KE8A 3AINA 4X3OA 5JZOA 4Q7KA 1QLHA 4HWSA 1EJ6A 4I50B 4WLVA 1TF7A 5BMVA 1UWVA 2PQ0A 4G1UC 2WUWE 4P36A 3DZFA 3WOVA 3EIUA 1XU4A 3HM9A 4HFNA 2MMGA 1GZ7A 4OAPA 1AURA 4CU2A 1JPNA 2ZANA 3BFXA 1V5FA 5CIYA 2JF0A 4IY1A 2O48X 1B41A 1O8BA 4BQSA 1H2XA 4K9RA 4U6QA 2P2SA 3T0FA 3W2EA 5HSGA 2D5AA 3QQ5A 4MAMA 3QX3A 1M6NA 4G81A 3E1GA 4HEA6 3D4IA 3DFIA 2GAFA 2LD4A 1TM1E 1WUKS 4PW0A 4AURA 4Z7QB 2JLQA 1ZW1A 3K7EA 4ND5A 2WP8J 3R7FA 2WHQA 1CY0A 2GCEA 1UZAA 3LBNA 2OHGA 2I7DA 3HJHA 4I5GA 2CVPA 4J7UA 5AQ1A 4DUZB 1SVSA 2G82A 2Y2VA 3M9LA 5BWBA 4MYSA 1EBFA 1KDTA 2BKEA 4MQ5A 1X13A 1KETA 3BHMA 3GRYA 5DP2A 4ZVOA 4AJKA 4DJDC 1LX6A 1PZXA 4HDNA 3DT9A 3JQGA 2X6TA 3HHEA 4QXPA 2OCAA 4B8YA 4PHHA 4CEHA 2R7MA 2QTFA 4KYUA 3F6PA 1CF2O 1YZNA 3T7DA 3BWVA 1BX0A 1X1CA 4G4SO 4E21A 5F9FA 1EXVA 1QANA 2NYVA 3QLVC 4JOQA 4TYPA 4OI0A 2F59A 1A9ZA 1B6GA 2FPXA 2G76A 3CR3C 4CL3A 1E66A 2ZI4A 5K51A 3O92A 2IXTA 1HE2A 1N57A 2VZEA 1T3ZA 2R6JA 2RG7A 2YC4C 2PX0A 1L4UA 2ZQZA 4L7QA 4UCXA 3AJEA 3E15A 1KARA 3HEAA 4YRZA 1MIOB 5KIAA 3IAM6 3OE1A 1ZI8A 5DMHA 1IN7A 4FT2A 2VPPA 4RFVA 3RJ5A 4ETNA 5A3QA 2CNDA 3DMYA 3BGDA 5DXFA 1XPUA 3K72B 1BW9A 1TM3E 3GEMA 3FGOA 4GOOD 3T9CA 5EQFA 3JPWA 4KZPA 1PR4A 3RIEA 2PT5A 1DRJA 3FJOA 3V46A 4I4TA 1XTJA 4XCVA 1E94E 2PH1A 4QG7A 5BUCA 3GLGE 4OMDA 4JJGA 3IMFA 2FMHA 1QK4A 3N6VA 1T2NA 2ZWVA 2FRDC 3NBZC 4GXNA 2RC6A 5ALFA 3I76A 2ZBFA 4FS8A 1H23A 4WRRA 3DV2A 1S5PA 1B00A 3CKMA 1MG5A 1MB0A 1U3GA 2W8BB 3O0DA 1U7ZA 1JBKA 2ZAYA 2NG1A 2C1ZA 3SZGA 1X94A 5GPBA 2G1JA 1ZW6A 3L7DA 5J4VA 2FEKA 4K9PA 3PQ2A 4RMNA 4XWTA 1LVHA 4FN5A 2FVYA 4H7DA 3MFYA 1QPBA 5DX0A 3AESA 3RVRA 3ZDY