3ZYCA

Dynamin 1 gtpase ged fusion dimer complexed with gmppcp
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
347
structure length
330
Chain Sequence
SMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVDEMLRMYHALKEALSIIGNINTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords DYNAMIN-1
publication title A Pseudoatomic Model of the Dynamin Polymer Identifies a Hydrolysis-Dependent Powerstroke.
pubmed doi rcsb
source organism Homo sapiens
total genus 103
structure length 330
sequence length 347
chains with identical sequence D
ec nomenclature ec 3.6.5.5: Dynamin GTPase.
pdb deposition date 2011-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00350 Dynamin_N Dynamin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3zycA00
1HQCA 4Q01A 1GL9B 1MOZA 4BUJA 4I1VA 3GD7A 3P4YA 3CWZA 1HY3A 1EGAA 2HJGA 1IBRA 1ZNWA 4P4TA 4C0QC 1Q12A 1WE2A 4PC2A 3H1TA 4MKIA 4N0EA 4CVNA 1ANKA 1OYYA 1JALA 4O3MA 5JJLA 1Z6AA 2HUPA 5JSZB 3G82C 1F2TB 2NO9A 1CXZA 1OJLA 2GKSA 4QG7A 2DFKB 1W4BA 4FI3C 1R8SA 1NJFA 2GA8A 2C8VA 4OI1A 1MH1A 3K9NA 3M0EA 4Q5IA 2VO1A 4FN5A 2Z0MA 2X8AA 1II9A 2Z5FA 1E1QA 3I92A 2BEKA 3A8TA 3EC1A 1VPLA 4L5BA 2HV8A 1BMFA 2F43B 2OFOA 2EFCB 2QMEA 4P33A 1ZNZA 5F98A 1Z2AA 3L8YA 1KSHA 3RRNA 1Z08A 1T8UA 2V7QA 1QHHB 3QPWA 4US1R 4FWIB 4D81A 1G18A 3LO5A 1UAAA 1L4YA 1F2TA 3L0OA 2ZJOA 3QE0A 1DBSA 1GVNB 2ZREA 2D2FA 4TLDA 4JT2A 4TL8A 1E96A 2HDNB 4LGMA 3BB3A 1XNJA 3QVVA 1ODFA 4NYJR 3THXB 1Z3IX 3EC2A 4DLWA 2WJYA 2G1KA 1EFUA 2DHRA 1OHHA 2B92A 1TAGA 2F1JA 3HWSA 1ZUNB 3FE2A 4QM6A 2F43A 3L0PA 5D3MB 1NLYA 3Q8XB 4C0AC 1JBKA 1XTQA 1KJYA 2O8FB 1FZQA 4B3GA 1ONBA 5GJCA 4E09A 1QHHA 2GRJA 4D82A 4ZPXA 4Z1MA 4BEJA 1TQDA 5F3WB 1CEEA 2RGEA 4TL7A 3D8BA 4FCTA 3A1UA 4LBVA 3CIOA 3CRVA 4DDUA 3AGPA 1A7JA 3DDCA 4GP6A 3VHXA 1F60A 5CIQA 4NP6A 1Q22A 3H0KA 1CLUA 2IK8A 1VIAA 1YRAA 4R2IA 5DLQC 3ZJYA 1Q20A 1ZM9A 1XD8A 3ZS8A 3FMPB 1GOTA 3RDPA 1G4AE 3U5ZB 4JLDA 3DOFA 5D3MA 4RCZA 1NVVQ 1HA3A 5CYPA 2O8FA 1PJRA 4Q03A 1KJWA 2QE7D 1AK2A 4K8OA 4KBFA 4JJKA 3AUXA 1NMZA 2CK3D 3CRMA 4QHSA 2QGZA 4UXHA 2XZLA 4JL5A 3HPQA 1KI6A 4ZDJA 1XJQA 4CEJB 1KNQA 2RGGA 4B3XA 2PJRA 2F55A 4KSCA 4DDVA 1HT1E 2CL7X 2K5UA 2W0MA 1U99A 1K6MA 4XVQA 2JLZA 3THYB 3GLHB 1JECA 3LVRE 3VU9B 3K0SA 1E6CA 1Q44A 4IVRA 2ZRAA 4PHHA 3KZ1E 2DFNA 1YQTA 3BC1A 1YZGA 3C41J 2YOFA 3RRMA 4RSGA 1N5JA 4JVMA 4DXAA 1DO0A 4ILEA 1R4AA 3LNCA 4TSFD 1KAGA 2PLRA 4U00A 4P3YA 2IWHA 1CJUC 2RGNA 4B3CA 2C77A 3QEOA 1E1RD 4TZ0A 4UNQA 1VIYA 4RVCA 1N6HA 4M9QA 4ABYA 5KNBA 4CEJA 2ZANA 4ITRC 1COWD 2CLDX 3THYA 1OFUX 3GLHA 4DT1B 4M1WA 4LDJA 3VU9A 1WDTA 3HYTA 4O0MA 4R98A 5J4HA 4MRVA 3GLFA 4K81B 2NO7A 4FINA 5HCIA 2ZR9A 4M1KA 1KK2A 3K0CC 3SDZA 1AJEA 5FOWA 2IYUA 3MG9A 4M21A 3H86A 4M22A 1CS4C 2GJ8A 2HCBA 2I1QA 4Y0AA 4DCSA 4ZDIA 4AKIA 3P4XA 4LPKA 4DUGD 1GNPA 3OIVA 1AGRA 2AWOA 3KQKA 1H8EA 4GMDA 2ZS9A 3IUYA 1KZ7B 1DELA 5J47A 1TEVA 3CR8A 4DT1A 2GXQA 5LB4A 1G4UR 4M1OA 1G5PA 4KVAA 2R6AA 2IWRA 4B3DA 4DIEA 5IK2D 4A1FA 1FQKA 1BO6A 3JZMA 4DB4A 2CL6X 3IBYA 4BE7B 2P6RA 1AZTA 2Q3HA 3WBKA 1S96A 1T5LA 2Q6TA 4DWJA 3I5XA 4TN1A 2O0KA 2WJGA 3VKHA 1OYWA 4AK9A 1Z63A 3JZAA 4X8MA 2O8BB 4Q9LA 4CZ2A 1CR4A 3RRYA 1FL9A 3DMNA 3N2IA 3QIAA 5KO2A 4G1UC 2ZR0A 2NO6A 1FX0B 1JJVA 1PV4A 1LV7A 3HR7A 2J46A 4ZDWA 4DC9A 2NZJA 2XXAB 3G0HA 1D9XA 4JSYA 4RZXA 1N5KA 3NHAA 1K5DA 5A0FA 2XB4A 1NN3A 1UEIA 2FSHA 5KDDA 3GLIB 5AUPB 5G40A 4YDSA 1FMJA 5KPDA 3CM0A 3P27A 1IJEA 2H5EA 2O8BA 3CKLA 5C4MA 3KB2A 3SYKA 5TY0A 2P65A 2DR3A 1LF5A 1KK0A 1CU1A 4DLYA 1FX0A 2H92A 2QORA 4LHYA 5JCZA 1XB2A 1YKSA 3CZPA 3SOPA 1E69A 1X1RA 3K0EA 2XXAA 1RYFA 1JAIA 1E98A 5EXXA 2ZRCA 4CEHA 4IXMA 4AYXA 1QHNA 2ZROA 2GCOB 2UVQA 3I4LA 3KDSE 1F6BA 2PEZA 1OSNA 2ZITA 3D3QA 4PQRA 5CB6A 2ZRBA 3GLIA 2WVJA 1IY2A 2ZYUX 1DAEA 1NY5A 2QRZA 1K5GA 2GESA 5JWOA 1MRNA 2XNDA 4O25A 2VHJA 1I4TD 1KK1A 4XVRA 3A58B 4NBSA 3ZVMA 3QKSA 2JA1A 4JZKA 1G7RA 2Z43A 2ONKA 2Q0HA 4LV8B 4NONA 1EWRA 3W9YA 1XZPA 1U2RA 3UMRA 3ZIAA 5GJBA 2JGNA 5CDFE 4RD0A 1CTQA 3B13B 1VG8A 1HE8B 2EW1A 2IYSA 3AP2A 1E79A 1AA9A 3OEHD 5AWFC 5KSOA 2F6RA 5J4VA 1XEWX 5F2EA 1WMSA 2R9VA 2SHKA 3L0IB 1E4VA 2KI5A 2R8RA 4D6PA 3X1XA 4KFRA 4HB3A 4M1SA 2UZ3A 1N5IA 4DKXA 1SGWA 3DZDA 3HDTA 1CKEA 1GDDA 3TW4A 1L4UA 4BEBA 4E03A 4OYHA 4LBYA 4QJ5A 4ESVA 4A36A 3AF3A 2FSIA 4BLQA 1H8HD 1KYIA 1OKKA 1T3LA 2ZAOA 4U5XA 4NYMR 2J0SA 2IA5A 2KSQA 4D0LB 1QDEA 2V1XA 5H1YA 2OM2A 4V0ME 421PA 5LD2B 5L8VA 2XX3A 2F9MA 3O8BA 4A8JC 2V9PA 3PUWA 5E3HA 1DAFA 2IYLD 1FUUA 4HZUA 4M53A 1JR3A 5KOYA 2R6FA 3T1OA 4DSOA 4BZQA 5E7MA 2GETA 4MRSA 3MJHA 2V6JA 2NTYC 4MITA 1G17A 3SZRA 4Q47A 2ANCA 4JKIA 2R6GA 4DLSA 1GRNA 3D6TB 4IOMA 4TLCA 3DKPA 1T9HA 1E0SA 1NF3A 2NQ2C 2YJTD 4OBEA 1VCOA 2BJWA 2NZ8A 3T1QA 3ADDA 2FFAA 1LF0A 3PFIA 3UMSA 4E5UA 3EA5A 4MDEA 1S3SA 3ZQ6A 3B82A 4TTPA 2WSSD 1RE0A 4ZKEA 1V43A 5IRCD 1DOAA 1UEJA 3QY0A 1F2UA 1S4QA 1HE1C 1EXMA 3EPJA 1NG9A 2REBA 3IO5A 1VHLA 4LYAA 3CF6R 1ZC3A 5JS7A 1E1QD 3UIEA 4Q1DA 3TSOA 5FFMA 1XEWY 2ZS8A 1BMFD 4TYPA 4KVGA 4MYCA 2IXEA 5E7IA 3DPUA 5K8TA 2ZJ5A 3JVVA 1D2NA 4A2PA 3BRWD 2ZJBA 1ZW6A 4IRUB 1XU4A 4KITB 2QL6A 3CF2A 1UKVY 1GRRA 3NH9A 3CNNA 2WKQA 4ARZB 2ZU0C 3LV8A 3NDPA 2FEMA 4GOJA 1OH7A 3SE0A 4UNPA 1E9FA 4G01B 3QPUA 1YU9A 4BFZA 4I81A 5FR1A 5LPNA 1VMAA 3LW7A 4Q7JB 5GVSA 2CEAA 4IOJA 3QUSA 4HLCA 1GAJA 2ZE7A 4KLZA 1OHHD 1Z5ZA 2RHMA 3L2OB 3PCRB 3BFVA 3LH5A 3ASZA 5FOUA 1IJFA 1GFIA 1G5RA 2FGKA 1GL7A 2G0TA 2FSGA 5KPJA 3VNUA 3EG5A 4Z1MD 5FPSA 2VHQA 4RD6A 3ZD7A 4QHYA 2BCJQ 1BKDR 4ARZA 5A5GA 4BLTA 1SXJB 2ZIAA 1VTKA 3V00A 4LPSA 2QAGC 1J2JA 4LI0A 3ZDQA 2RAPA 3AQ4A 1QZXA 2C96A 5HTKA 3DMDA 1XTKA 3RS4A 2WWHA 5KYKA 4YMVA 3TR0A 2NIPA 3BH0A 4GRAA 5EE0A 1Z0DA 1U0HC 2V8OA 4KAXA 1OXSC 2PJZA 2VSXA 3NBZC 3VR1A 1RW4A 3TR5A 1WXQA 4OHXA 1W36B 1IN5A 1U90A 2BM1A 2OBMA 3UANA 4MDFA 2WV9A 1SXJA 2G1JA 1CULC 3T15A 3W90A 1M1YE 4Q4JB 1I2DA 1EX6A 4YDHB 4P4UA 1HT2E 3R8FA 2KWIA 4LJYA 4RZ3A 4TSFA 3FKSA 1Z0JA 1G7TA 1J7KA 3AV0B 3ZVLA 1O3YA 1YR6A 2VP6A 2ZRHA 1FTSA 1IXSB 2AHOA 2PT5A 4JBXA 4B44A 3LWNA 2W58A 2R6CA 3IBGA 1KJZA 3U7HB 1DADA 1XCGB 3FVQA 4IDQA 1UKZA 3KTAA 3WHKA 2J1LA 2OBLA 3RS7A 4B71A 1YE8A 4B3FX 1VG9B 1W7AA 1COWA 1PZNA 2QBYB 3TRFA 5FUXA 4AD8A 1B23P 2ZSDA 3NWJA 1NY6A 2XJ9A 4Q4JA 1G9XA 2WAXA 2RGAA 1DVRA 1HUQA 4FMBB 2GAOA 3IQXA 2A30A 3AKYA 2P5TB 4MRRA 5JBQA 2QRNA 1CIPA 1TU4A 4JLVA 3LX5A 4F4JA 1RRPA 4EPWA 2R65A 4DUGA 1ZYUA 4NL4H 3ICEA 4CRWB 3QG5A 4ZV4A 5JI2E 3EZ7A 1FUKA 5F9HA 1A2KC 4W5JA 4Z8XA 4DLVA 4DCTA 3IEUA 2J7KA 4WZ6A 5FBLB 2VF7A 1UBCA 2XSZD 3GLHE 3TAUA 2R44A 2GJSA 3D7MA 5AUQA 3BOSA 1NMYA 5BN5A 3GFOA 4A0GA 1CJVC 4EJSB 3K09C 3NBXX 1M7HA 4YONB 3TK1A 1SQ5A 2G77B 4BQSA 1UBEA 1H8ED 2IUTA 1OPXA 1P9RA 1GNQA 3NBYC 2MSEB 4IKEA 1E9AA 2WMOB 4DZZA 2O8EB 4FW9A 1KGDA 1TQ6A 1X8KA 3FMOB 1TL7C 1AM4D 4A6PA 5FOVA 1ZNXA 2YV5A 1XBTA 4PC1A 1Y63A 3LBHA 4GNKA 2Q3FA 2ZYTX 4O2RA 2EWVA 3SEAA 4LWZA 3TQCA 1CJTC 2CDNA 1ETUA 4MYHA 2GEVA 1T4GA 3RSLA 4Q4AB 1LTQA 2Q9BA 3GQBA 1N6PA 1KMQA 2ATVA 4KSBA 2VSOA 4NYIQ 1SHZA 1Q3HA 1D5CA 1N3BA 4ACBA 2A3RA 1YRBA 3SJZA 1IXZA 3FFBA 4Q1FA 2IEYA 2YOHA 4IJMA 2VP9A 1E9RA 2GJ9A 3B8HA 2O8EA 4TMVA 2C5LA 3I5YA 2J41A 3M1IA 4FMCF 1YJ5A 5GJVC 5KNDA 3OIYA 4TZ6A 1NSTA 2CMKA 2H8KA 4WW0A 5JS8A 3U7FB 1XXHB 4AC9A 1QHSA 4B75A 3EPKA 1ZP6A 3SR0A 4B34A 1OIWA 2O8DA 1GNRA 2QMUA 4JJZA 1Z6TA 4DLTA 3QEJA 5B58C 4HB4A 4LYFA 3CRRA 2W6JA 4KLNA 4B48A 4JYBA 3UKDA 1P2SA 2KE5A 3B5JA 3LW8A 5DYGA 3K70C 3K53A 2X2FA 1R10A 3DEFA 2VF8A 4TT3A 1VYUA 4R9UC 1S8FA 3HR8A 3E5HA 1TUIA 4I99A 5AJZA 1T5IA 2MMGA 2OG2A 2ZUBA 1N0VC 1R2QA 2XNDD 1R6BX 5TXGA 2FFBA 4PHFA 4FCVA 3QKTA 4LY6A 2FN4A 1OLOA 3C7KA 2J45A 4C2TA 3THOA 5IT5A 3T1VA 5L3SA 3TIFA 3GLIE 3LBIA 4MGKR 2L0XA 3SC3A 3T12A 4TQAA 4WOPA 2LCFA 5EUQB 2F1IA 4LUCA 1P73A 2FZ4A 2WWGA 2A7QA 2EFEB 5J4YA 2EYUA 4P0TA 2Q21A 3Q7PA 1HH4A 1P60A 1Z0IA 1RYHA 2IYXA 1XTIA 1NBMA 3H84A 2QGNA 3RHFA 1XTRA 2ZRFA 3OE7A 4YXWA 2Y8EA 2IYTA 1W5SA 1VYTA 3ECCA 1OKKD 3LBNA 3TH5A 2YC4C 1NVUQ 2C9OA 4LYHA 3KKOA 3B9QA 3OEEA 2DB3A 1Z07A 2J7PA 3MGCA 4XTCS 5EJEA 4IXNA 4NCNA 2HT1A 3CNOA 5AJYA 3O8RA 1JR3D 1R0WA 4IHQA 1XEFA 1XCMA 1E2QA 4QM7A 4GMXA 3BH7A 2QENA 2D3WA 2QTHA 3N70A 4JL6A 4O2LA 2IF2A 2QM7A 4ZDKA 1ZNYA 3CX7A 2REXB 1E3MA 5KDLA 1JR3E 2WSSA 3A4NA 3WYAA 4YMUA 4WXPA 1U8YA 1KI9A 3GJ4A 3GLGA 2DFTA 4A92A 3AH8A 4L16A 1DE0A 2W2TA 3X1WA 4TYNA 3THWB 3P1JA 3TBKA 3GJ0A 1R0ZA 3I1FA 4OHWA 2ZYWX 2AL7A 1R0XA 2CCKA 4FCWA 5EP2A 2BV3A 4AKHA 4JVLA 2PH1A 4XJXA 1IN7A 1R5NA 4TYYA 1OIXA 3FHTA 5BQ5A 2ZRKA 4HI0E 2ZVPX 5LB2A 2AK2A 4JLOA 3T35A 4GL2A 1I2MA 4C0JA 2QMHA 4PO1A 5JSZA 3OF5A 3PEYA 1DAIA 3V4RA 1QG4A 1DO2A 3BB4A 4C0HA 2ZYVX 2CHVA 5AK0A 4QBHA 1KO1A 2PT7A 3F3YA 3HJNA 4KFSA 1EWQA 3T5GA 1E4YA 5EZ5A 4DDWA 1OFIA 2JCSA 2OFWA 2V55B 1HTWA 3GJ6A 2IW3A 5E4FA 1KNXA 4BFUA 1EFCA 1MV5A 2GEDA 1GG2A 821PA 1OXXK 1N6NA 1E9CA 3WNDA 2OAP1 1BH2A 4BFYA 4BECA 1E2KA 3U44B 5G3ZA 2FJUA 1IXRC 1S9HA 2J3EA 2WWIA 3AF4A 1T3SA 3U7EB 5BN4A 1K8RA 4RD1A 2DYKA 4DEYA 2ZJYA 4UJ5A 3DZ8A 2GK6A 2QG6A 3CR7A 2WWYA 1P75A 3H4MA 4G5RA 3SS8A 3THXA 1MO5A 3U4QB 5JI3E 1OXTA 3OESA 4Q1AA 3RSOA 5AUOB 5DYIA 1G41A 1YZNA 3EZ9A 1T0JB 2IS6A 1WA5A 4PHGA 1MR3F 5CIWA 4AG6A 2QTFA 5C2JB 1QHIA 1XDBA 3U60B 2XOKA 1G1MA 1OW3B 1P2TA 2WWXA 4FMCB 3EW9A 3EWAA 1ZM3A 1W2GA 1IONA 2V54A 3HYRA 4C0KA 3U44A 4QJ3A 4NE2A 4U02A 3U3OA 1KSJA 1D2EA 4QGAA 1W0KD 5KSZA 2REOA 4PAMA 4AY2A 3OZXA 1XMJA 5L3VA 2GNOA 4GI7A 1RFLA 3MSXA 3U4QA 1D2MA 3KJGA 1W48A 1G8HA 3K0FB 1IAQA 3O47A 1UM8A 1G8PA 5KSYA 2VTKA 1X86B 1F5NA 2JATA 1OXUA 2WKRA 2ZJAA 2I4IA 4G0NA 4LJ5A 5HZHA 2IS2A 2ZRMA 121PA 1SXJD 5J4LA 2RGDA 2WMNB 1G3QA 1KDRA 1T91A 2ZPTX 3B1XA 4II7A 4C0BA 4CDGA 1M8PA 5H8WA 5HR5A 3VNVA 2X19A 5CB8A 1X8JA 4D0NA 2ZR7A 2Z4RA 4B74A 1NLFA 3FKSD 4HB0A 4NH0A 3FTQA 3QXHA 4AIIA 4CW7A 3AKDA 4ZI3A 4LSGA 3SHWA 2IYWA 4A82A 3KL4A 3PXGA 2Q3MA 3SQWA 3RLFA 5CJ2A 1SXJE 4KU4A 4BFWA 3BJIC 5FOTA 1E2DA 3K0CA 4IW3B 4EPXA 4US2R 4E07A 3AGQA 2W6IA 3QI2A 3I72A 4BGDA 3K0FA 1W36D 3MWKA 3FPAA 3LXXA 1HEIA 1UBGA 1A4RA 2X1VA 4LHWA 3U3KA 1QBKC 5FPHA 2Z83A 4QGFA 4UXJA 4DIDA 3TQFA 4JLNA 1HURA 5FR2A 3U61B 5BYJA 3GJ7A 4GP7A 1UJ2A 3U6BA 3AF2A 1ZD9A 4NCJA 4TTRA 4KV9A 1HYQA 3WHLA 5FI1B 3RYTC 4B6EA 2XSZA 2X77A 1Z6XA 4TMTA 5FOXA 1N0UA 1WP9A 1DG3A 1A2BA 4BLPA 3KFXA 2WWFA 8OHMA 4F38A 2FZLA 4RZ2A 4F4CA 5AR1A 2RGNC 2B7CA 2PEYA 3PJRA 1ZIOA 3EIQA 4LYJA 1ZD1A 2BKUA 1N6IA 3GMTA 4Z54A 3GPLA 1GKYA 2P6UA 3EA0A 2ZSAA 1E32A 5G41A 1PLLA 1XP8A 2NO0A 3VR5A 2PMDA 4QXAA 2IUUA 5DO9A 5JWHA 721PA 4RD2A 3F8TA 3RC8A 2HT6A 3N2EA 2AR7A 2G88A 1C4OA 4PPQA 3C5HA 4N0DA 2J9RA 4B2PA 2JDIA 4ZKDA 3L0SA 1AKEA 1DAGA 2ZI3A 3PUYA 3I32A 1U81A 1NP6A 2QZ4A 3F5FA 1KI4A 1WB9A 1VDZA 1T6NA 4DJTA 4MUAA 1LS1A 3TSWA 1QVRA 4L9SA 1NJGA 4Q02A 5K8IA 2PZFA 2QQEA 1OB2A 1E2MA 4D0GA 2XTMA 1RIFA 5CLLA 5D3QA 3DO6A 3P32A 3AVWA 3SQXA 5JJKA 4C3ZA 2GXSA 1GIAA 2FPLA 2IYQA 3KQLA 4GOXA 3AP1A 2XEXA 5FL3A 2WZQA 3RS3A 3PENA 3IPYA 5FPYA 5FH9A 2JLVA 3A36A 3KQHA 1OV4A 3C15C 4J0QA 1IOZA 3A6PC 1E0AA 1PLJA 3MLEA 4X8HA 3NXSA 3ZD6A 2YNMA 4JLJA 4KCGA 3FB4A 3I3SR 3DM5A 3BH6A 3QVUA 4U7DA 1G6OA 4PSAA 1ESNA 4A8JB 1P62B 2I3BA 3I8SA 2LKCA 4OHVA 3WXMA 4F92B 3I61A 1NNEA 4NYJQ 2JJ1A 2G83A 1RJ9B 2KBEA 1JPJA 2VYFA 4G5GA 4IEIA 4JMPA 4QBGB 4F91B 2YWGA 4GZMA 3VKGA 4MA4A 2W6JD 4WXRA 1KSGA 4LZZA 1VCIA 4GT1A 3A1WA 4BFSA 3AUYA 3FYHA 1ZD8A 3AEZA 4IDOA 4B2IA 3UWOA 4TT3D 4WZAE 4B6FA 1J90A 4Q9IA 1OB5A 1TADA 3TMKA 5J5CA 3U3MA 3LQRA 2P2LA 2BDTA 3WRXC 3QKRB 2OZEA 3SNHA 3DM9B 3EZ2A 3IIJA 2VP0A 3GJXC 3IGFA 2GCOA 2DWPA 3BGWA 3VAAA 1HV8A 1XMVA 3ADKA 3VR3A 1V5WA 3CB4A 4A8JA 4LJAA 1D9ZA 5ELXA 1RJ9A 4HLQB 3IHLA 2QTVB 1GKUB 3TVDA 1JAHA 4P4SB 1SKYE 4RJLA 5DHFA 1XXHE 4XWAA 3BERA 2CCJA 2JIZA 3GJ8A 3TLXA 2DBYA 3AM1A 1WRBA 3CPEA 3MUFA 5EE1A 4E22A 3QXSA 1ZINA 5FI0B 1KI1A 1NBMD 2OBNA 3B6EA 2GBLC 3BFKA 3BFXA 4M1MA 4XWKA 4KBGA 3SN6A 3OE7D 4IVPA 4BLRA 4MGZR 4YXWD 1S2MA 4HYYA 2JLXA 3KJEA 4EFLA 2OAQ1 3TE6A 4D25A 2E1RA 1TF7A 1E99A 4X8OA 4UNNA 4PPFA 3M4YA 5CM8B 2DWQA 1KO4A 4HLDA 3OEED 3RVBA 2XZOA 2J7PD 2J0QA 1NBME 1NVWQ 3W34A 4PPNA 2A5YB 5K8LA 2XB2A 1J70A 3TUIC 1ZRHA 2BOVA 3FDIA 2AXNA 2XNSA 3A1TA 4BRWA 3W8RA 4YQFA 2AFIE 2WPDA 3Q5EA 4L9WA 4IFBA 1P2UA 1YZKA 5DE3A 1W44A 2IHBA 2ZI7A 2QT1A 4JT4A 2CNWA 2QNRA 4N1AA 4IVQA 4A6XA 2P0EA 2BKEA 4ASUA 2D4HA 4CF7A 1IN8A 4C4PA 1KY2A 2RGCA 5C1BA 2VQSA 4BZPA 2O0HA 2QAGB 4D26A 2IXFA 1RZ3A 3RS5A 4Y0VA 4PAOA 3MWLA 2GZAA 1EK0A 5JCPA 2D06A 4A0HA 4HB2A 1QF9A 2EFHB 3KUDA 3GLGE 1VYVA 3W3AA 1NIJA 1Z29A 3M6AA 4OI4A 3VHLB 1BIFA 3TGPA 2FEOA 4WAUA 3BWDD 5J4KA 1KY3A 2JLRA 4CIDA 2ZRDA 4IFEA 1Q1QA 1SVIA 2GXUA 5FTJA 1M74A 2BWJA 3PITA 2CLCX 2BMFA 2ZUCA 2QAGA 2CXXA 3PR1A 3OIUA 5KUTA 4LV5B 1G7SA 5FL7A 3HPRA 1M2OB 1ZM7A 3UWKA 1LNZA 1G19A 5B30A 1ZM2A 2F3TA 2C95A 2WIBA 4Q19A 3REGA 4EQ6B 3KJIA 4A0RA 4HAWA 4HLUA 4B76A 1JPNA 4KYIB 1GRQA 2IUSA 1KOFA 2ZE6A 4YMSA 2B8WA 3E1SA 5KSPA 1E2GA 1Q0UA 2C9YA 2IT1A 4P31A 1AS2A 4C30A 2QP3A 3CH4B 5FBWB 4B35A 1A82A 1BYIA 3EWSA 2HLDA 1FW6A 2GEUA 2YWHA 2ZAMA 1FMLA 3IKJA 2XAUA 3BE4A 1OH6A 1W0KA 2EYQA 1II0A 1NN5A 3LRPA 4BFVA 4F93B 3ICQB 3LXRA 3IILA 2B21A 2RHDA 3DKVA 1TX4B 2E87A 2BBSA 2O52A 2FE4A 3NC1C 2V1UA 2XOKD 1W46A 2H16A 4Q1CA 3FGNA 2YOGA 4Q7LA 3J81k 3ZS9A 1Q3TA 4Q1EA 4AI6A 2OCYC 2J0UB 1CRPA 4IDHA 4TTQA 1QG2A 5BN3A 2H1LA 3QQ5A 1KMHB 2BJVA 4A2WA 3RS2A 4OI0A 2ZE8A 5P21A 1OXVA 4TWZA 3AVOA 2ZI6A 3DOEA 5EZ6B 5AJVB 3ZYCA 4NCIA 2OEPA 2WJHA 1P4SA 4RY2A 4DLUA 1XEXB 4JLPA 4PO8A 2GJAA 4KYUA 4PPGA 3TAHA 1Z06A 4GOKA 4F7WA 4JLAA 2N42A 2GZDA 1UPTA 2A2ZA 2P5SA 1CRQA 2D2EA 1ZC4A 1PVOA 4MGYR 2IF0A 4NKRA 4HDOB 4QFMA 3WP0A 3Q85A 4QKQA 3P26A 3LQQA 2J87A 3CUEF 3X2SA 2O8CB 2FGJA 2HYDA 3T06B 4W5WA 3BD9A 2JLQA 4B2LA 4PC6A 1ZU5A 4OL0A 3CX6A 2F7SA 1W4AA 1XEXA 5FBQB 3MCAA 4RCYA 4FD2A 3BBPA 5EP4A 1EFTA 2W6ID 1JXMA 1NKTA 4C7OB 5EP1A 621PA 4AYTA 5KNCA 3EIHA 4XTRA 2C98A 2DCUA 4XOIA 3KXIA 3VR2A 4A0FA 2UZIR 3NHBA 2DWOA 4WA7A 2NPFA 2FU5C 1E2HA 1R0YA 2P6NA 3W8NA 2CE7A 3UG6A 2I1VB 4N3NA 4MKFA 1G21E 2BC9A 2PX0A 1P5ZB 3CH5A 2OE2A 3C4JA 1XPUA 2XTNA 1W0JD 2B7BA 2GILA 4G5SA 2ZUDA 2QBYA 3TUJC 2O8CA 4NTZA 4QNMA 3G5UA 2PCJA 3LDAA 5E95A 4TMKA 3H2YA 4DHEA 2IBMA 3UATA 3WNCA 3RS0A 1E2JA 1P7CA 3K1JA 5GADl 4NYMQ 1JQJC 2YHSA 4RZUA 1NN1A 4C7OA 1F3OA 4BLOA 5TB5A 1Z0AA 2ONJA 2IYYA 4IOKA 5EP3A 3O8DA 3MWJA 2CE2X 1PUIA 5DI3B 3IHWA 2AWNA 2Z6VA 1QHYA 2PL3A 1OFTA 4ON9A 1VKJA 5H70A 4AYWA 2WOJA 1J99A 3QBTA 1FOEB 3K70B 2YINC 2BVNA 5B2ZA 3EX7C 1KDPA 3U3JA 1RPZA 1ZU4A 4TYQA 3VR6A 4Z8YA 1CR1A 2ZS7A 1DEKA 1U9IC 4BFTA 4EJSA 4DB2A 1G20E 4YMTA 1A5TA 4EKDA 2GWHA 2ERXA 1RRFA 2JDID 2QY9A 4AURA 4Q48A 3CPJB 4NPHA 3PVSA 2HYIC 2WSMA 1II8B 2JJ2A 4Q00A 5IHPA 4M1TA 1I4DD 4ZIRB 2XJ4A 5EXPA 1LW7A 4URXR 1NVVR 1CR0A 2FWRA 3V4FA 3NTUA 2FA9A 4XSHA 1OH5A 3MRSA 1Y3AA 2ZSBA 5SZHB 2GZHA 1GZSA 1KK3A 1E9DA 2ZSEA 5JEDA 2ORIA 4BFXA 3DL0A 1KDOA 1NLZA 1Q1ZA 1SULA 2GVZC 3GEIA 2ZTSA 1G3MA 3CONA 2EFDB 1FNMA 1ZM4A 2CCGA 3BAFA 3OAAA 3ETLA 1Z6GA 2WBLC 1P6XA 1VECA 3QOFA 2FPKA 2RGBA 4Q4AA 3EZ6A 1GWNA 3C16C 1TUEA 2C78A 2OUKA 1YHNA 4CEIB 4ZIRA 2GVDC 2YYZA 521PA 4HZIA 1G64A 4IOLA 4LCBA 4AWXA 1Q57A 3CNLA 1P9NA 3MJRA 2MSDB 1E2LA 1FP7A 2P3SA 1QHGA 3KJHA 3NG1A 1SHKA 3K0AB 2JJ1D 3WMFA 4UNRA 1IY0A 2FDCA 1GSIA 1BS1A 1XXHA 4EPRA 1U0JA 1VCMA 1XF9A 2ZRNA 4URZR 1KZGB 2VHUA 2RGXA 1M34E 2NGRA 3IQWA 5ANRB 3EPLA 2ZI9A 3EAQA 1U94A 3ZGXA 3PUZA 5LDDC 1W1WA 2A5GA 1W4CA 4CEIA 2AFHE 1Z6YA 1ESMA 2QM8A 4OQNA 2AKAB 1R5OA 1TQ2A 2V6IA 4JS0A 3KQUA 3B85A 4HDQB 4OKSA 5HE9A 1TF5A 3K0AA 2JEOA 4FXPA 4XD7A 3B9PA 5G3YA 2ZU6A 3W6NA 3RRZA 3A4MA 3VX3A 4Q7MB 1P61B 4ZI2A 5AJXA 2ZI5A 2ZJ2A 2GCPA 2VA8A 1VHTA 2DFLA 2JIZD 1T3HA 1WBBA 4GZLA 2W2VA 2AK3A 2RKOA 4KO8A 2WICA 1F48A 1MABB 1E9EA 3EPHA 1E2IA 3SFZA 4UJ3A 4DBLC 2GF0A 4DSTA 1YR7A 3QG1A 2IS4A 3MWYW 4QGGA 3NDBB 3EASA 5L3QB 3CW2A 2C03A 2RMKA 4EPYA 1J8YF 1OT3A 4YC7A 2AN9A 1W4RA 1OF1A 2CLSA 1M6NA 4MYUA 2HJVA 2R62A 2FH5B 5DHAA 5JLJA 4FMDF 1TTTA 3CLVA 3AVTA 4PXAA 2IYZA 2VP4A 2ZE5A 4PC3A 5C4GB 5TDHA 3TSZA 3W5IA 1KI7A 4V0OA 4XIGS 3WBJA 1CF4A 1MABA 2WPDD 4GSYA 4QRHA 3SHFA 4GPTA 3FWYA 3VFDA 3IEVA 3EARA 1OIVA 1YVDA 1IQPA 5KDOA 3U7GA 2JLUA 3IDQA 5JJIA 2QAJA 1P3JA 2CNWD 4HSEA 4OQMA 1W47A 1XRJA 2OXRA 3F0TA 3KKQA 4PSVA 4WIAA 5L3QA 1KO5A 4ASUD 4MYTA 1G8YA 1LB1B 2BBTA 3WNBA 1X6VA 4RKFA 2WAYA 5FBVB 1W49A 2ZETA 2ZRGA 4F4IA 4EUNA 1P2VA 4JYCA 1UKYA 2PX3A 2OLJA 4WZBE 4TLBA 4NMMA 5SZKB 2VHTA 3LFUA 3THWA 2WHXA 4DVGA 3R20A 1TPZA 2WOOA 3UMFA 1DARA 5EQTA 2LKDA 4DSNA 5HPYB 5BWMA 2QSZA 4TL9A 5KU1A 1Z22A 4Q9KA 3AF0A 4LJ6A 1N6OA 3U3RA 2HEIA 2AD5A 2VLIA 3WP1B 4CT4B 2FX3A 1LFDB 1N6KA 3AF1A 1JR6A 1KIMA 4LJ8A 4HUQB 4XVUA 1SVMA 2BEJA 4Q4HB 1YR9A 3L82B 4Q18A 2QP9X 2HCJB 5FL7D 1EFHA 4QGHA 4OK6A 1YZTA 2OILA 1NMXA 1UKEA 2BBOA 4A9AA 4H1VA 3ZZ0A 1IN6A 4M9SA 4LV6A 4Q9JA 1IM2A 1DAKA 3PEWA 1JXOA 2EVWX 3GCGA 1E9SA 5CM9C 5TMPA 3B60A 1KTVA 2MMCA 2OSBA 3QBVA 4LHVA 2WJJA 1PUJA 2NOAA 3U2QA 4JKYA 3A4LA 3B1WA 1DAHA 4QOSA 4ESHA 2RCNA 5L3RA 4M9XA 2HLDD 3B2EA 4A2QA 2ATXA 1AZSC 3X1DA 2QSYA 5IDVA 4KODA 3NKVA 2QI9C 2H17A 5IF9A 1KI6B 1Q1EA 4HUQA 5DN6A 4NCHA 1P9WA 2FMXA 3JVUA 1XD9A 4Q4HA 1L7VC 2Q9AA 1NSFA 4G5OA 4PTLA 4OK3A 4Q1BA 1XFAA 3T34A 3RABA 3MD0A 5JFGA 4EDHA 1M7BA 1RKBA 3T1TA 1S9DA 4QNRA 1XCPA 1NN0A 3GEHA 4DLZA 2CHQA 4HUTA 5K8UA 3HU2A 1B0UA 3HU1A 3LD9A 3QJYA 2ZEJA 2F1RA 4PR0A 4QC2A 2W83A 2OXCA 5DH9A 5SZJA 1DTSA 2HF9A 1Q1BA 3DHWC 1AS0A 2ASEA 1E2NA 3ASYA 3VTKA 2AKYA 3ND9A 1EFRA 4TQ9A 1DS6A 1PLKA 2WJIA 4PAQA 2F1HA 2EWWA 2QP4A 5DI9A 5CK4A 1ZCBA 1E94E 2OCPA 3FFAA 4MH0R 5CLQA 1XZQA 2BIFA 2DY1A 4M0LA 4PZLA 5TVKA 1AQYA 3D31A 3GLFB 4QBIA 1AIPA 4PQFA 1KSFX 4K46A 2ZRJA 2QU8A 3AB3A 3NBFA 3B7GA 3MFYA 4OI2A 1U8ZA 1W0JA 4B32A 4B73A 2CHGA 1WCV1 1UBFA 2ZJ8A 4HAZA 3WRYC 1G7CA 3CRQA 3A1VA 2GXAA 4IEEA 4MRPA 3LLUA 3Q9LA 3R8CA 4D2IA 1UF9A 1SVOA 4LBWA 2QQ0A 3Q3JB 1X1SA 2VRWA 5AUNB 2C04A 4D4LA 5FPKA 2IYVA 2G0NA 1FNNA 4QBFA 2IX3A 1JB1A 1KAOA 1VG1A 1KKMA 3CF0A 4I1OA 2VSFA 1E0KA 3GJ5A 1S3GA 2RH5A 4WVFA 3PUVA 1T0HB 2QPOA 5BXQC 2VP2A 4TLAA 2CVFA 1MT0A 3PQCA 3SFVA 4W9MC 4C2UA 3RANA 3SYNA 3O8CA 2EQBA 5DIFA 4URVR 3RWMB 6Q21A 5HKKA 3B1VA 4FMDB 1JEEA 3NEYA 4EAQA 2BMJA 3QXCA 2H18A 3CRW1 4X8LA 4TL6A 2VL7A 3NC0C 4Q66C 2IYRA 4MRNA 2PCLA 5FUYA 3W5JA 1EX7A 2R6DA 1N25A 1XMSA 1YZUA 2OLKA 3T61A 2NMVA 1KHTA 2ZM5A 4MKGA 2NG1A 3GJ3A 1UADA 5KTYA 1R7RA 4OJKA 1FTNA 2GK7A 2OHFA 2G9NA 1GILA 2N46A 1Z47A 1GP2A 4L8GA 1R8QA 4PHTA 1G8GA 2OO7A 4PX9A 4Q9HA 5KHOC 1TMKA 4DCVA 2A5DA 4W7SA 1AS3A 3P20A 1CJMA 2QN6A 4B47A 4DRZA 2VEDA 2JJ2D 2KJQA 4JLKA 3B1YA 3Q7QA 4Q21A 3VR4A 2JAQA 4CYMA 5HCNA 5CYOA 1CP2A 4JIMA 1Z2CA 4V0NA 4CEHB 4B43A 3OFND 1AKYA 3MAAC 3RAPR 1SVLA 4EPVA 4HAXA 3K70D 1SVKA 4AG5A 5TV2A 4C0LA 4S35A 1SKQA 5DNYB 1N2CE 3RWOA 3CO5A 4JVNA 3PIRA 1D6JA 1UFQA 2XZPA 4OHZA 3QKSB 3OAAD 4IDPA 2QUZA 2MSCB 2A78A 4HATA 4AKEA 3E2IA 3ZZUA 1ZIPA 3AKCA 5JRJA 3CBQA 2A5FA 2FV8A 1QRAA 4ERNA 3SBEA 2VH5R 1SVSA 4JVSB 3FMIA 1G291 3EZFA 4JLBA 5EXTA 3HP1A 4DDTA 1DG1G 1DPFA 1TQ4A 1X8LA 4JSTA 4V0LA 4RD3A 2VIIA 2ERYA 1KDTA 1D8TA 2QPAA 3R7WB 3AKEA 1ZUIA 4KI0A 2GBLA 5FUVA 3ZLJA 3ADBA 1G8FA 1AGPA 3QXXA 4ZCMA 2O5VA 5J40A 1ZMXA 4LC1A 3X1ZA 2OCAA 3TW8B 2QPTA 3LVQE 4BPBA 3KXKA 5CJPA 3I62A 1J8MF 2IC5A 2ODEA 4HZUB 5FBRB 2RB4A 4LK2A 2QA5A 3QKRA 4HAVA 4XD7D 1TNDA 2PBRA 1R5BA 1RVDA 1SVWA 3PEVA 3B1ZA 3R9WA 1BOFA 4DLRA 1NI3A 1RRGA 3R7WA 3QF7A 3ZQJA 5BW8A 4NDZA 3FMFA 1ZBDA 1W5TA 2WM9B 2XGJA 4PANA 4PQYA 4RFVA 2KB0A 4P4SA 2KBFA 3C14C 3KXLA 2V4ZA 1IHUA 1OH8A 1MO3A 2PLFA 4BWYA 1AQUA 2BMEA 1Z0KA 1GL6A 1ELOA 1HQYE 2GF9A 1WBDA 4M1YA 3V9PA 2Z4SA 1CBUA 3X1YA 5FOSA 1E0JA 4NZYA 3EXAA 1F2UB 1NG1A 4PZYA 2YVUA 1WF3A 4PSKA 3GFPA 4LX0A 1KI8A 2IEZA 2WKPA 3L8ZA 4PZZA 5DSZA 4R71A 4EPTA 3K9LA 1JJ7A 3KFVA 3VQTA 4LJ4A 4OK5A 3TJZA 2B8TA 4H9GA 1IN4A 3W3ZB 5JECA 1C9KA 1JEDA 4L15A 4DLXA 2AD1A 3PEUA 4D4JA 1MO4A 4NHOA 2O0JA 4NYIR 4CT5A 4V03A 3AVXA 2ZQ5A 3VMFA 4OQLA 2FNAA 5FTNA 1ZVQA 2W00A 4XH9B 5B57C 1QHXA 3IIMA 3SYLA 2OT3B 2HXYA 1KKLA 4WBSA 4OQXA 3DVLA 2EU8A 2YWEA 2A9KA 4ACAA 3Q5DA 2YKGA 2AX4A 4PO9A 3WYGA 1JQLB 3B78A 2A5JA 2ZRPA 3FHOA 3T5DA 1LVGA 1WQ1R 4ZCLA 4DCUA 3KQNA 2GAAA 2OESA 5LD2C 3PG5A 4I4LA 3UK6A 1VG0B 5HE8A 2BHRA 2FFHA 5DISB 1CJKC 1I4LD 2V7QD 5FPTA 4DEXA 1YZLA 1Q21A 2X2EA 3NVAA 4L4UA 1EESA 2IHYA 2ZSFA 4PC7A 4QHTA 5JRZA 5SZIA 2VP5A 4TMXA 4RKEA 5EUMA 1TEXA 1XPRA 1N0WA 2FF7A 1N6LA 2F9LA 2YC2C 2CJWB 3UXMA 4URWR 1KI3A 5C46F 2ORWA 2GHIA 4M8NE 4QJ4A 3E70C 2QEQA 3ONWA 4FIDA 4URUR 3BS4A 1G3UA 5FTMA 4I1SA 4DSUA 4A15A 3TNFA 4S2EA 4V02A 4XWOA 1E2EA 2EFGA 2ODNA 4TLEA 1MKYA 3W6OA 4OHYA 2J0VA 5EE9A 4EIWA 3BIFA 2R2AA 3LAWA 2CBZA 2ZRLA 2FOLA 3KKMA 3QENA 4EQ6A 3BORA 4BLSA 1NRJB 3AVQA 2G6BA 1NKSA 4LC0A 4I1UA 1Z83A 3VX4A 2QE7A 4LRWA 1GTVA 4R2HA 2CJWA 2BMDA 5DN6D 2VHCA 2W0SA 4MUBA 1G3IA 1XTJA 2QROA 3QPVA 4G3XA 2ZJZA 2CK3A 4P32A 1A1VA 3GEEA 3FHCB 4HLUC 4BRUA 2QMOA 2PZGA 2ZXUA 1EG7A 4LHZA 1G5TA 1GITA 1Z0FA 3C8UA 4JL8A 5BYKA 5FTLA 3KTAB 4AKGA 1GM5A 2J59A 5LBIA 3VKWA 3FKQA 1E2FA 1MO6A 1ZJ6A 2P67A 5DGXA 2J0UA 3UPUA 4NCKA 5JHGB 4MKHA 3PUXA 1Z8FA 3GFTA 3AVPA 4TMZA 2NO1A 1KMHA 3L43A 1N5LA 2VPPA 2ODWA 2GCNA 2F3RA 1EFRD 2V3CC 1JI0A 3K9HA 3AVUA 3Q72A 1N6RA 4KFUA 4KXFB 1XJ0A 1E1RA 2D7CA 4LJ9A 2N1BA 4LHXA 1SXJC 1QVAA 3K09A 1FFHA 221PA 4TYWA 3S1AB 4H1UA 2PZEA 2ZVQX 2GTPA 2H57A 2UKDA 2JJ8A 4EFNA 1G3RA 1RRCA 3MMPA 4M9ZA 2E9SA 5GJWC 1L2TA 1NL3A 3IO3A 4UXIA 1U0LA 2W2XA 4KFTA 3TVTA 4HEJA 1O87A 2AXPA 2ECKA 1P72A 3WMGA 1W36C 1US8B 4TMWA 1IY1A 5UKDA 2IL1A 1UDXA 2ORVA 2WJVA 4ZCIA 3QF4B 1U9IA 2H7VA 2ODBA 4LOAA 3K9GA 2D62A 2OV2A 2WIAA 4Q4LA 5TARA 1ZAKA 1TU3A 4M2LA 3S1AA 1FPMA 4LJ7A 1GUAA 1XJCA 2XTZA 3A37A 3N5CA 5HKKD 2ZI4A 5IK2A 1T8TA 3WY9A 1Z28A 3CX8A 3NIBA 4M4SA 3AVVA 2CL0X 2FG5A 3IIKA 4C0SA 2PMKA 5CK5A 3GLFE 3TUZC 3KX2A 4JBYA 4ZO4A 1U8AA 1US8A 3NEJA 4PFSA 5AJWA 4D4KA 5FUWA 2OFXA 3LA6A 4DCNA 2C2HA 4IDNA 4CGZA 4C9BA 3QKUA 3QF4A 1E2PA 1OFHA 5B64A 2D74A 1W2HA 1XX6A 2FPMA 3HU3A 3KKNA 3CWQA 5DI3A 5G53C 3SBDA 5F9FA 3SJAA 4KHZA 4Z51A 3K8YA 1TF2A 2HF8A 3OFNA 1OE0A 2QT0A 4KJZA 3CZQA 3SI7A 2C9CA 2FFQA 3TKLA 3SJBA 4D80A 1XPOA 4BZXA 4EFMA 2O8DB 3KB1A 3CPHA 4XSGA 1L8QA 1XD2B 2DPXA 5C18A 5EE3A 3RC3A 5EXSA 4B33A 3QNUA 4GFDA 2HXSA 4NU0A 4R7ZA 2GDJA 1UDWA 5GVRA 3R9IA 4Q7KA 3LY5A 4RFSB 3U6KA 2GJKA 1II8A 2YZ2A 2JLYA 3EIEA 4URYR 2JLSA 3ND8A 1C1YA 2D7DA 1YR8A 5H68A 4EJSC 2CVHA 2TMKA 5JMTA 3BB1A 4TQUS 1ZCAA 1SKYB 2ZRIA 5JHHB 1AN0A 3WMEA 4BASA 1M7GA 2IS1A 5CDFA 4B3BA 1XD2A 2C99A 5L3SB 4OQFA 3ZH9B 3KKPA 3BXZA 4LBZA 3ZVRA 1U98A 3LX8A 4US0R 3REFA 3NH6A 4GDFA 3SJCA 2J5XA 4UQOA 1H65A 1LY1A 3OHMA 4GBMA 3QSYA 4RFSA 5JZVA 4MGIR 2VBCA 4V0KA 5FTKA 4D4MA 5JEEA 2B6HA 3A1SA 2BBWA 5HZKA 1VCNA 1ZUHA 4A4DA 5EE5B 1MRSA 2LWIA 3OEHA 1KI2A 3I8XA 4UNSA 1G6HA 2BM0A 4HAUA 3SU8A 3W6PA 1KO8A 1E9BA 3C5CA 2FSFA 4MQBA 1RC8A 2YWFA 3QXJA 2OCBA 1BYUA 2WTUA 2JASA 3BK7A 4POAA 2XITA 4RD4A 3AVYA 2WWWA 4V0MA 4OJQA 3ZIAD 5CITA 3FOZA 1GKIA 2BCGY 3PV0A 3ZVNA 3RNLA 5M04A 1E79D 1H8HA 1X3SA 3KUCA 1YZQA 4QL3A 4G5QA 1NVXQ 3I73A 5A4JA 4FWTA 1XTSA 4JLMA 4W5HA 3R9XA 4YMWA 1KO7A 1NIPA 3AP3A 1FP6A 4HDCA 3ADCA 3UG7A 5JWRA 4JBWA 4YLGA 3ZZTA 2IXGA 1JNYA 3IPXA 1G16A 1S0UA 1FQJA 3OIWA 1CR2A 3GP8A 2G3YA 1DAMA 2ANBA 1S1MA 4UKDA 1XWIA 3WYFA 1SZPA 2Q9CA 2JLWA 1XMIA 4HAYA 5E7JA 3GLGB 3LLMA 1S1CA 2NPIA 1LS6A
chains in the Genus database with same CATH superfamily
3GFBA 4L5IA 1KFJB 1PD0A 2POQX 3KTFA 4IIFA 6PFKA 2IGBA 1SUBA 3LPMA 1V3VA 3GD7A 1A1SA 3CWZA 5K6RA 1G8SA 4P4TA 4C0QC 3HJHA 4G56A 3NJRA 2HGSA 4JJGA 1N5DA 4I19A 1X1DA 3P2IA 5I9MA 4J0JA 1GPBA 1KORA 2WHYA 3NBUA 1V5IA 1ANKA 4UM7A 1OYYA 4RF3A 4O3MA 3R7AA 2P91A 2CXUA 3ZI7A 5JSZB 4W8OA 3VR6H 3G82C 4KXWA 1SBIA 2NO9A 3L4JA 2FETA 1CXZA 2WILA 5IBCA 1UM9B 4WLUA 5I4BA 3W5SA 2DFKB 3CVJA 3VH1A 4FI3C 3VPDA 1R8SA 2GA8A 2G5GX 3JXEA 5EJ4A 4IH1A 3WC4A 2QLTA 4O08A 4Q5IA 2YHBA 3CVOA 4QEDA 2O7SA 1I24A 5IUKC 2XRFA 4KXMA 5I8PA 1E1QA 2BFFB 2BEKA 1J9ZA 2AG6A 3L1IA 4J43A 2F43B 4KMOA 2EFCB 4YX9A 2JFVA 1DKOA 3AFGA 1ZNZA 2FQYA 1R9MA 1N3YA 1ZMOA 4CLRA 1QU2A 1NI4B 4BO3A 1I1NA 1W8IA 1QKIA 4UDXX 2AFRA 2AOTB 4UMVA 5SYAA 2H2HA 5B2FA 4LHSA 5CHYA 4ZFNA 1IMJA 3MLBA 1UAAA 1L4YA 4L57A 1MA0A 1F2TA 1NDQA 2ZJOA 1I9CA 1M9NA 2D2FA 2NO5A 2BF7A 3ZWVA 1FQOA 4LGMA 2C5AA 1DXYA 1KRXA 1ODFA 4NYJR 4NE7A 3THXB 3S28A 4MQ5A 3EC2A 4DLWA 3R0XA 5ALZA 4QU0A 1XTTA 2WJYA 1DU4A 1EFUA 4HGQA 2F1JA 1S89A 2C82A 4PY2A 4QODA 4XUDA 3IUMA 4AWAA 4QM6A 2GK4A 2QD4A 3TOCA 1U2DC 3CKKA 2D0IA 3KE9A 4KRGA 5D3MB 2DR0A 4HBZA 1KJYA 2O2HA 2O8FB 3Q7RA 4E09A 1QHHA 5F3WB 3A11A 2RGEA 3D8BA 4FCTA 5ENVA 2CB9A 3CRVA 3GOQA 2P2NA 4PFJA 1EP3B 5TS3A 4CKWA 3Q3EA 4XVHA 2PSHA 1BMTA 4A8PA 2Q2QA 3AGPA 2PZ8A 3JARA 1A7JA 3ETGA 3MMSA 1SZDA 3ANSA 3G5MA 3WLSA 1Z3CA 1N2OA 4LF4B 3H0KA 4P80A 4JQCA 3WJ2A 2AQKA 1TM1E 1GGNA 1PR1A 1SXHA 3CE6A 3GZNA 3H5RA 4R2IA 4CUZA 1XD8A 3I42A 1X9GA 2R84A 1ULAA 4YHBA 1M1YA 3IBTA 1GOTA 4OQEA 3RDPA 4D79A 1HDXA 5DZSA 3OTGA 1TM7E 5EPEA 4RNCA 3UC9A 1HA3A 3M9WA 1OAOA 1KC3A 3DSRA 1PJLA 2PU5A 4BDTA 2I2WA 4RJ2A 4KBFA 1BG6A 4CL3A 1VL2A 1F0YA 3AUXA 3TI7A 3R5SA 4OU5A 4ZOLB 3M6UA 1S2DA 2QQGA 4WUVA 1HFJA 3UH1A 4PGHA 5K6AA 3HPQA 4Z4EA 3VPGA 2RGGA 1INLA 5B3JC 4EG4A 2NTEA 3TDNA 2FZEA 1I2AA 2QL7A 4AZWA 2B1GA 1ZISA 2UZ1B 1U0GA 2W0MA 5J1TB 2JLZA 1UC8A 1FE8A 3HEAA 4MAAA 1T9KA 2PG3A 2DFNA 4YT5A 3RT7A 4ENSA 3JSXA 2ZTVA 4NNJA 1GEEA 2FWNA 3C41J 1SPXA 4E5NA 1J23A 1YOVB 4FE3A 4ILEA 1AK1A 2Y3IA 3VV3A 4E08A 3HJAA 4Y2GA 4LGYA 5HQ3B 1KAGA 2PLRA 3A6ZA 4OIFA 1E58A 1CJUC 4V39A 4Z4QA 4CMCA 1SOAA 3NKFA 1RAEA 3ZD9A 5AVSA 3DCYA 3QEOA 3PNLA 1PZHA 3WE7A 4BTEA 3WQHA 3Q8WA 1LDNA 5KCMA 2FZKA 4DMLA 1N6HA 1P0PA 1UAYA 3O2NA 3RIHA 4CEJA 3D8TA 2WJPA 3IEPA 3FNBA 3DE5X 2WD9A 2D1TA 2IUEA 4NARA 3UGJA 2CLDX 1RI4A 3THYA 5HZGA 2P62A 3SKVA 4M1WA 4LDJA 4MEJA 2H9IA 1SUIA 1PQUA 3P9KA 3KTOA 5H3HA 4EG1A 5JSQA 2XUIA 3LUFA 2PS9A 3GLFA 3QLEA 3E0XA 5DSTA 3KVNA 5HCIA 1UXGA 2W8BB 3K0CC 1Y9AA 4V38A 3F5MA 1IK4A 5DF1A 1XI2A 3S5JA 2WG0A 4AJ9A 1BA3A 4M21A 3ZW7A 4M22A 1KEUA 2XE7A 1FVHA 2AQ8A 2E4VA 4CM8A 1Y4ZA 1IFXA 4AKIA 4BKPA 4ZD6A 3DVRX 3Q9SA 4FR5A 3HO1A 3NPMA 3ZU2A 1VGQA 2A9JA 1AGRA 2F4VB 2HRRA 3KQKA 3EG9B 3IUYA 1BA2A 5C7YA 1EPUA 2HPVA 5J47A 3UJHA 5FRDA 1C7IA 1G4UR 4R83A 2PO5A 4M1OA 1G5PA 1OJ7A 3OIGA 2B78A 5ETJA 5J63A 1WTAA 4AJIA 4B3DA 4DIEA 2JIRA 5D00A 1FQKA 4A1FA 4CL2A 4M9RA 5IK2D 4DB4A 2CL6X 2HMTA 1IWPB 1ZONA 1XTPA 3S99A 4BE7B 4NDAA 2HMSA 4DQKA 1USUA 2X86A 3DC7A 5ALIA 1T5LA 4DWJA 3M6LA 1JFSA 1AMOA 4MVJP 1OVGA 2V45A 2WJGA 3AR7A 4YP9A 1JJBA 4FW8A 3DTTA 3IP8A 5J23A 4RS4A 5LZ4A 1JQDA 1WLSA 3A1NA 1O6GA 4KIUA 5CX4A 1M10A 3OEYA 2ORYA 5KO2A 4RO0A 3DV9A 1D4OA 3KBOA 5CVUA 1LK5A 4XXHA 5DXFA 4OREX 1C30B 4B87A 1I0LA 2HBZA 3M2TA 1RDFA 2VUUA 3MUNA 1VLZA 1ZOSA 2VK1A 1N5KA 3ACBA 3QUQA 3CA8A 3OKPA 1T2VA 2GN6A 1U4SA 1HLGA 3AIOA 3KR0A 1SUSA 3GLIB 1Q7TA 2CLLB 3F9RA 3P5SA 4YVFA 2P9BA 4RL6A 4GX0A 1YI0A 4XCVA 2A5LA 2Q5IA 3DAHA 4BZZA 4FCCA 3CM0A 3P27A 5KPDA 3SC6A 2PXCA 2Z5GA 3ORQA 2H85A 3GGSA 4JHXA 1WIWA 2H5EA 5EZQA 4LQCA 3CKLA 1D6SA 3ZZNA 2P9JA 4EO4A 2EJWA 2OY0A 1PYGA 2P65A 4OHFA 3W5VA 3FM9A 3LQFA 2BDUA 2CXOA 1Y5MA 1XDGA 2FG6C 2H92A 5JYBA 1MPTA 1XB2A 3FRJA 1PSDA 1TAQA 3UMCA 3ZHVA 3CZPA 3DA8A 1QJCA 5FJJA 1RYFA 2ODQA 1E98A 4HUJA 2P5YA 2ZRCA 1P4JA 4IXMA 4R9NA 5EXXA 4AYXA 1CDZA 1UBLS 3DR5A 3KDSE 5C0OE 4BB6A 1F6BA 2PEZA 1JIQA 1OSNA 4AUMA 4JC0A 5CXQA 3J81A 4M1ZA 1V71A 2XIJA 2HMUA 2PDAA 1DAEA 2ZYUX 3O2JA 3EIUA 4IMJB 4FHGA 2WY2D 4F04A 3I52A 2AN1A 2O2EA 1E8MA 1DDGA 4Y2VA 4RMNA 2ZIUB 1QNFA 2G40A 2XNDA 5H59A 1O54A 3OQMA 1NVFA 2P3LA 4NBSA 4DA8A 4DNXA 1DMSA 2EKPA 2JA1A 3ZVMA 4EG0A 1G7RA 3H65A 3D0RA 1YTLA 2ONKA 3L0YA 2YNMC 1RBYA 1EWRA 4NONA 3W9YA 1LFAA 2AR0A 3GRVA 1XZPA 1QRRA 4W9RA 1TVKA 3UMRA 5L53A 5CDFE 4LF9B 4OQ4A 3UV3A 2AUNA 1RSZA 5K0FA 1P77A 2EW1A 5AWFC 4JR2A 1XEWX 3B6IA 5CMLA 3HZRA 1WMSA 2SHKA 3NCHA 5ARDA 4Y98A 1F14A 4EI9A 3DZKA 1E4VA 3COVA 2KI5A 3L0IB 3FYSA 4DFDA 5FBZA 3X1XA 4KFRA 1BVHA 5KWIA 3PSHA 1ORRA 5C1IA 1LBSA 1SGWA 1GPAA 2C1EA 2VXBA 1BEZA 3KSRA 4AZ0B 4ER3A 4E03A 2X4DA 3OH8A 4OYHA 4DHWA 4PM4A 2P1DA 2UZ4A 3G5TA 3PC6A 4A36A 3A3NA 1JDBB 3G1WA 3P2JA 1YIOA 2B69A 1G38A 3NFYA 1Y42X 1J2YA 3AI7A 1T3LA 2R1UA 4DBLE 4FE7A 4LJLA 3VH4A 4CHGA 2FSVC 3JQ9C 2J0SA 2IA5A 3LBYA 1YK0A 2W2KA 3DLCA 3CZRA 1V45E 2V1XA 5H16A 3BF8A 1RI5A 3T5AA 1GV1A 2XX3A 5B5SA 1KH3A 4X7RA 5FD8A 4A8JC 5E3HA 3VV2A 5IMSA 1MNQA 1NJSA 2IYLD 4FLMA 4RA6A 5KOYA 2GBIA 2R6FA 1LUAA 1H5NA 3C3DA 4NR0A 4YREA 1VJ0A 2WLTA 3ELUA 4MRSA 2V6JA 3WYCA 1Z2DA 5LUAA 2WG1A 5TNXA 2WTAA 2ECFA 3H7IA 1IZ7A 2O9JA 5DX0A 1C1XB 1LRKA 1N75A 1WMDA 1SBYA 2YJ4A 4GD3Q 4P34A 5FFFA 1ZGCA 3AUKA 3A2KA 3MS7A 3BWBA 3VOSA 1Q1GA 3D6TB 2XNHA 1FK8A 4DCMA 1MFZA 4INOA 1NF3A 3LMKA 1J97A 4J0GA 4JOBA 4OCZA 5KOHA 3E03A 3T1QA 3T7SA 4PLYA 3GEMA 4LGVA 3PFIA 3N6XA 4S1TA 3MT9A 3UMSA 4TV8B 4FZ5A 4PQEA 2YMPA 4CGYA 1GLGA 3K92A 3EA5A 2Y9PB 3STXA 4IIJB 5I7RA 5KWVA 1S3SA 2D5IA 2PUFA 1D1PA 3ZNNA 4I5FA 1TIBA 2NSDA 5CDHA 4JENA 3U16A 2I2CA 5HS4A 5H9WA 1DOAA 1M1NB 4MJLA 5EIBD 4CM5A 5JQWA 4U2CA 4DXDA 3DXFA 1S4QA 2JZNA 4MGEA 2L18A 1MJGA 2E82A 2RI6A 1XZCA 3IO5A 1CUAA 1E1QD 2JI7A 3EODA 3GBSA 3HRIA 4ZVRA 3UIEA 5FFMA 1XEWY 3ILXA 1NZJA 4GOLD 4AP6A 4KVGA 2DY0A 3U13A 1Z2OX 3IAHA 2XD4A 3A28A 3DPUA 3QJGA 1EUDA 4X1IA 3RC7A 2V3WA 3K15A 1JS1X 4MQUA 3BRWD 2ZJBA 4OQYA 4ZZ0A 4KITB 5T57A 4HDNA 4IQ0A 2QTGA 1F06A 2PTGA 3HXPA 3LCCA 1AUVA 2FEMA 3LV8A 4OGWA 3SE0A 4ARZB 5A9SB 5AESA 5ADVA 3QPUA 4NIMA 2WVGA 1Y5LA 4NAHA 4BFZA 4CIYA 1PNTA 4IJUA 4X1OA 2FEAA 1JU4A 4OBXA 1VXOA 2VQDA 3LW7A 3A2NA 4Q7JB 2CEAA 1VJDA 2Y77A 3ZTYA 4BNMA 1FFBA 4UAVA 4R16A 1YBHA 4MPRA 4WWHA 3DYVA 4I55B 4BX0A 4HN2A 5FKJA 3L92A 5IKMA 5AVKA 2CNBA 3JALA 5KKAA 2A1UA 1JTEA 5LL6P 3TE7A 2EBHX 1EGHA 3ORFA 2PNJA 2GI4A 2GCIA 2B82A 5FOUA 1FLAA 4R8KA 1ZN8A 1IJFA 1H42A 3PB3A 1G5RA 2FGKA 4Q0MA 4GMFA 3VO1A 3K5PA 4XIJA 2OPBA 3AJEA 2OV1A 2VHQA 3QI7A 4RD6A 3ZD7A 1SUPA 4B7XA 1BKDR 3EQZA 2QAIA 3GLKA 3MJEA 4ZC1A 1SXJB 3BZUA 4J2TA 3DBOB 4NMLA 1VTKA 4V2UA 1XNRB 1DTWB 2MHCA 5ALXA 3WSVA 2EBFX 1J2JA 4A27A 1QZXA 2YXDA 2UDPA 3ZHRA 3PPWA 1BE8A 2HTFA 3RS4A 4Y1GA 5F5NA 4XKJA 3KYCA 3ZX4A 1JEJA 2OQIA 3PT9A 4O02B 4YRMA 4XWYA 4GRAA 3VKUA 2G09A 2GBPA 3EY9A 4QXOA 1U0HC 3RUEA 2V8OA 4KAXA 4P3PA 1H93A 2HCTA 1AUPA 1DBPA 2PJZA 3A7EA 3FB1A 4U7PB 1YFKA 3SS9X 3TR5A 1WXQA 5U4QA 5LVAA 2O8VA 5HIKA 3KOWA 3RFVA 4N65A 3SYTA 1W36B 4F4HA 5HIAA 2OGWA 1NUUA 2Q9UA 3LGXA 2DUMA 4UEWA 3VRHA 4UQLA 2WEKA 1V37A 1VZ2A 4M87A 5IAKA 2GZ3A 4F85A 4MDFA 1LGYA 5LC1A 1IPEA 3W90A 1M1YE 4UTPA 2XMCA 2Q7OE 1KVQA 4A7PA 5IDQA 1ZVJA 3R8FA 2KWIA 3F6PA 4YAJA 1NOJA 3MJSA 4RV5A 2FXVA 3ROMA 1J07A 3HCPA 2OBXA 3HSKA 4AMYA 1VC2A 5A4FS 3AV0B 1J7KA 1AGXA 1O3YA 4ARBA 3EVZA 4ZANA 1RCFA 2ZRHA 4JBXA 1IXSB 4DMKA 1KY4A 1FJHA 2IKSA 2W58A 5FI3A 3EFHA 4M8LA 1W88B 3AIIA 1P5HA 3CF4A 3U7HB 2QUKA 4TTJA 5F7XA 1XCGB 3FVQA 4MR7A 2LIVA 4HQOA 3KTAA 4Y67A 4N76A 2OBLA 3RS7A 3OM0A 1RLUA 4DA4A 3IH5A 1SKBA 3IP7A 4IX1A 4OLHA 1W75A 1IDN1 1CJCA 4EL5A 3TRFA 1M83A 3E84A 3TGWA 3H5WA 1WVMA 5FUXA 4FP9A 2I55A 2QU7A 3KU4A 3V80A 2FPWA 3T4EA 1NY6A 2V4MA 4X7PA 1TFUA 2VNHA 3QE3A 4J1SA 1ZA2A 1CY0A 3ZVKA 3RC2A 4H7HA 4AKSA 3I37X 1TT5B 3EUFA 4JP3A 1ZCFA 3DVAA 2QRNA 5JY1A 2OOSA 3QVKA 2P69A 4AJLA 1HDOA 4JLVA 4IV8A 1NLMA 3OPYB 2IQIA 3EVBA 3URMA 4BWVA 4QG3A 2X9QA 1NF9A 4NL4H 1CWUA 2B0JA 2P77A 1NQUA 5EWJB 4JNKA 4OLAA 4B0OA 4EY7A 3EZYA 3N2GA 2J33A 4Y2RA 4I7EA 4DF3A 4ZYLA 1V4VA 2P8SA 4Z8XA 4DLVA 2J7KA 4NQZA 1QX3A 4G0QA 4WZ6A 1RWNA 3ZYZA 5FNVF 4S24A 2JGMA 5E1DA 3RVDA 3TAUA 4Y8VA 3D7MA 3VHQA 2PLAA 4Y9UA 3GFOA 4N18A 4EJSB 1U3WA 2C84A 3ZZ1A 4MV7A 1BTOA 5A04A 1B93A 2JHGA 3OZBA 4AB1A 4BQSA 2Z8YA 4KWEA 4ME6A 1BX1A 1NFQA 4J8PA 4BLUA 1NTOA 2BW0A 5DYNA 1SB8A 1MC8A 3EVCA 4PIVA 1P9RA 2WYWA 1GNQA 2NU6A 2MSEB 1DC8A 2J3IA 4CCSA 4IKEA 3KKEA 4B6QA 5LQJA 4FW9A 1KGDA 2QTLA 4HH1A 5MDHA 4TUYA 3EOAI 1QCZA 5HGJA 5CA0B 4P7JA 4QJIA 5JNLA 1JHYA 3NGXA 3S2GA 1YDEA 3LBHA 4GDMA 1E7WA 4I2VA 1YBMA 1C0PA 1OV6A 3KLBA 4FLFA 2OZLA 13PKA 3T7AA 2OHIA 4NK5A 1N1DA 3G8YA 5JAMA 2FN8A 1PG0A 4EO9A 1E6LA 4MYHA 2GEVA 1G63A 4YNBA 3B6ZA 1TC1A 5KHAA 4R2WA 4AECA 1L7DA 1N6PA 1EFVB 2XXJA 4NYIQ 4R40A 1KFKB 2DHQA 4M9UA 4PBRA 3D0KA 4B4UA 1Z45A 1LLCA 3FF1A 3QVXA 5HFJA 3SJZA 4LTDA 5A6SA 2I2XB 4AJ4A 4Q1FA 4YMGA 4DIFA 4HQFA 3DCIA 4WLVA 3WR5A 3B8HA 2IODA 4XQEA 3DOJA 3QH4A 4BY9E 3IV6A 4FMCF 4XDYA 2XRMA 4TRMA 2CLFB 2LBPA 4FN4A 5GJVC 3FZQA 4O2AF 4TZ6A 3FCOA 2RJOA 5IH3A 1PJZA 2R6JA 4Y2UA 3P9ZA 4ZYUA 3OQNA 4LF7B 4JYMA 3BDIA 5KKNB 1DNPA 1DQRA 1G5FA 3L6RA 2I6TA 2OGTA 1HNWB 5JCOC 4LCJA 1JN0A 4KPGA 4OLBA 3OO1A 4HB4A 2I7XA 4LYFA 2W6ZA 2DM6A 2W6JA 4N7RA 2OXEA 1OFUA 1JE1A 1P2SA 1XZFA 3B5JA 3LW8A 5K0ZA 3DO8A 3A4IA 3VC2A 1TE2A 4R9UC 1S8FA 1PFWA 4PLGA 4WY8A 2WUWE 4CLEA 1VLVA 1RQ7A 3BQNB 1T5IA 1M2FA 4S1NA 1LI4A 3EIXA 2OG2A 1LJUA 1NXVA 3OTHA 2NV2B 1UJ6A 1JXQA 1CUHA 1N0VC 1PGNA 1GQFA 2XNDD 2C9BA 5DBIA 1O08A 1XAJA 5IJXA 4X92A 2LCQA 4LY6A 2XWSA 5AVOA 3RHSA 1OLOA 3ROTA 3H2GA 4AO8A 4E4RA 2F8SA 2J45A 1E59A 3EDOA 3VZPA 2VZ8A 5IT5A 3T1VA 1ZO8A 2OECA 3QVTA 3LBIA 4QARA 3WL8A 3VOBA 5CEFA 1EWYA 1XWFA 4FFPA 1PYDA 5AI4A 4OA8A 4H7JA 4TQAA 4RADA 1O6FA 1FTYA 4UC0A 5FWAA 3KE8A 2CMHA 5HIMA 1HEYA 2H6EA 2IITA 3AINA 3DHVA 4ZAXA 1V1RB 1RZUA 5I47A 4BKMA 4WDRA 1KZ9A 3AW9A 4PZUA 5CVVA 2HD4A 2JEZA 5BV0A 1NBMA 3H2SA 1XTRA 1ZH4A 1MAVA 3KOMA 4YXWA 1L5SA 1EVQA 4XDHA 2DPMA 2YZMA 3PUKA 4OGFA 4YALA 2GTIA 4DIUA 2OV8A 3G8CA 5E2BA 4IEFB 4D3FA 4LYHA 1AURA 1KS9A 1HKUA 3KKOA 3O91A 3OEEA 5JISA 4ALLA 4XPIB 3WRVA 2HT1A 1ZK2A 1KAHA 3HB5X 2ACEA 3M3HA 2CT8A 1R0WA 5I3ZA 1C9MA 1XCMA 3OX3A 2VCYA 2PYDA 3BH7A 1PJ8A 2D3WA 2QTHA 3N70A 3ACDA 4JL6A 1ZOLA 2FSUA 5BY2A 2QM7A 1UCFA 2X4LA 2I6XA 3AHFA 4ZDKA 4HEHA 3BQMB 1BX3A 1E3MA 2REXB 4FSXA 5KDLA 4MJXA 5HCUA 2PKWA 2R79A 4REQB 1D2AA 1E92A 1BOOA 1OWMA 1U8YA 3QY9A 1OMOA 2VYVA 4IG9A 3QZUA 3UB2A 3V6LA 2R8ZA 2CFOA 3K1ZA 3GLQA 5K6TA 4TSRA 1CF2O 3NXKA 1BCSA 5COAA 3DDOA 5JPIA 3TBKA 3J7AC 1P4HA 1PFQA 4KLAA 4Z9BA 4D9BA 4KRXA 4DV1B 1QGDA 1X1AA 2OHGA 4S0ZA 2BV3A 4JVLA 5B1SA 2O1EA 3USES 2XDWA 2Z58A 1IN7A 1R5NA 2P9EA 4N41A 4DV4B 4W6ZA 5T3YA 4BNHA 1Y3FE 2I2FA 5BR8B 2CUNA 2C4VA 2QOEA 5DFAA 2G70A 4DMGA 5HP4A 3RFTA 1PFKA 4CN9A 5HRCA 3JAMA 4C0JA 3QU4A 2A92A 4O1HA 3PEYA 3UBTA 3V4RA 2C88A 1GCIA 1HKHA 4PLCA 3BB4A 4C0HA 1Z17A 1CUFA 4O6VA 4UEKA 4CV1A 1KO1A 2CHFA 3F3YA 1QYCA 2CJYA 2XVAA 2FW9A 3KXPA 4FFBA 4OEHA 4AXBA 3JQPA 5JNTA 1P2FA 1SUCA 3AY6A 1EA5A 1POXA 5BSVA 1NVKA 3OZTA 2V55B 2OO5C 4ARAA 1HTWA 4AMZA 5BUCA 2YXPX 5E4FA 1KNXA 5IARA 1VI2A 4J03A 3I5UA 3I4CA 821PA 4Z9YA 1LRJA 5FO1A 1PSWA 4FMPA 5J3JA 3AG5A 1NAIA 1U11A 3TM4A 1KP9A 3PIDA 3QSGA 3I2FA 4X91A 2P9FA 4BECA 1E2KA 4NJMB 3C74A 4XGNA 4GGOA 2D7JA 2NN3C 5FNVA 5G3ZA 1L5NA 2WWIA 2Z56A 4ENTA 2HH9A 1K6JA 4FD3A 5BN4A 1E6UA 1K8RA 1E4EA 2APJA 1YB7A 3F67A 3GH3A 2DUUA 4J0KA 4B8YA 4DNQA 3OZFA 2YW9A 3OX1A 5JH7B 3E82A 1N9KA 1P75A 3RJZA 4G5RA 3SS8A 2LE0A 1C3XA 3OUTA 4G9BA 3T9BA 1XLWA 1OXTA 1XRNA 3M5WA 3RSOA 3TLGA 3VJMA 4DJJA 5L4LA 3PQ2A 3LHDA 1UC5B 2CNDA 2YWRA 3OF2A 3K1YA 2HSWA 1AK9A 1T1SA 3QNMA 4AG6A 3IJEB 2XBLA 4K9PA 3RYHA 4K9NA 4EGJA 2XOKA 2X13A 3DE3X 3GOHA 4I9FA 3MSCA 5FLYA 4FUQA 1UXJA 5BQOA 4J0CA 2CVQA 2B9EA 1YB1A 4E4TA 2O3UA 3G2PA 1F38A 2AS0A 4L8FA 5KAMA 3R7LA 2B3DA 3DBRB 4NE2A 1X7ZA 1D2EA 1YV9A 2H7CA 1W0KD 2R1TA 4GX5A 4GYYA 4DMRA 1QZ3A 2C4MA 1GA4A 3PDJA 4PAMA 4XR4A 4AY2A 2R97A 3OZXA 1K8QA 2GEKA 1H6CA 1XZJA 1L0BA 1RFLA 2FPGB 3D6VA 3MTGA 4MRMB 3KJGA 2P7IA 3OD5A 3RNOA 3ZCUA 4F60A 1W48A 4HWTA 4BNJA 3E9YA 3O47A 1UM8A 3FPSA 1VSVA 1N2EA 3H5IA 1SRRA 1V5EA 4BRSA 2VPYA 4HVCA 4LJ5A 2VHZA 5IUJC 1PWHA 1U0EA 2V03A 4EA6A 1ZOOA 4LFAB 4LXTA 1UBUS 2Q5LA 2QG4A 3B1XA 1BVYF 4II7A 1DKUA 4O2AA 4XARA 3GFRA 3LSTA 3WB2A 1S7GA 1K6IA 2ZWVA 3NASA 1HO3A 5HNKA 2E4AA 4D0NA 1TCCA 2HRZA 2ZR7A 3NVKI 1NLFA 4ODIA 4NH0A 3SM9A 4AAYA 1NURA 4FNGA 4CW7A 3AKDA 4ZI3A 6REQB 4LSGA 4A82A 1ISJA 3KL4A 5LQNA 5CVCA 3BN3A 1VDMA 4B6OA 4KU4A 1G21A 3BJIC 3IT1A 2PZKA 4OHOA 4BFWA 1F7UA 3H1AA 5FWNA 4IW3B 4EPXA 1WXHA 3K05A 3ABIA 2W6IA 3H6KA 2JCXA 3KOYA 2RJ3A 1VHWA 3C7TA 3EPPA 3N74A 2H08A 1GZUA 2CVPA 3F49S 3FPAA 4Q4DA 3ZQ4A 1PEYA 4ALJA 5BNWA 3SVLA 1A4RA 1IHPA 1YZFA 2F90A 2QDKA 2X1VA 2XMQA 4LHWA 3U4AA 3L7CA 3U3KA 5I7FA 1QBKC 1YL5A 1VMKA 2GEJA 2QUBA 2Z83A 4I66A 4QGFA 4N48A 1H2WA 3NC4A 1HURA 4GI3A 4Q9NA 1XVAA 1PGQA 2D1RA 1QFZA 2NZWA 3HC7A 1T4CA 2WFLA 3AF2A 4NCJA 4TTRA 4P53A 1U1CA 3OJEA 3EF1A 4KV9A 1WB4A 2NTVA 4H16A 3TW0A 4B6EA 4HH0A 2XSZA 1GA1A 1KC1A 1U80A 3ZI0A 5FEUA 1RXVA 1JKXA 3PWSA 2C54A 1WP9A 4F46A 1ZG3A 3KFLA 4ZT2A 4PN3A 2H1FA 5DX8A 3UXEA 4HKTA 2BFWA 2P0AA 5AR1A 1TGYA 1ZHFA 3C3XA 3KAPA 5B58T 3I2KA 3BMNA 1GKYA 4BATA 2Z5VA 2CZCA 4ZZ1A 2XMBA 5HWSA 1G20A 1E5TA 3H8JA 3T99A 2QV7A 2BE7A 2DBRA 4EYSA 2FOXA 1USVA 3D8HA 4Q9AA 5G41A 2H63A 2W43A 1FFSA 4UOZA 1K97A 1QYDA 3PNSA 4KBYA 2IUUA 5DO9A 1QYVA 1Y6RA 3WADA 3F8TA 3RC8A 4NZ9A 3MCTA 1YOBA 4NX2A 2DJ5A 1C4OA 4MP8A 4N0DA 2W70A 1QGUB 4O4JB 2JDIA 4O2BB 4ZKDA 1AKEA 2OCLA 2VKTA 4BXOA 1KOGA 1DAGA 2ZI3A 3PUYA 1U81A 3EYAA 4PEVA 3ASVA 4R54A 4WH0A 5FYQA 4CI0B 1WB9A 1XFDA 1VDZA 5TE9A 2O2JA 1SCJA 4MUAA 1LS1A 2C3YA 1QVRA 1ZHHA 3EGVA 5JS1A 1NJGA 2QQEA 1Z5PA 2WWRA 2H0AA 4YLEA 4UBIA 2PGNA 3LO8A 4JQYA 2YRFA 3NWOA 1MTZA 5CLLA 3P32A 4W5TA 2ZTUA 2VRCA 3SQXA 5T3UA 3H5NA 4KGXA 4PYNA 4C3ZA 1GZ6A 1A9ZA 1GIAA 1CNFA 4UU1A 2AFHB 4BO9A 2IYQA 9LDTA 2Q6VA 4NS4A 1Z7YA 2HF7A 1QLWA 1B4DA 1RNLA 4LDPA 5HDQA 3KPWA 5BWNA 3L41A 2BD0A 5KYUB 2RG7A 4ZARA 3A6PC 2RDMA 3WAGA 3NHMA 4RPKA 3JYOA 3NBMA 4MA5A 4WJLA 3ZD6A 3E0QA 3Q6NA 3T3GA 1WZEA 5MGNA 3IL2A 1DX9A 2WNSA 1A5AB 2FP3A 2X41A 2YVAA 4WOCA 1DIAA 1ESNA 4A8JB 1QGOA 4OHVA 3HA7A 1CUGA 3RHZA 4PX2A 3I61A 4NV1A 3UJBA 2JJ1A 2G83A 4AICA 4EY6A 4QBGB 4IEIA 3HRKA 4IIUA 1Y80A 1LPOA 1JT9A 3DT6A 1NF8A 4GZMA 4NEHB 5DYYA 1ORDA 4F8JA 2W6JD 2PSJA 4YAGA 4Q3EA 1VCIA 1WP4A 2HRQA 1WB5A 3MYRA 4IDOA 2VDJA 4WZAE 1O1YA 3M1LA 3O2SB 1J90A 1OBOA 4RM2A 3VU3A 4B6FA 1OB5A 1SC1A 3TMKA 5JXHA 3BICA 1RAFA 3GNLA 5F3DA 1R27A 2BDTA 3QKRB 4BQQA 5AW1A 3IVAA 1CUEA 3B5IA 1CUZA 2Z3VA 3DM9B 3SNHA 2RC6A 5IJ9B 3IGFA 1OGIA 5CNMA 4QO8A 1IUPA 2HEGA 5E9JA 3V4PB 3FLAA 3BGWA 3TEJA 4RX1A 1VPDA 4U6SA 3VR3A 3HBAA 4CTNA 2PUEA 1ULZA 5ELXA 4FQ5A 2ZWIA 4HLQB 1UZLA 2QTVB 3SF8A 1GKUB 1J49A 4GECA 3AMVA 2I87A 1G66A 2VPWA 3COSA 4P4SB 4UW9A 5DHFA 4QQRA 1CS0A 1Z25A 3B6MA 4FZRA 3IQGX 4R4JA 4G8BA 3T6KA 3IA7A 3S8EA 3D1LA 3AM1A 3CPEA 4G6ZA 5IVDA 3EXHA 4ZQFA 4JYPA 2WKWA 3AV3A 3F7NA 1HC7A 2I76A 3R5JA 5EE1A 1JDNA 3M6FA 5FI0B 1NBMD 4EKEA 2OBNA 3OFKA 2GBLC 3BFKA 3BFXA 4UNIA 4GXNA 4LDNA 4IV0A 4JUCA 1GPYA 5I01A 4YXWD 1Y5RA 1S2MA 4BNGA 2VPIA 4X1YA 2OAQ1 3U1BA 4D25A 1B42A 5IWCA 2E1RA 2BGKA 1RQRA 4PPFA 5FHRA 2H31A 1Q7EA 2QYTA 3OEED 4HLDA 3R0VA 3RVBA 1NBME 3H99A 3E3AA 3IVMA 4WE3A 3VU8A 4C08A 4R41A 4X7BA 4CKCA 3BXPA 2JIBA 3PF8A 3E18A 1A04A 2AT1A 3TS1A 2BOVA 1HSZA 1XJWA 2GBGA 2AXNA 4GC9A 4OXYA 3WQQA 4C14A 2V9CA 4RMIA 3OJLA 4D3YA 4YQFA 3CZCA 3CUTA 3ZWOA 1GLNA 2QRVA 4NJOA 4YUWA 1UP6A 1P2UA 2J5RA 3ADOA 3HI4A 2OYRA 4EF6A 3L1KA 3JRWA 4G86A 4GYJA 1B3RA 1L3BA 5DE3A 3OG9A 3PYLA 5GAJA 5KJEA 4JI2B 3CYFA 4A2CA 1WV1A 4WZBA 1XZ8A 2GD0A 2I6FA 4IVQA 3Q5GA 2BKEA 1YJXA 2C2GA 1GARA 2J9GA 1W93A 3B2NA 4YP7A 1M6VA 5M3BA 4CR6A 4MQEA 2XLBA 3HB9A 2VSYA 4GOOD 3B36A 4D26A 2P9TA 1B1AA 3H8VA 2B61A 4WKNA 1RZ3A 1L7BA 3RS5A 3KSMA 4Y0VA 2CN1A 4FZ3A 1D0IA 2CF6A 1EK0A 1RHQA 3BREA 2IXTA 3CUKA 2VC2B 3GRYA 2AQHA 4KVFA 4LWOA 4BJ5A 3BGIA 4BO8A 2EFHB 1WXDA 5JANA 3E61A 5KREA 3C97A 4H4CA 3VHLB 3I04A 4YRJA 1MP0A 1IULA 1CJSA 5ALJA 5C32A 4FEAA 2FEOA 3MWDB 2H0RA 1F51E 2AVDA 2IVFA 4HDRB 2AIRA 4XM1A 5F9MA 1LW6E 2NVUA 4XIIA 4PG6A 3CT6A 4KIGA 4CIDA 4HQNA 3HXOA 2ZRDA 2NYAA 5EN4A 2HLHA 3OCCA 2GXUA 1H1LA 5B3LA 2XYQA 1I3LA 5FTJA 1FDUA 4A10A 3IC5A 5CTAA 2O20A 2CLCX 1FMTA 2BMFA 2O2YA 2QAGA 2ZUCA 2CXXA 5KUTA 4GVLA 1E62A 4ER5A 5AVZA 2HHLA 5KINB 1G7SA 4MHSA 5JAPA 1X7YB 1M2OB 4RGQA 5IVKA 4IYJA 3UWKA 5ER6A 2CXRA 4P4LA 3PGKA 4YTEA 4A0RA 3B3FA 4HAWA 4HLUA 1O4VA 1JPNA 4KYIB 3NAMA 1GRQA 1X7XB 1BSVA 2IUSA 1NC1A 3DNFA 4I4TB 4B0PA 1BDJA 2W6MA 3HACA 3N2YA 2B8WA 3E1SA 4FFLA 2E21A 3NPAA 2YXBA 4P31A 1I1HA 4C30A 4DCCA 2QP3A 3CH4B 3HP7A 5FBWB 1RXWA 3WLMA 2BM9A 4RANA 2HLDA 3NUQA 5AXCA 1Y33E 2OXTA 1D0SA 4L85A 4GP9A 3GNQA 4CMHA 3WLLA 1I7QB 4G9EA 4BFVA 3ICQB 3GGPA 5CT4A 3LXRA 1ISIA 1Q91A 1TX4B 5I9TA 1DC7A 1IQ0A 2E87A 3RSZA 2O52A 3WLNA 1QPZA 1ZH6A 2XOKD 2H48A 1W46A 3OCJA 2H16A 2WABA 5EWLA 3TBHA 2YOGA 2GSDA 4PYLA 3J81k 1Q3TA 4Q1EA 3DF9A 2Q1YA 3TL3A 4DEVA 1CRPA 2ECOA 4LYEA 1I51A 5AXDA 4EL0A 4RVGA 2WYUA 1V3QE 3NX4A 4FJ2A 1LJ8A 2H1LA 4YEDA 4BN4A 4CJXA 2BJVA 4A2WA 3RS2A 4U6NA 2JA2A 4UHCA 3BSYA 4UVGA 1DOHA 4J49A 3TRIA 1OXVA 2FX2A 2EG5A 2ZI6A 5EZ6B 5IYZF 5L3ZA 3ZYCA 1VJ5A 4ZK6A 2GGSA 3S27A 3R24A 1YS2X 3OLWA 5DW0A 3M33A 2C94A 2WM8A 3MMXA 4PO8A 5MN5A 4K9MA 3PLNA 1T26A 1Y4AE 3PKZA 1Z06A 1QV6A 4JLAA 2QVBA 4OJMX 2N42A 5I7VA 2X3FA 5JFTA 2FQXA 1UOOA 1RKUA 2GZDA 3FROA 3W7AA 4YP6A 3K6SA 4OMCA 5JPDA 1PVOA 1SRQA 3HJUA 1DFHA 4MGYR 3U37A 5T7BA 4HDOB 1L5GB 3MOGA 4IS2A 3S2EA 4FFMA 1T2FA 2COKA 4LC9A 4Y6GB 3T7RA 4D0RA 4ZZ3A 5JD4A 2O8CB 2O0MA 3IB6A 2C2WA 5FPPA 5IWAB 1R4NB 2B0CA 1NVAA 2JLQA 1EIZA 5GINE 1P29A 3A10A 1AXGA 4K1XA 3CX6A 4RTLA 3WYBA 2VRBA 1XEXA 3JYHA 2NU7A 4RCYA 2CDBA 3BBPA 2TSYB 4FD2A 5FBQB 2W6ID 3LRTA 3M3DA 1DBWA 2O8NA